1ZD1A

Human sulfortransferase sult4a1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
272
structure length
251
Chain Sequence
GEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase 4A1
publication title Structural and chemical profiling of the human cytosolic sulfotransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 251
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.8.2.-:
pdb deposition date 2005-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zd1A00
1TQ4A 5FBRB 5BN4A 2PEYA 1TAGA 2VP6A 2WIBA 4HLCA 2VF8A 1O3YA 3AQ4A 5FOXA 3K0CA 1MO3A 4KITB 2QAGB 1W44A 4IEIA 4D0GA 3CW2A 4EPXA 1QBKC 4DCVA 4KFUA 1T9HA 4HAXA 4LUCA 1Z5ZA 2VHTA 4IHQA 4TYYA 3BH7A 2REBA 1F5NA 3C5CA 2CK3D 3LVRE 1QZXA 3I8XA 3KUDA 4D25A 2B92A 1P60A 2QRZA 4M9QA 1U0LA 2FPKA 3CH5A 3THXB 4Q1DA 1SHZA 4LBZA 3R9IA 5JECA 1JB1A 5DI3B 2XNSA 4A2WA 4D4MA 1P4SA 4B44A 2K5UA 4Z54A 3R8CA 3L0IB 2EFEB 2DYKA 4GMXA 2D74A 3CH4B 1NSTA 3O8CA 2ZQ5A 2ZRLA 1JR3A 4M1TA 2QMHA 1HH4A 1KI6A 1SVOA 3DOEA 2JASA 4GP7A 4B6FA 2C2HA 1AN0A 3K53A 4A4DA 1KO1A 2ZRGA 1IN5A 1T8TA 4NP6A 2JDIA 1F3OA 3GLGA 2OILA 3A8TA 3DEFA 1Z47A 4BLQA 1GKIA 1XPUA 2IYYA 4HLDA 4OK6A 2CEAA 4ZCLA 3EPLA 3VHXA 4E07A 1ZCAA 4CZ2A 1D2MA 3B9PA 2HDNB 4ASUD 2R6FA 3TNFA 1KJZA 2Y8EA 4C30A 2KJQA 3OEHA 1QHSA 3OF5A 3AVWA 4AWXA 5E95A 5JFGA 5TB5A 4CEIB 2AFIE 3WMGA 3VKGA 2HJVA 4YDHB 1G291 2IHBA 3IQXA 1Q20A 1UDXA 1E2KA 3NDPA 4DUGD 3LXRA 4UNRA 1D2NA 1E2HA 5JMTA 5IHPA 5L3QA 4D0LB 3ZYCA 1G8HA 3WP1B 3IBGA 1Z06A 3U2QA 4BEBA 1YU9A 4F4CA 1GL9B 3I92A 3KJEA 4BLOA 4JLKA 1AA9A 2DPXA 2EW1A 5CJPA 5BN5A 1D5CA 1JR3E 3HWSA 4LOAA 4OHWA 2OBMA 4DLZA 1UEIA 2CVHA 2Z5FA 4CEJA 3ZD7A 5JJLA 3QPWA 4LX0A 3HYTA 2J1LA 2C5LA 1F2TA 3GJ4A 5EP2A 1XPRA 5J4LA 1W36C 2D3WA 1S2MA 1XMVA 2J5XA 3C15C 2GF9A 2QE7A 4LJYA 1TF7A 1YRBA 4CGZA 1XD9A 4PO8A 2WSMA 3NKVA 1NKSA 1PLLA 4H1UA 4H1VA 2R6CA 4URXR 4G5SA 1G3QA 3KUCA 4C4PA 5JSZB 5M04A 3P20A 2IWRA 3FMIA 1HE1C 4LJAA 3GJ5A 4JLPA 4M2LA 1EGAA 2QP4A 3RSOA 1G8FA 2IHYA 1WA5A 2AK2A 3UKDA 2IXEA 5FL3A 2OCPA 2KBFA 4YQFA 1X8LA 5KNBA 4LJ9A 2B6HA 4C7OB 4LPSA 1UBGA 3EIHA 1JEDA 3UG7A 4PXAA 3HP1A 2V6IA 4Q7KA 1IN4A 1KZ7B 1XD8A 4LV6A 4C0JA 2GAAA 4JZKA 3U4QB 5ELXA 3I3SR 2ZU6A 4FCVA 4PTLA 3LRPA 4URWR 2WJGA 1KDOA 1U98A 4PZZA 1NG1A 1I2MA 4C0HA 2GCOA 5D3MB 4TL9A 4B73A 2YJTD 1VYTA 2NO1A 5C1BA 1MO6A 3R7WA 4XD7A 3VR1A 1E2EA 4FMBB 2PZEA 1ZU5A 1KIMA 4JYBA 1FZQA 3JZMA 2YWFA 2JIZD 1CS4C 2XXAA 3FPAA 1VTKA 5KUTA 5AUPB 1G1MA 1XWIA 1N5LA 4F4IA 2C04A 4V02A 1XEFA 1OXTA 5C2JB 3EZ2A 4DCNA 1Z0AA 3TVTA 2FF7A 2H8KA 3W9YA 4TQ9A 4BRWA 3PEWA 5G3YA 4PANA 4M1WA 4NDZA 2CE2X 2G0TA 4BFVA 1HT2E 3PV0A 4HLUC 1X6VA 4N1AA 4MGZR 3K0EA 2YNMA 3WHKA 2IS1A 3GLHA 2XSZD 4FIDA 1MH1A 3OZXA 3GJ6A 2C9CA 2VP2A 1KI3A 4KBFA 4LBYA 4WA7A 2D06A 1XCPA 3TE6A 4XTCS 4DIDA 4POAA 1D9XA 2Q9CA 2R6DA 5BQ5A 4KSCA 1E0SA 1HQYE 1Q3TA 2ODBA 2AX4A 2FSFA 1CRPA 3X1WA 1WRBA 2WZQA 2BMEA 2FN4A 3D7MA 3K70B 4JLNA 5HPYB 1DVRA 2A5YB 3TH5A 3SC3A 4KFRA 2CHVA 2MMCA 2X2FA 3CRW1 3MWYW 4IEEA 2GRJA 3BB1A 2A5GA 4PHHA 4Q18A 1DAIA 3BJIC 4GNKA 4JLJA 3VAAA 4LV8B 4HLUA 2ONJA 1FNMA 1R10A 1XP8A 3B13B 1OT3A 4C0AC 2C95A 1N3BA 2C9OA 3EAQA 3K09A 1OFUX 2VP9A 3AP1A 3GFPA 3VX3A 1GL6A 1SGWA 2LKDA 2Z0MA 4RZ3A 2CBZA 1AIPA 1LS1A 1G16A 1JBKA 1RZ3A 2FEOA 2R6AA 1N5KA 2XAUA 3H4MA 5H1YA 2P6RA 1U9IC 1Q1BA 4Q21A 5EP4A 4Q4HA 4A2PA 3NH6A 3LFUA 4KV9A 1A7JA 1VDZA 2G77B 2ZRMA 1JI0A 4CVNA 3WNCA 4E09A 2I3BA 1WDTA 1AQYA 4AURA 3P27A 3HDTA 1J2JA 4PX9A 4U00A 5LD2C 2HCBA 1TADA 1U81A 5DLQC 2ZSFA 2ZI5A 5HE9A 2GJAA 2YC4C 3GLHE 4DHEA 4DSOA 1BMFA 4KLZA 1HV8A 3QKRA 1R0XA 1CJUC 1IJFA 1HE8B 3GJ3A 1P72A 3O8BA 3ND8A 4P33A 4DC9A 1YZUA 1G7RA 4OHZA 2GZHA 4D26A 1LTQA 2GZAA 5FTNA 4W9MC 1G21E 3OE7D 1NN0A 4OK3A 3IILA 1SXJA 1F2UB 3I73A 2XTMA 2ZYTX 1KTVA 3NHBA 3ASYA 4QHSA 4TSFA 4V0NA 4M21A 2O8BA 3M0EA 3QIAA 4DSTA 4B74A 2VF7A 3IKJA 5EE0A 1G19A 2NO6A 2OZEA 3IGFA 3THWA 3BH0A 3OEED 1OIWA 2XB4A 3IEUA 1XMSA 3KKMA 1W7AA 3GFTA 2VP5A 1DELA 3X1ZA 3EXAA 3DM5A 4A0GA 1GUAA 4BFSA 1Z6GA 1FPMA 3K9NA 3T1QA 4IKEA 2BOVA 4G5OA 3LDAA 3CR7A 1QHNA 2QN6A 1GIAA 3A4NA 2N46A 1S4QA 2PL3A 5EE1A 2LWIA 1W47A 2YWGA 5FI0B 4JL8A 4EIWA 1N2CE 4OK5A 1VG9B 3D3QA 3FHOA 3QXJA 1W46A 4LRWA 1WQ1R 3EZFA 3AVUA 1CIPA 1LB1B 2NQ2C 2UKDA 4TMXA 1XPOA 2WKPA 4P31A 1X1SA 3MWLA 3E1SA 3FFAA 2VO1A 1HUQA 1XEWX 5KYKA 1YE8A 2ZTSA 2XZPA 3W6OA 1G5TA 1QHXA 3KKNA 4N3NA 5CLQA 4UXJA 5TY0A 3E5HA 2QY9A 4BLSA 1E1QA 1HTWA 2JJ1A 3B6EA 2VSXA 4IXMA 4TYQA 3JVVA 5K8IA 2ZJAA 2EYUA 2CLCX 1E79D 1MRSA 1W4BA 2AWNA 5CJ2A 3K0FB 4Q9HA 1XZPA 3X1XA 5JS8A 1RYFA 3GQBA 2CL7X 1W5TA 4HAWA 3CF0A 3VU9A 4WXPA 2QEQA 3MRSA 1E99A 3NBYC 4KBGA 5H8WA 3C7KA 2Q6TA 4D81A 5FL7A 4DJTA 3CKLA 1AK2A 3GLIB 1JAHA 5HKKA 1KK3A 2OAQ1 1YR9A 4NCJA 1T3LA 3UPUA 4YDSA 1NKTA 2YKGA 2IS4A 2O8DB 2J7PA 3IIMA 2FJUA 4I1OA 4JIMA 2AR7A 3DZDA 3LQRA 1AZSC 3Q9LA 5BWMA 1Z07A 5FTLA 3CONA 3FKQA 4NYIQ 3RLFA 2R9VA 2J0UA 3LVQE 2ZYVX 3SNHA 4D6PA 2VA8A 3TR0A 2OM2A 2GHIA 1FMJA 3ADDA 2XTZA 3GJ7A 2JLSA 3QY0A 1KSJA 1SHKA 4OHVA 4CEHA 3NWJA 3WNBA 3B82A 1GOTA 3FB4A 4IOKA 2G1JA 3ZJYA 3EZ9A 2CCJA 5AK0A 4A15A 1FP6A 