3FROA

Crystal structure of pyrococcus abyssi glycogen synthase with open and closed conformations
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
439
structure length
439
Chain Sequence
b'RHMKVLLLGFEFLPVKVGGLAEALTAISEALASLGHEVLVFTPSHGRFQGEEIGKIRVFGEEVQVKVSYEERGNLRIYRIGGGLLDSEDVYGPGWDGLIRKAVTFGRASVLLLNDLLREEPLPDVVHFHDWHTVFAGALIKKYFKIPAVFTIHRLNKSKLPAFYFHEAGLSELAPYPDIDPEHTGGYIADIVTTVSRGYLIDEWGFFRNFEGKITYVFNGIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSWEKSAERYVKAYTGSIDRAFDFIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GlgA glycogen synthase
publication title Lyase activity of glycogen synthase: Is an elimination/addition mechanism a possible reaction pathway for retaining glycosyltransferases?
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
total genus 157
structure length 439
sequence length 439
chains with identical sequence B, C
ec nomenclature ec 2.4.1.21: Starch synthase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
A PF08323 Glyco_transf_5 Starch synthase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3froA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3froA01
3UYLA 1L5SA 4WACA 3TAXA 1Z8DA 1FA9A 1L7XA 1RZUA 1JG7A 1FU7A 4BFCA 1RZVA 5GPBA 1HLFA 2R68A 4YI5A 4N3CA 3RT1A 1JIXA 4AN4A 3G2LA 2KS6A 2IV3A 4M60A 5DLDA 2QRMA 2QRPA 2F3UA 4N3BA 3H4IA 1BX3A 2C9ZA 3ZCTA 3FROA 3T7DA 3L7AA 2XA1A 1PSWA 1P29A 4MI9A 4N3AA 3MT8A 1Y8ZA 1Y6GA 3E3OA 3T3DA 3OY7A 1C8LA 2QLMA 1GPBA 2FF5A 4EL5A 1P4HA 3IAAA 3OTHA 4F9FA 3DDSA 4AMGA 4CTNA 3DD1A 4MRAA 2QN1A 5TMDA 2R4TA 4KQ1A 4GZ5A 3ZCPA 4F97A 2X0EA 1AHPA 3BD7A 4GYYA 5LQDA 3T3HA 3G2KA 2QZSA 4N39A 1Z6PA 3CEHA 4MI6A 9GPBA 3VDMA 3VDNB 3RSZA 1F6DA 2P6PA 4RENA 2QN8A 3L79A 2IEGA 2VCHA 1J39A 3S2UA 2VSYA 4RIIA 2VG8A 3MSCA 3OT5A 4F96A 