3FROA

Crystal structure of pyrococcus abyssi glycogen synthase with open and closed conformations
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
439
structure length
439
Chain Sequence
RHMKVLLLGFEFLPVKVGGLAEALTAISEALASLGHEVLVFTPSHGRFQGEEIGKIRVFGEEVQVKVSYEERGNLRIYRIGGGLLDSEDVYGPGWDGLIRKAVTFGRASVLLLNDLLREEPLPDVVHFHDWHTVFAGALIKKYFKIPAVFTIHRLNKSKLPAFYFHEAGLSELAPYPDIDPEHTGGYIADIVTTVSRGYLIDEWGFFRNFEGKITYVFNGIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSWEKSAERYVKAYTGSIDRAFDFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GlgA glycogen synthase
publication title Lyase activity of glycogen synthase: Is an elimination/addition mechanism a possible reaction pathway for retaining glycosyltransferases?
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
total genus 157
structure length 439
sequence length 439
chains with identical sequence B, C
ec nomenclature ec 2.4.1.21: Starch synthase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
A PF08323 Glyco_transf_5 Starch synthase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3froA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3froA01
1L5WA 4MICA 5TMEA 1FU7A 1RRVA 1QM5A 4N3BA 2IW1A 1WUYA 1NOIA 4Z5XA 1Y8ZA 2AZDA 2IYFA 1EM6A 2G9QA 1V4VA 2QN7A 4M83A 2R66A 2QRQA 4MI9A 3H4TA 2O6LA 2VSNA 3HBJA 2YJNA 4RIGA 3T7DA 1GGNA 3DZCA 6GPBA 2XA9A 1A8IA 2IUYA 3MTBA 4NC9A 3BD6A 3Q3EA 4RIEA 3NCHA 4N3CA 3EBOA 2XA1A 4L22A 4W6QA 3D0RA 2VSYA 1FTYA 2C1XA 4XI9A 2BGUA 3BCUA 3UYLA 3HBFA 3S27A 2QN3A 3BD8A 1FC0A 3Q3IA 5DU2A 3MT8A 1C50A 3CEMA 2VCEA 4M60A 2XGOA 2JLBA 2QRPA 2PYDA 1C8KA 4LDPA 3FROA 2QNBA 5ENZA 1JIVA 2C1ZA 2ACWA 3CEJA 1SXQA 2QN9A 4X7RA 1NZDA 2F9FA 3HBNA 3S2UA 4MHSA 3MTDA 3BEOA 2X0DA 3L7AA 1GPYA 2P6PA 2ACVA 3NPAA 1XL0A 2ATIA 1GZ5A 1SXPA 1O6CA 1P2DA 1UZUA 2ZB2A 3CX4A 3HBMA 2BISA 2XGSA 3DDWA 1K08A 4X7PA 1GG8A 4N9WA 3T3EA 3G2LA 3OKAA 2QLNA 1RZVA 1P4JA 3MTAA 4F96A 4WHMA 2PRIA 1FS4A 5TMDA 4AMBA 2HY7A 1JIXA 1HLFA 5HXAA 1XOIA 2G9RA 3T5TA 1E4OA 5DXFA 3MT9A 2QRMA 3PE3A 2GPAA 1L7XA 4RIHA 8GPBA 2F3UA 4RBNA 1P4HA 1GFZA 1PN3A 3BDAA 4MHOA 1GPAA 3MQFA 2IEGA 3RHZA 2OFFA 4M7PA 2Q6VA 2XCUA 3BCSA 5IKPA 1P2BA 2GT1A 3ZCVA 2JJMA 1PNVA 4BQFA 2H1FA 1NOJA 2R68A 3S29A 3COPA 4KQMA 1P4GA 4MI6A 1VGVA 2AV6A 2SKEA 1FA9A 3VDNB 2G9UA 5C1DA 4AY6A 1XKXA 4PQGA 3OTHA 3MBOA 2WTXA 4WADA 2BGTA 2PYIA 4GZ6A 3SYMA 3AMVA 1Y6GA 5D01A 7GPBA 2FFRA 2AMVA 1WW3A 2QLLA 1EXVA 2XMPA 3G2JA 1C3JA 2QN2A 2GEKA 3OTIA 4RIIA 4KQ2A 3MS4A 3VUFA 1Z6PA 3NAZA 3GPBA 1XL1A 1B4DA 3OKPA 4CTMA 4FZRA 3L7CA 1IXYA 4CDRA 4N3AA 1JG6A 3E3OA 4CTNA 1NLMA 2IV3A 3VDMA 2JZCA 2ECPA 3OTGA 1KTIA 1XC7A 3MT7A 2F3SA 1L5RA 1FU8A 5DLDA 1JEJA 1RZUA 3S0JA 3IAAA 3CUWA 2KS6A 1Z62A 4EL0A 1L5SA 1QKJA 4NESA 2IEIA 3H4IA 3OKCA 1YA6A 5BNWA 4BFCA 2IYAA 1M5RA 2ASVA 3BD7A 3BCRA 3CV3A 3RSCA 3T3HA 3DDSA 3GUHA 1J39A 1ABBA 2QRHA 3G2HA 1YGPA 4KQ1A 1XV5A 2X6RA 3OT5A 3IA7A 3D0QA 1P2GA 4RIFA 1WV1A 3MSCA 3ZCQA 1FTWA 5D00A 1F0KA 3S28A 4YUAA 1AHPA 2GJ4A 2QN1A 2GM9A 4NEQA 4X7MA 1JG7A 3CUUA 4MI3A 2GPBA 3CUTA 2PRJA 2PQ6A 3DD1A 3ZCRA 1Z6QA 1Z8DA 3CUYA 1FU4A 4GYYA 4N39A 5GPBA 3QHPA 4F9FA 4YI5A 2C4MA 4RELA 5TVGA 1Y6FA 2F3QA 2C9ZA 3TOVA 4EL5A 3CUVA 3MS2A 3D1JA 3L79A 3VUEA 5IKOA 4AN4A 2X6QA 1BX3A 2R4TA 3T3GA 3NP9A 4HLNA 1WV0A 1L6IA 3QKWA 3TAXA 2FF5A 3G2NA 1PSWA 2R60A 1P29A 3MRVA 4QLBA 3SYRA 3ZCPA 2GEJA 3MRXA 3C4QA 1JIUA 3E3LA 4EKYA 1E1YA 2X0FA 3WAGA 4GZ3A 2QN8A 4MRAA 3UYKA 4REMA 4RENA 2VG8A 1LWOA 3OY2A 2XA2A 3TSAA 3MRTA 3O3CA 4X6LA 2R4UA 3PE4A 5I45A 2H1HA 5TMBA 2X0EA 1UQUA 3RSZA 5JTTA 2QRGA 3NP7A 3T3DA 3E3NA 3EBPA 3WADA 4FKZA 4GZ5A 4HWGA 2G9VA 3OY7A 4GPBA 4EJ2A 2XGMA 2FETA 4XIFA 3CEHA 1L5VA 2XCIA 3Q3HA 3RT1A 1H5UA 3G2KA 1IIRA 1K06A 2QLMA 1WUTA 3NB0A 4G2TA 3L7DA 3ZCUA 4CTOA 3MS7A 2SKCA 4YI3A 2QZSA 1NVKA 3T3IA 4BQIA 1NZFA 5LQDA 1FTQA 4AY5A 3ZCTA 4F97A 1C8LA 1F6DA 9GPBA 2AW3A 1NOKA 2SKDA 3NC4A 2BFWA 3ZCSA 3C48A 1AXRA 1WW2A 2IV7A 2GPNA 3G2IA 1LWNA 4EKEA 5JTUA 3L01A 1L5QA 1UQTA 4AMGA 4GYWA 1PYGA 2VCHA 3C4VA 2F3PA 4BQEA 3WC4A 1GPBA 3L7BA 4WACA 4LEIA
chains in the Genus database with same CATH superfamily
1JQKA 3CPHA 5CT9A 4QELA 2PYZA 4RPGA 3HLKA 2D00A 3Q9LA 4Q82A 4M36A 3U0BA 5IBQA 2PUFA 4P83A 3TN7A 3S1LA 3MBKA 1WD7A 2WIAA 1Y82A 4GRAA 5G0VA 5EC8A 2IW1A 3MMZA 1P2SA 2GWHA 3E5RA 3U1VA 1CCWA 1C7RA 3CWZA 2QF7A 5DH9A 5BXQC 4F9EA 1GRQA 2C2MA 3BYZA 4W1RA 4HS4A 2R66A 2I5PO 1XRLA 3WB9A 3V9PA 1HT3A 4O2AA 4ALJA 1JLLA 1NW7A 3VRHA 1YMUA 4B8YA 3UJPA 3LI2A 3WBJA 3JYOA 2OPHA 4CBVA 2AQHA 4OHPA 5LYJF 2ZE7A 3DW3X 1AUPA 1UXHA 2QTGA 4KQCA 4MRMB 5K8LA 4EA6A 2HFJA 2WIFA 5LP6A 1VSVA 1YI1A 4YVFA 4LISA 1NZJA 2BCJQ 4M38A 2RJ3A 4I9HA 1PR9A 5D84A 3ZOKA 3CVYA 4CN8A 3NR2A 2AFHB 2RHMA 2VSYA 4PM4A 1KF0A 1PL7A 1SB9A 5JAHA 1SZDA 4M0KA 4E33A 2LRHA 5HR5A 2BGUA 3IPLA 4K2HA 5I48A 2FVXA 3GG2A 3OCYA 5KMGB 2WYHA 2Q62A 3EXG2 4M9RA 5EPOA 4H16A 1WXGA 4EENA 1HOTA 1NXPA 2J08A 1Y3DE 3RADC 2GXAA 1C1DB 1V7PC 4G63A 4HDRA 1OH5A 2IXEA 4R8RA 5FO0A 3VPCA 1XKQA 2WU3A 4KBGA 3SQMA 4MWTA 4QTXA 5KBYA 4E5DA 4KYUA 4EJMA 2IXBA 2VJYA 3DZJA 3TI9A 4DA6A 5HQJA 2C7OA 1VCNA 1NHWA 3IT3A 3THXB 2JGEA 1U8EA 2EBFX 4GQBA 3TRJA 1DDGA 2CVOA 