1YR8A 3DHWC 1P6XA 4BFYA 4PHFA 3IIJA 1XDBA 5KO2A 4XD7D 2QA5A 2QP3A 4B47A 1QHIA 4S35A 4I81A 3A4LA 3TQCA 1HT1E 3FVQA 2GF0A 1ZD9A 2BEJA 4EJSB 2BBOA 1XD2B 2ZRPA 1SVMA 3A37A 1KK1A 3I8SA 3IIKA 4M53A 5KSOA 2OO7A 2ODNA 2ZJOA 2HJGA 2AXNA 2CK3A 4HB2A 3KFVA 3TSWA 4Q19A 1KK2A 4LYFA 4KYIB 4DLUA 3QXHA 1KSGA 3H1TA 4A8JB 3AVXA 2PH1A 1L4UA 2XX3A 3F0TA 1DAKA 2ANCA 4M1OA 1DOAA 3ZS8A 2Q9AA 2FPLA 1GDDA 1IY2A 1EESA 4R2HA 1ZRHA 2IUUA 1QHGA 1KZGB 2Q0HA 2D62A 2LKCA 5EXXA 3B78A 2V3CC 1G5RA 1XU4A 1KNQA 1COWD 1NF3A 1TPZA 2RHDA 3QXXA 2WVJA 3VR3A 4NMMA 3K8YA 3MLEA 2XB2A 4LHWA 1N0UA 2FFQA 2WOJA 4P0TA 2F1HA 2JATA 2W2VA 3N2IA 1OSNA 1ZW6A 1IN8A 1OIXA 4KODA 3A1VA 2BWJA 3AVTA 1LNZA 3T1TA 3TIFA 3SJBA 4TZ0A 2JA1A 1AZTA 4YXWD 3AUYA 2B8TA 2NZ8A 2QBYB 4ASUA 3UG6A 2CVFA 3QKUA 5TVKA 3LD9A 3MCAA 4GOJA 2VBCA 4B3XA 3AF1A 1LW7A 2AD5A 4NE2A 1T4GA 3MD0A 3L8YA 1LF0A 3N2EA 1W2GA 4XTRA 2PJRA 1BO6A 2EQBA 3ONWA 4MGKR 2AKYA 2HXYA 3SYNA 3V00A 1XTJA 1JPJA 4DUGA 3C5HA 1FFHA 3BFVA 5IRCD 1ZBDA 1TU3A 2F3TA 1BMFD 1GITA 3VR4A 1IY0A 2DY1A 1FUUA 5DE3A 4LBWA 3KDSE 5AUOB 1NLFA 1PV4A 4DDTA 5FOUA 3OHMA 5EE5B 3Q8XB 3UMRA 3CRRA 3FDIA 4HDCA 1Q1ZA 1Z3IX 2ZJ2A 4BZQA 4GPTA 4BLTA 1H65A 2PZFA 1JNYA 1W4CA 2BBSA 4EPYA 1SXJD 4EDHA 4MRSA 4O0MA 4TSFD 2VP4A 4OQFA 5GJCA 1GWNA 2X19A 5J40A 3LV8A 3VMFA 1ZYUA 3ZD6A 1SULA 4KFTA 3BH6A 4RCYA 5FUWA 1OH8A 5JZVA 2ZE7A 3K0SA 1ZAKA 1O87A 2J46A 4GSYA 4B48A 3W34A 2IW3A 4FCWA 5CDFE 3V4RA 3OIYA 5SZIA 3BWDD 3U5ZB 1PJRA 1Q57A 3SDZA 4S2EA 1VMAA 2ZYUX 5SZKB 1GRRA 2C78A 2RGBA 4NCNA 5UKDA 3UATA 3CNLA 1NVXQ 1TX4B 2ZPTX 3DPUA 2HEIA 3FMOB 4F92B 1DBSA 3CWZA 2FEMA 1SKQA 4NPHA 4W7SA 2IX3A 4F38A 2P3SA 2C03A 2EFGA 1X8JA 4US1R 2O8EA 2DWPA 3CIOA 4AIIA 4NONA 4AG6A 5LDDC 3U7EB 2Z43A 4PC2A 4Q7LA 1NY6A 2QM7A 1G8GA 4FD2A 1D9ZA 3X1DA 4O3MA 5TARA 2MMGA 4MRVA 1Q22A 3KKOA 3PUYA 1BKDR 2V4ZA 4KAXA 4Q1CA 4ZKDA 2ZRNA 2GK7A 3K0AB 4GOKA 5HTKA 1GVNB 4HZUB 1AJEA 3SJCA 3F8TA 3LNCA 3QXCA 3B8HA 2ZRJA 2FGKA 5CM9C 2YOFA 4NTZA 2JJ1D 1NIPA 2H1LA 4TL8A 2ORVA 3SFVA 1PUIA 1E9CA 4DLVA 4G01B 4C0QC 2IBMA 2FU5C 2GJ8A 1E4VA 4DCTA 5FTMA 4ZIRA 4LCBA 2N1BA 3OESA 5CYPA 3T5DA 3FGNA 2GEDA 4UNSA 5FBLB 1R8SA 2MSEB 4F93B 3BFKA 3QG5A 2P2LA 4JL6A 4B2IA 1S8FA 1FP7A 1IXSB 1W0KA 3E70C 2ZSEA 4HEJA 1E9DA 2L0XA 4B3BA 1I4TD 4PHTA 5HKKD 4CDGA 2XSZA 4HAYA 3KKPA 5GVRA 1GM5A 3UANA 4XIGS 1VHLA 3MMPA 3KQKA 3CLVA 2FV8A 4PQFA 3QKTA 3KX2A 1BOFA 3GEEA 2ZRBA 2ZSDA 3JVUA 4Q9KA 1Q1EA 3PUVA 4W5JA 2YWHA 1XZQA 2V8OA 3K0CC 3PIRA 1R5BA 5TMPA 1HYQA 1LY1A 4WZAE 1UADA 2IXGA 4YONB 5DH9A 1YRAA 4QGGA 2FH5B 1FL9A 3RRMA 4UJ3A 2J87A 2WV9A 2CJWB 4EPWA 4LY6A 2JLXA 3HPRA 3PUXA 4PQRA 2O0JA 4QBIA 1KY3A 1IXZA 4XWAA 4M9SA 5DSZA 4PPGA 3ZZUA 1XXHA 5DHFA 4AI6A 3UK6A 2KI5A 4TLDA 1NI3A 1WF3A 3RC3A 3UMFA 3Q72A 2F9LA 1GRQA 3UXMA 1GNQA 3FKSD 4ITRC 4B3FX 4M9XA 3QVVA 3RRYA 2FZLA 5KTYA 5KDDA 1I2DA 2IS2A 3P4XA 2DFLA 2GZDA 2RAPA 1KMHA 4E03A 2IA5A 2QAGC 5JS7A 1J7KA 1KSHA 1Z2AA 3HU1A 1FX0B 421PA 2G88A 2Q21A 2WICA 3PEVA 5A5GA 4FXPA 4HSEA 2C8VA 2YOGA 221PA 5JWHA 2IYTA 2TMKA 1CTQA 1T91A 1U8YA 1NMYA 1ZIOA 4QBHA 2J0QA 4IJMA 4IFBA 3LQQA 5BN3A 2QSYA 3ADBA 2C99A 3LBNA 2PCJA 3OE7A 3PEUA 5CIQA 1RPZA 1OV4A 1E98A 1U8AA 2Q3FA 1P2UA 2QPOA 3RANA 4A6XA 5FPSA 4LJ4A 2ZE6A 2ZUBA 521PA 1ZINA 1DO0A 1GSIA 1DARA 1R8QA 2XITA 3AEZA 5KPDA 1E96A 3SYLA 3QF4B 2QAGA 4B6EA 3OEEA 2GCPA 1YZTA 4F91B 5ANRB 3SQWA 1IN7A 4HAUA 1EFUA 1QVRA 3VTKA 4LJ8A 3TK1A 2RGEA 5L8VA 2VL7A 2X8AA 4JLMA 2H57A 3ETLA 3K9LA 4PAQA 3K9HA 2ZAMA 2HYIC 1XXHE 2FFHA 3C4JA 2IYWA 3L0SA 3PG5A 3THYB 3IO3A 4QJ3A 3U7HB 3THXA 1TF5A 4I4LA 3CF6R 2GCNA 2OBLA 2Z6VA 3B7GA 4JLDA 2OFXA 4JT4A 2IYQA 1SVIA 4LI0A 4UQOA 5DI3A 3BFXA 2RCNA 3AKYA 2PCLA 1VG0B 4Q01A 1TNDA 1XX6A 2CNWA 1OLOA 4PC6A 5KSZA 4KU4A 3VQTA 3AH8A 1II8B 3AF3A 2PMDA 5JRJA 1OE0A 4F7WA 1FUKA 1U90A 2PJZA 3RS4A 1JJ7A 1KJWA 1M2OB 1FMLA 3IPXA 4H9GA 4LYAA 5FTKA 4Q4JB 3KKQA 4GRAA 4I99A 3U6KA 1DTSA 4OHYA 4UNQA 3ZZTA 2EFCB 2P6NA 3WY9A 3ADCA 3ICQB 2JEOA 1N6IA 4B43A 3NIBA 2CE7A 1MABA 3EZ6A 1WXQA 5FFMA 5CB8A 1XFAA 4WOPA 2VTKA 3VX4A 3QF7A 3LH5A 1E79A 1G64A 2P5SA 1ZIPA 1IHUA 1OXSC 3H86A 3ZVLA 2NG1A 3KQHA 1M34E 2HUPA 4A9AA 3GEIA 4MKFA 5G40A 3T5GA 3GLGE 4CEIA 5FOSA 4E22A 2CMKA 2ZRCA 2UZ3A 1NVVR 3QXSA 1WBDA 3BBPA 1PVOA 5AWFC 1E9EA 4JBXA 1T0JB 2SHKA 4WW0A 1Q0UA 1UKVY 1I4DD 3BXZA 3ND9A 1R2QA 3BIFA 4M8NE 4A6PA 3ZVRA 1W36B 2QGZA 1CLUA 3QEJA 3OFND 5FPHA 2YINC 1Q12A 1K6MA 4JJKA 1Z22A 1ZM2A 3EASA 1JPNA 3LA6A 3I5YA 2GEUA 4MGIR 4NH0A 5KDOA 4PC7A 4DZZA 2ZJBA 5FR2A 3Q5DA 2CL0X 4KHZA 5EXPA 4HB3A 2W58A 2Q3MA 1Z0IA 4JVLA 3EWAA 1NY5A 4AK9A 3RNLA 4QNMA 1N6LA 2QQEA 3PCRB 3M4YA 1E2GA 1ZCBA 4DSUA 4CT5A 3SQXA 4IVQA 1RYHA 1V5WA 2DFNA 2FMXA 1CJMA 4ZCMA 2V7QD 3VR2A 3B1WA 1M6NA 1GG2A 2PX0A 5JSZA 2OV2A 2HT6A 5JWOA 3EA0A 2GVZC 3Q7PA 1ZP6A 1ELOA 4FCTA 2FSIA 4B33A 5F98A 1KO4A 1IAQA 4OI1A 4IDNA 4OQLA 1Q3HA 2Q9BA 4L9SA 3LX5A 3D31A 1E2PA 1XEWY 4R7ZA 5DISB 1E69A 1MT0A 3GMTA 5J4YA 5FPTA 2IYLD 4UJ5A 2JLZA 2PZGA 4JVMA 1CJTC 2WMNB 4ZPXA 4BZXA 4C7OA 3GLHB 1AKEA 3T1OA 4JLVA 2B7BA 1W0KD 1JQLB 4CW7A 4TYNA 2ZUCA 1XBTA 3WBJA 2C96A 2JJ8A 3U4QA 1EX6A 1GZSA 