1EGMB

Crystal structure of diol dehydratase-cyanocobalamin complex at 100k.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
178
Chain Sequence
GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROPANEDIOL DEHYDRATASE
publication title How a protein generates a catalytic radical from coenzyme B(12): X-ray structure of a diol-dehydratase-adeninylpentylcobalamin complex.
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Lyase
total genus 62
structure length 178
sequence length 178
chains with identical sequence E
ec nomenclature ec 4.2.1.28: Propanediol dehydratase.
pdb deposition date 2000-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 1egmB00
1MMFB 1EEXB 3WB0A 1UC4B 1EGVB 1IWPB 3WB2A 2D0PB 3AUJB 1UC5B 3WB1A 1EGMB 1DIOB 5D5QA 1NBWB 5D5PA 2D0OB 3BRCA 1IWBB
chains in the Genus database with same CATH superfamily
3EUWA 1P2DA 4FX2A 3FFXA 3LCRA 3IX7A 3K0SA 2H0RA 4XJSA 4JLJA 3GLKA 4Y0VA 3EWNA 4HH0A 1ZH0A 3GYBA 1L4LA 3AHJA 2WOOA 3KOYA 1J0DA 1C0KA 3Q3HA 3NVKI 5BR8B 1OQAA 3OJCA 1X1DA 2HEIA 4FDUA 5C37A 1PTKA 3ZV4A 3KVNA 3M9XA 4BATA 1OFUX 3NV7A 3DDWA 4ALMA 4MKZA 3GJ4A 2CF6A 2OZPA 3EMVA 3LU1A 2HK8A 3KQTA 1OZ0A 4UPEA 1CQJA 5A3RA 5KTKA 5JH7F 1W6RA 1W59A 1EH5A 3OQIB 1Z28A 2WF9A 2C94A 3LG2A 2WJHA 1P6QA 4GYJA 1X0VA 2WR8A 2YZ2A 4G3XA 4M22A 3DWFA 4X1OA 1L9XA 1YR8A 4U9HS 2Q4EA 1ECFA 2DERA 3H65A 2P9JA 2I7XA 1S9HA 1QTIA 2MHCA 3M83A 3PIRA 4RZXA 1RPAA 2BMWA 3HJHA 3MNFA 2K6GA 4UHJA 5MGBA 1B93A 1SU8A 4PZZA 3SMVA 1VE5A 3WGHA 2AOUB 2A88A 4YH1A 2ZFUA 3UJ9A 4DCNA 4DMCA 2VK1A 3C39A 4BB6A 3AFGA 3O8DA 4PRLA 4PY2A 2JLWA 4JC4A 4L7QA 3KQUA 5CFNA 1HDIA 4ILKA 1G16A 3BSYA 5AR1A 1OAOC 2MSDB 1FMJA 5FI3A 2FNAA 3A4TA 3AR9A 4L3OA 3M4JA 1ODIA 4N3AA 1GADO 4YN3A 3C3JA 3R3XA 4FYYA 1X2BA 1KEKA 3CUVA 3DAYA 4FJ0A 1NNEA 4GGOA 4H1VA 4HWPA 4MOWA 5DX1A 1BDJA 3H0CA 4UEWA 3LWDA 1GKLA 2R8BA 1FSPA 2G09A 3WK9A 1U0BB 1FLVA 1U2RA 1R16A 2HMUA 3HZRA 1I7LA 3LRXA 3JRWA 4R69A 1E6EA 2QN9A 4RK1A 1BJTA 4PRKA 2OG2A 3A1SA 2ZIWB 2WU1A 2NSYA 1V25A 3HGTA 1WV0A 3G0IA 2J4CA 3EC7A 4FNOA 3RJ5A 2DC1A 3S1SA 1G2IA 1MRSA 3RS4A 1K8RA 1GZUA 1JT9A 1PKXA 4N5MA 3S5UA 1T5IA 2ZQZA 3L02A 4NX2A 4RHFA 1K6JA 5F35A 3PFCA 4HATA 4PAQA 1NMEA 1A9OA 3LM8A 1V95A 3DE3X 4B09A 1IH8A 4GI3A 2VH2A 1OC2A 3MIIA 5SZJA 5MN4A 4PYRA 4OQ4A 2MYTA 2XY4A 4KX5A 4EB3A 1VA5A 3CR8A 5U4QA 1Z3IX 5TVKA 1W5EA 2Z43A 4RTMA 5D84A 4HRVA 5ESDA 3P9RA 4HUTA 5FTKA 1E5LA 4TRMA 2DR3A 3ZXUB 4DLBA 3H6HA 2D1QA 3BCRA 5JPCA 2F3TA 1QVAA 1ORHA 3VDQA 4P2GA 5F2EA 1JYFA 4HLUC 4EW3A 1P9LA 1ZISA 3O3MB 4A4DA 2C3PA 4W5RA 1ZUNB 1TLTA 1CY2A 2JJ1A 5DNEA 4YP9A 2GXAA 2CL5A 1FNBA 4I1UA 2B3TA 3LUJA 3OAAD 4D3DA 4NCXA 4D25A 1P5JA 4OPMA 1UZLA 2OYSA 1JDZA 1E6WA 4PVCA 1EXVA 2PCJA 1ZC3A 3UOAB 2VJPA 3A1UA 2Z5VA 4GVXA 3S29A 4ATNA 3GXOA 4UQOA 5AM3A 3SKVA 1RJFA 1P2FA 1AQUA 2ATEA 3TR0A 5CB0A 1NPTO 3ZY6A 4C6TB 5BV8A 1X9GA 4AN1A 3UT0A 2XQFA 1JQBA 2ZANA 1C7RA 4Q3LA 4A0FA 1UWLA 4YUAA 2FUEA 4B46A 1AHNA 1Q0HA 2SKCA 1UBLS 1R0ZA 4M1EA 2V3WA 4OBBA 1N7JA 1OAAA 3R7AA 2BGLA 1JIKA 1BE1A 3MM4A 2CLHB 3DBRB 1OXBB 3DV9A 3O8OA 3VR5D 4H18A 5JCXA 4Q9AA 3E5HA 4GBMA 3IV6A 2J3MA 4NBSA 3WKAA 4X65B 5HFNA 3C3KA 3EYAA 4BDTA 2LD4A 4HFMA 3I2HA 3U3RA 2QHXA 1N5JA 1HYGA 4DCPA 2ZVQX 1LBIA 2AC4A 2WIFA 2EDAA 4M88A 4W1PA 2NP7A 3OD1A 3DW1X 1E61A 4S0ZA 1TYBE 5E0KB 5IAOA 4EJSC 2Y77A 2WHEA 1XT6A 3M6FA 5E6UB 1FEZA 1MF7A 5SZHB 2XD4A 5TIIA 3MTDA 5MFPA 3D4PA 3DS8A 2P2DA 1QK5A 5KI6A 4B79A 3ZZ1A 2UYHA 1QC5B 3I58A 1E2BA 2YFQA 2YV3A 4X3PA 2OZEA 2I9KA 1IWPB 1KR2A 2GK6A 2XMZA 4FS8A 4OO3A 1OX4B 2B7CA 3A9SA 2RHTA 3ABOB 3URKA 2FSIA 1RU3A 2H17A 3FOBA 3LQ1A 4NEQA 4EHHA 4CUZA 4WY5A 1BX3A 3F6EX 1H9AA 3IC5A 3QKRB 3QVLA 4JBXA 1DEHA 2HCFA 5F2OA 4G1VA 4C06A 4DA7A 1KZ6A 2CVZA 5BVGA 5JTTA 1QM5A 2H4WA 2ZPUA 4E32A 5KNBD 2DU8A 2OZKA 2QN2A 3I9OA 3RVBA 4C6HA 4EPTA 1WVGA 2Q6LA 2A78A 1BMDA 4UU7A 3RRFA 1EXDA 3WQQA 2ASVA 4FR5A 3GRRA 3TFWA 4ENVA 2P1DA 4GKJB 4HG2A 3UA3A 2YUIA 3BZUA 4BJHB 4BLTA 1QFZA 3NTLA 4WV3A 1IJFA 4AJPA 1HEIA 3OTOB 3CA8A 4BO6A 4D42A 1UC4B 1YRYE 3H99A 4KFRA 3HCDA 3UHOA 4JI6B 3AF2A 2VQEB 5GJVC 2BGKA 1T6XA 1TQ4A 3J7AC 4LIPD 4GKVA 1FNCA 4LRSB 2VRCD 3EPRA 5JZOA 1Y5LA 5LIRA 3D43A 2JIQA 3GT0A 1XU4A 3FHOA 4Q1VA 3FWZA 3UGKA 4PPFA 1W93A 2Z2JA 3IPRA 3TB6A 5J3JA 4ENUA 1T9AA 5E38A 1U0RA 1WXXA 2ICAA 3EZYA 2OY0A 5DNYB 4OUDA 4EVQA 2MSCB 1F12A 5JVDB 3CGGA 1CUYA 1QCYA 3ONFA 3WLHA 1LV8A 2BSXA 2FWPA 3R4CA 3DYIA 7MHTA 1B8NA 4TVKA 1D0SA 1WTAA 2QUZA 4J6EA 2PFGA 2C4MA 4NZZA 2QTVB 2VYND 5IARA 1QH1A 1Y7TA 3L77A 4DUGD 5CB8A 4BGIA 2C0PA 4OK3A 3WI7A 4CIWA 2E4UA 1DRKA 1UXHA 4BRUA 3HUEA 4A8JB 3JAKA 4GOLD 1YKSA 3K70B 4RE5A 5CJ2A 4RE6A 5EUCA 3SYKA 4JEIA 4CMBA 1KH2A 3R0XA 2OZVA 3VV2A 4UXJA 3OBBA 2WE8A 1U6KA 1DJPA 2FMFA 1K4KA 1RAEA 3HZHA 2TMKA 1WCWA 4M8SA 2BM9A 3TRHA 1KZYC 1YCDA 4O08A 2CXHA 3ZEAA 1CXZA 3FNIA 2GBLA 3H84A 3PNKA 4BB0A 2WJ4A 3LWZA 1GIAA 3PJFA 1K89A 4DJJA 4CMIB 1EBBA 2WF7A 1T91A 2O8NA 3UMMA 2P9YA 3C45A 4E1AA 3IVMA 1L4NA 4MS3A 3ZWWA 5JZ9A 1P81A 3FRHA 3ZPXA 1JQKA 4IIVA 5FPHA 3VZSA 2RIPA 3MT8A 3AKYA 2BGMA 1E69A 3JQ9A 3GGGA 3L05A 3Q8XB 2ONJA 2X0RA 3RKUA 4EX6A 2OSVA 