3FROA

Crystal structure of pyrococcus abyssi glycogen synthase with open and closed conformations
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
439
structure length
439
Chain Sequence
RHMKVLLLGFEFLPVKVGGLAEALTAISEALASLGHEVLVFTPSHGRFQGEEIGKIRVFGEEVQVKVSYEERGNLRIYRIGGGLLDSEDVYGPGWDGLIRKAVTFGRASVLLLNDLLREEPLPDVVHFHDWHTVFAGALIKKYFKIPAVFTIHRLNKSKLPAFYFHEAGLSELAPYPDIDPEHTGGYIADIVTTVSRGYLIDEWGFFRNFEGKITYVFNGIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSWEKSAERYVKAYTGSIDRAFDFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GlgA glycogen synthase
publication title Lyase activity of glycogen synthase: Is an elimination/addition mechanism a possible reaction pathway for retaining glycosyltransferases?
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
total genus 157
structure length 439
sequence length 439
chains with identical sequence B, C
ec nomenclature ec 2.4.1.21: Starch synthase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
A PF08323 Glyco_transf_5 Starch synthase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3froA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3froA01
3E3NA 1GG8A 2XCUA 5DLDA 1JIVA 5TMDA 5BNWA 4RIEA 3VUFA 3AMVA 4EL0A 1JG7A 1M5RA 1NZFA 3MT8A 4N3CA 2XGMA 2PYIA 3T3GA 4WHMA 1C3JA 3G2HA 3EBPA 3L7CA 1XL1A 4AN4A 1C8KA 2JZCA 2ATIA 4YUAA 4GPBA 2XGSA 2SKDA 2IYAA 1XOIA 4CTMA 2QLLA 3CUYA 3IA7A 4MI9A 2X0FA 2PRJA 1L5WA 1PNVA 3VUEA 5ENZA 1GPAA 4PQGA 4BQFA 2Q6VA 2BISA 4WACA 2QN9A 1UQTA 1XKXA 3T3IA 1K06A 3MT7A 2P6PA 3H4IA 4RBNA 1RRVA 3RHZA 3MRXA 1WV1A 4N9WA 4KQ1A 5HXAA 5C1DA 3E3LA 3TAXA 2IEGA 3L7AA 5D01A 4GZ6A 2H1FA 3OT5A 1YA6A 1JEJA 2ACVA 1P4JA 4BQEA 3CUWA 4EJ2A 4L22A 2QN3A 4FZRA 1F0KA 1NOKA 2C9ZA 2XCIA 4X7PA 3G2JA 8GPBA 3DDWA 2QN1A 1Y6FA 1Y8ZA 1IIRA 4RIIA 3CEJA 2QRHA 1LWOA 3S29A 1FU8A 2JJMA 4MHSA 1L5QA 4X6LA 3ZCVA 2PYDA 1PN3A 3NAZA 1L6IA 3OTHA 2AW3A 1P2GA 1XL0A 2GEKA 1WUYA 4KQMA 3MRTA 2F3QA 4AY6A 4N39A 7GPBA 2GPAA 1PSWA 3CUTA 3HBNA 3GPBA 3CEHA 3OY7A 5LQDA 1AXRA 3MTDA 1XC7A 2FETA 4BQIA 4N3BA 1GGNA 2VCHA 4RIHA 2R68A 3MRVA 2PRIA 1L5VA 5IKOA 4M83A 3T5TA 3SYMA 2F3SA 4GYWA 2XA9A 1SXQA 2WTXA 3CEMA 2ZB2A 3D0QA 1F6DA 1P4HA 1L7XA 2F3UA 4EKEA 2AV6A 3L79A 4M60A 4AY5A 3OTIA 2F3PA 3T3EA 1EXVA 3IAAA 3HBMA 5TMEA 4EKYA 1C50A 5IKPA 4XI9A 3MS7A 3D1JA 3CV3A 3G2KA 3L7DA 1NOJA 1BX3A 4NC9A 1PYGA 3H4TA 1WW2A 2BGUA 1LWNA 4MI3A 3BD8A 3PE4A 1C8LA 4F96A 2QN8A 2QRPA 4GYYA 1WW3A 2IW1A 3RSCA 2R66A 3TOVA 2KS6A 4F97A 1FU4A 4EL5A 2VSNA 1WUTA 2IV3A 4CTOA 2OFFA 5DXFA 4CTNA 2G9UA 2F9FA 3NC4A 1QM5A 1FTWA 3WAGA 3BDAA 2ECPA 1V4VA 1NOIA 2HY7A 2G9RA 3O3CA 4G2TA 3D0RA 2VSYA 4KQ2A 4XIFA 5GPBA 1B4DA 3SYRA 4GZ5A 3QKWA 2G9QA 1JIXA 5TVGA 1FC0A 2XA1A 2FFRA 2QZSA 3L7BA 1FTQA 1RZVA 3NB0A 3MTBA 3CX4A 2GPNA 2QN2A 1GPYA 1FA9A 4X7MA 3WC4A 3DZCA 1E1YA 3S0JA 4GZ3A 4MI6A 3UYKA 4MHOA 4NEQA 2R4TA 3MBOA 3L01A 1Z62A 1A8IA 3WADA 1P29A 3ZCSA 4WADA 3ZCRA 1E4OA 3Q3HA 3T3DA 3BCSA 3MTAA 1FTYA 5JTUA 1NVKA 4YI5A 1XV5A 3CUVA 3MQFA 1AHPA 3MS2A 3BD6A 4W6QA 2BFWA 2QRQA 1EM6A 4AMGA 4BFCA 1P2DA 4RELA 1K08A 3HBFA 1QKJA 3COPA 3EBOA 1JG6A 2C4MA 1P2BA 3NP7A 3OKCA 3GUHA 2XMPA 2FF5A 3ZCUA 1YGPA 2GT1A 3Q3IA 2QRGA 3E3OA 1J39A 4YI3A 3NPAA 3VDMA 2G9VA 2AMVA 3C4VA 4RENA 3G2IA 1FU7A 2QNBA 3PE3A 2QN7A 2PQ6A 6GPBA 1KTIA 1RZUA 3BCUA 3S27A 4AMBA 3RSZA 1L5RA 4LDPA 2IYFA 2QLNA 4N3AA 2C1XA 1UZUA 3BD7A 2ACWA 3RT1A 1VGVA 3C48A 4QLBA 1H5UA 1FS4A 4F9FA 3G2LA 1IXYA 3DDSA 1P4GA 2XA2A 3BEOA 2X0DA 4REMA 5JTTA 3G2NA 1NLMA 3S28A 2R60A 3T3HA 1WV0A 2IEIA 4LEIA 1Z8DA 2BGTA 3BCRA 4Z5XA 4HLNA 2QRMA 2GEJA 3NCHA 4FKZA 3MSCA 2H1HA 9GPBA 2X6QA 2O6LA 3TSAA 4M7PA 3ZCTA 2IV7A 3OKPA 5TMBA 2SKEA 3HBJA 3MT9A 1GZ5A 2XGOA 1ABBA 5I45A 2SKCA 1GPBA 4CDRA 2JLBA 3ZCQA 3DD1A 3NP9A 4RIFA 2GJ4A 2IUYA 3T7DA 5D00A 2VCEA 5DU2A 2YJNA 3UYLA 4X7RA 1Z6QA 4RIGA 3MS4A 2C1ZA 2X0EA 2GM9A 1Y6GA 3OKAA 2GPBA 3VDNB 2X6RA 3QHPA 3C4QA 3OY2A 3Q3EA 1O6CA 1Z6PA 3CUUA 1UQUA 1L5SA 2AZDA 1NZDA 4NESA 1HLFA 2R4UA 3S2UA 2QLMA 3OTGA 2ASVA 4MRAA 1JIUA 2VG8A 4MICA 3ZCPA 4HWGA 1GFZA 1SXPA 3FROA
chains in the Genus database with same CATH superfamily
3IJEB 2KPOA 1DP4A 1E5TA 4PRLA 3X1KA 2YYSA 4ETWA 3OOYA 1V6SA 2HTEA 1FMCA 2IUEA 2AZ4A 1T36A 3I5AA 2IZ6A 3NI2A 1YB4A 3OUUA 2Y68A 5EMNA 5FJJA 2FSSA 3TIFA 4ZGBA 4MVCA 1O6ZA 4K9DA 4OB6A 4BNWA 1L4BA 4LRYA 1M5RA 2P8JA 1OYWA 2IYPA 3E4CA 1N8NA 1QIKA 5AKGA 4UU7A 1NNLA 4M7WA 4DV7B 3MINA 1AK9A 1HMPA 3GJ3A 4K3UA 5A6SB 1H4QA 2CF5A 2EATA 3P4XA 2EP8A 2BFEA 3RVLA 2FFAA 5JCZA 4XWWA 1A0OA 3JQDA 3JX9A 4EJFA 1DX4A 1VPLA 4LYFA 1DQZA 2ILVA 4MQ5A 4H6PA 3KWMA 1CVRA 3DEHA 3QXGA 2GF9A 3DAGA 1OZHA 4LJ9A 3LNCA 3I04A 4WBNF 2C5GA 1PTJC 2NV2B 1MAVA 2R8ZA 1HT2E 3G5LA 3S8EA 4BEBA 2POQX 3AVOA 1W35A 2AJDA 4DCPA 1KPGA 3D4IA 4UAGA 3B9QA 4CZ2A 2HU2A 4J0FA 3Q8WA 2CFCA 3ROGA 2OBXA 3ET4A 1MGPA 1NNI1 3ZEAA 3HFGA 3IP9A 4Z6KA 3OZUA 4YK7A 4ZO8A 2YV5A 3EEYA 3UW3A 3DDNA 1G5RA 3I34X 3M5PA 5T4BA 1N1DA 5AVWA 3S2SA 2QP9X 3T3IA 3OP1A 4DLAA 5GWXA 2GPSA 4JQSA 2GJSA 4I55F 1EVIA 1OI2A 5J1TB 4L72A 4KQ1A 4WOKA 4UHEA 4BBZA 5IC6A 5HE8A 3E15A 1D1TA 3INGA 4L5JA 1QS0B 1WPXA 1EUQA 1XTZA 2IITA 2O9JA 2X1MA 4MVYA 1BG6A 1RQPA 2PSDA 