1EGMB

Crystal structure of diol dehydratase-cyanocobalamin complex at 100k.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
178
Chain Sequence
GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a protein generates a catalytic radical from coenzyme B(12): X-ray structure of a diol-dehydratase-adeninylpentylcobalamin complex.
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Lyase
molecule keywords PROPANEDIOL DEHYDRATASE
total genus 62
structure length 178
sequence length 178
chains with identical sequence E
ec nomenclature ec 4.2.1.28: Propanediol dehydratase.
pdb deposition date 2000-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 1egmB00
1EGMB 1UC5B 1IWPB 3AUJB 3WB1A 1IWBB 1EEXB 1DIOB 1UC4B 2D0PB 3BRCA 3WB2A 3WB0A 5D5QA 1EGVB 2D0OB 1MMFB 5D5PA 1NBWB
chains in the Genus database with same CATH superfamily
2QX7A 2YYSA 2QZSA 4QUIA 3B1KA 3U9TA 2FFQA 2R6GA 2DU8A 5CFNA 2ZRFA 4K2AA 4XYMA 1B73A 1U6IA 2V5AA 3EISA 1M8KA 2BGMA 2ASVA 3UJDA 5C1OA 1VG9B 2Q5CA 621PA 1G21E 2WVGA 2Z04A 5LQAA 2CHGA 5B7PA 1OFHA 4N7BA 1RM3A 3H5OA 5TR9A 2B8TA 4GX1A 4HHEA 4ZKEA 4X62B 1Y8QA 1W85B 2GXSA 1DOAA 4Y2TA 5G0TA 1KHHA 4MRRA 1GITA 3ASZA 1EXWA 3U7QA 3VH3A 1SQSA 1Y0BA 2PKWA 1FX0A 3N2GB 3MLAA 2ACKA 4RKEA 1N3BA 2Y6UA 1WHSB 3JAKB 2GHRA 1Q22A 5CFPA 1Q20A 5JFTA 3BJRA 5LA6A 1IUPA 5JJLA 1KKLA 3QTBA 2OCAA 1D8AA 2IC5A 4DEXA 3RRBA 4XVUA 3Q7IA 3EF1A 2Z4RA 3MWKA 5CIYA 4CJXA 1MH1A 4HGYA 4DREA 3F90A 3OUZA 2W71A 3R4VA 4R1UA 4XB2A 3D6AA 3RWOA 4QG3A 5IWCA 1ISIA 1C8KA 1BDHA 2MR5A 3R44A 4DDWA 1AZWA 1NI4B 5KAPA 2H18A 5ALFA 2O5EA 4MWOA 4OK3A 4CTOA 4BLRA 1QO0A 1P6XA 1TM5E 2CFRA 3OFND 4LMAA 1MR3F 2JIMA 3ZCXA 4DV3B 3NBAA 2FPGB 3OZSA 2UYYA 5KTYA 4N3CA 4AX8A 1IYZA 3FOEC 1X8XA 5F64A 3WJ1A 1V5WA 3L8HA 1SA0B 2VP5A 3LH5A 5E9JA 3RARA 1VKZA 3IOBA 2I4LA 4XX1A 1FLDA 2Y93A 1CJBA 3QWHA 1IY9A 1WEKA 1NBME 3K6KA 3P97A 4LX0A 3HGMA 2PX0A 4YJFA 3U19A 3L1UA 4UM9D 2ZJ8A 4Y2XA 1MZVA 1OFVA 1DAPA 2B9EA 4YGXB 1HOXA 3NEJA 4K40A 4GMFA 3AO0B 4P86A 4QM7A 2VOJA 3DD5A 3MMSA 3P0EA 4IGFA 3CBGA 2MU1A 2W6IA 4K9KA 4EGCB 2B8JA 3UA4A 1N34B 3PCXA 4N8EA 3JQPA 1RD4A 3LVQE 2A1UB 5AUQA 4O4HA 4D99A 5J23A 5JTTA 4YB8A 4WSOA 4EG0A 2OHFA 2VBIA 1I0IA 3GEBA 4GRDA 1LK5A 3ROFA 1BCRA 3A9UA 2H3HA 1T5SA 2WWFA 3OQNA 3NYRA 2A1TS 1OAOC 1C9YA 4L8LA 3O8LA 3AF1A 4U4AA 5B4VA 2GA8A 4ZARA 1C8VB 3ZNOA 2YYAA 2QTBA 2D5AA 3KOXA 2P9CA 3ZD8A 2OWEA 1KJYA 3P96A 5BWOA 3FCYA 1RS0A 4UVEA 5CA0F 1E7YA 2DUWA 2X0JA 4EZIA 4O25A 4KR6A 5A6SB 3GFBA 1MTOA 1BWRA 2NPOA 3F7MA 1XTSA 3GGDA 4PN3A 3HYCA 1J5EB 3TWOA 3SOPA 4WLNA 4HV4A 1IAQA 2IIQA 1TYDE 2BTOA 2C1XA 2EAUA 3W5DA 3PUZA 1ACMA 1U2PA 1ZGBA 5AXBA 4E2YA 5LNK6 3KYDA 4H7EA 3DNPA 3M9WA 4M38A 3N0RA 4ER0A 2WYIA 3FPCA 4BNMA 3C4QA 2SECE 4XGRA 3WB1A 4D56A 2I1WA 2A67A 1N5IA 1FRFS 3FTDA 4MLZA 1NXSA 5JFGA 2W8BB 1LPAB 3A3KA 3DV9A 4WZAA 4YWJA 3S4YA 2YDYA 1TEVA 3WB9A 1YZGA 3CWQA 5I9NA 3LZ6A 3SF0A 1WABA 5JNUA 1OD6A 3KWJA 4IH1A 3JD1A 3QI7A 1Z74A 2HA3A 3DL4A 4DHEA 1LW6E 1HI9A 1ZONA 3AM1A 5CDGA 5CBPA 4DR6B 1K9VF 1DE0A 1OIXA 5HRUA 2FFBA 4NMHA 1FLVA 2WIBA 2PNJA 3D1VA 3MD0A 3HU1A 3AWIA 4E70A 3TEFA 2KLHA 3SKXA 4ZICA 1SN7A 5B64A 4MR8A 1RQGA 1CUAA 2X6RA 3N0XA 4BVBA 4OL0A 4K3UA 3AEQA 2J7PD 5EI5A 3QU7A 2A5GA 3VNRA 3VKFA 3K4HA 1HOTA 5EIBC 3G2NA 3SXUB 3M5PA 3B2EA 5KO2A 4FONA 3MG9A 3WY9A 1YONA 4RC9A 3MUNA 1FNDA 3V9AA 4RHUA 3LUCA 2VLIA 2YVUA 3E81A 3O8NA 3WNZA 3AIOA 4Q3KA 3PKIA 3ZWYA 3EPLA 2PUAA 2BGRA 3DDZX 3AFNA 4AN4A 3FIUA 2PKQO 2P5SA 3GJ0A 3SBDA 4K6OA 3ZBPA 4M1MA 1RBYA 3CUUA 1IHDA 1K6MA 3IA2A 1OT5A 4DLNA 1QTQA 1R7RA 3RFTA 5AVUA 3I39X 1IXZA 2ZRHA 2HIMA 5TNXA 3Q2IA 5KWVA 4QBFA 1VYHA 3CY6A 1TOAA 4EYOA 2W00A 2QNBA 1T91A 3C3WA 1XR3A 3OCZA 4CKCB 3U6BA 1QLJA 2H0AA 3S5JA 3O8RA 4MW2A 4MJLA 1DFGA 1ZMXA 2PO5A 1K7EB 1PR4A 3RVKA 1FFYA 2FWPA 3NJRA 3W7BA 3LSTA 3IQWA 4NONA 4MPPA 1DRUA 1T8RA 4UXIA 3PQFA 4D0LB 3NC4A 1PQ4A 2WFLB 2GM4A 2UYGA 5EE0A 4FNMA 3E4DA 3T9AA 2LIPA 3OIUA 1QHIA 4G0NA 1G6HA 3D0QA 1KMHB 1O5IA 1W4RA 2X22A 4CCYA 1YDMA 3STVA 1C9JA 1ESCA 1YS1X 5G4KB 4Z1MA 3S7ZA 1DS6A 4URWR 1YUBA 2MOKA 2OSBA 2XQIA 3RYCA 2V0NA 2A5DA 4JJEA 1TO2E 3GNSA 4RPHA 3RUDA 1H22A 1EJBA 2UDPA 3L8GA 3OP1A 3WTCA 3HHEA 5GJCA 1H3NA 1RZVA 5IP5A 2QP9X 1KFJB 3E6AA 1KH3A 4NF2A 3U17A 4A92A 1RWPA 2EZ4A 3SE0A 3F4KA 1WUTA 4U2KA 2BSAA 4XEUA 4HAXA 5H16A 2QSYA 5DF1A 3URMA 2RARA 3GRVA 1D5CA 2QM8A 2VYVA 3O94A 1Z3IX 5EYPA 4D4LA 1NYQA 1QOQB 3RYFB 3BRWA 1YCHA 4JBIA 4WCFA 1U0LA 4UNIA 4Y6SA 2BWJA 3TIXB 3F98A 2JI4A 5G53C 2FPWA 2H4XA 5EJAA 4DIOA 1R6UA 4XWOA 1R37A 2ZYDA 4HQOA 3PGVA 3MS4A 3K09A 2BMJA 4J29A 4DV2B 4PWZA 2FSFA 2PKCA 2XH8A 1J0DA 2OENG 1VG8A 2ONKA 5KHAA 3T7JA 4ZYZA 1N78A 3TCKA 2FWMX 1NLFA 3I05A 2IZZA 3H2IA 1P1CA 1XC7A 1CS4C 3HZZA 4A1OA 3V33A 1AUOA 4HGRA 1XTBA 1WLSA 4QFCA 3R7BA 4ZOLA 1N2OA 3RBZA 2MWMA 3H5IA 4GI1A 1JPUA 1CEQA 4LJKA 1BYIA 1LI5A 3AFGA 1U7HA 2VH5R 4RAOA 5HIMA 3CVUA 2GJKA 1K8YB 1P3DA 5AW6A 4J3JA 4MB0A 5M29A 2QAGB 5I01A 4BKQA 3ZGOA 1RXSA 3L1IA 2G4VA 4M89A 4XJTA 3OY7A 3UTCA 1EUDA 3RF6A 1QRTA 1GN8A 1VKRA 4I4TA 1P6UA 4BY9E 1RI3A 2L18A 2PL9A 2ZFUA 3X1KA 2G5PA 1GPNA 1NBAA 1U8YA 1XMVA 