4LJ7A 4PNZA 2QF7A 3AR6A 3NKFA 2APJA 4JLUA 2OGWA 3WFZA 4WXPA 1CD5A 1F20A 1DAHA 4E4RA 4XCQA 1QIGA 3SBDA 4A2QA 2R8XA 3U5ZB 1PFQA 2PXXA 4C0AC 1P62B 5FI0B 3DE1X 3U4MA 4TKUA 2EFYA 2IS2A 2O8VA 3RARA 2GT1A 3C6QA 2ODEA 1JG7A 3N1UA 1FP4A 4QYIA 3H42B 4XQ0A 2BMVA 4Z0NA 2OESA 3WRYA 1PDOA 3IHTA 3DVQX 4UHEA 2VEOA 4CFSA 4GXQA 3HRHA 4DLTA 1F2TB 1XA4A 4L22A 1DKNA 1Y3CE 2D7DA 2G5TA 1HZZA 3NI2A 4EFLA 5BR4A 1V5FA 1IRIA 4YLGA 3WA6A 3W2HA 5JAOA 1ZZEA 1UXIA 2FW8A 3AV0B 3GPIA 3IPCA 3NJRA 2HU8A 4QG7A 4TV8F 4Y30A 1OLXB 3C41J 1ZS9A 3LBHA 4E2XA 1C8LA 4LDNA 5TQ0B 3FPKA 3U7QA 1R12A 4Q19A 4FLFA 1U3UA 2MDTA 3A06A 3BHJA 3DWEX 4FBMA 4ARBA 1KI8A 1ZCBA 1HNWB 1PU2A 1YBVA 4G84A 2GXSA 4OP1A 2YJTD 2W2MA 3GH3A 4ZO8A 3S7TA 3OE5A 3VNQA 4BU0A 3HJUA 4MUFA 4Y7CA 3H8JA 1K6MA 2ORED 5L8VA 1RW4A 2IYYA 3B5EA 4KLCA 5BVHA 3GFPA 4H59A 1UJ6A 4CXMA 2YXDA 4IDHA 4HUQB 4F4UA 4IUBS 4M1KA 1P29A 1HGXA 2HGSA 2O0KA 2JVIA 3PITA 3JD1A 4FGLA 4GAEA 2A2ZA 2Q1UA 4CT5A 1DQZA 4BNJA 3P9SA 1MRNA 2ATIA 4G1EB 3D7RA 3ISJA 1N9ZA 4B8YA 2FK7A 3AC0A 5DNCA 1DAIA 1E2FA 2GARA 3BTVA 3JAWA 3X1YA 4A91A 2O23A 3UNXA 3SX0A 2JH3A 3MTJA 3N2GB 3O2QB 3WHKA 5IAKA 4WZAE 4FFLA 1DFIA 1ND6A 1OF1A 2FPOA 3PKJA 3CT6A 4YUVA 5M04A 2IP4A 5ED0A 1OXXK 2VCEA 1O94A 2A0KA 1BD4A 1Y8RA 2XYGA 2VJMB 4KGZA 5AKIA 1Q6ZA 4C4PA 4IGAA 3TJMA 1VPWA 1MIOA 1ZL0A 2IXGA 4Q1DA 4CMGA 4L0CA 4EPWA 2VT2A 3CIOA 3RYTC 3OHMA 4KQEA 4EELA 2ZSBA 1B0AA 2OLEA 3KJFA 4DDKA 2OCDA 1J9GA 2R1TA 3UTDA 1ESEA 1R4MA 2XNDA 5K0BA 3WLRA 4YUZA 2XUGA 5DBGA 3TUIC 1L4GA 3FB1A 4EHAA 1WWKA 3DD1A 3PUWA 4JBYA 4OMCA 4LGVA 4EY4A 5BRAA 2VNIA 1P6XA 2P9CA 5TF0A 3PL5A 4FE7A 1O6CA 1C9YA 3QKSA 2F62A 5A3SA 5H83A 3CH6A 3HBMA 1QLJA 4U7TB 1M6NA 4JD5A 4FFRA 2Q2QA 2OVBA 3HCBA 1OXSC 1XMIA 3W3AA 3X1ZA 1F5NA 4KNVA 4JMLA 5HIIA 2CB0A 4PPNA 1DHRA 1F0PA 2FU5C 3R6GA 3SJZA 3HPRA 3WLKX 1BVUA 5H68A 3B5JA 5H3CA 3CNOA 3AY7A 4DXDA 1NDQA 1XZLA 4K9OA 4CFYA 3AU9A 3VTKA 3WGGA 3P9IA 1W48A 2C9OA 5IBRA 5ERXA 5DSXA 3RW9A 2ZATA 1JG1A 2W48A 3M3PA 5JTUA 1W44A 5J1SB 1ZINA 1Q0UA 4N9QA 4DCUA 1U2TA 3ROTA 4BPBA 2HA7A 1U5BB 3FGNA 2BTOA 1F1JA 4LC1A 1EXNA 1PDWA 3C0KA 4Y3UA 5HKLA 1KU6A 1KQOA 3H5NA 2C0QA 2QM0A 2E37A 5H81A 3RYHA 4XQGA 1WDTA 3W5CA 1XPRA 5FHRA 3KBBA 4H7JA 4JXJA 5JLAA 1OX5A 3DVLA 5BN4A 3EXHC 4Q1CA 4Y2UA 3I9MA 3S68A 3ZS8A 2DE0X 3U39A 4C29A 1KYVA 3PT9A 3R0QA 2EGHA 5YASA 2HHCA 1XVTA 3RVLA 4YV1A 2JZNA 1PT6A 4LNAA 1UBSB 2D06A 2J3KA 3OJLA 1CRPA 4NZYA 1JSZA 4OJQA 3AOEA 3G6WA 2EATA 1QCZA 3T99A 3QVXA 2BGGA 4F2GA 1DCFA 2EP8A 4ID9A 3HWSA 1KPIA 1RYFA 4OAQA 1ONNA 1KEZA 1YL6A 2HC9A 3V8PA 4RVDA 1E2DA 1VJRA 2MJLA 4YAGA 4JBGA 1E7QA 3SM3A 2JJ2A 2KBFA 2B98A 4ZAWA 3D6MA 5B1EA 2XT6A 2P67A 1HTBA 4JUDX 4Q3OA 3DONA 5CT5A 4HDNA 4EFMA 4JQZA 3TCXB 3A10A 4MVJA 5ADHA 4YJFB 3VKHA 3WJ1A 3C70A 4WKOA 4X3OA 2V5AA 4IEFB 5FOWA 2CDNA 3ZCUA 1N2EA 2C4UA 5ALHA 5LP6C 1YDEA 1FU8A 2B8TA 5B2ZA 2FWBA 4HQKA 3STWA 1P5HA 2V5UA 4KXLA 2WQ7A 1EI9A 2IOYA 2HM7A 3FUUA 5L4SA 1UJ4A 2IXAA 5EYPA 5I45A 1RXIA 3VISA 1YDGA 2Y1XA 4GM4A 1KC1A 1D1PA 3JXEA 3V4LA 4C76A 3BWYA 3TTWA 4G86A 4D8VA 1MHPA 1BHJA 4L5BA 2C7QA 4Q7LA 3ET4A 3IIJA 2OE2A 4QOIA 3W5JA 4AZ0B 4TMXA 3NHRA 4XJXA 3PDIA 3UAZA 4PW0A 3I5YA 1SG0A 3S7ZA 3K4QA 2VHTA 4QX6A 3H1GA 2W58A 4MYRA 4KQCA 4Q82A 2POQX 5LLTA 5FLKA 4C4SA 5HGXA 3F49S 1R5BA 1E1KA 3G8DA 3FUVA 4AJKA 4E13A 5LN1A 5BSRA 2A59A 1LDGA 3LY7A 3OX3A 4RKFA 3GVPA 4TL9A 2EJCA 3KSUA 1Z2OX 3PFHA 2HWUA 4OA8A 1VL6A 2CD9A 4A2WA 1P0MA 3AOGA 4R6XA 1G21A 1UINA 1WDLA 4K03A 4TTTS 2Y1WA 3D81A 4ZI5A 4DXHA 4UNQA 4YLYA 2VAVA 4JJZA 4PC2A 1E63A 2G72A 1ZGHA 3NHUA 4P35A 1RJDA 3STVA 5CK4A 1TB4A 3QVGB 4MPPA 5KQLA 3AEKA 2RONA 2RFLA 3TMYA 5AESA 3HXMA 1JECA 2RK3A 3VKVA 1WZCA 2GM5A 3U7HB 3P5SA 4ND6A 1LJ8A 3ABQB 3Q9UA 3KQQA 1EIWA 4RC9A 4GBED 4LKRA 2FCAA 4N03A 2Q5CA 2FMUA 1T5OA 1L5RA 1YR6A 3V5NA 4KQKA 8ADHA 1VGQA 1KEUA 2M98A 3L4SO 1I3LA 3GLIE 1EP1B 4KO4S 4TTSA 1OH6A 4GQAA 2HL6A 1VYUA 1FMCA 1XCBA 1NQUA 1YB5A 3KZ1E 4MVJE 4AU1A 4E5DA 1P44A 3JU3A 1OWLA 3C8ZA 3CLHA 3MWGA 3IR7A 5G3YA 3V4SA 2J6BA 5JS2A 3RK0A 2WP8J 4XA8A 2WWYA 2DFLA 1XEXB 1U8FO 4H7FA 2WSYB 4K88A 2XA9A 3CE9A 4M60A 2C9BA 3LCUA 4N49A 4ND3A 3H86A 1QDLB 3ZU5A 4RCZA 5DI3A 2NU9A 2I71A 2D2VA 4L6CA 4WBNA 5BMVF 2IV7A 5AK6A 4F85A 3U3XA 4Z99A 1IPHA 3E9RA 4EO4A 1CEEA 1S2DA 1YRQA 1GPAA 2WFMA 3K2BA 1ZL2A 3LMKA 1G3IA 3OLCX 3SHQA 2EDCA 3LWNA 4B3BA 4KE7A 2GUWA 3VDMA 2UUBB 3GDWA 4WXMA 3QNUA 3H7AA 4YHBA 3EZ6A 4F7DA 1T5TA 5KREA 4TSRA 4NS1A 2WYWA 3TMAA 2YJNA 2IYTA 5BR1A 4IGIA 4Z7NB 1NJ8A 2FWAA 3CPSA 1TD9A 4M9RA 2O4UX 3DCJA 1GRNA 4Q4HB 1O6FA 4JJ8A 5K0TA 2Q49A 4RQBA 1VBKA 5MHTA 3EPHA 1IN1A 1XEWX 3AINA 1BYIA 2VLIA 3GG2A 1TFRA 2C2BA 1GV1A 2DT5A 2QRQA 2WKRA 1KL7A 3T52A 4UD6A 3MOGA 5CJJA 4W6ZA 3O74A 1QE3A 4WDQA 2X3UA 2L2QA 4G9EA 1ENYA 1KDVA 3A1NA 3HCNA 3WYDA 2OO7A 2IUYA 4I9NA 1D2RA 1PS8A 1DUSA 4OHBA 3LUFA 3FI0A 3U0VA 4CF6A 3L92A 1XROA 1I14A 3B8HA 4IG9A 1IM8A 2V7VA 2X0DA 1IG0A 3SYMA 3V3TA 1FRQA 3N86A 5C5CA 3TXYA 4RLQA 4GO1A 1NDUA 2PMKA 1NVUQ 1ZN7A 3OQVA 5ENVA 4HI0E 3ZOZA 3ZXXA 5CDFA 3VJLA 2G7MC 4X1YB 3DULA 3HA7A 3CRNA 4QECA 3TZHA 1BKDR 1ORTA 2PLRA 1EDOA 2H06A 1K8XB 5TMBA 4GLOA 2CZQA 2J07A 