1UFOA 2QHXA 3AUSA 3GJ0A 1NR7A 3EVTA 4G8JA 4MH0R 1Z36A 2QZ9A 2Z5VA 3JTMA 3AHEA 5ERGB 1ZUD1 1D6SA 2PIDA 2QX4A 4YIKA 4BVHA 3JPYA 1I6MA 1RCFA 3UB2A 4UAJA 1C8VB 1LZKA 3PHIA 4G41A 1YR9A 2CJWB 3FCAA 4XWAA 2CHUA 2HIMA 3SBOA 1MD9A 3RVOA 4DA4A 2YIVX 1CR0A 5LQMA 3G23A 4NATA 1OV4A 2VAPA 4BFTA 2X3YA 3BH0A 1GHTA 2CW5A 5EHQA 2V6JA 5EKUA 2JLXA 3A6HA 1TF2A 2E6UX 1TAUA 2A9KA 4EQ6A 4U2GA 1PP4A 4DG8A 4AX8A 2O1WA 2B3TA 1N1MA 2VDPB 4XOIA 2PLRA 1YZLA 1DC3A 3U80A 3P19A 1IZ7A 1E1DA 2OAQ1 4GR4A 1Y7IA 3F2VA 2QBYB 4OMFG 5I5EA 2GETA 4OI1A 3USZA 4FX5A 1UT8A 2KYRA 4WDQA 4TLLB 5CCEA 4C7OB 4ENQA 1BW9B 4K9RA 2O52A 4B3XA 4RVFA 2JJMA 1AQNA 4A1OA 1B8PA 1C1XB 1LPNA 3UKJA 1N0UA 2YIJA 2GVZC 2RARA 3OQPA 4JHXA 3EPLA 3DCIA 3TIVA 1OAOC 2A9QA 3GLIB 4P93A 3M1IA 4TTPA 1SUSA 1V9LA 1M66A 4E31A 2B4YA 2XZPA 1NP7A 2HWXA 3LHKA 1VB5A 2OCYC 5A62A 5CCBA 4A4DA 1P2GA 1THMA 2OTCA 3BOSA 3OURA 1XYGA 2UZ3A 3C3YA 2FUNB 1Q95A 1V8BA 4PLGA 3FOFC 2DPHA 2VAWA 5LQSA 2PRSA 1T9GS 3ZHOA 1WXEA 1KK3A 3FJYA 4GSLA 5HUJA 1XZBA 4QOJA 2PBFA 2ZROA 1KEPA 1DAFA 3FFXA 1Q0HA 2X3UA 4E1BA 4ITRC 3Q7IA 2CNWA 3T99A 4B1FA 1Q7BA 3DL0A 4G97A 4QSMA 2I5PO 3TLJA 4F1KA 2IYTA 3JV7A 4I4TB 5FUYA 2AL7A 5SYNA 1QPZA 4J7UA 1KDTA 3FPEA 3THWA 4EIWA 2J08A 2A30A 4LJ8A 1KK0A 2AMLA 2HADA 2HRQA 5IJZA 1T5OA 4RKWA 3TMAA 4ND1A 4JKYA 4P4LA 5DX1A 3FUVA 5LFAA 1AK1A 5AW9A 1W0KA 1Y3IA 4TMKA 5CB8A 1OW3B 1ZIDA 1W96A 3KAPA 4PPNA 4RKFA 4ZAGA 5A3QA 5FDFA 5FL7A 2N42A 2BMVA 1U31A 2VCYA 3WYGA 5KJFA 1DTWA 4C2BA 4GYWA 4PO8A 3U26A 2I1WA 1D4ZA 1KJIA 1XZPA 4M8KA 1Z12A 3PVZA 4RJKA 5CG1A 5JCOC 3PQDA 2QV7A 4QO7A 3EF3A 2ADMA 1L7XA 2HJWA 3H2JA 4KQKA 5LBIA 3GK3A 5AT1A 2Q2QA 1ZEJA 4RHYA 5D84A 3C39A 3QPUA 4RVNA 3G9QA 1DFHA 2QTZA 2EIXA 2ZUDA 3BXZA 3GMSA 1GARA 2D8MA 3KKPA 3QLVC 4CEJB 2C54A 1QFJA 2JGFA 3KJGA 4TL8A 1CVLA 1VKOA 1I30A 1YASA 2H7XA 3V55A 4P3OA 4EGSA 4I5FA 5KSYA 2QMEA 3N76A 5AM3A 4KP7A 1BVYF 1E9VA 2RMKA 1VL8A 3GJ7A 4K9NA 5GZ6A 4B47A 2X77A 1F8FA 1A2KC 1TM7E 1TO1E 5B12A 4RTKA 3R7AA 1PYGA 3H4TA 1E5XA 1G6KA 3AY6A 1QGAA 3K2QA 4AB1A 3LKDA 1LWNA 3KOMA 3HVRA 4RZXA 2DEUA 3KALA 4R1MA 2V7QD 5SZKB 4D46A 4DLYA 1D03A 4F96A 3ETHA 1YMUA 4AZVA 1COWA 1HK7A 4P8RA 1UOEA 1VG0B 3PFKA 2PUAA 1FL9A 4ZCIA 5ICGA 2D7DA 1KAMA 4L6CA 2NXNA 5DMHA 5AFSA 4O63O 2HYDA 1M73E 1P4SA 4RH1A 1WCIB 4MW4A 4E21A 4P82A 3IMFA 3E84A 4UJ3A 4AUMA 1KMCA 3HNPA 5FBLB 1UP7A 4HNAB 13PKA 3K6RA 3T1OA 1Q1NA 4PBTA 4YJ3F 3VVCA 4CMJA 5JXHA 2AN5A 4QARA 2XRZA 4EA8A 2F9FA 1HFEL 5LXTA 4DC9A 3C74A 3IE0A 2QD3A 4ESVA 5CX1A 2RHMA 3CZPA 3K5PA 3RAFC 2DVMA 4NENB 3JYQA 4YLGA 1XU7A 3LBAA 1OWNA 1PUJA 3IEPA 1HKHA 4UDNA 1UMCB 4CEHB 1R74A 2I2AA 3RCBA 2ECPA 3OC0A 4EFDA 5GAJA 5BWMA 3F6RA 1M34E 3TDMA 3OCJA 3ZCXA 2ACKA 3FUXA 3AI7A 3TVTA 4A0GA 3FNEA 3DBVO 1V0JA 3L6CA 3G9ZA 4M1QA 3A4VA 4I4TF 1MZVA 1NL3A 1US8B 2W6CX 4D4LA 3RJ5A 3ZDZB 4AK9A 3SVTA 1BFDA 1NV9A 2FV8A 5EIBC 1R3DA 3QOFA 3RFUA 1QIHA 3ZS8A 5AW4A 4EOGA 3BK1A 2DHEA 4LBYA 3U7IA 4MSUA 1M8GA 2PQ2A 3CVOA 3MOGA 3JWHA 4ML3A 5CU7A 3VTZA 5KYXB 3QBTA 2PSJA 5TVGA 1IN1A 3V8NA 4HNHA 1YB7A 2WUVA 2XA1A 3Q10A 2R47A 3F8TA 1D2AA 2FHSA 1OFIA 3M4XA 2BIFA 4OATA 4S2EA 1W9MA 1ZZEA 5CXUA 2CV0A 5G3ZA 1ZJJA 3VRHA 1HURA 3ME5A 5JFTA 3U7EB 3VSDA 3P26A 3GUZA 1JAYA 4HG2A 1Z4NA 1GCAA 2PBRA 3SLGA 5EHXA 1TTHA 2P1ZA 5D1HA 3RRZA 4WT7A 2COEA 2Y1XA 2IUFA 1IBLB 1ECGA 4X7MA 3IQZA 1RM4A 3OX4A 4LTMA 5EHIA 3RVRA 3RTDA 3FSGD 4A6EA 3EF1A 3KEOA 3RWOA 4B2YA 1WZEA 2F62A 2JGRA 1RHQA 2TMDA 5ECGC 2ZB8A 3K32A 2X9LA 2ZDHA 2J7KA 4YQEA 1IZ8A 4OP2A 2VLIA 2DQ4A 1U0HC 2HX1A 5IKEA 1ZUNB 1P3DA 4B4VA 4YR7A 3FOAA 3HH8A 3NM5A 3SEZA 1XEXA 1GNLA 4MW7A 4KLAA 4NY1A 1U7WA 4DA0A 1VOTA 2E9SA 2BEVB 3O4RA 3TSWA 5JI3E 5LJLA 2Z2JA 1F60A 2BF7A 4MGIR 4OQ4A 4RF4A 4RQBA 5IVDA 3TZCA 4F2PA 1BHSA 1MHPA 1Y9ZA 2R2GA 2JIRA 4JHLA 5DSXA 1QQ7A 3RF7A 1NVKA 5AI4A 3TLGA 5ALEA 1F8GA 1K92A 1MT0A 1X80A 1E2BA 2GZRA 3KEFA 5DBOA 4BZXA 1A82A 2QG4A 2J32A 4W1SA 3P97A 1WL8A 4OXYA 1T2UA 4RHEA 4LJSA 1DRJA 4QXAA 2BFDB 2NZYA 2QYTA 4I1YA 4UHBA 5A0FA 1WW8A 3KO8A 3HYRA 3OQIA 4X54A 5IDWA 1KI1A 4MDEA 3QKSA 1K08A 1RBMA 1ZPDA 4JJ7A 1CR1A 5EEGA 4C22A 3PUYA 1FP4B 5D6OA 4CMGA 1ZD9A 5GZ3A 1QZ3A 4BO7A 3H0EA 2DT5A 2ZYGA 4ZT7A 4R7GA 3WYCA 2ODNA 1ZITA 3JCZA 5E7JA 1CVIA 4JYZA 3DOEA 2P6MA 3GUHA 3OLXA 1KDOA 1L4FA 1LRLA 3PTZA 3KBOA 2OHJA 2OORA 3HJNA 4P53A 3RR2A 4BLWA 3EJ6A 3OPMA 3PXAA 3X0DA 4YP6A 1I5OA 2W00A 2OHFA 1QRSA 4QM6A 1PZHA 2X4LA 5IJAA 1O8BA 1EFRA 1U9CA 3ONVA 1J39A 3PDJA 1PZNA 2IUTA 1QH8B 3OF5A 4WKNA 2DBYA 3L4JA 3KV3O 1Y82A 4FHEA 1Y0BA 5TXGA 2F48A 5JG7A 3G0BA 2HBZA 3BA6A 2B2XA 3FPCA 5H59A 4IEFB 4Q34A 4DC0A 1VMEA 1OWMA 4B32A 1ATIA 1YIOA 1Y3HA 3EISA 3I2IA 2YJZA 4MRSA 1OU4A 4Y1EA 5D6NA 5BN4B 4CLXA 4DFDA 2WYOA 5LIRA 1QJ4A 2J5RA 3G5AA 3LCUA 4RVCA 1TZJA 2BGWA 1I3NA 5ARDA 3AM1A 1CJTC 1T43A 3B2EA 1XRSB 3EZ6A 4YMUA 6GPBA 3M8KA 2J5QA 1RTTA 1JSZA 3BCUA 3PUKA 4BP8A 2RE8A 1T9HA 2TMKA 1RHMA 4HGYA 4KFRA 4MQ4A 3D6MA 2QROA 4ER0A 2I3ZA 2GTPA 1KDRA 2YL2A 4KBYA 3T7IA 2GCNA 1XZMA 2BI8A 3KCQA 4ER6A 5T3YA 2WG0A 1M2VB 1WMFA 2FWMX 2HEIA 2PZJA 2W5UA 4XUEA 3VX3A 2V9PA 3CPSA 2QL5A 1OB2A 1EJBA 4MP3A 3LD9A 4HAIA 4GMKA 2DUMA 1FFXB 1W4ZA 2V54A 4BQRA 1GAWA 1KO7A 3OJOA 4O2AB 5DM60 1IXYA 1KRXA 