1ZD1A

Human sulfortransferase sult4a1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
272
structure length
251
Chain Sequence
GEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase 4A1
publication title Structural and chemical profiling of the human cytosolic sulfotransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 251
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.8.2.-:
pdb deposition date 2005-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zd1A00
1NMXA 2YC2C 1S9HA 2ZR0A 2GCOB 2F55A 5EE0A 4QG7A 1Z6TA 2GF0A 3GLHE 3OHMA 1JQJC 1II8B 3MRSA 4DT1B 1UF9A 5JWRA 1E9AA 4I99A 2ZJBA 5TVKA 4Q4LA 4Q9JA 4LYHA 5FI0B 2C2HA 3H2YA 1UM8A 2OUKA 1OH6A 3NBXX 4QJ3A 4NCNA 1Z2CA 4ZV4A 1ZJ6A 4IOKA 1P75A 2J87A 1XTKA 2QEQA 2R8RA 4JLPA 4JZKA 2CCJA 2W2VA 4LRWA 2XOKD 2VA8A 3K09A 4P31A 4D4MA 1TQ6A 1G3IA 4URUR 3SHFA 1C1YA 3GLGA 4JJZA 4E5UA 1CTQA 5HZKA 2GCNA 2VP2A 4AG5A 2V7QD 1CR1A 4QFMA 5FFMA 4OJQA 3OFND 3I3SR 3J81k 1P60A 3HU1A 2KB0A 4EQ6B 1P4SA 2NQ2C 1J90A 1GDDA 1E69A 2QROA 2R6GA 3UIEA 4EUNA 1KAGA 1SXJB 3AVQA 4C0BA 4TYYA 1IN6A 3CWQA 5JWHA 1S8FA 4WAUA 3DM5A 1Z07A 3G5UA 3DOEA 2EFEB 2GZDA 3WMGA 1XD8A 1XNJA 2FPLA 4QBHA 3ZS9A 1L8QA 4XWOA 1CJTC 4QGGA 2QN6A 5CDFA 2HT1A 1RZ3A 1TF7A 1RRFA 2JASA 2FV8A 1LF5A 2RMKA 5SZKB 1R8QA 4ZCLA 4AWXA 2FU5C 3T1TA 1A4RA 4PXAA 3VR6A 5E3HA 5L3SA 1J99A 3H86A 5JECA 1W0KA 5FOUA 1ZNXA 4W5JA 4Q1FA 4CVNA 5DIFA 1QRAA 3K8YA 2HJVA 2F6RA 2RH5A 1P62B 1XX6A 2V8OA 1CJUC 3QXXA 1NLZA 3BBPA 4HLUC 2ZSAA 4YLGA 1Z22A 4NH0A 3SEAA 1XZPA 4ERNA 2D06A 1S3SA 2AKYA 5CIWA 1ZUHA 4U02A 2WKRA 4B35A 5DYIA 3V00A 1T9HA 1E1QD 3EIEA 4RVCA 3OE7A 3K9LA 3D31A 3MSXA 2IF0A 3LRPA 4C30A 1TNDA 1G6HA 2ZRPA 1XCGB 1VYUA 3I8XA 3ZJYA 3A1TA 1JB1A 1TQ2A 4TYQA 1SVIA 2O0JA 1ZC3A 4W7SA 1U98A 4TN1A 1YQTA 2VHJA 3GLGB 3K0SA 1E2QA 4MGZR 3U3OA 3E2IA 1FW6A 5JSZB 3RSOA 3BH0A 3SE0A 1Q3TA 1N6KA 3AGQA 4HB2A 3RC8A 1J8MF 2A2ZA 3FE2A 3K9GA 3LV8A 3BH6A 3UMSA 4DJTA 3VTKA 3ZZ0A 1NL3A 4DLTA 1T0HB 3KXIA 4G5SA 1W5TA 4U7DA 1DVRA 2J0SA 4GPTA 1MR3F 2FE4A 1XJCA 4IXNA 4W5HA 1ZCBA 4QKQA 5BN4A 4O2RA 1FUKA 1FQKA 2MSCB 4QL3A 5A5GA 5EXXA 3UK6A 4HAWA 2NG1A 3OIUA 1Q3HA 4KFSA 2VRWA 4BFUA 4V0LA 1E6CA 1XB2A 4LC1A 3VMFA 4IXMA 4R9UC 1K6MA 5L3SB 1JXMA 2VH5R 3DL0A 2EFCB 3FMIA 4HSEA 221PA 2J59A 5AJZA 3FMOB 4F7WA 1NVXQ 5EP2A 4YMUA 4DCTA 1R0XA 2Z4RA 2PBRA 1Q12A 3KQLA 3CX7A 4Q4JA 1JJVA 4LV5B 1NSFA 3BFXA 4LYJA 4RZ2A 2FNAA 3RSLA 2JLXA 3AB3A 5D3MA 2G0NA 4AYWA 3I61A 4LV8B 3FGNA 1ZYUA 1CRPA 4OQLA 3VR2A 3I92A 3B6EA 3BJIC 4OKSA 1F2TB 3KB2A 3VQTA 1S1CA 2ZR7A 2Z0MA 2P0EA 5KOYA 2P2LA 1N5JA 1R4AA 1G3MA 1H65A 2DBYA 3CBQA 5HE8A 1W36D 4Q21A 4MYTA 5JHHB 3C5HA 4BLOA 3B1VA 2C8VA 4IVQA 2F1RA 4JSTA 3I32A 1FP6A 4JLMA 4MRRA 4XH9B 3D8BA 4FCVA 4MYCA 3CW2A 3WBJA 3O8BA 1OXVA 3UXMA 3AKEA 5IRCD 2CL7X 2IYUA 2BCGY 1NIPA 3CZQA 3CF2A 1CR4A 1QG4A 3B8HA 1MO3A 4TTRA 1F2UB 5BYJA 1IY0A 4Q01A 5HZHA 4M0LA 3UANA 3C5CA 1JQLB 1CLUA 1JR3A 2OFOA 1QHHA 2ERYA 5L3QA 5DNYB 2WWXA 3KJHA 2RGNC 4EKDA 1SULA 3W90A 2CCGA 4YQFA 2ZYTX 5GJCA 4JMPA 4JKIA 4NZYA 3TSZA 3TKLA 2GDJA 2GVZC 3A4NA 1EWRA 1GUAA 3FHOA 1EX6A 3Q5DA 2ODNA 4BECA 4EPVA 2GXQA 3GP8A 1HE8B 5FTNA 4BEJA 1ELOA 1SKYE 1Z8FA 3GJ6A 3CNNA 5J47A 2P5TB 1GKIA 3AP1A 4KO8A 1W4RA 5CLLA 1QG2A 5F2EA 2RGEA 1HT1E 1W5SA 2XNSA 2O0KA 2WTUA 2GWHA 1O87A 2VL7A 2OCAA 1N2CE 4MKFA 1VIAA 3P4YA 5BQ5A 3CR8A 3MD0A 4JJKA 1EFCA 2BM1A 3QPUA 3PIRA 5FOVA 4BLRA 1E0JA 4PO1A 4IVPA 3DKVA 2R44A 2AD5A 1Q1ZA 1BS1A 2P3SA 4LBZA 2AR7A 4YDHB 3AM1A 1S1MA 2ZE7A 3KJGA 2GESA 3NVAA 4KVGA 3PG5A 1DE0A 2CHVA 1E1RA 3NBZC 1A1VA 1Q0UA 5AUNB 2YINC 4CEJA 1P2VA 3OEHA 4HZUA 3ZH9B 1PVOA 1KI2A 1G7RA 3SJBA 4GSYA 4ZPXA 4A1FA 4ZDJA 5KDDA 2DB3A 2XTZA 2OE2A 4LI0A 3DEFA 4V03A 2QM7A 4A2WA 3VR4A 4HAUA 4PHHA 2WMOB 2H5EA 1ESNA 4P4TA 3RRYA 4TLAA 5CYOA 2CNWD 5JRJA 2GEVA 4NCHA 4Q7JB 1N3BA 2ATVA 5L3QB 1QHHB 3U7GA 4Z1MD 3KKMA 2CEAA 5LPNA 5FOSA 2X77A 3UWOA 3LD9A 4UXIA 2F43A 1SHKA 2XAUA 3OAAD 3UMFA 2NO9A 5K8TA 2CXXA 3IQWA 1GNQA 1ANKA 2O0HA 4BASA 5AUPB 1GILA 2ZRBA 1COWA 1X1RA 4GZMA 4KJZA 4A92A 4BZXA 4BZPA 2ZPTX 4JLOA 1NVWQ 2VHUA 1K5DA 1EFRA 4XSHA 1G6OA 3NH6A 4GFDA 1G1MA 3NHAA 5DN6A 2A5FA 2P6NA 5JS8A 3JZAA 3VU9A 3U4QA 4F38A 4TQ9A 1XRJA 4PPNA 3HWSA 2ZYVX 3ADKA 1X8KA 4L16A 5B57C 5KNBA 2ZM5A 2JJ8A 1TEXA 4G5OA 1G7TA 1NN3A 5H1YA 2OCPA 2XX3A 3HYTA 1KJYA 1HURA 4E07A 3DO6A 621PA 2YWFA 1QHXA 4PSVA 2V55B 3RAPR 5FR1A 4TZ0A 3EIQA 2F9LA 1DAFA 1TMKA 3FKSA 4CEJB 1E0SA 1OIVA 1MKYA 4CEIA 4ZIRA 2AK3A 4GP6A 4QNRA 2ZREA 2WWGA 4MUAA 1QVAA 3A1SA 2GBLC 1OFUX 3ZVMA 4PHGA 1DTSA 4I1VA 3Q7PA 2P6UA 1QHYA 1UADA 5FPSA 4MITA 3FKQA 1JBKA 1DPFA 3IEUA 1KMQA 3WBKA 4BFYA 1J2JA 2ZU0C 4A0HA 1MABA 2QY9A 1NJFA 3KKNA 3QBVA 2RGGA 3SHWA 2IYZA 3CX6A 1Z29A 1GG2A 1YRBA 1E32A 2VO1A 1Q1BA 2ONKA 4C0KA 3U3MA 2ZRHA 4N3NA 1PUIA 4P0TA 2XZPA 4DLXA 5H8WA 2V9PA 4JYCA 4O25A 4JIMA 3QKTA 1DOAA 4HI0E 4D2IA 2BKUA 1U0JA 4LPKA 5E7JA 2UZIR 4FMDB 2A5YB 5IF9A 5LB4A 3GJXC 2ZJAA 2JGNA 2OBMA 2GZHA 3QKUA 4QHYA 2ZS7A 1I4DD 3N2IA 3THWA 1WXQA 3I8SA 5H68A 5JJIA 3CRQA 3U4QB 3BS4A 2R65A 4MGYR 4B76A 4HLQB 4C0SA 2GETA 4CEHA 3MWKA 4MKIA 2ZI9A 