3FDZB 1M7BA 4UNIA 3AETA 1SHTX 2JDID 3N59A 3NAQA 2C77A 2WKWA 1O95D 2CCJA 4X92A 5GZ1A 3NEAA 1B7GO 1KGSA 2VR1A 2H31A 5IC4A 2LP4Y 3SI7A 1WXIA 1OUMA 3S55A 2HJSA 4Y2TA 2PL5A 1ZI9A 3PRHA 5LLSA 4IGFA 2B36A 2QJWA 5EVCA 1FRZA 3MLAA 1LD3A 1KYXA 1XC7A 2AK2A 2DM6A 2MSWA 1OFTA 2FFHA 3T7CA 2LNDA 2IXDA 2VF4X 4RY8A 4XPZA 4AROA 4B2PA 3WB1A 3PQCA 4BECA 5IKEA 3GJ3A 4KTVE 2HF9A 1Z4OA 1MEEA 5AJYA 1KSGA 2XZOA 4DR2B 4Q3CA 5GPBA 4LFBB 3BREA 1JLRA 2OCBA 4KWHA 3HV2A 4F4IA 5K8IA 2VWHA 4EZIA 2ADFA 5EXTA 3T3MB 4ER7A 4R2MA 1W36C 4HDCA 3KJIA 4INOA 4MYCA 1RBQA 3WKBA 8LDHA 3A3PA 2NT4A 5FOVA 4J29A 4K9SA 3BDIA 3MWKA 3OJWA 4LYHA 5LIPA 1NHGA 3VR1A 1N6PA 4R9RA 2NVOA 3JQ8A 3KM0A 4KXYA 2C8JA 1R0LA 1PJCA 4EP1A 1U98A 3L07A 1TO6A 4CLRB 5K05A 2WT8A 4RH3A 2GTHA 1H2EA 3AHDA 3DOOA 5COAA 2PO5A 1TCBA 3T3PB 3WYEA 4YAWA 1NR1A 1P1CA 1V11A 2IZ5A 1XVUA 3K0FB 3OAAA 1M0WA 2DMRA 2W8BB 1YTLA 4MVJG 3GGOA 4HDRA 3SNHA 5B4TA 1VIAA 1ZD5A 1XZJA 3ZGNA 3KB1A 3HYSA 3MYYA 1SUEA 4JZYA 4LNUB 3VNAA 4B87A 4EG6A 4M1QA 1TZJA 4BEWA 2IODA 4C4RA 3AQIA 2CXQA 3W34A 1B3RA 1D6SA 2VEDA 2L69A 4JLWA 4W1SA 5FA6A 2IWHA 1KRWA 5AVXA 3DMTC 3JQBC 4MR9A 2IZ6A 3RO7A 4Y2JA 2XMDA 3PGVA 2YOHA 1Y33E 3OLWA 2UXCB 1SVIA 1RKVA 2HSDA 3ZVLA 3DUFB 4FFBA 1E3TA 4LEIA 3PQEA 2G63A 2ID7A 1ZSNA 1CZLA 4I50B 4QOHA 2D4HA 1DHTA 1Y3IA 4RXTA 3IBTA 4C7BA 1OOEA 3I6IA 4OXNA 2GK4A 3R1IA 3V97A 1CUCA 2FP4B 3G17A 1EM6A 4L5YA 2J30A 4XVQA 2XIJA 3T5DA 3W04A 3ILVA 3K6RA 4Q37A 3GLFA 2EAUA 3AYXB 3BL6A 2NUTA 1V4VA 1K08A 5IBQA 1LDEA 2FB9A 1M8GA 2AJCA 1DJLA 4DDHA 5JXJA 4PBRA 5EJFA 3SHTA 2WWVD 1N78A 2CCGA 3IQDB 4FEGA 3EVAA 2YIDA 1Q3TA 3EQ7A 4CETA 1PFUA 2O2JA 1X1SA 4GZ5A 3P9XA 4NE2A 2G3YA 4BQIA 2QW1A 1DAPA 4N4AA 1SQFA 1XYYA 4YJGA 5HDBB 5PGMA 3MCWA 4EB0A 2YXPX 1YS9A 2OT3B 3AB7A 2F1RA 3AH8A 3GARA 3VHXA 4OX9Y 2BMJA 1JALA 1LK7A 3OUUA 3HHEA 5LSAA 3D8BA 2WUWE 4IIYA 2O5RA 4KWCA 1PG2A 1RYHA 2CBGA 5B58T 1D2GA 2FPKA 3VHLB 2B6NA 1GPNA 3CNBA 1SR8A 2JI7A 2ZRMA 3DL2A 1C4WA 2PXHA 5KQGA 2O57A 3QENA 3GWZA 4M1MA 1IY0A 1EHYA 4TV8B 3F5QA 3RUIA 3QX7A 3DDHA 3C6KA 1VPDA 1FXWF 3IAEA 2PRSA 4UTZA 4MMYB 3HWRA 1U4OA 2Q45A 1HTWA 4Y6OA 3MJ4A 2B99A 1HQCA 1E2GA 3MUOA 3S2ZA 4AY2A 3KAPA 1FVFA 1WL8A 1VKJA 2B5VA 1DT3A 1ZN8A 3U6BA 1AS3A 2FY8A 2QXTA 2WA1A 1CUAA 3QMWA 4DKJA 1WKVA 3EISA 4OFBA 4LQDA 1AKUA 1FXSA 1G8KA 3ZVKA 2CLKB 4L5IA 2NV6A 4K8RB 4H6PA 4ALNA 3HYLA 5DX8A 5IVPA 1H0RA 1D8AA 4DLWA 1Z8NA 2X14A 1CDZA 1XLUA 4YJ2F 3IB3A 4QATA 3SIPA 4B7AA 1RKBA 3T1OA 1P1JA 1EINA 1NBAA 1ZM2A 3OM0A 4HB3A 1FDOA 1Z29A 1ZKMA 1Q44A 1DL5A 2ADOA 4MJLA 3ZZNA 4FLEA 2VT7A 2AOUA 1VMDA 2FSVC 2VRCA 4E94A 1KFKB 2P90A 3FPHA 2ERXA 3DOCA 3OIUA 4HFRA 4HGQA 1CP2A 5KQSA 2VDWB 4QOEA 3UPTA 2VA8A 2Q3BA 3JY6A 1YQGA 1N9KA 2FPRA 1H0KA 2WJAA 4LJ5A 1QIEA 3LX6A 4KQHA 4GZ3A 1F6WA 5KBYA 4BBZA 3CLUD 1T6NA 1YBHA 2C5AA 4D9NA 1S5PA 1ZLXA 2EOAA 2ZYAA 3NWOA 3QSGA 3O03A 3ETNA 1UBCA 3TTUA 4MV5A 4AJIA 4ER3A 4DUGA 5HJ7A 3VNBA 5KB3A 3ZKAA 2O8CA 1XGKA 2D5BA 4QICA 4QYTA 5FR1A 1PZNA 3KAKA 2AV6A 1D1TA 1VI6A 3BX1A 4IXNA 4V39A 3ZTYA 3AVVA 4CL3A 2ZT8A 3NDRA 3RAPR 1LLDA 2QTMA 3HN7A 1ZA1A 1VBMA 1BH2A 3O75A 4P1ZA 4C6RA 2Q9AA 1R2QA 3FVWA 1XMSA 3TX6A 5HYVA 3FE2A 1IIRA 3BE8A 4EHJA 5FTWA 1IG3A 5HKOA 3ZWPA 1U02A 2A35A 2AR9A 1JXOA 2Z9CA 2W2VA 3F7TA 2QY9A 4Z9YA 1ZNQO 4HD8A 3FTQA 4E14A 5BQFA 4V0OA 2QPOA 1OFVA 3RC9A 2VPXA 4CN9A 3FCSB 2RJ3A 3QEKA 4R9NA 3CIFA 1ZBQA 4DA0A 4XH9B 5LQDA 1KZ7B 3IGFA 4HNAB 4M0KA 4ZMBA 5BNTA 1JAIA 4I4NA 2IOHA 3OKPA 3CWQA 1QH8B 1YA8A 1QZTA 1MORA 3AY0A 1HR0B 5BQOA 4G4JA 3SX4A 5J5CA 2C82A 1QX4A 4J7XA 2IXEA 1UAYA 2I62A 2QX9A 3DZDA 3P9ZA 4KC0A 3DOIA 5DBEX 4AIRA 5GAJA 4J2OA 1V37A 1VYVA 3F2VA 4YI3A 1CV2A 5GIPE 1GAEO 1NLMA 2NYRA 4L57A 3VPSA 4XUEA 3Q88A 4E3ZA 3AONB 3BE5A 1EJBA 1RQPA 4E2WA 4RTJA 4QGGA 1Z4MA 1ZUNA 3MWEA 3KQNA 4DR6B 5CD1A 4H77A 1EUDB 1O8CA 4FDMA 4BNZA 2B25A 3PTZA 4IDEA 4MVYA 3VR3D 1UUFA 3D4NA 5TGZA 3KQPA 2IEYA 2QUKA 2XQVA 3AR8A 3KDAA 1I94B 4KNYA 4B3RB 4HL6A 3DFIA 2OENG 1Y5IA 3GZJA 3RTCA 2ECPA 1GA1A 1W4CA 4A73A 3CKKA 2E4VA 4B6EA 1E2KA 3AUAA 4LC9A 2J5BA 2CXTA 4C6TA 4B3TB 3O1IC 5JNLA 2Y1KA 1STOA 2JGAA 1XRNA 1AHHA 4IWXA 3KKMA 4RZUA 4NFHA 3HCOA 4Q3EA 3IQEA 5DIZA 4HJXA 1ATIA 3EZ9A 3OY7A 3QNMA 5AJXA 5AM2A 1VRCA 4AM8A 4J91A 1EFUA 5KX5B 3DVRX 3GXBA 2P9QA 2R25B 2ZJ3A 2P27A 1XTKA 4RNCA 1XP5A 4H7DA 4RF5A 1JSXA 1K8ZB 4Z2YA 3DEIA 3DBRA 1PVOA 1UM9B 4EI2A 1IQUA 4XQ9A 2RAPA 1OH5A 1U0HC 3HJBA 1BS1A 2OQRA 2PD3A 4W99A 4HH3C 3HY3A 4Q9NA 1U8ZA 3LUAA 3CG4A 4JCOA 4QBGB 4TYWA 2TMGA 3IXLA 1A8UA 4P4LA 4RYLA 4PIVA 1P7CA 2A9JA 4G1BA 4UU1A 4I1YA 2R6AA 1W4ZA 5JQGF 1Z33A 2EFHB 2M6RA 2XZPA 4IJQA 1UDWA 1L7AA 2W4QA 4UUAA 3CH7A 4W82A 3JZFA 2R6GA 4R2XA 2IYSA 2FG5A 4QUKA 2W37A 3A3KA 3HABA 1QC5A 2ZUUA 5CT8A 3OM9A 4L07A 4OLFA 2DCMA 1IM2A 4XWAA 2O20A 2OO3A 1OX4A 3SZ3A 2BGRA 1XKLA 2RK6A 2YFHA 4J1SA 1RRKA 3VU3A 3R2JA 1ACJA 1RWKA 2X40A 1XTRA 3STTA 1T5LA 4WK6A 3O4IA 3RTAA 3UWKA 2LPMA 9LDTA 5K8CA 3ZTTA 4LSWA 3QEAZ 1VFNA 1OC4A 2B1IA 1PL7A 3D8UA 1M2WA 5KYXA 4HLCA 3DXZA 3GMSA 4PYMA 5K4AA 1QYWA 5CLQA 5THXA 1XRPA 2AW3A 2VUUA 4D41A 1SURA 1AUXA 3C43A 4HQ6A 4Q1EA 4ZT7A 5HOEA 3PZRA 2COUA 1AK9A 2QL9A 3AJRA 