1ZNQO 2IVFA 2NYVA 1U2SA 2VDOB 1HQYE 3B36A 3K0FB 4OJKA 4P1ZA 4PLVA 2J9XB 1R9MA 2YJ5A 2FQYA 3GO4A 3H0KA 1IOWA 3KVOA 1P9NA 2H1SA 4PHFA 4FYHA 1ZH0A 4RZ3A 4UDYX 3H11A 4RPIA 4BMPB 4CIXA 1X3SA 1PS9A 1K86A 1QBKC 5B5SA 1KY3A 1MG0A 3DEFA 3GUZA 4YDRA 2GBPA 1WVMA 1IG3A 3DKRA 2DJ5A 4MUNA 4WFKA 4DC0A 4DIDA 3PGJA 4W8GA 4POOA 1X74A 1ZAYA 4LC0A 2J6HA 5EMJA 4TYQA 1AGNA 3GLUA 2FPGB 2ISSD 1Z68A 3UAXA 5EEGA 3DEJA 4DC1A 3R0XA 1R0BA 2J3MA 3GWZA 5FTKA 1G21A 1J8QA 4NU5A 4FBLA 5FUQA 1QPBA 2RGBA 4R9NA 2FX3A 2G36A 4FHFA 4N48A 3V2IA 2P65A 3S4YA 3CNHA 1XDGA 1M1XB 3CH4B 3DFFA 1N4DA 3K0CA 2R65A 4K9RA 3G8BA 1PG0A 3I34X 3L02A 4YCBA 1JB1A 4YRBA 1GSOA 1QCYA 2C8JA 5KTNA 1TXGA 4AKIA 1U8ZA 1O5OA 2P5UA 2BM8A 3DPUA 3EASA 2Z8YA 2HLNA 3GRUA 3JPWA 4ZMRA 4HWKA 1NY5A 4LHSA 2Q5HA 4Y0AA 3D6HA 1VCOA 1VL5A 4RV4A 1Z5PA 4W8OA 4AB1A 3G2LA 5FF9A 2P0AA 4GMKA 4D3XA 5J4VA 2IOYA 1O0SA 2FAXA 2BP7B 3N76A 4FHEA 4V02A 3T5BA 2DTEA 3D0KA 3T54A 1BRMA 2IT1A 2V7TA 4PTZA 4DMUB 1RLJA 5DGIA 3WS7A 2A57A 2WIKA 1O89A 3QOWA 3REFA 5HPYB 1XCGB 1BXKA 2OD9A 4E31A 1DV1A 1SBHA 4DV5B 4HSEA 3GFVA 3CX7A 4CI9A 3E8SA 3UJBA 4A0FA 4K9DA 1CE8B 1OMOA 1QC5A 2DHDA 2HK7A 2QE6A 2WC1A 2ZYGA 3I5MA 2Y1LA 3NNDA 4OM8A 4Q3OA 5DBEX 3V8VA 1Q21A 4G23A 4IZ6A 5DFAA 3STWA 5B6IA 3KUDA 1E2IA 1SNYA 4OXIA 1N6KA 2FW7A 3WL5A 1KSFX 2PA3A 3RQSA 2C0PA 4IIDA 4UVEA 1PK7A 1PUJA 1KA9H 1ZH4A 3ABIA 4BZZA 2OKCA 4ANFA 1K6IA 2Q1WA 3OETA 2ZPTX 4OQPA 4EI8A 4F4CA 2Z08A 3WV5A 4CHTA 5LU9A 4MYCA 2AL7A 2WDPA 4JYPA 1OAAA 3AF3A 4Q7LA 5EHQA 3TI7A 3DE2X 4DMKA 5DRYA 2O14A 2FEWB 3PA6A 1XZEA 3D3QA 5SZJA 4OP1A 1XYGA 4I1UA 1TGVA 1G5TA 1GL7A 4TUYF 4EA7A 5A6SB 3O31A 4X1KB 3M9LA 1C7JA 1YFZA 1ZCAA 3MOSA 4RH3A 3SFZA 2QQ0A 5BY2A 4YDSA 1B16A 1G291 1C9DB 1AUVA 2D1FA 1B0AA 1JA0A 3X1JA 4BJ1A 2WG0A 1UBFA 3GMSA 3KOYA 3M1YA 2V5AA 3OQPA 1A2QA 3DPSA 4K1LA 3G3EA 3A9TA 2H1FA 1GZ7A 1LVHA 4ROTA 3RYFB 3QYJA 1MDBA 1S3GA 1M6VA 1CUYA 2R1VB 2YNMA 3M6VA 4NK5A 3A9VA 4P36A 3TZHA 4ZT7A 1CP3A 2AUNA 3L6DA 1IJFA 1DIAA 5IS2A 1I94B 4YP0A 3DZFA 3QKRA 3VPDA 3CW8X 3TRHA 1EMDA 2YHUA 2NTEA 3D8NA 3GPCA 2C9CA 2ETVA 3I9MA 4OAPA 4C4XA 1JA9A 2ZYTX 5GJCA 1D2NA 2BEWB 1EFKA 2Q3DA 1E6KA 4FDMA 5ALYA 4HGOA 3HSKA 3T1TA 4MGEA 1W4BA 2V6IA 3UJ7A 4NS4A 1H2EA 2ZVJA 3N0WA 2Q3FA 2WFLB 3DCYA 1WLSA 2C4NA 4JI3B 3I9V1 421PA 1KK2A 3EIEA 2GJKA 1OC2A 2JVKA 2MSCB 3L0CA 3UV6A 3EUAA 1Y8AA 2D1TA 5FCDA 4D9FA 2IH4A 2IBMA 5AM2A 2J0QA 4GFDA 1GSAA 3N2GB 3WGHA 2YFQA 1JAZA 1ODLA 4KWEA 4X64B 3GJSA 2VP5A 3IEMA 3EEIA 4Q4CA 2BHLA 2H0RA 3SJCA 4EUKA 4UBNA 1GA6A 4ZVQA 4G1CA 1AHHA 2JDID 3GLIA 4MB0A 1X7XA 3IT0A 2IIPA 3DD5A 4RD2A 5MFPA 4B3RB 3VZDA 5HTKA 5L3SB 3QTBA 3W1WA 4EPYA 4N6GA 2HF8A 2W2MA 1DHTA 4B6GA 3HMQA 3PT5A 2AJCA 1HEUA 4K3VA 4MR7B 4WDQA 3W2HA 4D6XA 4Q7MB 2GTHA 4ZOLA 1DCKA 4W9NC 1TJ4A 3GAMA 1EAMA 3MJVA 3NT5A 1UBGA 4G1UC 3WO1A 4DQ0A 1JG4A 3ZXYA 4DWOA 1FNBA 2H2DA 3DZHA 1LV7A 4WCFA 1B23P 3IUMA 2FUNB 3JQQA 5EGNA 1JDBC 2KQUA 5FFNA 4E4RA 3NBUA 4ZJPA 1GLGA 4ZQHA 1GPNA 3SXJA 1O0CA 1GCOA 2UKDA 2YWHA 5EY5B 2ZSBA 4KSYA 1KHTA 3I5YA 4D82A 1MH9A 1VIYA 1WBJB 2GLTA 3F71A 4OQYA 5IYZF 1YQXA 3RW9A 5BOSB 5GVSA 1TM7E 1KH3A 2J5BA 5JPCA 3OQBA 2AJLI 2WJIA 5CFMA 1A96A 1GKUB 1OTHA 4P92A 4M22A 4YUWA 2KW5A 1RXYA 3C87A 1E1CA 3O7MA 4X90A 1U7XA 4X61A 1LK7A 1E1MA 2GB4A 2XTMA 2YV3A 1UBMS 1JI0A 2C2WA 2VJLA 3DOFA 4FJ0A 1QIJA 5JJ5A 1UDAA 4RQTA 2O8NA 3K0BA 4UKDA 2HHCA 4LDNA 3IPXA 4YV2A 2D5LA 4R98A 3EODA 3UWPA 3JRWA 4MTLA 4GL4A 4OHFA 1OH7A 4UMEA 4GX1A 4F11A 3ENQA 2RKOA 1G18A 3EWNA 4RSGA 3DF7A 1YS6A 3LOPA 4YA6A 3H75A 1K7XB 3RU2A 4ECEA 1MA3A 2JFQA 4U2BA 3IQEA 1J0CA 5AVVA 3BK7A 1QYCA 3S99A 1QHGA 3NHMA 2XUQA 4R8LA 3UGQA 2C7BA 4Q3BA 4DZTA 3DNPA 1Z13A 1E3LA 2CFTA 2V7WA 1XCLA 1F1JA 4YAEA 1VBNA 1QQBA 4IS3A 1MRSA 3HHPA 5TF4A 1O94A 4CMAA 2X6RA 1X7WB 4YQYA 2ZJ8A 4AQ7A 1AHPA 3GRFA 3G82C 3K20A 4KNVA 2I03A 1H1LA 4QVIA 5LA6F 1J8MF 1U4NA 4UASA 2Z4SA 5FTJA 4C0SA 5CDUA 3QUAA 2CC2A 1F5NA 2B94A 1N2CB 1W5FA 1XMQB 3O1HB 1QKKA 3SYKA 3MWGA 1P2VA 1C1YA 1RQRA 1Q0TA 1WE2A 1BA2A 4F4JA 5DXAA 2AN1A 5KKAA 4PGGA 3ZQKA 2XZPA 1EP9A 4WINA 1USWA 5CLHA 5HSGA 1TJ3A 4Z6KA 4RTNA 3P2IA 5BYBA 2YWFA 3ZDDA 3QUBA 3HWRA 3SEFA 1M5RA 4EEXA 1S2NA 4FI3F 2JIQA 3ZU3A 4EFDA 4ARUA 3KLMX 2WAAA 1OBCA 3OIFA 1WWKA 3EVCA 4FE4A 1VKHA 3EARA 3SQWA 2Q2NA 3P94A 4HB4A 5IKOA 5ADVA 2VQFB 1PSDA 1DFGA 4PR0A 3CZCA 3QF4A 5EUMA 3Q88A 4KMSA 3UV7A 2P6MA 3PWZA 3NBFA 4GI5A 5ALIA 4UTNA 4AKTA 3OTWA 2RHGB 1L7EA 2EATA 1JDZA 4FGZA 2Q3LA 4WFIA 1KR5A 2GN9A 1DKMA 3B1FA 1UZLA 4O5OA 2PAAA 3PR3A 1TLLA 1LPPA 3BBLA 4MV4A 4AMZA 1NW5A 4OGWA 1PQWA 4MZXA 1P7VA 1RQGA 4NZYA 3HDYA 2EFEB 2ZAGA 4RE5A 4IYJA 4F91B 4RVFA 3ONEA 4MQFA 2WUVA 2QSZA 3DMNA 3ETNA 3EXFB 3ENZA 4F6RB 2CMDA 3GV0A 2GM4A 4ZRNA 2VYVD 2HUNA 3ZE9A 5FJJA 3CSSA 4J0JA 3SJUA 1JECA 5E6SA 4IW3B 4TXLA 2WM3A 1OROA 2FZ4A 2P8SA 2Q3EA 4KRXA 1GL9B 1S4QA 2AF3C 2UYYA 1FL9A 3HZRA 4H4EA 1DARA 4J03A 3OZFA 2C8LA 1G3RA 2O3TA 3SIRA 4F5EA 3HU1A 4REMA 1FUIA 1ZESA 3FPFA 5IRCD 2O8EB 3OY2A 5AW9A 4AFNA 1JKMA 4RDXA 3Q9NA 5LFAA 3DE4X 2DU8A 1TUBA 4J6EA 4BFZA 5KREA 3HN2A 2VK8A 1IN6A 1L9KA 2G1AA 3HEBA 3MCZA 3U3DA 1M0WA 5CM9C 5JZVA 3QZUA 4KQ6A 2O3JA 3IBCA 4X63A 2ZJFA 1T3GA 3PTZA 3KKZA 1TF2A 4JJAA 4HX9A 