4I5IA

Crystal structure of the sirt1 catalytic domain bound to nad and an ex527 analog
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
272
structure length
272
Chain Sequence
NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-1
publication title The 2.5 angstrom crystal structure of the SIRT1 catalytic domain bound to nicotinamide adenine dinucleotide (NAD+) and an indole (EX527 analogue) reveals a novel mechanism of histone deacetylase inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 82
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4i5iA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4i5iA01
1OVMA 1V5FA 3D7KA 5K3SA 4K9QA 4QQ8A 1YNOA 4FVTA 5BWLA 4MPPA 2FSVC 1MA3A 4TWJA 2JLCA 1N0HA 1ZPDA 4GG1A 1POWA 5D7NA 3RIYA 4RJJA 4KPUA 2WVGA 3ZGOA 4KGDA 2PGOA 3CLSD 4JUAA 1YHYA 4RJIA 4JSRA 4JUFA 4UTNA 4RMJA 1Q1AA 2V3WA 4Y6LA 2UZ1B 4K9OA 4X3OA 3EY9A 2VK1A 2Q5OA 4K9PA 2Q5LA 3F6BX 2A1TR 4K9MA 3IAFA 1NM5C 4F4UA 4MQ5A 4MPRA 5DGDA 3CLRD 2B4YA 4IF6A 4GM4A 3GLUA 1O97D 4C7BA 4BUZA 4BV2A 4ZZIA 4JT8A 4FEEA 4V1CA 1M2JA 4J1TC 2Q28A 2PGNA 1YI0A 3F6EX 5MF6A 3E9YA 4UTZA 4FEGA 2EZUA 3FZNA 1MCZA 4BVEA 3CLUD 3EA4A 2H4JA 5EJ9A 2Q27A 2OD9A 4L3OA 3LQ1A 2H4HA 4V1CI 4BVHA 1E3TA 1PYDA 4ZP1A 2AG0A 2H2HA 4R8MA 4IAOA 1HZZC 4D5GA 3D81A 2OD2A 3RIGA 4HD8A 1Q6ZA 2OD7A 2VJYA 4K9KA 3K35A 2JI8A 4JD5A 4UUAA 2OORC 3HWWA 5EJ6A 4Q9DA 5BWNA 1V5GA 4RMIA 1PNOA 4RMHA 3PKIA 1ICIA 1U28C 2UZ1A 3JR3A 5DEIA 1V5EA 1J8FA 4COKA 5EJ8A 4F56A 1EFVA 1U2GC 4Y6QA 3GLTA 4J16C 4D5EA 5EJ5A 5DGTA 1PTJC 1YC5A 4JUBA 5MFPA 4UU7A 1OZGA 3HWX1 4JUDX 2PANA 5EJ4A 2EZ4A 4KXQA 2VBIA 1Q14A 1S5PA 5IMSA 2FRDC 5BWOA 1U31A 4X3PA 1OZHA 2JLAA 4MZXA 5K2OA 1T9CA 2EZ9A 4QELA 2H2FA 2VBGA 2FN3A 1S7GA 1YI1A 5MGNA 4MPJA 2IHTA 3GLRA 5FYQA 5K6RA 1BFDA 5EJ7A 2VK4A 2W93A 5EJMA 1POXA 3EYAA 2FR8C 1T9BA 2H2IA 4TWIA 2VBFA 1SZDA 4RMGA 2AG1A 3U3DA 1PNQA 2H4FA 1Y9DA 1YTLA 1YC2A 2OO5C 2EZ8A 4GPEA 1PVDA 2QQFA 4UTRA 4JUCA 1EFPA 2IHVA 4I5IA 2Q5JA 2H2DA 2WVHA 2FWNA 3GLSA 4JU8A 4IG9A 2DJIA 1SZCA 1OZFA 2JI7A 5K6TA 1O96B 1M2NA 4FZ3A 1Z8NA 1M2HA 2C31A 3U31A 3FLMA 2JI9A 3ZG6A 4Y6OA 2A1UA 1Q17A 1JSCA 2BRUC 5EJAA 1UPCA 4UUBA 2IHUA 4HDAA 1U2DC 4BN4A 1M2KA 3PKJA 4O8ZA 3IAEA 1PT9A 1YBHA 5FEMA 4K9NA 3CF4G 5MFZA 4L2IA 2QQGA 2JI6A 1D4OA 4JU9A 2NYRA 3CLTD 4GP9A 3PDHA 4K9LA 2H59A 3ZGVA 1YHZA 2JIBA 2X7JA 2H2GA 4JT9A 4QPZA 1PO7A 4BV3A 4BVFA 4BVGA 2WVAA 5AHKA 2EZTA 4RJKA 1T9AA 1UPAA 2Q5QA 4UTVA 1XLTC 2NXWA 4UTXA 2Q29A 1T9DA 4BN5A 3FSJX 1M2GA 2HJHA 3OE1A 4V1CB 4G1CA 4C78A 2VK8A 4GM1A 1PI3A 3JWPA 4BVBA 1DJLA 1UPBA 4UU8A 1QPBA 3D4BA 4GM0A
chains in the Genus database with same CATH superfamily
1ZGGA 5H70A 3V8VA 2NTEA 1HE2A 5FL7A 3HYTA 1SIWA 4FHFA 3MYYA 3H2HA 4MS4B 4HEJA 1E58A 1JZQA 4JLSA 1G60A 3HDQA 3HEMA 1F14A 4KWIA 4PHFA 1YCDA 4HWPA 5EL0A 1NSYA 3CBQA 1L5WA 3JS5A 4NAVA 4WY8A 2VHUA 4RK1A 1D8AA 3AFGA 3EGCA 1GCGA 5K3SA 4QQ8A 4ZZ3A 3HKDA 4YRLA 3SZ3A 4KACA 5K0JA 5LQJA 1QK3A 2P6OA 2XB2A 3IV6A 4MPPA 3C6XA 1EUCB 2XZTA 3KUKA 1DJOA 4DA7A 4YAIA 1F2TA 2CNKA 2E55A 2D2VA 2NLOA 2HHJA 3AHEA 2QIOA 3EMVA 3JTEA 3KVNA 3BQNB 4IJ5A 1J0BA 1ENYA 3Q8LA 1S6YA 3ABRB 3KKZA 5AKXA 2HNKA 2ZXFA 1Z37A 2VH5R 3NIFB 3IKJA 4HB0A 2XUIA 4KNWA 4M88A 3SJ7A 1EFAA 4MH0R 5JD6A 1UM9A 1N7GA 3IERA 4MGYR 1NP6A 5ILQA 3S2GA 3AWIA 1QHXA 5KVCA 4BPRA 4JUAA 5LC1A 3W6OA 3MJTA 3KQOA 1EAYA 1YHYA 1DGQA 5KSPA 2DWCA 4ESHA 5IKEA 7ADHA 2ZYVX 3ME5A 3UFBA 1FLDA 4B5KA 4BASA 3EPJA 2VP2A 5AI5A 1PBNA 2K87A 5WRFA 4QLOA 2WU4A 1P18A 2LCIA 2B92A 3FNHA 3N7UA 4MR8B 5FJIA 5HKKA 1B16A 3UQZA 1HT2E 2NO4A 4Z54A 3GJ3A 3FKSD 3O2QB 2O0JA 4X0EA 1FSPA 4E11A 4Y6LA 2H7CA 3O84A 1SHKA 4Q6WA 2HZ7A 3K7EA 1Q15A 4TXLA 3KQLA 4XB1A 1VHWA 4FOTA 2E6UX 2V45A 4AICA 3CF2A 3NLLA 2FP4A 4FYPA 2D4AA 5HE9A 4F38A 5BVGA 3NNDA 4QGSA 3ITEA 1YBFA 5IX8A 3F6RA 1BEZA 1DE0A 1I6KA 1Q20A 2QAJA 1MDBA 3KUCA 3NR2A 4LY3A 4DGQA 5B7NA 3X2EA 4XQGA 5T4EA 2QLJA 4IIJA 1DIHA 1H5NA 1WA5A 3MD9A 4KQEA 3RFVA 3WYEA 5K03A 1LFDB 4MQ5A 2MJLA 2VPPA 1XTJA 5J40A 2QZ9A 1GFIA 5EHQA 4DG8A 2I3AA 2GZSA 2Z8YM 3CPHA 3QZUA 4QUIA 5E3JA 5EE3A 3JQFC 4DR3B 3N6VA 3LCJA 1NVKA 4ZVNA 4EJ2A 1AN9A 2AZDA 3KOWA 1YRQA 1CB7A 2OQVA 3A9RA 4BFTA 1GSAA 2GSWA 4AJ9A 5KX5B 1J07A 1HQCA 1QWOA 3CUWA 1FZQA 3PYLA 1EUQA 5H81A 4K87A 5KNDA 1LWNA 4BRWA 1WB9A 1YS7A 4D41A 1R6UA 2ZIZA 2V8OA 1XF1A 3MYRA 4Z0TA 1QHGA 2GAJA 5HTOA 4F1JA 5LQUA 1T9HA 2R7MA 2ZYAA 2PUTA 5IAEA 4EY3A 3H18A 3UJNA 3NW9A 1HT3A 3H9BA 4LCBA 4LGVA 4DC9A 4KK3A 2EZUA 3HLTA 4B3SB 1WABA 5J5CA 1XT6A 2CWDA 2FFBA 1QYRA 3AKCA 3GPLA 1U1IA 3IUNA 2GPBA 3OZVA 3VFDA 5T57A 1GDTA 3WGVA 2XUQA 2YHIB 3CEHA 3D1JA 4A26A 4YP6A 5I9MA 1NIPA 1P8AA 3WLPA 4QOGA 1W8IA 4E12A 4Q39A 1YZKA 3ZCPA 4F4FA 1A0OA 2GEUA 3JWHA 1KAQA 3M5DA 2VPIA 9GPBA 4TMVA 1E3TA 3ZKWB 4B6PA 4B79A 2OHIA 4GYWA 2DWQA 2PX4A 2HPAA 2M6KA 5C9ZA 2AG0A 1HEIA 4BMNA 3GEMA 5I3ZA 3RS8A 3HY6A 4IKOA 3AINA 1O6ZA 3TFQA 2RIRA 2IOYA 1W6RA 1HZZC 3N8GA 2HCJB 4LQ4A 1C3VA 4NL4H 3MCWA 4JH0A 4IRUB 5JYEA 5L3SA 4KPEC 1W88B 2P3LA 1Y1KE 3UAXA 1U7ZA 2YVQA 4GZLA 3C1TA 2W6PA 1LX7A 1P7ZA 5FOVA 1ZUNA 1E2PA 4X20B 4K6FA 5IW8A 4UVGA 4EOGA 