3AEQA 2R6ZA 2OZEA 5GQSA 5HTOA 2D2IA 3VM6A 3DG9A 3MLEA 1RWVA 4L9RA 1J0XO 3RTCA 3T4PA 3AI3A 3R6WA 4MYHA 5AW7A 5JTTA 4MWEA 1RWKA 3UT5A 2ACEA 4DSTA 2QGZA 1TCCA 3T3HA 1WAMA 2RIRA 4EARA 5HW0A 3FTQA 2KW5A 4L3VA 3N2GB 2BGTA 5LJIA 2O5RA 5AHRA 3K1JA 3FR7A 2XDWA 3DD5A 1UXGA 2OYCA 4LKRA 4C0KA 1BS2A 4HYYA 1SQ6A 4B5KA 1HQCA 4PHHA 2XF8A 2C4WA 2O8VA 4P34A 3V4OA 2JKVA 4JY7A 2HU8A 2D1TA 3GNTA 4HTAA 1VE7A 1QHFA 3AR6A 4L9AA 3AJ8A 4PGFA 1H9BA 2R7AA 3WGQA 1V48A 2WFZA 3HU3A 3B2NA 2QXUA 2QGFA 3UAYA 2Q9UA 5TQVA 3ZCTA 3DZJA 1P1FA 1M6VB 5JAPA 1SUCA 1TQ2A 5HKLA 4D6XA 3TW8A 1KAGA 1T1RA 2ZIXB 3IODA 3KLOA 2D2VA 1OT3A 2XTMA 4HTFB 4QNRA 2W22A 2WRZA 1S9DA 3DAHA 3FJ1A 3HBJA 4K9KA 4V3CA 5AM0A 4DLUA 4GO1A 2F9LA 2FKNA 2ZAOA 4BLPA 3VZRA 5TT0A 1Q2UA 2I8CA 2PL5A 3P94A 3ZGOA 3S2YA 4ASUA 2SKCA 4F12A 2PMBA 2IRWA 1K98A 3IFSA 2XCRB 2PGIA 5KTSA 3OTQA 1FPQA 1GSHA 4U39A 1RCTE 3DV0A 3AXTA 1DC4A 3VBEA 4IQFA 3L6DA 1DXYA 3M5DA 4I81A 4R51A 3T7DA 5M2QA 3CT6A 2P40A 3O75A 3OWHA 1O9HA 4QE3A 4R2WA 3D7LA 5GGYA 4PN3A 2XWQA 4WN9B 4ZAXA 3R8XA 2I7VA 2ZJFA 1SCUB 3OJLA 1ZVVA 3ROFA 2CV1A 2WU8A 3ZZNA 2XRFA 1QGOA 4BGIA 1SKAA 2AXPA 4PZAA 1OCEA 5LP6C 2QD1A 1IG3A 3REGA 4GH5A 1RMQA 4TVKA 5GZ1A 4YJHA 1U9ZA 2WSYB 2GN0A 1ESDA 2D1QA 4PXYA 4EMUA 3L0BA 2WZQA 2F64A 3H84A 2GPBA 2ETXA 3FWKA 3IKJA 5CVTA 1XCPA 2VHXA 3B3AA 3ZNNA 1DO2A 1L9XA 4JBHA 3OY2A 5J40A 1XMXA 3GJ5A 3N75A 3RLFA 2BFMA 4F9EA 1I13A 4R0MA 5IJ9A 1W0KD 4YDSA 2DFDA 3UWMA 2FCRA 5FBHA 5FL7D 3P0IA 2GQ0A 3JAKB 3DEAA 2GOYA 3MJVA 4YRPA 1ZVJA 3ETJA 4F86A 2BCEA 2ASVA 4O2AF 3TTSA 5LKRA 3TGPA 4NP6A 4XM2A 1EUCB 5GJCA 3C4JA 1E4YA 1JEYA 1XZCA 5CDGA 1TZBA 1GFZA 1MF7A 1P7CA 4MR7B 1DEAA 5DTMA 1E1CA 5HBRA 2EW8A 2YWHA 2FG5A 4XXHA 1Z0IA 1B3BA 1UK6A 2GNPA 2IDMA 1M1XB 2YBEA 4GL2A 1R0BA 3BZUA 3F9RA 4WKPA 4C0SA 1X1QA 2VDOB 1TT5B 4ZPXA 1P18A 5DH9A 5E8JA 3D6FA 4ARZA 5C80A 3U31A 2RH8A 4ROTA 1VJTA 1KFEB 4MQMA 4JZKA 4G0PA 4X90A 1HV8A 1U99A 1K5HA 3NT2A 4LG1A 3IBGA 3OD1A 4GRAA 4IHJA 2QQ5A 5J5CA 4I9HA 4CLEA 3I28A 1Q44A 2RC6A 1D2CA 1KC3A 3L07A 4QGHA 1XL1A 2D0PB 5HBGA 2RJ3A 3TZKA 5C7YA 4FC6A 1VGRA 2FWNA 1YC2A 4X61A 5KTRA 1TFRA 1A4XA 1I9CA 2J4DA 3QLTA 4REQB 3PGXA 5LN1A 1ID8A 1VG1A 1DOAA 2NVWA 3MVEA 2R5NA 2SKDA 1YULA 3LP5A 4LY6A 4YCCA 3ADCA 1Y1RA 5FBRB 2IYAA 1ISRA 1PZEA 3LY7A 2H3HA 4D0SA 4DRXA 3JRWA 5JROA 2EDAA 4CM3A 1USWA 1V8FA 3DCJA 1ZGBA 4F93B 4J75A 3AY3A 5JE8A 3BHIA 3S2FA 3SWWA 1M72A 3AHFA 4WCFB 3OTWA 4NE2A 4TUYB 4O4LA 3TRFA 4GOOD 4OJQA 1XEWY 2YJ3A 5FO1A 1E2HA 2GD1O 4E4TA 1S0UA 4PQGA 1JAIA 3VH1A 4D9CA 2YHIB 1T3HA 5KX5A 2DR0A 1CPYA 3OEHD 1PTJA 4Q7QA 2XXAB 1V11A 1R18A 4LQLA 5HR5A 4BUJA 1IHDA 2ZBUA 2VUSA 3BDVA 4TWRA 3WR5A 3FTNA 5F4BA 4GC9A 1GV1A 5HZMA 3UY4A 3KSRA 3AEUA 5FI3A 1S2DA 4J9VA 3NUGA 4ENUA 1KBOA 3JQ7A 1PV1A 1WEKA 3LF1A 3PRKE 2A57A 4IGAA 1P60A 1PW7A 1E2NA 1K97A 5CT9A 1U0EA 2FWBA 1O96B 2QPAA 4B7XA 5KZMB 3RO7A 1P4AA 4EHLA 2PUTA 1KQFA 1L4UA 4GMXA 3F47A 1YDHA 3SAJA 1EX6A 4MRMB 4NJMB 4DQDA 1KBQA 1ZN9A 2CVQA 3F5DA 3PQ5A 1X38A 2P9EA 3DTYA 2K2WA 1OZGA 1ZH8A 3O8QA 4S0ZA 3TZQA 2Q5HA 3ZD6A 2WAOA 1J9GA 3G2JA 1RQXA 3KVYA 2YMQA 3C7KA 4XTRA 5H16A 3LDGA 1ZU4A 2M1ZA 2P9HA 2WD7A 4V2UA 4R2HA 4NNJA 1EBFA 5K2OA 4AM8A 2BEJA 1SB8A 2JANA 2XGGA 5FBZA 1FU8A 3QJ5A 4R8LA 2FGJA 2FEXA 3CLUC 5TMPA 4KMMA 3O1IC 1OI3A 1A97A 4Z1MA 3RRFA 4DIUA 3EZFA 4TQ9A 1FZQA 3D54D 3AR5A 4AQYB 2PYDA 3HDVA 4XVQA 2AQIA 3LY8A 1T1IA 2OGZA 1KJNA 3BIJA 3EDCA 4KXYA 4MB6A 3SJUA 2GEKA 4PQFA 3PL5A 4JL6A 1D9XA 3BQMB 4FUTA 4G0NA 1IG0A 3RUIA 5K6RA 3K6SB 4PAQA 3EG9B 1U8XX 1UPBA 3DW3X 3SIXA 1AUQA 2REQA 1CZKA 1KS9A 1K9VF 1QOQB 4RGQA 4BO0A 5KJ1A 1M2OB 2VWGA 3CH4B 1IOLA 1NJFA 2YVUA 5A9TA 3BQNB 3RRYA 2PUCA 1G5HA 1OAOA 2PZKA 4H1TA 3ZNOA 4D9JA 5G0SA 2QQEA 1IQPA 2X0RA 3D6HA 4FI3C 3TIGA 1ISIA 3ZW7A 5DI3B 3EDOA 3LZDA 5FWXA 5HFAA 1AV7A 1UKCA 4BCDA 5LYJB 5A4IS 2X8AA 4OO3A 1VDMA 2GZSA 4ZTBA 1MEJA 3A05A 5DULA 5HIKA 1M6WA 5E3JA 1H6CA 2I6GA 2MIIA 4RM2A 3T94A 3AWDA 2IGTA 3ENWA 2PRIA 3JVDA 4UHDA 1XU9A 1R00A 1RWBA 3TLKA 3DHNA 2AR7A 1XP8A 2JFNA 4QREA 2O2ZA 1EAMA 2GN2A 2HRBA 2VAMA 4W6ZA 3IERA 1DBVO 4D9HA 1F20A 3RQIA 1U7TA 1TYBE 1Y3DE 3D0QA 4MQLA 2ODPA 2BJVA 1E79A 4NHEA 4NABA 5CYFA 3HABA 3TCNA 2YFHA 5IPFA 4NQZA 2B8JA 4RF3A 1Y1LA 1EHYA 2GBLA 2XE4A 1EFRD 3KYCA 1Q0SA 2Q6KA 3EQ8A 4IMJB 3SDSA 3UUEA 1Z33A 4Z51A 2F3PA 4YRJA 2HNBA 2QRZA 2RAVA 5E6RA 1EP9A 2ATEA 3STWA 4WK6A 5J4YA 3BBLA 2ECQA 1UF9A 3QW2A 2OBYA 4W5TA 4CW7A 2XCLA 4YCSA 5HM6A 4ZEWA 4BLSA 3F6YA 4U8HA 1NYLA 1ZL2A 3M6WA 3UENA 2HJHA 2N1BA 2W2LA 5F76A 1O03A 5FWAA 2UVQA 4E2FA 1O6FA 4YJKA 3DT9A 4N0MA 1A7KA 3DC2A 5ERXA 2ODBA 2VK2A 4OUDA 5A3VA 4YMVA 1QHXA 3HSYA 1O0CA 2I22A 1VKHA 1ZIXA 1R4NA 2ZVDA 1XEAA 2VT6A 2W2OA 4RF5A 3QLVA 4LFBB 3A9RA 5F51A 3WDSA 4RYDA 3O8RA 1NW3A 3HADA 1ZJZA 2QGNA 5FO0A 1H8HA 1PEDA 4NCKA 1J1UA 4BV9A 3R9XA 4D0GA 2VP6A 4J76A 1VA5A 2XDAA 3TD9A 4QSHA 4ZI5A 5HIMA 1XDSA 4KEAA 4E33A 3NM4A 1FVHA 3FPGA 4MGKR 5DGXA 4G23A 5LB2A 2WQ6A 1OLXA 3VNUA 3FOEC 3HJTA 1I0IA 2G4CA 1E8NA 3LW8A 2X7JA 5DTRA 2GF2A 3SFVA 3VTKA 2FSGA 4I8DA 4XVCA 4JFAA 2JJ1A 4GU5A 1SXJB 2C2GA 2GKSA 1QLJA 5AVKA 4JQZA 3IQIX 4JZYA 1TT7A 3VGJA 1RI5A 1GTVA 3T7RA 1EG7A 1MABB 4H31A 1VCOA 3LQ2A 4BFZA 2HHJA 1E62A 