5DMXA 1EUQA 2BI4A 1CJCA 4EG6A 4TMTA 2NU7A 2JA1A 4HFJA 3FDZA 3W8RA 5HJEA 1XEXA 3QE9Y 2DSNA 2COUA 1SMKA 3NBXX 4E14A 1LLDA 5C8ZA 5LL6P 2ZYAA 2WYWA 3KQPA 3RGWS 3WKCA 1NV8A 3PC8C 3HXTA 3LKVA 1TGYA 4YB8A 2X19A 1D6NA 3D43A 1O6FA 4KKVA 4J0IA 2B25A 5CH5A 3ZHBA 2HIAA 5JPDA 2RD2A 4LVOA 4D80A 1DC8A 1E61A 2AW5A 3AETB 4DLWA 1JPVA 2ORED 2QDXA 1L5LA 2V6GA 2F9LA 3BGSA 3LJKA 4L07A 2VZ9A 5IWCA 1ADBA 3D5EA 1U99A 4GP9A 4JASB 4JMLA 3VKUA 5L3QB 4OCZA 2IXFA 1V47A 3GGPA 3G2KA 2ERYA 1LI5A 3SKVA 2DRIA 3FAZA 4R2WA 2ENUA 3EE6A 2IIQA 4AG3A 4A6XA 5CDTA 1PEKE 3NS7A 4GOJA 1BFKA 2VQ6A 1N3IA 4YY3B 4MUEA 2FZLA 2BCEA 4KUGA 1R5JA 4LE0A 2QBYA 3GGDA 1RT9A 1XF1A 3GLTA 4KAJA 2RONA 4D7AA 2AJDA 2LUOA 3DSRA 3IUNA 4OAOA 2BHNA 4TKUA 1YWGO 2C3MA 4LNUA 1SCNE 1YB7A 2ZKIA 3KVYA 4KMOA 2CJWA 5M29A 4C7MA 3AEQB 3RYCA 1Z63A 5L95A 4G4IA 3UOWA 3GPLA 1J20A 2C2GA 3PXCX 3OJFA 5DYGA 2G0AA 1E8DA 1YDWA 5AQEA 4BCBA 2BFWA 4D9EA 3K4PA 2X77A 2G5PA 5HEKA 5BW8A 2WVAA 4WLNA 1MT0A 3BJRA 1OXUA 1U0EA 3K5IA 4INPA 4M9QA 4Y7CA 3R9WA 2IV7A 3G89A 5IHXA 1L5GB 3D6FA 2JFFA 1V11A 2QUZA 3AILA 4FM9A 1ORTA 1QB7A 1N2BA 1Z9BA 2GJ9A 2FDRA 3KQQA 1ODIA 4II3A 4TV9B 3V4RA 3CUSA 4E32A 2GXQA 2HDNB 4HDNB 3LT1A 5JAOA 3VC3A 5JSYA 4OIMA 4JB2A 3C5VA 4I99A 4ND7A 4BFVA 2NXCA 1CY8A 4QQ8A 3EIXA 1UUFA 2BGRA 2BY4A 4GLJA 4IJVA 1KWGA 5AI9A 1JU3A 3ANNA 3JZMA 1ABFA 1GPBA 2VJQA 5AM3A 2AUMA 4TVKA 3U4MA 2HL6A 2EOAA 1UM9B 5REQA 4JZYA 4GMDA 2AZTA 3S2IA 1P61B 3GLFA 3NZEA 5DWVA 1AD2A 7ABPA 5JSFA 4TRMA 3VJMA 4D26A 5KNDD 3PDUA 3TS1A 4MEAA 4RU1A 4W1QA 4WOBA 4H0NA 5IAKA 3UWKA 1V1MB 3AKYA 4BWVA 5KU7A 3S8YA 3ANTA 1O95C 5DEIA 5AXCA 4BPRA 3F49S 3SZOA 1IMOA 2F4NA 5DHUA 1UL1X 1G8SA 3QEMB 3ZW9A 1JG3A 1PI3A 2PUHA 4MINA 4CDGA 4DPMA 1C1XA 3KTDA 3DW1X 3E5NA 5EIAA 1TPZA 4DLNA 1Y4ZA 1XVUA 2O2JA 2VTVA 5HF9A 2CNLA 3ADKA 4YPFA 1EQ2A 1KP9A 3B6EA 2G9QA 4J6FA 4V0KA 1M1UA 3FDFA 1BGWA 1DTWA 2VYQA 4EQ6B 2YHAA 1R4AA 1AQNA 4KXMA 4MVJF 5CDHA 2CZCA 2FQ1A 1QF7A 3O4IA 1R8QA 4FX2A 3U3RA 4DT1A 1P74A 5LQCA 2D4AA 4DUGD 3PBKA 4FNGA 1T6XA 2NSJA 4MP8A 1C9KA 1C30A 1GDDA 2ID8A 3C5HA 3QPBA 3PQ6A 6GPBA 3AM4A 4OK3A 4WK4B 4WZAA 3PUKA 1RNLA 2Q0HA 2G4LA 3GDFA 3P45A 4NTZA 2D7DA 4TTAA 4W9NA 2W2QA 2VJOA 3OLYA 3ILYA 3RABA 4TTTS 1JT9A 4DA7A 4RQAA 1O5IA 3KLOA 4BPBA 1UK8A 5IDYA 2WF9A 3HBFA 2AJ8A 2QN3A 1WD5A 3DDUA 3NHFA 3TAUA 4D8WA 2CUTA 3L93A 2FWNA 3RIGA 1RXSA 2VATA 3Q3IA 5DU2A 1CULC 2G76A 4PBTA 2WJAA 4OKSA 4LHEA 2B6NA 4OFBA 1EE1A 3A0UA 4KGXA 3F8WA 2XE7A 4GLOA 1WABA 2H9AA 1QJCA 3D4NA 3LCCA 4GVPA 1KMIY 4WKCA 5EP4A 3KBBA 3IKMB 4BZQA 3L6OO 2Z5LA 3TZ6A 4D3DA 3IQGX 5LP1A 3HVJA 3E3AA 2RCNA 1VIVA 1WOMA 2ORYA 2X1MA 3NTVA 4LXXA 4XFDA 5A4FS 1IAVA 2Z6AA 3G88A 3N8NA 2VP4A 3DMDA 2Q1XA 4GEKA 1DAEA 3ETDA 3IQFA 5KNDA 1P9RA 5IKXA 2CNNA 1F12A 1CRLA 1UBNA 2J3EA 3ZU4A 1A7AA 5DTIA 3NHKA 5L4SA 1I4WA 2BFFA 2Q8PA 3A1FA 2PJDA 3DCNA 3L8GA 3R0IA 4P2BA 3TFQA 3RS2A 3EZGA 4J2OA 4KLZA 1QO9A 5ER9A 2C4HA 2Q0SA 3EFHA 3A04A 3FJYA 2ATEA 1KJIA 1SU7A 1E5DA 3Q7IA 4BRUA 1R4NB 3KK0A 1KAEA 4ZIRB 2WHEA 4IGFA 1CS4C 4MV5A 5ENDA 5I5EA 4URYR 5IVKA 5K8UA 1TJPB 3ZXUB 4ETNA 4F1WA 3EVNA 3LP8A 3TLEA 4DUGA 4UPDA 2CUNA 4H7DA 5CYGA 2YWBA 1GU1A 2R97A 1BEEA 3JSXA 3ND7A 4DOMA 1T91A 4RORA 3HBMA 3K7EA 4EUNA 2P9YA 3C15C 3D7NA 4QOEA 3D7LA 2QI9F 1ULAA 4BNWA 1F0YA 1DIHA 4G0XA 1DAFA 4DUZB 1YE3A 2HDWA 4C0JA 3OKAA 4LBZA 2EDCA 5BRNA 3RM3A 3INNA 4OGGA 4HGQA 3CF0A 2XCSB 1MDFA 2XUPA 1K8XB 3Q8MA 2DWUA 4HN9A 4UHHA 3ZLUA 3ZWNA 5KS2A 3LLVA 1ZOSA 2J7KA 1NYTA 1RQNA 3ROTA 1U28C 2H7VA 1TK9A 2ZOSA 1G2IA 1KI2A 2OCGA 3T7TA 3BMOA 5EPUA 4CLRA 4IP0A 3EA0A 1XZDA 2WVJA 2Z3WA 4FT4A 2PKCA 4RXMA 1LLQA 1QNLA 5CIQA 4PNZA 2A30A 4JA2A 4JL6A 4C30A 1GTSA 3GLHE 3A25A 3CRQA 3UANA 1U0TA 2DX7A 1HFKA 4KXVA 4F3NA 1THMA 4KYTA 4Z7QB 1EFPB 2GZRA 4KN9S 2R9VA 4EG4A 4BE9A 2CY0A 2F3UA 3WNVA 3CNEA 4YP1A 1S7GA 4C4ZA 3FIJA 4OLHA 2KYRA 4H3HB 4BEWA 3SDBA 2ZBDA 2ID9A 5A4JA 1HY3A 2DUNA 3UMMA 2PZEA 1NLFA 1NY6A 4OSOA 3EGOA 4UEOA 4M55A 3WL8A 1H2FA 3G0BA 2IP2A 4Z2AA 3MQFA 4GQAA 3QFCA 1FQJA 3QUQA 4G4SO 4N5LA 3RSOA 3V00A 6YASA 3OLXA 2DSTA 3TINA 1X0VA 2WYOA 4PSAA 3HPQA 3KOUA 1LY1A 3ET4A 3OQ1A 4HDSA 3AM5A 4GR9A 1NBME 4JAVC 1JAIA 5FNVA 4Z7NB 3HGQA 2IPOA 2VI5A 4ZAFA 5AUNB 4DREA 2EBUA 1L7DA 1X1DA 2PZKA 3GDHA 4IGIA 3T61A 1O0BA 5T67A 4CR8A 1IN8A 4TKLA 3W7VA 1KRXA 3COPA 3C97A 1TC2A 3KAKA 3OZIA 4KRFA 5JQGB 1DIBA 4JYZA 2AV6A 3NETA 1F9EA 4WASA 2WQ7A 4PQEA 1CU1A 3NKVA 4Y30A 1S6YA 2HMAA 3FJOA 4UAGA 3ZDZB 2VZ8A 2AYZA 3OC0A 2YJ6A 3CXRA 4B44A 3UHJA 4XM1A 2VRCD 4FNOA 3KPUA 4GYKA 2Q1TA 4Y2TA 4AMUA 5E8JA 5B55A 1JYEA 2PL5A 1KRHA 2J4DA 4ZDKA 4MW1A 4GKKB 2Z09A 1D6JA 5JO0A 3I1FA 1VXRA 4H9GA 1QH9A 2XUZA 2ZVPX 1X70A 4TROA 1D2EA 1MNQA 1GAEO 2PZBA 3PNYA 4OH7A 4EGFA 1Y6GA 1QSGA 2BHTA 4B34A 3FAKA 4LA4A 1VJ1A 3HKDA 4JLPA 4MGIR 4PLPA 2UVQA 5CYOA 5DWDA 4OI1A 1H5QA 1TW3A 4E1AA 4EABA 1FBNA 3TSCA 1FSZA 3ICCA 2SNIE 1EXVA 1AQIA 1M2NA 4FCVA 1HDIA 4L5YA 2YDXA 4PZCA 5F76A 3P2KA 4KSCA 3G2JA 1DI0A 3HJCA 2XYGA 2OTCA 1T3HA 3OTIA 4GHWA 1E3MA 3NBYC 2EWWA 2FCRA 3M34A 2CW5A 4JI6B 2O3UA 2X5NA 1OREA 1I2AA 1O95D 1PJTA 5D7NA 4CKWA 1TZ2A 4W7HA 5CA0A 4U2CA 5AI6A 3GT7A 4N5HX 5IH7A 1DQZA 3HB7A 4S2UA 3CRNA 3LUDA 4P7KA 3GJ8A 4JOCA 4ASUD 