4ZDKA 4EAQA 3IEVA 4BPBA 5JHGB 3K09C 4RD6A 3UIEA 3CZPA 2J9RA 1P9RA 4KI0A 4RKFA 1MV5A 5D3MA 3TLXA 3O8RA 2VSOA 3AVYA 4AG5A 5FTJA 1SVKA 1OH6A 2PLRA 3TUZC 4MQBA 5EE3A 1IY1A 1OFTA 2ZVQX 4Q4AB 1XTIA 1COWA 1KKMA 2JLRA 2G9NA 2GWHA 5EZ5A 2REXB 2X1VA 1FTSA 2XNDD 4JYCA 2J3EA 1Q1QA 5A0FA 1W49A 3HR8A 3RS5A 2BCJQ 2PT7A 4QG7A 4DT1B 4EQ6B 3RWMB 2E9SA 3EC1A 4LJ5A 5CYOA 4YXWA 3KJHA 4DKXA 1NNEA 4FMDF 1A4RA 5B2ZA 2A3RA 2JLVA 4KJZA 2AHOA 2V9PA 1XJQA 1CRQA 1DPFA 1ZM3A 3KJGA 4XH9B 1EWRA 121PA 1ODFA 3WYGA 3PITA 1SXJC 4OHXA 2NPFA 3GLFB 2JLUA 2R6GA 1KI2A 4B3CA 4O25A 1G41A 2A78A 2BJWA 4RY2A 1E4YA 1L7VC 3AP3A 3L0OA 2GESA 3F5FA 3LLUA 2WWGA 5DYIA 3DMDA 2WWHA 4TTQA 1WP9A 2J0VA 5B57C 1K8RA 4DIEA 4YMUA 5J4HA 3KB1A 1TEXA 5B30A 4ZDJA 4ON9A 5FUXA 2GVDC 4BFWA 3K9GA 2ZSBA 1LVGA 3L8ZA 3DO6A 5JCPA 1CJVC 1OPXA 4TN1A 5K8TA 4RCZA 3VFDA 5LD2B 1CEEA 1NVWQ 1X8KA 1I4LD 1KDPA 1HQCA 4IDPA 621PA 3U7FB 2ZRAA 4X8OA 5JRZA 1G5PA 3SJAA 2IC5A 5HR5A 5C4MA 3QKSA 3QG1A 3S1AB 1YZKA 2YHSA 4EFLA 4R98A 1WBBA 3BE4A 3BK7A 1VCNA 3AF2A 2ZE8A 1G3MA 1Z8FA 2BDTA 5FBWB 4DLRA 1Z0JA 3HYRA 5IK2A 4MH0R 2ZROA 1Q44A 1JALA 5TV2A 1UBEA 4BFUA 3GFOA 1DADA 3B60A 2WKRA 1E9SA 4TMZA 3A4MA 1LV7A 3AV0B 4PSKA 4DDWA 1CP2A 4QKQA 3QI2A 4OKSA 3A6PC 3AF0A 2GAOA 2WSSA 1VIYA 2RH5A 2CNWD 2IL1A 3MJHA 1F2UA 2FWRA 2ERYA 1RE0A 3K1JA 2BKEA 3NVAA 2F1IA 1JJVA 1MO4A 2GTPA 2DCUA 1E1RD 4PZLA 4UNPA 3TUIC 4D2IA 1ZVQA 1PZNA 4TL7A 1NVVQ 2F1RA 3ZLJA 4RSGA 3D6TB 3NTUA 5FBQB 1KDRA 2P67A 2GJKA 4KCGA 2WPDD 4WIAA 1SXJE 4GFDA 1XEXB 2ONKA 2D4HA 2CL6X 2WMOB 4V0LA 1JR6A 1IQPA 3TJZA 2V1UA 1QHHB 3GD7A 5KNDA 1ZD8A 5LB2A 1E2MA 2R65A 2F43B 2C77A 1US8B 1X3SA 1Y3AA 3TQFA 5CB6A 2W83A 1RKBA 4M1YA 1E2NA 1RVDA 2QP9X 5AJXA 4KSBA 2DR3A 1CKEA 3U6BA 1OH7A 4DB2A 3MWJA 5BYJA 5EUMA 2HXSA 2A7QA 1N25A 1XJCA 3HU2A 4GZMA 2QT1A 2H16A 1N0WA 3LBHA 2GA8A 1IXRC 2A30A 1G7SA 5AJZA 3TMKA 5J4VA 4AKEA 1AS2A 1NBMD 3C8UA 5HZHA 3LW8A 4PC3A 5FI1B 3SBEA 2UVQA 2BM0A 1B23P 3TW8B 4HAVA 1RRCA 4JMPA 1L4YA 1AQUA 1QF9A 3OAAD 2P5TB 1R0ZA 2RGXA 4GI7A 5LPNA 2XZLA 4I1VA 3B1YA 4HUQB 3K0FA 1XCGB 4HI0E 1FQJA 1ZMXA 4CIDA 1UJ2A 2X2EA 3KTAB 4YC7A 5HE8A 4URZR 1CR4A 4JJZA 3LAWA 4NCKA 1Z2CA 5DYGA 5JLJA 1Z0FA 4MDFA 1GKYA 2OEPA 4RFVA 3LXXA 2AD1A 3WP0A 3GLIA 1IM2A 3WRYC 3L43A 3M6AA 4O2LA 5HZKA 4NCHA 1NN1A 2O8DA 2EVWX 1F60A 1BYUA 4HDOB 3G5UA 3VNVA 5CIWA 5JEEA 3PJRA 4AC9A 4R2IA 4LZZA 5FR1A 5DI9A 1E2IA 3FKSA 1UKYA 2AL7A 3T15A 4D80A 4B3GA 3AGPA 3CRVA 4TTRA 1C4OA 3RDPA 2DBYA 3O47A 3CX6A 4EJSC 2LCFA 4Y0VA 2J7KA 5E3HA 1L2TA 4Q4LA 2ZR7A 4GT1A 3IHWA 3BERA 5JBQA 3QENA 1WCV1 3SE0A 4JVNA 1P5ZB 2HYDA 2RGGA 2GJSA 5F9FA 1DEKA 4IDOA 1HY3A 2ZI4A 3ZZ0A 2JLWA 1CR2A 2IYVA 2Z4RA 3CNNA 3G82C 2BEKA 3RRNA 3BRWD 1SKYE 2B21A 3WRXC 2EWWA 5L3SB 1E2FA 3PR1A 1OH5A 3DL0A 5FPKA 3NC1C 5E7JA 3TSZA 1H8EA 2ZI7A 2ECKA 4OI4A 1U0JA 1BYIA 3DKPA 1RRFA 4LJ6A 5G3ZA 4US2R 1XTKA 1OYWA 3SFZA 4DBLC 3MG9A 5P21A 2W6JA 4Z1MD 1XJ0A 4EJSA 4Q1FA 1XD2A 4NYMR 3T1VA 4IVPA 1T8UA 3RRZA 4PSVA 3AUXA 4JS0A 1ZM9A 1VYVA 4MITA 1BH2A 1N6NA 1M7HA 1RFLA 4KXFB 3BGWA 2QTHA 1TUEA 2ATVA 4OJKA 3ZDQA 2WTUA 1S3GA 5G53C 2WWFA 2IF2A 3U44B 3BOSA 2NOAA 2OCBA 1E0JA 1NRJB 1N0VC 3SS8A 4A2QA 3ZGXA 4UNNA 4MUBA 4D4LA 4XOIA 1VKJA 2QENA 3CBQA 3BD9A 3SU8A 1XRJA 3E2IA 3ZVMA 4BASA 3ECCA 1N6RA 4A0HA 4BZPA 2FX3A 2W0SA 4PPQA 3C14C 4WZBE 3CR8A 5GJBA 3FTQA 4OI2A 1R6BX 4XWOA 3SN6A 4DB4A 4ILEA 3K70D 1G6HA 1E9AA 1ETUA 1IJEA 5EUQB 3N70A 4MKGA 1UEJA 4DVGA 1NJGA 2XTNA 1E2QA 4RFSB 4YMWA 1P75A 4ARZB 3LO5A 3Q3JB 1J8YF 2W2TA 4QC2A 2AWOA 3A1TA 4QHYA 1E9FA 4ZDWA 2D7CA 2OE2A 1A2BA 1T0HB 2OFOA 4GZLA 2KSQA 4LK2A 2CLDX 1KJYA 1CR0A 3UWOA 2QBYA 4LHYA 4OYHA 1OB5A 2D7DA 4AKHA 2ZS9A 3H2YA 5D3QA 5EP1A 4OQNA 3QNUA 2V55B 3X2SA 1E0AA 4LHZA 4NBSA 1TEVA 4AYXA 3DMNA 3CB4A 3I72A 1NVUQ 1N6HA 3CNOA 2IYRA 3EWSA 3DDCA 3KFXA 3QBVA 1YZGA 2UZIR 721PA 2WBLC 3FFBA 5DGXA 2BKUA 3OFNA 2O0KA 5IK2D 3GP8A 4A82A 2QTFA 4BFXA 1Z6TA 3Q85A 1VIAA 4PPFA 4R9UC 2VLIA 4AD8A 3NEYA 3GCGA 2D2FA 1B0UA 4YLGA 5EJEA 2XJ4A 2OT3B 5C18A 3SYKA 4Q1EA 2WSSD 1RC8A 5IDVA 1GAJA 5SZHB 3A1SA 3W8RA 3LY5A 2A5JA 4EPTA 3BAFA 2IUSA 3D8BA 4M0LA 1VECA 2IS6A 4CF7A 2D2EA 2ERXA 3Q7QA 2IYUA 1TL7C 4U5XA 4X8LA 4E5UA 2YOHA 2XEXA 1DO2A 3P32A 2O8FB 5L3VA 4M1SA 2V7QA 5IF9A 1KHTA 3ZQJA 3TGPA 2ZE5A 2G3YA 4PZYA 3ASZA 1E9RA 1VG1A 4P4SB 1Z0KA 2E87A 4JLAA 3BB3A 4C0LA 4RD1A 3SJZA 4F4JA 1KOFA 2X77A 4NHOA 1A1VA 4V03A 4C0KA 2JCSA 1Z0DA 1KI1A 2AKAB 3O8DA 1RJ9A 4Q66C 3P4YA 1GRNA 4P3YA 4DLTA 4Q7MB 2FPMA 2O8CB 1ZM4A 1VHTA 3TKLA 2FSHA 2PBRA 4PO9A 5CM8B 3T34A 2ODEA 4ZV4A 2EFDB 1S96A 2HCJB 3B85A 2OSBA 3IUYA 2PT5A 4XWKA 4HB0A 1H8HD 2IYXA 4FMCB 2W00A 3OIVA 4IDQA 1W1WA 2R44A 5AUNB 1RW4A 3K0AA 4R71A 4HZUA 1G20E 3DOFA 4Z8YA 3UMSA 4D4KA 1KI4A 4DXAA 2PX3A 3FMPB 4GMDA 5KSPA 4Q9JA 1KI7A 1EFRA 2ZJYA 4AKIA 3U3KA 3LWNA 1AS3A 4B71A 1CJKC 2ODWA 1C9KA 4EPRA 3TR5A 4TQUS 2B7CA 2VHQA 4FINA 2GXAA 1S9DA 2W0MA 1G8YA 3MSXA 1GFIA 2XNDA 4G1UC 2ZANA 1OKKA 1G3IA 3EG5A 3SEAA 3P26A 5JHHB 4AY2A 1FTNA 2OXCA 1WB9A 1P9NA 4BE7B 2GNOA 4Q02A 4M22A 4Q7JB 4TLBA 2YWEA 1BIFA 3CPEA 2JLQA 2V1XA 4BGDA 4I1SA 2ZM5A 3B1VA 4IRUB 4RJLA 3RHFA 