5JNUA 1HTBA 3DMTC 5FAXA 1QBGA 2N0SA 3L02A 5SZHB 2XQGA 1QLHA 4ZOEA 1UC8A 2DHRA 2I55A 2VJPA 3H11B 3STXA 3VA7A 4YP9A 3VR6A 4JYMA 1CDDA 2GRJA 4HNSA 4O8ZA 4HSGA 5CA0A 2JJ2A 1GQSA 3QVLA 4DKXA 1JHXA 3M5WA 3IMGA 2JD0A 4D5GA 4CIYA 2PCLA 4RORA 2IEYA 4QVIA 3OQVA 3QXJA 1CIJA 5DV9A 1JDBC 1F2UA 3QEMB 4KQ2A 1IVYA 1MX5A 4OFBA 2HC9A 4LSGA 4NIMA 3N87A 5AK6A 5C8XA 5LYJF 5FUBA 2WJGA 2O3QA 2YFKA 2ZUBA 3AFMA 1JGTA 3HVHA 1YAHA 2I2DA 3U9SA 4EHDA 3K9GA 4D0RA 1X87A 2W6IA 3PX7A 3FRHA 3VNQA 1YR8A 1DIBA 3F96A 3KT6A 4Q93A 3HEAA 4F5EA 4I9GA 4OL0A 2XEDA 3IHLA 1RM3A 1JLRA 1SIOA 4F9TA 3D6VA 2WV7A 1U0OC 3DE5X 5IXJA 2FLWA 5HMMA 3GRAA 3QU7A 4QWWA 3J81k 4XIJA 5HOEA 1OX6A 1VKJA 1KVTA 3FDJA 4P4NA 2GPNA 4U5QA 3W8EA 5GV7A 1V8PA 4RTOA 4DVGA 3B7GA 4DJTA 1PJBA 3DZCA 4U7HA 1RAFA 3ZXYA 4Q3BA 3NEAA 1F3OA 2X19A 2XVMA 2Y1KA 2ZSAA 3DVLA 3HB5X 3FH0A 3K4PA 3O4GA 3KKOA 4L4YA 3ROQA 4KITB 4PV7A 2QSJA 4IDPA 1WETA 2EEPA 3RTBA 1SJ9A 3RBAA 2QQ0A 3EPHA 1C0IA 1R0SA 4GXTA 4MKHA 1U1GA 2FPIB 5TS2A 4ZJYA 5BQ3A 5A02A 1T4MA 3MBOA 2ZVJA 4N8SA 3V2UA 2WIBA 2H4ZA 3AM4A 2B83A 3EDQA 1YBMA 2P69A 1NU8A 3OQOA 3MCUA 1CRPA 1C1HA 4G1CA 4TL9A 1ZK3A 3NBFA 4UW9A 3JQ6A 1D1SA 2DKNA 1TYAE 1Z7YA 1L4GA 4OSOA 4KE8A 1DEXA 4AC9A 3GPIA 1BMFA 3B85A 3UT0A 4Q3EA 3QPDA 2VTDA 4KXXA 3HTXA 3U3JA 4BU1A 1YB2A 1M33A 4CM5A 1AHPA 1FMLA 2DTDA 3TNYA 4UCWA 3IUMA 1KO8A 3ZZUA 4YUZA 4PIPA 2RH5A 3AESA 4DNXA 3LBIA 3H5WA 1W5FA 3ZS9A 4B35A 3PJEA 4RELA 1U80A 1XTQA 5MFZA 3K2IA 3HBFA 3NFRA 1VFPA 2CLKB 1KEKA 4ZVUA 1JG6A 4J43A 4Y1RB 2ZT5A 2HK7A 2F3TA 2X4DA 1X2EA 3EFEA 3ET5A 4QOIA 5J2UA 4GICA 1BAPA 4H3HB 4W7IA 5HJ5A 3GFVA 3GY0A 5A9SB 5JVDA 2D0DA 4O1HA 3Q3IA 3QUTA 2VZ8A 3QYAA 1E9AA 3I53A 4JQYA 3R7WB 2PE5A 3BHMA 1NE2A 3SX4A 1DTSA 3FX2A 2YVKA 3ZLBA 4G63A 4EB0A 2ZDGA 2VJMA 3A6JA 2NXJA 3KDSE 4GWLA 5CNIA 5ALQA 1DTEA 3A1FA 4ZT2A 4ZYUA 4HWOA 4Y8VA 4EYOA 4AVYA 1ZFNA 3D8UA 2F1HA 4I9FA 5DWDA 4ZPJA 1OTYA 1GZ7A 3EY9A 1CUFA 2MCFA 5JARA 1AS2A 5CIQA 1SCDA 1ADBA 2Q3FA 5AD1A 4N8EA 2QN7A 2P9QA 2HWKA 2QL7A 3HR4A 1RZUA 3LX5A 4KFSA 1SULA 4V02A 4K0KB 2C78A 3MUFA 5IVKA 4N5LA 3LBFA 1V5WA 2C94A 1U8ZA 1E9FA 3K0EA 3RVJA 3W4JA 3NHRA 2W6JD 3NWPA 4BNTA 5ER9A 1J2UA 3IEKA 5F23A 1X86B 3FUUA 3MMSA 4HWTA 1AF7A 1A77A 1VMKA 1QG6A 2P2NA 5GGXA 3E6AA 2H5LA 2I6TA 2NNLD 3H16A 5K4HA 4LPKA 2DPGA 1VL2A 2D1FA 5AI0A 1SWWA 2W2XA 4JC4A 4IQ4A 1RI4A 1S7CA 3A4TA 1QG0A 2NU7B 4MW0A 2FSIA 2AJTA 4GBGA 2YWDA 1LSOA 2IYQA 1OWPA 4LHXA 1P2VA 1BWSA 1F8YA 2GBFA 4FDTA 4PLZA 3ESBA 5DHPA 3WKBA 1LI5A 2BKVA 3ETDA 4MZXA 2HK6A 2OK8A 3OPQA 1WOMA 3QA3E 3ASVA 5LQRA 2ZANA 4LRXA 3VDXA 5H02A 2GN6A 2IPLA 3R7DA 1S8NA 2DPLA 4ANFA 5C35A 3HK2A 2XLCA 3FWPA 5K8LA 1I8TA 1F9AA 5I47A 4MJXA 4CM4A 5IT0A 3G6KA 3GJYA 2ZJZA 4Q3LA 4C03A 5BV8A 4K2AA 4OHWA 4QYIA 2A0WA 2WMNB 2RK4A 4IOLA 4ZYZA 1X74A 4NSNA 1MENA 1JXMA 5KTPA 4AP5A 3ZQJA 3MTGA 5C5CA 5TQ2A 4RPJA 4D42A 1KHHA 4CRWB 1FYDA 5H9WA 3SR0A 6CHYA 3JTEA 5KNDD 1RKUA 1C0EA 3O3MB 3QE0A 4O08A 2Z8YA 2VJDA 1EH5A 4DV1B 1E2DA 1H6BA 1J56A 3VSBA 1G3UA 2WPNA 1H66A 5HE9A 5JAUA 1NC3A 1VA4A 1XRNA 3OCXA 1Y8QA 2R8OA 1KYTA 1X7ZB 2MSLA 2OSBA 4AWAA 1W4BA 1KPHA 2Q3MA 4XSGA 3CZCA 4EK9A 2Q1UA 1GAEO 4A2PA 1TYCA 3VR5H 2P5YA 2CHGA 3OQ6A 3GJXC 4Z1MD 5CLJA 3T06B 4H7FA 4HCJA 2JBAB 1AKUA 2FZCA 2JGAA 3LHIA 4QBFA 3QVXA 4UOQA 3R24A 3QJGA 4AN1A 2OHIA 3BM5A 4KZPA 2PVCA 1K4MA 2HIHA 4X8LA 3ST7A 5FD8A 5B1HA 1JA9A 4GRDA 4DJ5X 3PQ3A 4X7RA 1ZO8A 2JEOA 1Y4ZA 3MBIA 3N0VA 3T8YA 4C88A 2J9FB 3Q5GA 4Z0TA 5IWAB 5CJPA 1UBJS 3MWKA 4IJVA 4TSFA 3SC6A 5BSWA 1Y5RA 1YR6A 2P27A 2BF4A 3H2ZA 4IHAA 3SE7A 2DBRA 4D82A 4FDLA 4DJDC 3VOBA 4CIVA 2O1EA 5HEKA 5GM1A 2CYAA 5IUNC 1Z0KA 5KTNA 2OKGA 4S2UA 3SHFA 3FNRA 4M54A 2YJGA 1LQ2A 2YASA 4G9GA 2ZLBA 2ZCJA 3L1UA 3PIRA 4K9OA 4ZAZA 3BWCA 3F7TA 3RK1A 4O02B 1XZKA 1RPTA 1CBUA 4G67A 4P4GA 1RKXA 3RJZA 5LP6A 4M49A 2IL1A 4CODB 2NV0A 2GVNA 4OIMA 3VGPA 4YLYA 3D3JA 3P2YA 5AVVA 5LUBA 3LW7A 2J8ZA 4Z2AA 4PINA 1E79D 4MICA 4V0KA 4I1IA 4LV6A 4E5UA 1JFFA 3FDFA 3M9XA 2OFWA 3IEUA 3T5AA 5SV2A 2XBMA 2R84A 1R64A 3EN0A 3QE4A 4XVHA 2H54A 1JJVA 5FPYA 2AOTA 4JWTA 2YC4C 4R2JA 4NR0A 2BVNA 4RIEA 1OYVA 5IARA 1NXWA 1I3OA 3UK7A 5KNCH 2GDJA 2ECFA 3FZNA 2Q5JA 3HKCA 1MRSA 1PWYE 5C5DA 4ZCSA 1PCXA 4D81A 2XOEA 4AKTA 4EL0A 2WF7A 3CLSC 3I9KA 3FUCA 4JOBA 5IP5A 3MERA 3R6TA 5K9ZA 2GO1A 2QG9A 3AGPA 3VC1A 1RCUA 3M81A 3O8OB 4X44A 1KOGA 3OKFA 1KNQA 4B4DA 5KWVA 1RWWA 4CDNA 3AR9A 3P4YA 4WHMA 2PXHA 3K0AB 2A14A 4P7FA 5DLPA 1C3JA 5ITZB 5KYWA 3EFHA 2JCGA 2P9ZA 3PC8C 4KIFA 5H3HA 1RXUA 1GGHA 5EKTA 5EJ6A 3GGSA 1Y8AA 4PSUA 2ENWA 4F6LA 4IHQA 1OLSA 2ODEA 5I7AA 1MJGA 1P75A 4IDOA 3I3SR 1LX6A 1GPDG 2RHRA 10MHA 2FH5B 1A9SA 1TM1E 2R79A 4JQCA 5L3SB 3W3AA 1XOIA 2JKZA 4MLDA 5DYNA 1WKCA 2ZAIA 3SXUA 4CM1A 3HA2A 5K20A 2RGUA 3AIOA 3HYCA 4IWYA 1POXA 1CQIB 2Z2YA 1V6CA 2EERA 4PZUA 4I6JA 1CDZA 5BSMA 1ZCBA 3WIUA 2OYSA 1U1CA 1VJCA 2FEAA 1JZTA 2J4CA 2QR3A 5ENZA 4B5LA 3R3YA 3UBTA 3FTPA 1Y81A 4PG4A 4OU4A 4GKKB 5E6SB 3JYLA 5DI9A 3OEED 3M9LA 5MN4A 1KMHB 5JRDS 1R4ZA 4YT4A 3JQFC 2QW8A 5C0OE 4ZVMA 1QR6A 2OWEA 1A4UA 2HMWA 4N9WA 2YQ4A 2JW5A 1JIQA 4Y0AA 2Y76A 1DIAA 1N0IA 1HDOA 1N2CE 2IT1A 2PX6A 3CFYA 3P2IA 1KEUA 2JNWA 2IPAB 3P9NA 3PRJA 2ZR9A 5H70A 1XMPA 3BWBA 