5C7LO 4GDFA 2R6JA 1P2SA 4JASB 4IX9A 2JFFA 3LGAA 4F4CA 1Z4NA 3NTVA 1JW9B 2A0KA 2QVLA 4KZKA 3IOBA 4EVSA 2J3DA 1KAOA 2JVJA 3JSXA 4RYLA 1KI8A 3ZJYA 1DO8A 4KQXA 4OHCA 3IUJA 3CW2A 2QW8A 1HG0A 3HGQA 2X86A 1R3DA 1NMYA 2OHGA 3CUYA 1L8QA 2EG9A 3F46A 1HE4A 2R1VB 3D7LA 1ZXLA 3HWWA 1U2GA 3ZVMA 1F8YA 1PE0A 1AHNA 2C5LA 2OV8A 1B3RA 3OZGA 5JMTA 3UMGA 1FNCA 1ODSA 2WIDA 3PQ3A 3VSBA 1FYEA 5FLYA 4ZVRA 1O0BA 4FGJA 5EMLA 2A0WA 4QKQA 4CM3A 1ICIA 2XWPA 5E38A 3ZH9B 1NNUA 4XD7A 1VJ0A 1C8VB 3FTPA 3I8SA 3DE0X 5CU7A 4GPD1 1GV1A 3VAZA 1TZJA 2PFSA 4IGAA 2JRLA 3NVDA 1JB1A 1V5EA 4AO6A 2OCPA 1L5GB 2C0CA 3IOCA 4EY4A 3DEHA 3AY3A 1PHRA 4UHKA 2GAOA 2IXTA 3SU8A 3TRDA 1Z0ZA 1G20B 1IG0A 2X8JA 3EIEA 1U2GC 2Q45A 3OF2A 1SKQA 1SBTA 3WYAA 2RDMA 5C37A 2BHSA 1I3NA 3TPZA 1Z2NX 2OA0A 4RD2A 3I9V6 3L9XA 3PF8A 3IOMA 1J9ZA 1YQEA 2XNHA 3GGOA 1MUUA 3PLNA 4DL9A 4E5SA 2PEZA 1DTSA 5EJ5A 5J2TF 4KDRA 4N0QA 2XMZA 4AJPA 2YC2C 3HYSA 2P5YA 3GGCA 1X86B 3SYKA 2G7ZA 1VMEA 5L4SA 1V35A 4H6VA 1OZGA 4X84A 2CXRA 3CRZA 5FWNA 2F00A 1I3MA 2NAFA 3HWX1 3R8CA 3T3HA 4AJHA 1OFVA 2XB6A 1WKBA 3KQNA 5I9LA 3QPCA 4IWNA 4C4SA 4D4GA 4Q24A 1IHPA 4ROTA 2YBDA 4IG4A 5DBGA 4H1TA 1T8YA 3T6KA 2ZUEA 3RIXA 2HF8A 1LRLA 2XIQA 1N7HA 3H3FA 3LPCA 4OFZA 4Z9XA 3S4YA 1EWKA 1KJJA 1SAYA 1KP2A 2DULA 2XYVA 4H15A 4UJ5A 4W1QA 5JXGA 5KTMA 3O75A 4BRSA 5J9FA 1H2YA 3I8OA 1OFUA 2DY1A 1N3YA 4BZWA 3FZQA 5K3FB 5DWQA 1CQIA 2C3UA 4ZJYA 1KJYA 3BYZA 3LL7A 4GQIA 1PQWA 3G59A 3KQQA 4LRWA 4NCIA 1HE8B 3S29A 5JQGF 1CEXA 1T6XA 4K6GA 3IPLA 3Q10A 2PA0A 4GBJA 1RLMA 4Y2HA 3AM1A 1I14A 1KVSA 1M5RA 4EFDA 3CURA 1QZTA 4J2OA 4ZYYA 1P1KA 4BE9A 2P9YA 4B0PA 2G1AA 3QJ5A 4Z9FA 4DBVO 1Y48E 2VNSA 3HJAA 4CCYB 3AFOA 3TSZA 4JSTA 2H5IA 2VDWB 1Z2PX 4PW0A 2E82A 4ALJA 2FK7A 4E5YA 1ZIDA 3W7VA 4DT1B 2O1XA 1ZNQO 2I9PA 1FNNA 3PUXA 4UAUA 5I7UA 4I14A 2DLDA 3U49A 4PV7A 1CWUA 3DWIA 3PGXA 4DLVA 1YE5A 3B1ZA 3V3TA 5LDDC 3ITKA 1BRMA 4HMQA 4LYAA 2BISA 4NENB 4YUVA 2PD4A 2FPXA 3EYAA 2O8BA 1SQ0A 3FMPB 3A2NA 5EUBA 4LSMA 4OLHA 3JQRA 2VLBA 3WADA 1Z0DA 3HH8A 1KR2A 3X1YA 1ZLXA 3U4GA 3KZMA 1Z6GA 4JODA 2HF7A 2P9CA 3OPYI 3WLEA 3GP8A 3KT6A 5JBIA 1E79A 1QP0A 3PFFA 3ODPA 5KNLA 4W5TA 4IJWA 2I7DA 1Z25A 4YQFA 4RMGA 3GVIA 1SURA 4J6EA 2R00A 2W5UA 1GZDA 2ZYIA 4PG5A 2P5TB 4Q05A 2ZFUA 2UAGA 2H4FA 4IMJB 5JAZA 5J59A 3IQFA 2AFHE 4QXAA 1RWWA 4B3MB 2NU9B 3SVTA 2W6NA 3I62A 4R9RA 4Q3KA 2F3SA 4CT0A 3G17A 1CRPA 2VYFA 4J3JA 3EEBA 3VU8A 3DFIA 1ESMA 3OHPA 4HSGA 3ILSA 2PUHA 3S1LA 1RAEA 3FPSA 1XMPA 5FUYA 4IDQA 4MWDA 1NR1A 2G28A 2WJVA 1DKUA 3CINA 1EXDA 3L4SO 2R00C 4HNSA 2UUCB 4IDNA 4HDNA 4NULA 4OJKA 3SF8A 4HUQB 3CW8X 3MGBA 1YRAA 1R12A 2FSUA 1EFKA 1G21E 2Q46A 2X2PA 4G81A 1URPA 2Y1EA 4OYLA 4HVLA 4TSFA 2FEAA 4QJ5A 4NH4A 4ZI3A 5FF9A 4FFPA 3Q8WA 2I5PO 5I9TA 1XDSA 2I03A 2P6MA 1B41A 3HZRA 4OJNA 4QBIA 5BQPA 4CKCA 2PS9A 3IQIX 3UJ6A 1DIOB 4M9RA 4K2HA 1JKIA 2GDJA 4ZOLA 3EDCA 4X00A 3M5CA 3B82A 3ZW8A 1BXGA 1CQZA 1R6VA 1LTQA 1NFRA 1FTWA 3DTYA 1S3IA 5F76A 3VU9B 1JKJB 4C7MA 5F7OA 3DQPA 4HRVA 5JWOA 1UEXC 2JJ2D 3TTVA 4NEGA 3ICQB 1Z83A 4ZVSA 4AS3A 4AJLA 1WCIA 2C2HA 1SXIA 2GJAA 2ZCJA 1QXSA 2F1OA 4Q3BA 3SSOA 3ZQKA 1M2NA 2QYHA 1BCSA 2B37A 1IIBA 3GFQA 3WDLA 4A23A 1DDOA 1F8GA 1K6IA 2V8BA 1XBTA 4QPJC 4UBNA 4F4IA 1H5UA 4GPZA 3EGEA 1TXGA 2YY7A 3KE9A 5DHQA 1YS1X 2OQRA 1C7EA 1Z9BA 5CITA 1H2ZA 2NX2A 3RHZA 3W79A 3WIVA 3Q8KA 1XXHA 3R23A 5AW2A 1OU0A 3QM1A 1F6WA 4Y6OA 1J9EA 5FEUA 5KDOA 2NO9A 2K7FA 4HQRA 2D7CA 3IBFA 5ICCA 3V7WA 3GJ4A 1FTGA 3DL2A 3EOAI 4UUBA 5KKCA 4KFTA 3RVKA 3ZU4A 2FYTA 5J47A 1EG2A 3K32A 3DTNA 1ZLYA 1L5QA 1YKFA 1EGAA 2OV3A 3KQHA 2Q2NA 1DIBA 4WCDA 3HKDB 3VSAA 1I80A 2C2OA 1Z74A 4LOKA 2ZQYA 4A1OA 4ZFNA 1Q95A 4JXKA 5DWDA 1ZIXA 1DKRA 1JEDA 1L6IA 2B7CA 2NQTA 3WNQA 2EW2A 1K5DA 3AG5A 1XG5A 3K53A 1F2TB 2DMRA 4JN6B 1J99A 1YZUA 4NIMA 4UFNA 3SHVA 3WNZA 1FX1A 3WZ2A 1ZC4A 3QPDA 2BGNA 3RWOA 4D9GA 2RG7A 1ORIA 1LK0A 2ZRBA 3KT0A 2Q0XA 3O8QA 1JHQA 3LF2A 4HWRA 2B3TA 5H9VA 1MVOA 2EFYA 4Q93A 1LI4A 1VSBA 2I2AA 2HSZA 1L8XA 2VQSA 3F4KA 3F71A 4IUBS 4Z3DA 3TIXB 1ZL2A 1UM9B 3F5DA 1H3EA 1SHUX 1W9MA 2C98A 3LRTA 3Q5GA 3QUTA 4HJRA 1H22A 6LDHA 3BEDA 1U63A 4IYRA 5A5DA 1M6HA 3CF4G 3TXAA 4EMUA 5J5AA 4F6LA 4FN5A 3B1VA 3KUXA 2JHFA 4MUEA 4DA6A 1VTKA 2C2WA 4MWBA 2G1JA 2C9OA 1BKDR 2Y4NA 3L6BA 3IT0A 4H7PA 3FBGA 1Z7EA 1K66A 2NV0A 3NHBA 5BV2P 4BBJA 3BM5A 1YZFA 1T5HX 2B4AA 2XHZA 2X0JA 1RQLA 2JFXA 1B00A 1FSGA 4UVHA 3PWTA 2HX1A 1Y3AA 4MYRA 3HYLA 4M0FA 1XQ1A 3NOXA 4U2FA 1ZN7A 4R31A 4DDWA 3CEJA 2FP4B 5AHRA 1YDMA 1CY4A 1XCMA 4YJ2F 2I1WA 3W06A 4ZEMA 2ZJYA 4ZK2A 3OA2A 3EC1A 1WSBA 5CGZA 4A3SA 3A31A 1Z8HA 4B85A 2EP7A 1O6CA 3RUPA 3JRWA 2QZZA 4IIJB 3REOA 1HEYA 2WHEA 3QKUA 4G1VA 4RKFA 1E6MA 3ZQJA 1TO6A 2HMTA 3EODA 4EKNB 1AT1A 2OXFA 4XI9A 5IJ9B 1NQWA 2AEEA 1NQVA 3WLIA 2FW1A 3ZI7A 4ALLA 3B1JA 3SNKA 2V55B 1RWVA 3KKMA 4ZQEA 3NJRA 5EE5B 2B20A 3PUYA 5F23A 3EZ9A 1QOQB 3VNSA 5D8DA 1WHSA 3ZHUA 3S2YA 4EFKA 3DUFA 1I2AA 3EUWA 3FYHA 1PZGA 1JEOA 3M6UA 3OIWA 4H1UA 4W5HA 3EOZA 1FZTA 2K5UA 3IUSA 5A4MS 2RHOA 3K70B 1L4EA 2HYDA 2C3YA 2P3SA 5EP2A 3RKUA 3KJXA 1UJ2A 4RXUA 3ONEA 2WNIA 1ONSA 3BMXA 1Q7RA 5J4HA 1G8JA 1VYUA 3U7EB 3L8ZA 