2AR9A 3C1AA 3LG2A 3NYQA 3PFIA 4KGDA 4C21A 7ABPA 3HQ4O 1AH2A 1VRCA 1XA4A 3RK1A 2Q8NA 4M0EA 5GVSA 2GEUA 1DX6A 1W4ZA 1QC5B 4I66A 3RD5A 2EZTA 3ZK9A 3I5MA 1M8PA 1N5JA 2I66A 3QZUA 3K9CA 5MN4A 2WM9B 3THOA 4Q1VA 5E9AA 3UG6A 2J3MA 4PG4A 1NPYA 4UVHA 3LKDA 4WY5A 1NOKA 1QE0A 4FI3F 1CUUA 2DKNA 4KE6A 4Y6OA 4FGUA 1JA1A 1RCUA 2JCSA 2GF9A 3ODGA 4KU4A 5GWXA 5I9MA 4POOA 4OO3A 3HTXA 4MEAA 3W34A 5SZIA 1WF6A 1DKRA 1G55A 1KGSA 2D1TA 1A72A 2NV2B 3EMDA 2CMFA 5FWXB 4OX9Y 3UATA 3OTHA 1W4CA 4WN9B 1U0TA 4KHZA 4Q4JA 4RFSB 2QX8A 5JEDA 2PBLA 4BCDA 3GY0A 5E4FA 1VPEA 3T4XA 1VYUA 3THXA 4F3RA 2X0FA 3HWSA 2YN4A 1N2GA 4Z9AA 1AMNA 4CIAA 1Q7RA 1QHSA 3I6QA 4QRIA 2W8BA 3WDMA 1VJ0A 2FRDA 3GGCA 5FO0A 1YK0A 2B3DA 2IZOA 1L7QA 2JI9A 1A97A 3IHLA 1Q1ZA 1T1EA 2VHEA 2VUUA 1L4NA 1O2DA 1DJOA 1TM7E 3IS3A 4FFDA 3UO8B 1ZJWA 2RGRA 4DA6A 2ZPUA 3MTGA 3P45A 2AOVA 2IYWA 4Q6BA 2V7TA 4TT3D 1YR1A 2NUTB 3HADA 3WDSA 1CZOA 4XGIA 2XE6A 4TZ0A 3WK7A 2P11A 1SVKA 4LTMA 1PJZA 2AI1A 3OKPA 3ON5A 4EIWA 1D9XA 1W8DA 4JT4A 3TG8A 3MM4A 2DHCA 1HYBA 3PHHA 2QIOA 1UPCA 3HSYA 4X8LA 1P62B 3M8KA 4IIEA 5F9FA 1O87A 2Q4OA 5EXPA 3H3XA 3UQYS 1W76A 4AY2A 1OA1A 2DCUA 2ECFA 3V80A 4L6AA 2PS0A 3LPCA 4LSGA 3I8OA 4C9BA 5B3JA 1EP3B 1VP9A 1GG5A 2D59A 1G8MA 1C3VA 2Y92A 2Z56A 3COYA 3E0XA 3C41J 3GI1A 1P2SA 1RBQA 4A5OA 1FE8A 3OOHA 3ABOB 2NTNA 2HLDA 4NMXB 2EW1A 4E08A 1F17A 3NQ41 1QBKC 2YNMD 2Y1XA 4R2JA 3CVWA 3L4KA 3WGUA 2BKXA 2GYWA 2QV0A 1UZLA 1LV8A 3PWKA 5KYWA 1OV4A 1A2QA 3KT3A 4PX9A 4F9EA 1OFTA 4MAAA 1D1SA 4EKDA 5GV8A 2NG1A 4AQDA 2HJGA 3RT1A 3UOWA 2YASA 4O8CA 4A10A 2Q9BA 1D6MA 3EZ9A 3SYKA 1BXRA 2GCPA 3DAPA 5LQSA 1TQ2A 3G9UA 4KKXB 1Y6GA 2GGSA 4X64B 3TW8A 2XDQA 2SKDA 3ZY3A 4N82A 2OV2A 4TKLA 1YVEI 5AXDA 3X1WA 3PT9A 3ORQA 3HCBA 3Q8XB 3QLVA 4LDJA 5A4KA 3THXB 1Y6RA 1KMHA 4G8BA 9MHTA 3VPBA 3WIBA 4HUJA 2QZPA 1KS9A 2A1TR 3HFRA 4QICA 1PD0A 4MWGA 1VCIA 2I2BA 3A1TA 2YVAA 3FG9A 1W5FA 3MBKA 4PZDA 4RLHA 5FLYA 1IY2A 3OI7A 1ZOPA 2TS1A 1WZ2A 3NJ4A 3SJBA 2R8RA 4BAUA 1EXNA 1HEUA 1ZNWA 2AE1A 3CNLA 1XI2A 2O7VA 4JBHA 2AEMA 1P4HA 4LJ5A 1EE1A 1ECGA 2BM1A 3ZQUA 1TL7C 5JNLA 4P7JA 2J9XB 4XR9A 3WHIA 2HR1A 1N6HA 1ES9A 3L8YA 4L02A 1E2NA 2N46A 2ZSBA 3DFKA 2JI7A 1OGJA 1A82A 3GFVA 1FMTA 2CD7A 5IJ0B 3RIXA 3HKCB 4BFXA 4MQEA 3A6JA 5EGNA 2J9GA 2YUIA 5BV1A 3N3AC 3SX0A 4JI4B 1V5FA 2VHTA 2ENUA 3ZS8A 2BGJA 1C7EA 2YICA 4H31A 4BNDA 1E2EA 2HCJB 3R5SA 1VE6A 2X7XA 3WKEA 3D6UA 2FK7A 4NYJR 2J30A 2I8LA 4HZIA 2V6FA 1ODFA 4R1PA 3UNXA 1LDBA 4DW8A 8AT1A 2M32A 4R1OA 1GTRA 4TLMB 4URUR 2VEOA 2XMCA 3EGOA 2HBRA 3C16C 3K53A 3U1VA 1II8B 3HBNA 2K2WA 3EULA 4RK7A 3Q3IA 1HFEL 4R8KA 3OICA 1LTQA 5CTAA 2AJ8A 2QUZA 4LZAA 3RAGA 3U5TA 1JDBC 3CLRD 1I2CA 1B8PA 3SHTA 4CIYA 4PSVA 4OB7A 1FBTA 3T3OA 1JW9B 4RK1A 4NE2A 2BEUA 1KEEB 4PCAA 1C1DA 1C1XB 1U7UA 7AT1A 3R3XA 4MMXB 4YJ2F 4DG5A 5FFNA 1Q6ZA 2A0UA 4XX0B 1DUIA 4XGKA 2NO6A 4AB1A 4CV1A 3KQOA 4OYYA 1GL6A 1GZ5A 2W2PA 4UVGA 4EFDA 5KTNA 1VIMA 2B4TO 4R51A 2I4IA 2FDRA 3DBVO 3GVXA 4P82A 4B3XA 3K9FC 2RHJA 1XPOA 3J7AC 6PFKA 2PZEA 1L5HB 2W6CX 3WOHA 2QY9A 3I0NA 3BT7A 2I1QA 2SBTA 1E2JA 2AC7A 3MFQA 2CY0A 2RAFA 3P2IA 3HMQA 2ZJAA 4S3MA 2BR5A 2Q7DA 1JSXA 3K6SB 2QVXX 3PJEA 1JHMA 3ACDA 3DBHB 5BR1A 5DTRA 1YKFA 4QODA 3VZCA 1BH2A 3KAKA 4BNNA 1MEOA 3V42A 3WGGA 1FSSA 1E2QA 1DIAA 1P1BA 1Q95A 2COEA 3TD6A 3B6EA 3ZGZA 2Z8XA 4YV0A 1M6HA 3E53A 4WXEA 3U4MA 3GAZA 2QAGA 3L4BA 3DS8A 1VGQA 2FUKA 2IPLA 4IPTA 3WYBA 4RTKA 2ODNA 3QFFA 4OAOA 4RXMA 16PKA 4W63A 4UAJA 3AQ4A 5DNCA 3UICA 3GXOA 1V3QE 2UVQA 1A4XA 1ZZGA 1XXHE 2C9ZA 3H4VA 4A8JA 4YRBA 4DB2A 1W1WA 4UM8B 1MB3A 4F21A 3ANXA 4AW9A 4B3DA 2D06A 3A7DA 3D5EA 2G17A 2IYNA 2DH6A 4RCZA 2ZJ7A 5IRCD 4J2OA 4DMRA 3G9TA 4DLKA 2R2AA 4L16A 5FBLB 1R0CA 1MEEA 2DF8A 1YQTA 3LUBA 3T5AA 1FNSA 1X1DA 2PWZA 1DMRA 2Y4NA 2VHCA 4OP2A 4A27A 3RSLA 3AY6A 1HZZC 3UJCA 4EA9A 5EHXA 4RKWA 1DG9A 3AU9A 1NBEA 1Z2NX 3EZLA 3F71A 3G1TA 4XDHA 3AG5A 3FWYA 5T41A 3B7WA 1XAGA 2LUOA 2VDJA 1Z5VA 1VRWA 1KI4A 2QJOA 2SNIE 3GFGA 2WB2A 3COVA 4W1SA 1VYTA 1V5IA 3COSA 1ZJ4A 2PMFA 2PUTA 3H2HA 4JR1A 3EDYA 4KV9A 1XQ6A 1Z26A 3I01M 4N39A 1GU7A 4PRKA 3LUKA 3P94A 4CQJA 5K6AC 1N6LA 1OLOA 2GTIA 3G3EA 4RIGA 2XQJA 1XAHA 4ZOQI 3I9OA 4FR0A 3Q9SA 3CPHA 1NOJA 3LRTA 1IM5A 2P4QA 4FLFA 4H27A 4XSVA 4YASA 3K1YA 3L1JA 1LF5A 4LISA 3UOGA 5BWMA 2KS6A 1H2ZA 4F9GA 1IHPA 2P2LA 4I4TF 5JRJA 1U9JA 1G8KA 4QQRA 2IT1A 5CHYA 5KVAA 3LLSA 2X23A 3HBLA 3RV3A 1UEJA 1Y1QA 2JA1A 4E0BA 1N33B 4YECA 4ZPJA 2Z1MA 5JS1A 1ZITA 1C0IA 3LA8A 1E1KA 2D8AA 2YN2A 2Q1YA 3FHJA 3ANNA 3FKSA 2AWOA 3KKEA 3MELA 2WJYA 3SP1A 4AYTA 4DZTA 2M1XA 2VAPA 1IC6A 2ESRA 2VTEA 5AW7A 4QJ5A 1JTVA 1MQ9A 3RS7A 4AO8A 2J7KA 1XQ9A 1LFAA 2REBA 2A84A 3CYFA 2FE4A 4F04A 3RLIA 3PJGA 3AEYA 1PX0A 1ZIOA 4R9SA 1R15A 4YCMA 2FETA 3B70A 3E2MA 4YP1A 3VU9B 4BO8A 2FZGA 3D3WB 1Y8QB 1W0JA 5DHTA 3V2HA 2KJQA 2EEPA 2NPFA 3Q3EA 3GPDG 1XVTA 4MQMA 4RL4A 4EM6A 4MKIA 1U5BA 2VJPA 2NUBA 3MJRA 1UWVA 2ACWA 2WNHA 3ZEAA 2QORA 3HKDB 4PM4A 1IM8A 3FY4A 4JP2A 3QI2A 5EMHA 1DO2A 1L5SA 4BV8A 4E2WA 4Q4DA 5BSKA 4MVJG 4NARA 3HN7A 4CE6A 3CSDA 4CF7A 2HSWA 2VXYA 2PCJA 3ORSA 3A05A 3QBEA 3PI6A 2WF8A 4I9FA 3DKIA 5CVUA 3WK8A 2WHXA 3BQ9A 