5EXXA 4EG8A 2GAFA 4Q5IA 1QP0A 5AW5A 1T8YA 1DBRA 3DO5A 5GVRA 3PCTA 1XFAA 1BROA 2D7CA 2J9YB 4MA4A 1DRWA 2Y0CA 1PSWA 3DOJA 2A57A 5A0FA 1GPJA 2DETA 1NU8A 3NDBB 3TQCA 4BBPA 4K6HA 4A2PA 4WN3A 4M0UA 3P32A 2PGJA 3HU5A 3GN2A 4M0CA 2R6ZA 1O0SA 4NBLA 1UMKA 5A4MS 2XB8A 3QQ5A 4RA9B 4X90A 3T7IA 3R9IA 2D3WA 4W5OA 1AGRA 3AR2A 5AH0A 1FTNA 3B89A 3R7FA 1Z15A 1E3LA 2WE7A 3KKZA 4GPEA 4TSKA 5JVDA 1PJAA 1W49A 2FN8A 2O52A 4I9HA 5CNIA 4EMBA 5KJCA 1UQTA 1E0DA 3UV6A 3D1JA 3IT3A 1L4KA 3BXPA 3KLOA 1K86A 1PNOA 3FPEA 3U3JA 2QTVA 1M6VB 3VYUB 4E7OA 2W6NA 2PMCA 3RS8A 1SKBA 3F7MA 2CN1A 2R8RA 1ZFNA 2GFQA 3KYBA 3UQZA 5BMVB 5CA0F 1CEQA 2CJYA 3I2GA 4JLKA 4GOJA 4QHSA 3RRNA 1KNXA 4O25A 3DAFA 3DQPA 3COPA 3IMKA 1X7HA 3WLLA 3UB3A 2V74B 4CHTA 3T9AA 1ADFA 3WMEA 3CB4A 4IM7A 1H42A 1IEXA 2GM3A 2K7ZA 1DV2A 4S0XA 5AJTA 2R9VA 2WWIA 5EKXA 2ZJ8A 3TW8B 4CQJA 3TG8A 2X8JB 3EIUA 3NEPX 3ZX5A 1LC3A 1YD7A 3HB9A 3RANA 4DC0A 2OK7A 4FWTA 2CY0A 4XLTA 5CXQA 4KQJA 1IXSB 1DXYA 1V6SA 4NPAA 1T4GA 4PWYA 1JUDA 3RS3A 1TUEA 2GAAA 3HQ4O 3DFMA 3COWA 4PEVA 4ZQBA 1CJVC 1YS2X 3OEYA 4TTQA 4D4HA 1Y42X 4K9MA 2QX6A 3N6VA 3QF4B 3BIOA 4R1QA 3B2QA 2YZMA 4EB8A 3KZMA 1SOMA 3N2LA 5I7WA 2CD7A 1QOPB 1UEXC 4UAJA 3C1OA 3RK4A 5DDIP 4ISCA 1NBOA 2P6OA 1AXGA 1NLFA 3RLFA 1KS9A 5K4HA 3BRSA 3K9NA 4BIMA 5SY4A 2PBZA 5KJ1A 4QHTA 1K97A 1CFZA 1YUBA 1MIHA 2YXEA 3DBLB 4YRDA 3IKLA 5E7MA 2JD0A 1U2GC 4NAHA 2DTXA 1NYQA 1OBVA 2QG6A 1J39A 2J3IA 4TL6A 2XMCA 1VLVA 5CHEA 4B4KA 1W5FA 2NO1A 3E9CA 4K6KA 1PUXA 4RTOA 4X8OA 1F2TA 3KD3A 1L3CA 2XNHA 5G53C 2WZCA 2UYOA 1FA9A 5E9WA 2JJQA 3B1WA 4JBWA 2Q6OA 2RI6A 3KUCA 4W7HA 2XCIA 3W1WA 4ICIA 1CF9A 3ETJA 4TQAA 1OLXA 2RGCA 1NT2A 3FHLA 4RSHA 3AEYA 4KV9A 3BMNB 2YC4C 3EEYA 3RFUA 1KOLA 5ETJA 3ZU3A 3M89A 1BDBA 1GFSA 5D87A 4IQFA 2X0FA 1Q0TA 3R76A 3GVCA 4CKCB 3VPCA 4ZQIA 1PAUA 5B2FA 3FCXA 4F4FA 2QD3A 1Z13A 1X7XB 2L18A 1C81A 3IP7A 4X61A 3TIXB 1U3TA 3O9VA 3QLUC 1ATZA 4M8IA 3V8NA 4YI5A 1U8AA 2QRKA 1C7ZA 1EFDN 2Z0MA 1OPRA 1YT5A 4IDQA 1QKIA 4KNWA 4CU5A 3E22B 3RAFC 1VCNA 3LXRA 4PGFA 4KIJA 1ZJYA 4HUQA 1TJ4A 3ENQA 2XGGA 5AJVB 1HZJA 2ZYUX 1Q84A 2DBRA 3BXEA 2C07A 2AFRA 1CUEA 2FJPA 3P0EA 5HDQA 4G0OA 1HK7A 1U7XA 3A1CA 2PQ6A 2I2BA 4IUYA 4PAWA 3TVYA 2V55B 4AKEA 4EUKA 4K9NA 4BMCA 2GCNA 4OFXA 4YQZA 3OC0A 1EWKA 3ZD6A 1OBOA 3N2GA 3TI7A 3V8VA 3A6HA 3LY9A 4D0SA 3N53A 3RJMA 4B76A 4RW0A 3NR2A 4IS3A 1XTBA 4PHCA 4RMIA 3GEIA 4ADSG 3GQBA 4MV6A 2BMDA 3DHYA 4RK4A 4LF8B 1G42A 2IQ5A 3K0KA 4J0JA 1V45E 1W76A 1HRKA 2IYXA 5EJEA 1CX9B 1K68A 2GN4A 2LCFA 1LVHA 3EWIA 3F1KA 3H0KA 5CYPA 1I4WA 2PIDA 2HKIA 1T5HX 4B6FA 1HDGO 3N0XA 4JKOA 3ACDA 4KN5A 3MVEA 3PI6A 4L75A 3ORYA 1H2FA 3Q7TA 4EW2A 5HW0A 2XCSB 1KDRA 4G0WA 2JF0A 3SIRA 4BLRA 3VHRA 1Z25A 4D9EA 1IB0A 2YZGA 3MRXA 4NESA 2VQ6A 2IT1A 1ZNZA 4N3CA 5DGTA 2Y9MB 3CX3A 4QPCA 3TQOA 3SSNA 1QPBA 3OCVA 4OXIA 4RV4A 3D8TA 1ZU5A 5L7YA 4ERNA 1DG3A 2ZULA 1FZTA 4ER5A 4PS0A 5FPYA 4I6GA 1NN3A 3LVRE 3L43A 1JV2B 2JVJA 4V03A 3VTZA 1WSDA 1JQLB 3JSXA 3PGJA 3FFBA 1YTUA 5HQJA 1J8DA 3EMBA 3KLPX 1BWQA 4NOLA 2QU7A 3IIEA 4HADA 4OJNA 1B6TA 5H5JA 5BSKA 3LZ6A 4TWRA 3UG6A 5T57A 3W3ZB 2NTNA 2X8AA 3E84A 2VBCA 4A36A 1RKQA 3MBIA 2JB9A 1BKYA 2H1CA 3OBIA 1B42A 3QHAA 3OQ1A 3V4VB 3L7NA 2RH4A 4AN4A 1H3FA 3R5JA 4JBNA 1U5BA 4O0LA 3QPUA 3V42A 5DYWA 2OQ2A 4KBYA 3L18A 3SJBA 2ZR7A 3IE2A 1N1MA 1QUFA 8MHTA 4V24A 2FW9A 3DD5A 1RWVA 4ZU1X 5AKHA 2UYYA 5TE9A 4DAOA 4DV4B 3SSMA 1EFTA 5BW4A 1Y6QA 1EKXA 1GGFA 1P5FA 2AOVA 2W0SA 1QAMA 1NVKA 5HFJA 2BFNA 4NH0A 2JLCA 1EMDA 1NY6A 2FRDA 3NHJA 1EAYA 3ROMA 4UCFA 3TKYA 3G1UA 4AICA 4YX9A 4H2DA 5C9ZA 2VYCA 3DGFC 4CM4B 1RXCA 4CG3A 2JDIA 4MNTA 1O95A 3G2NA 3A1DA 3AZOA 4RSMA 3MUNA 2ZS8A 3HI6A 1C5KA 4H6WA 4J7CA 1DX9A 3ZLJA 1JXQA 2KM1A 4E88A 6ADHA 4CEJB 1OI3A 3A27A 3WSVA 1THTA 1HT2E 1OV4A 2XMRA 5HJEA 5K0GA 3BCSA 3DVAB 3H5LA 1LB1B 2JCGA 5J4VA 1YUNA 2BRUA 3E4DA 1PJLA 1MX3A 3DHWC 5F1YA 3VI4B 4MIEA 3M9LA 1GKYA 2C8KA 4BX2A 4C4AA 1OGIA 3G3EA 1PJ3A 5L3ZA 3K72B 3MQFA 4QT4A 2I54A 4FOSA 4QO7A 1N92A 1BFDA 1THMA 5ALKA 4MICA 1TJNA 1U2QA 3Q72A 4HEQA 4YDHB 1S8AA 1JLKA 1W1WA 5LD2B 2JBWA 3U62A 3L6CA 3R3YA 3AZQA 2XX3A 3ZDFA 2P2CA 1USVA 2XODA 9ATCA 2YS6A 2CLEB 4M7RA 4XEHA 4DLPA 4B4VA 2GEDA 1DTEA 2PKXA 4G85A 3COZA 2V7WA 3EIXA 3M1LA 1A27A 4J75A 4X1IA 1XJ0A 5G1PA 2IPXA 4AZ0A 3GP8A 4ZCLA 4NU0A 3VPXA 5CIWA 1KO1A 3OM1A 4PC6A 7GPBA 4OHCA 1S0UA 4W8OA 3HFJA 2NTEA 5JS7A 5LQCA 2IYWA 2Q5JA 3HCWA 5AVRA 3STXA 1OFIA 4GMFA 1MZPA 1CDEA 3FYHA 2ZITA 4B43A 5BNFA 3PGKA 2M6LA 3AVOA 1Y6RA 4G23A 2Q1TA 4WFQA 4D43A 4OHXA 2W83A 2W6JD 3A9RA 4RX1A 1MG5A 5TX7A 5BWCA 1BU5A 4MWGA 4P7GA 4WKGA 2BUCA 2VHQA 3D4OA 4BP1A 2QN7A 4LZWA 4GNKA 4QEKA 5AHOA 2VAPA 3QVGA 3WLIA 4BV9A 1GZ6A 2HYIC 3WMXA 2RKOA 3P2YA 3PX2A 3N87A 2DWUA 4PF1A 1QG2A 4OMUA 5ECDA 1KQGA 2EHJA 4R31A 2JKZA 2NV0A 3OFJA 4NNPA 2GGSA 1UQUA 3HMKA 4KI7A 3IFSA 1WHTB 2PN1A 5EIAA 2VH1A 5EPEA 5FBZA 1HSOA 4JS0A 3P0IA 1RTTA 4WK0B 4NG4A 5EG5A 1IOLA 1KI2A 5JDCA 4KJZA 1C7EA 3EA4A 2HV9A 2P6RA 2GDZA 4IHJF 4ZZ0A 3LT2A 5LQRA 3CISA 1WMAA 3UCFA 2YR0A 1HFEL 2HXYA 3BFJA 5D86A 3EGCA 4JXZA 3NH6A 4IKEA 1B8UA 1ULUA 3EB9A 5EWLB 5J58A 2HMTA 4Y1RB 1LDNA 1L9KA 1R0KA 