2RKOA 3MWJA 3REFA 1E9FA 4LJ6A 1XTRA 2J46A 5C1BA 2H17A 5CIQA 3MFYA 1IAQA 2QQEA 3GQBA 4ZDIA 3VKHA 2ZAMA 3GD7A 1OFHA 3LWNA 3QPWA 3TAHA 4TSFD 5ELXA 1XXHE 2FSGA 1GZSA 3VKWA 1N6RA 3PUXA 1UKVY 2IYSA 2YOFA 4CZ2A 2N42A 2Q6TA 4JT2A 3T1VA 1XU4A 1OW3B 3QENA 4DUGD 1NMYA 1YZKA 2C96A 2FWRA 2V3CC 1ZNZA 4IDOA 1KZ7B 5J5CA 3NH9A 3KQKA 2GJSA 1XPRA 2Q0HA 4M22A 3RC3A 2O8EB 2YWHA 5JI3E 1MABB 1VG9B 3EC1A 2KE5A 4OL0A 4Q19A 3WNDA 1MRNA 1BO6A 2WWHA 3O8RA 2OESA 3K09C 1CU1A 1T4GA 5CJ2A 4R98A 2OV2A 3ZQ6A 2P6RA 2YWEA 2RGNA 4MRNA 1MT0A 3T06B 3IUYA 1N6HA 1NLFA 4XD7D 3U6KA 1KJZA 1CIPA 1NIJA 4LHYA 4Q7MB 3I1FA 4DIEA 4GDFA 3HPQA 3GEEA 2O5VA 2ZUDA 1SZPA 2VP9A 4OHXA 1LW7A 1P3JA 2H7VA 4OQXA 4U00A 1GRNA 4QBFA 4BFVA 1ZM4A 5JJLA 2XNDD 2YOGA 5DSZA 1VIYA 3WRXC 1UFQA 1ZUNB 4ZI3A 3THWB 4MDEA 1CJMA 2OZEA 1OH8A 4BFSA 3SYKA 1G5RA 4M1YA 3C4JA 1FL9A 2CJWB 4EPTA 3B9QA 2FZLA 1JAHA 3CO5A 5CLQA 4MH0R 2ATXA 1EFUA 1LTQA 2W83A 2HCJB 3IQXA 5FTKA 2IC5A 3KJEA 4RFSA 2FFBA 2ZITA 3TVTA 3B85A 1H8HA 2HT6A 4FD2A 3LQRA 2VLIA 4EPRA 1E2IA 4II7A 2ZS9A 3BH7A 5FI1B 5JRZA 4P3YA 2Z43A 2E1RA 4WZ6A 1TX4B 1NN1A 2UZ3A 4MKHA 5KHOC 3IIMA 1QZXA 3I62A 2B21A 4AYXA 3QUSA 1XWIA 1N5IA 4ZDKA 1I2DA 3EAQA 2EVWX 3PITA 4X8OA 3KB1A 3KXKA 3LBIA 2B7CA 4B73A 3AVOA 4RCZA 2F1IA 5JHGB 2WSSA 4FCTA 4JVSB 4ARZB 3TIFA 1Z08A 3QKRA 4B32A 1RRCA 1AM4D 4JLAA 4IRUB 4HAZA 4IDNA 4CYMA 3BERA 3VHLB 4Q9KA 2QT1A 2YNMA 4A2QA 5FTLA 3TJZA 2ZE6A 2JJ2A 4B34A 1OLOA 1U8YA 1OXTA 2Q3MA 3Q9LA 1J70A 1KSFX 4FIDA 4QNMA 2VQSA 4B2IA 2G1KA 2O52A 3A1UA 2ZSDA 1AJEA 2N46A 2CVFA 2WJJA 2BMEA 3CPJB 3IHLA 2IWRA 3K9HA 1XMJA 2CLCX 2OBNA 4Q00A 1NVUQ 3LBNA 4DSOA 3I5YA 4BFZA 2Z5FA 4PHTA 1OJLA 3GMTA 4NL4H 3EA5A 2O8CA 3NDBB 1CXZA 2R6FA 1HH4A 5DH9A 1N6IA 3VR5A 3FVQA 2ZRIA 4P4SA 3WXMA 3JZMA 5IT5A 2ZRAA 1L7VC 1OE0A 4KODA 4M2LA 4MRSA 4Q4AB 3KZ1E 4CDGA 4DEYA 5JZVA 2H16A 1DS6A 2QSYA 3BWDD 4XTRA 3VX4A 3QPVA 4XSGA 5HKKA 4IHQA 1S9DA 1P9WA 1M34E 2LWIA 3CRMA 4LBYA 2DFTA 2XB2A 3BC1A 5FOTA 1OH7A 3RS7A 3LY5A 4TT3A 2G77B 2IW3A 1AS2A 5EP4A 1IXZA 4WBSA 1Z06A 5KDLA 3SYLA 5JI2E 4BPBA 1NKTA 1XD2A 1WDTA 2VEDA 2ZI5A 2BVNA 1KSGA 4F4IA 2XXAB 1JJ7A 1X8JA 4A0GA 4LHVA 2ZXUA 3WHKA 1AGPA 4ZKEA 2A30A 3D7MA 2HCBA 1SGWA 2GEDA 2K5UA 4B71A 1KDTA 4A82A 2B8TA 2QTFA 5FTJA 4Q18A 2QENA 5J4KA 1G291 1YJ5A 3BGWA 4JBXA 1YVDA 3K70D 2NO6A 2QMEA 5GADl 4QHTA 3GLFA 2PEYA 1YZLA 1OHHA 4E09A 2J5XA 1PJRA 5EE3A 1P9NA 1GOTA 4AKIA 1P61B 3RWOA 1HQCA 2OCBA 2QP4A 2VF8A 4GI7A 1IQPA 2QTVB 1E79D 1R7RA 4PAOA 3JVUA 1ZD8A 4V02A 3CX8A 5KYKA 2ZRDA 4AURA 1OKKA 1IY1A 2ZSEA 3LXXA 1HQYE 4HATA 421PA 3R20A 4BFTA 3TVDA 2V1XA 4V0OA 2IL1A 1UJ2A 1SQ5A 2O8CB 3KL4A 2J1LA 3AVPA 1MOZA 3PUVA 1OT3A 2DHRA 1LS1A 3FMFA 1KI3A 5K8LA 4P4SB 2ORVA 5DLQC 4YXWD 2FSFA 3CZPA 4PZYA 2QI9C 2IYXA 2D7DA 2PJZA 1LVGA 2OILA 1XMSA 3IBYA 1KI6A 5B30A 3NWJA 2GAOA 4M21A 3U61B 2XSZD 2O8BA 1ZM7A 3BE4A 4IFEA 4ASUA 2QORA 5FPYA 3ZZTA 5C46F 1X3SA 2MMCA 3B5JA 5IK2D 1XD2B 4O0MA 4DVGA 1E2NA 1OYYA 1AA9A 4FI3C 1R0YA 3S1AA 2BMDA 4LGMA 2GJKA 4IKEA 1W0JD 2Z83A 2IUTA 4NCKA 1US8B 4C7OA 3TQCA 1KYIA 5F9FA 5F98A 4YDSA 1Z6XA 1GNRA 1XTQA 2FFAA 4JS0A 4YC7A 5TARA 3L0IB 5FH9A 3ZIAD 1XXHA 2RGDA 1DAGA 2VIIA 1XTJA 2KJQA 3B9PA 5HCNA 1WP9A 3GLFB 1E9EA 3GEIA 1G19A 2B92A 1FX0A 5HCIA 1KI4A 5FPKA 1P2SA 4GL2A 5JCZA 3HJNA 3ZVNA 4FINA 4EJSA 2G88A 1DEKA 1S3GA 2I1VB 2UVQA 4QJ5A 1IN8A 1OSNA 3AF4A 4DIDA 5L3VA 3Q7QA 5C18A 1U8ZA 2GXAA 1KO4A 4BLQA 3PUWA 2QSZA 1KGDA 2AD1A 4TMTA 2X2FA 4OHYA 3M1IA 4PQRA 4Q48A 3NTUA 2PMDA 4D82A 2H8KA 3LX8A 2EWVA 2F3TA 2PLFA 3MWLA 2WWFA 2IXGA 3Q3JB 2FFQA 3KX2A 2WJYA 2FGJA 5KTYA 2WBLC 2WM9B 2O8DA 3EPHA 5KDOA 2QAJA 2R6AA 4V0MA 3PEYA 4HAXA 3U44A 4P32A 4CT5A 4TL6A 4D80A 3EXAA 1UDWA 2WJHA 3QG1A 4BWYA 4GT1A 3K53A 1P2UA 4QHSA 2MMGA 1GNPA 2W6JD 4Q7LA 1CF4A 2KWIA 4M1SA 2EWWA 3ZGXA 2X1VA 4AC9A 1I2MA 1EX7A 5E95A 2WJVA 4CIDA 2J7PA 4JLDA 4L15A 2VP0A 2KBFA 1NY6A 2XITA 1H8ED 3IDQA 4S35A 2YOHA 2IYVA 2CHGA 5GVSA 3T15A 4KITB 2WPDD 1P9RA 3KDSE 3T34A 4AG6A 4PZLA 1XF9A 1K8RA 1G4AE 1U9IA 3CWZA 1JXOA 1NRJB 3FDIA 4I1OA 2MSDB 3FHCB 4PSKA 3SFVA 3AVTA 4A0FA 3HDTA 3WY9A 1W2GA 3QEJA 3ASYA 4UJ3A 2FSIA 3PEUA 2BHRA 3BK7A 5IDVA 4MYUA 5KSYA 3UWKA 4US0R 4DSNA 4PC3A 4NKRA 1AS3A 2PCLA 4C0QC 2GJAA 3CH5A 4G5GA 1XEFA 3QVUA 4JLBA 1W2HA 4B3CA 4PHFA 4S2EA 2QP9X 3SBDA 2OM2A 3KUDA 3W8RA 1PZNA 5KUTA 1T8TA 2Q9CA 4MQBA 3T12A 4NPHA 2WKPA 4M1OA 1EFTA 1FOEB 3CKLA 3P1JA 1HEIA 2OLJA 2WHXA 5DHAA 3QSYA 4HUQA 1AGRA 3NBYC 4YMVA 4A6PA 2VYFA 5JCPA 4FMBB 3U44B 1WBDA 1IBRA 4K8OA 5AK0A 1YR9A 4LHZA 2GK6A 3CPHA 3SJCA 1VCNA 2GXSA 1IONA 3K0EA 3OEED 5DHFA 4DHEA 1KSHA 1RYFA 3L8YA 3SNHA 5IHPA 1DAHA 4K81B 2JA1A 2ZE5A 2Z6VA 4FMDF 4HDOB 5FOXA 3CRRA 1AS0A 1N6LA 1E96A 1ZNWA 5DGXA 3PCRB 1KDRA 3RNLA 4A36A 1JEEA 4DDUA 3I4LA 4OI4A 4PTLA 1VKJA 4NTZA 4RD3A 2G0TA 3QE0A 2PT7A 4F4CA 5CITA 4RD6A 1T6NA 4DEXA 3QF4A 1DBSA 8OHMA 5DO9A 2QAGA 2ZRJA 4D0GA 4BEBA 3QBTA 3EG5A 4D4JA 1YZNA 2JDIA 3ZYCA 4LJ4A 1KDPA 3PR1A 1KIMA 1VG8A 2A5DA 2HYDA 3EPKA 3CB4A 4A2PA 1KO5A 2X19A 1W7AA 3NEYA 2OBLA 2JJ1D 4OI0A 2HLDD 3E5HA 1PUJA 3MUFA 4DSTA 5E7MA 2A78A 4LBWA 3AKCA 3GLIA 3SQXA 1ZAKA 