5JXWA 1KZ6A 1JAIA 2X19A 1JPJA 1Z16A 2I5PO 1F0PA 1E1RA 1XLUA 2VQ6A 1KQGA 1NT4A 4RSRA 3LPLA 4NCJA 4E4YA 1HKUA 3KKZA 4ID9A 3WL7A 1I7NA 3L9WA 2R47A 1H6BA 4GD3Q 2RJOA 2BEKA 1NXTA 1GL9B 3IMKA 3LY7A 4HVLA 2IY7A 3KLNA 1M1XB 4YRDA 3AZQA 2VA8A 3WMFA 4N6OA 3Q6IA 3EPJA 2VSXA 3TLGA 1WUIS 5LNK1 2VTKA 3DHYA 1Y6FA 3F3YA 1Y3BE 2FFHA 3EPRA 1JG1A 1M2OB 2A5JA 2UYOA 4W8OA 3VYRB 1FNNA 3FSGA 3GLHA 4Q9NA 1JLMA 3JQ7B 1Z82A 1E2LA 1U8CB 3FMPB 2HSZA 3LHKA 1M2WA 1OBCA 1NBHA 4FMDB 2PEZA 1L4MA 3QPCA 5L7TA 3GT4A 3MTDA 5F5NA 3VJRA 3W77A 3WMWA 4FGLA 4TT8A 3DP7A 4DPKA 2C7VA 1A1VA 3T7EA 3MGGA 5L4NA 3PYMA 4JDPA 1FXSA 2GK7A 1YRLA 2KMLA 4G0XA 3UYLA 5B5SA 1N3LA 2CHEA 2NO5A 2WDPA 4Y30A 2P6RA 1KY4A 4F4CA 3U9LA 2EF1A 3I12A 3VUFA 4DDTA 1Z4OA 5IYZB 2HU7A 2HV8A 2NU7A 1K3UB 3AY3A 1Q2XA 3D64A 2ATCA 4RWZA 4W6ZA 5JH7A 1NNEA 1XYGA 2F4VB 1JVNA 4FHCA 1NVGA 1X7ZB 4KMMA 3VPSA 2PM8A 4Q82A 4JBWA 3NI2A 4OOEA 4WDRA 2JLVA 2F17A 3LWZA 4ARBA 4DHWA 2GI4A 1Z7BA 3OFNA 3KD3A 4PGAA 1XELA 4KFSA 1CIVA 3ZNNA 2CDBA 1SUWA 2P2GA 1NOIA 1TJNA 3DJFA 3GCWA 5DKFA 4DIMA 2BDTA 1G5QA 4WZBE 1JDPA 4OK5A 4V0ME 4XSGA 1IG3A 3GQBA 2LBPA 4KWTA 2PSJA 4PYRA 4Z0NA 2RCNA 4FYMA 4AF7A 4YUAA 2APJA 3QK7A 4TMKA 5BN4A 1N2CB 1HDEA 2MSWA 3HLYA 3UPTA 1JJAA 1RP7A 3EC7A 1MW9X 2OO5A 4BNGA 3EWAA 2DPXA 1JWBB 4ZK2A 4GAEA 2XNKA 1RXCA 4BASA 1SA0A 2ZJBA 1LTKA 4JEUA 2EFGA 4DMLA 3UPDA 2DLCX 4GGMX 4LGMA 3TTXA 4YTEA 2JLQA 3CZQA 4IJKA 1V7ZA 5I9BA 2J0QA 2PUFA 2F1KA 5ALMA 1COWD 4UKDA 4BJHB 4G5FA 1FP1D 1NRJB 1JG4A 1TD1A 4S1VA 1KXZA 4KQKA 3I04A 4Z3OA 2A7QA 2I6SA 5AVOA 2ZWIA 5EZYB 1QYWA 4MHTA 3FNEA 1N0IA 3L7DA 4M1YA 4UM5A 3ZDDA 2HTFA 1ZIPA 1WXXA 1ZN2A 2HXYA 1IIRA 4DJFC 5JTUA 1GTL1 1Q3KA 1UBMS 3H1AA 1ISPA 1VE1A 3HS3A 3DTVB 2BGTA 4CV0A 4NHOA 3LX6A 4ZVVA 4Z4QA 4XVCA 4UEQA 1B0ZA 1VB5A 1VI6A 3P9XA 1KDYA 3V7UA 3F5DA 2PGIA 3AUYA 3INGA 4CLDA 5ADUS 1QGED 2GRJA 3EH2A 4BU0A 3UK2A 3HEAA 1OX5A 4ZCLA 3WLNA 1U5BB 1ZCFA 4XVHA 2ECKA 2NU6B 2PO7A 1ANKA 4ACBA 5L40A 4M9CA 1TZ2A 4FQ5A 3U7GA 2W2QA 2K4MA 3L5OA 5AW0A 5AM0A 3S68A 2JFNA 4IOKA 3L0SA 3G8YA 3F2VA 4I6JA 1B23P 3CR3C 3AHCA 5EUBA 3RE1A 3PRJA 4EMBA 1NVVR 4MIKA 2CNDA 1CQPA 2C03A 3W6UA 3ASVA 4EVIA 4Y6PA 3DWGA 5IDQA 4X45A 1A9XB 2FQWA 2RKWA 3FRIA 5DCUA 3W5VA 3U7HB 1AE1A 1QS0A 3Q4GA 1CZNA 4NPCA 2X77A 3FJYA 1BD3A 1MIHA 2A86A 5T5QA 1G5HA 1SU8A 5K2OA 4F1WA 1JIXA 3FJOA 3I5XA 4ESEA 2QX4A 4XD7A 1XD9A 1QF7A 4AZVA 4V0LA 4RMJA 1NP3A 2DBRA 3R5JA 2GSDA 4FBGA 4QYXA 4UHCA 4KH1A 4HDRB 1KYIA 3EZYA 3ER6A 1OFGA 3R5XA 2FSSA 4NS1A 4Z51A 4AS1A 2RI0A 4AZWA 2R60A 1GCIA 2ONJA 3GJ3A 1PUJA 5LB2A 2BLLA 3JW8A 3V1UA 4CLXA 6NULA 2BKEA 1SVLA 3PHBE 1CF4A 2YJNA 1CS0A 2GK3A 1YR2A 3HV2A 4ZYXA 3WL3A 4TROA 1ONNA 4J75A 1ILEA 1YZQA 3FMGA 4O4LB 2ZIXB 3W9UA 4HJXA 4UAGA 4LV8B 5G0VA 5SYAA 2F8SA 4B3CA 1JYFA 2OQ2A 3HA2A 1T13A 4HDNB 1JFLA 2IZ1A 2JIOA 2EHJA 4NI5A 4XWKA 5K09A 2Q0XA 2KPOA 1ZVMA 2CLFB 2XX3A 2YOGA 3OO1A 4JB3A 4QYSA 2O0LA 1N9KA 2ID8A 1XZLA 1DJNA 2ZSHA 1O77A 3HVKA 3I5UA 4OJYA 3RS3A 1PJ3A 2HBZA 5E7IA 5JO0A 3Q87B 5BT8A 1QU2A 3FVQA 1N1EA 2ANCA 3VDQA 1UC8A 2G06A 3D31A 5AVKA 1TFUA 1AS3A 2V1UA 2F9MA 3D3EA 4BE7B 2ZJ2A 1NKVA 2J8ZA 3ET4A 4TYQA 2QN2A 4P83A 3X43A 2NW6A 3M82A 4WTOA 5F7XA 2QNIA 4H6PA 1R0LA 1BDJA 4U2BA 1L6RA 3AYXB 1KETA 3PITA 2PH7A 1YB2A 3T3DA 4ED9A 1ODTC 3IR7A 5JE8A 4JUCA 3TOCA 1NN3A 1HFJA 3PC8A 3L5KA 2Q7XA 4NX2A 3WYGA 4EW6A 4YCLA 1G7TA 2PGNA 3LUAA 3U7IA 1QCDA 1W0CA 2IEZA 3SICE 4GUAA 4BECA 2K7FA 2JFVA 1TT7A 3CB2A 2F6RA 2Q3BA 4LBWA 4NEHB 1UF9A 1PT7A 4R0NA 1NW9B 2PFGA 1AO0A 3P26A 2R84A 2J85A 1UWKA 2B4RO 4YP6A 1UM9A 2PH1A 3C2QA 3O4FA 2BSQA 3T1TA 4Q01A 2XVYA 1K97A 5LKAA 3WK6A 2DECA 5EWMA 4IG4A 3BXFA 3O38A 2W8ZA 1Y7LA 1UOQA 2ILTA 4RGBA 5DTEA 3O2NA 1SZJG 2CVOA 1SXJC 1Y4AE 3D5QA 1ZJ5A 3FHCB 4HCJA 4IQFA 4QBHA 4XH9B 5TQ0A 3W05A 2JGNA 5KNDA 5DEOA 1RHQA 4BRWA 4NXMB 4RKYA 3K31A 2VPXA 4EMSA 2W2XA 1ZK4A 2RONA 3HUDA 1FW8A 2IEAA 2LTAA 1L8LA 2Q4RA 4RSMA 1R4ZA 5SY4A 4UW9A 3WLTA 4CLHA 1FDWA 1R8XA 4P32A 4MR7A 3KTFA 4Y3UA 2ACEA 4KC0A 4P3PA 3ROQA 1RVV1 4M36A 4OHPA 2ZSFA 3B7PA 1X77A 1JEAA 3NTVA 4GZLA 3SQMA 5LR6A 3OZDA 3DVAB 5HQTA 3UJ8A 2E21A 1XWWA 4MW5A 1FSPA 1F8XA 3SAJA 4XM2A 4ZQBA 5K20A 1IJBA 3UIEA 1X7DA 4GDMA 4QOGA 4GR5A 1R0KA 3NPAA 1MV8A 1VYVA 2GK4A 1K2WA 4GUDA 1K9SA 4RMHA 4U0KA 5HF5A 3RC2A 2JLBA 2EV9A 5J2UA 1BN7A 4Q5IA 1V1MA 2IW3A 1EK2A 1ESEA 3DOOA 3QWBA 4LXGA 4JHLA 1OOEA 4H6VA 4FC6A 2WJJA 2ZTHA 5DYYA 1AGNA 1DEXA 1GGJA 1HQDA 1W96A 4LKOA 3MB5A 3X1ZA 4C0HA 1HNNA 4MKFA 1OB2A 4TLLB 2JAHA 4N18A 1J8MF 1NJ2A 3DG9A 1T1RA 3TJRA 3NHMA 1WMBA 2BP7B 2F1IA 1EFLA 2WD8A 5CP8A 5JJCA 3QEBZ 5IX8A 3WWDA 2D0IA 2GM5A 1Z35A 3V1YA 3NTQA 1GEEA 3JQEA 3CH7A 2VEDA 4NFLA 2FZLA 4R31A 5A62A 4QPZA 5H68A 2JF0A 2NAPA 2FN8A 2QLFA 4IZ6A 1OPXA 3X2EA 1VXRA 2FPIB 3C3XA 5HKLA 5CBPB 3KB8A 1E5QA 3TAUA 3WWCA 1T9GS 2D1FA 2X0IA 4NU5A 5FTNA 3IEXA 3AHFA 2PJRA 5EZYA 4H0FA 1P19A 2BFEB 2JCYA 2ZJ5A 3GGJA 3JZAA 1R8JA 4MPTA 4EPWA 1SCKA 1JECA 1QKJA 2CNLA 4D25A 2WKWA 2FN7A 2JJ8A 2Q9CA 1KARA 4XARA 4ZVNA 3I3OA 3SDBA 3MZ0A 5M34A 5IULC 1CERA 3RIGA 4F7DA 2V7PA 2VDOB 2I1VB 1J2RA 4G97A 1E1QA 2YYZA 4DA8A 3Q6MA 1DKLA 2Y1GA 3MPUA 4PV7A 1DTSA 