2EHDA 3O74A 2E4WA 3I76A 3OE5A 3QOFA 3GFOA 2CSXA 2YUTA 2O4CA 1FDWA 3V2UA 2WLSA 2RHLA 3EE6A 4G0YA 3TMYA 5T64A 8GPBA 1Y6FA 2G9UA 3LHFA 2JEZA 2IU6A 1VPDA 4FGZA 4YIKA 3W77A 2JCGA 3LDFA 4RDXA 5DNWA 2AB0A 3OPXA 2CVOA 3KO8A 3OWHA 1MW9X 3C85A 3OUZA 3CMMA 2DZDA 3VYUB 3CN7A 2AUMA 3RH0A 1THZA 4DYVA 4PC1A 3CSUA 3IQZA 2AUTA 3N0WA 2IYUA 4LISA 3DULA 3NDBB 3KBOA 3MAJA 1TZCA 2WABA 4MX8A 3AVPA 1TUBA 3FUUA 3SF0A 1BH2A 4L3WA 5HKAA 1QIIA 3HGTA 1ES9A 5EIXA 1MA3A 4OLBA 2PWBA 3OJCA 3UY4A 1E2MA 1MO2A 2X9QA 5FR1A 1ZGZA 5HKKD 5L3SB 1Q7BA 1JHVA 2JF0A 2V58A 3HJTA 4NU6A 1D1PA 4AYXA 4AO7A 2Q9AA 1OKKA 1Z35A 1ZUNB 2X8BA 3BF7A 1X7WA 3RIYA 4WNAA 2CB9A 1VZ3A 4XB2A 1NF3A 5ALWA 3CVVA 4NJEA 3K31A 5IAJA 2ZUUA 3FMVA 1E2IA 3PTLA 5CK5A 3HV0A 1YS6A 3DE5X 1WL8A 5LR6A 2VHEA 3LP5A 1QQ7A 5DHTA 1GYRA 3K0CA 1EVKA 4LHEA 1M6NA 3TX2A 4IF4A 3FX2A 3I2FA 4R3UC 5JJKA 2Y6UA 4HPJB 3M89A 4B7XA 1VLJA 4CIXA 3TQCA 1SN7A 2YQ4A 1EXVA 3TSCA 5SV2A 1XLUA 2EJVA 2YINC 3HB1A 3ED5A 5AVRA 1UXGA 1YDHA 4NU0A 1X70A 3HA7A 4RF2A 1I2MA 1QH9A 2VDQB 1O5TA 4X7BA 4ZANA 1P4RA 2PKQP 5DNYB 3U5ZB 4WLFA 1M83A 4J1TA 5EJ2A 5LQMA 3PXAA 2WF7A 2OCGA 3K0CC 2X8JB 3LP8A 4ZJZA 2W0SA 2Y1LA 3K1AA 4HO1X 3B6IA 2ATVA 4TXHA 4XW2A 3S99A 4F93B 3GZNA 4RADA 1ENZA 5HQTA 2ZIGA 3OQ6A 1BD4A 1GAEO 3OJFA 1A9YA 2EKBA 5HW0A 3Q3GE 4Q16A 1KS9A 1P5HA 4MVJF 1CT9A 1II8A 1Z22A 5JC8A 3GLUA 3R75A 3GJQA 3IOEA 1K27A 2PXHA 1JQAA 3TMKA 5K01A 2QRZA 1YCFA 2LKCA 3K0EA 3LUFA 2QJFA 5FKJA 4DF3A 1SXQA 3C4VA 4KBYA 4A27A 4J1TC 4PAOA 3PXCX 3IPYA 2ID4A 2L0XA 2NZ2A 3DMDA 1SD2A 3OMXA 3QLUA 4FYMA 5D85A 2VHWA 4ZQHA 1JEAA 2XVYA 4A6XA 4BFYA 5J4VA 4DSTA 4D9FA 3QITA 4ZXFA 3E9YA 2GM9A 1WPQA 3A7EA 1JMYA 3AHGA 4FEGA 4K28A 3V55A 1RFLA 2BLLA 1I7DA 4JVMA 1D2MA 4MUMA 4QVGA 1ID8A 2D0OB 1M34A 5A02A 5CDYA 1A88A 5BNTA 3T99A 5ILGA 1RM3A 3GMDA 2ZU0C 3GLHE 1G8PA 3QXSA 1X7GA 1MFPA 5JQGA 1CQIB 1NQTA 2EYUA 1KPHA 2C77A 3IGFA 4KEAA 4LRXA 3QI2A 4URFA 1R6DA 2A0YA 5JDCA 2H1FA 1I32A 1K5GA 3QLUC 3OP4A 2P75A 1E0SA 5DULA 4ME6A 3EQ6A 3JVUA 4PLTA 4X54A 1R27A 2NO0A 5ED0A 2X9LA 3IP6A 4NZNA 1KYTA 1KORA 2WU1A 2JZOA 4PZDA 5M34A 2EKQA 5SYNA 2J6BA 5LLTA 4D6YA 1WQ4A 2CYCA 3F8TA 3N3AC 4H17A 2R1ZA 1KDVA 5CCXA 4FFLA 3SQWA 4FC6A 1ST3A 1EZ4A 1KPGA 1OBOA 2O7NA 5L4LA 3EYWA 1XC7A 2AXEA 4CV0A 1WR8A 2VJYA 4EB0A 1GCUA 5LZ2A 3F96A 1COZA 1ZWKA 2WG0A 1NA5A 3IA7A 3VDRA 4XIJA 3PZRA 4RZSA 1JEJA 2RAUA 3L4KA 1M0SA 1AQLA 4G2TA 1IEVA 3IAUA 5EGNA 3Q9SA 3RC8A 3QTTA 3SP1A 1Z15A 3BE4A 5BSVA 2V1UA 3H4TA 1NPYA 3EMDA 2F4NA 2R87A 3L8EA 5EIBD 4CLXA 3A6GA 2VTBA 1DC3A 2Z2JA 2I71A 3FFTA 2RGDA 3PNQA 3NJ8A 3LY8A 4R83A 1DAIA 2B21A 3A4LA 2ZRHA 4P4SA 1FRQA 4LY9A 2XTZA 4RMHA 4L78A 5DIFA 4DEXA 3RRXA 1JA9A 1OD6A 2WJAA 3O1HB 3ZWBA 2EX0A 3DLPX 4N5NA 1FMTA 1WO8A 5KYUA 1HFEL 4MVXA 5AVVA 5JYBA 1KHHA 1IQUA 1ZQ9A 2HU2A 4EBBA 4Q1CA 3ERCA 1ZWLA 1JR2A 2Z9CA 4KXYA 3RWMB 2FW6A 3ICWA 2AE1A 5K1ZA 4F56A 1DT3A 2Q6OA 1QVVA 3BK2A 3EGDA 2EAUA 4MRRA 1O87A 1E9FA 3SYMA 1K2WA 1O6GA 4X1YA 3RTEA 3FN4A 1LC3A 1BOOA 5KHLB 2P6PA 3GL9A 4O5OA 4Q34A 2BFMA 1JDSA 4LQLA 4YRGA 5B64A 4X3CA 1HXHA 2WWHA 2R5NA 1ULAA 2YV1A 4HDNB 4P58A 3HWSA 2OILA 3I92A 2CJFA 4J9VA 1CHNA 2HT6A 5LBIA 3TLMA 3RUFA 3DJFA 3E53A 1I2ZA 1QFMA 2PQMA 1X1DA 4CM5A 3RUEA 1UJBA 4UNQA 2XF2A 1E3JA 3T4UA 2OBNA 3BMQB 3NWPA 1DB3A 1B8PA 1EEXB 3R76A 3TW0A 3WK6A 4D4MA 1HX7A 2VN8A 3DVQX 2PANA 3UGTA 4C0LA 3HU1A 4H08A 5KYTA 1OX4A 3WFZA 4M55A 1UC9A 5AVXA 3IV7A 3WRXA 4H3HB 1EQAA 4ZOLB 3GLIA 4OG2A 4N40A 4NARA 3RS3A 5IAAA 4J4HA 1K1EA 1JVNA 1OWNA 1BXGB 3I1YA 3CA8A 2PXXA 2VBIA 3AR5A 3OZ7A 3QU7A 3KYCA 3U0BA 3FPGA 2H63A 3ZWKA 1BQEA 2C8KA 4R51A 5TJ9A 3NBYC 3PFCA 3A11A 4H3VA 4OGFA 2HKIA 4BMOB 1D2CA 3NFRA 4ZHQF 4CLRA 1DLJA 2XBLA 3AR9A 5FBQB 3MVEA 1R9GA 1JDZA 1G5TA 3ABQB 1JZTA 3QYFA 1BCSB 5F73A 2CFSA 2J9FA 1PEDA 3H1TA 2RHBA 4R1NA 3P97A 2FG6C 2JFBA 5HCIA 3CF0A 4CIDA 1T2UA 1FDVA 1PWZA 1E5QA 2DU8A 3WRXC 5JCJA 2LIPA 5AJTA 4DA8A 1CV2A 1B2RA 2B6NA 2XVMA 3OOYA 4GYJA 3A2LA 2VJMA 2QQEA 1XXHB 5H5JA 1E79D 1X19A 3RYIA 1GTJ1 5E1DA 1GTG1 1PNVA 2PPLA 2PZMA 3HNRA 4BGIA 2OHJA 4NOJA 5EGSA 5TF4A 2G67A 4A92A 4I9UA 5JZOA 2PIDA 4HDRB 4MKXA 4RZ2A 2H9AA 4D4LA 5EINA 4NBNA 2C00A 4I50F 2DKOA 2EU8A 4RGBA 5EJFA 3UJCA 5JHHB 1Q6YA 1AURA 1NLYA 4Y9DA 4XVUA 3AZOA 3TEJA 1VLHA 4OLFA 1R9JA 1DU4A 4DMFA 4UPEA 1XMQB 4D0LB 2V5AA 4WEOA 4F8JA 3A3PA 1FL9A 1R0KA 4L5YA 4DIBA 1NG9A 1TQ8A 4C4AA 3MINA 2M1ZA 4W63A 4LV5B 4R1UA 2R5WA 1N78A 1GDHA 1D4FA 5IXSA 3RHSA 1PWXA 2XVXA 5K8IA 3CCBA 3O8QB 4MDEA 2EGUA 3KOMA 1RHJA 1SZDA 3ZWDA 2WHQA 1I3CA 3BEOA 4X9XA 8OHMA 1C4OA 1M2EA 1TIKA 2AG1A 1CUDA 2ZUCA 1UBRS 3BWDD 3QPAA 1N2EA 4WBXC 4P36A 1W75A 3I45A 2OKCA 3TOSA 1XNHA 5HJ7A 1QK4A 4TSFD 2IPNA 5A4JA 3HBMA 4X8OA 3L7YA 3HHPA 5ALJA 4MV4A 5BT8A 1OSNA 1WKVA 3LY5A 3OQVA 5BT9A 4N9QA 1R64A 4UAGA 2NU8A 1YA6A 1DWPA 1TO2E 3BIFA 4AMZA 4EQ6B 4Q4AA 1XD9A 4GPEA 3CNQS 2RKBA 5ESXA 1I3OA 2FSGA 4FT2A 2FDXA 3UHJA 1KYWA 4B3RB 2XUDA 1FUKA 1AHIA 3T3MB 3BAFA 2ADOA 4EO9A 4XYBA 2QTAA 4LMBA 2P2DA 1HV8A 1QLHA 2I3DA 2B99A 3DOIA 3T4PA 1UADA 4P3YA 4L4YA 3AGPA 4X6YA 3EIXA 1GEGA 1P80A 4H0NA 2H6EA 2GEVA 2Z8ZA 3LK7A 4OQXA 2XZOA 3PUWA 3WSWA 1ZRMA 