2IF2A 2JLSA 2ZU6A 3X1DA 1E98A 1E2LA 1BMFD 1YRAA 3CPEA 1NVVQ 3DMDA 4FWTA 2VBCA 1P7CA 1SVWA 1ZMXA 2B8WA 1HY3A 1UEIA 1RRPA 1P73A 1KO1A 1SXJD 3BB3A 3KFVA 3OZXA 4TQUS 3TW4A 3QKSA 1E2EA 1HV8A 1NF3A 1VHTA 2RCNA 2W2TA 4HUQB 5DI3A 5BYKA 1G17A 4QM6A 1LF0A 1VCMA 2REOA 4Q03A 1T8UA 5F3WB 2V1UA 1AQUA 2CCKA 2Q9BA 3ZS8A 3VR3A 1Z28A 4Q7KA 1NBMD 4IW3B 1ZCAA 3L82B 3TLXA 4Q4JB 2BC9A 1G8HA 4B74A 1S4QA 4OQMA 5FL7D 3THYA 2W6ID 4H9GA 2C95A 1Z6YA 1E99A 2CDNA 3D6TB 3B78A 2OAP1 5EZ5A 5D3MB 4UKDA 4P4UA 3ND8A 2QPAA 3W5IA 4IEEA 1GRQA 4BZQA 1QF9A 5M04A 3AF3A 2FFHA 1HYQA 3LBHA 1ZIOA 3GPLA 1ZM2A 4EFLA 2SHKA 1O3YA 3B7GA 2WAYA 3KXLA 4LOAA 3V4FA 1Z0FA 3CM0A 4TQAA 4AY2A 2AL7A 3GJ0A 2GCPA 3ONWA 3QF4B 4ACAA 3SJZA 3GLHA 3IGFA 1AZSC 3L43A 2C04A 3CONA 4B6FA 3M0EA 4TYNA 4O2LA 3PVSA 3U3JA 4BUJA 721PA 1GL7A 4FWIB 1X8LA 3A4MA 1KDOA 3GJ8A 3LFUA 1CR0A 1RW4A 2XTNA 5EP1A 4LC0A 2EU8A 4LYAA 5CM8B 1Z47A 1R5OA 2GRJA 1OB5A 4LDJA 1U0LA 2IEZA 3QQ5A 1ZVQA 3LH5A 4L5BA 4MUBA 4GNKA 3PJRA 1HT2E 1YU9A 1Z2AA 2HXYA 3M4YA 3K0FA 2JIZA 1B0UA 3HU3A 1W47A 2A5JA 2D74A 2V4ZA 2CE2X 3AV0B 4N0EA 1DAKA 3QKSB 2J45A 5DI3B 3H0KA 4LJ8A 3U3RA 2J9RA 2FZ4A 5FUWA 3RYTC 3MCAA 1U8AA 4KLZA 1R10A 1NI3A 2ZE8A 4DRZA 1NMZA 2XGJA 3VFDA 2VSFA 4OI1A 4KVAA 2WIAA 3A36A 3THYB 2W0MA 4NU0A 5CJPA 3BB4A 3LLUA 4RY2A 3UKDA 1G3UA 2QMOA 1LNZA 3B82A 4UJ5A 4UQOA 5FPHA 3DOFA 1ZC4A 3O8CA 1W0KD 2C03A 2A7QA 3L2OB 521PA 2GXUA 5KSOA 4R2HA 3MMPA 1XEWY 2PCJA 2F1JA 1RKBA 4UNPA 1SVLA 3KQNA 2JLQA 5K8IA 2RGXA 1IN4A 3NDPA 3SS8A 1G3QA 4J0QA 3DZ8A 4G5QA 4AYTA 3OE7D 1UBGA 3GLHB 4KU4A 4TLEA 3WP1B 2DWQA 3O47A 2IS6A 4I1SA 1RJ9A 4HZUB 2GNOA 2BCJQ 4EIWA 5SZHB 4M8NE 4B2PA 5UKDA 3H1TA 2OXRA 2VP5A 3RVBA 1PLLA 3C14C 1X86B 1Q20A 3Q5EA 3AVVA 3G0HA 3OIWA 4HEJA 2NZJA 3Q85A 1V5WA 1L4UA 2IHBA 2PMKA 2D2EA 3SYNA 1L2TA 3F0TA 4X8MA 3DHWC 1JEDA 1W44A 3EA0A 1FTSA 1S0UA 1QDEA 4NP6A 4WA7A 5FBWB 1W36C 4KLNA 3ICEA 1UDXA 2BEJA 2VP6A 3ETLA 1PLKA 3THOA 4LYFA 2F43B 2QM8A 2R6CA 4Q1AA 4TLBA 4UNSA 4LX0A 4D4LA 1NVVR 5FOWA 3UPUA 1VG1A 2C5LA 1FNMA 1BIFA 5EZ6B 1SXJE 4RKEA 1WQ1R 2WJGA 4I1UA 2QBYA 3AQ4A 4IOMA 4BE7B 2DWPA 4KV9A 3TQFA 3A1WA 3K0CC 1TU3A 4PAQA 1T0JB 4URWR 3VU9B 3THXA 1D2MA 2VPPA 1AKYA 5FBRB 3PXGA 1NBME 5FTMA 1N6NA 4A6XA 2BWJA 2GZAA 4URXR 3AVUA 1MV5A 4JLJA 1XP8A 3IILA 2ZROA 5EXTA 2RHDA 4JKYA 3WMFA 3DM9B 3QNUA 2F9MA 3NKVA 1QHIA 3H84A 4MRVA 2EW1A 2QE7A 2OHFA 3TSOA 4ACBA 3DDCA 4IJMA 4CEIB 2CK3A 3X1XA 4B6EA 4ZIRB 2ODBA 1RJ9B 3OF5A 1OPXA 2C9CA 3GJ3A 5G3YA 2E9SA 4Y0VA 1W48A 3PQCA 4QGAA 3NC1C 1E94E 3CNOA 2WWWA 1OXXK 1AK2A 2PX3A 1S96A 2Q9AA 2VSXA 3BFKA 4DLVA 2GILA 1FQJA 2L0XA 4HAYA 5J4LA 2XZOA 2Y8EA 2IYWA 1J8YF 1FMJA 3G82C 4EPYA 4D81A 3TH5A 4HUTA 4MA4A 4X8HA 3TK1A 5CB8A 5HPYB 2N1BA 3UG7A 3GLGE 1IHUA 2XJ9A 4M1MA 2XOKA 5EXPA 4A8JC 3GJ7A 2HXSA 4EJSC 1DADA 2BJWA 3Q72A 1JR3D 3ASZA 3U7HB 3V4RA 1OF1A 2V7QA 4WW0A 4IOJA 2ZTSA 2JATA 4KI0A 3TRFA 2CLDX 1KI8A 3OFNA 2LKCA 5JBQA 2HF9A 3GFOA 2AWNA 1EWQA 3THXB 5ANRB 4GZLA 4ZDWA 5TB5A 1R5NA 4QGFA 1R0ZA 5AJWA 1YKSA 1ZM3A 2HF8A 3LAWA 2CE7A 2VHQA 4CEHB 6Q21A 2ANCA 2QRZA 3B13B 4TMWA 2QMUA 3W6PA 1EG7A 3NEJA 3KQHA 2P67A 4IVRA 5JWOA 3SN6A 4TYWA 2AFHE 3PENA 4JT4A 1D9XA 4BQSA 4D26A 4HB4A 1NKSA 3EASA 5C4GB 1UBEA 2ZJOA 1GSIA 1NP6A 3R9WA 1KKMA 4WVFA 3PEVA 3RLFA 3M6AA 4IDPA 4TZ6A 1K5GA 1LFDB 1JPJA 4BLTA 1WF3A 1G7CA 2WAXA 3FOZA 3QXHA 1KI7A 5GJBA 5EUQB 1WA5A 3RS3A 4N0DA 1CRQA 4Q1DA 2CVHA 3KUCA 5JEEA 2ZI4A 1HE1C 2ZI3A 1BYUA 1F6BA 4DCNA 2A5GA 4DDWA 2FJUA 2AFIE 1E1RD 1P6XA 5CM9C 3VHXA 1E1QA 2VP4A 5CYPA 3R7WA 3RABA 2FEMA 3I73A 3OEHD 3TUIC 1GFIA 1YZTA 3TUJC 3MG9A 4PQYA 3ECCA 4KYIB 4WXRA 4XJXA 4M1TA 5AWFC 1GWNA 1ZU4A 2RGBA 2REBA 1U9IC 1XEWX 1TTTA 4F92B 1G16A 3SBEA 1KO7A 4NE2A 4JVLA 3MJRA 2X8AA 3VX3A 3EPJA 1SVSA 3WHLA 1G5TA 1TEVA 3BD9A 3U60B 4JL5A 4IEIA 4WXPA 2HUPA 2AWOA 3P26A 1N6OA 2WZQA 2WMNB 4LHWA 4PC2A 4RD2A 2ZS8A 5AUOB 1KJWA 1KNXA 2QMHA 1KKLA 1OYWA 4KSCA 2D7CA 1G9XA 3D3QA 4OK6A 3RHFA 4JYBA 1M2OB 4HDCA 2J41A 3FB4A 1AIPA 4B44A 3CR7A 1UBFA 5EXSA 4WIAA 1LY1A 3HR7A 2QQ0A 1FTNA 4NMMA 1COWD 2BOVA 1OXSC 4LJYA 1M6NA 1EFRD 1DELA 2D2FA 1X6VA 4LY6A 2O8FA 2IS2A 3CRVA 4R2IA 3SDZA 2WJIA 4RFSB 3CUEF 1SKYB 5DN6D 4C0LA 1U81A 1W4BA 3LX5A 1G8GA 4OHWA 4OBEA 1KNQA 1KY2A 1IXSB 4Q02A 4RJLA 5KO2A 4FW9A 2X2EA 5JS7A 4DB2A 5A4JA 3AKDA 4I81A 1BYIA 1G4UR 3LNCA 3LW8A 1TL7C 2CMKA 1I4LD 2REXB 3PV0A 3T5GA 4EDHA 1G41A 2HEIA 3VKGA 4EPXA 3FKSD 2XB4A 2LCFA 3EARA 3R7WB 3QKRB 3NXSA 1BKDR 2PLRA 3C41J 4UNNA 4G01B 2JLWA 1E2MA 2GCOA 2QAGC 3ZDQA 4DZZA 3MAAC 4DC9A 1A2BA 2IUSA 3WP0A 4DT1A 3FHTA 3CIOA 4AD8A 1U94A 4TL9A 1CS4C 4ITRC 4E03A 2IXEA 2R6DA 3BXZA 1CBUA 4TL8A 2XEXA 3ADBA 4DDVA 2ANBA 5A0FA 3O8DA 2BBWA 2DWOA 3FFBA 3KKPA 2JLVA 5KNDA 5KNCA 3CRW1 2CL6X 3OIVA 2ERXA 2P65A 4HZIA 2WWYA 4IOLA 4B3XA 2G83A 3W6NA 2ZVQX 1Z0JA 3ZVRA 4M53A 5K8UA 3K0CA 1UAAA 4D0NA 1YZQA 4TYPA 2QNRA 2ZETA 4ZCIA 5EUMA 4LZZA 1YHNA 3A37A 4KBGA 4NYMQ 1IXRC 2PJRA 3SOPA 2ECKA 4PC7A 3BFVA 1T3SA 1Z6AA 2GJ8A 3BIFA 4DCUA 1RVDA 5G3ZA 1ZIPA 4JL6A 4DLYA 1LV7A 2OFWA 1UPTA 2YKGA 1EESA 4B2LA 4B75A 4NBSA 3QJYA 1TUEA 3RS4A 2QPTA 4QM7A 2KSQA 2QRNA 4LPSA 