3O47A 1VJDA 1QF6A 5C35A 3FUTA 2VHVA 4YUXA 4QVKA 2DVMA 4YJ2B 4HDRA 5E7JA 5DLPA 4A5SA 4V38A 4CF3A 1XQWA 3IUSA 4Z6KA 1J9ZA 3VZPA 3B85A 3HKEA 2D0OB 4DCJA 4EPYA 1PR9A 1FA9A 1YQEA 3C8ZA 9LDBA 4BVHA 3BHIA 5LDGA 2JJMA 3QEOA 2IQ5A 1V2GA 2ZS9A 4M0PA 2AYZA 4JL8A 4TMVA 5KNDD 3R0QA 4R16A 4D0GA 1AB5A 4TMFA 1DC3A 1WB6A 3E48A 1SBIA 5B6IA 2C7OA 1Q5PA 3PDJA 1CIJA 1L4KA 1T8UA 1UJMA 2C2XA 2H2WA 5TMBA 3NM6B 5GIOE 2JKVA 3UJ6A 2BN4A 4DNPA 1O0SA 1KFKB 3NIGB 5CH3A 3DE1X 2H1RA 1SPXA 1W44A 2F1JA 3HU5A 3R3YA 4OA5A 1NNLA 1HV8A 4RVGA 4WCDA 5REQA 4YDQA 3U6KA 3PEYA 3EY9A 2QXYA 5BVGB 2BHSA 4KXFB 5AW2A 2PYIA 3R3WA 4XIYA 4F71A 3FWPA 4QJIA 3M4XA 2JVKA 1BVYF 2Z4SA 1Z08A 2FZCA 1VL1A 3TAHA 4IDCA 5C8ZA 4K88A 5A9RA 3R7DA 2DERA 3CN9A 4RF4A 1RMYA 1U11A 2D5CA 3D8HA 1T43A 3LUJA 3O4JA 4HTFB 4ZAZA 5K3FB 1IZ8A 2IH5A 2R48A 2J46A 5FUVA 4DMKA 3MYYA 1BXZA 2QD5A 1ZDMA 4U2GA 4G0UA 4MV0A 2P7IA 5J5CA 2O05A 3KQNA 3FAKA 3G0IA 4NMMA 2HYIC 4RJ2A 5HFNA 4DZZA 2H59A 4HDOB 2PAAA 2W22A 3KYJB 5BR4A 5BV2P 1IVNA 2YW9A 3QPDA 3FPLA 1PJQA 1PJ8A 3B5EA 5HHTA 1U94A 2ZJ0A 4B4KA 4DVGA 4B6RA 3QUCA 3B38A 1KTVA 2WU8A 2DX7A 3QKRA 3RJMA 3RVNA 4FM9A 1Z4LA 3QPAA 5DGXA 1X1BA 3PRYA 5BRJA 3KKLA 3KOZA 4BNKA 3P2YA 1NPDA 3OQMA 1RRFA 5ALPA 2JFXA 4AZSA 3IPRA 4TTIA 4XEHA 5B2ZA 3EXFA 3G9XA 2JASA 1NAHA 1PVVA 2PZFA 4EJSB 1JU3A 1OKKD 3WYFA 3ROPA 3QX9A 4G5SA 2ZYAA 3C3EA 3H75A 3PFFA 3AESA 4N03A 4FEAA 1KI8A 1DQYA 1RLUA 2VRCD 1QVZA 4CM7A 4D4JA 4PW0A 5L4SA 5FUBA 4NYJQ 3FI0A 4BP1A 4V39A 1JIJA 1LX7A 2UXBB 2WSBA 1L4FA 1B2LA 3MRSA 3ZTYA 3N7UA 1NQ5A 2ALJA 1G21B 2KLBA 2IQIA 3PHCA 4I4TB 4RSHA 3N2EA 4AJNA 3LRXA 5BP7A 4G24A 4LI0A 1L4EA 3GA7A 3L7IA 3ONEA 4GNRA 4HNAA 4NBKA 4AMUA 4Z7QB 3F3SA 3MIZA 2GJ4A 2WD7A 5DNYB 1GSOA 4HC4A 4I9GA 1N2ZA 4URYR 3FPSA 3SSOA 5F98A 3KSRA 2EP8A 2X8JB 3LKBA 2W6PA 4TS1A 3BMXA 4X44A 3WB0A 3DE5X 1YF3A 2LW7A 4B09A 1G6OA 1CY8A 1FFSA 2JGDA 4LXUA 3KZCA 2PMEA 3SZUA 1QQ5A 1HLDA 3DZIA 1QRAA 4G81A 1V9CA 5BNFA 4E33A 2P65A 3W1VA 3WMGA 2VSFA 4C04A 5ETJA 1DJLA 1HDRA 3AILA 3BK7A 3HWWA 4JZYA 4S1WA 5CW1A 2ERXA 2XUPA 2Y1LA 2BPOA 1KZHA 1XRSB 3JRXA 3HBMA 3FR7A 3JCZA 2CEAA 4C2AA 5A1TA 4I2VA 1KJWA 1SC6A 3U7RA 3QQ5A 5CVTA 2PU7A 4C0LA 1H9BA 4KDFA 1EJ2A 3N8DA 1XRNA 4N8DA 5I7AA 3L8CA 1VE5A 1JALA 4KBGA 5EKSA 3V4OA 3NBYC 3ZR4B 1GIAA 1WB9A 1Z0ZA 1KOGA 4X3PA 4Z4EA 4Q1BA 4E2ZA 5F7JA 4ZV9A 2JFFA 3M0EA 4IX1A 3DOHA 4JFRA 2P35A 4V0RA 3BXGA 5EGSA 3V00A 2NXNA 4RQTA 4DV7B 1TC2A 3KOYA 1U2SA 1VMEA 1HORA 2P5YA 1T2CA 4V02A 3UJ3X 3EXG2 2IOQA 4PAQA 2OPBA 2A9RA 3FKQA 3FNHA 4O5AA 2PKQP 2FQXA 2YJ3A 2DBYA 3G6KA 5DM2A 1GOTA 1OTYA 5C81A 4I4NA 2FEWB 3Q7EA 4C22A 2XQKA 3JQGB 4D8UA 1JB9A 2CL5A 2FEMA 1ZX1A 5HGXA 5BNZA 4TTTS 4K6FA 4UHBA 4CDMA 3LLVA 1S01A 1RYZA 2O8CB 4ZU3A 2ZQYA 4IDQA 4HVAA 2FG5A 4KZPA 4L8YA 1P8AA 2PKXA 4DA9A 3A1EA 3ITKA 5JT1A 1HO3A 2W43A 3EEFA 4IJWA 4JSTA 4HDMB 1ZYUA 2AN1A 1NJ8A 2WHYA 2XIQA 3IB6A 1NFQA 1O6CA 3NV7A 4GMKA 1B42A 2DULA 1MABB 4HB0A 4QQNA 3DE6X 1EWTA 2RBGA 1WP4A 4DBVO 2A9JA 4E15A 4ZDKA 3JS5A 3P9PA 1S8NA 1A4IA 2ZIGA 1LJ8A 3AEXA 1SXPA 3EIHA 3KPVA 1O03A 1PKXA 4S1PA 4G37A 4L5IA 2LZ0A 3OT1A 4C7JA 5EJEA 1GPUA 3ZOZA 4XPIB 2YQ5A 5DEIA 1WDLA 3NRBA 3GNQA 5SYMA 2AHRA 5AJXA 421PA 3JR7A 1AB6A 1EDDA 1IBLB 1SXJD 4H1TA 4IDNA 5KYNA 2I3ZA 1SHKA 2A14A 3AI2A 4LMRA 2R1ZA 4C0AC 4LHSA 5K3AA 4Q3OA 5KSOA 3NHUA 4D42A 3NKVA 1FYVA 3HJRA 1H4VB 2UV8A 4BQEA 2QM0A 2O54A 3WRWA 2CLDX 4N7JA 3BIJA 1V96A 3ZHQA 2E18A 2AN5A 4EQ6B 3KDSE 1C4OA 2XUKA 3R0XA 4U8GA 1EFCA 5HTKA 3USZA 1KAHA 4EHLA 4WCFC 4FOSA 1G1MA 1XTUA 1E3JA 2RHLA 3JVIA 3AINA 4LOKA 3ZH9B 1TLFA 2KM1A 3OFJA 2WJWA 4WEQA 3CX4A 2TRSB 4Y67A 5KU7A 3P20A 2KB0A 4KN6A 5CBKA 1UBTS 3LUFA 2D3TA 1JKIA 1NI5A 2V6JA 4RQBA 1N7IA 3T12A 3HC7A 3VJLA 2B1GA 2F3QA 1RXIA 1DKOA 2GBLA 4Z86A 4M8IA 2NO4A 5FPYA 3WLFA 4REQA 3WNCA 1F2TA 5FEMA 5I4BA 2C9OA 1GTG1 2E87A 4PCVA 4XDZA 2XE4A 1TTPB 2CXTA 4R1TA 2QUKA 1B76A 4E5DA 1KSJA 5G1OA 1F9AA 3G5LA 3CLSC 4MYUA 5TJ9A 1T8YA 3FOAA 1D0VA 2ATIA 3DYIA 3LXMA 1P0CA 1I6WA 4OQFA 4BPRA 1F2VA 5FNZA 2ADFA 3D5TA 1GO2A 1YL7A 4YIKA 5EZYF 3W4KA 5DN6A 5JJBA 3KJFA 1JHYA 2BKAA 2ZRAA 4J1SA 2ZWVA 5I4KA 4R3UC 3IQXA 3M6AA 4AC9A 3HUTA 3FRHA 4UTNA 1YH3A 1E9FA 1MA0A 1A8IA 4CU2A 4Q4HB 1OH5A 3BQNB 5CYFA 3ETJA 5FF9A 4AN1A 1VL5A 1PDOA 3W1EA 3AY0A 5AKJA 4F4UA 2X1VA 2XSZD 2XGGA 4ADSG 3NHFA 3UJAA 2XIJA 3R8XA 4OGKA 3TLKA 1IY8A 5F21A 5TQ2A 3MWFA 4MKZA 5HUJA 3RRFA 3PSHA 3WGQA 4O4HB 5BQPA 4CKWB 3KETA 3C39A 2XQVA 5BOSA 5KYUB 5DXFA 2B7BA 2AZXA 1EDBA 4KNYA 5HNKA 2EP5A 1X1SA 1N0WA 4WL0A 3AUKA 4F11A 4DXHA 1VRVA 4ODIA 3UVEA 3V2GA 3KJNA 1NDUA 3K1AB 3O2QB 4AJLA 1P4GA 2KYRA 3D6TB 4GOKA 1SUSA 3HI4A 2O4CA 3QVVA 5LXTB 2FMUA 2HK6A 4MV9A 1FS6A 3H1BA 4PQFA 4BQRA 3JASA 4M0MA 1T8PA 4QPPA 5LM3A 4OK6A 1I10A 3QNWA 4LG1A 1K5HA 1FQKA 1I8TA 2ZOSA 4FKBA 4LZJA 4O5OA 1PNTA 2IODA 2BM8A 5DOVA 4A2WA 4ARUA 1TGYA 1WNTA 3DL2A 1A7UA 1WS6A 3OKCA 4UNSA 4V2IA 3T9FA 3HK2A 1N9ZA 4QOSA 3T54A 3B3AA 3R3JA 4NCIA 3L43A 1AOXA 3LP6A 1XZPA 1E60A 1JIVA 1N5OX 4CMEA 5A04A 3JWHA 3SC2B 1IVYA 2XKJE 1QYCA 4QXMA 3DVRX 2NLOA 1KHTA 5CEEA 1RAEA 2FW6A 2WU1A 7MDHA 5JOQA 3JD2A 2E49A 3MVEA 3KUCA 2A58A 3EIXA 3VH2A 3O0DA 