4YK7A 1OFUA 3H5TA 4C7KA 4D8WA 1Q57A 5HUQA 1V1RB 3DFZA 1D07A 2V58A 5JRZA 4KLRA 4Q3NA 3UT5B 5FPPA 3FZNA 3I53A 3N7UA 4L8YA 2PVCA 2C42A 2W6MA 1OXTA 2VRNA 5FPQA 4DHEA 1P61B 2IBMA 3LV8A 4HRYA 2O6LA 3ZW9A 4X60A 1KI9A 4OJKA 3KQLA 2OVFA 1Z5ZA 4KGVA 3VH2A 2AZDA 4U7WA 4EGQA 3QE0A 4BL5A 2DPLA 2REBA 3WV5A 4WT7A 1I3CA 2ZR9A 4IRXA 3C6YA 4K5QA 3HCPA 3FTNA 2H4FA 3KU1A 1W25A 4QODA 4YWJA 4PQRA 3AIKA 2Z9BA 3U4HA 3RREA 3AL0C 4R2JA 4ZYXA 3P45A 1UPTA 2KWIA 1FUKA 2ZI7A 1AK1A 1SQ0A 4IX1A 4P31A 3O8LA 4OHZA 3SYLA 2Q7XA 3AI1A 3OSZA 5AI8A 4B3GA 3ZLBA 3E35A 2NVUB 2VT6A 1AQ6A 1WETA 2LW7A 2ZRBA 1AH2A 4AKHA 1B6GA 1JYSA 1DOAA 5FWDA 2HWKA 1M7HA 3W3AH 4ERXA 2HJWA 1ZXLA 4FZ3A 1MJFA 1UWVA 2PGDA 4IFBA 5ED4A 4H3VA 2F64A 4KAJA 1NP6A 3QY9A 3CEHA 4KQGA 4Q4AB 3FYUC 1PGNA 2E0IA 5JQGB 2XQKA 4IP0A 4DBZA 5KNCA 4JU9A 2HW8A 2O8FB 1YQUA 1GZ3A 1XWFA 2ALJA 4XSVA 1MTZA 2P75A 3RWMB 4DSAA 3QEBZ 4CEIB 1DIHA 4G5OA 2KI5A 4FFPA 1O6GA 3N8GA 4BE4A 2G77B 4HGRA 4ZN6A 4MP8A 3K5HA 1HBJA 3MHPA 3P0FA 5E0OA 1SXQA 2X1VA 3B53X 3MMXA 4AMUA 4X1YA 3UA4A 1ADBA 1KEWA 2BGUA 4NARA 4YMLA 1KFJB 3CUWA 1SO8A 5AKYA 4UJ5A 1QQ6A 4DMLA 5IFLA 2ZKLA 3CRMA 3TLEA 3FDZA 1JHAA 5TJ9A 1OFGA 1XAHA 3VVCA 1JHMA 4PN7A 1DFGA 4AO8A 2J85A 1X92A 2QM7A 4K81B 2DFKB 4P5EA 5C7YA 3QVWA 2JD2A 3GO4A 1IM5A 1DRVA 4EA8A 3SWWA 2C3YA 4Q05A 1J8YF 1FYEA 1RFGE 3GJZA 1G0OA 2ONCA 4DLAA 4OXRA 1XAIA 4L8WB 1LXCA 2NZWA 1JAHA 4FJ2A 2W00A 3TNLA 1XZNA 2JKYA 3E7XA 1KZ4A 4BO8A 1NP7A 2C57A 3FCCA 4M4SA 4JP3A 2Q8NA 2Z5GA 4QD3A 3VZPA 5KTRA 4X1KB 4MROA 5BN3B 1HL7A 1TPYA 4OHYA 3BGOS 4JI2B 4D6XA 3QX8A 3RUCA 1AOXA 2F67A 1X15A 2VUTA 2MR5A 4MJ7A 1IYZA 2XSZD 1W7AA 2DUMA 1BGXT 1F2UB 3IMFA 3PDWA 2GEJA 4R0MA 1GSAA 1QV7A 5HJ5A 2Z5LA 4AW9A 1AS2A 1AUVA 1F7UA 3V3KA 3DCYA 4HH1A 5EEGA 4DEXA 4NQRA 1YMUA 3LOPA 4DCCA 1DGQA 1JFRA 4CLRA 2WYHA 3BJMA 4QLOA 4AL4A 1PQUA 2HFJA 2YUTA 2HSGA 3IAM1 4H7KA 4FEEA 4Q12A 2BMEA 3SE7A 1C14A 1R6TA 1XRQA 5CA0B 2N0SA 1JIUA 3QTBA 1XL1A 1Q3KA 1K27A 3K0FA 1O58A 1N5LA 3VR3A 5AYVA 2W8BA 4ZK2A 4YP6A 1TNDA 4LWPA 4J1TA 4B4DA 1SD1A 3EUAA 4JQSA 4BVFA 2BE9A 4LNUA 2C98A 3SGLA 1H0SA 1QCDA 5DP2A 5T3UA 3RIMA 4A8JC 1UPAA 2XV1A 3LXUX 5CA1F 1FBNA 2VPPA 3MWDB 3QH4A 1ZUD1 2V1UA 1Y8CA 4BX3A 1PEKE 1NZDA 1GVNB 2WKPA 1GDHA 1PG5A 3U16A 1IZ8A 5C8DA 1XOIA 3HFSA 4GICA 2H4XA 1Y7IA 4MMZB 1MT0A 2YASA 4GDFA 1QIMA 2Y76A 4QBTA 3RIHA 3C1AA 4JC5A 2AA3A 4I50A 3H8SA 2P7HA 4ZEMA 2I6UA 3KB8A 2FP4A 1VE3A 1W73A 1V96A 4BHTA 1Z0AA 1A5BB 3HN2A 3IVAA 1WSAA 5B6PA 5K0SA 1N6OA 3PR3A 2IIPA 1RPJA 2Q1YA 2Z58A 4TMWA 1XZCA 3WZ2A 1OXMA 1Z26A 2F59A 2OL4A 4GGMX 1T9BA 1I9CA 3H3JA 3KTFA 4ZAFA 4LMBA 4P3KA 3U13A 1PFWA 1TA0A 4YAJA 3HLKA 3EGWA 1LTKA 1C3XA 3N7TA 4I1RA 3PC2A 1J1IA 4FM9A 2RHRA 3M34A 6REQA 1G6KA 1YR1A 3FR7A 4MQBA 1WB9A 1DAKA 2EARA 1WF3A 4IHKA 4F97A 5C1OA 1FPQA 3GA7A 2P69A 1IN5A 2FDRA 3RABA 3TNJA 2BR4A 5K3AA 1A7JA 1Y4DE 2QRNA 3OU2A 1HTTA 1KKLA 2O7NA 2G6TA 2YVUA 4TV8A 1EU1A 4MW9A 2CJPA 2VKQA 4HYTA 1GZ5A 1RCFA 2ZYGA 4MYHA 5KJEA 4EA9A 4F06A 5LVAA 1WDMA 3V1LA 3HUFA 2Z2YA 2FF5A 1IPEA 1M1UA 1G7CA 4TYNA 2XE7A 3ROEA 4NBVA 1TEVA 1XZMA 2C2HA 4MUAA 2QDXA 4FI3F 2C5FA 3EVGA 2CHVA 5ENDA 1KZHA 3VVMA 2DSNA 3DP7A 2H1FA 3ILYA 3UJ7A 4DIUA 2Z6UA 1U3WA 3ANXA 4QOFA 3DR3A 2XEXA 4LYYA 1X87A 3CUSA 4GT1A 1QDEA 4BMYA 4RPJA 1ZONA 2H1OA 1IHUA 1JH9A 3PD0A 2HCRA 2VXCA 5HM8A 3BZBA 4CF4A 1YJ8A 2FK8A 4I3FA 4IDNA 1NU6A 4MKHA 1ZVMA 3T38A 4CM1A 2AX3A 2ATCA 3WL3A 2FFQA 2NWQA 1R37A 3T1VA 5H02A 1H2ZA 3IO5A 3TAXA 3OHSX 1V8BA 3DMDA 3EUEA 2ZM5A 1CB7A 2BD0A 1SUAA 2E21A 1VIYA 2VDWA 1AUQA 1YIOA 3EXIB 3PXDA 3GV0A 1KBQA 4BNVA 1RJ9B 3I92A 2KSQA 3PE3A 4U0JA 1QRRA 1YO6A 3AESA 5JFGA 1G8PA 3PDUA 1KMIY 3DOFA 4TS1A 4AMBA 2YYSA 4G97A 3I5XA 1L7VC 1L1QA 1DV1A 3Q40A 2CNNA 3FFTA 4J4BA 1TKAA 3ROXA 2YMPA 3EFEA 4NCBA 2AFVA 1RM5A 2H7XA 2Y8EA 5LB2A 3V8EA 2ZYHA 2M6KA 4H7PA 4AZWA 3GOHA 5SV2A 5L3QB 1AXRA 3UCEA 2OWEA 4PINA 1E60A 1VP9A 1Y8AA 2WSSD 4ZVRA 1LRKA 1Y63A 2DY1A 1TT7A 5D5QA 4DCOA 4YR9A 5CAEA 3N75A 4FNAA 4K1XA 1TIPA 2NACA 3F8WA 3ER8A 1MXHA 3DZ8A 2IS6A 2UAGA 4YV0A 4OH7A 1C3OB 1ZMOA 4LRTB 4XGRA 4LOHA 3EZFA 5J23A 2AR0A 4W5JA 1I5EA 4I46A 4DUYB 1R8QA 4RESA 2G76A 5CM9C 5DU2A 2PKQP 5GQSA 5I7AA 1U9IA 2ZCVA 2WU4A 3MCAA 5KSYA 1DOHA 4ARCA 4J0CA 4ZYUA 4RZHA 1YJXA 5BWLA 3EG9B 3TCKA 5A62A 1BXGA 1EFRD 3TTXA 3CPJB 1GNTA 3BB4A 2ZLBA 1YHZA 3UJHA 2VDVE 3RC3A 5H9WA 3WDLA 4O63O 4RS4A 4GX2A 3QIAA 4WSOA 2WYVA 5AVJA 3L6DA 4RD6A 4JC8A 5JUWA 5AMXA 3I62A 1NUSA 3AGQA 1SHUX 1GG8A 3DE0X 3KLNA 5EESA 1C7IA 2PD6A 3MJCA 3IIIA 3RBVA 1Z35A 4QJ4A 3H5IA 4AY4A 1KP3A 1AMOA 3BD9A 4P7KA 3UJBA 3OQNA 2TMDA 1KVQA 4XWYA 3OX4A 5GJBA 2H2HA 1QAQA 4N8DA 4NZPA 3ZWCA 3N5KA 3JWGA 3BICA 4TXLA 4LVUA 2GZAA 3G9ZA 1PJSA 4PPQA 4ID3A 1DS6A 5AXDA 1FSGA 3PR1A 4I1SA 1EUDA 4RMNA 1J8FA 5ALEA 1SXIA 1GAXA 1LDBA 3F9CA 4QO8A 1HY3A 2DY0A 2AX4A 5IT4A 2BBOA 2YJ4A 4YRLA 5DK6A 3B6ZA 4I4IA 5J40A 1FFDA 3QXHA 3RVKA 1X1TA 2DKNA 3B6IA 4GOMD 5BXYA 1YQWA 1BG6A 4ZJPA 4IO1A 2RGGA 4EWLA 4AQ7A 1E58A 1WOMA 4KYUA 2IEGA 4O1IA 2GSWA 4JN6B 3RROA 4F3CA 5KQMA 2QOEA 3B7GA 3CZQA 1QYIA 5D3MB 2QD4A 1XMOB 1RBYA 3G68A 1J0CA 3LA8A 4QHYA 1PNRA 4U6NA 2PLNA 5FBLB 3NOVA 2W2KB 