2B82A 3JQAA 1NVVR 5EP3A 3UKJA 1YAHA 4IV0A 3VYVA 1PG0A 1QQTA 3DV0B 3W04A 1FYFA 2P78A 3SQOA 2GVNA 2EFJA 2ZAGA 3ZV5A 3RRFA 2J85A 1C9KA 2EV9A 4B1FA 1GVHA 4NCKA 3RWBA 1WXIA 2IF0A 3OQJA 3Q85A 4PBTA 1Y7TA 2HO4A 2I3BA 2C83A 5JS8A 2H57A 3C8UA 5LB4A 1W87A 4LI0A 1O96B 3LA6A 3QW2A 2W2LD 3WL4A 3N2ZB 1WHSB 4I9HA 1CK4A 3DUFB 4FZ3A 1VGVA 3VOAA 5E1OA 3EXHB 1DKOA 3IP5A 2OYCA 2JAHA 3F7MA 3SXJA 1N6LA 4D92A 2Q4TA 1MW8X 3EBOA 3WX0A 3TAXA 2BAGA 3N70A 3KQYA 1ZMBA 3GRVA 1JXMA 1T5IA 1EESA 1IEXA 5GGXA 3AB3A 3SBEA 3WGHA 2R8ZA 1CLUA 3RTBA 1BIFA 3ID6C 4RTOA 1USKA 1JSCA 1YB7A 1KY3A 2C9ZA 4QAQA 3TQIA 3W6NA 3E4CA 3E8SA 1W52X 3RBXA 3L92A 2Z4TA 4HX5A 1LPAB 3UJDA 3EVEA 3RC7A 3KLNA 1XPRA 1X9GA 4ID3A 3P52A 1U4OA 1M2KA 1YZQA 2C8VA 2W48A 3I9NA 3ILHA 1GNSA 4IHAA 4ETWA 2CLLB 1P7YA 4WLVA 1IN7A 1TUBB 3KD3A 2VJPA 4ZT5A 4TQAA 4QULA 1XRNA 3IAEA 5FV7A 2P4UA 1S3GA 1Y3FE 2O2DA 1EVJA 4G4SO 2QN7A 1TVKA 4RDHA 1R0SA 1NBEA 4Z5XA 4A2CA 3BILA 1UPTA 4LYHA 1X7WB 2WUEA 3E3AA 3H7AA 4KSCA 1JQ5A 1GQSA 1Z2AA 2P9ZA 2RJOA 3KR9A 3Q2OA 2C1XA 4WNAB 2JIZA 1M66A 2PUJA 3C3DA 3RK1A 1Z2OX 4NJEB 2FU5C 1YZLA 3H04A 4MWGA 5EIEA 4WZ6A 1V96A 1L4MA 2P77A 1VA4A 4MCIA 1MIOA 4UPVA 3SJBA 2B1JA 3IDAA 1YZNA 3T1TA 4E03A 3GXBA 1MDFA 1NKSA 1W0CA 3SIPA 5BN4A 4WY2A 5BYJA 4H4DA 1KRHA 1ZD1A 2JFNA 4FSHA 4UMFA 3N2YA 3S2ZA 3QPVA 4YQZA 1RLTA 2F6RA 1YMQA 4FT4A 5J58A 3CQ9A 5B6PA 5C53B 2FKNA 3LD9A 2GJKA 3WKEA 2D0IA 3AG6A 1XMOB 3HJFA 1NT2A 3L7LA 1J24A 1X7XB 3NYRA 4BLQA 4H3KB 2JD0A 4XEUA 2FUNB 3VHXB 4P33A 3PJRA 1TPZA 3C1OA 4BVGA 3H6HA 1BHQ1 3DOUA 3ZHOA 1N5DA 2YJZA 4UBOA 1YVEI 3LPDA 1WUTA 4A2QA 2GEKA 1RKBA 2RGWA 1RXIA 3AR4A 5AIBA 3TLZA 2W6IA 4A0SA 2X5NA 2Q5QA 3QE4A 3K1AB 2E4AA 1G5FA 3GZNB 2X3YA 5I8PA 3B1KA 1FE8A 2C58A 3OIUA 4MVJA 1OXMA 2C29D 1EJ6A 5J2TB 5D3ZA 2BI7A 1II8B 3O4FA 3QVGA 1BTOA 2VUSA 1G5IA 7MHTA 1O6BA 2H3EA 3BXZA 3S81A 5HIKA 2J31A 2QYOA 4CJXA 2AOTB 1ZKMA 2QRHA 4JQSA 3WLOA 5A4AA 3C97A 1Z82A 3SDSA 3DQQA 4IIEA 3VH2A 4BO1A 3DMPA 5A5GA 5U4XA 2IZ5A 3WWCA 3C5EA 3RS7A 5B2FA 1DAGA 1SKAA 1BRTA 5K0CA 2VK8A 2FZLA 4L74A 1NUAA 1PF7E 1PI3A 3NCTA 2P4HX 4OXQA 1QSGA 4D96A 3G5TA 3OZEA 1DRUA 4G67A 2EJUA 2Z30A 4IWYA 3VDNB 5BYAA 3PNMA 3H1FA 3AF0A 4L76A 3I61A 1NAHA 2VRWA 5DLDA 4D4HA 4N8DA 4YRJA 1JIVA 1FDRA 1OTYA 4XGKA 5JJBA 3NHPA 4R7ZA 1M34B 3MF4A 5BSMA 1LX6A 5ES4B 3A1NA 1O58A 2BR4A 4OHMA 3K92A 4UZSA 4NBWA 1WG8A 1BMFA 1TT5A 4WD3A 5CJPA 2JLZA 3RRMA 5JQGB 1VMAA 1WX1A 1Z6YA 4NMMA 2AFIA 4PHHA 1EDZA 1HL7A 1QKJA 2GPJA 2H65A 2I3ZA 2V7QA 4OAOA 1WPXA 2JLSA 5SZJA 1MC4A 2ZUDA 4NONA 5F9MA 2ZYDA 2E5FA 16PKA 3FDJA 4L6AA 4XX0A 4Z8XA 4YUYA 1BGWA 1EB9A 2ZJ6A 3FGNA 4NF2A 2WMNB 2R7KA 5A9SA 2CNNA 1Q2UA 2FQ1A 3KSZO 3DFZA 1TU0A 4PAGA 4PTYA 3U17A 1GPH1 2PBLA 4D3SA 3LU1A 4EY5A 4R71A 2JLCA 4IGEA 1H0KA 1NQOA 3FA2A 3JATA 5EQJB 5JD5A 2Y9PB 3EFOA 3LSYA 4IZ6A 1Z36A 1YR3A 4MKFA 1I9CA 3TS1A 2JH9A 2QUJA 4B43A 4G5QA 4YECA 1HT1E 1M72A 1U2EA 1XOIA 1P4SA 3JTMA 3PFBA 1E3IA 4FW8A 4B35A 4C7OA 4CF3A 2JZCA 2COUA 2O0MA 1FK8A 1KFJB 1JFSA 3L41A 2A0FA 2M98A 2UUPA 5BMOA 3GZ4A 1J5PA 1XZCA 4K1XA 2XGMA 5TVKA 4AMVA 1E3QA 2DWUA 4BDTA 1IM8A 1IXYA 2PZ8A 3DO6A 1PJAA 4YMTA 1AF7A 5L8VA 5HCUA 3ECSA 3IEMA 3I3SR 1B8NA 2VTBB 2R68A 4UTNA 2A88A 4PY2A 2FQYA 5JHGB 5LZ4A 5EIAA 1WZUA 2JH8A 1PUIA 3COVA 5BSGA 4MPDA 4I0WB 3I9JA 4P4SB 4Z0HO 2VZ8A 4R8VA 3EW7A 3RHFA 3DL0A 5IU6A 2HSEA 1Y1LA 4WA7A 1KZ1A 1RYZA 3EY9A 5KYUB 1QP4A 2HFJA 1EU1A 1RNLA 5B1SA 3TUJC 2YMQA 3RYCB 2YRFA 2X0KA 5IH3A 2Z2KA 2V59A 3QBDA 4O29A 4YP7A 3EXG1 3P2JA 4EJ0A 1GFWA 2GXAA 1XRMA 1E4EA 5B1HA 4ZAYA 4TV8A 1EM6A 3Q0TA 3EGDB 2OHHA 2NQ2C 4R2HA 1FDOA 3HBFA 1E9AA 3QSYA 3WMXA 3B2NA 1P73A 1WBDA 1U8XX 3MOGA 4JB3A 4X1YB 5CVCA 3T3OA 4W5NA 3ZDAA 1XVIA 2L2QA 3E22B 4BIMA 3KZOA 2AI3A 3E8MA 4IF6A 4EWLA 1YR7A 5IYZF 1SNYA 4HNVA 5C32A 3M34A 1Z5OA 2VXCA 1SMKA 2D3WA 3C3AA 1PUJA 2PKWA 3FZYA 2BFDA 3LSTA 4PQFA 1AX9A 2P79A 3MOIA 4OQNA 5AIAA 5BUQA 1RQ2A 5B3JA 4K3UA 4O1IA 4ZOCA 4B2LA 4PS0A 1A4XA 1L8AA 1SPXA 1Y3IA 3ZJUA 1AIPA 4QBKA 3CRMA 4BQPA 2D1QA 4DBLE 5AW7A 1MENA 1E1YA 2Y0DA 5TRTA 4B44A 1RLIA 3AUSA 1ZM2A 1L1FA 1NRIA 1UM8A 1U1CA 4JXXA 1DHTA 1OX4B 5LCXA 4XLLA 3KEMA 2B78A 1N8NA 3GLIB 4YX9A 4MI9A 2OVFA 3ZDFA 2H11A 1GAWA 5FA8A 3KYCB 2OPHA 4CMCA 2HJ9A 2R66A 2C5AA 3FNEA 1I4WA 3ND9A 1IATA 3M6XA 3PFGA 4ROSA 5A5VA 1G2QA 4YMSA 4F1KA 2ECPA 5B3JC 1WBBA 3KTFA 3LQ2A 1KP9A 4F3RA 3LO8A 1LVUA 2H4HA 3K1JA 5FLXA 4LDJA 1BWPA 4B87A 1PS8A 3C14C 3VNBA 4B81A 4ERNA 2J9FB 2QUHA 1DRKA 1DBQA 3T41A 4MAFA 1GL9B 3LNTA 1DEKA 2XNKA 3G5AA 3PVSA 4D1YA 1JE1A 1OGIA 1MO6A 2PBFA 1ISIA 2ZRKA 4IMPA 3QHPA 1EFLA 2VJMB 1LDGA 1IPEA 5B53A 2FI1A 5JVDF 4GVPA 2VP4A 4I1UA 4I8DA 3RYIB 3KB1A 3PZBA 4MLDA 1UQUA 2ATCA 2G36A 2ZT7A 3EZ2A 3PP8A 4ASUA 5KSYA 3NXKA 3J81A 3R9XA 2I6QA 3OZCA 1UP4A 3VVMA 5DH9A 3VUFA 2A5FA 3PITA 3CTMA 4YRSA 2D0PB 2IF2A 5G1OA 4DA9A 3CC8A 1M76A 2PJRA 1ZZEA 1PN3A 2B0CA 1BN6A 2QT0A 3G2OA 1RPZA 2IEAA 3TVTA 3CH6A 2G72A 3CO0S 3P9ZA 4TSKA 4DLNA 1OFUX 3UJPA 2C04A 4B6OA 3ICCA 3NTRA 4X1KB 6YASA 2RARA 1NF2A 1KMNA 1KEEA 3GUUA 1JTEA 5T5QA 3MINB 4M7WA 1U5BB 3OFVA 2AJ8A 3RUIA 1FP6A 2XWSA 3JY6A 3LKVA 5SZHB 3UMRA 1FDSA 2GFQA 