1UZUA 2XCUA 3C4VA 1WUTA 3SYMA 2QRGA 2IYAA 2GPBA 5D00A 1P2BA 2VSNA 2FETA 3MRXA 1GG8A 3PE4A 2ACWA 4LDPA 1FC0A 1GZ5A 2F9FA 3MQFA 1UQUA 3G2NA 3BCUA 5DU2A 3DZCA 4MI3A 5I45A 1FU4A 2QRHA 1VGVA 1NOIA 5C1DA 1XV5A 1JIVA 2R60A 3EBOA 2XA9A 3Q3EA 3OKPA 4CTOA 3MRTA 2X6QA 2AV6A 1GPAA 1L6IA 4MICA 3CUTA 3BDAA 3CX4A 4HWGA 1ABBA 2XGOA 4XIFA 3MTAA 1E4OA 2QLNA 3L7CA 2BGTA 3RHZA 5TMBA 4AY5A 4WHMA 3OKCA 1RRVA 3PE3A 4RIHA 3VUFA 1EM6A 1WW3A 2YJNA 4MHSA 2ZB2A 2C1ZA 1FS4A 2FFRA 2IUYA 3VUEA 4CTMA 3EBPA 3COPA 3NCHA 3ZCRA 3BD8A 2C1XA 1UQTA 2XGSA 3L7DA 3OTIA 2AW3A 2O6LA 4YI3A 1L5QA 2QN3A 4NC9A 3BCRA 4MHOA 3ZCSA 4KQ2A 2JJMA 1LWOA 4YUAA 1YA6A 3E3LA 4X6LA 4RIGA 3NP7A 4EKEA 3NC4A 4PQGA 4NEQA 2IYFA 3QKWA 1XOIA 4GZ3A 3C48A 2QN7A 1L5VA 1FTWA 3MTDA 5ENZA 6GPBA 1FU8A 1NLMA 4HLNA 2SKDA 2GJ4A 3T5TA 1GPYA 1GFZA 3MS2A 4KQMA 4WADA 2GT1A 1NZFA 2GEJA 1PYGA 4XI9A 4AY6A 5D01A 3CEJA 5TVGA 1P4JA 3OKAA 1XC7A 1WW2A 2XGMA 5IKOA 1E1YA 2G9VA 1C3JA 2G9QA 3HBFA 7GPBA 1K08A 2QLLA 3E3NA 3NP9A 1AXRA 1A8IA 3C4QA 2H1FA 2H1HA 1IIRA 3CUUA 1XL0A 1C8KA 2R66A 5JTUA 3S27A 3AMVA 3GPBA 4G2TA 2HY7A 4M7PA 1XL1A 4L22A 3CV3A 4QLBA 1O6CA 1P4GA 3MS7A 4W6QA 4EKYA 3S0JA 2IEIA 3BD6A 2X6RA 3D0QA 1F0KA 2X0DA 2GPNA 2QN9A 4NESA 5BNWA 3ZCQA 2F3SA 3IA7A 2GEKA 4GZ6A 2GM9A 3CEMA 4N9WA 1QM5A 1NOKA 3S28A 3ZCUA 3H4TA 4BQEA 4FKZA 4AMBA 1IXYA 1PNVA 3RSCA 1Z62A 3DDWA 2SKCA 2ACVA 4CDRA 2XA2A 2AZDA 2ASVA 1L5RA 2PYDA 2IV7A 2Q6VA 4RIFA 1YGPA 3NB0A 4LEIA 2PYIA 2BFWA 2F3QA 5HXAA 1NOJA 2QN2A 3WAGA 1B4DA 2GPAA 4EJ2A 4X7PA 4X7RA 2VCEA 5TMEA 2OFFA 3T3EA 2PRJA 1M5RA 1Z6QA 4REMA 8GPBA 3G2IA 3MRVA 2C4MA 1QKJA 4RBNA 4EL0A 1SXPA 5DXFA 1LWNA 3S29A 1KTIA 1SXQA 4GYWA 3UYKA 3QHPA 3D0RA 4Z5XA 3G2JA 2XCIA 3HBMA 1L5WA 2BGUA 2G9RA 3HBNA 1FTQA 1P2DA 4RIEA 3T3IA 3WADA 4RELA 1JIUA 3CUWA 4X7MA 3TSAA 3Q3HA 1WV1A 