1JKMA 2IEGA 3GGDA 2FQYA 4M37A 5EPEA 3Q5DA 1QH1B 4R0NA 2SNIE 4KXLA 5IVIA 3AFNA 3OU6A 5KVQA 4A2WA 5B7NA 4I8IA 1FSZA 2GWRA 2XB8A 4CIXA 5ICSA 3ROPA 2JZNA 1KZ9A 1YO6A 2IIPA 2P3SA 2Q21A 1PYOA 1PGJA 3QKIA 5BR7A 3IPCA 4LCBA 4MWOA 5K0TA 5I7HA 1X0XA 1IQ0A 7ABPA 1Z2AA 4G24A 3DWGA 4L22A 5E3IA 4F45A 1AO3A 1HDZA 2QN3A 4QIHA 5EIBD 3TUIC 1GG2A 1M1YB 3MGKA 4NCAA 5DNEA 1E99A 3SFTA 1KI3A 4FMCB 3O90A 1CUXA 3C6QA 1SHUX 1ISFA 4U4AA 5AM1A 3TVYA 2C20A 2K6GA 1QZUA 2WG1A 3DV2A 3K2EA 4BVKA 5JJIA 3CEJA 1MV8A 3ADDA 1E3WB 2ZJ2A 4KWTA 1WBBA 3AUAA 5TEWA 2HMVA 4HDOB 2WT4A 3R0VA 2Q5EA 4MS1A 5KYVA 4N48A 3ADOA 1BC5A 3TD2A 3ZCVA 4BMPB 3JQGB 3SKXA 5K8JB 2X9NA 1VJDA 1R2QA 2BV3A 4N7BA 5CXSA 5TDHA 5AVTA 4P4SB 4A0FA 4K03A 4TTVA 4WNIA 4POOA 4U9IS 3ZKWB 2PUEA 1T24A 4D9MA 4QXOA 3N2IA 3UAXA 4BJ6A 4EMTA 2H5EA 4AS3A 5JQGF 1P1RA 2OXCA 4M9XA 3KOXA 2IHNA 1OKKA 1WDWB 3O7WA 3ON5A 3ENVA 3P2MA 1BJRE 2KLHA 2N9UA 3KDPA 2C57A 4MVJD 3CIOA 4G1VA 3SN6A 4MVJH 1PQWA 3IVMA 3RYHA 4JJKA 1M9NA 3EXEA 3TPFA 1NTOA 4PG8A 2QTHA 2Y4OA 2VJOA 2YV1A 2F90A 4FWIB 1DC7A 4NF2A 1RE1A 3IPAA 3L0ZA 4ZRMA 2WU1A 5IAKA 4PYNA 4A82A 3N3AC 3NDRA 3IBCA 3OZBA 4LOHA 5KC8A 2ID4A 2ZYDA 3D4BA 4RJJA 3L5KA 3ZGLA 4ZDKA 4NU6A 1XVUA 3D59A 1Y8RA 2ZYUX 3OT4A 1GL7A 4HDRB 4GNKA 3ENNA 3E9DA 2GAJA 2I1QA 5ULLA 2KLBA 4ZOBA 5JCJA 5ADVA 1DWQA 2FMUA 1XDUA 2PX3A 2R2AA 1PWHA 2XB9A 3GRRA 3SNKA 3LQ1A 5CA1B 3ODGA 5BSTA 2GBPA 4CQNA 5CD9A 1E6WA 4M0UA 2WE8A 3WI7A 3B8HA 1JHDA 2E82A 2J87A 4TS3A 1HETA 2J9RA 4KGVA 2R3SA 2V7GA 1IAQA 4XPIB 2JS7A 1M10A 1YGYA 3V1TC 4CLOA 4QTZA 3WWEA 3WV4A 4N0PA 4QECA 3ICQB 3IVXA 3T3MB 4B3BA 1AB6A 1NW4A 4Q39A 4RADA 1K4YA 4YFYA 2B1QA 3M0EA 3K9BA 3O2QB 1VG8A 3LWDA 4D56A 5K8VA 3LX4A 2BCJQ 3HBMA 3MUOA 4HB2A 4EKYA 5CBPB 2XTAA 1D6JA 3LXXA 5IKPA 1V7QA 3PFHA 1E4EA 2GB4A 4DQLA 2ZBVA 2DPYA 1QRRA 2G7ZA 1U65A 2AZTA 4NHOA 4QAQA 3RYFB 2E4UA 1UBCA 1YU9A 2FZVA 2VAVA 2P6NA 3FPBA 3IPLA 4I1SA 4LDQA 5L7WA 1WB9A 1O58A 4UDYX 5AOCA 4YBRA 1T13A 4Q1VA 1CYDA 4FYXA 2VNAA 3DF7A 1C0PA 2GZ3A 4FMCF 1LRKA 4EZBA 2W4QA 3G9XA 4Q4AA 1A9ZA 2NMVA 3TXYA 2ZTMA 4XEUA 5DWVA 4FCTA 3AERB 1CCWA 1I4TD 2XQKA 1E1RD 4Q6BA 2CLDX 1QDEA 3NXKA 2WKPA 4LJYA 4US0R 5ERYA 2O59A 1Z4IA 3U7FB 4BLTA 1VYHA 3W5DA 3QTLA 1IM2A 2I1LA 3ADPA 1W2WB 2XX3A 5L7TA 4QG3A 4AKIA 4IIJB 3FY4A 2G63A 4I99A 2PIAA 3VPSA 3S70A 3SMQA 1DT3A 1KIFA 5EJIA 3WAGA 2BMWA 2NU8B 1JU9A 4LJLA 4PFKA 2PLNA 3CNOA 5I9NA 4FFLA 2VJLA 4FD2A 3I64A 3LA8A 1EFTA 3DHWC 3KYDA 4LV5B 4RWEA 1RHKA 2KM1A 2A33A 1MO6A 1A5SB 4ER5A 5F5LA 1EPUA 5FNVB 3T95A 2VDLB 5F2NA 2PG3A 4J2HA 4TXHA 3H1TA 1YRLA 3W90A 2JLZA 1EFUA 2CNOA 2J67A 2VJQA 1GU7A 1IUOA 1ES9A 3CW2A 3FA2A 3ZQUA 4LF6B 3QKUA 1E7MA 2PMDA 2CL7X 3ECAA 1FW8A 3WHPA 2NO0A 3RS5A 4W8OA 1Y7LA 2IYZA 2FFRA 1OBCA 3HA5A 3QE9Y 2A1UB 4OTZA 3SK0A 5LZ2A 3EULA 3KPUA 1UBFA 2XADA 3T5MA 4FKBA 2Q7OE 1IOVA 1CT9A 1TGYA 2PXAA 3CLHA 4MW6A 2E4YA 3LG2A 4XB2A 4XJTA 4D97A 1LU9A 2GEDA 4L5IA 1SO8A 1A9XB 3GJ8A 4H0CA 2DWCA 3WHIA 1SM4A 1ISJA 3FE2A 3WLLA 4F4FA 5AI6A 4BX0A 2WK1A 1B00A 4GPD1 1U9YA 2IYOA 5C8YB 4DB4A 1I2CA 2RDMA 5CH5A 2QUKA 4KKXB 2C8VA 3PD7A 4PQRA 4QYWA 3NBYC 2Y1EA 2OBNA 4R71A 4HDAA 5KS2A 2X0JA 3JPWA 3SJ7A 2OG1A 2CJXA 3AL2A 4GOMD 5E1MA 1K6MA 4NLLA 4CWAA 3DDHA 1A8IA 3OOSA 3EASA 1OY1A 3PFWO 5AW3A 2NLOA 1IC6A 3U7RA 3JYNA 3DAFA 3EVEA 5HF6A 5HRCA 1RLJA 2H1RA 5IXYA 4O1MA 1EJ0A 4BHTA 2OO5C 4QGFA 1KAOA 5E2BA 5HA5A 4UBIA 5C7IO 3L9WA 4L8YA 2Q6LA 2FNAA 3RHSA 4OXIA 2HA4A 3MLBA 5JTUA 1TA9A 3SJCA 4LC1A 4BYGA 1ZC3A 2PSSA 3PZRA 5K3BA 1T3GA 1ZONA 5FTLA 1DUSA 5L8VA 3BORA 4L76A 4LHZA 2WTBA 1XZNA 3OFND 1KWKA 1E3QA 4LXUA 3VSEA 3T3NA 1G9TA 1GJRA 3OUTA 1DAIA 4GEKA 4R40A 1P5ZB 2VHQA 4YV2A 3PRHA 2QRQA 1SNYA 4BN4A 4IIJF 4IMPA 2VDWB 3AEZA 4RY0A 1F06A 1OD6A 2ZT8A 4YAFA 3PSHA 5EZYA 5I01A 1VL5A 2F8SA 3NHMA 4EA9A 1MN6A 4L4UA 4XUGB 2OHOA 4A6XA 1YZYA 3CZ9A 3ER8A 4R9SA 3KQWA 4B6FA 4DT1B 3CVVA 1Y9DA 2IUUA 2FF5A 5EHGA 1IONA 4MQBA 1ZX1A 2E18A 3QITA 4HDMB 1G8PA 3SI7A 2IBTA 2HXYA 5EVCA 1RPNA 1KKMA 1Z2EA 2HFKA 4BMDA 1QVAA 2NO7A 2AKEA 1HG0A 1ZGGA 2NU9B 1TVEA 4X97A 2MYUA 1XSEA 4TV9A 2I6XA 3T15A 1GYRA 1PL0A 3UWKA 2ATCA 1EM8A 3E0QA 3KXIA 4C2AA 2ZWIA 3KBBA 3IT1A 2HXSA 2FDXA 3FSJX 3QWIA 4IFIA 3V4ZA 4M1ZA 1FLDA 5I7VA 1X19A 5C8DA 5EZSA 3HCRA 1SBIA 6REQB 4H08A 4OA5A 4G07A 3EXG1 8ABPA 3LT0A 2I0FA 3G2IA 5JD3A 3ODPA 3STHA 4G9EA 4GD3Q 3HY4A 4UMEA 2JC3A 3TOZA 1DJNA 2PQ6A 1H2HA 4QU0A 3W3AD 2IH4A 4DB2A 1QE0A 2R1ZA 2VC2B 3O1HB 2P9BA 3RWBA 1NJ8A 4TKUA 1I7QB 3N2NA 1Q74A 3EDYA 1SOVA 3OIGA 4F4UA 2C2KA 2C99A 1AIPA 4ECEA 5LU9A 4CKZA 2C1XA 2B8NA 3B78A 4IIDA 3EXHA 1UL1X 1XF1A 2VNIA 4E51A 2GEBA 1SFRA 4ZYTA 1TEZA 1IIBA 3WMWA 4RH3A 1NG9A 2W2MA 1ZJWA 1BX0A 3KPJA 4WSOA 3RUEA 2QD2A 4XJXA 5AH0A 4BECA 1CIVA 3ZJVA 2B35A 3L7KA 1UDAA 4W9MC 2WE7A 4BX3A 1YB6A 1IBRA 2NUAB 5K03A 2FW6A 3R77A 2F55A 5ALMA 3LGXA 1X15A 2NTJA 2GFIA 4NCNA 1HLGA 2AQHA 3E82A 4REMA 3UJBA 3DC7A 5TX7A 1ZS9A 3Q3GE 4G8BA 2B0JA 5FBVB 4C6SA 1BH6A 2Q4BA 2PV7A 1H2BA 1KEEA 1M6YA 1EDOA 1HSZA 1QGDA 1T3SA 1UZMA 2FFJA 2ZIZA 1K3UB 3EIUA 3K30A 3ORSA 4FILA 1HFJA 2EJBA 3BCRA 5A2GA 3LQKA 4YRLA 1QGZA 1GOTA 3FIJA 1Q20A 2AKYA 3ISVA 4GEGA 4QASA 1C1DA 4O3MA 1TQ4A 2IDJA 3T3PB 1DOHA 2H1HA 4NMMA 3O91A 