4QDKA 4IDCA 2GJ9A 5C81A 1VLJA 2DUJA 2ZYRA 3W5DA 4KE6A 1FB5A 5B1DA 1TQDA 1U3VA 4FPXA 5KX5A 4DA6A 1E9DA 1VCHA 1ZGJA 2EWMA 2KB0A 2Q28A 4X3CA 5K6AA 1TEZA 4CQMB 1RHJA 4TLDA 2O1EA 3R3JA 1L5WA 2FUNB 4HP8A 3AEXA 2VJAA 3F71A 4M8NE 1FDIA 1M33A 2QMZA 3NM6B 1UM9A 3JV7A 3EK2A 3PUHA 1RRPA 4DREA 2QORA 1GILA 2ETVA 2FMIA 1XKTA 1OYOA 1QHSA 3PFWO 4NCAA 2YZKA 2R5NA 1EFPB 4NF2A 5CDUA 4C04A 4ZFNA 1SBTA 3VR5H 1EQUA 1JEDA 4HDMA 3I8OA 4B4WA 3JR3A 5DM2A 1SXJB 3DR5A 4QTTB 3UKOA 3VZBA 4JI8B 1O6BA 5KNDD 4QC2A 2I2CA 4QOGA 4ZYWA 1UWCA 3OFSA 2EX0A 1T0PA 1F8XA 2O2EA 2QRHA 2CXSA 5BV7A 2CV2A 3QOXA 1LBSA 4IDGA 4KXUA 3B85A 3I5UA 1RI1A 4QUJA 3OQ6A 4A23A 2RH5A 2WJWA 1AO0A 4IHAA 1E7YA 3P4UA 1BFKA 2ZWVA 4TXHA 3E82A 4DPKA 1NTOA 3NO4A 4ITRC 5DYIA 4EEZA 1UCFA 1FSZA 4MWZA 1J2JA 3JYNA 3PHCA 3VYWA 5EMHA 5FV7A 4ZI2A 1YI1A 4FGUA 3AYZB 2Q3MA 1GL7A 4GXTA 4XPIB 3A28A 4ESOA 4B75A 3ITKA 2Y67A 5LC1A 1Z3CA 2F90A 7REQB 5A7HA 3LC0A 1N2CB 1U6JA 1X1AA 2A9VA 2PRJA 4O2LA 4BFSA 4KXWA 1K0UA 1LLFA 1PE0A 4YQEA 4LE2A 3CEJA 3SBEA 5IT0A 1ZW1A 1IBCA 5K2MA 5AUOB 5C4IA 2PDAA 2AI3A 2WM9B 1II8B 3HUUA 3L8YA 521PA 5KNBH 2K7FA 3IEVA 4YMIA 2QUBA 3D6NB 4R81A 4AF6A 2CMDA 3TLZA 1I36A 3L0DA 1GL9B 4UM9B 3CCBA 2X0EA 2PH5A 4OHPA 3HMQA 5AVWA 1EFCA 4N48A 3AVUA 4PCLA 1E9CA 3CMMA 3AF5A 1N5MA 4ZYZA 1LGYA 1OIXA 4RA9A 1Y6FA 3E7WA 4REOA 4AURA 2FUKA 2NVWA 4B81A 1WJGA 1G20B 1DARA 2XXJA 1KOJA 1J8MF 2XVZA 2YVAA 2F4VB 3NIWA 5FUBA 3JQ9C 1GU1A 4PSKA 1E6KA 2YV1A 5DZSA 2AG1A 1G5TA 4JJ6A 4MWCA 4BJ1A 5AW8A 1KAHA 3O47A 1M6VA 1BS9A 1TGVA 4G8CA 1Z73A 3U4QB 1B1CA 2WPDA 3AUKA 1W2GA 5BMVA 1G3RA 3T5PA 1N2XA 1QVWA 3N0WA 4JLSA 2Q0QA 4HBZA 2XBMA 5JE8A 3WNQA 1UXJA 4J1NA 1PQ4A 5DNUA 3BC1A 3UJAA 1Z4NA 1MEOA 4IVNA 2AWNA 3P9PA 3W90A 2R5WA 4ALIA 2W2XA 3E48A 4EJMA 1SCUB 3QUAA 3TW8A 1KARA 1Z4QA 4RJIA 4G25A 2X8JA 4WXRA 5H1YA 3SN6A 4Z2AA 4Y2QA 5JROA 1UXGA 3UUGA 1KDOA 3NU1A 3W5BA 5AK4A 4I4TF 3F5SA 3NS7A 1PJ8A 1C30B 2H4YA 5CD9A 1T6BY 5JXGA 3OPNA 2I3GA 1N7IA 2LIVA 4WD3A 1YCFA 2P79A 2Y92A 1HE5A 3N2ZB 4OV6B 3WJ7A 4OJMX 1VZ2A 3NP7A 4UARA 2EWVA 4NH4A 5JEEA 2IKQA 3EULA 1YVDA 4WERA 4DR4B 3QF4A 4KEAA 3UHJA 1GTRA 1OVGA 1S2MA 2CE2X 4HVTA 421PA 4OQMA 2GPBA 6LDHA 4A26A 2H1IA 2R6R1 1TMOA 3MQ2A 1DUVG 4WJKB 5DGDA 5E1OA 3UVEA 5EKUA 3WO1A 2PR2A 1K7SN 4IMIB 3DF7A 4EKIA 4EBBA 5KHOC 5I48A 1OE0A 3SCZA 1HT1E 2X8LA 3DBLA 3C1UA 3TQHA 4ZANA 1YV9A 2WYIA 4BO5A 3HJRA 2QP9X 2XDYA 1PL0A 2WKQA 2GTPA 1ZCFA 3G6KA 1JAXA 2RGAA 2FWRA 4CVNA 3ROFA 2RE8A 1NV8A 3WGTA 4C4ZA 3ZYZA 2HFKA 2JHPA 3JYQA 1XTTA 3AMVA 4JVNA 2W11A 4NI5A 3AP1A 2YHBA 221PA 4PIPA 1TJ5A 2X86A 1E1DA 2XJ9A 4K40A 3ZCTA 3E18A 1N5RA 3PHLA 4Q9KA 2HBYA 1U0TA 2BFWA 4OM7A 1LI4A 1R0WA 3BMNA 1L1RA 4ACBA 2J8ZA 4O4IF 1O94C 3HJTA 3JASB 2PGIA 4C1BA 1E2PA 4O5OA 5IDVA 3SM9A 4QPZA 4G2TA 3WGMA 3BTSA 1X0XA 2ACEA 2XA1A 3I2FA 3GR6A 1JR6A 4N6OA 4CKCA 3OMXA 2X1MA 1V3QE 4AYTA 2W6JA 4CCAA 1X7XA 3NHAA 5CVJA 4KUEA 1WMFA 4CQMD 1UM8A 1MCZA 2Q1XA 1HFJA 5BOVA 1GGVA 3FOAA 4LJRA 1XVIA 1SUFA 3I4FA 5F78A 1FXUA 3E22A 3N2KB 2PGAA 5BV1A 2WZBA 1N6NA 3NLLA 5B3AA 3A36A 3MWFA 3ZYCA 2VDRB 3QXJA 4QU0A 1EJ6A 2EZTA 3T3DA 4LKOA 5LQSA 3OE1A 4QUAA 1J1ZA 3VC7A 3D4BA 1CY0A 1KOGA 2G07A 1YVUA 3ADKA 1WR8A 4URFA 3TECE 3KT6A 2WB2A 3L0CA 2BF4A 1JFLA 1NM5A 1K1EA 4EENA 3AO0B 2WM3A 4QGBA 1JH8A 4YP0A 4WK2B 2XWSA 1E18A 1R5OA 1XXHB 1OBFO 4XD7D 4FT4A 3CRVA 5IBPA 4YLEA 4B5LA 3QOFA 3EVZA 3KYDB 2CL6X 1TIKA 4J9UE 1ZSVA 1FFBA 3ZQUA 2ZWPA 5KMGA 2DWOA 1XD2B 1G0NA 2P4HX 3SF8B 1GSIA 2Y1DA 1YULA 1NJ1A 1ZOIA 2ZTUA 2Z8XA 3BQNB 3QYFA 5DBOA 3VX4A 4BKMA 2PEZA 4WUTA 1QRAA 3RJ9A 4RK0A 5CA1B 2FPXA 2HA0A 2XW6A 2NU8B 2Q9CA 1Z5OA 4XR4A 1AQYA 4LBVA 5F33A 1CZRA 1DBQA 3U1VA 4OA5A 2BI8A 4OU5A 3TD6A 2D13A 2ZBGA 1YNSA 2QV7A 4UUMA 2QNRA 1AF7A 3HXLA 2IS1A 2ZJAA 4NPHA 1OLOA 4JQYA 3SE0A 3FOFC 2OORC 1Z38A 1AUPA 3D2BA 3IP8A 5EJ6A 3P7MA 3UYKA 4ZOAA 3ZE2B 2FZ4A 5JSQA 2Z57A 4BLSA 2VK2A 2JFXA 2J09A 4KU4A 4QTXA 1KSJA 1US8B 2BKXA 4W9RA 4WHMA 4UM9D 1NKTA 2Q9UA 2Z2IA 2F2TA 5B3KA 1B15A 1F4LA 3OZ7A 3AOEC 3OZEA 3I0NA 5BPFA 1SUIA 2NZVG 2GVNA 2WV7A 3H1AA 1PV4A 3M70A 4DM7A 5I3ZA 4UFNA 4F3NA 3KZOA 3BIWA 1Q0QA 1P7PA 4RZ3A 4GEKA 4QUEA 5GONF 2C4VA 4CLEA 3GPLA 3G5TA 3UV7A 3A4MA 3FYTA 2H2IA 1IE3A 4M46A 4JI3B 1TO1E 4BLWA 4RKQA 3ND9A 3VRHA 3ET5A 2YRFA 2E1RA 2FYTA 4C0XA 4LJ8A 5LP1A 2CNKA 5J1TB 4DGSA 3KZNA 2W42A 1E3SA 5F5LA 2J0QA 2I5PO 1DUIA 3VH3A 1FXWA 1M5UA 2EV9A 5EFZA 2A1TS 2VDUE 1ZD1A 3CX7A 1Z5PA 3FTFA 2PT9A 2P41A 3INRA 2QKYA 3KR1A 3UK7A 4EDFA 4RJLA 5FAKA 3OFND 4RDIA 1N6LA 1M2JA 4CM4A 2VXYA 2ZROA 1L5ZA 1VL0A 3F98A 3LPCA 4IUCS 4MW5A 4YAOA 1N1EA 1RVV1 2HQRA 2J7KA 1YDMA 3EJ6A 3PGA1 4M55A 3LDUA 4NENB 4A3SA 4CCYA 3NHKA 3DVSX 4CEJA 2ANCA 2WIKA 3K09A 3UWDA 4YJ2A 3GRUA 3QITA 4JKYA 4PVDA 3DVAA 3QEJA 5JAIA 1LVUA 3JTEA 2P40A 1Z17A 4AMGA 5AW1A 1BC5A 2ZSAA 3G0HA 1QZ3A 2XXAB 3ISTA 1KJNA 4J2HA 2GK7A 1WVIA 5AVTA 3O9ZA 2FEAA 4L27A 2WF5A 3KT3A 1ECLA 1SRQA 2LVBA 3EASA 1OBHA 3CR3C 5F76A 1T8TA 4UASA 2R7AA 3LUGA 2XSZA 3ND7A 1YK1A 1N5DA 3BH6A 1NWHA 3B5IA 1NMQA 2H92A 3U3OA 3ZCXA 3M6LA 3ZS9A 2KYRA 1ZIOA 2Q3CA 1SD5A 1RWQA 3L7IA 1GR1A 1RABA 4P93A 4RPIA 2EF0A 3Q3GE 4MVCA 4B6QA 