4B2YA 1OX4A 1UKEA 1ZK2A 5EKDA 1E6MA 1SZCA 2BWJA 3U26A 4N6NA 4WXPA 4UM9B 4UOEA 5B53A 3FBGA 4XQGA 2CL0X 3M7IA 1RI4A 5ELXA 5HTOA 3F2IA 5EJEA 4FYJA 5HCUA 3IJEB 2WIGA 3GT0A 2XMQA 3AM1A 1UDXA 4X8MA 1JG6A 1T26A 3LP5A 1T9CA 2D59A 5CHEA 3G5UA 3UJHA 2HPVA 2II6A 2QJWA 3G1UA 3IPYA 1NF2A 5AW3A 2JZCA 4MS4B 2HSDA 4ZDIA 1I7PA 2J45A 3PL1A 3SC4A 4TS4A 1E7YA 1GU0A 3OWOA 3VH1A 1EVYA 3I3OA 4YASA 4DZZA 3ZE0B 1VGRA 4WN3A 3KJHA 3S3TA 1EGHA 4Y6RA 4PHHA 5L53A 5EFZA 1D4ZA 4NOMA 2QVLA 4XDHA 2AOWA 2KS6A 2PZJA 4LY6A 1FJ2A 4IL5A 1QBGA 2W2OA 2A5FA 4TV8B 3F46A 3GRPA 3S2GA 3QVVA 3USES 3VTFA 4QQKA 4C06A 3NYWA 2X6TA 3CRMA 3QVUA 3B5EA 4NBSA 1QIMA 4C78A 1F1BA 5CX1B 2WNHA 4POAA 3LQ2A 3WP0A 3ZWAA 2OA0A 4NH0A 2X2FA 4U00A 5KC9A 2E5LB 2JIOA 1F14A 1ZNYA 5A04A 5CGQB 1I5RA 2HGSA 5AJYA 1V2HE 4DEVA 5IM4F 1CQZA 5FQOA 3WK4A 4IYRA 5LM3A 4JS0A 5KJEA 3B2EA 4RVDA 5ESXA 1SIUA 2VSXA 3C3XA 5BN3B 1JEYA 5F35A 3SC2B 3X2FA 1O95A 3LE8A 5CMLA 3IAFA 3VKFA 1JTVA 4WKNA 4Q4AB 1UOPA 4YRNA 2O8FB 3IA7A 4ENUA 3OZ7A 5K3CA 2P67A 1OV4A 2FWPA 2XNHA 4M8NE 4LN1A 5KSPA 3IUPA 4ASUA 4HB3A 5LB2A 1UOQA 1U7TA 5EWMB 5B1YA 2GJ4A 4NEQA 2GM9A 5FHQA 4RA6B 1BOFA 3SFTA 3SJ7A 3WKBA 1A1VA 2UXBB 2GPBA 2VEOA 2W6JA 3KQWA 2PQ6A 1ILEA 4G5OA 5GM1A 2G08A 3QGMA 1RACA 5IJZA 1IC6A 2I2AA 2IEZA 4HVAA 4Y1FA 3W6ZA 4E6PA 3MGKA 1U2ZA 2VJKA 5LD2C 1RABA 2JLUA 1IEXA 3PQ3A 4OXNA 1LLFA 4R40A 3N2NA 5F73A 3A1UA 1E3DA 1ONPA 2HMTA 4AS3A 4CM3A 3B1ZA 1JHZA 1Q1EA 1SRQA 4HJXA 5SY4A 1LSSA 1YV9A 1DIRA 1S8FA 1Z0ZA 4M1OA 3RC7A 4EW6A 3RF6A 5A06A 5ABPA 4QOSA 4ZTUB 1Y5RA 4XCQA 4JT2A 1EE2A 1P0FA 1M83A 1TJNA 3VOTA 4EY7A 1JXQA 2CL7X 5DCUA 5PNTA 3B9PA 4MGKR 5IAJA 2VUHB 1G5RA 4PZPA 3TKYA 3GLGE 2GZHA 4TTRA 3MTEA 1Z4JA 3KVRA 2OXIA 3RLIA 2PJZA 5HFNA 4QREA 2QAGC 4MAFA 3T3GA 2QVXX 4U4AA 1KIMA 4FR5A 4TXJA 2KB0A 3WDKA 3ZGOA 2IOFK 3O9MA 4HLNA 1FBTA 4TMYA 2XVMA 4XM2A 3VYVA 2DHQA 4FQ8A 4CCAA 1N3LA 3UQYS 1ZD5A 4PYRA 1ULTA 5JZBA 1ZJ6A 1EFRA 3F6SA 5KOHB 1Y8CA 3P26A 2FSUA 1GQ2A 2UUOA 2ZRIA 4TLMB 1R16A 2FF5A 1DJNA 1V5IA 4B3MB 1ZWLA 4FZ3A 4L3WA 2DF8A 4HQ0A 4AZSA 5KYUB 2V7UA 2TSYB 2WF7A 1YA4A 3SYRA 5IFKA 3OCZA 1LQTA 2R1TB 1YMVA 4R2LA 4BP8A 5I3ZA 1LTQA 2BDTA 1YQ9A 4CJXA 3UFBA 1EXNA 1TM5E 4ETWA 4TGLA 4PVDA 3OLQA 3RS3A 3VI4B 2UUCB 2G8NA 1XNJA 5IX8A 1XJQA 2J5RA 4RFSA 3SZMA 3G2OA 4HOYA 3D8RA 2PD4A 4U5XA 1AKYA 5EJGA 3FHTA 1CJVC 1DUIA 2PM8A 4JB0A 1LWOA 2QTAA 2QORA 1YMQA 4IWNA 4N49A 1BDBA 1L1FA 1RIIA 1C3OB 1NVWQ 5DNAA 4YJKA 4IKOA 1H1TA 5J9FA 4Z4FA 2X4IA 3GZNA 3PXAA 3BWMA 1JDVA 1HMYA 1XU7A 3FNGA 1D1TA 3TQHA 5LQMA 2E4XA 4L9SA 1ACMA 2NXEA 3N7AA 3KSDO 1E66A 4LZLA 4A0RA 4JEHA 1F06A 1Y33E 4K46A 3VTAA 1I01A 3TPZA 1Y5MA 4FKBA 1E3JA 4CF6A 1ENYA 4LGYA 2Z95A 4M1MA 4BQRA 1TU0A 3Q98A 1H69A 4BNKA 4K88A 3IBFA 3WRXC 1W0CA 1U8TA 2W2KA 4O2BB 3VOAA 3W1VA 1Z18A 1VE7A 2IP1A 3WWDA 4F5YA 1KZ9A 1K2WA 4OL9A 4LQDA 5ERXA 1Y89A 5EE3A 2ZULA 4CE6A 1BE1A 1E7MA 3CIOA 4GPIB 4ZCMA 4OMFG 1R00A 1M54A 1YULA 2Z8ZA 4HTFA 4G5HA 4LMAA 3LWDA 3P9NA 1SCJA 1NKSA 1OBHA 1VL2A 2HCRA 1DWPA 3M1IA 2RHTA 2OZKA 1HQKA 2GEDA 1T8WA 2MSEB 2VZ0A 2G80A 5IP5A 5JAMA 1L5VA 2XCIA 4P7FA 1QOQB 5TIIA 4L4XA 2W4IA 2BEJA 3F6EX 1K06A 2ZI5A 2PX0A 1CFZA 2ZT8A 5F51A 4B76A 2A58A 2XDQB 3HE3A 3VKWA 1IHUA 1NQWA 3HJHA 1WDTA 2VJCA 2ZB4A 1RJFA 1DPFA 3H8WA 3OP1A 4OFWA 1R6AA 4TV8F 5J59A 4RJ2A 3STTA 4OJYA 2OUIA 2ZQ5A 4GX5A 3TLCA 4MJ3A 2YXNA 3MS7A 1CNMA 3CKYA 2ZIFA 1MX5A 1N7JA 4BNYA 3PNVA 3WHKA 3KXPA 5L45A 3D4LA 2ZRLA 4ZVRA 1FTQA 4NFYA 1CUIA 4IX9A 4MARA 5EJAA 1CK4A 4IIGA 1UZMA 1V6SA 3IQXA 5E9QA 4KX5A 4BU1A 1O6ZA 5CNMA 4LRXA 5K6TA 5JLJA 2HQOA 2EBHX 4Z51A 3EZLA 3UJAA 2OO5A 3BFKA 3Q7SA 3ZJYA 3C8MA 3CXUA 3JYLA 5HRUA 1YK1A 1KOLA 1E79D 2XH8A 1WKBA 3N59A 5EJFA 3WMEA 3ELYA 1L5QA 3WGJA 3F1LA 4PHTA 2MYTA 5EWJA 1PZEA 4FMBB 4LXUA 4XWGA 4XCVA 3TCXB 2F3PA 1KY4A 2ODTX 3B6MA 4BQEA 2O9JA 1UCFA 4S2EA 3ZJVA 1CQWA 1D03A 2B1QA 2PVCA 2QN6A 1IMJA 3KVNA 4XDGA 3KT0A 2HI0A 3OIUA 5G0UA 1CDZA 3FKSA 4P81A 1UEXC 2CSXA 1I4TD 3U7JA 5JXWA 5FPYA 3HCAA 5DGDA 3ZXXA 1NUUA 1RRVA 2VKQA 3BKWA 3E2IA 3T9BA 1JR3D 2GO1A 4DJJA 3FLEA 3KJIA 1NMXA 1ZOLA 3Q2KA 1UQRA 1E2GA 4Z4IA 3E70C 4ERNA 2BMWA 4U2FA 2QD4A 1NUTA 2GSDA 3GRAA 1BXGA 2RMKA 4IJKA 1BW9A 4XD7A 4PBSA 2C03A 2OZVA 1J5PA 3VYRB 3M6IA 4W99A 3KUKA 4JYAB 1MAVA 4IJWA 1JXMA 5KTTA 3QU7A 1E6CA 2P6UA 5CLIA 5A4DA 4K9PA 1OILA 1U0LA 3ROFA 1JKJB 5HGJA 3IMGA 5ES3A 2DHEA 3WLKX 2OHGA 1T5LA 1S3IA 3PNQA 3AH8A 2C5AA 2ZYHA 3DKVA 1PNTA 3FOCA 3CVVA 4MW0A 2HCJB 4EP1A 5M2QA 4JX8A 4PLFA 3V2UA 3BQNB 3WGKA 2FK8A 3OPVA 4RA9B 2EFDB 4R1PA 1A2BA 3INRA 3ADPA 4YJ3B 3WJAA 3B1KA 3QX9A 3VPXA 3WK8A 4EYGA 4JUBA 2ZCUA 3WR5A 3HJTA 4G0YA 3ZW8A 1E9DA 1M67A 4B84A 2PIAA 3D4IA 4C7OB 1E79A 4R1MA 3RJTA 1T1JA 3HXMA 3S8MA 4KFTA 4CEJB 2IU3A 4C0BA 2XTAA 1A3CA 3CEAA 4KGVA 4ETMA 2ZREA 4FILA 3B2NA 4GRIA 2VDUE 3CF6R 2X8WA 4BQPA 4MQEB 4ENRA 1I6MA 2DQSA 3DYIA 4CCYB 2JH9A 3G0IA 3LVRE 4RDHA 4C5CA 1SQFA 2HADA 3W5IA 1HETA 5TQJA 3D9QX 2IY9A 3O95A 4RL6A 5AVTA 2BTEA 1JR3A 1NVXQ 3B20A 3KLPX 4G0MA 2CE2X 1HKHA 4I5IA 5EZ5A 2JAHA 1GZ3A 3BEOA 3C3MA 3GB9A 4E21A 4F4HA 5ITZB 4V0OA 1P2UA 1CRWG 1K7EB 1OU0A 4A15A 1IL0A 1T6YA 1IPHA 1HTWA 1O9GA 3IAS6 3Q8KA 5IJWA 4CKCA 2O2DA 1KZ4A 2BMFA 2CLOB 4NVRA 