2OV1A 4OMUA 2FZGA 2D2IA 3SZGA 4E4YA 2VYVA 5JECA 4KMSA 1W0JA 3TM5A 2KM1A 4LPSA 4DS3A 5J23A 2O2HA 4H7DA 4CMJA 4L07A 2YJNA 4JS0A 3II6X 3IPXA 3PDIA 2VJKA 2X15A 2JK0A 5AI8A 3WLNA 5C5CA 4AK9A 4Z9AA 3ABZA 3MTEA 4Y1GA 3I53A 1AKNA 1G19A 1J2TA 2ZR8A 1U0BB 4NP6A 1UH5A 2IIQA 2MSCB 1QF6A 2QKYA 3G8AA 4JL5A 4Q4AB 1QX4A 2IODA 3UAOA 5D1HA 3JQPA 3E48A 3T95A 3FTNA 3EZFA 1CR0A 1JSZA 4W99A 2NYUA 2FFRA 3FJ1A 1TK2A 1I4TD 1ULUA 3UAYA 4F85A 1HE3A 2R751 2B9VA 3PVZA 2PUWA 2ZBFA 1Q1BA 1XA3A 2CDNA 3AR2A 3QUAA 5TPZD 1ACJA 1LSUA 2VAWA 3UK0A 2BDTA 3OIVA 5E2IA 1YUMA 5AKKA 2IK8A 3W5BA 3IE1A 1QVZA 4WK4B 3DVLA 5KVQA 5GZ1A 4IGKA 5CCBA 3IEVA 2RGAA 2PZBA 3JQAB 1N33B 1IDN1 2QPOA 2WG2A 2DQKA 3PC8A 4O4LA 5HP4A 3I1JA 1IUOA 1PW5A 3HCRA 4GU5A 5D3MA 5JCJD 4FI3C 3V3KA 2A9VA 2DHEA 1M8JA 3N9IA 5CX1A 3UAZA 1IB6A 3ISJA 4MKIA 3QYJA 5A9SB 1DCTA 4OO3A 3I0ZA 1G6Q1 1V3QE 2PNFA 1CUYA 1GU0A 2HADA 3M4JA 5DISB 2WSSD 3VO1A 1OAOA 2HAEA 2V6MA 3H0CA 2VI5A 4MAAA 4Z8YA 3UT5A 1YXMA 1JAXA 2Q6IA 3D8UA 2QAIA 4KB5A 4XQ0A 2P27A 3TRIA 1CSEE 1E5LA 4NJMA 1G6KA 1MP0A 1IXSB 4QHYA 1ECFA 4FR2A 4E2WA 1OR8A 3DV9A 1P19A 2A8YA 5TXGA 1J20A 4EX6A 3U5TA 1I2BA 4OIFA 4AJIA 1WXFA 3PC8C 4RO0A 3JYLA 3DOEA 3GDHA 4Q0MA 4DUGA 1EHIA 4NE2A 4MO2A 5GQSA 1O54A 3OT4A 2QU8A 4LS3A 2ZULA 5KOHA 3W34A 4O3MA 3QY0A 2IEBA 4JB0A 2W4IA 3WL8A 3KXDA 4RA9A 5C2JB 1Y0BA 2AYZA 1A98A 4X8HA 4IDPA 1K0UA 2YN4A 4H27A 4MQEA 3SBOA 1QP8A 1R0WA 3TSWA 3ZZ1A 3UHAA 5ISMA 1KC1A 4DJFC 1EXNA 1A69A 4RZHA 4GKBA 2XMQA 3DEKA 5D5QA 1E6LA 4M99A 1L5LA 5LB2A 4HKTA 3PNYA 3JQDA 3WOHA 5KTRA 2EFCB 1P2FA 5JNUA 3SQDA 3JQ6A 3C4QA 1JR4A 1T91A 3IUEA 2Z56A 4ZOEA 1CJVC 1PQYA 3HZOA 2Z0MA 2N9UA 3RANA 4QNMA 3OMWA 3MS2A 2JCSA 5B7GA 1TVKB 4DCGA 3TW8A 3IEXA 1NGSA 1YNSA 1IUNA 3AJAA 4K88A 1OWMA 4JBIA 4D9IA 2A3NA 4QGAA 1DBPA 3CH7A 1LNQA 3S1AB 1MT0A 5AVKA 5AW0A 2BONA 3D31A 4EI7A 1WETA 1SHLA 3A6JA 1MIOB 1NP7A 1L3CA 4M76B 3I23A 4CMIA 5GTDA 2L19A 5KC9A 1Y80A 5BN4B 1RAAA 4ZQIA 3BXPA 1PBTA 3QRWA 3SFZA 2GCPA 1QF7A 1JJ7A 3AIMA 1VPEA 1W4CA 3ETLA 3KU4A 1A8SA 2K4MA 4BNHA 2H9IA 2A94A 1MVLA 3KQTA 3HFSA 4D8YA 3Q9NA 1K89A 2QUKA 2HMYB 4LPKA 4EMBA 4I8IA 1J5XA 4UTRA 4P22A 3VPHA 1DV2A 4UNIA 3V4VB 1WXXA 4RHXA 2F3RA 2G9ZA 2HIHA 4QLAA 2XMCA 3ICVA 3GX1A 5FBWB 3DR5A 3K16A 3C8HA 3UMMA 1NE7A 1KFEB 1SVLA 3EASA 1U0HC 1OI7A 3W9YA 2HSJA 3GEDA 1KJ9A 1ZOIA 4BFCA 4DILA 4DR6B 2Q0SA 2CUZA 2DQSA 2VHVA 4R7TA 4AO8A 1C0PA 1W29A 3HU3A 4CU2A 2YIMA 3RSFA 2GZAA 2O2EA 1NZFA 4JJIA 1U7OA 1QIJA 4DSNA 1E6CA 3N8IA 1RHQA 4HDQB 1SZCA 1RQRA 3GPIA 3HVUA 4RF3A 1DRVA 1RKVA 4XIYA 3R9IA 3S2FA 3L6CA 2AKYA 2PD6A 4MHOA 3T7EA 3P2KA 1CQXA 1M8KA 4MK4A 3TH5A 3ELWA 3VVCA 1L0BA 1WXQA 3HVIA 1GG9A 1YVDA 4M9CA 5EJEA 1WLSA 3LS2A 5BORA 4QA9A 1SC6A 2O4UX 1QG4A 4Y2XA 2AX4A 4FU0A 1HTWA 3Q72A 3QVVA 2MR5A 4WASA 1E7RA 2FPOA 3E5MA 2VPXA 2E87A 3GLQA 1YL7A 2PRJA 4KTTE 1RXEA 1FRNA 2OMEA 2FWAA 1A8HA 4KN5A 1TW2A 2RGBA 3ZUGA 1NMXA 4YBRA 4HNAA 5HRCA 5ICEA 1G3MA 3OEHD 4ZV4A 4BJ5A 4JR2A 2JFZA 4QTZA 3CS3A 5AOVA 3VGJA 5JEEA 4JI2B 2WUDA 5GAJA 1ZGHA 3NPAA 5TGZA 1SUFA 2BHTA 4F7DA 1GP2A 1QVWA 1GKYA 3DFUA 4L4UA 3LWNA 4R54A 4BZZA 2NZUG 2HA2A 3DHVA 3SS7X 4D9JA 2NXJA 5G3YA 1D7AA 2EL9A 5BQXA 3WP0A 1WULS 2FFAA 4D9CA 4EPYA 5KYYA 4YRDA 1S8NA 1E92A 3C87A 3GROA 2JIZD 3SC2B 2ABWA 4K5QA 2UZAA 4P5PA 3G6KA 3GNQA 2XYPA 3CWZA 2HRQA 1CYDA 4WNIA 5KREA 3HI6A 3MA0A 2FUEA 2NUBA 2VJQA 4F9EA 2ZSUA 4FOLA 3D3NA 3IL2A 2XXAB 1Z0SA 1SVUA 2HHCA 5CNKA 1UKBA 3DJYA 2BMFA 2I6UA 2QX8A 2O3TA 4EEXA 2Y99A 3WXBA 1JDJA 3JATB 1S2IA 3MOSA 4AC9A 3KRTA 4PG6A 3TN7A 3V32A 4P0PB 1XEFA 2QS9A 3EFOB 1J1IA 3TZCA 1E9SA 2JBAB 4JB2A 4O2BF 4WPGA 1UZAA 1TJ5A 1T1EA 3HA5A 2AVNA 4C7OB 1MRZA 4NV3A 2ZCVA 3TIVA 3BSWA 4ALNA 4S1WA 1O4VA 2PZLA 3EISA 3LZDA 3U9LA 1KQOA 4W7SA 5FOQA 4NBLA 3MJVA 5HG0A 1JR3A 2C0QA 3GP3A 1E2QA 5EQDA 3W2HA 4HMPA 4EF5A 1X94A 3PX3A 2OGWA 3OOWA 5F2EA 4R2KA 1D4OA 4E51A 1GQRA 3GEIA 5AW6A 4EEKA 2Z43A 1JIKA 1TLFA 4LSWA 1J2YA 3BZUA 1OLXA 3GEGA 4GOKA 1JIQA 4M1SA 4DIEA 1JECA 1VKJA 4MVJD 4BWYA 3A32A 2JIBA 2D1RA 4JBHA 3BBPA 5DX8A 5ITVA 4R69A 2OL4A 4FMBB 5FFNA 4CMHA 2QSYA 1KJNA 4BV3A 4MWTA 2VSYA 3UGJA 3HVHA 3C3BA 4YBZA 4BX2A 1P2UA 4BQIA 4AN0A 1SCAA 1RVDA 3A9TA 3A26A 1ULTA 5IPFA 1UINA 1JVSA 3I9KA 1V25A 4TN5A 2WFZA 4M8LA 1E4EB 3OLCX 4HF7A 2UV8A 4HWOA 3PCRB 4RSMA 1IBMB 3TL2A 2A67A 1VM6A 4BMXA 4LYYA 4AZTA 4UTVA 3SIRA 5HYVA 1M7BA 3EUEA 3KUDA 4C0BA 2HH9A 2ID9A 1HGXA 2R1UA 5A2GA 2YASA 4KLNA 5T4BA 1JJAA 3CUSA 4JGBA 1P3Y1 4P4UA 3UHPA 4DCNA 1BDJA 4REMA 2G5TA 1G16A 1BMFD 2NZWA 1NXOA 3CH5A 1S1CA 3NG1A 4IQ0A 1IIRA 4J0EA 1RXVA 4S0ZA 5I47A 1DI0A 1GZHB 1LW6E 1CJSA 1V2GA 3W8DA 1E2DA 1SOUA 3I2JA 1Y9EA 4XM0A 3CYFA 4JQZA 3OSUA 4U1RA 3ETDA 2LCFA 2OK8A 1ISJA 2CUTA 4QFCA 1TMKA 1NLFA 3QU4A 4EJMA 4UU8A 1ZHFA 4Y1RA 1LQ2A 1IULA 3CSSA 3FY4A 3I64A 3ZNOA 3C8ZA 3UCFA 5J4YA 2QL6A 1DIRA 4R9UC 1GADO 1R8JA 2PX5A 1ZIOA 1IPFA 4I4IA 4BHTA 4B80A 2ZBUA 1KMIY 1V5FA 3K5IA 1E5TA 5H7XA 1SIBE 2GZ2A 3LX8A 1NY5A 4DCTA 3B36A 1WB4A 3QFCA 4MS1A 2C9DA 3JWGA 2AWNA 3RW9A 1NVFA 5A0VA 1K7YA 3MMXA 4Q21A 5TSDA 4UHHA 2IX3A 1ECJA 3EBLA 2HCFA 1L7EA 2CXHA 3DD5A 2GCEA 5A3JA 1PAUA 1TX4B 4J94A 