5TY0A 2FOXA 4ZOCA 2QMOA 4FEEA 2G4LA 2UVPA 4QGBA 4PNEA 3IR6A 4AYWA 4CG3A 4UE2A 3FZNA 1TMYA 2E4WA 1ZQ9A 2IDMA 4JSRA 1NG1A 5I8WA 1QLHA 1C3JA 4ISBA 4ACAA 1IBSA 1HLGA 3MTEA 4IFTA 4UC0A 1I4WA 1RWBA 2ZKLA 4GM1A 3FX2A 3PTLA 4HYQA 4LV5B 1NV8A 1X1AA 2FAXA 4RORA 4JGBA 3KEMA 1SPBS 3KZOA 3PRHA 1ZOSA 4JLVA 4YP9A 2OFOA 1DIGA 1YBMA 2HF9A 2L42A 4Y1FA 4BFLA 3IO3A 2JS7A 4NCXA 5FWYB 2VJBA 3H2JA 4IEIA 4WUTA 3HL0A 1KDZA 3T4PA 3HV0A 2FKNA 5FWDA 3OZXA 1E1MA 4U39A 2XUAA 1RI1A 2C3MA 3WWYA 2P6OA 2Q0QA 2DT5A 2Q3LA 4GC9A 4HF7A 3BJZA 3GYBA 4YAKA 1ZMOA 3T9BA 4DMFA 5MN6A 2WHPA 2YRXA 2W42A 1LZKA 2I8CA 4V0NA 5CR9A 1J8YF 2QLBA 2IXBA 2GBPA 3EVNA 1T1SA 1EVZA 3OZBA 4TXHA 4UEJA 4D9FA 1UJ4A 4INOA 2J48A 2ZDHA 3RADC 1LBSA 1TMGE 4DN6A 3H65A 5SY9A 4B8ZA 3ACCA 4JQCA 4QZVA 1USUA 3WK9A 4C7VA 1CUYA 1BMFD 1E6KA 2MMCA 4LZNA 4NH4A 1FP4A 2IYYA 3C6BA 3GDGA 3UKJA 3RSSA 1N5KA 2BMDA 1M2GA 5C7YA 4N0PA 1GKUB 1RMTA 1SWVA 3C14C 3NHBA 4HYYA 1OX4A 2WI8A 3UK6A 1NP6A 4ZEMA 1KEVA 3IPLA 4NBLA 4LSZA 1ICEA 3PEWA 3ESRA 1JNYA 2GZHA 3A6GA 4BATA 3WHPA 1QFMA 2WF5A 3DR3A 3O9MA 1BVRA 5CCBA 2WUWE 4H35A 4PGMA 4K8OA 1JR4A 1XRQA 2VSNA 3E7DA 4GPAA 3VSAA 1JFRA 2BTEA 2LGJA 3L0BA 3LWBA 5HQ3B 5C3MA 4J4HA 4UU1A 3MBOA 2VP0A 4M6WA 4EFKA 4ZEWA 1GPBA 1PJCA 3GJQA 2NV0A 4HPWA 4FMPA 2X5NA 3HDVA 3UYKA 3K72B 3ZJ4A 3V4LA 3LLCA 2ZT8A 4X8OA 5EXXA 2RHDA 5JO9A 1WW3A 3T3IA 3DFMA 4FX5A 1S2GA 3HN2A 1NR1A 7ADHA 2DHQA 3T7RA 3FYUA 5KWIA 4FTWA 1WUKS 5D2CA 4WY2A 2XXAB 4NNPA 1CYEA 2C4VA 2NZ8A 2GN4A 1C3OA 1S3FA 1U80A 4RZIA 1WKVA 2V8BA 5E2BA 1AGRA 3W06A 1QH0A 1RPTA 1P9WA 2CLIB 2QQ0A 4YT5A 3RCBA 1GZDA 5IH3A 4ZYWA 1T3SA 1VCMA 2GBFA 2N1BA 5AKEA 4W7IA 3NHKA 1QPZA 4G89A 4P1ZA 4A8JB 4MKGA 4RY2A 4QNRA 1YS4A 4TPKA 1T6YA 4R8RA 3E3NA 3UXEA 1S0UA 3GLUA 5I9SA 4L6IA 4BBJA 3FPAA 4R2HA 2QD1A 2PG3A 1F6BA 2Z2IA 1QIKA 3IUQA 5A7GA 4B71A 1ILWA 4MB2A 4YAFA 4ZZ2A 5JYEA 3P2MA 1KY2A 3AOGA 3C24A 3TRJA 1HG1A 2YV2A 4EYSA 4F8EA 3C6KA 3TPFA 5A02A 4OY3A 3GWZA 4DRYA 4IIBA 1WTCA 1EGVB 1E3QA 2QUAA 4LTNA 1M34E 1H6CA 2H8GA 3UGQA 1G9SA 1K8RA 1G20A 1DCKA 1GUDA 1QK3A 2Y0CA 3Q85A 5JCOC 4DBLC 3O8OB 1EFPA 4C1BA 4AT1A 3VYUB 2PUGA 4MWZA 3B9PA 3VHLB 1CS0B 3C6XA 1DC4A 1RTTA 1X87A 4C20A 2ETVA 3HXLA 1IZ9A 3A6ZA 1EA5A 4BZXA 2V7GA 3SBEA 4G26A 1QBGA 1OJ7A 1UAGA 3ZVLA 2XYPA 4BBAA 1L3BA 3NOXA 1GZHB 3AB7A 3JZFA 3EQ6A 2IYPA 4J03A 4CUKA 2C99A 4RYDA 1Q6YA 2FWIA 3U4HA 2NUAA 1EPUA 1UXGA 2OCYC 1OQAA 3GRRA 5A6VA 4CFYA 1GPLA 1XPJA 3MLEA 4QRHA 5IMBA 1W4BA 4OIFA 3RVJA 4KLZA 3T6KA 1YQDA 3V8MA 1JHOA 3R20A 4B0PA 3LQFA 4YS6A 1HK7A 3WGOA 1NZDA 4XB1A 4GVLA 1YVUA 1PG0A 1Z0FA 3RUAA 5I5EA 4OHKA 3FGPA 1UFVA 3CF4G 2XVZA 4JROA 4MZDA 1PT9A 1UQRA 2HPHA 3KHKA 4KK4A 4MCHA 3LQ2A 4OI4A 4WK4B 2HX1A 4F2GA 1JBKA 4NOKA 5EKXA 1W0KA 1EUDB 1IG0A 1MV5A 5CJ2A 3FF1A 1RAFA 4XCQA 2I2DA 4TVBA 4ND1A 1PR5A 1WU7A 1N5MA 4X54A 3L6RA 1L8OA 3HR7A 1NMZA 5DLYA 4C87A 1P1KA 4D41A 2YWBA 3QWIA 2HWKA 2QP3A 3HYTA 2PXHA 1QK5A 1SD2A 1EK1A 2OHJA 3KL2A 1T5BA 1CUGA 3RVBA 3WBKA 1BHSA 3HO8A 1RQLA 5ALKA 4B3FX 3DXFA 3O8BA 3WSTA 4CG1A 1XCBA 1M7HA 1XAJA 1YDHA 1D2HA 2I67A 5E3JA 3SYNA 2XE8A 2Y8EA 1ZXLA 1WDKA 1GDDA 1UIMA 2I87A 3DHWC 3N74A 4R2XA 2VI5A 4WQMA 2WDZA 3S1LA 3I52A 5A4FS 4JAVC 3ZWWA 5LBTA 1U3DA 2YRWA 3TI7A 4ZWNA 4B2LA 4WA7A 5A4DA 4Z8YA 2H2IA 2IIPA 4GP7A 2WPNA 5EWMB 1KPGA 2Q3CA 3UK1A 5BMOA 1KK1A 5GVRA 2IYUA 4XD7D 2ZI4A 1O5TA 3S6JA 2QL7A 2G8LA 3B5JA 2JGMA 1E9DA 3IPXA 4JA0A 5E95A 2XGJA 1YT5A 1CQJB 5KNBH 2RKBA 4BLUA 2XMDA 5MDHA 4NMWA 4GYWA 1UQTA 1PJ2A 1SKBA 1Z0UA 2A5YB 1FB5A 2HQOA 5DGDA 4BHTA 4DAOA 2QTFA 3K0AB 4AIIA 2IOYA 4LRXA 1CK4A 2I54A 4LYGA 5KNCD 4FHEA 2Y1OA 5K3DA 5DM70 2I29A 5J9FA 2YMLA 4IHQA 4QT4A 4W5OA 3E22B 4HX2A 3IODA 3PXXA 4DIDA 1PR3A 2OAEA 5AK6A 1R5JA 1XZBA 1GUZA 4B3MB 5PGMA 4PO9A 5AI9A 1SZPA 3JQ7A 2WTAA 3H1PA 1EVEA 2UAGA 4BB6A 5I45A 4PIPA 3T3PB 5C1PA 1B6GA 3KV1A 5CT5A 5F3RA 1QU3A 4R69A 2YXLA 1Z4JA 1YJQA 4GGPA 5EQFA 1XFAA 2GD2A 3AEQB 3S8EA 4UU8A 2ZCJA 1F8FA 3GFRA 4LOJA 4Q7QA 2O2HA 5F1PA 2P9HA 5K0ZA 1RHJA 4EI2A 4GP9A 4JJ8A 5NLLA 2I22A 1XZKA 3DKRA 4CDNA 5EEGA 2WTUA 1QB8A 4UUNA 5GZ1A 1ORHA 2HDOA 1OXSC 4RHFA 5F1KA 5G1NA 3RSOA 1CRZA 5L3ZA 2CNBA 4KXUA 1M66A 2QD4A 4LWOA 4GOLD 1DBVO 3F5SA 3F6SA 1JQEA 3GUZA 5DP2A 4C30A 1SM4A 4DA0A 1GEGA 4K81B 1GRQA 2P0EA 4JD5A 2J5RA 3IUNA 1E79A 3KYCB 4OIMA 4L73A 1UUFA 1P18A 1RJFA 1N6RA 2GBIA 2RJNA 3JAKA 4G4SP 1PSDA 4PG7A 2OMEA 4ZC1A 5KDOA 3DUFA 4HQNA 4NY1A 1E77A 1W25A 3KXKA 4BJ6A 4PC1A 1SCJA 2QRUA 4IIJA 4L8GA 1XEXB 1T5TA 2XE7A 3GRKA 3IIJA 4Q3LA 1KSGA 4MEJA 3LJKA 2QSJA 1C80A 5AM5A 1JZSA 4AX4A 4YRGA 4BQOA 1OX4B 1WMEA 3WZ2A 4HQLA 1E4EA 5DE3A 1R18A 4KB5A 4R9NA 3C6ZA 4F5DA 4H7IA 4ZAXA 4IMJB 5B4UA 1P5FA 4ZAYA 4EY7A 2GYYA 4JUBA 1KK0A 5FCDA 3HUUA 4MNTA 4N3AA 3K1AA 4CUJA 1T5HX 1MD9A 4DOMA 4EVSA 1C9EA 1NUUA 3FPFA 3GARA 1MJGA 4LZOA 4B7UA 2FR8A 1ML3A 1XTVA 4L75A 5AJYA 1T25A 1JFSA 2MSNA 3IMCA 4P5PA 4YUVA 5HR5A 2PIAA 2Q6OA 3PXEA 2DT8A 3MGKA 3U1TA 2WC1A 4LZLA 4ZCPA 2GBLC 4PLHA 5KCZA 3LT1A 5DCLA 4PFQA 2MR6A 1KS2A 1I1NA 5JI2E 1J9GA 3BH7A 2IS1A 5JC8A 1Z18A 1OZHA 3D4OA 1ODKA 2C2WA 3LSYA 3MF4A 3ZWCA 3BWCA 4XRGA 1PQYA 4WCFB 1GTSA 4RY9A 4XB6B 3O9ZA 