4DA8A 1HLGA 3Q0IA 3QMPA 4MVJG 3D3EA 5JR3A 2HQSA 1AF4A 3TLMA 2P5TB 3O47A 5H3CA 5C2JB 1I3LA 4FYKA 4HH4A 4I46A 1W36B 3PGLA 4RF2A 4EX7A 4XX1A 4M0DA 3P1JA 4U7PB 5DP2A 3CINA 4DJTA 1FP7A 5JNVA 3ICWA 2BISA 4BNDB 2R62A 4B31A 4NNJA 5LNK1 4XUEA 1ISMA 1OSNA 1ZJ5A 3GJXC 3FVTA 3RF7A 3UHPA 3IIIA 1H0KA 1PK9A 1G0OA 2QTNA 3CNLA 1UDBA 4DIUA 1P6QA 5L8VA 5AK4A 4QOIA 2O0MA 2X0NA 1WUIS 3MA0A 3V1MA 1LBSA 4OYHA 4Z9XA 2HU8A 4S1OA 4H6VA 5FTLA 1UOOA 1QIHA 2B0JA 4RZIA 3V42A 3JU3A 1ORHA 4KR2A 2H17A 5LC1A 5EHNA 4R9SA 2PLNA 2WSSA 3WRWA 1BEZA 2NSDA 1OLUB 2AN5A 2RKWA 4Q9HA 2F90A 2DUJA 2PGNA 1X77A 4Y8VA 3ZZ0A 3KYIB 4O1HA 4IXDA 2JEYA 4OAQA 3PJDA 1KMNA 2GHQA 4LPKA 1F2TA 3ZNOA 4U02A 2P9GA 1AK9A 13PKA 1V1RB 4DDKA 4GR4A 5LYJA 4YUZA 4MCJA 3NTOA 1Q11A 1ZHOA 2Z2ZA 1O4VA 2Y0EA 4CKZA 4UQLA 3K92A 1G41A 2RHWA 2QG9A 4XUDA 1IOZA 1CF9A 1DT5A 4QIHA 2QAGA 3ASZA 1QHHB 3WLLA 4KIUA 3WXMA 3U5ZB 1CS0A 5DNUA 4LGMA 3DWEX 3OQIA 2JHPA 3E61A 1UKAA 3BD9A 4Q0MA 3W1EA 1LU9A 1Z5UA 2NTYC 4HNAA 4Q9IA 1VSQA 2DQZA 3IDQA 3QTTA 3C3DA 4HO1X 3OJEA 1TIKA 4Y9UA 4E51A 1FF9A 3HGMA 3G5TA 2UZ3A 2FOLA 4DIEA 1U6IA 1GXSB 2DPMA 2JD2A 2JCGA 3IRUA 4MULA 4NCXA 3STVA 5ADUS 1JYFA 2G9NA 5FI5A 1B0PA 1FNSA 5H02A 3ZHUA 1HKUA 1GR1A 2P4EA 2V6MA 3T52A 9LDTA 4MUHA 2XB8A 3DGFC 1JEQA 2Q07A 4OFZA 2WJ3A 3CC8A 4P3PA 3T95A 5FDFA 4BZXA 4PYQA 2QP3A 2O1EA 2AFIE 4UCQA 4YRSA 2PT6A 3JZFA 2P9TA 4LDJA 5DNVA 3SXPA 4BCDA 4EK9A 1IB6A 5CVDA 1E9RA 3S81A 3I62A 2PMKA 5CDGA 4S1VA 2J9RA 1YH3A 3MTIA 5HVNA 3I01M 1DEKA 3QYPA 1DRKA 1ZJZA 3R7WA 2YRXA 2OLKA 3TCNA 1ZMOA 4ID9A 4FB4A 3KG2A 1XKXA 1CDOA 5E3JA 2JGLA 4MUYA 4BKQA 2L19A 3BTSA 5FAKA 1Q0RA 2W4MA 5JXIA 2Y27A 2WTXA 3EGDA 4QUEA 3V4OA 1CYEA 1VMIA 4XIYA 4WADA 1P19A 3FPKA 4RL4A 1IYZA 1G63A 1YS4A 3LQKA 5FBKA 7GPBA 4OUDA 2FFRA 2BW0A 5CNKA 4YRPA 3RKSA 1VG8A 4UU0A 4LF5B 3V2GA 4YJ3F 1OIXA 1I8TA 2C54A 3WRXA 1T8UA 4TX1A 1QG0A 3C3PA 4AULA 4UTZA 3C39A 5FL7D 3IT2A 5E1DA 3U7EB 3PUWA 4EPXA 3NHYA 1PQPA 1JHOA 1ZHFA 2QN2A 2GKOA 4RIIA 2G8LA 1T2VA 4JELA 4HH1A 3BXOA 3Q5EA 2Y1WA 2HUPA 1HBJA 4PAWA 3ONNA 4UAJA 5FPQA 5GJVC 4LY0A 4RPHA 4DY6A 3ZV6A 5ILOA 2BBWA 2YHIB 4RCVA 2AXNA 1HT2E 1CEYA 1D4FA 2CE7A 3B7WA 2Q6KA 1IHXA 1W49A 2ZE6A 3DP7A 4RCYA 2M6LA 3SQLA 2IF0A 4QDXA 5LOVB 1XL1A 3RTAA 4KX3A 2F1KA 1U0SY 1LPBB 3I9NA 3QHQA 5CEJA 4KFSA 4I19A 4H17A 3DKKA 4WNAB 4XUCA 1M7BA 1W4AA 2VAPA 3DVSX 3JALB 4FIDA 1VSTA 4NAVA 5H5JA 1PVDA 3EJ6A 2ANBA 2ODBA 3GAAA 3PWKA 1KHHA 4G5QA 5SYMA 3HFJA 3MLAA 4Q7KA 2P3SA 4IO1A 5JWHA 1XZBA 3CR3C 3MT7A 1W5AA 2F3SA 3EY9A 2QL9A 3M9XA 2BGIA 4N0MA 2QLFA 4YR9A 7YASA 3V4SA 4RTPA 1SUIA 4G65A 3JW8A 2REXB 3IERA 2X3FA 2DB3A 3D0OA 2NO9A 5HKBA 3L6UA 3NDPA 1S9HA 4YV7A 1YF3A 1ZU5A 2Z4RA 2R0QC 1R0YA 2YYYA 1INLA 3V8EA 1W8IA 3UXEA 3KJEA 5EZYA 5CB4F 4ALMA 3E9CA 3L46A 2E48A 4XCXA 3DTVA 3TL3A 2QW1A 3LVBA 4KR0A 3ZS9A 1RR6A 1P1KA 5K99A 4OP3A 3Q7TA 4XTRA 4TUYA 2ZP1A 4B47A 2ASVA 5BRAA 4PIMA 2W42A 1YRBA 4AZ3B 3CF4G 1DAGA 4MOWA 3U3XA 4OTZA 2KHZA 2RSLA 3AF5A 4R5MA 3VR0A 2AEEA 1EZZA 4JA0A 3Q7PA 3IDAA 4LGVA 2BF4A 3EDYA 4A0GA 2VAXA 3OA0A 2OPBA 4HQ6A 1FDUA 1EDDA 2YC4C 4CF3A 1WZIA 2F00A 2O2HA 1ZUWA 2GPWA 1MJNA 1UWVA 1NRJB 2FXVA 2D0IA 1XLTA 1U6KA 4R16A 3D59A 1U9JA 1XQ9A 4I8XA 1V7QA 1Y34E 5CTJA 1JA1A 1KBZA 1RCTE 2NYUA 2G0TA 3FRIA 1ISHA 3DT6A 2I80A 4XGNA 1N3YA 2J48A 3CLVA 3CUTA 4PN3A 5TV2A 4GAEA 5K5EA 1C0PA 2GKSA 1T8PA 4KU4A 5KTSA 4OHKA 3IPCA 1TU4A 1A5BB 3TIIA 3NOOA 1H5NA 3AHFA 3WWOA 3D8SA 3ZWQA 2PG3A 1YE5A 2C4MA 2YVUA 1QF6A 1Q92A 2D62A 4OL0A 4QDUA 1FMJA 3T7SA 3A06A 1W6RA 3FNIA 1ZGCA 5AH0A 3L0ZA 1NQXA 3EXHB 5ALUA 3MS2A 4OHOA 1U3CA 4FR2A 1H3EA 4IIBA 4MW6A 4JLUA 3A05A 1TMKA 4D0GA 3RTCA 3QLEA 2I91A 4UPVA 1QK3A 4OQEA 5JPIA 3W7AA 1EP3B 4OGKA 3I12A 3JY6A 1T8RA 5FOXA 1AVTA 1YI0A 1P8AA 4IV5A 4K6GA 2JW5A 2HZ7A 1EVEA 1OYOA 3HKCB 5SZHB 3CR8A 4CMHA 2FEKA 3CCFA 3GJ0A 3DLBA 2J0SA 1QVRA 4HY3A 3T15A 2AC2A 3H87A 2PRKA 1E3EA 3C3AA 4HNSA 3D7RA 3OEED 2R8PA 5IDWA 4OVKA 5KX5B 1GAQA 2ADOA 2AOUB 2YXBA 1CEQA 4N5NA 4EHDA 3PCRB 1W9MA 4URXR 2VH2A 1ULHA 4QBKA 1HEYA 2VTEA 3KDSE 1L5KA 2RE8A 3BHIA 2DLDA 4QJ4A 4ZOEA 3QI2A 2IZ1A 5F5XA 2I55A 5K0SA 4Q1DA 1WB9A 4GNKA 3WFJA 5HYVA 1NIJA 2C4WA 3FPLA 2FPUA 4FVTA 4XJSA 2IU0A 3GPDG 2E6KA 1KYXA 3M5CA 2AD1A 2ZI3A 2NYRA 3NC1C 1BDJA 3OWHA 3TK1A 3O3MB 1P91A 4FE7A 3DLPX 4I5GA 4CLXA 1HE4A 1CJKC 1WB4A 1H8HD 2GPJA 2QN8A 4GPEA 4OK6A 3E82A 1ZSNA 2LIPA 3J7AC 3MEQA 3NOXA 1PNRA 3DEKA 3LUKA 4JGBA 4NZOA 4EGJA 5KTRA 3R0JA 4RENA 4Q00A 2C9BA 4LQ4A 4KMRA 4IG9A 2PGAA 4YFVA 3LQ1A 2BTOA 4E7PA 4UE3S 4GI7A 2ETXA 5KDLA 5LMNB 3PE4A 2PIDA 2WD9A 2XODA 3O26A 3R9XA 3G6KA 3KBOA 1VL8A 2ZB7A 1J8DA 2IPLA 2KE5A 3OJCA 5JSUA 3BK1A 3ND8A 3QKSB 1QONA 3NW9A 4UARA 1CIVA 2YYZA 4WEQA 5JUWA 4O4HA 1EVKA 1RWMA 1JJVA 1UC5B 1WB5A 2FE1A 3FKQA 4K6OA 3T3DA 4DYHA 2VCYA 2X1HA 4Y6QA 3STYA 3R09A 3IEPA 5KJ6A 2ONYA 3CRW1 5JJBA 1NXSA 3DFMA 1A8SA 4YAGA 4TVOA 3QVMA 3S2YA 621PA 2PN1A 2NVBA 1AMNA 3C6KA 1WRBA 4B6PA 1C0LA 3ABRB 1OKKD 2WJZB 2F17A 3NONA 1UP4A 2FETA 2XUOA 3SU8A 1N0HA 4NARA 5LA6A 4NMXB 4FDVA 4HDKB 2V7QD 4Q19A 5ECYA 2I6FA 3N07A 5G2OA 5B6JA 5IXSA 2D0PB 3RVQA 5EYPA 4KTTE 5IC5A 3VNRA 1BWQA 2FVYA 1YDFA 2WF6A 3AGQA 3L7NA 4EO4A 3A6PC 1SH7A 3QY0A 4H4DA 2HW8A 