2CL0X 4JVNA 2QTHA 2ZQ5A 4B3DA 1SHZA 2AHOA 1TF2A 3V9PA 1ZD1A 2IYLD 4WZBE 3IPYA 1GKYA 4CRWB 5HE9A 3ZVLA 2NO7A 4TMZA 2QUZA 2C98A 5BW8A 4H1UA 2IXFA 2GK7A 5FBVB 5DE3A 4MGKR 4D6PA 4Q4HA 3TSWA 5EE9A 3X1YA 5B2ZA 1M8PA 1VECA 1WBBA 1NJGA 1T91A 5LD2C 4EPWA 1E0KA 5L8VA 1A7JA 3LVQE 5KPJA 4C2TA 4NCIA 2MSEB 1W36B 4ZKDA 1EGAA 2NIPA 1W46A 3BAFA 3E70C 4Z54A 4A8JA 1TQDA 4MKGA 4BRUA 2ZR9A 3F3YA 2IS4A 1RRGA 2H1LA 3L8ZA 4PZZA 4QBGB 2FH5B 4TMKA 1XD9A 2PZFA 1FMLA 1R2QA 4TMVA 1RYHA 3AH8A 2ZSFA 3SI7A 4Q1BA 4XOIA 2IUUA 4RCYA 1ETUA 3W8NA 2JLZA 2I1QA 4Q1EA 5KSPA 1TADA 1XCPA 2CNWA 2WOOA 4M4SA 3DMNA 3EPLA 4KFUA 1T5IA 5JSZA 4GBMA 4Z1MA 4PSAA 1T5LA 2C78A 4M9SA 1E4YA 1U99A 3SQWA 1G5PA 1KI6B 1PLJA 2VTKA 1G8PA 2ZJ8A 3I72A 1CULC 2VHCA 3C15C 1T3HA 4LJ5A 3OAAA 4M9ZA 4RD4A 2O8BB 4MGIR 3T5DA 4RZUA 1TAGA 4PPGA 1VTKA 4I4LA 3AVXA 1KSJA 2B6HA 3LA6A 2G1JA 2I4IA 4F91B 5JJKA 1GKUB 3WNCA 3S1AB 2D3WA 2IX3A 1NLYA 1RFLA 2FDCA 3GFTA 2IS1A 1H8HD 4PC6A 4Z8XA 4C7OB 1UBCA 2NPFA 2F1HA 2EQBA 4JBWA 2EFDB 4NYJQ 1OB2A 1NY5A 3LDAA 3SR0A 4HLDA 2QZ4A 4XVQA 4PO9A 4Z8YA 1HA3A 2ZJYA 4Q4HB 4M1KA 1C4OA 2DFKB 2E87A 2EFHB 4XIGS 1XXHB 3H4MA 1ZBDA 3NC0C 5FBLB 5G40A 1GITA 2WVJA 2YVUA 4D4KA 1EXMA 1VDZA 2QP3A 1FX0B 3T35A 4PANA 2BEKA 1GIAA 4A8JB 3RS5A 2WSSD 4WOPA 4HB0A 4EJSB 4G5RA 5LB2A 1F2TA 3U7EB 1FP7A 4GMXA 2FG5A 2AX4A 1GVNB 1GM5A 3B1WA 1D2EA 1XPUA 1DAEA 1ZUIA 1ONBA 3KKOA 4RD0A 2JLRA 3HP1A 2JJ2D 1XEXA 4RZ3A 3TE6A 5JMTA 1D8TA 5FUYA 3TR5A 3AUYA 4B3FX 4DCSA 5P21A 3VNUA 4KFTA 4W5WA 3K1JA 3K70C 3A6PC 5FL3A 5C2JB 4AI6A 4JSYA 4R7ZA 3TMKA 1F5NA 3PUYA 3RS0A 1GL6A 2O8DB 3UG6A 1F2UA 2ZI7A 4LWZA 4EFMA 3AF0A 3KKQA 3X1WA 1XZQA 4LUCA 2QA5A 4A9AA 1AQYA 3WYFA 3R8CA 4NYMR 2QG6A 1DO2A 3ADDA 3IHWA 2IHYA 1KZGB 1YR8A 4YMSA 1E4VA 4KBFA 5HKKD 3WNBA 2ZRMA 4Y0AA 2V54A 2A9KA 3MJHA 3R9XA 1RE0A 4DLZA 4TT3D 2DY1A 1VPLA 1KMHA 1BOFA 2A3RA 4UNQA 3EC2A 1QHSA 3WYGA 1E9CA 4PAMA 1F60A 5G53C 4Q9LA 2ZRKA 3R9IA 2ZAOA 1WE2A 2NOAA 1ZM9A 1E0AA 5BWMA 2BDTA 4TSFA 3RS2A 2ZSBA 2FN4A 2I3BA 3T1OA 2R2AA 1VHLA 5EE5B 4LHXA 2V6JA 4POAA 4B33A 2R62A 1OFTA 5TY0A 1KK0A 1Z3IX 4ABYA 4DUGA 3TAUA 2AXNA 1OIXA 4Q9HA 2C77A 3LW7A 1OHHD 3JVVA 1MO4A 1UKZA 1IJEA 1ZINA 2QL6A 2YWGA 4MRPA 3EW9A 2YV5A 5D3QA 5H70A 2F3RA 1XEXB 3B2EA 1Y63A 2DYKA 4Q47A 5E7IA 1U90A 1Q22A 3A8TA 3CF6R 3L0OA 3OIYA 5CK5A 1HUQA 2OCYC 3AP3A 3SZRA 4GOXA 1ZNYA 1TU4A 1OKKD 5B58C 3W3ZB 1Z0KA 3AF2A 1Q57A 5FBQB 1U2RA 5E4FA 2QT0A 2OFXA 3ZD6A 3K9NA 3QXJA 2BBOA 4XD7A 2WWIA 2IK8A 4C2UA 3LQQA 3IBGA 2BMJA 5AR1A 2P5SA 4KCGA 2BM0A 3Q8XB 3I5XA 3ZZUA 2J7KA 3GEHA 1QHNA 1T3LA 2FOLA 1GAJA 2XNDA 2BIFA 1VCOA 4URVR 3EZ9A 1R8SA 1V43A 4ZCMA 4QBIA 2BV3A 3U5ZB 3QY0A 2ODEA 4RD1A 4E22A 4JLVA 1YE8A 4ASUD 3OESA 1YZUA 4L4UA 3LLMA 4QXAA 1KMHB 3ZD7A 4G3XA 3U3KA 2CHQA 4ZO4A 3IIJA 4DWJA 2HYIC 2XJ4A 4TTPA 1DG1G 3WYAA 2QAGB 3IO5A 3NHBA 4PFSA 4NYJR 1NN0A 2W0SA 4YONB 2YC4C 3TUZC 1G7SA 4Z51A 2RGCA 2IBMA 2RHMA 4GOKA 4US2R 3IEVA 1RIFA 4D25A 3REGA 2R9VA 4RFVA 3K0AA 4X8LA 2C9OA 4DCVA 5LDDC 4YMTA 1WRBA 1GRRA 3GLIB 4NYIQ 2NO1A 4K46A 1G64A 5AUQA 1XCMA 2OAQ1 1TPZA 1ZRHA 1N6PA 3EZ2A 4IDHA 1OIWA 1JPNA 1M74A 4NCJA 2Q3HA 1W49A 4LJ7A 3AVWA 2NGRA 3KTAA 3E1SA 1N25A 1QBKC 3BRWD 4URZR 4DLRA 2FGKA 4KHZA 2HV8A 2OLKA 5AJVB 4NDZA 1E2PA 3SJAA 5CK4A 1OFIA 1KI1A 1G3RA 3IIKA 3P20A 4TTQA 1E9RA 2VHTA 2JCSA 1JI0A 2PH1A 4GMDA 2ZUBA 3DZDA 4B43A 1A2KC 2JLUA 1XTSA 1BH2A 2ZEJA 4XTCS 3EZ7A 3VR1A 2PL3A 4DKXA 4PR0A 4KFRA 3RRZA 3BB1A 2YZ2A 2ZRCA 3AP2A 2J0UA 2FPMA 2ODWA 1LB1B 2ASEA 4IDQA 3IPXA 5G41A 5GJVC 4DB4A 2BBTA 3CH4B 3GCGA 1TQ4A 1IN7A 3PEWA 1D6JA 2W2XA 1FZQA 4OYHA 4G1UC 5DYGA 1OV4A 1YR7A 4RSGA 2V6IA 3GJ5A 4XVUA 2HJGA 3C16C 5KU1A 4B48A 5GVRA 4UXHA 2AN9A 4R71A 5J40A 4KSBA 1MO6A 2J0VA 4HLUA 2D62A 5LD2B 3AUXA 4QOSA 3AGPA 1QVRA 2PEZA 2J7PD 3RWMB 1Z63A 5EQTA 2IWHA 3TW8B 4UNRA 1SVOA 4B3GA 1NG9A 1E2JA 1MO5A 1ZD9A 4LJ9A 2UKDA 4EAQA 2ORWA 5EP3A 3W34A 5J4HA 1UKYA 1OH5A 3K0AB 1ZU5A 5FR2A 4KAXA 1W4CA 1VYVA 1DO0A 4FCWA 2AK2A 4NHOA 1XDBA 4HYYA 4RZXA 1AZTA 1FPMA 2RGAA 1M7HA 3HR8A 1XMIA 3R8FA 1CJVC 3QXSA 4FMCF 4M9QA 4URYR 3GLFE 3K0FB 4P33A 1Z0AA 1XBTA 1TF5A 3TBKA 3KTAB 2D4HA 1PV4A 1Q21A 1E2DA 3A1VA 4PO8A 3FFAA 1D9ZA 4JL8A 4BFWA 5C4MA 1Z6GA 2JAQA 2O8EA 1IY2A 1XPOA 2FEOA 3B1ZA 2ZUCA 4C9BA 4LBVA 2YYZA 4FN5A 2NTYC 2GJ9A 4CW7A 2J3EA 1E79A 5JLJA 1IOZA 3DPUA 3U2QA 1A82A 4V0NA 5SZJA 4L9SA 5HR5A 2IYTA 821PA 4JBYA 2F7SA 2QPOA 1II0A 4OK5A 4YMWA 2DPXA 4F4JA 2LKDA 2ONJA 2J0UB 4L9WA 4LSGA 3GFPA 1WB9A 4OJKA 3W9YA 1UKEA 1JECA 3MWYW 1E2HA 1NN5A 1E9DA 2KI5A 4PQFA 1UEJA 2FPKA 2XZLA 1JNYA 3RANA 4ESHA 1Q44A 3PUZA 5AJXA 3X1ZA 1SXJC 1GP2A 1FNNA 3QI2A 4YXWA 2OXCA 1G8FA 4D0LB 1KI9A 4KXFB 5FUXA 1W4AA 2ZRNA 4FXPA 2HDNB 2IA5A 3N5CA 4OQNA 3SU8A 3P27A 1A5TA 1VG0B 2ZRLA 2XSZA 4KYUA 4HLCA 2CJWA 1Z0IA 4C0JA 4O3MA 5FPTA 5F9HA 1P72A 2IT1A 4AKGA 4ILEA 4ESVA 1JR6A 2W58A 1KHTA 4Q9IA 2CBZA 1NSTA 5IK2A 4OI2A 4G0NA 1VCIA 2BMFA 1SVKA 2B7BA 4EFNA 1B23P 2BJVA 1N0UA 1N0VC 3B1XA 1G18A 1GTVA 1R5BA 4LJAA 3UATA 3TGPA 1KY3A 1W0JA 3EWSA 2JDID 1E3MA 2NPIA 3EIHA 3QVVA 2CLSA 2WICA 2WOJA 3FWYA 3T1QA 4BGDA 4A0RA 4DLWA 4L8GA 2GAAA 