3H5RA 4EY8A 2ZB2A 2OC4A 1MH9A 5F4ZA 3I45A 2XCIA 2H7VA 2QL9A 2QSUA 1GRRA 3E3AA 2QJWA 3JYHA 3WSVA 5DNUA 5HP4A 2Q3MA 5KIAA 1E1DA 1TIKA 4JLMA 4MQFB 4BN0A 2ZR0A 3WNBA 5C5DA 5KKCA 3V4ZA 1GN9A 3B3QA 2V6GA 3EQ7A 5H3LA 4FQ7A 2EDAA 3U39A 3VTAA 1LDEA 5CNIA 4IHJA 2YOHA 3NATA 5KOJA 2V03A 2XBLA 2E82A 2Q5HA 3LHDA 2QZ4A 1ULBA 1ISGA 1G291 5JMTA 5IM4A 3OOWA 2QR2A 4L95C 2P6PA 1D6JA 3E15A 2JLSA 3LNTA 4MKXA 1P72A 1W88A 2HNKA 1M76A 3ZZTA 3ORFA 4J76A 1QCZA 3D4LA 2C5HA 1YRQA 5LOVA 3BTVA 2ORVA 5CFRA 3VNSA 4BPBA 3AONB 4D3YA 3OJOA 3P5SA 4EUHA 4CT4B 5BUSA 2XUJA 1QTIA 2Z6VA 3B20A 1QH1B 3WLRA 3ZZ0A 4D02A 5KQRA 5BQ3A 5F12A 3BZUA 4MP8A 3TR0A 4CZ2A 4IV8A 1TF2A 3IURA 3D9QX 1E1YA 1F60A 4MUIA 1H2WA 4RA6B 4RPKA 4B3HA 1PGJA 3GLVA 1SKQA 4FP9A 3N5KA 5L51A 4KQIA 1P9LA 4D0RA 2QTMA 5E0KB 2XD9A 4G8CA 1LDYA 2OXFA 4ZVQA 3SQNA 4I5IA 4DQLA 5BWLA 2WIDA 3FXAA 4WGFA 3CLKA 5K6RA 2HDNB 3GLKA 2XMRA 1YZKA 1B0UA 2NIPA 3SLGA 5ICGA 3NWOA 1P2UA 2H1CA 4JV5B 2OHVA 5FOWA 4YMHA 2IYLD 9LDTA 4I8XA 2C2ZA 3B9BA 1QVRA 1WKBA 1R0SA 3CCBA 3JQ6A 5SZJA 3R9XA 4YCBA 2PT7A 3C3YA 1NXXA 2W83A 1EUCA 1P9OA 4IR7A 1Q1QA 3CRNA 4EOGA 3WQSB 2UYHA 1NXQA 1OBHA 2BI8A 1S9HA 2IIBA 4GWLA 2CF6A 5C8VA 5BV8A 1NYRA 3N59A 4PVDA 2HIGA 3AP2A 1R0BA 2OEPA 4EFMA 5E8JA 2YTZA 4ZVUA 3ZDXB 2ZQ5A 4KYTA 5DNDA 2NADA 4KHPB 3TGLA 2BGWA 3QLUA 1EFUA 3S2SA 2PGDA 4KNVA 2WFMA 4CG0A 4WKGA 4KWIA 1WVMA 1AQIA 4CMGA 4C7BA 5EJ5A 4RULA 1BKDR 1YCFA 3Q98A 4AMBA 1LPPA 5FPTA 1OUMA 3MAGA 2QLTA 3AUUA 3TQOA 3KL4A 3SHQA 1ISRA 3P9IA 5IKEA 3GCXA 1QQ7A 3H5AA 1P1FA 2HCTA 3QELA 2GWRA 1KI9A 5FWYA 2QTNA 1Z13A 1I24A 1UKEA 1LBIA 3LNCA 4PG8A 3DOFA 2W93A 1Z4NA 3SJAA 3VZDA 1JJFA 1XZGA 4FS3A 5IPFA 1HYEA 3KJXA 1DGQA 1H65A 2NSLA 1AKQA 3R41A 3GLFB 1DSSG 2IY8A 2G40A 4WLUA 4Y9TA 1ZAYA 2C2GA 4DSNA 3QYAA 1PK9A 2RAUA 2ZRKA 2Z98A 3IOEA 4I8IA 4NCNA 1Y34E 4INJA 4QHYA 5DYWA 4WBNB 5JDIC 5ENZA 4GPEA 1CE8A 3F1LA 3BBPA 5G4LA 2G1KA 5MGBA 1FTYA 1T8TA 4QRDA 3BICA 2DTDA 3JV7A 4DILA 1IULA 4OBWA 3LQQA 1W8IA 1NE7A 2QMEA 2QAJA 3VYSB 3CN7A 3JQQA 4WZAE 4D81A 4DJDC 3MINA 5NULA 4A73A 3U2QA 1Q84A 2G4CA 3TSOA 1VL6A 4J1TC 2YXPX 3Q7SA 1BROA 3D2CA 3E58A 1W36B 4M1QA 1U3VA 2VP3A 4C78A 2VHUA 3LYLA 3VUEA 1NT2A 1YIDA 3QKSB 5EXEA 3UH1A 4E51A 3BXZA 5LXTF 5TX7A 3UCEA 2AA3A 2MYPA 1H2RS 1I32A 2QLNA 3AR4A 3FYSA 4PFSA 2CHVA 4LOAA 1N25A 5IC4A 3JWEA 2ZJ4A 1K1EA 4WFQA 3IJRA 4ALKA 1CR1A 2A5FA 2J6BA 2Q3EA 4OL9A 2VNSA 1LSJA 2X2OA 3CR7A 4PZLA 5EIAA 2I9KA 4M7OA 1O94D 1TRKA 2OOSA 3DD1A 3G89A 4NBTA 4EKIA 3S2IA 2QNRA 3DOIA 3C43A 4F3KA 5LMUB 3GH3A 4ZIRB 3EEOA 2G5GX 3ESXA 4S05A 4DUZB 1ZR2A 2FZEA 1KVQA 1PYGA 2AD1A 1CD5A 4LDNA 3HXQA 4UPEA 2JJ2A 1R0WA 2VRBA 4X7BA 2XB2A 2H1HA 1P7PA 2IOHA 2OZPA 3ENKA 1XK6A 3KU4A 1THMA 4G8JA 2J9ZB 2WT8A 3LD9A 1QB7A 1YZVA 4AP9A 2II6A 1TCAA 5FADA 3QNUA 5U1PA 5IJ0A 1N8KA 1U04A 2R8PA 5J5AA 2C9YA 4F2HA 3DWEX 4NH0A 2R62A 2DWCA 3DPIA 3A4IA 4ARAA 5BSFA 4TQAA 4D4GA 1UBCA 1NMEA 2BJWA 5C53B 1NUSA 1BOOA 1E2BA 3HABA 2OZLB 1MVLA 3GHHA 1IUKA 1KFCB 1CU1A 3G88A 3PFNA 4FBLA 2BEVA 4PYMA 3MTAA 1JQ5A 2NM0A 2CFCA 4DZRA 4ICIA 2WZCA 4X5OA 3UMJA 2C78A 2YY5A 3IAM1 3GLHE 4LDPA 4L9SA 4AURA 2CYBA 2PJUA 4YMTA 4D4MA 1YQ9A 1FDOA 1QZXA 1VHQA 2QKYA 3W9SA 1WE2A 3ZWNA 3JVUA 3TNLA 1QQAA 2OUIA 1LLQA 2BTQA 3V2UA 2GKGA 4YRMA 3N87A 2EJWA 4KP7A 5D85A 4ZQFA 1Y5NA 3FNBA 1AQNA 1BG6A 2J0VA 2Z08A 2HK8A 1X1QA 3OQPA 1VHWA 3GEGA 3UJ9A 4CDRA 3IAUA 3QYPA 4BGEA 2IUEA 4TKZA 1YUNA 4EX6A 3ZVKA 2XCRB 3B36A 2QN8A 3ZX5A 4XTCS 1ZGAA 1K4KA 4W5HA 5AM3A 1YI1A 4ENVA 1HL7A 1Z2DA 3D1LA 1J23A 2BEJA 2BHLA 4FD2A 1M6VA 1JFFB 3NJ8A 3TAXA 4DBLE 1X7XB 1EZ1A 4KQJA 4KQEA 4N8SA 3G2JA 4OTZA 1OGYA 4L5CA 1MB2A 4F9TA 1ZUNB 3QQPA 1CVLA 3GYGA 4IBOA 2BY4A 2RGNC 3EWNA 5DI3A 2FN3A 2G0NA 2QUJA 3F8WA 3K16A 4JYAB 4Q4AB 3AUXA 1WCYA 2GS9A 2JBAA 2KHZA 2YHBA 2FSGA 4TLCA 2C1ZA 3NFYA 5JD6A 3NB0A 1LH0A 1XZ8A 2QTVA 5DIFA 2NZJA 3C3MA 2WNSA 4F3YA 3PP8A 1YR8A 4CMAA 2ARKA 3K0FA 3A04A 2VO1A 4IS3A 2GARA 1JQLB 3GA5A 4MYCA 1FUUA 2JEOA 5BOVA 1CT9A 2AEJA 4RKRA 5KWSA 3RYIB 2HIHA 1HZZA 4B5LA 2JFHA 1KWKA 4N12A 1QUFA 4LYJA 4BVGA 4DGSA 3TVDA 3ZHCA 4Y2GA 1MOQA 3L7BA 2I91A 1XMSA 4ZVSA 4CLEA 4DGQA 3E7WA 5HZGA 1EWKA 1TUEA 5FHRA 2I3GA 3IP9A 3ZDFA 2OBBA 4G5XA 4MQLA 4WE3A 3L77A 3NTRA 1Z63A 1T34A 2JIZA 3RKRA 5JW6A 3KR0A 1BN6A 2NVBA 3IUEA 4AG3A 1E2HA 1DKPA 3QG1A 1DRWA 4WBSA 3JALA 3WQHA 2JHGA 4JCCA 5ICSA 2I80A 1SAYA 2WWIA 4UQOA 4TSFD 2N9UA 5EVJA 1KQ3A 1D9ZA 4ZI7A 5JQGF 3QVGA 4JIMA 3MTBA 2F3TA 4MRSA 4PSAA 1PZGA 4N3NA 3WBFA 1I7DA 1K66A 3IQZA 1CF9A 4N54A 4PEVA 5E6RB 5FA6A 1T15A 3R3SA 3A9TA 5CFOA 1A1SA 1KE1A 5LOVB 2OP1A 3CW9A 3EIFA 3KQQA 3MJDA 4J1TA 4ROTA 4XR4A 4BMSA 3CRRA 4EO7A 1MORA 2E7ZA 1ISSA 3ABRB 3VU8A 1TMKA 3NM5A 2TMDA 4ILKA 3RLFA 3ZWBA 2AT1A 1X80B 1ACJA 3GJ5A 4MUGA 2ZE5A 2XCTB 5JFOA 2D3WA 2PL1A 4M21A 2EWVA 2RSLA 4RBNA 1ENZA 1M1YB 2PWAA 5GM2A 4D8XA 5ECDA 1U65A 4OFXA 4LJ6A 5BXYA 4RH0A 4JOCA 5HG0A 2YDXA 3E2IA 3GXBA 2G83A 3KPJA 3NHLA 1QG2A 2VHXA 2NP6A 2AR0A 4YV7A 2VVTA 4QD3A 1PF7E 1RYFA 3U16A 4BFZA 1PTKA 2X1MA 3FRJA 2CD9A 3NBKA 3PEVA 2XQFA 4HDKB 2PTGA 2YINC 1Z2AA 4E12A 4EKEA 1VBNA 1ZUWA 4Q1CA 2H5LA 2XT9A 1KU6A 3ANLA 2XA9A 1SXIA 