1NZDA 1K06A 3D1JA 2QRQA 3O3CA 3GUHA 4M83A 1JG6A 3T3GA 2BISA 1GGNA 3SYRA 2F3PA 2ECPA 3L01A 4FZRA 3CUYA 3CUVA 2QNBA 3MT9A 3OY2A 2XMPA 2WTXA 1V4VA 2G9UA 3NPAA 3ZCVA 3BEOA 2R4UA 3HBJA 3TOVA 2JZCA 1WUYA 1JEJA 1P2GA 4BQFA 2ATIA 3MS4A 3BCSA 2PRIA 3NAZA 3G2HA 3L7BA 1EXVA 2JLBA 5JTTA 1FTYA 3MBOA 4GPBA 2X0FA 2PQ6A 2AMVA 3MT7A 1PN3A 1Y6FA 1H5UA 2SKEA 3OTGA 3WC4A 3MTBA 5IKPA 1XKXA 3Q3IA 4BQIA 1NVKA 1C50A 1WV0A 2IW1A
chains in the Genus database with same CATH superfamily
2AJ8A 1MFZA 1G8SA 1QMGA 1ZCAA 2NO6A 1DWPA 4UCWA 4S1TA 5DYIA 3VBCA 1THTA 2BUCA 4QBIA 1JLRA 3P26A 4G5GA 3S2ZA 5JSUA 4D41A 1H3EA 3BL8A 4GXRA 4IQGA 4QUKA 3R7LA 4KNVA 3T0FA 4DRXB 4ENQA 5REQA 1B14A 1VJ1A 4QGGA 3OMXA 3TQFA 4ITRC 1M83A 1YZUA 5IJ9A 3P9RA 2DPMA 3O9VA 3KB6A 3ZGVA 5D6NA 1RC1A 3GZNA 3TRHA 3KB1A 2WE7A 1NG1A 1BE0A 4KWCA 4Y1RA 5TC4A 3PHLA 1ZHFA 1JAZA 2XADA 3EF3A 3GO4A 2DVMA 4QUJA 4W99A 2OXIA 3GOQA 4YRKA 1A9PA 1GGKA 2NZXA 3Q7PA 2H4WA 2JI7A 1SHLA 5CLJA 5FBKA 3LLVA 1YFZA 4LGYA 4XJVA 1YNSA 1JXMA 2MJLA 4OEHA 1HPLA 3N0VA 3E4CA 1U9CA 3OZIA 3RT9A 4H1WA 3JARA 5TSDA 2AZ4A 4UTNA 2ZE6A 3L7AA 3ROXA 5ERXA 5H82A 1SBNE 1O03A 3DV0B 3WNVA 1URPA 2I76A 3AESB 2IXEA 1JQ5A 1A96A 3SZRA 4ESHA 4YO8A 1XTBA 1KJ9A 1ND5A 2WKSA 1GILA 3BSSA 1Y8ZA 4L07A 4NMMA 2PX0A 4PIVA 1QWOA 4X90A 3QBDA 1ZI9A 3J81A 4TZ6A 3V80A 5FA8A 5J2UF 1BEZA 3E3OA 1U0OC 1R18A 4C5CA 4ZN6A 1GPBA 3TH5A 2R86A 4CCYA 2O8NA 4P0PB 2QL9A 2PA0A 3O8NA 2MR5A 5A4IS 1U04A 2JAUA 5DX1A 4F9FA 4WGFA 3K70B 3F5QA 1AXEA 3DMFA 3E2MA 4TM7A 1M6VA 4MGKR 4B3IA 1GZ4A 4C29A 5DW3A 2W37A 3NTOA 1E2KA 3FGOA 3VJKA 4U7TB 2QVZX 5AI5A 4UMDA 3ZKWA 4M8NE 5LN1A 3D8TA 1QVWA 3DT8A 3K53A 4WV3A 2J9FA 3LYUA 1MO6A 3GFTA 4ND6A 1IVYA 2XZOA 2QZSA 1NFFA 3PVCA 4MVWA 3IQGX 4GRIA 2EKBA 4QOEA 2EW8A 1WTCA 3UAOA 4E2ZA 4ZI7F 5C1BA 4FW8A 4PNHA 3VBEA 