5ADWA 3K8OE 3DE7X 4I5EA 4PR3A 3LCRA 5CLQA 2OY0A 3R24A 3FOCA 3X2SA 2OFWA 2C99A 4MV1A 1KH2A 4UM5A 2FE4A 2Q8PA 3D9QX 3R9XB 1L5RA 1CUHA 1I7SB 3RVJA 2DFTA 4LFBB 2CLEB 3SZRA 4LSZA 1GT91 1XQVA 2D5AA 2YWRA 1P2VA 1JNXX 1XA0A 4OHWA 4NZZA 1WMBA 1YFLA 1GPMA 5JADA 2Y68A 4ZCPA 1K4MA 1XYGA 2AWOA 3GVHA 3SHQA 2Z5VA 1OH5A 4WACA 4O0MA 3IUPA 3A1VA 4TRRA 2ZE5A 4PEVA 3LQ4A 3G2LA 4P7GA 3T7KA 1KEEB 3D6MA 3NAMA 2M6LA 1W96A 2QX9A 3OM8A 1Y8ZA 3AJ9A 3OP1A 4C7JA 2XD9A 2HMUA 4GPTA 5EJ4A 4OJYA 5TQJA 4R0VA 4QXQA 2BKAA 5JMOA 2QLBA 3Q6MA 1ONNA 2DR2A 4LDNA 3TOZA 1MAWA 3FJYA 4WN9A 4HV4A 3QVLA 4PSDA 2JFWA 2PZFA 2AC7A 2PU7A 4ITVA 2ISQA 4K6HA 3H83A 3PDIB 4CPDA 5JTTA 2FW7A 2V74B 3KAQA 4IDDA 3EC2A 1RQPA 4R2XA 4XIIA 1C8KA 1PJ4A 1UT6A 2GEDA 1GUZA 1I4DD 5KKNB 2VHCA 4IH1A 4A10A 3MS4A 4HI0E 4EG8A 2MYUA 3ITNA 4KYTA 4D79A 2W2VA 3BE6A 4E46A 1WY5A 1NVWQ 1JHRA 5HOEA 2OYRA 5DGDA 2YHBA 2XEDA 2E2WA 2LDXA 1AGPA 3IEKA 4DMHA 2C5HA 5AOAA 1LB1B 3WP1B 3P45A 1RRVA 2AMYA 3F3YA 3TZKA 2WM8A 4PS1A 5SY4A 1ZK0A 3KKEA 4ZO4A 3U7RA 1HE1C 4YJFA 1EFUA 2RI6A 1P2DA 1CE8B 2PIAA 4G4GA 4FCCA 2P65A 2ZT6A 4CL0A 4M0KA 3RARA 1JE0A 1M33A 4AKIA 3TJZA 4O4LB 3ZTTA 3OZSA 1A8UA 4HFMA 4WCFA 5FX2A 2P2ZA 3EUAA 5EY5B 4XRGA 5DHSA 3NCHA 2ZANA 2MSEB 3G88A 3EGVA 3VSDA 1FTQA 3NP9A 1BMTA 5GM2A 5GV8A 1MAVA 1KQFA 1YB4A 5G3ZA 3UAGA 3ZLBA 4BVEA 3HC7A 2AC4A 4MV3A 1J7JA 2BUBA 2J9ZB 5TT1A 3SD7A 3D7SA 3UT5B 4AG3A 4GGMX 4ASUD 1DQSA 2ZETA 2D8MA 2J3KA 4NJMB 3FPLA 1L3IA 1T3TA 4PFQA 2BZ0A 3PNPA 3S6JA 2XT0A 3TD6A 3VR2D 1D6JA 3T5GA 2R85A 5LZ8A 4JA0A 4LK2A 5AR1A 4B3XA 1GZ4A 2AW5A 4B75A 2VEDA 2ZE7A 1RJ9B 3A2MA 4WCFC 1G20E 4H7IA 3D4PA 4PICA 1HNWB 4MRAA 4RD6A 4Y8VA 4CL2A 2WHRA 7YASA 5KOHB 3ZVKA 3RU7A 1GG5A 4EZBA 3T7TA 1YBMA 3OVMA 3UUFA 1UK7A 2WYIA 2I6TA 4RA9B 1UC4B 5BOSA 3RIGA 8MHTA 4FEYA 2D1TA 4FFMA 1VKRA 4GSKA 4FYXA 4MQEB 4O3FA 3K4QA 3LZCA 3NDIA 1W0JD 1PFUA 1SCBA 3FB4A 1OX5A 2WIAA 3QQ5A 1GWNA 3FGZA 3OM0A 2QY9A 4L02A 1Z08A 3L8FA 4HADA 4IXMA 2J5BA 3NHWA 4XVQA 3PR3A 1NQXA 3RSCA 3VPBA 5EFOA 1WQ3A 4W9RA 3P9KA 1M6VA 2G70A 4LJSA 4CDMA 4YR9A 1XDDA 1SELA 1HEUA 1XZ8A 1QORA 4JVNA 1X87A 2W9XA 4EI9A 3IKVA 5G0SA 1X1BA 4Q9DA 5IT5A 4FS8A 4GZ5A 4J16A 4INZA 3TW8B 1GL6A 4EL5A 4DIUA 5C4MA 1IY1A 1EVLA 3O94A 4WSOA 3RO7A 3SJZA 3TDNA 4S04A 1U28C 2GXSA 3UCEA 1WMSA 4FQ8A 4LE0A 1PTJA 2I2BA 1GGVA 1IAQA 2IPMA 3LLMA 3GT0A 4MWSA 5DI3A 5FB3A 3T7DA 3ZXYA 3EQ7A 1P44A 4D7AA 2ACWA 3LW7A 4CMIB 1LBHA 2Q4BA 1AKYA 3CZAA 3ROKA 4GEGA 4WK0B 1Z0AA 2I7TA 3A9UA 1M10A 3WDSA 4CUKA 3WBJA 1Y37A 4OYHA 3WK8A 4YAFA 3OT1A 4DV6B 1MO5A 4CE6A 1L5MA 4J6FA 5KJEA 2WQ6A 2Y2UA 4P53A 1Z5PA 3JYPA 4OQLA 4Q1AA 4BDSA 3KSBC 1E99A 3IDOA 4AZSA 4J16C 3I32A 2IQ5A 3WICA 1FOEB 2PSHA 4UZFA 1ABEA 1L5YA 1MZVA 4G9EA 4B76A 1NKTA 2W98A 1PTJC 3AP2A 5LU8A 4XB6B 1IVSA 4QRHA 4OFBA 2C1ZA 1YC5A 2JKVA 1ECPA 2ORWA 2RB4A 1B6SA 2WHPA 2ZJ3A 3CKYA 2JS7A 4BFUA 1ZVMA 4U2GA 3E05A 1K5PA 2QE7A 1YQTA 3OX3A 5LOVF 4NNPA 4O2LA 1A27A 1AA6A 1GKUB 4N54A 3X1KA 2DE0X 4RPKA 3CZ4A 3TQOA 2VAMA 4YXWA 4QUGA 2WAYA 3A1TA 2RHDA 4TL8A 2HXSA 2EZ4A 2DTDA 1GAQA 3OU7A 1EFHA 1A1VA 3KEFA 1LJ8A 5JCXA 1W6UA 1GZSA 1YGPA 5CYGA 1A9QA 2CV1A 3J7AC 4WX2B 3ANLA 3BTOA 2GAFA 2QVGA 5LMCA 1UDRA 3CF4A 4KPYA 5AK4A 1W36C 3E9RA 2FZ5A 3ND8A 3R1IA 4H7KA 1SC1A 2Z57A 4UDXX 2CHFA 1IN4A 3K70C 4J75A 3C39A 4QTYA 2XDWA 3QXXA 4QXMA 1XCOA 2BT4A 3RJ5A 3DR3A 3KCNA 4B2IA 3VPAA 3BSYA 4HNAB 3WWOA 3EVFA 3LGSA 1N2JA 5EFZA 1CR1A 3BX1A 3GPDG 6PFKA 2EDCA 4LJ7A 5K7SA 3BXEA 1XVLA 4IM7A 1MZPA 4RSGA 2BEUA 3AVQA 2QN9A 3Q1LA 5E1MA 1R2QA 2QOEA 5EWMA 5MGNA 1G59A 3O92A 5MGBA 3E3NA 3OJXA 2WWTA 1L6RA 2OCLA 4WKNA 3REQA 2EFGA 3WNCA 3HVRA 2R47A 3AM4A 2EFHB 4AF8A 5KYYB 1ODTC 4ZI7F 5KYWA 2VUUA 3IPCA 2VK4A 1Q91A 2IZ6A 2RHHA 4LG1A 2IYSA 4CUJA 2R8PA 5C8YF 3KB2A 1RRMA 4KXUA 5F12A 1KO5A 2ENWA 2LE0A 2P11A 3B13B 3F74A 4XD2A 5AI9A 2H2IA 3RVSA 5K0TA 2YWBA 1XQ6A 1VI5A 5DGXA 6CHYA 3GVPA 1H2HA 1QDEA 1JU9A 2Q9BA 1II0A 1T9GS 4QPPA 1GZ5A 4HDOB 5DBIA 3DVAA 1QO7A 3KX2A 3TG2A 4B8ZA 4O2BA 1VPVA 4I55A 2D4HA 1YF3A 2CMHA 1V26A 1U9CA 2VYQA 1GPYA 2C2MA 2Z2XA 4IHQA 1E2HA 4TRNA 2X42A 3ABIA 1V1JA 5CAEA 3ZXIA 1P31A 2G04A 4YA6A 3WAKA 4UHFA 2OBFA 3QNMA 4U7TB 3DAFA 2OV4A 5D7BA 1TA4A 3OFNA 3HQ4O 3ADPA 1OWPA 3DH0A 1RC8A 2YL2A 1M0WA 3GB9A 3LFUA 2VOJA 3KV1A 4LFCB 2PGLA 3L2OB 2XRYA 2YV2A 3QFHA 5M04A 3EEQA 1O0SA 2P9FA 3F98A 2WJ6A 1OLXB 1Q5PA 4PZZA 3TXYA 1JQKA 1DS6A 1DXYA 5FBVB 1D3AA 4TS1A 3BWEA 1OV4A 3FETA 4JLWA 2YJ4A 2AFHA 1PDVA 1UKZA 1EVZA 2Q5JA 2ZAMA 3FVTA 1MTZA 3G7SA 3O82A 2WVHA 3PQ7A 4N82A 5DBOA 1DINA 4DIDA 5H8WA 2QWXA 3LA8A 5DCLA 1KSHA 3L1KA 3OLWA 4GXNA 1QO9A 5FQNA 1F51E 4DMMA 5CLLA 4NZYA 3L6OO 2XDQA 1HDXA 1KVQA 2RC6A 1A2QA 1A1SA 1DG9A 1NPDA 1W44A 2G4VA 2I1QA 5CW2A 2HRBA 4F96A 3EIHA 4R7GA 4NG5A 4XPZA 4BVJA 4TKLA 1QV9A 1EE1A 1FP1D 1OZFA 2VG8A 4H9GA 4REQB 4QBHA 1JBQA 3EX7C 1NVUQ 2ZKIA 3R74A 2VJBA 5JEDA 1WZ2A 3AY6A 3GN2A 2R9VA 2HY7A 4BJHB 2ZAYA 1PR3A 3C5HA 4EITA 1Z13A 1PW7A 1QGOA 4L16A 1NI4A 3SMQA 1QHYA 5ILOA 1HR0B 1GA1A 3B7GA 3M1IA 1NASA 1O95C 2AN4A 2PWYA 3H0KA 4BVKA 2JANA 1E6KA 3VO2A 2MMCA 5ALVA 4EF4A 2ZRFA 5DTQA 2IYVA 2WFLA 4WBSA 1I24A 1CR6A 4QTUB 