3OX3A 5DSTA 4JJ7A 3BYZA 1Q44A 2C95A 1I4OA 5LBUA 1G3RA 2A3NA 2NWQA 2MJLA 2GJ9A 1Z3CA 3GP8A 3WNDA 3T9DA 4P8RA 5KJCA 1C30B 5AHRA 1BXKA 1IXRC 2ZYTX 4EUSA 1VHDA 4FT2A 4D26A 3WBJA 4OSEA 5TS2A 4G4IA 3ZCTA 3ADDA 4OGLA 1BW9A 1EEHA 2XT6A 1CPYA 2AFHA 2OHIA 4Y0AA 1HT2E 3QLEA 4P53A 4WGGA 5D7NA 4AZ0A 2IUTA 3ZLVA 4WNCA 4XCXA 1ENYA 1Y6ZA 4DNXA 5D3ZA 3BMQA 2VQDA 1AKNA 1C0LA 5DHFA 4BB9A 2C4KA 2Q2VA 2UUOA 1QF9A 2HU2A 2JGJA 1F14A 5AJUA 1SK8A 4HQRA 4LKRA 3F3MA 5G40A 3QKIA 4CM6A 5JZSA 1YE5A 3VOSA 2VSYA 2W4MA 3B12A 3HLKA 2V7WA 1TIPA 5BSRA 3AL2A 3RF7A 5ALVA 5BNTA 1FVXA 3QPWA 4FYHA 3ESBA 1N2XA 1U9CA 4H7JA 4D8VA 1L7EA 4QU9A 5B7GA 2CZQA 1UBKS 1EFPB 4F5YA 3W04A 3RVDA 3DMNA 3EZNA 3U4DA 1PFYA 1WX1A 5KS2A 2WM3A 4KGZA 3R3ZA 4LQLA 3ZTWA 4HQ6A 4CNQA 2L69A 5I5GA 4YRAA 2JD1A 3ANTA 5KJEA 3GK3A 2AC2A 4NU0A 1D1QA 1NTRA 3N2ZB 5E9QA 3QFHA 4DIUA 4RTOA 1JSZA 1JI0A 1CUBA 1NASA 1PZNA 2H17A 3GGPA 4GX5A 1TLTA 4WCVA 3C48A 3TOSA 5LL6P 5TPWA 3K6JA 4UULA 2PPLA 1GYQA 2UXDB 1QR2A 3H0CA 2RGXA 2VRNA 2PKYX 4JMPA 2CXNA 1AA9A 2INGX 1RJ9A 5FOVA 1LLFA 2HQRA 3ZKWB 3T5PA 2VDWA 4JGGA 3BD6A 2GQ0A 3HJUA 3ZZUA 1PRYA 4U63A 1CR4A 3HEBA 4CIVA 4PTZA 4KQ9A 4E5NA 2JANA 2GYUA 1P1JA 5C8XA 4MQUA 4QYTA 2Z1DA 1E4VA 1Z5OA 2EKQA 3GX1A 4MRMB 4DVJA 1Z7YA 3N2YA 1Z5NA 4UUQA 5E1MA 2P0YA 2OLEA 4C3ZA 4C2UA 2QUBA 3A31A 4JJ6A 2BEWB 5IK2A 3WAKA 1KP3A 3A06A 2VFAA 4GZ3A 2W58A 2DHDA 3OTOB 2RMKA 2AF3C 1IEXA 3FLAA 2PSEA 3CH5A 1UADA 3HCCA 5LC1A 2PWBA 5KPJA 2FDCA 1GP2A 4FFNA 5JEEA 1ZN9A 5EIBD 3VR6D 4HDNA 5JZVA 4GR9A 3H16A 1XRPA 4MKRA 1YDEA 3DBRA 3EGXA 5B1DA 5HFJA 3VR6H 4TQGA 4CM4B 2FV8A 1ISMA 4O4JF 5EOVA 4US2R 1M1ZA 4H6XA 2XWSA 2XXJA 3QXCA 4NQRA 3ZWDA 4DCOA 1TLLA 3K5HA 4M8LA 4DDMA 3VYTB 4L0DA 4QTXA 1J7JA 4JFAA 2G1PA 3JD0A 2A1IA 4OVKA 1BMFA 5BSEA 1Q7BA 3PQCA 5EXTA 2VNJA 5CVVA 1QIEA 2CDCA 3G0HA 1U7DA 2XZOA 2R3SA 2X5JO 5IZCA 5KTKA 3IB3A 5DHUA 3GRUA 1KQPA 3AERB 1JQBA 2O7QA 1S3IA 3RUCA 1ZNQO 3T5TA 1E6LA 4G5OA 4DUGD 1Z38A 3KAPA 1OXKB 4F4HA 1BEUB 4FB4A 2Q5OA 1D7OA 4BJ1A 4WN9A 4K6CA 5F2OA 2PS1A 1NF3A 4LRYA 3A9RA 4UHFA 5BQOA 1HYHA 4KRXA 2KWIA 4M7PA 4OXIA 2JB9A 4QQKA 4CHGA 4P3YA 2VPPA 2JLAA 3T38A 4YO7A 2CXHA 4NJMA 1F8UA 1V9SA 3HO6A 1XHFA 3S8MA 4UM9B 1RJ9B 4N1AA 1PV1A 3AR2A 1XLVA 1V11B 3RFXA 3HSKA 5ALHA 3QEAZ 1BZYA 5AW8A 2Q5FA 4C4OA 3DOCA 4JJZA 3AV0B 1E99A 3IDZA 4RK6A 3LT5A 5SZKB 2VYCA 3RAFC 4LC0A 3TIFA 4QEDA 4MLCA 1RJWA 3EARA 4JI0B 2GHQA 4GOJA 4H1VA 5IT5A 2GXQA 3P9CA 5LP6B 1LXCA 2X0KA 4QNMA 1UPUA 4UCWA 5JYDA 3I2KA 4HGOA 4XFDA 4CTJA 1P4SA 2EBWA 4Q3AA 2JGKA 4A23A 1KWGA 3P27A 2OKCA 3G2HA 4M55A 4EHFA 4HNRA 1LSOA 2OO5C 3ZHOA 1QJCA 1CUCA 5AKYA 2IWHA 3F7OA 1WDWB 1WZIA 1J8FA 4W8HA 2CYAA 2DY0A 4TYWA 3P0RA 1QP7A 4JQYA 3C5WP 2BBOA 3AI1A 1ABEA 2YZ7A 3WKCA 3LC2O 4LXXA 2H00A 2J09A 1Z0AA 3ZIUA 3FNIA 3GNTA 4KVZA 2J67A 1IN8A 1B1CA 4LRSB 1ODIA 1Z0SA 4BMYA 3CONA 2C3PA 4PZYA 3HKEB 1XDGA 3JZMA 3LL7A 3RRYA 4YHHB 4M9SA 2DQSA 3WQBA 5HIKA 3WRXC 2X14A 1GADO 4NEQA 1V71A 3PGA1 1QV9A 2O2ZA 4R1LA 1CRPA 3KZVA 5D3MB 1HTTA 1S3SA 4J0KA 5FPSA 3S99A 1HE8B 1NY5A 3CM0A 3RFUA 1X7YA 3LC1O 1PEAA 3OX4A 2YFKA 1GRVA 5BURA 1EQAA 4Q16A 1GCGA 5DGHA 1BWPA 3AV3A 3B6KA 1AU9A 1U5AA 4FDTA 3JWJA 4CKEA 4LGYA 4CIXA 4ER3A 5ALLA 5K03A 1ZVVA 2PZBA 3K09C 1DVRA 3DULA 5G02A 2NU8A 4IIUA 1E1RD 8ADHA 3HRIA 2D62A 2GUGA 5AVVA 1E6EA 4FSDA 1E3EA 1GWNA 1VMKA 5I3ZA 2OAGA 1Y1RA 4KI7A 4TSRA 5DX1A 2ZUSA 2WV9A 3TIIA 3HA5A 1FFXA 1BA3A 2WJ6A 4PHFA 1ZL2A 1E7MA 3BRCA 1H9AA 3GJ4A 4NNJA 1EB8A 4O0MA 5DN6D 3BD9A 1BGXT 3BMCB 3C5CA 5B1SA 3LDUA 4KMRA 5LUAA 1YRAA 2R00C 2XOKA 1NSFA 3W8RA 2FTKE 2VXCA 2GM3A 2B25A 3H2GA 4AL4A 2H31A 2GVZC 4OHMA 4B35A 4BNZA 2FQQA 2JVJA 1I6MA 1XVIA 2X9QA 4J0EA 4A2QA 3PQ5A 4F4JA 2ZRJA 3NCHA 4Z1OA 3UC5A 1LPOA 3SNKA 4RVOA 4KRGA 3FETA 1D4OA 2VHQA 4U5XA 2BHRA 3ZHBA 4D0SA 1P2GA 4ALMA 2AXNA 4BMVA 1TYBE 3LFTA 3E9RA 2IH2A 5JS8A 2HA0A 1ZW1A 4H59A 5FBWB 5CG2A 1Z5UA 1D6NA 1EFTA 4PAWA 1ADFA 5DV9A 1VG1A 3SJZA 4L5JA 4HO1X 3DHEA 2P1RA 2L82A 3P5BA 3JX9A 1XV5A 4OXRA 4W99A 3OBBA 4XLTA 2C84A 5KNCA 1JFTA 2QROA 4MROA 4ENSA 3V8NA 2W48A 1E3IA 1DBPA 4IRMA 1Y8RB 4RHCA 2ZS8A 1GCOA 2XV1A 1V41E 2R8OA 3VO8A 2Q5LA 3DE0X 2VR1A 4YMSA 1TIBA 2IXTA 5LWHA 1WV0A 4WOPA 1E3WA 5MFZA 2I6UA 3ITNA 4MMYB 2I6FA 3LFUA 4OKIA 2RGCA 3BL6A 4JBXA 5C7LO 1RNLA 3WO1A 3WRYA 5JUWA 1J20A 3QY9A 4EUEA 2HTEA 4Y6GB 5DLQC 3GOQA 2W2OA 1IB6A 2AMFA 1G1AA 4WV3A 4OKNA 4Q1AA 4YJGB 5BSTA 3QA9A 3B1FA 1QHEA 2O4UX 2OB1A 4HFRA 4ZODA 2IYAA 2NN3C 3GNLA 3FBWA 1SB8A 4HAYA 3SCZA 4OG2A 5EHZA 5C9ZA 1GUBA 1QVVA 1B43A 1J07A 1IEWA 1D4ZA 3AIIA 3AHHA 4KXYA 1XPRA 1R1DA 4PXYA 1LRKA 3DVLA 3NX4A 3PUYA 5ALIA 1WZEA 3VPDA 3QKTA 1CBUA 5CX1B 3H1GA 2XOEA 4D9KA 5JARA 4DKJA 2YR0A 1UOPA 5DWDA 3UUGA 3KJZA 2OILA 3B1XA 1IUOA 4EF5A 3GLGA 3QEKA 1E0KA 3PUWA 5FHQA 4QULA 5H1YA 1I4DD 2G0TA 2P91A 1EIWA 4YA6A 3G5UA 4CT5A 4RDHA 4O4JB 3VPAA 1GTVA 4IVNA 4LS3A 1SVNA 2P68A 4LV6A 2NU9B 3VDNB 4G0WA 2ANBA 2PSHA 2ZYHA 1SUBA 3FPHA 3C3PA 5MHTA 3PWZA 3VBEA 4LF9B 4OHFA 3KE9A 2WHEA 4JB0A 2CV1A 1L2TA 4ZVMA 1DOHA 2XF8A 4DMCA 4XYGA 5ERYA 5HE9A 2ECPA 3PXGA 3IDSA 5IFKA 1U0JA 3P4YA 3RK0A 1RRVA 4JKOA 2OQIA 3CNHA 4CKCA 3QW4B 3HJBA 4OUKX 