3DKVA 1W4RA 1A82A 1ZC4A 1ESNA 1PUJA 1Z6XA 2JJ2D 5J47A 4KVGA 4V0OA 1F48A 1SVWA 1ZNXA 2QI9C 4JBYA 4LGMA 2IUTA 1S1CA 4WBSA 3PQCA 1XNJA 4BQSA 2FOLA 2ZJ5A 1XB2A 4LHXA 4IOJA 2BIFA 5KU1A 4QXAA 4ACBA 5AUQA 1JXOA 2GBLC 4NYJR 2ZITA 2CJWA 2G1KA 2DHRA 4NYMQ 5LB4A 2GK6A 3GJXC 3QOFA 1R5NA 1U8ZA 1PLKA 1KI6B 2ORIA 1R0WA 4FWTA 2WKQA 2HT1A 1W5SA 2QG6A 3RWOA 4ZO4A 2WHXA 1N5IA 2ZRIA 2WAYA 3SR0A 4LWZA 5CITA 2FDCA 4N0EA 1T5IA 2RGNC 3WMEA 3GLGB 4RVCA 5DN6D 5AJVB 2NO7A 1H8ED 4A1FA 4QNRA 4B76A 3W8NA 5BXQC 2VP0A 8OHMA 5KPJA 1IONA 1UAAA 4IVRA 4MDEA 2PEZA 1QHYA 2IK8A 2W6JD 2OBNA 2J0SA 3HR7A 4EUNA 1MKYA 4MYHA 4Q1AA 2GBLA 2HV8A 5GJWC 4C0BA 1KKLA 1FX0A 4QJ5A 3TVDA 1Y63A 4DLWA 4WVFA 4OI0A 4LYJA 4MYTA 3LLMA 1QG2A 4GP6A 1KY2A 1E32A 3AKCA 2OCYC 5KOYA 1JECA 4B34A 4LC0A 1UKEA 2W2XA 3KB2A 1E3MA 3CWQA 3B5JA 2QZ4A 2RGNA 1TQ2A 4BECA 5JJIA 1OXUA 4B32A 4C3ZA 5L3QB 1TTTA 1TU4A 2ZS7A 2AXPA 1N6PA 3J81k 1A5TA 2ZXUA 1DS6A 2CLSA 3HJNA 1OJLA 1UM8A 2QPTA 4OBEA 4EFMA 4B75A 1S0UA 4CT4B 2QQ0A 1JAIA 4IFEA 2ZRKA 3AM1A 1EXMA 4D0NA 2NPIA 1E1RA 2ZRFA 3QF4A 2WAXA 1NN3A 1MABB 1YZLA 1U2RA 4XVQA 4CEJB 3FE2A 1FOEB 2NO0A 3KXLA 1K5GA 4UXHA 1F2TB 2Z83A 4DSNA 4ESVA 5F2EA 5G41A 2WPDA 2OCAA 4DDUA 3VHLB 3B9QA 5CLLA 2H7VA 1NMXA 1YVDA 4A36A 3THYA 3EIQA 2WM9B 4GDFA 5EXTA 4HYYA 2E1RA 4URYR 3R9WA 2GXQA 4Z51A 5EZ6B 4HATA 1Z63A 3I5XA 2GETA 2ZU0C 4BFZA 4GOXA 4AYTA 1OIVA 1G4AE 1OFIA 4URUR 4RZ2A 3TW4A 5JEDA 2ANBA 1SQ5A 5B58C 1II8A 1XCMA 1CR1A 1WMSA 1GTVA 4M9ZA 3A1WA 1JEEA 3V9PA 4LJ7A 3M1IA 3ZH9B 2HF9A 4Q4JA 1AS0A 1Z83A 4TT3D 5H70A 2JAQA 1M8PA 1OW3B 4MYCA 1NBMA 5TDHA 4I1UA 2BMDA 2CHQA 3CX8A 5L3RA 1OB2A 4CYMA 3IQWA 1ZNZA 4U7DA 3EPKA 2H17A 1IN6A 2BC9A 3AKDA 3IBYA 3QEOA 5DHAA 4PR0A 3MFYA 3U7GA 3OAAA 1KYIA 2FFBA 2NZJA 3X1YA 2XOKD 1W0JD 3CZQA 4CRWB 1NP6A 2H18A 3T06B 2GCOB 4NCIA 2QT0A 3C41J 5B64A 2I1VB 5C46F 4PFSA 2RGAA 4M1KA 3R7WB 1KO7A 4K8OA 2ASEA 1P62B 4ACAA 1G9XA 1Q21A 2QORA 2XXAB 4KVAA 4N0DA 5K8UA 3QPUA 4PAMA 3T35A 2VH5R 1DAEA 3CUEF 4TTPA 3RC8A 4DDVA 4PHGA 4PSAA 2WJHA 4HLQB 3NG1A 1J90A 3NDBB 1NIJA 2ZJ8A 3EW9A 4MKIA 3W3ZB 3SHFA 2VRWA 1QG4A 3U3MA 4ZCIA 3FHTA 2NO9A 4MRNA 1T3HA 3L82B 1KO5A 1FNNA 5FPYA 2RHMA 1G17A 1QDEA 4QJ4A 3RS3A 4NYIR 3CRQA 1M1YE 1NBME 4IOLA 2BMFA 2MSDB 4MYUA 2QRNA 3EARA 1P2VA 1GKUB 5FUVA 2KB0A 2G83A 3R8FA 5AJYA 2EU8A 2DFKB 4TQAA 3DVLA 3N5CA 4HZIA 2NTYC 1HEIA 4Z8XA 4Q48A 1A2KC 1GL7A 4K81B 3AVQA 1D8TA 4LPKA 5E7MA 2OAP1 3FYHA 5F3WB 1EFRD 2BJVA 2Z4SA 3A36A 2F7SA 3SOPA 4QBGB 4Z1MA 3TBKA 2BMJA 2GDJA 4ZI3A 5DO9A 2C98A 4YMTA 3VNUA 2FA9A 3U3RA 1OHHA 3K70C 1TF2A 1P9WA 2F9MA 3B1ZA 1OKKD 1SZPA 2WJJA 3FHCB 1W4AA 5TXGA 4L5BA 1RRPA 5KDLA 1SVSA 2P0EA 3SI7A 1M74A 4D4JA 3IDQA 1GILA 3ADKA 4Q4HB 2A2ZA 2W6ID 3T12A 1GNPA 3WMFA 3VKHA 1E2DA 2O0HA 2ZYWX 4NYJQ 1EG7A 4OJQA 2HLDD 4DLYA 4P32A 1Z29A 2YV5A 2FNAA 1OXVA 1YZQA 4JKYA 4UXIA 2F1JA 4KYUA 3QJYA 2GKSA 2ZRHA 1YHNA 1EFCA 2QUZA 2OLKA 4Q9IA 3QKRB 2ZIAA 2HF8A 1ANKA 4V0MA 1N5JA 4Q4AA 5J4KA 2F6RA 3NBZC 3TSOA 5CK4A 4QBFA 5HCNA 5IT5A 4BRUA 5DNYB 3GPLA 5FUYA 3QPVA 1RIFA 2QMOA 4J0QA 3I32A 2KBEA 3RS0A 2ZR9A 4YMVA 3L2OB 4B2PA 1UPTA 1BS1A 1OXXK 1SXJB 4QGAA 2ZI9A 1S9HA 2O8BB 3QKSB 1U99A 3PFIA 4DT1A 4EQ6A 4ZDIA 4U02A 2ZI6A 4WAUA 1DAGA 4OL0A 3W6PA 1ZC3A 3DZ8A 2IWHA 3BC1A 4L8GA 3I4LA 1F6BA 3THWB 1ZD1A 1T5LA 1EK0A 1VCIA 2ZEJA 4MGYR 1YKSA 1CBUA 1DE0A 3W3AA 2VHCA 5GJVC 4UKDA 1YJ5A 1AM4D 1IOZA 1SVLA 2OESA 3CX7A 4TYPA 5FOTA 2CHGA 1TUIA 3GLFA 4Q03A 4RD2A 1R5OA 4BUJA 3EC2A 3CF2A 1P61B 2RGCA 1FQKA 2WWYA 5J5CA 2OLJA 4TMVA 3SHWA 1P2TA 2CCGA 1ZNWA 3I61A 1ZNYA 4DRZA 2JLYA 2NIPA 2ZETA 2QM8A 1HA3A 2OHFA 1DG3A 1K5DA 1U9IA 2CDNA 4GBMA 4ABYA 3FOZA 2AN9A 1JR3D 3R20A 1GNRA 2IT1A 3MJRA 3EPJA 2DFTA 5LBIA 4DLXA 3GJ8A 3CRMA 2VSFA 2ATXA 2J45A 4V0ME 5AJWA 1RRGA 1UBFA 1E0KA 2MSCB 3I62A 1W48A 2JDID 2IF0A 1KI8A 2CCKA 2VPPA 1TMKA 4NU0A 3S1AA 4FI3C 3VR5A 3F3YA 4OQMA 2ZAOA 4X8HA 4XVRA 4EKDA 4EPVA 3KQUA 3BB4A 1KI9A 1NJFA 4RZUA 1G6OA 2BCGY 4QM7A 4JKIA 2I4IA 1AKYA 1G4UR 1XMJA 2RGDA 3PUZA 2C9YA 3OEHD 2BM1A 1YR7A 2EYQA 2QPAA 4RD4A 4FW9A 5EE9A 1Z6AA 1V43A 4MRRA 2GJ9A 3VU9B 5JCZA 3NBFA 4JVSB 3RABA 5JI2E 1N6KA 1KDTA 3AP2A 4TLAA 3GLFE 4YMSA 4HAZA 2QNRA 4IOMA 3U60B 2QROA 3LBIA 2QMUA 1J8MF 4QGHA 3NEJA 1CF4A 3RYTC 4EFNA 1ZU4A 4RD0A 4NKRA 3LX8A 4Q00A 2XZOA 3C16C 1FW6A 1KO8A 4V0KA 1ZUHA 1H8HA 2G0NA 2J0UB 1R4AA 1SKYB 5C4GB 2OUKA 4NZYA 4WXRA 3IPYA 4JSTA 3PEYA 1TQ6A 1VYUA 1D6JA 2P65A 4Y0AA 1LS6A 2A9KA 4PQYA 5EP3A 1J99A 1XEXA 1LFDB 4QHTA 2QE7D 2FFAA 1L8QA 1P2SA 2BHRA 4FMDB 4KFSA 4XJXA 3B2EA 3QVUA 4BEJA 4G3XA 4CEHB 3G0HA 1QHHA 2CXXA 3THOA 2VEDA 5KNCA 3BORA 1OFHA 4PC1A 2F43A 2V6JA 3U3JA 4TZ6A 1US8A 5H68A 3QE0A 3QUSA 4LDJA 3A58B 3OIUA 2R2AA 4HUTA 4ERNA 1NLYA 2B8WA 5FOWA 2ZRDA 3ZIAA 4KO8A 4JLBA 4P4UA 1LF5A 2ZS8A 1W36D 2JJ2A 2DWQA 5EQTA 2KE5A 4Q9LA 4ZKEA 1YZNA 1CULC 1C1YA 3EZ7A 4PAOA 4Q1BA 3TAUA 4DLSA 4TMWA 3W6NA 1NSFA 2P6UA 3WYAA 2VHJA 3WXMA 1ZUIA 4XSGA 2GILA 2NGRA 3VR6A 3U3OA 2QL6A 6Q21A 2WOOA 4HUQA 4XSHA 4RZXA 4QL3A 1S1MA 2BBTA 2OXRA 4MA4A 3KTAA 1DAFA 2XGJA 3L0PA 4P4TA 2VYFA 4QOSA 1M7BA 4JSYA 4A8JC 3PENA 2ZJZA 3HU3A 2GXSA 