1KK3A 3AF1A 4UXJA 5J4VA 3ZIAA 4LCBA 1Z83A 3NBFA 1CJKC 4NYIR 3QXCA 5KPDA 4H1VA 1KAOA 3N2EA 2OG2A 3K70B 3MLEA 2PX0A 5EJEA 3EZFA 4DLSA 1E9SA 3B1YA 4IFBA 1KTVA 1Q1QA 4XVRA 5DI9A 5TV2A 3QOFA 1YZGA 2QGNA 1F3OA 3B60A 4QJ4A 4ARZA 2QBYB 5CB6A 2ZYUX 1E2KA 3C7KA 3FPAA 3U7FB 1XJQA 2ZIAA 5JFGA 1C9KA 4TWZA 1AN0A 4C0HA 3EX7C 1P5ZB 4AKHA 3KJIA 5TMPA 1HTWA 2OO7A 2RAPA 3AKYA 3QF7A 5CDFE 4C0AC 1N5LA 1S2MA 3MGCA 3DKPA 3N70A 2DFNA 2ORIA 4RKFA 1J7KA 2VF7A 4V0ME 2TMKA 3ND9A 2C99A 1MRSA 4JLNA 2DR3A 4OHZA 3QEOA 3KFXA 2G6BA 5DISB 4DSUA 2FF7A 3WRYC 5B64A 1VYTA 2H18A 2Z4SA 2DFLA 1EK0A 4BLSA 4GP7A 3HYRA 4QRHA 4BLPA 1MH1A 2RB4A 5J4YA 2C9YA 3AVYA 1LS6A 3GJ4A 3CLVA 5L3RA 2EFGA 1Z0DA 2ZJZA 3L0SA 1FUUA 4Q4AA 5HTKA 4XWKA 4A4DA 2W6JA 1NG1A 3U6BA 4BRWA 3W6OA 2IYQA 1WCV1 4NONA 1SKQA 2AKAB 2YHSA 3NG1A 4TL7A 5LBIA 4LV6A 4AKEA 2PZEA 3ZQJA 3TR0A 4Q5IA 3A4LA 1E9BA 4A15A 1H8EA 4PC1A 5GJWC 5BXQC 3QG5A 1G21E 2FSHA 2GA8A 2PZGA 2ZI6A 2XXAA 1M7BA 3VNVA 2DCUA 2OSBA 2WPDA 5FUVA 3ICQB 2J0QA 4TMXA 1D2NA 5SZIA 2WKQA 2G3YA 1QHGA 2GTPA 1N0WA 4U5XA 3AEZA 2JIZD 1ZW6A 3UMRA 4XWAA 1ZP6A 4OK3A 1DARA 2GEUA 4V0KA 3P4XA 1W1WA 4TLCA 4US1R 5TDHA 5KSZA 3FYHA 3W3AA 2WSMA 1ODFA 4CT4B 1XMVA 5TXGA 2QU8A 1P2TA 1G8YA 1M7GA 3FTQA 3PFIA 3TNFA 1YR6A 4HDQB 1X1SA 1DG3A 4Q1CA 1GL9B 2ZJ5A 2NMVA 1KK1A 3HPRA 4JVMA 4ON9A 1XJ0A 3SC3A 2G9NA 121PA 3CF0A 2IYYA 5JEDA 1XFAA 1AKEA 2EYQA 1XTIA 2W00A 4PPQA 3RDPA 5BN5A 4M1WA 1DAIA 1NNEA 1ESMA 4HAVA 4AK9A 4JLKA 2GVDC 1IM2A 2FA9A 2ZANA 2ZYWX 3HU2A 1Z5ZA 2NO0A 1KO8A 3T61A 3OEEA 3L0PA 3LO5A 4GRAA 2ZJ2A 1R6BX 2IEYA 3RRMA 4FMCB 3IKJA 1II9A 2ZRFA 1Y3AA 3VAAA 1DAMA 2JEOA 1R0WA 1WMSA 2GKSA 3C8UA 2H92A 2AXPA 3F8TA 4PPFA 2FMXA 3RRNA 1VMAA 1RC8A 1EFHA 3WMEA 4QGHA 2QGZA 3LXRA 1II8A 1F48A 2YJTD 3DVLA 4N1AA 2XTMA 3X2SA 4OHVA 2GBLA 3CNLA 3LVRE 3KQUA 4WZAE 1JAIA 1TUIA 1IJFA 4DBLC 1D5CA 1N5KA 1US8A 2EYUA 3NIBA 2NZ8A 1I4TD 4LK2A 3GLIE 1L4YA 3A58B 4DXAA 4W9MC 2JJ1A 2Q21A 2HLDA 4TLDA 1JR3E 2FX3A 2BBSA 1SVMA 1Q1EA 4MDFA 1CKEA 2PT5A 4CGZA 2ZVPX 1OXUA 1BMFA 1M1YE 4C4PA 2KBEA 5AJYA 4BFXA 4DDTA 4HB3A 2WV9A 4B47A 3QIAA 2O8FB 4EQ6A 1E2FA 3IO3A 1SXJA 3BOSA 4B3BA 2H57A 3W5JA 5BN3A 3BORA 4ZI2A 4DLUA 1KOFA 3EZ6A 3ADCA 4M9XA 4PX9A 2GF9A 2OEPA 3ZLJA 4GOJA 2WIBA 2ZRGA 4MYHA 4CF7A 4F93B 3FMPB 1NBMA 4Q66C 4C3ZA 1G20E 2GHIA 3SFZA 2VSOA 5FL7A 3P32A 2IYRA 1U0HC 1CEEA 2Q3FA 2W6IA 1E2GA 4AIIA 1CR2A 2JLYA 4OQFA 1KK2A 1RPZA 2QE7D 5EE1A 1JALA 1FFHA 1CP2A 2BKEA 2OT3B 2CK3D 3F5FA 3EWAA 4QC2A 1IN5A
chains in the Genus database with same CATH superfamily
2B5VA 1NQ5A 2VS1A 2ZR0A 2GCOB 1HTTA 1UMDB 3IOYA 5AXBA 1II8B 3DDZX 3CLKA 5KJ6A 4WASA 5ISMA 1E9AA 5F76A 3SWWA 5TVKA 4Q4LA 4TX1A 3CZMA 2N3ZA 4LRQA 4CG0A 2AI1A 3REQB 4AICA 1KQGA 4LQCA 4LYHA 3H2YA 4M7RA 4UCFA 1UM8A 2CDCA 4IGIA 5DXFA 4KH0A 2CVZA 4ZMBA 3N8HA 1QMGA 2PIDA 3NBXX 3Q3HA 2GYYA 1QCCA 2VOEA 2WA2A 3E6AA 5IKOA 4ZV4A 2HN9A 4R8VA 3T5AA 4IOKA 2J87A 1XTKA 2Y0BA 3L0YA 2W2VA 3IA7A 4G1EB 4W9NA 4XWYA 2HLPA 5CH5A 1JE1A 3I30X 2AJ8A 2H4FA 1GYPA 4MIYA 2RDMA 4P58A 1NDQA 4R0VA 2XE6A 3TB6A 4R1NA 2G72A 1C1YA 5BQPA 1Y7LA 3W8DA 3GJSA 3OX4A 1RLTA 1CTQA 3EOAI 3BA1A 3HYCA 2HHLA 2OM6A 2JKZA 2A9JA 2V7QD 4QFMA 1COZA 4IFTA 4Y30A 4OJQA 3O84A 5HMLA 3J81k 1CQPA 2C5HA 1I7NA 3ZXUB 2QZZA 4NPCA 1GGJA 1QM5A 3UIEA 1QVWA 2QROA 5EPUA 3UHOA 3AVQA 5KWVA 1IN6A 1JHOA 1WMFA 4ANFA 4RFLA 4AJ2A 5BN3B 2JFWA 1I6KA 1J24A 3CNQS 4FFSA 4WQMA 3U3ZA 4F45A 4EYSA 4CG3A 5BWLA 1ISRA 1D7AA 2GPWA 1Z6PA 3PL5A 4CKWA 2WC1A 3CKYA 3DW3X 1N7GA 3BTVA 1NV9A 2EFEB 4EKIA 1RAHA 2QDKA 2W6NA 1DC8A 3OCUA 5EESA 3ZS9A 3E9YA 2CVPA 4WUVA 1X1CA 2HY7A 1RRFA 3H8JA 1LF5A 3AO0B 1CJBA 1R8QA 1UXHA 2D7JA 2FU5C 4IX1A 1P91A 1P1FA 3H1EA 3I34X 1A4RA 2A9FA 2H1VA 3N0XA 3ZI4A 3R2JA 2YASA 5E3HA 5AFSA 3AY3A 5DBFA 5L3SA 4AQDA 1X9IA 3NJ8A 3NV7A 5FOUA 4W5JA 1MGPA 4ZRDA 1GNTA 5P8WA 2JPDA 2F6RA 1JU4A 1T9BA 2RH5A 1YIOA 4B40A 2LD4A 5FLYA 3AINA 3KUUA 2BAGA 4NARA 5T7BA 4ZU3A 2R84A 4ZK6A 4GLJA 2Q6VA 4BMXA 1EUQA 2WEKA 2YMQA 2O2IA 2WKRA 4V3CA 1UBNA 3L1JA 2COEA 4PX3A 5DYIA 5H3CA 1T9HA 4AY3A 1TKRA 2GFIA 2I6XA 3OE7A 4RK1A 4EGQA 1YHZA 1UFVA 4INZA 4KO2S 1TM2A 3K9LA 4EY4A 4QPNA 4KACA 1CIJA 3D31A 4F6RB 2IF0A 3UAVA 4QVIA 1TNDA 1VPEA 4QULA 1TJ3A 1V16A 3ELWA 4A8PA 2R00A 4WJLA 2FPGA 2JI8A 2YJ3A 3I8XA 1S2IA 1BJKA 3ZX5A 1JB1A 5JAMA 1GCGA 4TYQA 1RLIA 4H7FA 2ZZKA 4QEDA 3C24A 5GWXA 3SZGA 4FDMA 1T1GA 2WE8A 4W7SA 1U98A 1C3JA 4ZRNA 3K0SA 4WEOA 2R7KA 4MGZR 3E2IA 5FHRA 3KVNA 4AJKA 5DASA 5FWYB 3RSOA 2XE4A 2M1ZA 1N6KA 1M6EX 3H2HA 2CNOA 4CV3A 4UHFA 4BX0A 2A2ZA 3FE2A 3HRIA 4JUFA 2IGBA 2Z30A 3F98A 3I1YA 3S1LA 4DJTA 3ZZ0A 5KMGB 1NL3A 5FQNA 4DLTA 3KXIA 4KQKA 3W3AD 3K31A 1RJDA 1U65A 2FEXA 1M54A 1W5TA 4OJMX 3RRZA 3VXKA 2N75A 2J6CA 4QVKA 4DDMA 1SXQA 1M76A 5HDQA 2J0SA 4CF6A 1MR3F 2FE4A 3DUFA 4WSOA 3CRNA 3V33A 5KVCA 1ZCBA 2VUSA 3LOPA 4IIEA 1BDHA 4XFJA 2VQFB 3EBPA 4MS4B 5A5GA 1TO1E 1U7WA 3OKCA 4PINA 4HAWA 4PSUA 3SQLA 4D3XA 3R7AA 1HG1A 4DQDA 1LI4A 2O14A 1XB2A 1XZAA 3G0OA 4HO1X 3H5NA 1Y5NA 1G5HA 1K6MA 3HUTA 2VVTA 3R9KA 5CA1B 1JXMA 4F7WA 3DL0A 2EFCB 4DMUB 3FMOB 2RH4A 5EP2A 2O4UX 4DCTA 4C07A 5A4FS 