2IXDA 4ZCPA 2EHDA 1WD5A 2NZWA 1W0JA 4YFYA 1KQNA 1Z5UA 3Q2KA 2UZ1A 2GF9A 4EX6A 1L5HA 3EF0A 1MF7A 3C70A 1BMFD 3AUKA 4RJIA 1GTRA 3PV0A 2YQ5A 1LK5A 1FFWA 4WCVA 3TKYA 5AQ1A 4B3RB 4DGSA 2EJWA 4JLNA 1CKEA 2A9KA 2AQ8A 4M49A 4PFQA 1SBYA 3UXYA 3PQ7A 1F1BA 2BZGA 3LY7A 2GJ9A 3KOMA 3B6IA 4IINA 2JW5A 3SJUA 3KJHA 3LP5A 1DAKA 3QG5A 1M6EX 1OV6A 3OF3A 4ND2A 2JLRA 5DH9A 2MR6A 4CF5A 5A5DA 3EXFB 4UZSA 2Q5IA 2WF9A 1J8DA 1U0HC 3DA8A 1QYWA 1P19A 1MV5A 2F1IA 1XDGA 1JEQB 5ALMA 3HBLA 1B8OA 1TGVA 3UIEA 4HWKA 1RI1A 2NXJA 1K4KA 2C61A 2I8LA 2XMCA 3Q4GA 4BLOA 4MDYA 3PCTA 1NW3A 1AMOA 4ZVKA 1TXGA 1UPXA 5ELXA 2ZUSA 5FNZA 4AZSA 1F60A 1F4LA 1WVIA 2OYSA 2QTFA 1Y4ZA 3A1WA 3IVXA 4GMGA 1XDZA 3B8HA 2YS6A 3WI7A 4E46A 3RSLA 1TKAA 1P4RA 4PGFA 1V8FA 2H06A 2W6PA 4EPRA 1RPNA 1ZS9A 3SIRA 2VF8A 2NU9A 5LOVB 4KK4A 4EG0A 5FP0A 3FRHA 4BDSA 2GF2A 2Z8XA 5KTRA 1FFCA 2P4QA 5HS4A 1N77A 2ZR9A 4LXGA 4CTOA 4XWTA 3RK4A 3VRHA 2WBLC 2I34A 1ZXLA 3DT9A 1ECJA 1XF1A 3ISJA 1HLDA 3DTYA 3LCVB 4PHGA 4I0WB 1T4CA 3W3AA 2F8MA 3MW8A 1VG0B 1B6SA 2IOQA 2H29A 3A9CA 4ID9A 2PH7A 3PPWA 3U4IA 3CX4A 1N1GA 4NVRA 3DWGA 4O2BA 3SP1A 3QTLA 1DLIA 1HTWA 1V41E 4NENB 4OJMX 3M4ZA 2ZANA 2ZSFA 4R8VA 2AG5A 1UP4A 2FLKA 2JGNA 1ADBA 3L7CA 3WNCA 4PCUA 4XDYA 1OI7A 3VJLA 4QHSA 1IUOA 4YP5A 1A97A 4CLRB 1RHRA 4CXMA 4HDCA 3NQ41 5LYYA 1DBIA 4E7PA 4GWLA 4W5QA 5EXEA 1DQYA 4BPBA 2DT8A 5CBPA 3II6X 5AO9A 5M04A 2PX5A 2CB9A 2Q1YA 3ESCA 3GGDA 1XQYA 3CO0S 1YQUA 1EI9A 1S9HA 2GLUA 3ND8A 1WDLA 3UFXA 2YJ5A 2WPDA 2C96A 2YR0A 2RGAA 1LY1A 4R4JA 4B79A 3IPYA 1DEXA 1YS9A 3U40A 2Y0BA 1PP4A 1ZH8A 2V3CC 3HV2A 2O8BA 3R1IA 2JAXA 1Z06A 2ACKA 3JS5A 1TLLA 2NUBA 1W2HA 2VUSA 2OBNA 1UKVY 3CH6A 4AKHA 1J2UA 3FF4A 1NJ5A 5IEBA 1CW2B 2IUSA 4YI3A 4Z3DA 4UCFA 2DHDA 4TZKA 3GDOA 1WWKA 4XX0B 1XJWA 4F5EA 2IS6A 4AY3A 4ZOAA 1FJHA 2FN8A 5GONB 