4P98A 1US8B 2MHCA 3PD0A 4KTVE 3WYAA 1L4HA 1JEOA 4B6QA 1MX3A 1XEFA 3I09A 2WMDA 1Z15A 2C9CA 4P9NA 4RGQA 1PFUA 4BO4A 4EQZA 1HSZA 1XYYA 4JYCA 3RSFA 1AV7A 1TVCA 1NFRA 3D0RA 4X00A 4HB3A 2EFHB 5FWAA 1N5DA 2HMWA 4PHCA 3PX7A 1X9GA 5BT9A 1E62A 4ZCMA 2BDUA 3EVCA 3A6HA 1ZM3A 4XASA 1GNVA 2H9AA 4D57A 4FK8A 4FC7A 5BMVA 1XAIA 4WWHA 4YMLA 1SQFA 1IPHA 3CLHA 4TV9F 1S2MA 4TVSA 3G2IA 3CUEF 1ZRHA 1AXRA 1E92A 2HBQA 1ZK0A 2OAP1 3A26A 2GPAA 5EJ2A 3TL6A 3TW0A 1B74A 2BE7A 4DANA 4H7KA 3C7CB 3EAQA 3E1KA 1F2DA 1MMFB 2JAXA 4X6XA 2W98A 3QV2A 1MDBA 4IWNA 3U13A 2O8BA 2FR8C 1KE2A 1ZK1A 3TJMA 1BS2A 4ALJA 3TE6A 1AIPA 1K7FB 2Q3HA 2Z5FA 1YOVA 3OD5A 3T7CA 2ZJFA 2IKQA 4GFDA 3PF9A 1G9TA 2QMUA 3VR3A 2DGDA 4G1VA 1H2EA 4KFUA 5ALNA 3ZE6A 3TQRA 1L7VC 2XADA 2YXBA 4BLVA 1ADJA 1XJ5A 1L0BA 5A6SA 2ECQA 3ZHUA 2MCFA 3FMIA 1G7SA 3LCVB 2D8MA 3KJGA 3ZIAD 4BEWA 3NYIA 4KEAA 3UAGA 1AG9A 2C5SA 2NACA 2V6MA 3K9NA 4Q9IA 2BRUA 1PNOA 1EVKA 2OCXA 3C3JA 3CF0A 2LDXA 4QUEA 3WYEA 2OO3A 5JD4A 3FTQA 3QVMA 4YR9A 2A7XA 5BSWA 3QM1A 4PINA 4F4DA 4F8YA 3HJGA 2OGWA 1DFHA 1NQWA 4DTIA 3CO5A 5LP1A 5IM5A 1MRNA 5HILA 1TU4A 5FUQA 5HKKD 1KO4A 1MABA 1J6UA 1L6IA 2I0FA 2NU6A 2P9FA 2F1RA 3ENNA 3EVFA 3FDJA 2UZ3A 5AYVA 4XWAA 5HDBB 1LBTA 3PNQA 3SX4A 3OOSA 1GQRA 4LZZA 1OI2A 2WMNB 3H6HA 3KQYA 2GFIA 2OLJA 3FR8A 3QEJA 3QYFA 1BGWA 1HNZB 1G41A 2WWXA 3QU2A 4MR8B 1E3LA 4AULA 4DQDA 1ID8A 1C7JA 5CXUA 2TMYA 4Z0PA 4XSHA 2WIJA 2ZCUA 3A1UA 4XWGA 2A9FA 2PT9A 2RGYA 3DYBA 3GCZA 4PAMA 5CM8B 3UT5A 1ISJA 1UBHS 3OZUA 3Q41A 1XUOA 3D7SA 1LVUA 3PT5A 4E5SA 2QR5A 5AVWA 3PL1A 1U2GA 1A27A 5C7OO 4KFRA 2CMKA 5H3CA 2YNMC 2MYUA 2QXUA 5D51S 5GMOA 2UZ0A 1FRVA 5D84A 3DTNA 2HKIA 2YH2A 1WHSA 2FR0A 1M2FA 2A4KA 2Q21A 3PXDA 2VHYA 3QBTA 4UD6A 4YDRA 1WV1A 4B32A 1AZTA 5B2EA 4M46A 5U9CA 2XYGA 4Z2AA 1ENPA 1RM0A 3W90A 4P4SB 4A82A 3QKUA 4FFBA 3WGKA 2FEKA 4JJAA 3MYRA 4PO1A 1UFOA 3CX8A 3AVWA 3TKYA 4JJ4A 4MICA 4J0QA 2R65A 3VJMA 4RANA 1A9OA 1ZVJA 1SKUA 1U2TA 4QUBA 3Q5GA 4AWXA 4BVFA 5JQGB 2O5VA 2R8EA 3FPKA 3RTGA 4UEWA 5KPDA 1L1QA 3N75A 4AJOA 5JIBA 4LZPA 2YZKA 1GILA 3MXTA 3DZKA 1RPJA 1U8TA 2OAQ1 4CMIA 4GPIB 4XJSA 3RC9A 3ZE1B 3UTDA 3K71B 1XEWY 2JVIA 2OUKA 5JS6A 3LCJA 4MS1A 4GICA 2JZOA 4BFVA 1XGKA 4BNHA 4EGQA 1VSTA 5LPNA 3FVVA 4B79A 3IT3A 1ODCA 4CEJA 5AW5A 3VTZA 4EJ6A 4MYDA 3CJTA 2YWDA 3ZHXA 3H8SA 4F3NA 4KQ1A 3PUIA 4R7GA 1WXIA 2EFDB 3N5CA 2Y4OA 2IPAB 4LBZA 1RKUA 2FSHA 5C7IO 4FOOA 4Q9AA 5U4XA 1Y4SA 5B30A 2XECA 1Y9JA 2ID7A 3QF4B 4KIGA 4MX8A 4TT3A 4F4FA 1E6CA 1ELOA 5KTSA 4XPIA 2Q27A 2MDTA 2HA2A 1W29A 2Y1FA 3WIOA 5ARBA 4MJ7A 3LPNA 5FT9A 2VAXA 1L5WA 5HK8A 4QJ3A 2GZDA 2RHOA 3AR6A 5T8KA 2HMVA 4X91A 5ARDA 1Y81A 3TBHA 3FPBA 1UZUA 1Q21A 4EDFA 4EHAA 5J4KA 4DJEC 4EL5A 4KKVA 1TW3A 2ZTUA 4WADA 4HDMA 5CVJA 2C2YA 4QGHA 5FOXA 3OEHA 1LPSA 4I46A 1GQYA 4HNTA 1R0RE 2GPNA 4R54A 5K4GA 1OSNA 5JS2A 5H7XA 3C7KA 1RFLA 1E5XA 3CZPA 1NY6A 2JEYA 2YBDA 4Q47A 1O95D 2EQBA 4WD3A 2JIDA 4M88A 3OHPA 5IKOA 3OCCA 4EG5A 1HDOA 1I5EA 2PGXA 2BFEA 5CYOA 1I01A 1TJ5A 5AWFC 1UC5B 5BSMA 4F2DA 3S27A 1EMDA 1R9GA 5CAEB 1Y8AA 3T95A 2WWYA 3II6X 1U9IC 4R98A 2HYDA 2QAGC 4FGZA 4YONB 3SPXA 3U49A 4BFYA 3TDMA 3Q8LA 5HZHA 3H2BA 4AO6A 2OCPA 2O8FB 1M75A 1XDUA 4I55B 3TX2A 3ILXA 5AW4A 2HL6A 3IDOA 4RGVA 4TSKA 3SDSA 4CN8A 1NVEA 4NBUA 2XVMA 1E1NA 4YRZA 1DELA 5CDFE 3T99A 1YZYA 2R11A 2GZ2A 3GBVA 4MQ4A 4V1CA 2VZ8A 1TYZA 2PVCA 3DTTA 3BJMA 5GZ6A 1AQLA 1GDTA 1SBCA 4QBIA 5AHOA 1II0A 2ZJ3A 1LJUA 4ECEA 2H2GA 4DS3A 4GX0A 2P3OA 2OXTA 2OPHA 3TW8B 2PKEA 2PUHA 2H29A 3A4TA 5DWVA 1Z56C 2ODPA 1DJQA 4YCAA 5EY5B 1SG0A 3ES9A 1GRCA 2WJGA 4XUDA 3RAJA 4MINA 1JR3E 3KPWA 4G36A 3E70C 2UZIR 2G9ZA 3OPQA 2AFRA 1F06A 1V1MB 4FEGA 1OPRA 2OBMA 4M83A 1C7IA 1TKCA 3RU3A 4EF6A 1TTQB 1U4NA 4G4SO 4LJLA 1ECJA 5FKJA 1MG0A 1EVJA 1M33A 4IIDA 4KIUA 5JDCC 2J0SA 4RACA 2XYVA 1XEWX 2PLNA 4N9WA 4WKCA 3OTWA 2WMYA 1O94C 1VLJA 3OZEA 5C52B 4R8LA 3PLRA 4OB6A 3WRVA 2EU8A 4ZHSA 1B93A 1U0HC 2QVCA 3F6YA 5GV7A 3VR3D 2VAVA 1X19A 1L5OA 1U8EA 1NVKA 2QG4A 1GY8A 3AJ9A 4FN4A 4GPBA 3T7SA 5AD1A 3VC7A 1G20E 5CRIA 3VC3A 4CM3A 5B3LA 1HMPA 2CCJA 3BGDA 5C8YA 3THRA 1RYBA 1SC1A 2G5TA 4HLDA 4BCCA 2JDID 4CFSA 2X1LA 1PG5A 4S1OA 1SU7A 3ZDYB 2HQ1A 4B0OA 1ORTA 3VTKA 3VSDA 1ISHA 2EX0A 3UG7A 1T1GA 5HEKA 3LHSA 4JXJA 3DXZA 3ZWOA 5K3EA 4EP1A 1NQAO 5KHLB 1KEEA 4JS0A 2FPOA 2GHTA 4BBPA 2C0CA 5KYGA 5AUOB 3A6LA 3EXIA 2QRVB 4LIPD 2O59A 4OSOA 4QDKA 1QX3A 5JCPA 1K8QA 4BNDB 3AM3A 1K0UA 2XHZA 1Q0RA 4Y9UA 1RU3A 1HTBA 3HCWA 3AKCA 3KFLA 4HAZA 1OXMA 5EPUA 4R2IA 1WW8A 5T6BA 4D8YA 13PKA 2FJPA 5LCXA 4N5HX 2O8VA 1RCTE 1JI3A 2HQSA 4YFYA 4DYVA 1IM2A 1TVKA 1WZCA 2A0FA 4EJSA 4G09A 2Y6VA 1LU9A 4JL5A 1PEDA 3HM9A 1OB5A 4PGGA 4TTAA 4AUKA 2W2LA 4FBMA 2HEIA 2O14A 1N77A 1RM5A 4AIRA 2IYTA 3IVAA 4LWPA 3KBOA 2C7PA 4JOQA 2FPXA 1TM1E 5HFAA 1N75A 1IONA 2I76A 4O29A 2CSUA 5EUCA 1B8NA 1X0VA 2WWVD 3V32A 1PBTA 1TW2A 2G7ZA 4Q1EA 4E7PA 4YUYA 1X3LA 5KX5B 3ZU5A 4HATA 3ZHVA 2XB8A 1BHQ1 3LHFA 4H4EA 4E6PA 3FCXA 1CUDA 2FUG6 4A0SA 2WLTA 2WW8A 4JBYA 2REQB 3UWPA 3VR0A 3GUUA 3IP8A 2PRSA 4EG4A 1LS6A 3TNJA 5A03A 2BP7A 4GRIA 3W4JA 2A88A 1VSVA 4ITRC 4TS9A 1FYWA 1OYWA 1T0PA 4LY6A 2Q5IA 4INZA