1JEYA 4FPXA 5L51A 2C2BA 4NXMB 3AW9A 2MCFA 1LI5A 2ZIUB 1NSFA 4JC4A 3LDHA 1N8KA 3QLUC 1ZW1A 1SUFA 2VJQA 3O95A 2JLXA 1JHRA 4LV8B 4OQLA 4EBFA 2YDXA 2JA2A 4GOLD 1Y6FA 2UUBB 3RSCA 1F51E 2C57A 4YP7A 1SHJA 5KTMA 3H04A 2AFIB 5CT8A 1M0WA 1VPVA 3FCOA 2ZR7A 3LMKA 4ZT6A 3FUCA 3SFTA 1V96A 1L8OA 4AO6A 1N5JA 1R4AA 1RWBA 9ATCA 3CBQA 3DZJA 4MYTA 4X3PA 3C5HA 3H6GA 1QQ5A 1W19A 3B1VA 4Y2XA 4B35A 3OX2A 4M0MA 2B4AA 3C3DA 2F1RA 2HJWA 1LNSA 1YRLA 3I32A 4GWKA 4XH9B 2D1QA 3W0LB 5FO1A 3DLBA 2GAIA 3NDJA 2V3VA 1U5CA 1P4GA 2CL7X 2C9BA 3AKEA 3D0KA 3OLZA 5C1DA 1N1MA 3IUQA 3KUXA 5EG5A 3O2SB 2GI4A 2A9RA 5KNCD 1DWPA 4DR6B 3R3ZA 4ZZ0A 4D0SA 3B8HA 1F2UB 1ZJ5A 4KUGA 3ZLUA 2RHRA 4Q4CA 2BGLA 3M2PA 4BYGA 3FPJA 2BF4A 5HZHA 4M0LA 3UANA 3K9BA 1DLIA 1JAYA 1JQLB 5LQJA 3UHPA 1CLUA 4MUKA 1QGUB 2OFOA 4URFA 5L3QA 5MGBA 3GGCA 1CYDA 3DNMA 4EITA 1Y3CE 4EKDA 3DDUA 2Y1XA 4YQFA 1PFQA 2XBLA 3NBMA 1R9JA 4JKIA 4NZYA 3TSZA 1FFWA 3VPFA 3TKLA 1K08A 3DL7A 1U8UA 2R8BA 2KX7A 4O0LA 2POQX 2ALJA 3FWZA 5AHWA 2RAUA 1TVKB 4JASB 1RP7A 3ES9A 3ID6C 2GXQA 3RFUA 1X7XA 1DCKA 4P7JA 5FTNA 1ELOA 3TD6A 4Z9FA 2P5TB 1ZHOA 4FN4A 1DNPA 1HFJA 2AMYA 1Q6YA 3UMJA 4DC1A 3NVDA 5F2EA 2QRGA 5EMMA 2RGEA 2X7XA 2BSAA 1Z38A 1PW7A 4Y1RA 2GWHA 3QMWA 1HGXA 2VL7A 4CKCA 4O2BA 5HZMA 4KFCA 1AUOA 3KYDB 3QPUA 3KV3O 3M83A 4WZBA 1BS9A 1SR8A 3OZTA 3Q3IA 5DXAA 3TINA 4NU5A 3NVKI 2A33A 5T4BA 1Q1ZA 3DYVA 1GZ4A 5EXEA 4LBZA 2Z9BA 2Q4RA 5KWSA 3B6MA 4N4AA 2POCA 3EDOA 3AM1A 4L74A 1WABA 1LFAA 2P9TA 4FJ1A 3ROQA 3NBZC 1XZLA 1JQEA 2XRFA 5AH0A 1A1VA 2YINC 1P2VA 5L95A 3JQ8B 3L04A 2XI4A 3GH3A 4ZOAA 4E4TA 1KI2A 2DVMA 2GEJA 4A1FA 1OJ7A 1T1SA 3HP4A 1PDOA 4ZDJA 5KDDA 1E3WB 2XTZA 1E7WA 3BJZA 4LI0A 1L7BA 4OIFA 3E22A 3DEFA 1FYEA 2VRCD 4MRAA 4R9VA 2HUNA 4A2WA 3H19A 1B6RA 1Y1KE 3VR4A 4LRXA 1GZ6A 2WMOB 3W2IA 5C51B 3PC2A 2W2KB 4TLAA 4UOQA 4MYRA 2CNWD 3IBFA 4YLEA 2DTXA 4RXTA 5AI0A 1QG0A 4Q7JB 2ATVA 4IV0A 2P91A 2Q4EA 3MCZA 3U7GA 3L1HA 2R7AA 4Z1MD 5BV8A 3MMPA 5JJCA 4EYQA 3PT9A 2Q7XA 2X77A 5CXXA 1X1AA 1ISIA 1T8RA 1ZMRA 1VBFA 3ENVA 5AVOA 2XCUA 1FYVA 3MD9A 1CQIB 3UFXA 4XASA 3PQ6A 4EZIA 4OVKA 2ZAGA 1J0BA 1QGYA 2NO9A 2G76A 1P5HA 2GF2A 4EFDA 3H1BA 4J16A 1L6RA 5E1BA 2BJHA 3JQGA 2ZRBA 3GV0A 1COWA 2INGX 1RADA 4KJZA 4MS3B 4C4ZA 3E23A 4BNLA 4HNUA 3BZBA 2PGDA 4U7FA 2HW8A 1CW2B 3LX6A 2Y76A 3NH6A 4YBRA 4LFCB 5HXAA 4LFBB 2P6NA 1NX6A 1RM3A 3JZAA 2X41A 5JNUA 2XA2A 1O0CA 2VNKA 2XUFA 4S0XA 4TQ9A 4PPNA 1AUVA 5B58T 1UJBA 4QECA 1X8KA 4FGZA 5B57C 1HDZA 1QFMA 3D4LA 3H2JA 1V3QE 1G7TA 5H1YA 4TV8A 3ND5A 1SHLA 3HYTA 1KJYA 1HURA 2R8ZA 5T8KC 3DO6A 3ETJA 4CTMA 4W5TA 1SIBE 1QHXA 4HH1A 4IHAA 4PSVA 5JPDA 1LCIA 1JVNA 1Q84A 2DSTA 1OX5A 3RSZA 4L07A 2Q2QA 4YYZA 4NS4A 3TLYA 2IZ1A 1OIVA 2I2AA 1XA3A 4QTZA 1UOQA 4WESA 5JBIA 4CEIA 1ENYA 2AK3A 3LPCA 4GP6A 2ZREA 1YL5A 4PXYA 4MUAA 2FXVA 1QVAA 5C5IA 3ZVMA 2AVNA 1YQGA 1V48A 3CUKA 3Q7PA 4PNPA 1JPUA 2H5JA 2OO3A 3W2EA 5HUHA 3R6DA 4I8IA 1DPFA 1R64A 2BDEA 2HL6A 1XT6A 3WBKA 2AI3A 2YIJA 2D0OB 4C05A 3ESDA 2QUKA 1N2ZA 1NJFA 1VHDA 1YO6A 3BHIA 3HA3A 3KKNA 2NUPA 2D0DA 3SYTA 5H81A 3I9KA 1SU4A 3QE2A 1Y9JA 4YXFA 3WQRA 3IDAA 2IU6A 4UBNA 1XSEA 2JD1A 4C0KA 2UVPA 1KFEB 3U3MA 3N2KA 2O6HA 1PUIA 4P0TA 2XZPA 4LE1A 3RK1A 1ILEA 1HNZB 3FOCA 4WOJA 3MFQA 3O8QA 3QKTA 4WFIA 2ZYRA 1XA0A 1HG0A 2UZIR 4FMDB 3UJHA 2O5CA 4AXXA 5IF9A 1BHQ1 5LB4A 3TRIA 4ARVA 4UM8B 3T4XA 2JGNA 2OBMA 1R4NA 4QHYA 4GYJA 3FCCA 2R47A 5FA5A 1ZUNA 3G79A 4NRDA 1WXQA 5FBHA 4FHCA 3WSTA 1SA0A 4CIVA 3CRQA 4GRDA 3L9XA 1F4VA 4J4HA 2R65A 2VJKA 2RGRA 2X40A 4MGYR 2IPOA 2OQ2A 3QLUA 4A8HA 3OQVA 4MKIA 2RKOA 3WGIA 1JBQA 4LJ6A 1XTRA 4ND8B 3TIIA 5C1BA 2VXBA 1KJ8A 3TCKA 3ORYA 1U6JA 1SCNE 3BD8A 3MFYA 3GQBA 3N05A 1ZVKA 2HMTA 3MQ2A 4ZOLB 1ODTC 4UFNA 2YQ4A 5AW9A 1YDMA 4MPDA 4WEQA 2PKYX 3QPWA 1QTNA 1JBEA 3Q9NA 3TAHA 2D4AA 3U49A 3ANNA 3PFHA 3EPPA 4Z4QA 3AUTA 3TM4A 3V2IA 3VKWA 2IYSA 2YOFA 2FZEA 4KN5A 1NWCA 2PTGA 3RVLA 5H83A 1ZSVA 1E5XA 3N8IA 5HQ3A 1OW3B 3QENA 1KQOA 3MA0A 1OLXA 1NMYA 1V71A 1Z26A 2FWRA 2QD2A 2QJOA 3E5NA 3KCNA 4IDOA 4ALMA 1WOYA 4BN5A 5C8YF 3KQHA 5K4HA 2E49A 1CT9A 1YFJA 1AQ6A 3BXGA 2NO5A 1T4CA 2Q0HA 1NJSA 2UYYA 1ITZA 3HYLA 4M22A 4YCMA 3TPZA 4P80A 4UASA 2QR3A 3K4QA 1ZONA 4LVCA 5LYYA 3TQOA 3MBIA 8AT1A 3O8RA 2OESA 1IOVA 3H9QA 1T4GA 3GVCA 2FR0A 1HOTA 3K09C 3PC3A 4I55A 4MQ5A 4PLZA 4ZAFA 3HBFA 3KPJA 4DV1B 3NT4A 3JRXA 3O8NA 2WMYA 2RHLA 3FMGA 1KQFA 3WE7A 3GCZA 1T9GS 3Q9UA 4I3FA 2FF5A 4XD7D 3KQVA 3O9VA 4BJ5A 5JXHA 1CIPA 2XT6A 1NIJA 3AJAA 5GINE 1NUSA 3HPQA 3NM6B 4K0RA 1CNEA 3GEEA 4TTTS 2OL4A 4OHXA 1V6CA 3EDQA 2JFOA 3PHJA 1M6VB 3JRWA 1PFWA 4QBFA 5CT4A 4ZVRA 2BUAA 2XMBA 2TYSB 2NU6A 3WRXC 2YWCA 2AZMA 3GRYA 5EJ7A 3OPYA 4RMJA 1QE3A 4YCCA 4M1YA 4ARIA 4LVNA 2QNIA 3G6KA 1DMSA 5HEKA 1KDZA 3B9QA 2FZLA 1JAHA 3CO5A 1PJZA 4K88A 1MB9A 2Y0EA 3UC5A 1UUFA 4O8ZA 4IIHA 4L1KA 2ATXA 3WZLA 3SDBA 3UHFA 1B3RA 1BCRB 3IQXA 4K2AA 3GGDA 3NOOA 4PCUA 4HGNA 2KPOA 1YI0A 2B8JA 2NYRA 3TVTA 3X1JA 4RKYA 1H8HA 3CF4G 1E2UA 1I94B 4P36A 2HXGA 2I6FA 1E2IA 4PEVA 3BH7A 5FI1B 3S29A 2BEUB 1WO8A 2PTHA 1L3CA 3AHGA 4EEKA 1W96A 3OMXA 3JW8A 4Q7EA 2IZ0A 1P5RA 4PPYA 1QZXA 2SKCA 3I62A 4TM8A 