3KYBA 2XCTB 1IN7A 5AJUA 5DNDA 1JKXA 3GH3A 2R8BA 5SYAA 3GVIA 2IP1A 3HO1A 2V1UA 2HRZA 3KHUA 2BHRA 4HNTA 3QXCA 4MR8B 5ALUA 1RWMA 1Z2NX 2WPDD 3WMFA 4LSZA 4Q7MB 2WMYA 4E08A 4HNVA 1QKKA 3VPAA 4X45A 2EZ4A 2IU6A 1NR5A 3HM2A 4K1LA 2RAUA 1A72A 4HBZA 5JBQA 4K6GA 1LPBB 1DNPA 1QK4A 4FFBB 4DJFC 3FG9A 4KN9S 3GI1A 3B9PA 3R6DA 4A8JB 3TTTA 5L4SA 5I45A 3E22A 4O0MA 2LNDA 2WINI 3A9VA 2XT0A 1AGPA 2DAPA 3IHKA 1XDDA 4MAFA 1XVIA 4ER3A 1NVWQ 4IJMA 3UC9A 1CQJB 3EIXA 121PA 1U1DA 1LPAB 3R0QA 3N58A 4GBED 3RREA 3OZGA 3T0GA 5BRAA 1SBTA 1J7JA 1HDXA 3BFPA 3Q2IA 2OBFA 2X13A 2GAIA 3HCNA 2ERXA 2OA0A 2ZI3A 4NBKA 2ABWA 3ABQB 1SA0B 1JE0A 1JKJA 2AT1A 5KMGA 4FW8A 4M0EA 3G1UA 4R5MA 3O26A 3R7NA 5FWNA 3MS4A 2HK8A 4TMTA 2I7XA 1XYVA 1RLOA 1WMBA 2O2SA 3AM3A 4FOPA 4J16C 3CSDA 4WE3A 4O4JA 3H1EA 1TEXA 1OR8A 1Q22A 1YI8A 4I50B 2IOYA 3QG5A 2YZKA 1AQLA 2MTBA 4DLNA 2OQIA 3ZWNA 1TJYA 4O4HB 1ZD2P 3HI6A 5I9MA 3PGJA 5KUTA 1N4AA 5JXJA 5IK2A 3RKRA 4MCJA 1V5GA 1ZK2A 2VSFA 1L1EA 4JR2A 4MYDA 3UMCA 1EB9A 1A8QA 5JIBA 2VZLA 5TB5A 5KWJA 1OOEA 1HM5A 4ZQCB 3VVMA 1O94A 4Q4JB 5JCJD 5BO5A 4DWWA 3C0KA 2ZJ5A 2YCBA 5LOVA 1E2GA 3ZIAD 3ZTYA 2N46A 3VZBA 5BSKA 3CKMA 2JHFA 1KU0A 4R2IA 3WYFA 5JD5A 1CHNA 4H60A 3NYRA 1II8A 4HDKB 4CKWB 4DDWA 4PO3X 2NSDA 1X1TA 1DIHA 4HNQA 3NHYA 3N7TA 2JA2A 3WSVA 1UZNA 3PWZA 1EDEA 5GJWC 1G21B 1XFDA 1NC1A 2BUCA 2X4IA 1UXHA 4J94A 3RAGA 2A6PA 3UWSA 1V9CA 3BWEA 1J5PA 5D1NA 1TU0A 1IUKA 3GEBA 5THQA 4Z3OA 1GG8A 2FJPA 2NAFA 1Z8FA 3FRJA 2IELA 4FEGA 3H6KA 3C1UA 4ITVA 1NHWA 4MYUA 1JZSA 3E58A 4IZOA 4KLRA 1DL5A 2CUZA 2BKUA 3O0TA 5EUBA 3W6PA 4C29A 3ELBA 1JG7A 1W8DA 2G67A 3RI3A 4RDIA 1YRHA 3OP4A 5HS6A 4R1PA 4EB6A 4E4RA 5JC8A 4JXKA 3C45A 1AA9A 4C6RA 4D3XA 4UU8A 4D9GA 3T3GA 2R0QC 1GITA 1W47A 2R87A 1KDPA 2AYZA 3DFZA 4Q21A 2Q99A 3AHGA 3I01M 5CIYA 4G3XA 1ZM7A 2VHCA 1P1BA 3RWMB 1ZJ5A 4ZO6A 2FLKA 2OXRA 4TN1A 4JLAA 3HYTA 3V4VB 5I9BA 2ZRDA 2H06A 4U2DA 4BNVA 5J3JA 1OXXK 3P9PA 1NNUA 2FTKE 2Y1GA 2WLSA 5TS3A 5CD1A 1DJMA 2C84A 4UFNA 1T8PA 3F6BX 3PNYA 4J90A 1ZD1A 4NBVA 2DT8A 4UNIA 4RDXA 3NTUA 4RZUA 4E14A 3TAHA 1RPZA 1M7GA 4JP3A 1SQ0A 1G3MA 1GPAA 2GZHA 3FHOA 2OCKA 3H87A 4IDNA 4INAA 4LQDA 2IYEA 1FVXA 3PRYA 1R6UA 4RVOA 1D8AA 1OHHD 3TBFA 2ATXA 2VN8A 4PX9A 4QRHA 5ELXA 1M8PA 2Z9DA 4XCQA 1L4MA 3UJCA 3WB1A 4XX0B 1PDVA 4LGVA 1AH2A 3N2KA 1RRVA 3NONA 1NF9A 2IS4A 2FA9A 4Q12A 2RGAA 1OH7A 4LJRA 2FMKA 4HXFB 3DR3A 2JFZA 4LOKA 4WD3A 5E0KB 2E4WA 4BVGA 3TUJC 4IJWA 5U9CA 3D0KA 2HT6A 4YCDA 3IX7A 3GUUA 4O4HF 1GRNA 4PYMA 1LCIA 3EXFB 4DEYA 4EG3A 3W8RA 2WT9A 4MV9A 4QATA 4RLFA 4WXYB 2XAAA 2JAHA 4GZ6A 3EGWA 4RTQA 5EG5A 3O83A 3EMVA 3PE6A 3QMWA 4KE9A 4QPNA 4C30A 4BFVA 1T4CB 1BGXT 2BFOA 5H0IA 3HR8A 1ECJA 3D8SA 2R7LA 4D8UA 4R2LA 1JEJA 3AZOA 3NNNA 3UGKA 1YOVB 2PLWA 5EJFA 1T35A 2Q45A 5EMLA 1A69A 1BDJA 1O95C 4BCCA 2P3LA 4MNTA 1B0UA 4E03A 1G5IA 2L17A 4YX9A 3DKVA 5DBIA 3FZGA 1WZUA 2R6FA 3K5IA 4DHWA 4C4OA 5JWOA 1KH1A 4JLWA 1Y6FA 4Z4IA 2UDPA 1QFYA 1M5TA 5AJYA 4RIIA 1KYIA 1Z73A 1EUZA 3W78A 4D3YA 1AGYA 2FSHA 1JNXX 1NJ2A 2V5UA 1JEQB 1LTKA 4UUNA 1Z34A 2HA3A 3PGVA 1ZNYA 4RCYA 4BO9A 1QRDA 4CLRB 4ER7A 3LBYA 1HE2A 1OX4A 1QE5A 1ZW6A 1UUFA 1YFZA 4J0KA 3JYPA 2DG2A 3O2JA 5C51B 1SZJG 2VIIA 4KFUA 4EI9A 3KOZA 4Q9LA 3WAJA 1BXRB 1SBNE 2NZWA 3RUPA 1DBIA 3W7VA 2YQ5A 3OTHA 3IP3A 3SF8B 2IPXA 1GRCA 1XTJA 5KHOC 5MFPA 4KQMA 3BC1A 1FBTA 1HNNA 2QJOA 5THXA 1JEDA 4XSVA 5CVDA 5BOSA 3WK9A 1QP7A 1KZYC 1P7YA 3AR3A 1CRWG 2FCAA 2JI8A 3M3HA 1XAIA 2HDOA 4GQBA 4OBBA 4UUBA 4H3SA 2RGYA 3I1IA 4X92A 3NS7A 3THXB 1D4OA 2WWYA 2EF1A 4NFSA 1YS2X 4PEVA 1PSWA 3K71B 1M7BA 3C6KA 5FWYA 3IUEA 1YDGA 2Q07A 1HBJA 2C2BA 5LQDA 2HU5A 2HA2A 3F7OA 1RNLA 3PQ6A 4Q01A 5EZQA 4DG5A 2IEBA 1QYVA 2BGNA 4XIGS 2FETA 1GZ3A 2KBEA 3WMRA 1H1LA 2B9EA 3ETCA 3WJAA 3KQYA 1ZMTA 3T9AA 3A6KA 3FMOB 3E7XA 4C0WA 1FXWA 3B48A 1VPWA 9MHTA 1QHSA 3B8EA 3NR2A 1U28C 4KN8A 3LLVA 3EJWA 4KDRA 2IPOA 1BH2A 5B7QA 3JD4A 1LV8A 1V26A 3CEMA 3AETB 3PC6A 1RJ9A 1SZCA 2DFTA 4RWZA 1SN7A 1WZCA 4NFLA 3CE9A 3Q1KA 4R1UA 3ORHA 2VP0A 1EX7A 1N5MA 3IP8A 2RHOA 1JXQA 1TQ6A 3NORA 2V0GA 3ESRA 3L82B 4YY3B 4M60A 2K4MA 3VJKA 1IWOA 1FUEA 1R12A 2GNOA 2QUAA 1EIWA 3A26A 1YJBA 1EDDA 3PT5A 2DC1A 1OXSC 2VL7A 2OAEA 4EJSA 3MHPA 4EFLA 2QAIA 1D0SA 3OIFA 1FFEA 1ORVA 1ZVQA 3A6EA 3T7SA 2LDXA 3CRNA 3D7KA 4TQGA 2FN8A 5I3CA 2IZ5A 2G6TA 3MS7A 1L8OA 2CMGA 3IAEA 1Z6AA 3D1JA 1QVVA 1SXIA 4RY2A 4EW6A 4XASA 1EHCA 4Q3CA 5K0ZA 3PX2A 5DK4A 3URMA 4EYGA 3TGLA 1VPTA 3DXZA 2FP3A 1N6LA 4QAJA 4GMGA 4L8FA 5T5QA 4X63A 2QNIA 3B53X 4F38A 2GK3A 3TG8A 4NPHA 4XM0A 3KB2A 2L2QA 3DFKA 4L2IB 1CZHA 1JR3E 1EG2A 2ZRKA 1MW9X 3KZVA 3RSCA 4BIIA 3DVQX 3KUUA 2BTQB 3I8OA 1F7UA 3DUWA 2PWAA 4YRFA 1RE0A 1F5NA 2W0MA 1Z5GA 2XKAA 1ZGJA 4OXRA 2AZXA 2OQVA 2Z30A 1JFSA 4BE4A 4L75A 1CUBA 1E18A 2BW0A 3UANA 5AICA 5I3ZA 4GOLD 1VLJA 1WLSA 1QF9A 4QNNA 3OPXA 4TM7A 2DETA 2RGEA 1E63A 4MQUA 4HJXA 4HMPA 1AKNA 2G88A 4E70A 3NKFA 5JQWA 1PR2A 3PKJA 2SCUA 1NRJB 2X2EA 1II0A 3E1KA 3GPDG 3UFXB 3RSLA 1I3LA 1A50B 4LYEA 1TUGA 3SQMA 4N7JA 3JAWB 3U6BA 2CD7A 3QXXA 1QORA 4FEEA 1TF5A 4OK5A 3V4LA 1E59A 5ALWA 1RP7A 1HC7A 1YHZA 3ISTA 5MF6A 3BZBA 1OZFA 1KGSA 1MBZA 1T9GR 2IYLD 4FHCA 4L50A 1L8XA 1M1UA 4J1TC 4URYR 1KFCB 4F2GA 