3K0CA 3KJHA 1SULA 3W5AA 2E3JA 3SICE 4DIKA 1COWD 5KTNA 4NXNB 3DJFA 1JIJA 4OB8A 3OLXA 5KDDA 3HR7A 3OETA 2GCOA 2ODWA 2DSTA 3S8YA 4KO2S 4WOBA 3HA5A 2JGLA 5EPUA 3HP4A 3W77A 1G60A 1Q12A 1XG5A 2IHKA 2G9QA 3LCJA 3WICA 4A03A 2FWMX 3SHOA 5ICGA 4ZZ2A 2EQBA 4KR7A 3G0BA 1LY1A 1Z6ZA 1HLDA 3R3WA 2ZDQA 4J0DA 4IWNA 4ZVMA 2P30A 2G0AA 2PUTA 2ZSKA 4GLLA 1KJ9A 2ZZKA 1JFFB 1BD3A 1UBJS 5DLYA 1DFHA 2Q3JA 1NJFA 1QBGA 3AKEA 3L0BA 3KWFA 4NQZA 4WY8A 1TM1E 4XGKA 4M6WB 3TGWA 2IUUA 4ZJZA 2GHRA 1EUZA 2ID8A 1P18A 3FROA 3T35A 3Q1KA 2UXDB 4JCCA 4HH4A 4MK4A 4N0EA 3TX2A 2NYVA 3MZ0A 3VC2A 3G5UA 2MWMA 2CXRA 3ON5A 3OP1A 4YROA 5B3JA 1MO2A 1N6KA 1WMDA 2GCIA 2ZIZA 4YAFA 4Z1OA 4NDNE 1U63A 3GU3A 3R8FA 1WTCA 3T3EA 4X84A 2X2EA 5ER9A 3OPXA 1GAQA 1QFYA 4ZI7F 1WHTA 3R3SA 1PDVA 3DEFA 3UIEA 2RG1A 1CB0A 4EKEA 3DZGA 1T29A 1JHOA 2R7KA 3GFQA 3KOZA 1EX1A 1M2OB 2G1KA 2WNHA 4I14A 2O2ZA 4MGIR 4LSMA 3FHJA 2BBWA 1FFWA 4Y9DA 5LYYA 5EWLA 3M3HA 3W6PA 1L4HA 2HJ9A 1WHSB 1PEDA 1MQSA 1TZCA 4QXMA 3HRIA 2X9VA 4HDQB 2WG2A 3HY4A 2WU8A 2C4NA 3BIXA 3OIDA 3KOMA 4G6ZA 3QX3A 1YOVB 2HX1A 4B2LA 4FB5A 4YRTA 3UT5A 1MOSA 4DVJA 5JWHA 1UC5B 1UZNA 2XQJA 4U2BA 1ZH2A 1QOQB 4DPLA 1H3EA 4JWKA 1NQAO 1VRWA 2IHVA 2R4QA 2C2KA 3TDMA 1M6EX 3IAFA 4TWAA 4R71A 4OUKX 5CX1B 2VTKA 2QYSA 2I7TA 3S44A 5EIBD 2BM8A 2ZRCA 4PZUA 2R0QC 4RDXA 1CUVA 2YFYA 1VZ3A 1T2FA 4E5KA 4EY3A 3PFFA 2IPNA 3QKIA 1T3TA 3EZ2A 4RXUA 2VJYA 4QPDA 2NV2B 2NVUA 4DIMA 4MUHA 2GRJA 5DLQC 1OGJA 3VU9B 1F3OA 1F9AA 1YC2A 2D1YA 1ZNYA 2XR1A 3AP2A 4K3VA 4KOAA 2AFHA 3D1VA 4OI1A 1EX7A 2WJPA 2A58A 5FA5A 4YA6A 2Q27A 5HMLA 3E2IA 3HXOA 1PBNA 4CWAA 2QLMA 1TVCA 1I1QB 1RC0A 4O3FA 5C3UA 2NXWA 1U81A 4Q4AA 5JQGA 3VNRA 3KV1A 3ZLTA 2FKNA 2J6CA 4ZQFA 2CK3D 2PZAA 3R5HA 4HS4A 4XFJA 3WQHA 1UKAA 2ESRA 4YASA 1Z0ZA 4CEIA 1DBIA 1A72A 3P71T 1TAQA 2RHWA 3UXYA 1G41A 3UTCA 3ETGA 1ZGCA 3AY3A 4QUGA 5A02A 4QDJA 4RH1A 2PX5A 5ALIA 4C07A 3WMWA 5L7TA 2R7LA 4MGZR 2PMDA 1P0QA 4UHDA 4ZCPA 5C2JB 4Q9IA 4GRAA 4PAGA 2J3JA 2WSSA 4RL4A 1LPNA 2FEKA 2H1LA 1KI1A 2ES4A 4A92A 1XZQA 4I4CA 1Q7CA 2LDBA 2JAOA 2VNAA 2I4MA 4TX1A 2E5LB 4A6EA 1FJXA 2E49A 2GSDA 4HO1X 5AUQA 2OCYC 1A8QA 2ZRLA 3R6DA 4CTJA 3B3JA 2UV8A 4Z0HO 5L3VA 4KITB 3IDFA 1UJ2A 3NKLA 4HLDA 4DQLA 3R5XA 1TA9A 5BSMA 3EVEA 4DC1A 5IASA 3L1UA 3U4GA 1XQYA 1EFRA 4DZTA 1UKVY 2FI1A 2Z30A 2QRPA 3C85A 4GM1A 4A2CA 3KJNA 1DPFA 3LZDA 4X1KA 2N9UA 5IN5A 4AZSA 3LY5A 3SBOA 5TNXA 4FFNA 1P9WA 1T2VA 4QU5A 4MH0R 2QRJA 3FDFA 3LE8A 3NORA 3QHPA 4GH5A 5EEHA 3DFKA 1VLMA 2Q1WA 3QLEA 2WD7B 4DABA 2DEUA 1F2UA 3FI9A 4EI7A 4RKEA 4DV2B 3EODA 3LC1O 1KO8A 4MVJI 2VQSA 2OFXA 3EMKA 3GVIA 1U0EA 4W1RA 3NHYA 4A0RA 3BK2A 3FBTA 3GJYA 1XEFA 4U7PB 3GT7A 1OPXA 5ALNA 2VPZA 3VOBA 1UMCB 2E5FA 5LJLA 1C1HA 2WG1A 1VMKA 4FWIB 4BZQA 4JGGA 2AUMA 5CA0A 1W2HA 1JG4A 5AVZA 1ECBA 3E6AA 4RKYA 3U09A 3VBCA 3SLRA 1UL1X 3DFFA 3QPBA 1GTJ1 2RHMA 4UEOA 4IDAA 3ZVNA 3MPUA 2O0LA 3TINA 1T2UA 2JVKA 4YREA 1RYYA 4RZ2A 2VJCA 1TXGA 2W2NA 1NUQA 3NETA 1LRJA 3E7PA 4FQ7A 2YC2C 3O3NB 3MWDA 4CRWB 3NDIA 4I4TB 1VJCA 3SIWA 3QRWA 1V6CA 3A6KA 1RIIA 3ETEA 4KPEC 3TFQA 4OOEA 1BMQA 1HMYA 2EJBA 2R3SA 5G0TA 4EKNB 2JIRA 3FWYA 1BYUA 4AZ3B 2PM8A 5I4BA 1P2SA 3TIIA 5IU6A 4D9FA 4J3FA 1HT3A 3DGEC 3L40A 1PTJC 1NQXA 5IS2A 1CT9A 2O59A 2G1PA 5LZ8A 2FX3A 3WRXA 3KTAB 5EP1A 4IO0A 4C87A 4RVSA 4EZBA 4P7FA 4YPVA 4N5IX 1FE8A 3FOCA 5F77A 5FR2A 2JGDB 3FKSD 3OKFA 4FYXA 2GWHA 3PYMA 5JW6A 4M99A 1APBA 3VAZA 2R79A 1JWAB 5CJPA 5JS8A 2AD5A 5BQ5A 1SG6A 4U9UA 3UWSA 4KR9A 1T3LA 1WW3A 1N2BA 2YW2A 4CODB 4MQ4A 4HRXA 5CLLA 4OVKA 2O3TA 2Z8ZA 1RHUA 3M5CA 5EZ6B 5AP9A 4Z4FA 5FEMA 1GXSB 1GNSA 5KNDA 5AW9A 1GRVA 1SC9A 2G9RA 3AUSA 4J0FA 5E6SB 3GZTB 1C9KA 1Z6YA 3AP3A 1L4FA 4KK4A 1N0HA 2QM3A 3WQSB 5EP3A 4CKYA 2WTUA 4WMLA 4L5JA 4EFDA 3SD7A 1R9GA 2IZ7A 4LK2A 4KBGA 1OASA 1G9SA 2YV2A 4M0DA 3I1IA 1X8KA 4QULA 3M82A 1YS1X 2POCA 2E7ZA 1WQ4A 2XOEA 3BJRA 4O4IB 3QVKA 5TPZA 4CKWB 3UW3A 1VE9A 2P9HA 3H5RA 3D64A 4PAMA 2DVMA 1U8XX 2J3QA 2OCGA 5ICSA 4DLXA 2C96A 2WUVA 2Q46A 3P2EA 2C7GA 1J56A 1OILA 3EMDA 3RDPA 3SQLA 3DV0B 2XDAA 1R74A 4W5WA 5CW2A 2YW9A 3ZDCA 4JEMA 1KI7A 1X9HA 2OO5C 1GT6A 4PYOA 4UQLA 1UMBB 4L0DA 1Y1PA 5DPMA 3SR0A 4DNXA 2ORVA 1UBHS 3GW8A 2C7OA 1A88A 3U80A 2Z83A 4U5QA 2WF8A 5L4LA 4OHUA 4YMUA 4HAOA 1ISPA 2PU5A 1WLYA 2AEFA 2ILTA 2GCGA 2GCPA 4EECA 1MENA 1QK3A 4L3VA 3FSRA 1RWBA 5HX7A 3THYB 2B5OA 3EE6A 4BV8A 1S4MA 1R0BA 2VPQA 3CLTD 1PWYE 1RJ9A 3KO8A 2I2AA 3L2OB 3SF0A 1WEKA 5ELXA 2PD4A 4TOIA 3E53A 3N0VA 4YJKA 4BMNA 1SCKA 2EKPA 2HRZA 1VMIA 1A3CA 1F4VA 1U7HA 4CM9D 4EQ6B 1EVYA 5JMTA 3A9VA 2OP1A 1H22A 1Q74A 2R6JA 1JIQA 4TLMB 1I4TD 1W9MA 3RU2A 4Z4EA 1UJMA 1FNSA 3EDMA 1Y9DA 4J0GA 1OB2A 2WKSA 3F4BA 2FPPB 1M2FA 5L3QA 5FTLA 2VHVA 2GUGA 1FL9A 2BFOA 3L1KA 5I4IA 5C4GB 1LEHA 1SU6A 1XCGB 2A5FA 3AHFA 3L7YA 2ZJ0A 4Y9TA 2R6CA 4HQ0A 1JLMA 3FWHA 4KAAA 3VZCA 3E8SA 3CVXA 1VRVA 3GRPA 4GSKA 1XAGA 5GGXA 4CF7A 3O1LA 3RFVA 1JHDA 3B1VA 2L19A 3GUUA 5FORA 3MAAC 4QLAA 2XQGA 2CVPA 2X23A 2XAAA 1MC5A 3ZTWA 4DCSA 5KTSA 1PF7E 2QVGA 5K99A 1U2DA 1YGPA 2ET6A 3OJFA 3D59A 3P27A 3D0OA 3EG9A 1SHJA 3NTRA 2MSLA 1CZNA 5IDQA 1OBCA 3N3BC 4C30A 3M1YA 4D4LA 4OQZA 2YKGA 