3QUSA 4ZO6A 1Z88A 5EZQA 3K0KA 3HM2A 2B7CA 2F8LA 3KYIB 5FYQA 5EWLA 2F1IA 2GN0A 2L18A 3T3EA 1ZCJA 1DCFA 3QKRA 1RRCA 1XYYA 5CMLA 2GH1A 5DKFA 2JHPA 2UUCB 4F96A 4HAZA 3P9YA 4U4AA 5B3KA 4DPKA 1SIUA 2QT1A 4FOPA 4A2QA 4Z4CA 5FTLA 4OD0A 3VZCA 1AMOA 5DTIA 3AUKA 2G4VA 2GUWA 2VAXA 1WVMA 3JQAB 4FUTA 5KSWB 4U7TB 1DRJA 1J70A 3IHKA 3Q9LA 4G36A 3GIWA 3FTNA 1EB8A 3D7KA 1RWOA 1ZK4A 2GGSA 2G1KA 3EGDA 2WU1A 4KVZA 5AW6A 4Q3BA 4MUGA 2CVFA 1UEXC 3E9NA 4WV3A 2OBNA 2ZCVA 4D4GA 3N28A 3I5YA 1TIPA 1KU0A 2A5LA 1U2GC 1OJLA 4PHTA 1M8FA 2OGZA 2EX0A 3SXUB 3EA5A 2D3TA 1UQUA 4Q3OA 2DERA 1J1UA 3NDBB 5DM70 2HBYA 4S24A 1GZHB 5HS4A 1TJ5A 2YN0A 4P5PA 2Q4TA 1N6IA 4RIHA 4R1OA 1O0BA 1GUZA 4P4SA 4RVFA 2M32A 5IT5A 2ZRAA 2WNSA 2ZQYA 3B8EA 3E1KA 4MRSA 2PVPA 4Q4AB 2NU9B 4IZHA 3TTWA 3V7WA 2QSYA 1HFEL 3BWDD 3QPVA 4JI5B 1E66A 1RC0A 1TZKA 5T8KA 3SK0A 3LZCA 3AIOA 2LWIA 3WKCA 2PLWA 2X1LA 3DV0B 3EFHA 3PXBA 3GA0A 3NX4A 3RS7A 3ANYB 1WP4A 1JDJA 4Z4HA 4RY8A 2G25A 1LBIA 3SYLA 2DBVO 5K0BA 4FM9A 1SU7A 3DVAA 4FFRA 5IMSA 1XMQB 2P9QA 1EQUA 2BVNA 2RJOA 2XNCA 1GFZA 2ZWIA 2HMSA 3QX7A 4QYSA 5LP1A 3M9WA 1W30A 3WHKA 3S81A 2MSNA 3OUTA 2DHCA 3M5DA 3V8QA 4YUWA 2WD9A 2Y2UA 4GO1A 2A30A 3D7MA 2HCBA 3B20A 3PD1A 4MGEA 1Q77A 1V35A 2H48A 2WUDA 1PGNA 1DBRA 2YFYA 4TUYA 4Q18A 5IEBA 3QUAA 4DRXB 2XDWA 5LUAA 3CX4A 4AZVA 2Z4TA 3K70D 3MERA 3GLFA 2HU5A 2A9OA 2YCBA 1YZLA 1DJPA 2PZ8A 4UHDA 3WGLA 3MM4A 2OQIA 3QV2A 4HDMA 1QGZA 5BSFA 5L7TA 4XB2A 4HGQA 1P61B 2IPMA 3B1KA 4Q39A 4AKIA 2OCBA 3PWKA 2HLHA 1R7RA 4PAOA 4C03A 3ABRB 3CUVA 2X14A 3CX8A 1GPH1 4UCWA 1GAWA 1FZTA 2CDRA 5L9AA 4HATA 1A9RA 2JFPA 421PA 4BFTA 3MS7A 5BN5B 2R7MA 4N82A 1UJ2A 4JJIA 3OLYA 4YJ2F 1SQ5A 2O8CB 4P2GA 5B1YA 2JHCA 2Y4NA 3KL4A 2J1LA 3AVPA 4L22A 1A9OA 1MOZA 3PUVA 1OT3A 3TEMA 4L28A 2G1AA 4TS1A 2JIRA 1QQ6A 3RTDA 3C3WA 1BZYA 5IJZA 2QI9C 2GYVA 3ZHTA 4TMYA 5BVGA 3E9DA 1SXHA 1EH5A 4C08A 1KI6A 3VR6H 1ZH2A 3L05A 4WXYB 4D1YA 5B30A 5K51A 3UB3A 3IEIA 1LQUA 1PDVA 3M8KA 2GDZA 3DJYA 2WLTA 3CUUA 3GFBA 3BE4A 3KBOA 3OECA 4UHHA 5DNUA 4B3RB 2VHZA 4IKOA 1H0RA 1IVNA 3OZCA 3GEPA 3W06A 4ZEOA 2Z8YM 1MJHA 1ZOSA 3GT4A 4IJUA 2AQKA 1E4EA 3HVHA 4NU8X 4RV9A 3ZZTA 1FU4A 4FU0A 4ZZIA 4DVGA 1P1HA 1K9VF 3GGOA 4WINA 1X74A 4FI3C 3RD5A 3I9NA 4BVLA 4ZV9A 5HFJA 4LGMA 4TPKA 3WLMA 1B8UA 1DOHA 2GJKA 5JTTA 1W0JD 4BY9E 3C0KA 4YPFA 1TCAA 5F98A 5FUQA 1VSVA 5F9FA 4WN9B 2WJPA 1GNRA 2G9QA 2Y92A 1ZH4A 3QWBA 2I62A 3L0IB 1U0SY 1P2DA 2IOFK 1M6WA 1RVV1 2D5BA 2CV1A 1DAGA 2CXQA 1P1RA 2E1PA 2HREA 2VIIA 4UBMA 2CMDA 5DF1A 4BCCA 5ALYA 1YGPA 3R7NA 3BXXA 2X58A 4E5MA 3GEIA 1CR6A 5D1NA 4AJOA 1UK7A 4MQFA 5HCIA 4IDBA 4J1TA 2IYAA 5GMOA 5JCZA 2CSXA 1USGA 3AEXA 4KWIA 3L7LA 4EW3A 5A03A 2ENWA 2H5LA 4KLCA 1MZVA 4BQIA 2I1VB 1FSPA 1GT91 3DMYA 1IN8A 1OSNA 1QIHA 1SC6A 2NSHA 3INGA 3KSUA 3QLEA 1F06A 3M3DA 1QRSA 8MHTA 3TRKA 1T4DA 5JS6A 5F64A 1KO4A 4B80A 4MQ6A 5IAKA 2QSZA 4HVTA 4ID9A 2O3QA 4TMTA 3AR6A 2W6MA 2X2FA 3EVCA 3JQAD 3QBJA 4NIMA 4PQRA 4Q48A 4QPZA 1R0BA 3NTUA 2H8KA 3CLSD 5ALNA 3OTHA 4RK4A 1TK3A 1MBZA 2HA4A 4FK8A 4DA8A 3Q3JB 3KX2A 4M76B 1QO0D 3M70A 1SOMA 3EISA 4PSDA 1KZ6A 2NPOA 5BYBA 3U4GA 4C22A 9MHTA 4C4OA 2PA0A 2PY6A 2O8DA 3EPHA 5KDOA 4DIFA 4HQRA 3BFPA 3S44A 1WUTA 4CKBB 4BO3A 4NAUA 4CT5A 5FWXA 4Y6PA 4C21A 4I5FA 4UNIA 1Z7GA 3GGSA 4EVRA 2WNHA 3C8HA 2X3FA 4PZCA 3V2HA 2O0LA 1E58A 4C6RA 5BQXA 1G8AA 3CR3C 3DMRA 1PJ8A 2PMCA 4P6VF 1CUXA 1KVUA 1CF4A 3TOXA 1SK9A 3HCPA 3OD5A 4MIOA 4C4AA 3W7AA 4AC9A 3MNFA 4C1BA 5IVPA 1U3CA 2WU0A 3P2JA 3NHSA 2P7IA 4JA0A 2I9PA 4CIDA 1JRLA 2KBFA 5DTMA 3KS9A 2DE0X 2HJRA 2H8GA 1H8ED 1C1DA 3DAOA 5HK9A 1U2EA 2XKKA 2UYCA 2VAVA 1NNUA 4YASA 4L5YA 2JFGA 4FFNA 3T34A 2E82A 2QLTA 2G5CA 4RZHA 4FSHA 1YZVA 2BN4A 4DMHA 1U9IA 4RNDB 3RNOA 1JXOA 5A05A 4ZALA 4ZN6A 4B8WA 4PSKA 1XHLA 3JD3A 2CXTA 3KPYA 1GTZA 1NJ5A 3QEJA 4KIWA 1LC3A 5K3CA 1TRKA 3ASYA 4PAWA 1LJLA 1PQWA 2Q1YA 1OFGA 3UW1A 2WF5A 2F90A 4KV7A 4NJEA 5I47A 3PFCA 3O93A 1EXWA 4QPPA 3CLUC 4DSNA 4ZO9A 1CZOA 4OLFA 1AS3A 2YZGA 5C9ZA 3CH5A 2H0QA 2JHFA 3GFRA 5JYCA 1GG9A 1W2HA 1U2GA 4CKWB 4CMBA 3E2MA 4X65B 4PHFA 3TQIA 3IP6A 2OKGA 4IH9A 2O7VA 1FDVA 3HFJA 2QP9X 2LZ0A 5DNCA 2OZPA 4K03A 1T8TA 2Q9CA 2VXOA 5KUTA 2C9ZA 2WKPA 1C50A 5G4KB 3P1JA 4Q93A 3O2JA 1KVRA 1LPNA 2OLJA 5DHAA 2D1TA 4HPJB 5J2UA 3RCBA 4ZYVA 3KELA 4CE6A 3JV7A 4MX8A 3U44B 3PHCA 2GPTA 2IOFA 2XGGA 4HGRA 1MOQA 1R37A 1G60A 2G70A 2H4HA 3DB2A 2PBZA 1ENZA 1W93A 2GXSA 2B36A 4XUCA 1KSHA 3MCVA 5FA8A 2P2CA 4PX5A 1W25A 2QJWA 4DR4B 1DBPA 2X13A 4K81B 4UM9B 3G0CA 2J4DA 4JC5A 3ZY3A 3D3JA 4C6SA 4HDOB 1AZLA 3ELYA 1I7DA 1FS5A 3CRRA 1PGJA 1Q91A 1T1RA 1AS0A 2Y6VA 3HDYA 4IIUA 2HSJA 3I3OA 5KREA 1E1LA 1E96A 1XCLA 1JEEA 4DDUA 1R27A 1C4XA 4LN1A 4OI4A 1VKJA 4RD3A 2FPGB 3D5QA 1NZFA 3D5TA 4Z4IA 1Z18A 3IS3A 4TRRA 4YRCA 5CA1F 3BBLA 1IPEA 1SRQA 2QX9A 2HPAA 3PKJA 3I2YX 3AL2A 4YROA 2BKLA 1ZR2A 1U3UA 3UMYA 3I0MA 4HRVA 2B3DA 2GX6A 3QBTA 4QUBA 4OGWA 4XJSA 5BOVA 4D4JA 3ZYCA 1ABFA 3LT1A 3VNBA 2TRSB 4P7KA 4Z86A 1OUMA 2X0IA 2IE0A 2YZ7A 4E88A 1CCWA 2RI1A 4G9EA 5TC4A 3WGHA 1Q7RA 2DPGA 3I8OA 1X94A 3C6BA 2JJ1D 3NEYA 2B35A 4ZOQI 2XE8A 3MUFA 1CY7A 1UBLS 3AKCA 