3UXHA 3TJRA 3JWGA 3PPYA 2QF7A 5CNJA 1T4MA 2BR5A 4OFWA 5DBOA 3ZHTA 4PTLA 1W19A 2BH9A 2G72A 4X1OA 4E31A 2QP9X 5JARA 2X9LA 5D5QA 3HDQA 4ALKA 3BA6A 1AC5A 2N42A 2QTRA 3FA2A 2WWRA 1SD1A 3DGFC 4NBSA 1EFDN 4Y6QA 1Z8FA 4EKDA 3ZHVA 3F73A 1ISFA 1WEKA 2QTAA 1CUUA 2IYWA 4N5NA 4P3KA 4ZVUA 1KERA 3AH8A 5L3RA 1MTOA 2W11A 3C24A 4JC4A 4S0XA 3RKRA 4DSZA 1I6WA 3UJ3X 1JMKC 4XPIA 3KUDA 4AICA 3KDAA 3PQ8A 4LRXA 4DNFA 2Q28A 1C30A 1CY6A 4ZVMA 4EZEA 1RWMA 1GN8A 3OLVA 4FYWA 3AEYA 3HVRA 2Q4OA 4PC6A 3K20A 1VCOA 3JX9A 3F7TA 2PL1A 3LBYA 3LC1O 4MLPA 4Y6GB 2WJAA 3VO8A 3WWPA 4JYZA 1Z08A 2XNDD 4CLXA 3RF7A 1P9RA 4C78A 1UEJA 3BRCA 3CR7A 4HXGA 3WGOA 3LY9A 1KYIA 4BX9A 2FK7A 3D43A 1SC4A 3LBHA 4P6VF 4DCMA 1I5OA 5CT5A 1GRRA 1V4NA 3DOCA 2GO7A 3HRHA 2HDOA 4JVSB 5ERGB 4E5PA 1BDHA 3HP1A 4GPIB 4EHNA 1T8TA 4G0UA 1PT7A 4ETMA 4DMHA 3ZW9A 1X19A 3A6KA 1Q6ZA 2FPSA 3DOFA 3E23A 1V5EA 3ESZA 4DQXA 4JA0A 4K86A 2QUHA 3NHWA 1ADYA 1EFUA 2IYSA 1E8NA 1PJRA 3DVQX 3EGEA 1S96A 1X39A 4Q47A 1GTJ1 1UJMA 1GAWA 1XTRA 2PMCA 2ZS7A 3T7KA 2JJ8A 2C92A 3ZY4A 4YUWA 1HQDA 4OQFA 1X9GA 1AO3A 4WZAA 3U0VA 4GXQA 4FMCB 1T2UA 1GYPA 4GP6A 4IDCA 1WZNA 3O21A 4NABA 1V16B 2ORWA 4Y7DA 4MKRA 2H8GA 4K8OA 4A0FA 1ZHOA 1T9CA 4I5EA 1M8FA 1NY6A 4QXQA 4MWEA 3OG9A 3W79A 1MN6A 3U9LA 3KYBA 5M2QA 2WMNB 4D3YA 3RNOA 2QJWA 4D4IA 2RGGA 4EA6A 2UKDA 3MWJA 1FXWA 1J97A 3CONA 1IN5A 3Q0TA 4IJKA 5K7SA 3CLKA 3RAGA 5BNFA 3I9LA 3LNCA 3KZNA 2R65A 4NCJA 3PEUA 5JCOA 3MXOA 2JCBA 3KTAB 3D8RA 2W2NA 5KSYA 1D8AA 5L7WA 4FQ7A 4FYMA 5EXSA 4CLOB 4B3TB 1K5HA 5FUMA 3QXHA 5FI3A 1VYVA 3HADA 5FT9A 5LSAA 2Q1UA 2FOIA 3LLMA 2EARA 2ZGVA 2VZ8A 4I6EA 4M9RA 3T9DA 1T0BA 4HNTA 1PS8A 4TVKA 5BN3A 3SVLA 1TVMA 3GGOA 1RT9A 2X6RA 3AHFA 4RKFA 2LTAA 1G9SA 1RRPA 5TJHA 4A2QA 4DIKA 4FX5A 1T35A 1SU8A 1XAJA 3QU4A 4JC8A 4LX8A 2X0DA 5CVTA 8OHMA 1ENYA 