5AW8A 4E3WA 1VL6A 2A9PA 1E3WA 3T7RA 1MT3A 4BB5A 3N5KA 2YCBA 3U3MA 2YHBA 3KOOA 3SKYA 2A1IA 2XB9A 3IX7A 2GEUA 2IZ7A 2AFHE 2RGYA 4PAQA 4Q37A 4QSHA 5IC6A 1HE8B 3W3AD 4URHA 1TZMA 3HNPA 3U09A 4JBWA 3AR3A 3ZCTA 2JJYA 4IKEA 3PWTA 4PYIA 5KQSA 1FLNA 2QP9X 3DB2A 3U0VA 2NZ8A 4AO7A 1VRWA 4K6MA 1IFXA 3ILVA 1G19A 4P2GA 5LMZA 2RHCA 1WW2A 1UOEA 1VL0A 3EVZA 3QG5A 5D87A 3KTFA 5CXQA 4AY2A 4R3UC 4EJSC 2ICAA 4KQHA 3G2IA 2W2NA 1BDHA 1JDSA 1Y6FA 4J9UE 1FLDA 1NTOA 4TLDA 1T2UA 3NEYA 3FOAA 4Y2HA 5DYWA 3UT5A 1VBKA 1U3FA 5FBHA 1JJIA 3JRNA 1SQ5A 4PN7A 5FA8A 1Z08A 3W5JA 1ZUD1 1U8YA 4KIGA 5A5DA 3M2TA 4RANA 1KVSA 5DHRA 1CWUA 1HOXA 1PZNA 3M5PA 3V46A 2QTBA 1E6WA 1Z4NA 2XVXA 1R9NA 1U0FA 4I5EA 1MAWA 1W1IA 3H6HA 4BFUA 3ECSA 3EIQA 3TPFA 5I4IA 5K0EA 1TM4E 4OO3A 1I7QB 1JDNA 1M2EA 1J2YA 1W88B 16PKA 3P9CA 4U3JA 1VE6A 4BLQA 4IGKA 1QJ4A 1QM5A 3V80A 4KWIA 3LC2O 5JNLA 5ETJA 1XNGA 1AKNA 3TQTA 4AF7A 1YOBA 3KQNA 3EXIB 1HYBA 2V7QA 2FFBA 4X8HA 4ZGWA 4JOQA 3SEQA 2PHZA 2WU0A 4OYLA 4EATA 1W75A 1QVAA 2INGX 4RQUA 4OQNA 3BDVA 1PWYE 1YASA 3VPSA 2ZUCA 4M8KA 5E3HA 5BR8B 4YALA 1RAFA 1T1SA 1D07A 3NTQA 2ZRCA 1E5VA 5F9MA 5IULC 2XUFA 3KKKA 1S2LA 2XTZA 4M0FA 5IXYA 1YL7A 1XRRA 2VDMB 3MTBA 1A8IA 4KXLA 3W3AA 2B20A 1KFEB 1RFGE 2REQB 3NCHA 3CH6A 3VSEA 1Z3CA 2GFQA 1SEPA 4CIBA 4EHIA 2A5YB 4X66B 5EMNA 3THSA 5IG2A 4LWZA 4AS1A 4TYYA 1DJQA 4L5BA 1GQQA 1RMQA 2C04A 3EIFA 5TB5A 3WQHA 5I4CA 2QM7A 2B1GA 2H1IA 4HS9A 2H4XA 3S27A 2VHJA 2P1RA 3I30X 3QNWA 1M5TA 4N82A 5F1KA 3RTBA 4DTIA 5E4JA 1FFHA 1J2JA 4CIWA 2IITA 2B30A 3NVMB 4WLFA 1UXIA 3BZWA 4M60A 3SSOA 4LDAA 3WBFA 2ZZMA 1I4EB 4GT1A 1GJRA 3P4XA 1N77A 2BEVA 2JJ1A 2HXGA 3FE2A 5DT9A 3IGFA 3LT4A 3Q5GA 3UM9A 2QZZA 2XMSA 4EB0A 1PRYA 2VHUA 5JVDB 1SXGA 2XYVA 2FRDC 1GAJA 2ZRDA 1D1PA 4YQEA 2A1UB 2QEQA 4PBRA 4RADA 3RK0A 4EYOA 4ND3A 1WVGA 1EI9A 3CEJA 3ONDA 3QVGA 4CM4A 2BKUA 2QN9A 4L3VA 3T4EA 4BGEA 2Y05A 1URPA 1YS7A 2WJPA 5CUQA 5D3ZA 1KQNA 3NWPA 2R47A 1X7YB 2IK8A 3EDQA 3K8OE 3KJGA 4GEGA 5CYPA 2YS6A 3MTDA 3PFKA 2W22A 5G02A 1J8VA 1FUKA 3RTGA 3WGZA 2H11A 2IFTA 3PWSA 2C2BA 4DCVA 2QR3A 3KYBA 1UAAA 5J2UF 5AKEA 1ZHHA 2NYAA 2AXQA 3G68A 1CUSA 4DXAA 2ERXA 3HY4A 3HBLA 3PX7A 3PQDA 1L1RA 4GE3A 3TQIA 2XTJA 4IVPA 1ZH2A 3VBEA 1SXPA 2G1UA 1NBEA 4F3RA 4X8LA 1ZC4A 2BUBA 1P2DA 1CERA 1KAOA 2NZJA 4WT7A 2AN3A 2PKRA 1MV8A 2ZJBA 2K2QB 3F3KA 1GVNB 3I05A 1RHRA 3KTAB 4LHZA 4RLSA 5DX8A 5F98A 5FIUA 1VDZA 3JARA 1ZP6A 4GMHA 1U0OC 4XSGA 1L5HA 1ZUNB 3I37X 3NAMA 3ZQ6A 4ATNA 1BD3A 3DWGA 4PSCA 4ZU3A 5C1BA 1ESMA 1FRFS 3PIRA 1V0JA 3I64A 4FOPA 5TJ9A 5E6RB 3H5WA 4N9WA 2XNDA 1KDPA 3KUXA 2BJHA 2ZITA 1T6BY 4LG1A 1WTAA 3L41A 3F6YA 3IHWA 3PXBA 4HK4A 5BQ5A 1RHQA 2DP4E 2N0SA 4BTVA 3TXXA 4YXFA 5C1PA 1ZIPA 4JP5A 2P5SA 2PFKA 1P7WA 4FQ5A 3L0OA 2WD8A 1N8TA 1S2IA 1VLLA 4NU8X 4O4LA 4I1IA 4AWXA 4P4SA 1HQCA 1YR9A 3GLQA 5ALOA 3TQSA 4ENVA 5BSWA 2R8BA 3I23A 5HIIA 3FYUC 3HA5A 4WOPA 1L8QA 2IYRA 1CW2B 4BLRA 2E9SA 1BCRB 5CH8A 3TFWA 5JYEA 2Q28A 3WQBA 5KQLA 5I4KA 3RIXA 1RYBA 1TJYA 4IQFA 1DHRA 4F1JA 2P9QA 1FMFA 1N5LA 3E9ZA 3E1GA 3O9VA 3PE3A 4FGJA 1M9NA 5ILQA 3TTSA 2RI1A 3E1SA 1W85A 1DRVA 2AX4A 2P2DA 4NBRA 3SDSA 3NBZC 5L3VA 1NR5A 1CZOA 2XUAA 3EF3A 1TB4A 4Q3CA 4KHZA 3RR2A 1V8OA 1MQ8B 5J2TF 2YTZA 3T4UA 1OR8A 3IAXA 1TVMA 2REOA 1GUZA 2D3WA 4Z4GA 1ODCA 3H97A 1I5EA 2DWCA 3DDNA 1N1DA 4NBLA 4EG3A 5EKXA 1XPUA 4KUHA 3KKEA 5DTEA 2ODAA 1PZXA 2C42A 1ISSA 8AT1A 1ULUA 2BMAA 1W6UA 4GI2A 4RQBA 1U9CA 5D5PA 5AKJA 2VUIB 1AV6A 4ZCLA 4FFLA 2E89A 3BMNB 3IVRA 1DX9A 1KKMA 2FRXA 2QE7A 2QPOA 5BV0A 5I7OA 5GOZA 1QOZA 4O4JB 1Y7HA 2H4JA 3WFZA 1PNVA 3OEHD 4QPPA 2I6SA 3WMFA 2QP4A 2H8GA 3QVTA 4KQWA 3W9SA 1HDYA 3N2ZB 1I36A 1V6AA 2P78A 4JL8A 4WJZA 1EFLA 5KYXB 2A86A 2RGNA 1RZ3A 4OK5A 4ER7A 1C1HA 4DQUA 3KQHA 1OTXA 3V1KA 5AW1A 3V1UA 3NUGA 1XQVA 1A71A 5HX7A 2E85A 1T9KA 2QZ4A 4KFRA 2GNAA 2AHRA 2D7JA 1FP4A 1YZFA 2VYCA 2XITA 3P9KA 3L4BC 2QMHA 6CHYA 3F7MA 4ER5A 4GDFA 3OHMA 4N3NA 2CVFA 3AMVA 3DT8A 2XYQA 3K0SA 3DLIA 1ODJA 1ZVMA 3VH2A 4MJXA 2XQGA 1H3NA 1S2MA 1A7KA 1XD9A 1GZHB 3FWKA 5IHPA 1PFVA 2PMFA 2CYCA 4QDTA 4NJMA 1FB5A 3HUUA 5JI3E 1BMQA 2ZRKA 3ESCA 1IWOA 1SCUB 2YMPA 4R8KA 4K9MA 5EGSA 1SG9A 3R3YA 2CCGA 4C9BA 3FF4A 2BFEA 2Q6TA 2QHXA 2WW8A 1NR7A 2J0EA 5DM1A 1OLXB 3ZGYA 2C5BA 3GOHA 4WZBB 3PRJA 3W8DA 4B6SA 1AZTA 4YDQA 5HZMA 3AESA 3B38A 1RYMA 4DDMA 2OB1A 2GX6A 3U6BA 2G83A 3BGIA 3W9YA 3THWA 5JQGF 4U2GA 1T5OA 2A7XA 2EIHA 4LTNA 4BB9A 1TM1E 2JPDA 1NVVQ 5KOJB 3HUEA 3A6JA 3SJZA 5BQFA 4E0BA 5E2AA 4CF5A 2HSZA 3AR4A 1QRAA 1C14A 3ASVA 1BN6A 1WF6A 1ZLXA 1Z39A 1N2CE 3AKZA 4IQ4A 1U5CA 3LVFO 1XDBA 2MR6A 2QWXA 3IT1A 3MN1A 1M8FA 4BKRA 3GAFA 2PUBA 2DERA 4CTMA 1G1AA 4D99A 3CKMA 1XTJA 2C4KA 1RYDA 4FYIA 1CKEA 1PYDA 5I7RA 2QRLA 2NXNA 2I78A 1C7ZA 4ZU6X 3UA3A 1GUYA 2A4KA 4K9LA 3ZHVA 4ZJUA 4FNMA 2Y99A 3DA8A 3P19A 4HFMA 4MVWA 4B0PA 4J0CA 2AZXA 4WTOA 3EQ8A 4M9XA 1UWCA 4XJXA 4TSFD 5ED4A 5DO9A 3T4PA 2ZT7A 4LMRA 3V8BA 4BEBA 3AEZA 2XMCA 4D43A 1QAQA 3A28A 1IRIA 2FHPA 1DINA 1OQAA 1YKGA 4OHXA 1IVSA 1SKYB 2SHKA 1T34A 3WGYA 1SURA 2R00A 1CZLA 2NAPA 1UMKA 5CRIA 3RRJA 4BO0A 4EJSA 4YUXA 2IYLD 2M6RA 2YKGA 3E22B 3WYBA 1OGIA 5JEEA 3TL2A 2PWPA 4KAFA 1E0SA 4KQFA 1BMFA 1VJDA 3VPFA 4JYMA 3RG2A 1MD9A 