1MR3F 2H5EA 5DN6A 4QFMA 3FWYA 1M7GA 3ZS9A 1NLZA 4ESHA 1EWQA 2WJYA 2V54A 4II7A 3CM0A 1TQDA 3W90A 2GXUA 2IXFA 1OHHD 3MGCA 3WNDA 1NL3A 3GLIE 4BFTA 1P73A 1E94E 2WWWA 4G5RA 2IYSA 2J41A 1XTQA 3I1FA 3PUWA 4MRPA 3Q5EA 4BLPA 1XMIA 4TL6A 4JT2A 1YQTA 4A8JA 4JL5A 3KQNA 4GL2A 3MWKA 1X1RA 2WWXA 1DG1G 1Z28A 2I1QA 4RKEA 4TLEA 3R9XA 3QSYA 4US0R 1QRAA 2VHUA 3CPHA 3VKWA 5L3SA 1CXZA 4NL4H 4FMCF 1VCMA 4WZ6A 2R8RA 4JLOA 1NN5A 3TUJC 2YVUA 2R62A 3EA5A 5GVSA 5AR1A 3AKEA 1NMZA 4KLNA 2QMEA 1U94A 2WJVA 2YZ2A 5EXSA 4DCUA 3V4FA 5CDFA 3TRFA 1E6CA 4G5QA 2QTVB 1G7CA 1NG9A 3NXSA 3RS7A 4DEYA 1MOZA 3U44A 2RMKA 2ZI3A 3UWKA 4QM6A 2WIAA 3WBKA 1AGRA 3KZ1E 5K8LA 2PMKA 4G5GA 4L16A 1G7TA 4AKGA 5E4FA 1DAMA 5GADl 2F55A 1R7RA 1HURA 1G3UA 5KSYA 3ICEA 3KJIA 1E9BA 2QSZA 3BS4A 1KGDA 2ZUDA 1EFHA 1VCOA 4LHVA 3LW7A 4TMKA 4MKHA 3CO5A 4C2UA 1DAHA 3KXIA 3REGA 2A5DA 1ZJ6A 3NC0C 4X8MA 4BLRA 3EPHA 4AYWA 1G3RA 2DB3A 4PPNA 2DWOA 4TT3A 3WYFA 4RFSA 1KK0A 1II9A 4ARZA 1JQJC 3MAAC 2O8EB 1W2HA 1VG8A 2FGJA 4IXNA 4OQXA 3TAHA 1Z08A 1II0A 2AK3A 2QGNA 4TYWA 2YYZA 5FOVA 1YR6A 3SZRA 3W5IA 2XOKA 1W0JA 2GEVA 2VQSA 3WHLA 4C2TA 3AVOA 3NH9A 4Q47A 4ZI2A 4FN5A 1QVAA 2O52A 5JI3E 3AVVA 5FH9A 1G8PA 4G0NA 4QGFA 3KXKA 3KQLA 1OF1A 2YC2C 4C9BA 3RS2A 1OYYA 1ESMA 2FE4A 1AGPA 3NBXX 5CK5A 3ZQ6A 2AFHE 3AVPA 4URVR 2KWIA 3JZAA 3IHLA 4ZIRB 2PLFA 1CU1A 2OFWA 1WE2A 1RJ9B 4LBVA 1E2JA 4DWJA 2IEYA 2F3RA 2QU8A 4O2RA 2BBWA 2O5VA 4IW3B 4M1MA 2RKOA 3OIWA 1XTSA 1EFTA 1UKZA 3AF4A 4RD3A 3EX7C 1VPLA 2XJ9A 3PXGA 1S3SA 4XVUA 1D2EA 3A1UA 2FZ4A 4K46A 4IDHA 1ZM7A 4A92A 5FBVB 3H0KA 3QQ5A 3KL4A 2Q3HA 5A4JA 3T61A 4LV5B 1UF9A 3H84A 4TLCA 4A0FA 2FSGA 5BYKA 3NHAA 4HDQB 4QRHA 1E1QD 4LYHA 1N6OA 3GEHA 1Z6YA 2JIZA 2A5FA 3B1XA 4L9WA 3P1JA 2ORWA 3W5JA 2O8FA 5HCIA 2RB4A 4PO1A 4W5HA 1P7CA 1XTRA 3DM9B 2EFHB 4B35A 1UFQA 3IO5A 1ONBA 1KSFX 1MO5A 1G18A 2BV3A 1ZUNB 1GP2A 821PA 4A0RA 4DEXA 2JGNA 4P4SA 4JBWA 4LC1A 2WJIA 5JJKA 3MUFA 4DCSA 1X86B 5FL7D 1EX7A 3EIEA 3PVSA 1P3JA 2QAJA 3HPQA 5E7IA 2H92A 3RSLA 4Q5IA 5BW8A 5DIFA 2O8CA 1JXMA 1XXHB 1T6NA 2FG5A 3CPJB 4C0SA 3REFA 2J7PD 2J59A 1KMQA 1MRNA 2IEZA 2ZVPX 3GJ0A 4B2LA 1U0HC 4MUAA 1PLJA 4L4UA 2W6IA 3ZIAD 1J70A 1E2LA 1IBRA 2HLDA 1KMHB 2G6BA 2REOA 3RVBA 5KHOC 3RAPR 1KNXA 2IYZA 2NMVA 2ZR0A 1XF9A 2OG2A 1UBCA 3SBDA 2EWVA 2N42A 3AB3A 4TWZA 4HB4A 2ZSAA 5SZJA 4M4SA 4LSGA 4L15A 3AGQA 4BWYA 5F9HA 1R0YA 1KAOA 3ZVNA 2ZREA 2VIIA 3U61B 4B3DA 1UDWA 4TMTA 4FWIB 4D82A 3FMFA 1KAGA 5JWRA 2WWIA 4W5WA 1T3SA 2BVNA 3QBTA
chains in the Genus database with same CATH superfamily
3PR2B 4CODB 5HJ7A 2PEYA 1UMBB 1LX7A 1AUVA 5LYJA 5F2OA 1A8PA 1O3YA 3STHA 4ISCA 4XVHA 3SC2B 2I4TA 1B0ZA 1QJCA 2H54A 3CCCA 4IEIA 1KBZA 3JU3A 4RVUA 5FWDA 1U1CA 4FW8A 2WLSA 4KFUA 3K2BA 1T9HA 2OO5C 2W98A 3E9NA 3EDYA 2AFIA 1Z5ZA 4LUCA 4EBBA 3G9UA 4X1KB 4KKXB 2IE8A 5JC1A 1QZXA 3I8XA 1M66A 3IOEA 3KUDA 3WJ1A 4ESOA 5KU7A 5CAEA 1JMKC 2R8OA 3T1YB 1LI7A 1GZDA 3THXB 3ODPA 3MTAA 2GUWA 3GGSA 3RRFA 4AJLA 5FUBA 1MDFA 1NT2A 1U0NA 1M1ZA 5JECA 2DR2A 2NNLD 1U2TA 1YQ9A 4D4MA 1P4SA 2JFHA 4B44A 1NF8A 3R8CA 5A0VA 4OMDA 3L0IB 3RB8A 3WMXA 3NHRA 5IMBA 3AG6A 3CH4B 4ZEWA 1NSTA 1OC4A 3CR3C 3EDCA 3ZCXA 3O8CA 4OGLA 4XQEA 3K1TA 5ALUA 2E5LB 2DECA 2QTBA 1JLKA 3ZHUA 3CF4G 1U0RA 2G4CA 2Y1OA 4O4LB 1Q1GA 1PHPA 2OO5A 1O03A 1BA2A 3BQNB 1YDFA 3GLKA 1AN0A 4MEAA 3IVRA 4AXBA 3CLTD 2PZAA 1KO1A 4L4XA 4V2UA 1IN5A 4DRXB 3F2VA 5H82A 4CFYA 1AB6A 4NP6A 4YAJA 1F3OA 5IARA 3GLGA 3QLVC 4MW4A 2A6PA 1A9TA 3FH0A 3DZJA 5EZYA 2J9ZB 3I9KA 3EHDA 4BLQA 1GKIA 1XPUA 4D5GA 3V8EA 2XRFA 2ZDGA 4IIVA 1UKAA 1UMKA 2H2IA 3IPLA 3HWRA 4ZCLA 4G23A 3P97A 3SCZA 3VHXA 2X5JO 1SC6A 3WB0A 4CZ2A 4DMLA 4E07A 4LF4B 1N9GA 1D2MA 3B9PA 3LU1A 2HDNB 1J5XA 4OIFA 4RPHA 1SAYA 3ZX4A 2BFNA 2I7TA 4AWXA 3FTEA 5JFGA 4W1RA 3V6LA 1Q7BA 3AF5A 4Y1RA 1U28A 3VKGA 3GOQA 4A26A 5DBFA 5IYZA 2IHBA 3D7NA 2XCSB 4RADA 1K88A 2IUFA 1GV0A 2CNBA 1DZIA 4UNRA 3HCWA 4F3RA 4G8BA 1E2HA 4DS3A 3RK1A 5IHPA 3N0XA 1VSBA 2I1WA 2ZZKA 5EVJA 1TJ3A 3H87A 2CLIB 4D79A 5BQFA 5HTOA 1BDJA 1EZZA 1YU9A 1RYEA 1LDBA 1RZUA 2FRXA 1VJ5A 1Y1TA 3KLNA 5KVQA 1MEOA 4BP8A 4F4CA 3BKXA 3C3PA 1P1CA 4QVGA 1D5CA 3OQBA 1E5QA 3H97A 4C4AA 2OBMA 2D5BA 1B4DA 4QYXA 4RZQA 4EX7A 3JWIA 2CVHA 4PIPA 3IVMA 3WLMA 5FLKA 4LX0A 4GWKA 2J1LA 3P9XA 1E3IA 3GJ4A 1XPRA 1XYYA 1NDUA 3MWEA 3NJRA 3PQDA 2D3WA 3E9QA 3SKXA 3U4GA 1S2MA 1K92A 1XMVA 2FKNA 3BXXA 4ZRDA 2B8NA 4B7ZA 5HYVA 1MORA 2NZWA 4FZRA 1TF7A 2W11A 4PIMA 4BOYA 4X95A 2F62A 3NKVA 1EHIA 1C30B 2AJ8A 1Y81A 2EFJA 1KOJA 4HNSA 3BWXA 4TROA 4WE3A 4H1UA 2H8GA 16PKA 3C6MA 4FYHA 1SXHA 1I3OA 4A8PA 4NNJA 1GCUA 2O7RA 2GI4A 5JSZB 5EXEA 2QGFA 4QTYA 2QUJA 3UW1A 2AZDA 1F8GA 2IWRA 3K31A 1HE1C 4LJAA 1XKQA 2VNSA 3NHMA 1ULAA 4M2LA 2CLLB 1EGAA 1BGXT 4ECAA 2XZDA 2IHYA 2BT4A 1JG2A 3PEEA 1XYGA 5IKPA 3UGJA 1MIHA 2QLMA 4NRDA 5LA6A 3O2SB 3U17A 4TZKA 2H1CA 3RF7A 4YS6A 4AJJA 5I7SA 4CU2A 1RTKA 1OYVA 2D1YA 1O6GA 2B6HA 4HGNA 1JHUA 2FPOA 4JLWA 4LPSA 1W88A 3GGOA 1LDMA 3HHPA 4BPRA 4EEZA 2CVPA 1KC3A 1JEDA 2FMFA 4XM2A 3LT5A 3HP1A 2V6IA 4PLTA 1L0BA 1I51A 1EPUA 3U4QB 4LV6A 3TNLA 5E2BA 4JZKA 5C3MA 1VBFA 3GAZA 1ORVA 2ZU6A 