4W8OA 5FI5A 5TQ0B 1GR1A 3VGPA 4Z51A 2TMKA 2J46A 3C8MA 3O3NB 2RE8A 2B8EA 3VYWA 2QJOA 3IA7A 3UK2A 3E1KA 3AVOA 4WFIA 4EGQA 3A32A 2LW7A 2P2SA 3AFOA 3DE5X 1PR9A 1WR8A 1J90A 2DJ5A 3D7LA 1NASA 1XN1A 3ENQA 3H04A 4LJ6A 3L18A 3MNFA 3K32A 2Q3LA 5F4ZA 4JROA 3NKVA 1M33A 2ZROA 2VAVA 1PT8A 1FSSA 1W73A 1MPXA 1B3BA 3HCBA 1OZHA 4B45A 4YYZA 1B23P 4EIWA 2I1VB 3T9AA 3CRMA 3DH0A 2JIMA 3PXUA 2DY0A 2CN1A 2PR2A 3O2NA 1WCWA 4JEIA 1XWIA 3ON5A 4ME6A 4EVQA 5C46F 5IKXA 5FA5A 2JAPA 1E0DA 4G0XA 2ZR0A 4RGYA 1EGHA 4M0PA 3T0GA 4RIFA 3W6UA 4CIXA 1W76A 2I4TA 4BLTA 1F2VA 3IT1A 3NB0A 3EQ2A 2P1RA 3O4FA 3ORFA 2HBZA 4OPMA 5ALLA 3L0IB 3GFFA 2PYIA 4F1KA 4HXFB 4YPFA 2BUBA 2HEIA 3EB9A 3OQIB 4KXFB 2LDXA 5K6AC 3AVPA 4L3WA 3B6ZA 4J91A 2OXFA 1WCXA 4IJMA 2C3OA 5FPSA 4KR9A 3DCYA 3TBKA 1E2DA 1G7SA 1W75A 3A1SA 5LA6F 3OQHA 2ID9A 5BQOA 4OHFA 3W5SA 1I9CA 3G0BA 4C4ZA 1OT5A 3D6MA 3PFKA 4XGRA 1N9ZA 1IJEA 1J06A 1KORA 1NKVA 2AYYA 4A8JC 5TS3A 4F4JA 1OGYA 3NH9A 1PK9A 1H93A 1YCDA 1JG3A 2EIHA 4LE2A 4K6KA 2PCLA 6AT1A 1U7OA 3RW9A 4DSAA 3GRCA 4N8EA 2VXYA 3ETHA 3HMKA 1ESDA 2P30A 2O3SA 3RFUA 3TS1A 3KXKA 1JR3A 5KPDA 1NNI1 2Z2ZA 2OGSA 3S29A 2EW1A 4EPTA 1HI9A 4WUVA 3ONEA 2Z1NA 4TQ9A 5PNTA 1FFGA 3EVBA 5FWXA 4QYWA 4RS3A 4DRYA 3I04A 4MHTA 1BA3A 1VHDA 4X45A 3WE7A 3OT4A 5EJIA 3ZHYA 4F3YA 2Z3ZA 2R85A 3G2PA 4A26A 4D74A 3K2BA 3N6RA 2XCIA 1GZ7A 5IMBA 2RBEA 3P0JA 2IIBA 1Y42X 2G9RA 1ZITA 3L0OA 5H81A 5BW5A 1PO7A 1ZC4A 4HQOA 1IWBB 4QJ5A 5ALHA 1ZK4A 4KQJA 1AQUA 3GYBA 3ESDA 1RFGE 1NHWA 1JL3A 1OOEA 1QK4A 4J1SA 4QOIA 3CQ9A 1XZFA 1J2EA 4KO4S 2QRQA 2DMRA 1E2BA 2JFBA 1R15A 4MW1A 3L6OO 5AVSA 5IJ0B 4RTQA 4Q1CA 4LNUB 4YRQA 1WXGA 5KNDD 1ZO8A 2GARA 2PKXA 2PXXA 3E9MA 4YUVA 3K6RA 3OE7D 1TW2A 2FQWA 1MIHA 1ZX1A 1BYIA 1NBIA 3NAMA 1PG2A 1NI4A 3IEXA 3O6VA 1T2NA 2ORYA 1ZEJA 1RR6A 3DZJA 2J4FA 3WQBA 