5DN9A 5F33A 4V0QA 1H0SA 1UK9A 4AG5A 2C4HA 1AMOA 4BJ3A 2EHJA 3EGXA 4BMVA 1CNEA 1VYHA 2JGIA 2SHKA 3KYDA 3WNBA 1W4LA 1R4AA 1RRKA 4W5QA 4F5EA 2QJOA 1BAPA 4CQLA 1XHFA 3MLBA 5H59A 3MWEA 4BNGA 3UUGA 4MS1B 3CPJB 4JLVA 1YZHA 2F67A 1QHSA 2KYRA 2PSDA 3R6WA 3IB6A 3MUOA 4H7HA 1Y1RA 2HDOA 4M22A 2GPWA 1JR3D 2ZSBA 4IOKA 4C0QC 4FILA 4CR8A 3ZWXA 4FUTA 3I73A 1HFWA 2WF9A 5CB8A 1RYHA 4QM6A 4RTKA 2Y1OA 1TTQB 4RTRA 4G09A 5F98A 3LWBA 3BC1A 3S70A 2HHLA 2PKXA 1YA8A 3AW9A 3S2SA 2I4IA 5DZSA 4E5PA 1BD3A 4KRXA 1QR6A 4AP6A 1ECGA 1Z07A 2HBYA 2XOXA 3I04M 3L7IA 1YKSA 2CLCX 2XQKA 3DBRA 1K6XA 4YREA 3M3DA 1V9LA 2GGSA 2VUHB 5KQRA 4HL6A 5KWEA 1LPOA 2FSPA 1S4QA 2G06A 4OHBA 2I4NA 1EFTA 4FLMA 3U3RA 2Z09A 3B53X 3M81A 2MSDB 4GRAA 5DHUA 4CETA 1C0EA 1X2BA 4UDOA 5JJCA 4ANFA 3A8TA 1K3TA 1MJGM 4YC7A 5P8WA 5I7FA 821PA 3DW3X 1ISPA 3DXFA 4JU9A 3ELDA 4HSEA 1OROA 5JROA 2NYRA 1P1FA 2FWIA 2WSMA 1KVTA 5FOXA 4U7FA 5FYDA 2YJ5A 2PS3A 1VGRA 4EAAA 1I33A 2XB9A 1XLTA 4YAWA 4U8GA 2H5JA 4DDKA 2WV7A 2VP6A 5I8WA 3QELA 4WK2B 2QD4A 3INTA 1KK3A 4QDUA 4KR7A 1K3FA 5BPFA 1P2BA 3A1UA 1XVAA 4MUXA 3ZY5A 1ZMXA 3K09A 3PT5A 5FBRB 5TF0A 5AM2A 3LDHA 4WN9B 3BD6A 4F60A 2PR7A 1TQ6A 3Q7TA 1C1DA 1ZJ4A 1Z45A 4LUCA 1FEZA 1AKRA 2VL7A 5JLAA 5KJ6A 1MOPA 3UJ3X 2HB6A 1NRXA 2DWOA 1G55A 3I6BA 4CI9A 1ZMRA 4G5HA 1IY0A 3SNHA 3T15A 4C4PA 3I9MA 3OX4A 4MQFA 4NBTA 5GY7A 3VGPA 8AT1A 5JZMA 1E2BA 3GA7A 2XBMA 2HQOA 5DM4A 1MEJA 4E5UA 3QTBA 4N3NA 4IOJA 1XLTC 3CZMA 4A82A 4AAYA 5FRDA 4TPKA 3WMRA 1DFHA 3OQNA 2IZ0A 1TM7E 2Q3HA 4K9DA 5IKPA 1VJDA 4HNHA 1SO8A 1WUKS 1KAEA 1SEVA 3K09C 4PGGA 1ZCAA 4ZAFA 4BLUA 2P41A 2Q3MA 4YJFB 4YRPA 1NJGA 2NMVA 1Z7BA 2AT1A 5ALUA 3LUDA 1RC1A 4MW7A 4YUXA 4YCNA 1JWAB 3ESBA 1FU4A 3FVVA 3RHTA 3KAPA 4BNVA 1XMIA 2P9HA 1KZ6A 2FN4A 2IPXA 3PPIA 3RS0A 5AUPB 2IX9A 3TDMA 4C3OB 4BTVA 3UGQA 2Q1YA 2WK1A 1QMGA 1V48A 2FZWA 3NBUA 3WNDA 3OCZA 1FNMA 1RXUA 3HFJA 1S02A 4G1FA 4M21A 1M6EX 1RPTA 1SC3A 3L1HA 2BDUA 3GDWA 4XEHA 5DK4A 4B33A 2B8JA 1DEXA 3B7PA 2JB9A 1I5OA 4MVJI 3E2IA 2YVUA 3QSGA 2PPVA 1UJ5A 4RVDA 3WGNA 1Q21A 5FUVA 2VA8A 3BCSA 4C87A 3JX9A 3W4JA 4HZGA 1U8AA 3FVRA 5CXSA 5AJHA 1MFZA 2CLIB 4H7FA 4NBKA 1ZD9A 3H84A 1VXOA 1F48A 4YRFA 4DXHA 4ZMBA 3O7WA 4LHSA 1Y5IA 3KAJA 5DYNA 1CRZA 3DEFA 2FUG1 2B2NA 4B8YA 3AERA 5K3CA 2ZJ4A 3Q3EA 1EG7A 1BQ3A 1TKRA 5CFQA 4QJ4A 4B7ZA 2J41A 1DX4A 4YWJA 4F6CA 1TAHA 5A06A 2JASA 2W22A 3I2YX 4FM9A 2CUNA 3DHWC 1K92A 1CXZA 2Q5EA 1EUYA 2JIOA 3SKXA 1YJBA 2M9MA 1I7NA 3BXHA 3QFTA 3SE7A 5BWCA 4RZ3A 2HU8A 2DCMA 2GYWA 2P1RA 3NJ4A 4GRDA 4NABA 4DANA 4F04A 1ZAYA 4EHKA 2IDKA 3IP8A 1ZH2A 5BW8A 5BOSB 1AE1A 1ULBA 1XCGB 2YC4C 4H6WA 1AGRA 4JAVC 1NVBA 4U2DA 5EG5A 1O8BA 2AUNA 2DWPA 2KX7A 3MIZA 2JCBA 4QOEA 1OGJA 3Q8XB 4NVRA 3GW8A 1VHJA 1XX6A 1P0QA 521PA 2WIKA 3BIJA 3S3TA 3HDJA 4J9UE 4RY2A 3IP9A 2GPSA 2BGWA 3G5UA 2WVGA 5TQ0A 1BMDA 4KGDA 1N34B 2X3FA 3KXKA 2WZBA 4MA0A 4U7PB 5EC8A 3B6JA 5FAKA 4KN8A 2HW8A 3H5LA 2V9PA 3EBPA 5FL3A 1E66A 1M6VB 2JAUA 1B43A 1FFHA 4V2UA 4X71A 5CR9A 1N5IA 1EXWA 3P32A 5ALEA 4OJMX 1I36A 3ZH2A 4PIVA 1HQKA 3V4SA 4C0WA 5JJ5A 2OG1A 5AI4A 2CMDA 5F7ZA 4PGFA 4HN9A 5BN1A 1NJ1A 1C3LA 1O3YA 2JBHA 3MHPA 4PGHA 5T67A 4AJJA 1AY0A 1VHTA 1VPWA 2VK1A 3NWEA 4RXTA 4EQ6A 2Q5OA 4L8YA 3ZCVA 2CL0X 2NIPA 4EUEA 3E9CA 3M6WA 1XEWX 3MWDA 5EKTA 4GS5A 1TFUA 4RY9A 4D80A 3KEGA 4GO1A 2OAGA 1TEXA 2PH7A 2UZ3A 5C4GB 3TTYA 4EKEA 1V16B 3OT1B 4PSUA 4TS9A 1D0VA 1NDQA 1JQBA 1VL2A 2EBHX 1Q3HA 3AFIA 3K9GA 4N6OA 1KY2A 2ZAIA 1NOIA 2QVYX 3QVOA 5ESDA 4F4UA 5LLSA 4DV0B 5A1TA 1J49A 1S9DA 2B4TO 1QCYA 1R0LA 4OK6A 2VPTA 5EJIA 2HCTA 2ZBVA 3WSTA 4AYTA 1X9IA 3DOJA 4XM2A 5EXDA 2H48A 3MFQA 4B40A 4CTJA 1EYZA 4KU4A 1JSXA 1B73A 2WHPB 3G79A 3JQ7A 1ZUIA 4BV2A 1J39A 2ODPA 5DT2A 4UVIA 1KSJA 3UA4A 5LOVA 4PLGA 1M2JA 4PWYA 1Z4OA 4B3GA 2F3QA 2CJYA 1YZ3A 4UOEA 1U3FA 1JPVA 3UB3A 3WHKA 1MJ5A 2N0SA 3D6UA 4AMYA 4F5YA 4HVAA 1QCDA 1YI0A 2D3TA 2X2EA 5ADVA 2Q2WA 1FLNA 1N36B 4RIFA 1RCUA 2DHDA 3U6KA 5CIWA 3R3WA 5G0TA 4ARVA 3F5MA 4QLBA 4QGBA 1B6TA 3FZNA 3DONA 4HEHA 4QG3A 4O33A 1AM4D 4ED9A 3B12A 1KSFX 2R8EA 4HQ0A 1EGMB 2SNIE 3FGPA 2XKBA 2ZPTX 1BHJA 2F62A 2XECA 3DFMA 2PGIA 3V1YA 5BSFA 4NXNB 4MUNA 2GHTA 1KMQA 1W19A 3RR2A 1TM3E 5DM2A 1FP2A 3AK4A 4BATA 3TRJA 4QX6A 2ZAOA 5ERXA 4KBGA 1YQUA 2BEUB 1C80A 3N59A 2AZTA 4HHEA 3CLRC 4HB2A 1M5UA 4W9NA 2D5CA 2EJCA 3GLHA 3L79A 5CA1A 5EWMB 3C6QA 2NACA 4KQMA 2XF8A 3HB7A 1WAMA 4EP1A 4C0KA 1KDPA 1E2NA 1WB5A 4UNPA 3REQB 4YCSA 5HZGA 2QXTA 4GGPA 1V47A 2HPHA 2XH8A 2XE7A 4KJZA 4ZI7A 3AVVA 4QU9A 2JK1A 4IJUA 5KYWB 1FXSA 2Z6VA 3FJOA 1D5WA 1Q92A 4J0IA 4MSUA 4UUQA 2WAXA 3OPQA 5FUXA 4KSYA 2X6RA 1LZKA 1SCJA 2PTHA 4AJ4A 3LX4A 3QOXA 1L4NA 1UBKS 2QNBA 3MSXA 4OHZA 4DA4A 3S44A 4YMLA 1NW5A 2JLQA 1Y4UA 3DE4X 1UPFA 3PK0A 5JYDA 3A9VA 4WEQA 4DUZB 3K0SA 2J32A 5DPMA 1T6ZA 1TCCA 4IBOA 4O2BB 4PQEA 4I55B 4RX1A 5LP6A 1GUBA 4MXDA 4HUJA 2FOLA 2RHJA 1D4ZA 3PRJA 5CFOA 2BEKA 4NNJA 4XX1A 3AQ4A 1W36D 1C9EA 5CAEB 1MG0A 3M4NA 5CVEA 4PPGA 3K70D 2AMLA 1CF4A 1KY4A 2ROQA 2Q7XA 1DAMA 1JBEA 2H7YA 4NYJQ 4NH0A 1S2NA 1RQXA 2DHQA 4K46A 3WMFA 2PL9A 1KDTA 4G23A 3U9SA 1MEEA 1XXHE 2ZWAA 3O4RA 4HGQA 2Z3VA 1LSJA 1ISGA 