4FCVA 1DDGA 3SZGA 1F7UA 2X6RA 1KDOA 1U98A 2ODTX 3MGGA 1I2MA 4PZZA 5FULA 4C0HA 2NACA 4DIKA 4P35A 4TL9A 4MQMA 2R7NA 2YZ7A 1YB2A 3HSSA 3PC3A 4P7KA 4F8JA 2VQ3A 3R7WA 3ZY5A 1LLFA 3EVDA 2DFVA 2PZEA 1KR2A 1ZU5A 4ZPJA 3VYWA 2DJ5A 4URFA 3TOCA 1ZD4A 3AEQB 1WXXA 3AYXB 3PC8C 3HXOA 3KJNA 4AS3A 1XWIA 3C3KA 1L1FA 4J2HA 5BSGA 3IE2A 3RUDA 4Q6WA 1XEFA 4IL5A 4NJMB 4YRRA 4H6XA 4HJXA 5K0EA 2AFRA 5T6MA 4DA9A 3U16A 2YL2A 3EF3A 1XV5A 2FF7A 3PEWA 3LYHA 3O1LA 4PANA 4IX1A 4PY2A 5K05A 3BGDA 1DTEA 2K87A 3OBBA 4HLUC 3FCXA 4E7PA 4N1AA 3LBAA 3OMWA 4C43A 4IXWA 3PXBA 2H0RA 2XSZD 2ZB3A 1MH1A 2TYSB 1HNXB 2VQDA 2D06A 2HWXA 2R6DA 2A0FA 2AG1A 1Q6ZA 1TXGA 4KSCA 1RWQA 2WTUA 1Q3TA 4EG6A 2J31A 3H9JA 1WRBA 3ILHA 4G5HA 4E2XA 5BW4A 2FN4A 3D7MA 3JQAB 1UM9B 3NTXA 3K70B 5I48A 5C80A 3LQ2A 1B16A 3TH5A 3K8OE 1P1FA 2CHVA 3BIJA 3CRW1 3L6DA 4O3FA 4IEEA 1YTUA 3HZZA 4RK7A 3LDGA 2E6KA 4FGLA 4QOGA 1Z73A 3O4VA 1ORTA 2WF5A 3GVHA 2X13A 1N8KA 4QXOA 4DUYB 4HLUA 4GH5A 4L0CA 2XA9A 3T7EA 1OT3A 2GN8A 2OV6A 3D5TA 5KHAA 2C9OA 1CUZA 4XDHA 3K9FC 3DSRA 1DBQA 3VX3A 3SQMA 2B78A 7MHTA 1NI4B 3TRHA 2GERA 2ORED 1NXQA 4RZ3A 1X1BA 1AIPA 1G16A 1Q7EA 3ROPA 5H81A 5H1YA 3H4MA 4H27A 1DL5A 4PLGA 5JZBA 4YT5A 1QG6A 2PRSA 4KWIA 5DNAA 3L9WA 3O5AA 4Q21A 3QELB 4WXEA 5EP4A 5EI5A 4Q4HA 3S0JA 4F6RA 4CMHA 1J0XO 1PP4A 3G1TA 3OE1A 2I78A 2Q1SA 2G77B 4HYTA 1JI0A 1RP7A 4XYBA 3WNCA 1FEZA 2I3BA 4E09A 2J4FA 3AR2A 1AQYA 2Q5JA 3NAZA 1RC0A 4DPMA 3HDTA 1BD3A 1J2JA 2XUFA 3T0IA 4J90A 1JP7A 1N2CA 5IM5A 1TADA 1U81A 2DP4E 1JDUA 5DLQC 2Z09A 2ZSFA 2ZI5A 4MVXA 2GJAA 2OCIA 2EJCA 2YJ4A 4DSOA 1BMFA 3MCTA 5AM1A 3UWSA 3U56A 2VF4X 2VJPA 3UUWA 1P72A 5I8WA 5CA0B 3O8BA 5ABPA 1AKQA 1XQYA 2C0PA 4U9UA 4K9LA 4MEBA 1BDIA 1DX6A 1LDYA 1WSAA 2PRZA 2YJ3A 1NX6A 3G13A 2GZHA 4LNAA 4N3CA 4UUMA 4AMGA 4EI9A 4F3KA 2GZAA 2VWHA 1K4KA 1OZAA 1VKNA 1NN0A 1UOQA 3E2MA 4QNNA 1SXJA 3I73A 2XTMA 3ESXA 3RV3A 3QIAA 1QNFA 4LEIA 2HV9A 4ARAA 3IKJA 5EE0A 1G19A 4LNUA 4CKCB 2VXOA 3THWA 1SUIA 3PNQA 2Z8YM 4H7PA 1T2FA 3PWKA 1XMSA 4OKNA 4V1CI 3KKMA 4HDRA 1HE3A 4KQHA 4CCSA 3SQLA 3GXBA 1PFVA 5ADWA 4PWYA 3C7CB 1K06A 1Y5LA 4N6GA 1DFHA 4BFSA 3V1LA 4GXRA 3UBTA 3DDOA 4AS1A 1R4MA 3VTAA 2QRVB 2NVUB 4KNYA 2OV8A 3RJTA 2DEUA 1YR2A 2FPGB 3LCMA 3Q7EA 1NOKA 1GIAA 5EIAA 2JF0A 1WVIA 3ET5A 3PU6A 2ZUVA 3AEYA 5LZ8A 2P4QA 5TMDA 3T5CA 4B0OA 4EIWA 1W8DA 2H85A 4B6OA 4OK5A 1GN8A 2R66A 2QLNA 3PXUA 3OZAA 4BMYA 4GKAA 2YXDA 4QPZA 1W46A 3I23A 2OUIA 4YTEA 3EZFA 5IX8A 2I87A 4G5FA 5HG0A 1JDPA 2Q5QA 2UKDA 1XPOA 4AJ9A 1X1SA 4LKRA 5JR3A 1V96A 5DDIP 5C5IA 3U26A 1ZY2A 3QHAA 1YE8A 5KSWB 1R1DA 1XF1A 4L3OA 3KKNA 1ECGA 4TLMB 3E3AA 4UM9B 4YRNA 4YFYA 5TY0A 1VL6A 3RPEA 1UWVA 1R15A 3N2NA 1PN3A 1E1QA 2O9JA 4H08A 1H2ZA 1HDYA 3WLLA 2ILVA 4TYQA 4E5VA 5KOJB 3JVVA 5K8IA 3NGLA 1CG6A 4C78A 2EYUA 3PGKA 2CLCX 2Y2VA 2X41A 2G08A 1L5MA 1U6JA 1X70A 2MIIA 2PWAA 3ELBA 3HE3A 1QZ3A 3IDAA 2AS0A 4IFTA 3M8KA 5CJ2A 1K86A 1C7JA 1JHXA 2RKWA 1Z38A 3OEWA 4AP6A 1HLFA 1XZPA 1XP5A 2BFDA 3L93A 1RYFA 4HH3C 4XYMA 4DREA 4HAWA 3CF0A 3ETJA 4KAJA 2GM3A 3G5MA 4KBGA 2PWBA 4R7GA 1CFJA 1TPYA 1VIDA 2AXQA 3ZHXA 2R79A 3BE5A 4X84A 3Q6IA 4G85A 1V6CA 2I29A 2VDWA 4NCJA 5ITZA 1T3LA 4RHCA 1ZHFA 1DKLA 2MT9A 2GLXA 2YKGA 3OZSA 1NDHA 2HO5A 3KOXA 3IIMA 5EWLA 4PZDA 3RROA 4E13A 5KOIA 2FJUA 2QSJA 3K8QA 2AR7A 4L73A 3VJRA 1UBRS 4MW9A 2OTCA 3Q9LA 1TGYA 3ZK7A 4D9BA 5FTLA 1Z07A 4NYIQ 3SIWA 2DCMA 3NWBA 3WGMA 1WOYA 5CU7A 4JHXA 1EP3B 3DBRA 2B36A 1K5PA 2OM6A 4YP7A 5A1JA 1XHEA 5AI4A 3KZKA 1W6UA 1X92A 2AN1A 2NU9A 2Q2QA 2PAAA 3P7MA 1FMJA 4MQFB 1BXZA 1NPYA 1PL8A 1JDZA 2XTZA 3GJ7A 3I45A 3QY0A 1KSJA 1DHRA 1TCUA 4OFZA 2W6ZA 2Z9DA 4IHJF 5JAQA 5LIPA 3FB4A 2G1JA 1E4EB 1ZI6A 2G82A 3HFJA 1CVRA 5FB3A 3RUFA 1EFLA 5I6DA 4F1KA 5GP1A 1ZIYA 4PHFA 5A3RA 1XDBA 1XNGA 4BATA 3M9WA 1MA0A 3QLJA 4ODIA 5KO2A 1NVDA 2QA5A 2FUG1 5K2MA 1QHIA 4PGFA 4S35A 4FGKA 2EGGA 2FEWB 4AN4A 5DEIA 4CUZA 3FVQA 3W4IA 2GF0A 2YHIB 4DG5A 2BBOA 3UV3A 4WJKB 1SB8A 3IIKA 2RCYA 1I6MA 1VB5A 3KJFA 1HG1A 5CR9A 5FWYB 2OO7A 1FS5A 3KAKA 1O8CA 1UIRA 1BE6A 4NK5A 4TT8A 2GCIA 1MX5A 3QQPA 3M81A 3S7ZA 1TD1A 1Z17A 5D6OA 5EEHA 3TSWA 1KK2A 1QUEA 4LYFA 1M5RA 2BMVA 2LTAA 4IMIB 4NEQA 4PRKA 3QXHA 1OI3A 3P0JA 1KSGA 2QV0A 1XDZA 4WY2A 4IQGA 4D3XA 3IAEA 1Y4DE 3Q3EA 4YI5A 1F14A 2O7NA 1DAKA 2ANCA 3H1EA 4QDKA 5FTWA 1WSBA 4E11A 4CN8A 2GN1A 2BFMA 4S1WA 4W1SA 3L46A 1XZMA 1IY2A 5F12A 4JHLA 2JH8A 3GC6A 4R1TA 1EESA 4G4GA 3D6MA 3KT3A 5B1SA 2QAIA 1GGEA 2I6FA 2IUUA 1QHGA 5CGQB 1KZGB 2PVPA 1JFSA 4LJSA 1T0PA 1XU4A 2Z8ZA 4KDFA 3U0VA 4OJMX 3CTPA 1CS0A 2WVJA 2AYXA 3VR3A 3MLAA 2VWPA 1KH2A 3K8YA 4QXPA 4RW0A 3SLGA 2NYRA 1R3UA 4LHWA 4YJGB 2WOJA 4P0TA 2WHPA 2F1HA 2DSNA 3NATA 4FS8A 2JATA 5JH7A 1JJFA 1IN8A 1AXEA 3PFBA 4UVDA 1D03A 2MINB 3X1MA 4C4TA 3OZVA 2VPXA 4G0XA 4RMNA 2WNSA 4Q24A 3RBVA 5DU2A 4EYGA 2JCGA 1XDSA 1XU9A 3WX0A 3MTIA 1EUDB 4NLLA 5DEOA 4ZRNA 4MUEA 1HZZC 1E8DA 4GOJA 1UXOA 5J2TF 1PDVA 2H7YA 3I9JA 3AF1A 4KQJA 1KDZA 3OO1A 3GVXA 2EW8A 3KC2A 3DE2X 3IJPA 4LDNA 4YECA 3TVYA 1JEJA 2GZRA 4JP1A 3K4PA 3ZIUA 5JVDF 1W2GA 1AUQA 1BO6A 3P2IA 4B1FA 4FJ0A 1LQUA 5E0OA 5AFSA 2EAUA 1EGMB 3ONWA 4NBKA 4F4HA 