1IY1A 2G4VA 3H4IA 4RDIA 1YA6A 2Q5IA 3FRJA 4XYMA 2C61A 3C3EA 1NBMD 4AKHA 3WYGA 3G9QA 3I5XA 2I0FA 1MH1A 3BD7A 1A95A 2VOJA 3F5SA 4MS1B 3TNLA 1RJ9B 3BA1A 3WIOA 3QEBZ 1JHAA 1MFPA 1DO8A 1AIPA 2HBYA 1DB3A 1AA9A 1CUXA 2J5XA 4WD3A 4FEEA 2OV3A 4QUDA 3DDZX 3TM5A 1TA9A 4REQA 5K0TA 3GJRA 3MBIA 2VBCA 4UDXX 5I7EA 4YT2A 3F3MA 4LKRA 1EYZA 4JJ6A 4B3BA 1R27A 2PBRA 3LYAA 1CUUA 1J5XA 1K3FA 4UD2A 1B73A 3DUFB 1FNMA 3TD6A 4BRZA 1KYYA 1QGED 1X6VA 2IYOA 1ZM3A 4P33A 1VCHA 3LK7A 4XXHA 2R8YA 4AYTA 4EI9A 2MJLA 3UMVA 2Q1UA 3LUBA 4EGQA 2O7QA 1BNCA 2X0KA 4ARCA 3C1AA 4BX2A 3KEGA 3WB1A 4RKYA 2FN9A 4DR6B 1NUAA 5LZ5A 4EKGA 3K4HA 1JQDA 1RQPA 4MEBA 2Z9CA 4BTLA 1VLVA 1H05A 3K9QO 3ZCXA 2EGGA 3KP1A 1JHUA 5FUXA 4QYIB 4F9GA 5LMCA 5FPPA 1DRJA 1KYVA 2J09A 1GRNA 2BM0A 4HRXA 2Y0PA 1ZYUA 2EFCB 3HCOA 1PX0A 3CF4A 5F77A 3MCUA 2P41A 3E7DA 2A5GA 4QU5A 4RELA 3VR1A 1RYZA 4J2TA 1G8YA 2HLPA 2WOJA 4JK3A 2HIHA 4BNVA 3LM8A 4EL5A 2O6HA 1A0OA 1FPQA 2FH5B 4IQ0A 1SHTX 2QYOA 4R1QA 1VZ3A 4TSFA 2DKFA 4NFSA 3JYPA 4E07A 2CCJA 1FVFA 4YX9A 3RC8A 3A31A 1KBOA 2J9ZB 1RBZA 1XPRA 2IHNA 1XZPA 3VR5H 4LOAA 3O8CA 4YBZA 3FFTA 3NXSA 1WHSB 1T9GS 4F4IA 1DQNA 1QMGA 3QLVC 1KOGA 3O94A 1FDOA 3P4UA 5KWSA 1JIKA 1TX4B 4TLEA 2C5HA 2O7NA 5K0NA 3RS8A 4B7AA 1TK2A 4WY2A 3MINA 5AJWA 1U94A 1Z0FA 3I0NA 2GAFA 4FW8A 4LX8A 3K8YA 5CM2Z 1KZHA 1Y4SA 3ETGA 5DM0A 1N57A 5EJ7A 5JSZA 1O77A 1L6IA 3DFZA 4DR4B 1L5ZA 4FLFA 1L8LA 4C29A 1PJAA 4YIHA 4OGFA 4RM3A 2ECFA 2ZWVA 1E4YA 2YN4A 2WJ6A 5CITA 4O4IB 5HOQA 2ZAOA 3IKVA 3FDJA 4N1AA 4RTLA 3NGLA 5JI2E 4BZPA 2XBLA 3BQ9A 4KI7A 4GMFA 4B82A 3OIVA 2C4TA 1TRKA 2PEZA 4WECA 3TM4A 3QU4A 4HH0A 5BWCA 3KLBA 4M9SA 1SUCA 3AUXA 4NDAA 2IDKA 1UKVY 4L74A 3RGGA 3KHTA 4GI3A 4JJZA 1FYVA 3QRWA 5AXBA 2SCUA 1FFXB 2QD1A 1IZ9A 2VP6A 3RV3A 3AR9A 4D9MA 4RD3A 4Q16A 1WX1A 1JIIA 2QA5A 1OY1A 3DLCA 3SG0A 1IQRA 5EXPA 4Z1OA 4OHCA 4TQAA 2PKQO 2QTMA 4DWVA 2FZ5A 2XUIA 4KSBA 1LX7A 2H5IA 3NGMA 5DNWA 3X1YA 4C22A 2ZETA 4B7XA 2AR7A 4L4RA 3MLEA 3SX2A 4S1WA 2PANA 5C52B 3CG4A 3G7SA 3JR7A 1AS0A 1JSCA 4OQQA 2DECA 1Y80A 1N3BA 2V4ZA 2H92A 4QLAA 5TGZA 4ARIA 1UQUA 1GDTA 1IY0A 3IO3A 5K3FA 3GW8A 1J24A 1ZXBA 5FPHA 1ZVJA 3EBPA 2ZYVX 1V8DA 2ZSJA 3AVOA 3GUVA 1ZMTA 3K0HA 5TLSA 1JFTA 3GN1A 2WEKA 4OBWA 4MKXA 3U7FB 4Q93A 2QG6A 1MQAA 1JT2A 4UBKA 4AZTA 7AT1A 3IYLW 3VR2A 1HDZA 4KWTA 3SEAA 1XKLA 1Y4DE 3FYUA 5CA1A 3NBMA 1YVRA 4FWBA 5CW2A 3WYEA 2AOTB 2GVDC 4BIIA 1Z35A 3RT1A 2GYWA 4CYMA 1H5UA 1JKIA 1HPLA 5AW5A 1I80A 3NB0A 4IOKA 3HS3A 5A0FA 4KE6A 2VP0A 2CYBA 4PGHA 3ZNPA 1UFKA 2B8TA 2FXIA 5CBKA 3PFBA 3FPGA 4CM8B 5J5VA 3UMGA 2YJGA 1EVQA 3IKLA 3T9EA 4D02A 1M73E 5BVGA 1OZAA 2EWMA 2EEZA 2I2DA 2QU7A 2BIFA 3U44B 2XXAA 1GQYA 1TZCA 1CY0A 4JFAA 2CMHA 2E4YA 3HA3A 3PDIA 4UJ5A 3ZZNA 1HLPA 1R6TA 4B74A 3QA3E 3WDMA 3F7OA 4G8JA 3S1AB 4OATA 5FWXA 1I30A 2ZIUB 4OD0A 1Z26A 3WDSA 2QMZA 3ECCA 1XDSA 3HLYA 3O3NB 1C8LA 2JJQA 4DQXA 4URWR 3K1AB 3KKQA 5F2KA 1HDGO 3DC7A 1FX0B 3ZCSA 8ADHA 3F7TA 2ZBFA 2AMFA 2YV1A 1D5WA 3T5PA 3AEUA 1QORA 2BFMA 2YFYA 2IX9A 1WJGA 4ZI7B 1F2DA 1KAGA 3PS9A 2G77B 1V71A 4NE2A 1ZSVA 3ESAA 4FOTA 3LNTA 5IJ9A 1W4ZA 2QSUA 2Q5CA 3AU9A 4UNNA 1YVPA 1WDKA 4AURA 2WWGA 3KWFA 4MRSA 1YNOA 3QU9A 3F98A 1CY4A 5EQJB 1GOTA 1TZBA 2VCHA 4X84A 1Q19A 4N18A 3L8EA 3MWEA 4C1NA 2GJAA 1FP2A 1QFMA 1ID8A 5BYKA 1YVDA 5CFPA 4WACA 2ZWAA 4YEDA 4WA8A 1LVUA 1YZTA 3KEOA 2NPFA 4P58A 4AYWA 4AF6A 2FR8C 3B51X 3I9LA 5TMEA 3JQ7B 3L4BA 1MU0A 4PG5A 4EUEA 1LJ8A 4QT0A 1H6DA 1L5FA 3IAS1 3ZY2A 4ZYLA 1LTKA 4LFAB 2JBAA 3ADOA 1JI3A 3QXGA 1XRQA 4F4DA 1E3SA 5A5GA 5M7EA 1K9VF 1VC2A 1ECGA 2P6RA 3SC6A 4CXMA 2Y68A 3M4YA 1R37A 1WUYA 4XYEA 4CM9A 4HYYA 1GT91 4FS8A 2R85A 1SXJA 1NW3A 3DTTA 4WGGA 4Z5XA 5JECA 1QWSA 2ZSFA 4QZVA 5MHTA 5HILA 3KSRA 3A1TA 1TMYA 2XE4A 2OUKA 2QUKA 1N6LA 1BYIA 4NYMQ 5GV7A 1VI5A 5I7HA 2FMUA 2WP8J 1NXOA 4GF5A 5C4MA 1ZIOA 3H4TA 3HBJA 3AO0B 3CNQS 3K9LA 2YJNA 1R5OA 2JJ8A 1KXZA 5J23A 1N9KA 5DSZA 3SS7X 1ZN9A 4JI0B 3AF4A 1UMCB 3UGTA 3BHMA 4Y98A 3RTEA 3WNDA 2VQ3A 4RIEA 1YSCA 5ARCA 4AKEA 1MTOA 1RPAA 4O4IF 4AW9A 2VSQA 5FUVA 1L7RA 3WNZA 5EIBC 4EVIA 1DQSA 4OH1A 3TBHA 4U2KA 5EJIA 5JZMA 4K0RA 4MUAA 5AO9A 3IP3A 2PX2A 3U48A 3FIUA 3BCUA 4XJTA 4OU5A 4H15A 4CDNA 4OSEA 3ZBQA 2YRFA 5DDIP 4LAFA 1PGPA 3SHFA 2BELA 1UZAA 2HSWA 2XOXA 3DMTC 3BFXA 2QR5A 1Z37A 4H18A 4KJZA 2XQJA 4XX0B 3COYA 2Q6LA 4ZCIA 1OYYA 1TAUA 2PQ2A 2XVAA 2JLBA 1PX2A 3HYNA 3MWDA 5AKZA 5KNBA 3O8NA 1YL6A 1XHLA 2R96A 1VE5A 2AR9A 2P2GA 3I52A 3IHLA 3G49A 4J3FA 1QS0A 3NMUF 2PD3A 4D4HA 4JH0A 2RH9B 4IWYA 1W5EA 1ZO8A 5JRZA 3M5DA 2P9ZA 1IPEA 1GGKA 4PFSA 3V97A 3H7IA 2JLQA 4JN6B 2BCGY 2F1OA 3QK7A 3HEMA 1ATZA 1OAKA 1RFLA 5BW4A 2YOFA 1OPXA 1ZD9A 2Q7DA 2CT8A 1LB1B 3ANLA 4ZXPA 1C9MA 2F9FA 1JLLB 3AV0B 3H5VA 3H6KA 3OCUA 4ID3A 4PXSA 4U9UA 4EM6A 4V0MA 1A2KC 2BFAA 4C6TB 4L7QA 1GNQA 4RFLA 2X0DA 1KMQA 1YDHA 1YJCA 2IEDA 2W8ZA 4MA4A 2Q5JA 4IWXA 5LP6B 4V3CA 2EX0A 5K0CA 1NKTA 3TQRA 1YJ5A 2BSXA 4F9TA 1K5DA 2PWYA 3AHHA 1A4XA 3ELDA 1KJ8A 4GDMA 4EBFA 1N2JA 1ONSA 1NNUA 1Q0PA 4D2IA 1QLHA 5GTDA 1NKVA 4K0KB 3DE5X 4I55A 2HYDA 5FORA 3AEXA 3ZWPA 2QTHA 1E0JA 2AG0A 3LUCA 2Q4EA 1E63A 4HLUC 3C7AA 4ML3A 2PWBA 4L78A 2H1OA 1RLTA 4KB5A 1QAOA 2FZKA 4HDRB 1AMUA 1XZNA 1GG8A 1DWOA 