3OF3A 1H66A 3TEMA 4KHPB 5BOSB 2WOJA 3CTPA 1XDUA 4ZC1A 1J20A 1V4BA 5HF5A 2GLXA 1A8HA 5E1DA 1SVLA 1S02A 2MR6A 2V9PA 5GONB 2UUAB 3O90A 3GZ4A 2WIBA 1DC3A 3GJRA 1EGQA 2PQ2A 1B0ZA 5EGNA 1EDDA 1W0KD 2PEYA 1GTL1 1UDCA 2XUFA 3OT4A 2XRFA 3UXMA 1DMSA 4CIAA 4R9VA 4FZRA 1PW7A 4E2ZA 1YR2A 1K98A 2VO1A 2PWYA 3A0RB 4B80A 3KEOA 4Q7KA 1YU6A 3UMFA 2O5VA 3BWBA 2HHHB 1FDWA 1L8OA 3DLTA 4G5GA 4X8HA 1TKBA 5EMNA 1T9ZA 1GDTA 3WIUA 4E5MA 3V7WA 4MW1A 4WCFB 1LCIA 3MRVA 3QELB 3IULA 2BDUA 5KVVA 4P08A 1ZR2A 3ZHCA 2NQ2C 3MSXA 3NHPA 1WS6A 3N74A 5IMSA 1N6RA 5EUQB 2A9KA 2B9EA 3QWBA 1NMZA 4C0SA 4EKYA 4LHWA 1DXHA 1U1CA 2OAEA 2HREA 3TBKA 1RLIA 5U9CA 5D3MA 3ASZA 3MT0A 3PXUA 3HL0A 4UU0A 1JMKC 3KSZO 1Y7PA 3P94A 5ULLA 2JIDA 3TVDA 2O3SA 1ID8A 2W2KA 5JAQA 5ECGC 1JDBB 5ER6A 5JSKA 2V3CC 2A4MA 1EVEA 1JKJB 1ZN9A 3U37A 3NHMA 2NSDA 4J0EA 4CQMA 5LU8A 5LBTA 3HI4A 2AN3A 3IT1A 4WLNA 2IEIA 3Q0EA 1ZD8A 2IHNA 5DTRA 1IY2A 3WIVA 5G3ZA 3SFTA 4YT2A 4LGCA 4Q93A 1EP9A 4PZYA 2IU4A 3K8ZA 3NXSA 1R4NB 4FC7A 1RWXA 2Y71A 1RXUA 1EFPA 2AR7A 3KVRA 4JYBA 4CCSA 4NABA 2GJAA 1T8PA 3N8HA 4LECA 5A9SA 1DJQA 4WLOA 3ES9A 1OKKD 1LPPA 2OGTA 1GUBA 3A05A 3BRQA 4KXMA 4MV4A 4QEZA 3K0HA 4IIFA 4DMUB 3HPQA 1E9AA 1Y9JA 4OQXA 5DXFA 2DQ4A 1PG0A 3IEKA 1DIBA 4GMXA 2A5DA 1N5OX 2G9UA 3E7FA 5I4CA 3ICQB 3ITNA 2A5GA 4PSCA 1RRCA 3UK0A 3OZAA 4HWOA 3HBNA 3PLAE 3P4YA 1NE7A 2R751 2WHPB 5MN5A 2NU6B 4RY0A 2P68A 4D81A 2FQQA 4J8PA 4JB3A 3LYLA 4M87A 4K87A 4NONA 2QTZA 2G70A 3WWYA 3PJRA 4K6CA 3EWSA 1I3MA 5EE3A 3DO8A 2HA2A 3TM4A 3IESA 3TNYA 2YMMA 1Y5MA 3WOHA 1C8BA 5L3SB 4DB2A 4GP7A 4HZUA 1NVDA 2FE1A 4XPIA 3LT1A 3U7FB 2QLJA 1RI5A 1KY4A 2WAYA 2ZS9A 5D51S 2FW7A 5JALA 7REQA 1ZLYA 5EJ7A 1XDSA 4IG4A 5DWVA 2WIGA 2WJ6A 4N01A 1XLVA 2Q5FA 3MJRA 1Y80A 3ME5A 4PLZA 3RQIA 3VMFA 1LNZA 2HRQA 3GJTA 3PKIA 1QU3A 4KL8S 2HHJA 2GN0A 5KSPA 1FX0A 6Q21A 5IJ0B 1LF0A 1P8AA 1II8A 4F84A 5KYKA 2J7PD 3KP1A 5COBA 4MKFA 2RI1A 3EQ8A 3A6LA 3C3PA 4O59O 4PLWA 4AXBA 2GI4A 4DRZA 4M1TA 1MV8A 2Y2UA 3DG9A 4I1IA 4ZI7B 2R87A 4H4CA 1LQ2A 1XU9A 3GG9A 4QJIA 4RABA 4BVJA 1EZ4A 1P45A 1UBOS 2R8PA 2ZRPA 3DAPA 3DQQA 4LG1A 5GOTA 5FPKA 5KHLB 5KSZA 4OQFA 4N0DA 1VHWA 4IHJA 4UM8B 5JYBA 1RZRD 2A67A 1ZH8A 1GWNA 1U0OC 4PNPA 5H7XA 3TLKA 1G20A 4GW3A 2EG9A 1C3JA 2OM6A 3PFGA 1JF8A 4XZ3A 1NYTA 1WZNA 2E85A 4DSNA 4KI0A 2WQZA 4O1HA 1IJBA 3LPMA 5TRTA 2VPYA 3UCXA 2OV8A 3PRJA 5DHAA 3AI3A 4BEVA 1ZGBA 2XVXA 3G9QA 1RYZA 4G0ZA 4R8SA 5T3YA 2RK4A 4DFDA 3U4QA 1WM1A 4J49A 4ZOCA 2PZJA 4AAYA 5A0VA 4NICA 1ILEA 1G6Q1 1YIDA 1WU8A 5IF9A 1KY3A 2AYXA 4LWOA 4GWLA 2DFPA 3C5CA 3PVSA 1SXJE 3GLGB 2PLAA 4MX8A 2VQFB 4HTFB 2A86A 2XRZA 1OZHA 1QSGA 2BCEA 2FDXA 1BN6A 3KYJB 2LR0A 2Q6KA 1MPXA 2I6SA 1SCUA 5TC4A 3RVNA 3ELDA 4WK4B 5DGCA 4G0VA 1TIBA 4HDSB 2OHGA 1X1CA 4YDRA 3ADBA 1EG2A 1PWZA 8OHMA 3NEJA 4IAOA 3TZEA 3DMGA 3IELA 2XWJI 3KEMA 5JNSA 4PFJA 5BURA 3YASA 1DKRA 5KTOA 4DCGA 3ND5A 4LXQA 3WWPA 5K3EA 3QU2A 1QFSA 5E4FA 2G83A 1YIAA 2LUOA 1S7CA 1N1GA 4QRDA 3CBQA 3GT3A 5E7JA 1BGWA 2C9DA 3FPSA 3SKXA 5I5EA 1MAWA 2DUWA 2UYGA 4L74A 4DDWA 4BO9A 2GNAA 3T5CA 1GQQA 1N2CE 4LXHA 2IP2A 1NBMD 1P6UA 3QLVA 4PHHA 1BWPA 4FXOA 4FW8A 4H3HB 1H2RS 3KQKA 2L17A 3HXQA 3A32A 3RCBA 3T34A 4CCWA 4UVHA 2X0KA 1QK4A 2O48X 2CKMA 2IH5A 4KN9S 4W5TA 4FYJA 4IFIA 1V2HE 4UDOA 3WK8A 3REFA 3TYXA 5COQA 1XFDA 2I65A 1IY9A 1TCUA 2NXJA 2REQB 4TTIA 3OE4A 5IXSA 4G67A 4BP9A 3DBOB 3KSRA 4UXHA 4V2IA 3GAMA 2W2QA 3C3YA 3QEOA 3ER9A 3LLUA 4BCCA 3ZHBA 3ANSA 2G0NA 1CF2O 1NFQA 4MRVA 2GLTA 4PXSA 3FSGA 1COWA 1JJVA 3EIOA 1JS1X 3GEBA 3B60A 5DHTA 5DT2A 1T2AA 2C88A 5ANRB 1AMUA 4OI4A 1G20E 2BGWA 3L04A 2NZ2A 1KVRA 4Z4QA 3BIJA 1SRRA 1YVRA 1QV6A 4HDKB 4KX3A 3D8RA 2HF2A 5ALFA 3SK0A 2G82A 3M5PA 5EJMA 4BQPA 4DLSA 4YPFA 3W6ZA 1FTYA 1PCXA 1A97A 3FWNA 3GEEA 3HACA 4GLJA 5FI1B 1ZD2P 3JASA 4IJUA 4X93A 5DNVA 3TE7A 3VU1A 5JEDA 2AXQA 5DTJA 4BWVA 4KIFA 1RR6A 2D0OB 3ZWMA 5I7VA 1L7XA 1RJWA 4GPAA 2R2GA 3DLBA 5AIAA 3LLMA 4IIGA 1E9VA 1KDPA 1QO7A 3HE3A 5EA2A 2DLCX 3H1PA 1BTOA 4HWRA 5K3CA 5AJWA 2GYWA 3IT0A 4XM0A 1N57A 4RNDB 1PR5A 1Z0UA 1IONA 3G7NA 4R2WA 4DDVA 4PBSA 1PX2A 2QN1A 1Z62A 3QUBA 3R40A 2QBYB 3N2KA 5IABA 3DMRA 4L6IA 1RXYA 1AN9A 1LW6E 1BWRA 1G6OA 2ETXA 1M2HA 3CO0S 5CURA 2EXXA 4B84A 4G0NA 3CZ5A 3PQ3A 1XCLA 3IKMB 3S2YA 1YDWA 4BVGA 3C8MA 2ECQA 1ARZA 4ND8B 3Q2OA 4OQDA 5E1MA 4UHFA 4MS1A 3JD0A 3ULKA 4ARAA 2RI0A 2GOYA 2RGNA 3Q9NA 2J31A 2X1HA 4HSEA 4CV1A 5JXWA 4RHYA 4QL3A 2WY2D 1E77A 4XQEA 4WVLA 2D3TA 1XZ8A 4XOIA 5I9LA 1JJFA 4AY6A 1RI3A 3D6AA 1EVQA 4R1MA 5GM1A 1T1SA 3IAS6 5I7EA 2DFNA 1XD2A 5K8TA 1NVAA 2XQIA 3UAXA 1XZDA 1L5HB 1Q0RA 3M81A 1QHFA 3AM4A 3II6X 2Q2VA 3OIVA 4UMEA 5CA1A 1YQXA 3R3UA 4PR0A 2NU8A 3VYVA 5A6SB 5FUQA 1JTVA 4U2DA 1GL6A 3Q1LA 3RIGA 3O4GA 1DC5A 4JX9A 1T2DA 2B82A 2J67A 3V55A 4BU1A 5HG0A 5C1BA 1PFYA 1N2HA 1YR3A 2NO0A 2ZCUA 4POAA 2WJ3A 3T41A 5C18A 2HPAA 3LY8A 4H1WA 3PXBA 4E6EA 4DDTA 2EW1A 1WUJS 3W05A 1KO7A 3U7GA 1RQ2A 4D8UA 4LXYA 4RFSB 3TUJC 2V8BA 2BR5A 1US8A 1O95C 2GEUA 3E1GA 1O4VA 2PY6A 1UFKA 3PTAA 2QLTA 3FHCB 3OWOA 2JEOA 4RORA 1H1LB 3VHQA 2PZBA 3A11A 1GU7A 3RU3A 2AJDA 1GARA 4K6OA 3LO8A 3UMYA 2BRUC 4MARA 2AMVA 4MVJF 3TRDA 2P78A 4GX5A