3CUVA 2QW1A 2ZRBA 3G8BA 2H7CA 4ZVLA 5I9BA 2AG6A 1PD1A 1JS1X 2C4TA 4IMIB 4N6NA 5LVAA 5FUWA 4JT9A 1C9NA 3SMQA 3L8FA 2VDPB 3D81A 4MKXA 1V4VA 4Y3UA 4TQGA 1T5DX 2R8BA 1U4SA 4QGBA 3RDPA 4BX8A 5KSPA 2CLKB 4C4OA 1YUMA 1RQ7A 4PZ9A 3GIWA 2I6TA 3NM4A 5TDHA 5KSOA 4EI8A 7YASA 1KEVA 5DGCA 5JI3E 1YJBA 4DJ5X 3S7TA 2FE4A 3WKDA 1WQ3A 4PC2A 3GJ4A 2I3BA 5BMOA 5BMVA 2ILVA 2QSYA 3UAZA 2FE1A 1WUYA 2AI1A 2GVDC 1E1NA 4HHEA 4KXMA 2ONZA 2V6MA 2MHCA 2ZRGA 4NS1A 5B30A 4JR0A 1VSQA 1KVTA 1NT2A 5FBHA 3WQQA 5LMCA 2HMYB 3HEMA 5EPUA 1ANKA 5CFNA 2FPXA 4LY9A 3PUVA 1OWNA 2UVQA 3EGDB 3PYLA 4L02A 4LOIA 5FOUA 4HDRA 4R40A 1KH1A 3B20A 3E5HA 4EYGA 2NW6A 1E18A 4DA0A 2HL6A 4IG9A 5J4LA 1NDQA 2Q5QA 4OP3A 2EWVA 2AMVA 2XSZD 4WA7A 5A2QA 2O7VA 2XWPA 3AZOA 1KZHA 3S8MA 1IQ0A 1UBGA 2AN1A 4RH0A 1ATIA 3NANA 1KZ6A 3PK0A 1OIXA 2I7VA 2ISCA 2OBMA 1FVOA 1O96B 3CLHA 4MV8A 5HX7A 3VU9B 4LJ5A 1RYEA 1W1UA 2PV7A 4HDNA 4YV7A 3M6WA 2H0RA 2PIAA 1XVUA 5EVCA 2JFUA 1F2UA 2B4TO 2WVJA 1RTTA 2DKNA 3Q87B 3VHLB 2NZ8A 3LP6A 3P5BA 5AUQA 3N0TA 3OJ0A 4JP2A 3WSVA 1TTTA 5JH7A 1FA9A 2I5PO 2ZE7A 2O8FB 3EXHB 1X7GA 3RKSA 1ADJA 2C9CA 5AXAA 4FB4A 1JHAA 2H4JA 1FU7A 3SMVA 4DQUA 4E22A 1NYLA 1T8RA 1FNSA 4GM1A 5EIWA 5JWHA 1VL2A 1QDUA 4YPVA 2OZEA 1T2CA 3OBIA 5EP2A 1MIOA 1ORIA 2EL9A 2DHRA 5I9NA 3JU3A 4Z7NB 2B69A 2KYRA 3C5HA 3MWEA 5GOTA 4DLPA 3D3EA 4ER5A 1D2GA 3U1VA 3QFTA 1ODTC 2XMRA 2ODNA 3B7WA 3EDCA 1K6MA 3G0CA 3L7IA 3QUCA 1F06A 3DBLA 4I19A 3UJCA 3ODGA 4ARIA 4KTTE 2RJOA 2MSWA 3H8JA 4TYPA 2Q99A 2R8PA 1VE3A 3CPSA 3FLMA 3H4IA 3RC2A 4J1TA 3NWBA 1COWD 2OPBA 3GLQA 1M67A 4KBGA 2IXGA 5KDDA 3AY0A 4HT3B 5BN5B 2DRIA 5G0SA 3S2YA 3GLGA 3G13A 4GGOA 2HMTA 4DWVA 2Q5EA 3ABZA 4BV2A 2C5LA 1J8FA 2A9PA 2IS2A 3EXIB 2Z5VA 1K92A 1KR5A 2WVHA 3ITNA 3K0AB 2HJVA 2IZ1A 4NFYA 5LWHA 2J0QA 4ARZA 4L3VA 1DEKA 4H1UA 