5IFKA 2ESRA 3TCXB 4XQEA 2QTFA 4MCHA 1QV6A 2C92A 4G5SA 3V42A 1GXSB 3HM9A 1IY9A 4DA7A 4C4XA 1G55A 1Y4AE 1EE1A 5ECYA 3QKWA 4PZZA 3OFJA 5HS4A 1KEWA 1W76A 2IIBA 3NVAA 2WWHA 4PRYA 1UWKA 3PHLA 1NVXQ 1XCJA 1XZJA 1UJCA 4IJ6A 5C32A 1A9YA 2GLTA 1PT7A 4QJ3A 2GSDA 5DZSA 2C8LA 1ZOPA 1XNRB 1OXKB 1A8PA 2H4YA 2MOKA 4MITA 2WSSD 2TRSB 3ETEA 1FDVA 2Y66A 3I83A 1CUEA 4AJNA 2OESA 2GUWA 3NYQA 1NW5A 2Z57A 2XMDA 4HXYA 3VR3D 1XHFA 2A88A 1P0FA 3E9CA 5I4CA 3R9WA 4PIVA 2C2ZA 1X7XA 1V39A 1TJPB 5C3UA 4N5MA 3TKAA 3VDRA 1MUUA 2PMKA 4EAAA 4XOUA 3QX3A 3L0SA 1N78A 2HJVA 4JJZA 1LQTA 4EH1A 5C52B 1YRYE 2HO5A 3BL5A 3DGEC 3AB8A 3QF4B 3TRJA 2WZCA 2R4TA 3VH4A 2OO7A 3FLMA 3FYUB 2GWHA 1T9CA 1XQWA 4KIGA 4U5XA 1ZR2A 1B1AA 1F5SA 4X84A 3VC2A 2CL0X 2G9NA 5IYZA 3EHDA 4QU5A 2JLUA 3LYAA 1GSAA 3G2QA 1Z5ZA 4FGUA 2XTZA 3A06A 5J58A 2GBIA 3BMOA 2ORYA 3Q7TA 1EUDB 2MJLA 1K7XB 3HJHA 2D13A 1AM4D 3V7UA 2AA3A 3CLRC 4CMIB 1V3TA 4BEWA 3HJAA 4W8HA 4IOMA 4W8GA 1SRQA 3PQ4A 3C7AA 3VNAA 2ZXFA 3LVQE 5BUZA 4LF7B 1UINA 3R4CA 2P77A 4DMCA 3QKRA 4YUVA 4C4RA 2BZSA 3AFGA 2MSDB 2YWBA 4LK2A 2XE7A 3GLUA 5AOAA 4HVLA 2RHWA 3MMXA 3KSDO 2N3ZA 4FE3A 4V1CB 1IQUA 4P32A 1SVOA 2OO5A 3PJGA 4ALIA 3MA0A 1G3RA 2AYYA 2PT6A 5J4KA 3MJFA 1BVRA 5AVXA 5E6UA 4NEGA 4HGNA 1T9AA 3P9XA 5AVSA 5FTNA 5BVGB 1EGHA 4HAOA 2IYWA 2ZRQA 4Y30A 5SZJA 1N2ZA 2NW6A 5C3MA 5BQ5A 4H1VA 2WJJA 5TQJA 2LE0A 3ITEA 4KIWA 1JKIA 4FHGA 4QFCA 3SE0A 3ROMA 3V6MA 5KYUB 4LWOA 4W63A 3TL2A 2JI6A 4MIKA 4DLVA 5DGIA 1IXKA 4F4IA 3R76A 3F74A 4FOLA 3I04M 2RHTA 2J7PD 4QDTA 3R3JA 1L8AA 2H8GA 3NDIA 5B7GA 3WL6A 2QE7A 2WHPB 3TO5A 2AN9A 3H5LA 2AMFA 2J31A 1MQ9A 2J41A 3COSA 1IOWA 3FKSA 5CFRA 1BFUA 1LH0A 3FZQA 4KMOA 4LDNA 5DHRA 4A15A 1KEZA 4YNBA 1J25A 3CU5A 4B9EA 4MV7A 3MWEB 3HDQA 1BVHA 4P33A 4BWFB 1DJOA 3WQSB 1W5BA 1R5OA 4M6WB 5KYYB 3CLSD 2WLTA 2RGXA 3BMNB 3N59A 3WTBA 4URXR 1Q0PA 6YASA 1U0BB 4JT2A 3LFUA 4KE7A 4MLCA 5CA0F 3ZWBA 5KINB 4FOOA 3ZBTA 2JPDA 2H4XA 2PYZA 5L3QB 2GZ1A 3OLVA 1V5FA 2L82A 3DFFA 3O4FA 1MMFB 2IYVA 3IH5A 1NVUQ 3M33A 4QUIA 4HI0E 4DNPA 1RJWA 4A73A 1EESA 3UB3A 4NAUA 3VVBA 2REXB 3ADBA 1X3LA 4BN0A 3GU3A 1VI5A 3QPBA 4YMSA 3WYDA 4C06A 5JT1A 2Q8NA 4Q7JB 1SEPA 4NOMA 1FS5A 3DDSA 2HF7A 5IT9A 1K7CA 3NIGB 4CIBA 2W6QA 1K6JA 1ONBA 1Y3CE 1CUJA 3BEOA 2X0DA 4I2VA 2BGLA 2XNCA 2I2FA 3C8DA 3JD0A 3LCJA 2J9XB 1ZLYA 5BYKA 3VKUA 1XB2A 4MDFA 4V38A 1LBIA 5EC8A 2QRNA 5C81A 1F6BA 2EZTA 4O4IA 3B1ZA 3KJFA 5JRJA 1QIIA 2C96A 4B74A 1Z37A 4B3IA 2VPIA 4UDXX 1T6ZA 2Z5GA 3OFVA 3AUXA 3ESAA 1UWLA 1L7BA 3BTUA 2UUAB 4FGSA 4HDQB 2QVGA 4B6JA 4NG5A 1Q7TA 5EMMA 3SZ3A 1U3UA 3VR5A 1SQSA 2NN3C 3DBRA 4D9BA 1E6EA 1HOXA 3N05A 2PR2A 5L3ZA 2IEZA 1CUCA 3IO3A 1P4RA 1S02A 5HOQA 5JS7A 3GRPA 4XLZA 4TWAA 4Y9UA 3ZY4A 2CVZA 1D7OA 1VI2A 2AEJA 3A9WA 3QGMA 3ETGA 2XIJA 2ZKLA 3H0CA 4G1EB 4IDEA 4WGGA 1P17A 5JPIA 3UAWA 3KP1A 2W42A 1GZ5A 1OH5A 1W6UA 3G85A 1A8HA 2PMWB 2C9CA 4BNZA 1O8CA 1N9KA 3GEHA 4I4LA 1Z47A 1M8JA 1TB4A 1UDBA 2BELA 2VP3A 3G5TA 4KWHA 3S7TA 3CJRA 4Y7CA 5EXTA 1L5GB 5ARBA 2HNKA 3KR9A 5FV4A 3QKTA 4Y2TA 3REQA 3LKBA 1ICIA 1H2WA 1GO2A 3DVAA 1JFRA 3EXAA 4EJMA 4KKVA 2ZSEA 1SXHA 1X7HA 3ZDDA 1W59A 4GC5A 3V1LA 2G0TA 4BEJA 4HGOA 1ZI8A 2XV1A 3PENA 1U5BB 1WCXA 4WERA 2RJOA 5D3QA 4ZVKA 3GVHA 2D3WA 1QHIA 4TT8A 1NLFA 1ZINA 1Z6QA 5CK4A 4HUTA 1KXZA 3NMUF 2MSWA 1QTIA 1Q16A 5TGTA 3M4YA 2DP4E 5B3JC 5F2EA 1DMSA 4BVLA 4ZOLA 3TN7A 2GM9A 2W71A 2WG2A 3FVVA 3R3UA 2YNMC 1GSIA 4XD7D 2PUHA 1E2EA 4D57A 1GEGA 3BGIA 3LE8A 5ALVA 3MJ4A 3LTEA 4YMGA 3QHPA 4UM9D 4YJGB 3ED5A 5KNDA 2HLNA 2QLTA 4QT4A 2FP4A 1AMUA 3MXTA 2JGNA 4D0NA 1O6CA 5EE1A 5K1ZA 4ZTUB 1NQTA 4J16A 1GR1A 5U1PA 3K5HA 3OQMA 5JDIC 3JWGA 3L1HA 4D9FA 2RHBA 3FBWA 4IG4A 3TZLA 3P7MA 4RA6B 3ETNA 3OZRA 4RY8A 4I3HA 3UOAB 1HXHA 1YJ8A 3L0YA 4MMZB 4B40A 4JMPA 3FDZB 2DWQA 2WIAA 1AGRA 2DKOA 1ZM9A 1G291 3FZYA 4IQ8A 3M4ZA 4OB8A 3GBSA 4PG6A 4CF7A 3HVUA 1T4DA 2HLPA 1MTZA 1ZISA 3S40A 3G0HA 1GKUB 1JIVA 2OXEA 4LKOA 4FS8A 3L1KA 1MCZA 4G5XA 5FEUA 2M9MA 1M2FA 3KZ1E 4ZXPA 3RVQA 4D2IA 4JB0A 3AMVA 4PLTA 1ESNA 3K9WA 1VC2A 4CQMB 2BMJA 2JGKA 1SQFA 3R4VA 3USES 4JGBA 4Y6GB 1JLSA 1KVRA 5CCXA 4GECA 5IVHA 4B7AA 2OO3A 3PX3A 1K2WA 1ADCA 2ZREA 1YD7A 2ZUCA 3GZNA 1UT5A 3QFCA 5FOWA 3A6PC 3RQSA 5I4IA 5GADl 2JZCA 3DJYA 4GR5A 1AZLA 1CZRA 3FUTA 2WQ7A 3WX0A 2G06A 4ZHSA 1BDBA 2W58A 2ZYWX 3N0XA 3SDBA 1BKYA 1FF9A 3CUYA 3DMHA 1L6RA 1X42A 3DZFA 1DKNA 1K88A 3NATA 3MJDA 1QHHA 3STUA 1NT2A 3USCS 3KKKA 2Y2VA 4TMVA 4D9IA 5K8IA 3V3TA 4NV3A 1AS0A 1G18A 1H3NA 2H48A 4G1FA 3PFCA 3B3FA 2GESA 3ZXIA 4CKEB 3EWIA 4PPFA 4ZIRB 1LK7A 1T2FA 1CR2A 2EYQA 3WY9A 3I9V6 4YDQA 5BMVA 4EPRA 3R20A 2P6PA 5EJEA 2J85A 4NOKA 4F60A 5TQ0A 1NBHA 3IIMA 4PS0A 1UBEA 4E2YA 2BMAA 5HXAA 2BBTA 5C1DA 1BYUA 1NGSA 3GUVA 4IJQA 4OQMA 1NW9B 4ENVA 3Q4GA 5JAHA 3CMCO 1GIAA 1G7CA 4EKDA 3I5XA 4J6FA 5DCUA 4ZVPA 5IULC 1GPKA 1TPZA 4JYAB 4J7CA 2NO1A 5J5AA 2ZT7A 2ECKA 3AK4A 2ZUTA 1RM5A 2COUA 2DLDA 2L19A 2V45A 3IXMA 4KAJA 3ZU3A 3V4RA 3EZ9A 3L2OB 2V8OA 2EFEB 3U9LA 3EUFA 4F5DA 4EHJA 3T5BA 1IAVA 4DNQA 3ACBA 1CY8A 1XCOA 4WRRA 3VR4A 3K1TA 3W1WA 3HE3A 1XZ8A 1RHRA 1Z4KA 3E3AA 1JR6A 2Q6OA 2FY8A 4WK2B 4X7PA 5K3FA 1KH2A 4C07A 4IXMA 1ISMA 2X8JA 1BD3A 1UEXC 3B1YA 4ZI7A 1EE9A 4QGBA 