5HJ5A 5CFRA 1ODKA 1Y8QB 3PIIA 5JNSA 3GVPA 3V00A 1XTJA 1RM4A 1FFHA 1G4HA 1TUBA 1YD7A 3C5HA 2J07A 3CUSA 1BFKA 4AWAA 5U9CA 3BFVA 1SUCA 4JR1A 2AQ8A 4GECA 5FQOA 3DVAA 3RBXA 5IRCD 1VI5A 2QF7A 1HRKA 2YVLA 4WN3A 5JPIA 1Z5GA 2OVFA 3ZJVA 2DY1A 3HI4A 2X9VA 2D5IA 2EATA 4R8MA 3WHPA 2WA2A 4EG4A 4EUEA 2ZYIA 4IP0A 3LRTA 3C3XA 3ORRA 3GN2A 4WKBA 1G0NA 3Q8XB 5MF6A 3CRRA 4MS4A 4Z4IA 1Q1ZA 1YRYE 4CM4B 3R6TA 4GPTA 3DV9A 4BLTA 5HNKA 3DAYA 3AFGA 3M1LA 4UTNA 3KQTA 4YV7A 1XIVA 4O0MA 4TXMA 1T1JA 1W73A 3DEIA 4C0WA 1IOVA 1PTKA 3GWZA 3MERA 1GWNA 2P0AA 5DK4A 5BWBA 3O4FA 3VMFA 3ZD6A 3T99A 1H0SA 2P79A 4XASA 3F74A 4IDAA 4L8FA 4G97A 2ESRA 2ZE7A 3DBVO 2K6GA 4R31A 4PM4A 3ZGLA 2CXUA 3UJ3X 1JDSA 1KJIA 1NE2A 1JTEA 1NNLA 1Z6QA 5BNIA 4N5NA 1MC5A 2QUIA 3MJTA 3W5CA 3SDZA 1VMAA 1Z5UA 2ARKA 5SZKB 4LHEA 1IZ9A 2C78A 3K1AB 2FSVA 5UKDA 1G5QA 4QX6A 1R0CA 2VNKA 2ZPTX 3EXG2 1CYEA 4F5YA 3FMOB 5HIJA 4A1OA 1VSTA 2PV7A 5AT1A 3Q8KA 3E3NA 2FKAA 1DUSA 2FEMA 1SKQA 2X6QA 3F7TA 5JD3A 1XVTA 4A0QA 1TVKA 5DM4A 1JDTA 1V11B 2I6GA 1QKJA 4YAGA 2NLOA 4OOEA 4F38A 1BHSA 2C03A 2EFGA 1X8JA 1XTUA 4I4IA 3OKAA 4US1R 5DTEA 3V6MA 2DWPA 3CIOA 4MIKA 4KIWA 2VJDA 4Y6LA 3W2FA 4QSHA 3U7EB 2Z43A 4X63A 4Q7LA 1NY6A 5AP9A 3VU1A 1Q7RA 5TARA 4YRDA 2XQKA 3MXOA 2XUQA 3KWLA 1C81A 3KKOA 4UREA 5B1DA 4RKWA 3B1FA 4AF6A 1XZJA 3QA9A 3QX8A 2JFWA 2ZRNA 1NWHA 2GK7A 2IXTA 4DMMA 4CLHA 4X54A 3DC7A 4O4LF 3N2GA 3B53X 4BMSA 3ZR4B 2ZRJA 2IXAA 4JUCA 2JJ1D 4EF4A 3D02A 1U7UA 3S2IA 3DFMA 3P2YA 3DQPA 1PUIA 5T7BA 5L4LA 5H5JA 4J3NA 3LI2A 4WFIA 2IBMA 2GJ8A 1E4VA 4ZIRA 2Y92A 3COVA 4LCBA 3T5DA 4X00A 4I3FA 1K27A 2GEDA 2GWRA 3I42A 5FBLB 1HOXA 1TM7E 1NW4A 3BFKA 4N7MA 1Y1PA 3GRPA 3EISA 1S8FA 3CSUA 5DT9A 3E70C 1SHJA 3KUUA 2ODQA 1RAGA 4HEJA 2X5OA 2L0XA 1W96A 1PGOA 3JQ7A 4L5AA 5J1TB 4DWWA 4RTOA 1MPXA 1YJXA 3N1UA 2XSZA 5AQEA 4HAYA 4MO9A 4OQZA 4M3NA 5GVRA 1GN9A 2BKAA 3GA0A 4RA6A 4XIGS 4FP9A 8AT1A 4GBGA 1A97A 3CLVA 3FWZA 1K4MA 5EKSA 5A6SB 3QKTA 3KX2A 2K7FA 1A2OA 1BOFA 1WR8A 3BN3A 1JIKA 4IM7A 5E3JA 1XZGA 1Z45A 5FX2A 5FQNA 3K0CC 3TRIA 5TMPA 1LY1A 3L0YA 4WKNA 4YRZA 3B9RA 1OWPA 3I5AA 5COBA 3S4YA 5IJ0B 2HF2A 1FFAA 4QYSA 1TM4E 2NU6A 4QA9A 3B6ZA 4UJ3A 3ZU4A 4Q93A 2WV9A 2LDXA 4JB8A 3VAYA 2D00A 3P2OA 4LSMA 1KYXA 4PQRA 3D8HA 3CNBA 5KMGB 2O0JA 1K2WA 1R4ZA 2GOYA 4QBIA 4BVLA 4DQXA 5MGBA 1LC0A 3GNTA 4BV8A 1AGYA 5DSZA 4I5DA 3L7NA 3RC7A 3LY7A 2OZVA 5JVDA 2QTRA 3ZZUA 3JVDA 2HHCA 4AI6A 2FLKA 1J49A 2HU2A 3TB4A 2RG1A 4M0DA 1OXBB 1KMCA 5T4FA 3EGDA 4TLDA 3ZBQA 4DQDA 1EXDA 4WY5A 5MN5A 1Y4UA 1K0UA 2B5OA 1P91A 3FKSD 4B3FX 3L4SO 1I2DA 2CXTA 2VKTA 1F4PA 2DFLA 2VRCD 1KMHA 2O05A 4E03A 4B4KA 3I2GA 5C1PA 4Z4EA 2IA5A 4MWDA 5LDDC 3ES9A 1M6WA 1PX2A 3R41A 1J7KA 4ND3A 5ILGA 1FX0B 1DXQA 3KYCB 2BFBA 2WICA 5A5GA 2O6HA 4HSEA 4WBNB 1OI2A 2C8VA 2CZCA 2WKWA 3L7OA 3P2KA 4X6LA 5AXCA 1GQFA 5HF5A 1U8YA 1WULS 1Y80A 1NMYA 4ED9A 2NVOA 3IKVA 3AUKA 1R8YA 2P9YA 4IJMA 1P2FA 2GYYA 3AJ9A 3GRCA 1QH1A 2HQOA 4PLFA 4EW6A 5JARA 3ADBA 1VLHA 4JX9A 2PCJA 5CIQA 4NICA 1RPZA 3STWA 2PL9A 3EMBA 2W42A 1E98A 1U8AA 2W9XA 2CUKA 2QPOA 3E7FA 1LGYA 4XGNA 1UMBA 3DOCA 4LJ4A 4M7OA 2ZUBA 1NV8A 1W87A 4NR0A 4WK4B 1ZINA 1DO0A 4QVKA 5YASA 1GSIA 4E4YA 4K86A 1JKXA 1R8QA 2PH5A 2XITA 4GIBA 3SC2A 4BVFA 4YT2A 5KPDA 1FRFS 5JYDA 1EVKA 2Y0PA 2H5IA 2WQ7A 4F91B 1V7ZA 4HAUA 3SQWA 4X6XA 1EFUA 4XB1A 1I36A 1PIWA 1QG0A 3IUMA 1G8SA 1YBAA 1ZEJA 4DDHA 4DY6A 1PFGA 4EEXA 3ZGZA 2VL7A 3FSJX 4YWJA 3HMKA 4FMPA 1CQJB 3NHFA 3K9LA 1UDCA 1U7XA 3K9HA 2ZAMA 4PQGA 3JATB 1TOAA 1EK1A 5CJJA 5KYUB 2EKZA 2JGAA 3DTVD 1YIAA 4NSNA 5TNXA 4DQ0A 3THXA 5EIOA 1LU9A 5EWJB 5DM70 2OXFA 3B7GA 2W93A 4D5EA 3X44A 1V4VA 2RCNA 1Y8RB 5JADA 4HRXA 4IGKA 1Z6ZA 3UK2A 2X0KA 1Q0QA 3A0UA 1VM6A 3GJRA 4EI7A 4PC6A 3TLCA 5KSZA 1XK7A 3AH8A 1II8B 1ODLA 1ULSA 2D59A 3BA6A 3WK4A 5JRJA 3ML1A 2HC9A 4KWHA 1FUKA 1U90A 1X94A 4G5XA 4HMQA 4O4LA 4BJHB 1ZSYA 1H1DA 4H9GA 4QEDA 4CIXA 2Z30A 3CU5A 2WWTA 4U9IS 3CLKA 4I99A 5GM2A 3MT0A 4ZAYA 5M3BA 3SVLA 1DKQA 3FZEA 3WHIA 4DRXA 1MPTA 4QOEA 3U6KA 1Y6GA 4LF5B 1OGYA 3RNOA 1Y9DA 3T9AA 2Q5FA 3C3JA 2QLTA 2EFCB 3NVKI 3ADCA 1FXUA 2OHHA 2J85A 5IP5A 2EBFX 3SSNA 3EUWA 2P30A 1MABA 3EEBA 2AV6A 3QA3E 5FFMA 1XFAA 2WF8A 3L3BA 1WVMA 3OZWA 3QF7A 4R2JA 4I1PA 1H2BA 3HNPA 5EMMA 1G64A 4COKA 3BCHA 1BX3A 4UFNA 5EERA 3A9TA 3WDKA 1H22A 5K0ZA 3GH1A 3SYTA 5LZ4A 5FOSA 1WBDA 3BBPA 2HQBA 1TB4A 4ERXA 4AROA 4JBXA 4IUCS 1T0JB 4XDYA 3KKZA 2NTEA 4WW0A 4M7RA 1U63A 2KLHA 3BXZA 2J3KA 4FGWA 5T4HA 3SXPA 4E3WA 2PGNA 4M8NE 1PJLA 4NOKA 3WLNA 1GTL1 1QP8A 2R47A 2QGZA 1V3VA 3O3NB 3FPLA 4OHPA 1TJ4A 3BMNB 1ZGHA 2RGRA 1K6MA 1ML3A 2VDMB 1Z22A 1RR6A 1ZM2A 2WF6A 3LT4A 2ZTHA 3O1IC 2VQFB 4JOCA 5H3HA 2ZQZA 4V3CA 3VUFA 2ZJBA 5FR2A 1TD9A 4FHZA 1N2ZA 3RC2A 3KBBA 4U5QA 3PE4A 4KQEA 3LPAA 3JTEA 4UE2A 1NYLA 3DR3A 2D0IA 1Z0IA 4MB6A 3ZWDA 5AW5A 4JVLA 2C4VA 3GEMA 4MUNA 2JGKA 1UQUA 3I04M 2QQEA 1WV0A 1Q3KA 5HMMA 2WYIA 5AVQA 5CTJA 4L76A 3DCJA 1QRTA 2PMWB 1C30A 4KE6A 4CT5A 1CR6A 1TA9A 1VKZA 1IBKB 1XRMA 2HO4A 3L40A 1RYHA 3D8RA 4J0JA 1O9HA 2JZCA 3TBHA 1THZA 4RIIA 1CJMA 4ZRMA 3K15A 1FQOA 3B1WA 4RK0A 3UV6A 2WQ6A 3AJDA 1ZAYA 5JSZA 4R2MA 