3PI6A 4FMPA 4O0MA 4X0EA 1QDUA 1YD7A 2I1LA 2NTNA 3JVUA 2Z3VA 4B4KA 3J81A 1I2MA 1L8AA 1QPGA 2VYND 1LKZA 1NU6A 1AMOA 2ZJOA 3AB7A 4DKXA 1D8TA 4BNIA 3NDIA 2VA8A 4QATA 4BV3A 3TRKA 4BKUA 4ZT4A 1ODFA 2HHJA 3AWIA 1HNNA 1Y8RB 4NYIR 2GH1A 1E8MA 2YJ3A 4P4UA 2Z9BA 1GG2A 2OXFA 1DO2A 2I3ZA 2XYRA 3CNBA 5I01A 1U1CA 4ND8A 1T6ZA 4D9CA 4EECA 2B4AA 1TQHA 5T6BA 3WHPA 3ROXA 3QLVA 3WK5A 4RKQA 1TIPA 3KQVA 3VR3D 2DLCX 2F8SA 5KCMA 2Q5QA 5G4KB 2XKBA 1ZNXA 1EVLA 4FOSA 3T9CA 3LMKA 1KVTA 5AESA 4C0XA 1RLMA 1AU9A 5ALLA 1QV6A 3BM5A 3L7MA 4TWJA 1QG4A 3B13B 3QSYA 2OAEA 4MW4A 4OQMA 2Q4OA 1R66A 3ISJA 3H9CA 2Q41A 3NYQA 2VNSA 4L5CA 1GPAA 4M49A 2AHOA 4UXHA 4PWYA 4IVQA 4ABYA 1VJTA 3MM4A 2Y1GA 1CJUC 2A9QA 1D2AA 2SICE 4MLZA 4V0NA 4R7GA 3BMQA 1PTJC 1A50B 2HJHA 2XTNA 5D6NA 2XCUA 3X1WA 4BQOA 3HVHA 4Q03A 1FXWF 2PBLA 2Q5EA 1MQ9A 3CMCO 4KK3A 1I4LD 3W04A 1VBMA 4FGUA 2ZANA 3U7IA 5IDXA 1XXLA 4PPQA 3ROKA 1GHTA 2IA5A 2A84A 4UDOA 2R68A 5LQSA 1W76A 3NHUA 2IDMA 2ZDHA 3IP1A 3PC3A 1Q17A 5B36A 4AKGA 1FFGA 1BWPA 3KPJA 3PQ4A 2P4HX 4FE3A 1JSXA 1LDNA 1ONBA 1O1YA 2PQ0A 2RHBA 1ZMXA 2I22A 3IUEA 4JP2A 4UAUA 3T0FA 1CNEA 3O91A 3EZ9A 4FCTA 2EYUA 2PK3A 2G7MC 4MDYA 4TN1A 3U4GA 3L8CA 1WF3A 2XZOA 1GGEA 2BH2A 2C7GA 1QIIA 2VYNA 4X3PA 4KR6A 1P60A 5EZQA 1OI2A 4MIOA 1LPSA 4YV1A 4LMBA 1OT5A 2BGTA 2CBXA 3PP8A 4FLMA 4IXMA 4K86A 1SQSA 2ZE5A 3STHA 4RD6A 1I6WA 1U0JA 2D5IA 4EW3A 5EWLA 4R8VA 1MOQA 2LVBA 1PFUA 2QL7A 4FYXA 3QUSA 4IMIB 4FJ1A 3ZE6A 3GNLA 2QLLA 3HFRA 4FN4A 5BUZA 1WY7A 1Z28A 1XVLA 3L9XA 3OZGA 5KI6A 3GFRA 4HVTA 2X0IA 5GGYA 1XYVA 2FMKA 2FZGA 3SLRA 1EAYA 4P54A 2B78A 3BHJA 3DEHA 1ENPA 1U0GA 3U62A 1D4AA 3ZTWA 1CV2A 2CNOA 4DR2B 2VDPB 3EXAA 4G5FA 5JFOA 1H2RS 2UYQA 1UIRA 2Q7OE 4BHTA 2Y1XA 4H3SA 4X00A 2PH7A 3P0EA 1EHYA 2YOGA 2Q3JA 3M8KA 3ICQB 3AG5A 4PAOA 1FDVA 4PQRA 4UNPA 1E3IA 4XQ0A 4L85A 3OKPA 2Z56A 4YQZA 3PC2A 1RIFA 4O2AF 3QKRB 3E8XA 4NZNA 2EEPA 4FJ2A 2CV1A 1N1MA 1HT1E 3KXKA 4TTQA 1MKYA 4PANA 2NSHA 3N6VA 4BYMA 4DJ5X 3QM1A 4MRNA 4EF4A 2IBTA 5KPDA 1OVMA 1Z0SA 3WIVA 3GPIA 4ZEWA 1NLMA 5F5LA 1E1KA 5LP6F 5KSZA 1EBFA 5AICA 1VPLA 2ECOA 1USGA 3T6KA 4MW2A 3VSCA 3P9SA 4DQLA 2YZ7A 2ODWA 3LHSA 5TXGA 1DUSA 3IODA 4NENB 2VPZA 4QKQA 2PVSA 2I2BA 2C3OA 3DBRA 1RLUA 1R0ZA 5H8WA 1WQ3A 2J6BA 1RZUA 1UJCA 1VJRA 2XOKD 4OB6A 1ZM9A 4ENWA 4B3TB 4WH0A 1CQIB 3ETLA 1PAUA 1Z07A 5LN1A 3KSMA 4UCFA 4MHTA 3FZQA 1P81A 4QOGA 4U5QA 3IEVA 1GTMA 3EPPA 5C51B 1QH1A 3HYSA 2A0YA 2CXHA 3GLIB 1OYWA 3H04A 4O6VA 4WN9B 1X7XB 4F86A 4QGAA 3UVEA 4LYDA 2A5JA 1QP0A 3GYBA 2ENWA 1YQEA 3U1BA 2NAFA 3TLGA 3QLTA 2UXDB 1JLSA 3A6EA 2N3ZA 2KWIA 5C81A 7MDHA 3T7JA 4EYQA 3SNHA 1D2HA 2GVZC 1X1TA 2MSDB 2Q0QA 5BMVF 4JSTA 2PA0A 4ZOLB 1A4RA 4MAMA 4MKIA 2NZVG 4H35A 2OCDA 5DNEA 5E0KB 5F5NA 2CLHB 3CZ5A 2YRWA 3DV0A 3WNBA 2C5FA 1JR4A 1T36B 3TR6A 2J6CA 2ISQA 4K1XA 3DP9A 1IZ8A 1GYQA 5FJIA 2AYXA 2Y66A 4PC1A 2XRZA 1C7IA 2IYZA 5D00A 3PXEA 4K9QA 2J0UB 3G8AA 4JR1A 1HLDA 4ZEVA 1ZS9A 4TS3A 1HNWB 2HQRA 1SBIA 2WU1A 5CCDA 4XM0A 2HWUA 1A8HA 2DWPA 2JFUA 4G8CA 2OHHA 1SHLA 3C8UA 2W70A 3LVQE 2AC4A 2BBSA 2O7SA 3LNCA 2R6AA 3WTCA 3I09A 1E1CB 3CG0A 4QHTA 4LXHA 2I3BA 2JZNA 4KW7A 5DTJA 3OU2A 3QPDA 2PSSA 3GFFA 3LG2A 4HMPA 5CJPA 5AI0A 4A0QA 3F6CA 5JCJA 4J1TA 2NO1A 2B61A 4IJQA 4R2HA 2P0EA 3CUVA 2HCTA 2GAJA 4HXEB 2VT6A 5BSKA 3MGAA 4P3XA 3R8FA 2F3RA 4PX5A 1GQSA 4ESVA 2V45A 3D1JA 3LUJA 5ALEA 1NT4A 2V4UA 3ST7A 221PA 2FWMX 1I32A 3BH6A 3CW9A 5CR9A 1XXHE 5JAZA 3TTXA 3GJQA 1ZI6A 5AVYA 3FOFC 1SBTA 2NU9A 5EJ6A 2QNRA 3DMTA 4K9NA 1Z7BA 3B1VA 1BX3A 2E55A 3LDUA 4HZUB 4ZT3A 4YQFA 3W5BA 4UATA 3GFBA 3MB8A 1BROA 1UPBA 3PXDA 2MMCA 2YVKA 1Z2EA 1WV0A 2HV8A 4A2WA 4MVJP 3BWDD 1T0JB 4AM8A 1V26A 3KB6A 2Z2JA 1GFIA 1PV4A 4CKBA 6Q21A 2B2NA 1COWD 2QTRA 4Q4HA 3AQ4A 3FXAA 1R3UA 1P7PA 1LSJA 1PSWA 4G37A 3VR5D 2OP0A 4ND2A 3SHQA 1H1LB 2FZCA 3HI4A 4C4AA 4QLBA 1DKPA 4ZGBA 4Q4JA 1WSAA 3DTYA 1Q95A 4MW9A 1I7SB 1M6YA 1RXIA 5GV8A 1ETUA 3EVBA 4ILKA 4BFLA 1TYZA 3FNBA 2BAGA 3AIKA 1M5UA 4BNTA 2QMYA 4YHHB 2VZEA 1EM8A 3IQWA 5BN1A 5HQ3A 2GASA 3R3ZA 2NADA 1DADA 4KAAA 4EKYA 5FPTA 2IHVA 1TDJA 1BO6A 1PJ3A 1B76A 3GJ5A 1C3LA 1MV5A 2F6RA 4PU0A 4DEXA 1NJGA 2FN4A 2HT6A 2BKAA 2QTZA 4K40A 3TKLA 1BKDR 3JQAB 4F72A 2PS3A 5CB4A 1XEWX 2BRUC 3DEZA 3DKPA 3TSAA 5AI4A 1YBAA 3FTDA 3H2GA 3ORHA 1THTA 3O3CA 2PMCA 3PFHA 2PPLA 3JQDA 2BEUB 2W6CX 4J1NA 4X6LA 3BWEA 5JS2A 4HLUA 5I45A 3ZD6A 2H1LA 3PF8A 3ZDAA 1N6IA 2PSEA 2HA5A 4HFNA 4ZAGA 2HWWA 3QMWA 3V6MA 2FG7C 4MQ4A 3R5KA 4ZKDA 1HURA 4JI7B 1RKUA 1HSOA 1M66A 3OQNA 1KS2A 1BKSB 1Y8QA 1EFCA 3ZE1B 4BEJA 4D57A 2V97A 2H0QA 2FPRA 4O8CA 2R79A 3JQGA 4UU8A 5J1SB 3ZDFA 1J25A 4YGYA 2H59A 4DW8A 4OFXA 1C80A 1WB6A 3GGSA 5BNZA 2F8MA 3KSUA 4HWGA 5ALRA 1HFEL 2MYPA 2Q8QA 1OHHD 4BLWA 3T1HB 4B4OA 1E5LA 1XK7A 3BAZA 3DOJA 4KO1S 3CO0S 2FSHA 5JLAA 2I4RA 1XTKA 1EWVA 3BL6A 3IQZA 5COQA 4B3FX 3CNOA 1AQUA 1EB8A 1TAHA 3ZHRA 2H48A 1X1CA 4BATA 5E6SB 4R1LA 3TIGA 4JVNA 5TF0A 5G3ZA 2NO5A 1H93A 2ZI6A 3LH5A 2B7BA 3O7WA 4O63O 2G04A 1U65A 3DHVA 3E9NA 4FD2A 4XRRA 3E18A 3I04M 4R41A 3VR5A 5JMPA 2XIJA 3ZCUA 2HMVA 1Z4LA 2CDBA 2V59A 3SIWA 2JVJA 2C2HA 2OAQ1 5A5VA 4I50A 4Y2VA 2WSYB 2OESA 5CT6A 3EGCA 1OBVA 4BQIA 1NZFA 3ND6A 1TUBB 3TTWA 1M6NA 1P6XA 4PF1