1DZ3A 2E3JA 2PRSA 1T3ZA 1G8KA 1K9SA 1ZAKA 2GKOA 2JLSA 3RKRA 2E37A 1E2LA 3DMDA 1KH1A 1YRAA 1NVVQ 3EFEA 5BV7A 3GYGA 5A6SB 1KIFA 1DUSA 2IOQA 4W9RA 2FN8A 1PRYA 5AIAA 4OQ4A 1SVWA 5CDUA 1DX9A 1QLWA 3Q7TA 5BYKA 1UJNA 1P73A 3OZXA 1GG8A 5KJCA 3TLCA 5A2GA 4XXHA 1NC3A 2HQOA 4YRZA 2RCNA 1NR7A 1M1UA 5T6MA 3O4HA 1WLSA 1UPUA 3QU2A 2IVZA 4XM2A 2WJWA 4Q03A 1L1QA 3COWA 5AT1A 3WBBA 1RWNA 3UQZA 1L3IA 1AQUA 2Q9BA 1EFVA 1RACA 1C0PA 2YVLA 3C70A 5JRDS 2RHJA 4S1OA 3I04M 3VO2A 1Z28A 3TLXA 3NIWA 2C42A 4B74A 1S4QA 2RK6A 1LZLA 4OQMA 4G07A 1UFKA 3M6LA 5FL7D 2W6ID 5EMKA 3THYA 3D6TB 4P93A 3OETA 4AJJA 1DKUA 4FS3A 4TGLA 2OAP1 5EZ5A 1IRXA 3ZHSA 3MTQA 3ZJ5A 2QPAA 4H7IA 3GNSA 2HSWA 5HSGA 4DA7A 1Q1AA 4BX2A 3FYUC 4NBUA 2FFHA 3S7TA 1VL2A 1XF1A 4NHEA 2H1HA 4B7AA 1Y5LA 4GLLA 1KWGA 1MIOB 2WAYA 4LOAA 2HKIA 2O1WA 1RIIA 1Z0FA 4TQAA 3HUFA 3V4FA 4BE9A 4KN6A 5JSHA 5DTEA 1Z2NX 3QX3A 1YR2A 1DJLA 1EDDA 3PNSA 1J5EB 4HNAA 1JF8A 1JJIA 5BV1A 4ENUA 1DC6A 4Z0TA 2JG3A 4TYNA 3U3JA 3N59A 5LA6F 3GZTB 4QBTA 3L06A 5FF9A 4IHJA 1CR0A 2UZ1A 1SKMA 4MUHA 2AN3A 5EP1A 3L8CA 1SQGA 3BFJA 3IAEA 3P2EA 1EK6A 1JI3A 3G17A 4JN6B 5CNIA 1ID8A 1TMOA 3VNAA 1NVGA 1IIRA 1ND5A 1R5OA 3LM8A 3R40A 3W5AA 1GZVA 1X0XA 2XCLA 3PICA 4IIVA 1QUFA 1ZVQA 3JWHA 3H9GA 2XOEA 2OHJA 3L7MA 4KW7A 3PJRA 2V0NA 3BIWA 2FVYA 5K3FA 1JDZA 1FFBA 2JIZA 2PUHA 4MKZA 5CFPA 2VATA 3GH1A 1OBCA 1N1GA 1ODLA 4CM9A 2CE2X 1XMXA 2XKAA 5I6DA 2W6OA 4RW0A 2YUTA 4S1WA 1DAKA 1ZAYA 2K4MA 1F2VA 3SHVA 1YJAA 4OA8A 2C3OA 2J9RA 3U3RA 3S1SA 1ND6A 1JHXA 1ECLA 1LQ2A 3BQMB 4RYDA 1X7XB 3RJ9A 3MCAA 1L5ZA 2VAWA 3DB1A 1G9SA 1NI3A 3G59A 2ZE8A 3IDOA 5MDHA 3WL4A 2WUWE 3NHFA 4E5VA 2XGJA 3B5IA 4LX8A 4OI1A 3TLJA 2QM0A 4TKZA 1PYDA 4YCJA 2O07A 2Y05A 3HUEA 4KXQA 3GMIA 4MW6A 3OZAA 5CJPA 4Y1RB 1LNZA 1MC5A 4JEUA 3DOFA 1ZC4A 4O2BB 1NKVA 5JYEA 4ZC1A 4FDTA 5CX1B 4IINA 2QB5A 2WM8A 3WLKX 2F48A 1RR6A 2A7QA 521PA 3W4KA 4HS4A 3TRHA 1RKBA 5AJHA 1B74A 4AJEA 2R2GA 4EY7A 1T1IA 3W6PA 4AG3A 5M2QA 1CP3A 2PQMA 4UM9D 4Q3KA 2PX6A 1K6IA 2P9HA 2XCQA 2VOJA 2Z2JA 4KR3A 3HYNA 3BWYA 3IALA 3OE7D 1HDYA 2AG6A 4G2TA 2W6ZA 3MTEA 4C88A 2ON6A 5TMBA 4D9KA 4DNXA 5MN4A 3LGXA 5C7OO 4EIWA 4UM7A 2P40A 1LH0A 4AUNA 1ORRA 3E22B 2Q5IA 4QXOA 4ZYZA 5DX1A 3G0HA 4EO7A 3VOAA 1EGQA 2OP1A 3DAHA 1CY1A 3JYNA 3KJNA 4AP5A 5AM2A 2H1OA 3Q85A 3DR5A 1ML3A 1L4UA 1RAAA 2IHBA 4JBIA 3S6JA 2Q4OA 2D2EA 4JK3A 4MYDA 4PNHA 4RPCA 4XQ0A 3QLTA 3HTXA 3RIEA 3W2HA 4AECA 4LWQA 1L2TA 4OJNA 3RSHA 5BR8B 3K9FC 2HMWA 4OIMA 4XGRA 3DFZA 4LWOA 5EZYF 2YX1A 1EK1A 3TIVA 4BQEA 1KH3A 1QDEA 2B4KA 4H1HA 4NP6A 5DWVA 2P0AA 3WMRA 1W36C 1TM3E 4KLNA 2VP6A 3BCRA 3II6X 4Q16A 2XBMA 3OU7A 3UFXB 3NTXA 4HBGA 4I8XA 5TMEA 3QLJA 3ZCPA 4TLBA 2JLCA 4BLUA 4NLLA 1FNMA 4P92A 3H17A 1U5AA 3DWGA 3JQGB 1W6RA 1UC8A 3JWGA 1NYQA 3PDCA 4NU6A 1WQ1R 2VYVA 2WJGA 4GG1A 3N6XA 4XCXA 3AQ4A 3R0VA 4BJ6A 4BE7B 3TM5A 1NBOA 1L5SA 1T25A 4KV9A 1BVHA 5ECDA 4PAQA 1ZVJA 5ED4A 1T9ZA 3THXA 1LGYA 3NNDA 1D2MA 2VPPA 2OUIA 4JOQA 4C0WA 4KLAA 4NESA 4NBVA 5FBRB 3U80A 3Q2IA 1N3IA 5FWDA 3PXGA 3VU0A 3WYBA 2L2QA 3AUSA 5DM60 5IPFA 1W6UA 4ZICA 2J9GA 4TV8B 3QYJA 3W5CA 2IBTA 1MV5A 1B8PA 1BGWA 1YACA 2Y3IA 2ZROA 2RHDA 4HTFA 3EXFB 1DRKA 4BVEA 3S2YA 2F9MA 1I3LA 5EIWA 1KOGA 4PBRA 5FI3A 1HRDA 5I9BA 4DBZA 4WBNF 2DJIA 4IWXA 3OZGA 4JLWA 2PLNA 3BCHA 2OHFA 3P9QA 4DNQA 4WWHA 5DM2A 3IT3A 4FC7A 4XGNA 4IJMA 4WESB 4CEIB 2LVBA 2WM2A 3OTWA 1NRWA 2V7PA 3OF5A 2C9CA 1WV1A 4IV8A 4J2TA 2C58A 3KXPA 4Y0VA 5G3YA 4A16A 2WD7B 3PQCA 5AW4A 4R1TA 1PX0A 1E94E 2IHNA 2H08A 1AK2A 1Z34A 1RAEA 3R6LA 3NHZA 5LDGA 3BFKA 2GCGA 3QFFA 3ZBQA 1JPVA 3PA6A 2NV2B 1FQJA 2WHQA 3HWRA 2NUPB 3IP5A 4C7JA 2P41A 1PR2A 2IYWA 2XHEA 1C30A 4WX2B 1J5PA 3ZWDA 3GXOA 4HUTA 2VNSA 4X8HA 2VT6A 1YBFA 4S0ZA 5CB8A 1GAQA 1W94A 2UVPB 2CYBA 2N1BA 3L5OA 3A70A 3IAAA 3K9WA 3H8SA 2QJRA 3N2KB 2IQ5A 1IHUA 3RKUA 3ROGA 2A1TR 4M1MA 2XOKA 5EXPA 3EBLA 4A8JC 3GJ7A 2HXSA 4RHUA 2QHXA 3O8QB 4Q4DA 1AK9A 2R85A 1QR6A 4NULA 4DV4B 2G82A 2I3DA 3P71T 4BGEA 3V4RA 2X6RA 1G98A 2Q5EA 1EFKA 2VF4X 2AT1A 1I7LA 1CNFA 4UUAA 3TRFA 3ZQUA 3G5LA 2JATA 2OORC 4KI0A 1R4NB 3IAUA 1JFFA 3FPFA 3GFOA 1L7AA 1XAHA 1SA0B 5LZ2A 4IDEA 1SCKA 5IJXA 5D87A 3INTA 5TB5A 4F3CA 2GWRA 3ZC3A 5C81A 5AJWA 1R0ZA 2JAOA 5AVYA 4IQ0A 5HP4A 3LAWA 4ENSA 3F5QA 3EEYA 2FR1A 3IR6A 2QMUA 4TMWA 4M0PA 2HIHA 5TX7A 1OBVA 2P67A 1IG0A 3NOVA 4OXXA 3V7NA 5KC9A 2AFHE 1RS0A 4ZA2A 4C89A 4AN4A 3FYUA 1RBMA 3GQBB 3MMZA 5EGSA 2HA0A 5LQNA 3UK7A 1Z36A 5HWSA 2XHZA 2ZJOA 3A26A 3H42B 4BU0A 3KZCA 4JWTA 5H9WA 3KM0A 3SZMA 3PEVA 4AKSA 3M6AA 4IDPA 2JFXA 1C5KA 4TZ6A 1K5GA 3K4PA 1VI5A 1G7CA 1LV8A 3CMMA 4ZMSA 2X3UA 1XNRB 1I80A 1MJGM 1VLQA 2DG2A 4DYHA 3UXYA 1WA5A 5HQ3B 1JWLA 1OLXB 1DWQA 2YYSA 4Q1DA 5LOVB 2CVHA 3RUDA 5JEEA 3PU6A 1X15A 1HE1C 1X80A 3FWPA 1BYUA 3TJRA 1L5FA 3DVQX 4DCNA 1KEUA 1PG0A 1T4CB 2AUMA 1P6XA 2BFWA 2Z58A 3DCJA 4WK0B 1E1QA 5CM9C 2FY8A 3NV9A 5D00A 3ZIDA 4BHTA 1DXQA 1DJNA 1JIQA 1L7PA 2FEMA 3BTUA 3M6UA 3TUJC 5C8ZA 3T7EA 2EL7A 3G5TA 5AWFC 4I55B 4XPIA 3OJEA 3G8BA 2RGBA 4P35A 1E89A 3PSHA 3VR4D 2RHOA 4C2BA 3GUVA 3HJHA 1ESZA 4HQ0A 3ZDCA 4JVLA 3AETB 3EZXA 2X8AA 3JALB 5ABPA 4N18A 1FLAA