1SU7A 1T2NA 3BJZA 3IOMA 3OLWA 4LWOA 4CE6A 1ELOA 3W2IA 3DHYA 4JEUA 3A6ZA 3OT4A 2FSIA 3ZDRA 2Q3DA 2YCBA 4GR4A 3ZDYB 3JQBC 1EE2A 4RETA 5GIPE 1I3CA 3TRKA 1XEWY 3PUIA 4R7ZA 5F51A 2WD7B 1MT0A 3IXQA 4EKGA 4TXJA 5J4YA 1XEAA 5FPTA 3SC6A 2VNHA 4GC5A 4TQGA 2GO7A 1ZESA 2HRZA 3E7WA 3NOVA 4YR9A 2HQ1A 2W4IA 4JLVA 5CDTA 5CH8A 1WV1A 5LUBA 1V37A 1JQLB 4DYVA 1UAGA 4JC8A 1TFUA 5JNWA 2C96A 4YUXA 3U4QA 1EX6A 2BAGA 3WKBA 4BPBA 4B80A 3VGJA 1ISRA 5MN4A 3FYDA 4IIYA 3HY6A 5EHIA 3PJDA 4E2FA 1JW9B 1QORA 1EEHA 1KEUA 1P9RA 4KI0A 5ER9A 2IV3A 5EMNA 2L82A 3ZV3A 3ZWPA 3O8RA 4MP6A 3ZU2A 1T1GA 2JGJA 4AG5A 3AVYA 1JG4A 3G7UA 4DR5B 2PLRA 3G3EA 4MQBA 5EE3A 5ICGA 4TKVB 5CB4B 3AEQA 3LHFA 4NHEA 1KGSA 3R3JA 2X1VA 1QCYA 2JRLA 4TUYB 4NJMA 3L79A 1BG6A 4WWHA 3LLVA 2XCRB 1BVRA 3D54D 5A0FA 3RS5A 3BF7A 4JIGA 1P7ZA 2FB9A 4DT1B 3MS7A 3EVZA 1AHPA 3C6XA 3CA8A 1NJ1A 4EA6A 1QIJA 1F2DA 4DDMA 1YKFA 2EP5A 2XYPA 1HL7A 1RCFA 2D2IA 4RTRA 5B2ZA 2ZPUA 2JLVA 2EBHX 2I67A 3JZFA 1XJQA 1CRQA 1DPFA 5KC9A 4XH9B 4QOHA 3DCIA 2EZ4A 4MVJM 2QWXA 3WYGA 1ODFA 4BIIA 1K66A 4XCVA 1MB9A 4IDFA 4YJ3F 3VM6A 2HPHA 1ZJWA 1V5EA 2JLUA 4L51A 1S8NA 2PX2A 3JQAA 1G41A 1UM9A 4OH7A 2B0JA 3Q7SA 1E4YA 1Y82A 1CIJA 2PWYA 3ISVA 3TI7A 1F0PA 1J0AA 3ROKA 4OLHA 5B6IA 1W5FA 1REQB 3F5FA 4MAMA 3UUEA 1TK2A 3KVOA 4LZJA 4B9EA 2WWHA 4BMXA 2W2LD 3DFKA 4BVAA 5B55A 3QHPA 4YMUA 5J4HA 1SWWA 3H11B 4WUVA 1Z82A 1ECFA 4YJKA 4ZDJA 2FPWA 4KO3S 4ON9A 5FUXA 3K9GA 1KPHA 1QXSA 1LVGA 3L8ZA 3ZCSA 2VDOB 3DO6A 4RDHA 3VV3A 1CJVC 1JYFA 2DBQA 3OECA 4IIBA 4WXMA 1VDMA 1VJDA 3VI3B 4RHXA 5F2NA 1I4LD 4GQAA 1HQCA 1NI4A 2JBHA 4IDPA 2IYAA 4X8OA 4E5PA 1JAZA 5JPDA 2Q49A 2IC5A 2I3ZA 4Z7JA 3DUFB 4RIEA 5I8PA 3D2BA 1UKCA 2PQ6A 1ZN7A 5AW0A 2J6HA 2O14A 3QELA 4JASB 4DBLC 1G38A 2YMQA 3G8YA 5AKYA 1AQIA 5CLJA 1DIRA 1OAOC 5JT1A 1Z8FA 3UWDA 2BDTA 3ODGA 3V7YA 1ZR4A 1YQQA 3PSHA 3M3HA 2H6EA 3KBOA 5I4BA 3HZOA 2ZROA 4N76A 1KIAA 4NXMB 3AR4A 2AEMA 1HYEA 3U49A 1CF2O 3WKCA 5HJEA 1JALA 1ULHA 1UBEA 2PKXA 4G0PA 1BE1A 4BFUA 3KETA 2Y4OA 2CFCA 3E3OA 2WKRA 5CA0A 2H2HA 3Q3GE 4Z9AA 4ZV9A 2CDCA 3R5FA 3WGUA 4EATA 1GDTA 3N2YA 4AF8A 4CPDA 3AV0B 4QFCA 4DDWA 5JUWA 3QI2A 3AF0A 5F77A 5K0CA 2VYND 5AOBA 1VIYA 2RH5A 3DPIA 4MUFA 3OBIA 1RWWA 2IL1A 2RHJA 3CZRA 4LXXA 5LWHA 3RHTA 2QYOA 3RWBA 5C7IO 2WTMA 2HIHA 2X5KO 1PS0A 2EQAA 3LVBA 4ENSA 3LUHA 3JYOA 4IAOA 2AI3A 4QARA 1JJVA 1CQWA 2DCUA 1E1RD 3NXKA 4PZLA 2YY6A 1UK6A 3AJ8A 1PQUA 2F3SA 3MRTA 4TL7A 1NVVQ 2F1RA 3CTMA 4OLJA 2P2ZA 5EAIA 3ZLJA 3NTUA 1BS9A 5FBQB 3O3CA 1GGVA 1J5PA 2FCRA 2GJKA 4FEYA 3PA8A 2WPDD 4KCGA 3OMLA 1FNSA 2CL5A 1W25A 2HFKA 4LQCA 3PTAA 3LCRA 1M33A 1SQSA 1W94A 3H6HA 4QFDA 4QDOA 2QRVA 2NVUA 3CNHA 4NJOA 4MI3A 1V8FA 4WK0B 2V1UA 2FPGA 1QHHB 3PCXA 4FOTA 2BZ0A 5H4GA 1C7EA 1HX7A 2F43B 4DEVA 4DLLA 3TQFA 1WDMA 3OZEA 1NASA 1QFJA 1U4OA 4LTDA 4M1YA 4I5IA 1BHJA 1Z15A 1ZRMA 5AJXA 4KSBA 3F7NA 3MRVA 5JXHA 1SCNE 1VHDA 3EZNA 5M5BA 1Z9BA 2E5FA 3MWJA 2QX9A 5B6JA 1E6UA 2H5LA 2HXSA 2B83A 3HU2A 1YDWA 2L69A 3IKMB 1EP9A 4M49A 4Z86A 2H16A 2G8LA 3WWPA 2YRWA 4GDMA 2DAPA 2OQVA 1Q1AA 2CKDA 3U9LA 1R0KA 3GBVA 3HV0A 4Q9NA 3C8UA 2V3VA 3UHFA 1EDBA 1K7XB 3T5PA 3IE0A 1UT5A 3SDSA 3TW8B 3H6GA 2IPOA 5KOJA 4CN9A 3IDFA 1R66A 4Q3OA 2BW0A 1F3LA 1R0ZA 2FG7C 3FPEA 5LPNA 4DV1B 3LUPA 4JU8A 4IZIA 4CM6A 2BR4A 5BR7A 4XFKA 4WQMA 3A2NA 1VLJA 3H4VA 4YK7A 1PEKE 2XGSA 2PUHA 3M83A 4CIDA 3KTAB 2VJNA 4FDTA 5HE8A 4URZR 4CWAA 2CT8A 1CR4A 4B3RB 1K8XB 2XCOA 4JJZA 1W93A 1KFCB 3LAWA 2C4NA 3H5WA 2ZYGA 1ONSA 2YS7A 3BA1A 1Z2CA 3QZUA 5A9TA 3WSTA 4RTQA 5JZ9A 2EEZA 3C48A 1HF3A 1NDQA 2Q5LA 5CT6A 2G5PA 2HGSA 2P9TA 2AD1A 2QX6A 5IDQA 5LU8A 2C7PA 1FU7A 3L43A 1PQPA 1DRVA 2EVWX 1F60A 1SCJA 1BYUA 3VNVA 5CIWA 3ESYA 2PXXA 2NT3A 4R2IA 4LZZA 4ETMA 4J03A 4LJRA 5FR1A 2GPNA 4H0NA 1E2IA 1P0PA 4OAPA 1CUSA 3FKSA 8LDHA 3UEOA 4EENA 1P5JA 3JD1A 1N2IA 2V6GA 2WVAA 4UMDA 3W06A 1M73E 1C4OA 2BHNA 2OP1A 3NQ41 3QX7A 3OCUA 3O47A 3TE7A 4LY0A 4XIFA 3ZQUA 3K1ZA 4BQPA 5IXYA 3TQOA 1PR6A 2J7KA 3P45A 1IAVA 2QZSA 2ZR7A 4GT1A 4MQFA 3RU9A 5C1IA 2YFKA 4G1CA 4I8DA 1WCV1 1SKMA 1MJHA 2HYDA 2RGGA 4ML3A 2FJPA 3KZCA 4DV4B 1TC2A 1KFKB 2QW1A 2OKGA 3HB0A 3KELA 3F3KA 1EX9A 4JUAA 3QFRA 3RFUA 1WX1A 9ABPA 1I7SB 3R9XB 3R5HA 2Z4RA 1T2VA 2IKQA 4YO7A 3RRNA 3ZE2B 3TR6A 2IY7A 3WRXC 5LP6B 1RYZA 4R7TA 3WDSA 3ABZA 3CG4A 5FPKA 1KRXA 4KDEA 1V16B 3O73A 5B4UA 3J7AC 1UDBA 2R8ZA 2QTWB 3GGDA 4OI4A 3DKPA 1ZLXA 4LJ6A 4MGEA 4BU1A 1Q92A 2DQ4A 4FVTA 1BKYA 2INGX 5G0SA 2YHIA 3GARA 3HN7A 2FW8A 2PA0A 5L4SA 4DV5B 1T9ZA 1VE9A 5FWYA 4PSVA 2JIPA 1F7VA 1L5ZA 3V80A 1ZM9A 3DNPA 1LZKA 1RLOA 4MITA 2EWMA 2ZTUA 4HDSB 1RXIA 2ONYA 3PYXA 4OOFA 4A91A 1M7HA 2CUTA 2QTHA 3EGCA 4XYEA 2QJRA 3RARA 5FWAA 1KY5A 2B4KA 2AFHB 2IF2A 3BOSA 5G53C 5BMVF 4DR6B 3OI7A 4ZT6A 1YULA 2OCBA 4DMKA 2JFZA 3SS8A 3EDRA 2RAUA 4A2QA 4D4LA 5AM4A 2WUWE 5I9SA 4H7HA 1BJRE 3DZGA 1TJPB 3SU8A 3EZXA 3OQIB 2YWCA 2AMLA 1BTOA 1GEEA 3LVFO 4QUEA 4QDUA 4MV0A 2BGNA 2PGLA 4NOMA 1NMQA 4YA6A 4PTZA 2C5AA 4UTRA 4H3KB 1YFKA 2FFJA 3WWDA 1YRQA 2FPSA 3DDUA 3NBQA 1LK0A 4PBSA 1ETUA 1IJEA 5E2AA 4TWRA 3P71T 2BGMA 5DX1A 3NYIA 1P75A 3R5TA 4KRGA 1TYBE 3MBIA 2AGVA 4YJGA