4RDIA 1TKAA 2XQVA 5DHPA 5DM0A 4BNJA 4RH0A 1K7FB 1JJFA 1Y63A 3I3OA 1QE0A 5LDHA 2C7GA 3GBPA 5LP6C 4IEEA 1SGWA 4CIVA 2ARKA 3PHIA 1VB3A 2ZYHA 1GRNA 2APJA 2OGUA 1KWGA 1I7PA 3CONA 2H4XA 3KAKA 1R9NA 3NIWA 3PEEA 3QUCA 5TQVA 2Y71A 3B38A 1YVPA 1TJPB 4CM7A 4UU7A 1W581 1RJFA 1W85B 3TUZC 4XCQA 3NM5A 1Z28A 3OEWA 2N1BA 5H3CA 1OWLA 4PZ0A 1K6JA 3VI4B 2GASA 1H6DA 2ZWVA 4KQIA 2SECE 2FSSA 2GLUA 4PPFA 4IIUA 4RH3A 1QYIA 2XDQB 5JE8A 3RS4A 3LPLA 5DEOA 1PLKA 2WFAA 3MK31 2HJGA 2IPLA 2WYHA 4HAUA 4B7AA 3BCHA 1NJSA 3PFNA 1LDEA 5AD1A 4MLPA 3RFFA 1NUSA 1OE0A 121PA 4P86A 1I2CA 1YGYA 5A71A 1DEAA 4CEIB 3LLCA 1A4UA 4J43A 3X44A 3L01A 5LBTA 4NRDA 2FEOA 1M2VA 2FE1A 4ZODA 1NI4B 2GILA 3QLEA 4DLAA 3RBVA 2QZJA 2RK3A 3PGMA 4QQFA 1DP4A 1CD5A 3Q2IA 4Q18A 3WQHA 2GRUA 2XTMA 3C1UA 1NUPA 3KCQA 4F0JA 3COZA 3IVGA 3BH0A 3VZBA 4ER6A 1N2XA 1SKMA 2WFLB 1AQIA 3RJTA 1QNLA 2VBGA 2QD3A 3A05A 1Z38A 1MABA 4U00A 1NW9B 3AETA 3PUZA 3P71T 1TTTA 1GCIA 3PUVA 2OR3A 5FA6A 3EGXB 1RE0A 2GT1A 3HS3A 3QKSA 4OM7A 3KYDB 1UJCA 3Q3IA 1UWLA 5ALIA 1WTCA 2CBXA 5EERA 5JSQA 2J0QA 1PR9A 3D02A 1KJZA 1S2LA 4GUDA 2JLYA 3CNBA 1V7QA 1FY2A 4DM4A 1E5DA 4G86A 2HPZA 2O54A 3MWEB 3ETCA 2HMVA 3EVGA 4ABTA 3I8XA 3C16C 1KNXA 4MRPA 3KWLA 4OXKA 4QHTA 3SYLA 2P9BA 3IIJA 4H0FA 4MDHA 1WU8A 4A8PA 5AH0A 1POXA 1Z56C 4GXRA 5AI0A 1Q0HA 1V1RA 1H69A 2E9SA 5FA5A 3VHQA 3OFND 3OY2A 3PSAA 2CNLA 2QMHA 4UQPA 3U3MA 4RY8A 1RSZA 4FFNA 2OO5A 2PRZA 3GVCA 4FEAA 4FWBA 5D5PA 1T3ZA 2WIBA 5AYVA 4JK3A 4EHJA 3X43A 3S8YA 2O07A 3OD5A 1EKXA 1JDVA 2VT2A 3UB4A 3QMMA 2G80A 2JFPA 1E2KA 1PFWA 2F9MA 2ZLBA 2ZUBA 3D4OA 2WP8J 3DBRB 2J0SA 4FK8A 4Q3EA 4JI0B 2Q6LA 2DFKB 4PSVA 4X65B 3WMGA 3QWIA 5JAMA 5LMZA 4Z3OA 5FPKA 2FLWA 1MT3A 4I6EA 1UBUS 4JXZA 3PNVA 1XA4A 2BZGA 1CTQA 1OXSC 1PQ4A 3QI7A 3BIWA 4G1BA 4LA4A 4FGLA 4OK5A 2RMKA 1O95D 3E84A 2VDVE 2OO5C 2X2FA 2E4UA 5DRTA 1TZMA 2XD4A 1RJEA 5MHTA 3K9BA 3H2IA 2AHOA 5ITSA 2G08A 1CR2A 3OKCA 2EGHA 2QLFA 5C1DA 3PDCA 5I48A 1MF7A 3QELB 1KQ3A 2PGDA 2GD0A 4P6VF 1OH6A 2XHEA 5ALHA 1XTIA 2I4TA 4YMWA 4C29A 1QMPA 1S8AA 4UUMA 4E31A 4D3FA 2H2DA 1O5IA 2F3PA 3THRA 3W3ZB 3MCVA 4F4DA 4YLYA 2PDAA 2O14A 1C1DB 2G5PA 3DOFA 1UBNA 3KELA 2QSUA 3EDOA 3F1LA 5G0VA 4AU1A 1ENPA 4MQFB 4OU4A 3JQCA 3QPBA 4NS4A 1EEHA 4YDSA 3VX4A 3H75A 3W2TA 4ZQBA 3MS7A 4PC6A 3E5RA 3EVZA 3LX6A 4AF7A 5JXWA 4YJHA 5DNAA 3ZKAA 2DH5A 4BZPA 1GPKA 3M6IA 4XDZA 4DARA 3MJFA 3PWSA 2FHSA 3BS4A 3GJ8A 2CVQA 4J49A 4NE7A 4DUYB 3BB1A 4NNOA 2C54A 1P9WA 4GBGA 4AUMA 2D00A 4Y67A 4P84A 1XV5A 1MU0A 3FKQA 1OFTA 1BJRE 2REOA 2IU0A 1WVIA 2O8CA 4CGYA 1CKEA 1ZCJA 4P4LA 4E6PA 5LJIA 1ZN8A 2DRIA 5KNBD 2IYLD 4ZZ0A 2GHQA 4MVWA 1SU4A 2C31A 3U31A 3D5EA 3H5NA 5B4UA 2Q2QA 1E7YA 3FIUA 2RGXA 4H6XA 1DO0A 3IRUA 4KODA 5IHXA 2NYVA 4MW9A 1PJQA 3WKDA 1XZHA 1JLHA 2OLEA 5IP5A 1XZFA 4QEZA 1EBFA 4RC9A 2IA5A 3U4QA 1UC8A 1MAHA 1E1DA 4Z51A 4C4YA 2C96A 1BE0A 1MPXA 1N2SA 1PZMA 4PYQA 4ZVVA 4E88A 1ADGA 3QYPA 4I4TA 3TTWA 4YAJA 1T2DA 4AKHA 3IJRA 4N49A 3OKPA 3AERB 1INLA 3GD5A 5DFAA 2YOHA 2CLOB 4DR7B 3OUTA 4OQFA 1HLDA 1T4MA 3O91A 3TDKA 3PUHA 3IR5A 4CCSA 1UP7A 3OAAA 3FOEC 3RFUA 4L5AA 1VJ5A 3C8MA 1E7SA 4CG0A 3KC2A 2PMWB 2BGIA 4J0CA 5HXAA 1Q16A 5DU2A 2N46A 2J5QA 4E09A 3BIXA 3RF6A 5G0UA 3W4IA 3LL4A 3QE0A 1PV2A 2FPRA 4MAMA 3GRUA 4B6RA 4BO7A 2FP3A 5TQ0B 1HRDA 1P7PA 3I2IA 1ISHA 1SIUA 4LN1A 4K9NA 5HZKA 1HMYA 3DEYX 2DPMA 4UULA 2HMWA 5JZ9A 1DV1A 1NFFA 4KE7A 4A8JA 1Z6ZA 3PNSA 1EJ0A 2ALJA 3F7TA 3O3CA 1Y3HA 4Y2GA 1ENOA 2FX3A 1PJ2A 2AEMA 4XGIA 4CU5A 2PUCA 3HO1A 1JLMA 1M34E 1U0EA 3UJBA 1IN8A 3EPPA 1J25A 1Y34E 2F8MA 3BD7A 4UHBA 4DCUA 2XNDA 4EJSB 4X91A 5EWJA 4BE4A 5BN5A 2UVDA 4ETIA 3UG6A 3SJCA 1YQWA 1YK0A 2B35A 2BGJA 2CF6A 3D43A 1NN3A 2WVAA 3EF0A 1Z7WA 3DDNA 3KFLA 4NCXA 3UWSA 2Q07A 5KHAA 5EWLA 5BMVF 3N74A 3TTSA 1Z6AA 2C88A 3C6BA 1L7PA 1ID1A 1TJ3A 2YYYA 2ZI3A 1PL6A 3MWDB 3KFXA 4B4DA 2OM6A 4A8JC 4EKYA 5K0BA 1YD7A 3EVNA 3G0HA 3RIMA 5C8VA 2A9KA 3JARA 4KXFB 1HLPA 1EAMA 2AEFA 1H1TA 2B2XA 3DKRA 3F7NA 2F1IA 1AO3A 1VRWA 1T0JB 4BOYA 1QOZA 4PIPA 3E1GA 1D9XA 1H2WA 2FX5A 3MW8A 1J0AA 3EARA 4LHXA 4NPAA 2KPOA 4QDXA 4X1OA 5K0EA 2D7JA 3E2PA 1XZAA 2GN1A 1AUXA 3E35A 3LI2A 2GBIA 3BRWA 1CQJA 4OX9Y 3OE1A 3PTZA 4Y2QA 5TARA 4XUDA 5EZYF 4EAQA 4L4ZA 4KXXA 2C84A 4K7JA 4D9HA 4ZGBA 2VHQA 2WLTA 5HKOA 5LOVB 4CQJA 2AJLI 2FJUA 2EF0A 3BWCA 5FTKA 2IXEA 5B2ZA 4ESVA 2H8GA 3VZSA 2AR0A 2HIMA 2WPNA 3QLJA 2AIRA 4TV9F 3TQHA 3QE9Y 4YRKA 2PMDA 1DZ3A 2ZROA 4BX9A 2GK4A 3ZJ5A 5BR7A 1GJRA 1LQTA 4P3XA 4UW9A 4DZTA 2JKZA 5E0KB 2IV7A 2QQ0A 3CR8A 5BUSA 1CUAA 2R7LA 4JL8A 4QSMA 4LWOA 3AUTA 5E9QA 3DDZX 2WTUA 2DPLA 2PVSA 1US8A 2DSTA 5EE1A 3NX4A 3VR3A 2JVKA 4HXEB 3P9NA 4YCJA 5I7OA 2AKEA 3TPCA 4FKMA 4FGWA 1Y3BE 3QY9A 2HBRA 1SVSA 3SHTA 4EW6A 1QPZA 4QRDA 2YY6A 4LKOA 4YI3A 1FFGA 5ELMA 4HUTA 2ECQA 3PX7A 4NKRA 3D0KA 4KRFA 3NHUA 1S01A 3KVVA 3B1FA 2W11A 4RPCA 3TTUA 2ZQZA 3W90A 1YNOA 5TE9A 1WVGA 4GZ6A 5KNDH 2RBGA 3FM9A 4MO9A 2WKWA 2PQ2A 1C4KA 3GLHB 2IHBA 2VA9A 3AIIA 4TKVA 4RA6A 4KK4A 1ZD2P 4MV7A 4M1KA 4U5XA 4YUZA 3LTNC 3FBWA 3U4HA 2CE7A 5GMOA 1HDIA 4ZI7B 1TAUA 1ORTA 4PLZA 1HUQA 3HL0A 3QQPA 4IFTA 3WDKA 2CE2X 4BVLA 1X7ZA 4ZO8A 2HRDA