5CVCA 4PYJA 1P72A 1Y8ZA 1EA5A 2BFCB 3ZU4A 1O9GA 1EQ2A 3NBZC 2VP4A 2H6EA 5KI6A 5EESA 1MLDA 1Q6ZA 3WL5A 1GKIA 4OQEA 4NBRA 1WBDA 2JCYA 3ASUA 1R66A 4UREA 4W1PA 5EXEA 4P38A 3SX2A 1EIZA 1MKYA 1O95A 1RAIA 3LH5A 4MUYA 3UUWA 5IF3A 2GXAA 1V71A 3BB4A 1L6IA 1N9GA 1S2MA 1TVMA 1MH9A 1U2EA 3GGOA 2RHDA 3LQQA 1SELA 2C7QA 4OQLA 4K9LA 3WGKA 4L16A 1RJDA 2CFTA 2QMUA 2VF2A 5AXDA 3ANMA 3KX2A 3IO5A 4OFXA 4LFAB 3HLTA 4Q37A 4I3GA 3VX4A 1MAUA 3M6IA 1ONSA 1VL1A 3AF3A 4EPTA 4URHA 3Q3JB 3QXHA 2DJ5A 3CH5A 4HH0A 3QELA 4TTAA 3WNDA 3R9IA 2G0NA 3T6KA 2HF9A 1J33A 4RAQA 1R0LA 5A3RA 2C2YA 1KSJA 1N2CA 1O9BA 1IBKB 2G6BA 1AUXA 3MT0A 4NOLA 3D8TA 3IAUA 4M87A 1SK9A 1CUIA 2V5VA 4JP8A 4LVNA 4TWZA 4LFCB 3RH0A 5B6JA 2F8MA 2FXIA 3QVOA 4LY0A 4N3BA 2B4KA 1G6OA 4GL4A 4WXPA 3Q8KA 3OJEA 1V6AA 3ULKA 4YIHA 1DKOA 2ZUUA 4GWKA 3AH8A 4IEEA 3TAUA 4NH0A 4YCJA 2ET6A 3LWZA 1O3YA 4GSYA 4WKGA 2C8JA 5BN5A 1RRMA 3JZAA 3QVKA 2DZDA 2R8YA 4MUJA 1G2OA 1CY0A 1KETA 4WLVA 3FMGA 2PJRA 2NQTA 3CH6A 3PFFA 3DZIA 1XZHA 5IH7A 3L93A 4AJEA 2ADOA 1J8DA 4L51A 5TNXA 3RSQA 3QU5A 3I8XA 1HT0A 4EKEA 5T3UA 5CUQA 2XF2A 1LC3A 4INZA 4E0BA 1UZLA 5AUOB 1JWLA 3X2FA 1W88A 1G2QA 2RG7A 4HAXA 4N54A 3U7QA 4NBWA 1CHDA 1KRWA 5HZGA 1N5LA 3A1TA 4X1KB 1U28A 3EGEA 1NUPA 3C1AA 2P67A 1A96A 1U7ZA 1I9GA 2WFLA 3K31A 2B4RO 4K46A 2IXEA 4Q7KA 4UUOA 3F9CA 4MS4B 2HMSA 1MOSA 1GT6A 5KAPA 1NVVR 3LI2A 1U11A 2XUZA 1A7UA 5L9AA 5MDHA 3G2KA 2J3DA 1HNZB 2GPYA 2Z4RA 3H17A 2JAPA 2R96A 2BSXA 2YHUA 4TS9A 3WGZA 2HK9A 1AXGA 4B79A 4B71A 1TQDA 2EV9A 3PNBA 3PXEA 1GCUA 4KLZA 1V1MB 3GH1A 3MWDA 4GYKA 1P1CA 1P7ZA 1ND6A 1XMVA 2IW1A 3CEAA 4LRSB 3T35A 3U4DA 3L1VA 5IU6A 3SIWA 1XU4A 1TQHA 4CMCA 2DBQA 4KX3A 3SGLA 4EVQA 2L69A 2J5KA 3KCNA 4X65B 1K5PA 2JGDA 3GA7A 3WKAA 3AEYA 1H9CA 2HPAA 2VT7A 4Q66C 5CB0A 5H82A 4PSKA 4LXYA 4BNNA 1L0BA 2EGUA 4TYNA 5IAEA 1G66A 3DFUA 4M8NE 4WOJA 2NOAA 1JTFA 2GUGA 4PZ0A 2G76A 1SCBA 1U8TA 2NG1A 4IXWA 1XRMA 2ZJ7A 4LXXA 4MB0A 2AK2A 4OP3A 4OGGA 2PR7A 2E5LB 1VBFA 4FNGA 2FR1A 4PFQA 1IM8A 1IWPB 4DV5B 1O5IA 1WKVA 2HY7A 4C20A 3TNJA 5LLSA 5JYEA 1PUIA 1X8JA 2H2IA 4LA4A 1A1VA 3ONFA 1NF3A 3KLMX 4K86A 5BQFA 1XXHE 5BR4A 2O07A 1E3TA 1CF9A 5TEVA 3H97A 4RD1A 3GAZA 3UF0A 1W0CA 3QF7A 2WNIA 4AG5A 4JLJA 4KRXA 1IN5A 1PBNA 1C3OB 2G09A 4OOFA 1GTZA 2NXWA 4M38A 1QWOA 2GSWA 4YAJA 4J8PA 1LSSA 1BIFA 2QL6A 3B1VA 3BXPA 2H3EA 2CDRA 3P2KA 4UUPA 2QSYA 2PGXA 4EEKA 3ANLA 4J1TA 4C7BA 4FDMA 4LWQA 4Z53A 1VSBA 2G9ZA 1Q15A 3HGMA 5J4HA 2IZZA 2V7XA 1MGOA 2Q62A 2YRFA 3K8YA 5FA6A 4I55A 2FKAA 3O38A 4MYCA 3Q72A 2FN4A 4LI0A 5FJIA 4IICA 3R7FA 4KXNA 3MD9A 4Q3DA 3C87A 2QN2A 5DK6A 4G4JA 4KPFC 2FQWA 3ZU6A 4EY5A 2M2IA 1W34A 3LRTA 4RU1A 4FR2A 2UYGA 3S1AA 3UQZA 2EFCB 1K5GA 4C6TA 4KQHA 4L95C 3E05A 2ONJA 4UBLA 1Z45A 2PS1A 2QENA 3RHFA 3LYUA 4B33A 1SVNA 4XA8A 3AUYA 1S96A 3EIQA 4BWGA 1T6XA 2QU8A 1PR9A 4KLCA 5T67A 1E1QA 4HLQB 1N77A 1F38A 2QOEA 1YF3A 3DMYA 1B76A 1N0VC 2X86A 1SCKA 2C3UA 2Q6IA 3DDZX 3NHBA 5IANA 1W581 3NTRA 4J03A 4B0PA 1X0VA 4TRRA 3IUSA 2G1KA 4DCSA 3I61A 1P29A 5ALYA 3IHTA 3GDHA 3VHLB 3HVIA 4JJ8A 5HQ3B 4D44A 4MKGA 5HDBB 2DTXA 1DAKA 1BRMA 1KJZA 3H6HA 3Q88A 2O0LA 3K5WA 2PU7A 3CW9A 3MTAA 4MK4A 2D2XA 3ZGXA 1AV6A 2UZ0A 1I7NA 3QLJA 1P1HA 5AUNB 2UUCB 3F0TA 1J8VA 5IWCA 3JXEA 4E12A 1DCMA 1U02A 3ANNA 4NCIA 1LLCA 3BUSA 5M34A 2RGCA 3G9TA 3ZZTA 2LPMA 3RJ9A 4WKBA 1M2WA 2H2GA 4KUEA 3SLRA 2C4VA 1CS0B 1SUIA 1JA0A 2EWMA 2QVLA 4ESEA 1CDEA 4P35A 4UM7A 2CVHA 2NVOA 5IZCC 3NOQA 4OJYA 3RSOA 1Q3HA 3FWNA 1Z0AA 1DBWA 1A3CA 2MMGA 1MA0A 2WIDA 1N8KA 2ILTA 3Q0TA 1P2DA 1VL6A 4IM7A 3RS9A 5A6SA 2ZK7A 4WCFC 1MX1A 1KVUA 4XUDA 1XEFA 2W2QA 3LCRA 1YB5A 2VP2A 2C4MA 1XVAA 3EBOA 4MVJP 1MO2A 1PG2A 1WF6A 2FHPA 1QCZA 2LTAA 2XPCA 1Z5VA 3IIIA 3K6KA 4MWSA 1GN8A 4RQUA 3E1GA 1FQJA 1Z16A 1NJ1A 2ZBDA 4KQGA 1Z4JA 1LLDA 3DCNA 3H2SA 4DDUA 4IX9A 4ZVQA 2F1RA 1UCFA 5FQOA 5A1TA 5KCMA 2HIGA 4IQ0A 1N1EA 2OHHA 4FYWA 3K70D 3TJMA 1GZVA 4LMBA 4M0LA 2UZ4A 1M7HA 2NTVA 1GPMA 3CX3A 4OLJA 4Q16A 4U2FA 4J0DA 1ZRSA 3DDCA 3VDMA 1KAQA 1YZKA 4X60A 3CNLA 1QOPB 5I7OA 1ZAYA 4RJTA 1T1SA 2O4UX 3VQTA 3LYHA 2Q2WA 1G8GA 1V1RB 4KIUA 5KWSA 2B99A 3SG0A 1FQKA 3OG9A 4HEHA 3I2KA 5EJ5A 2ZIUB 3W5VA 1ZOSA 1JBQA 3RTGA 4TMYA 3DTVA 4LNHA 4JN6B 4GVPA 6PFKA 1MRNA 3VYTB 3I52A 1SCQA 3PITA 2XRYA 2Y92A 4B4OA 3IQGX 1NXPA 3PTAA 2HW8A 5CPFA 5DT2A 4WLUA 2JD1A 1XMJA 3GDOA 2RSLA 1QS0A 1PVOA 3WHKA 4AMBA 4HN4B 3FVRA 4JB3A 3EZLA 4JLBA 3RSZA 3UQYS 2MR6A 5FPTA 1RD4A 3W2FA 3ZY6A 1IFXA 3AI1A 2ZR0A 4F5WA 2RH4A 3K0FB 1XAJA 3CF4G 5B3AA 3W5SA 1BXGB 2JGEA 3C48A 4OCZA 3KEQA 3N28A 2CJWA 3SY8A 2BD0A 2GAOA 4DUYB 1NFRA 2D5AA 2QMOA 4AY4A 4WL0A 2EW1A 2FG7C 4JXJA 2WTMA 4WV3A 4HV4A 1KIMA 2PMFA 1H5NA 4NDZA 1OIWA 4YV7A 3BXFA 4M98A 2GKOA 3FETA 3UK1A 5JSZB 3O82A 1TIPA 1I7PA 4CG1A 1SURA 4G84A 3C3CA 4R2KA 4GOKA 3GXOA 4IAOA 1ZM3A 5J5VA 1AQUA 1BEEA 1LJLA 2QBYA 4GZMA 1VZ2A 1HPLA 1GUAA 1TKRA 4C7OA 3RKUA 1BW9A 5AWFC 3OO1A 1C1XA 3PJDA 1E94E 2P9FA 3NCHA 1WVIA 3O7MA 2WWVD 1DSSG 3NTQA 2FW8A 4CUZA 4FGZA 4TTIA 3G8AA 3VR4D 2R5WA 1K4KA 1NAIA 3M34A 2C77A 3D64A 4KVGA 4XIYA 5LQJA 5DRTA 1B0PA 3GCWA 3KOOA 3RW9A 4DPKA 3N07A 3ZDXB 2B7BA 1LW6E 1NI4B 4MR9B 2IH2A 4U8GA 1Z2PX 2PUJA 3KYIB 3WBJA 4HFRA 1CJMA 1O6BA 4BX2