3H2ZA 3K6KA 4H27A 1OLUB 1O54A 3IP1A 4JUFA 3OPQA 1B8VA 4JUBA 2QX4A 1TQ6A 1VG8A 2HEGA 3RD5A 5CG1A 5IUJC 5GIPE 1L5ZA 2XRFA 5HCIA 5CFLA 3ZBQA 3VR5D 1UPFA 5T4FA 1CF9A 1Q16A 3BXZA 3FPHA 4O4IB 2V0CA 2Z95A 2C2YA 2FJUA 4J03A 4KH0A 2CHVA 3TTUA 4CLDA 3E8MA 1Y3CE 3IGFA 1XZHA 2NSDA 3UUFA 1NKTA 4EFMA 3V2HA 5I3CA 2M1XA 2O8EB 1JQDA 4NF2A 1SUAA 3GQBA 1V8DA 4MS3B 1S2MA 3U3MA 2E6UX 1VPEA 4LF9B 2PIDA 3P0IA 5AD1A 3BD7A 3GH3A 3ZV6A 4U3JA 3AP2A 2R6GA 3OCYA 3TD6A 1BHJA 2ZUCA 3ZDFA 4WWHA 4YRGA 3M5CA 4R69A 4U02A 1WY5A 1LLUA 1IWOA 3W4KA 2O8DB 3H5AA 3I6ZA 4RMIA 3S2FA 3WLIA 5I5GA 5LXTB 1IBSA 1UJBA 3WYAA 4RZHA 4KMSA 1R6VA 2HWWA 3I45A 2VCYA 1ZG3A 1CY2A 3JTMA 1VOTA 3OJXA 3RS0A 3GAZA 5GZ6A 1WXDA 2Z4RA 5C8ZA 1PJZA 2OV1A 1YE8A 1BW9B 4RIIA 5E6RA 1WZ2A 1VMDA 5L7TA 5EKTA 2D3TA 4UHHA 1Z2EA 4X6UA 5CB8A 3AEUA 4A36A 4IL5A 4O1HA 4RLFA 2VSNA 1F17A 3HB9A 1LGYA 2C3UA 3ORRA 3E8XA 4JFAA 2JB9A 4Q21A 3SS8A 5CB0A 3PE4A 1F0NA 4HJXA 4KDFA 1XF9A 1DUIA 2EJTA 2Y05A 3PZRA 3QLVA 1QMPA 2Q7DA 2C2ZA 1D03A 5A06A 4DAOA 4Q00A 3DMNA 3W06A 3HYNA 2PUDA 1YDHA 4UU7A 1ONOA 2I3AA 4C4AA 3OC0A 5C7IO 3IEUA 3K5HA 5AIBA 1HYHA 4O33A 1US8B 2NX2A 1SCUA 3KQHA 3R5TA 1PX0A 3FJ1A 1H5QA 2OUIA 1L7VC 1U2GA 1K68A 4BO6A 2ZJ2A 3AKEA 1Q7GA 3JD2A 4JKYA 4Q4AA 5DW0A 1X13A 3H9JA 4I8XA 3ANXA 3OU6A 1DHTA 1NOIA 1SGWA 3GNSA 1GL3A 3DWIA 3WSTA 3CX7A 3F49S 3H0EA 3ODPA 4YCCA 5K5EA 3TSCA 3MTEA 2YN4A 2FFHA 4TSRA 2QL5A 3ANYB 4XW2A 4DSTA 4UCQA 5JMWA 1VM6A 4MUXA 4UDOA 4WTOA 2V0GA 1I3KA 1DGQA 4MV7A 2QN6A 3VPBA 3EFEA 2Q50A 4PVCA 4P3XA 4PPYA 4ED9A 3PQFA 2BUAA 3DL2A 2XYHA 3EYWA 4JLBA 4CU5A 4D0LB 4G25A 1BD4A 1QKKA 1T6ZA 4O59O 4XDGA 1Q1GA 3FCEA 2RC6A 3B2NA 4IH1A 3HJFA 1NDUA 1SEPA 4PC1A 4OLJA 1BU8A 1UXKA 3KSZO 4B3FX 3BXXA 4IDEA 5ULLA 3T12A 2OG2A 2GWRA 2DE0X 2J5QA 2XDQB 1X8LA 4ER0A 4L85A 5IFLA 1KI2A 1EM8B 4ZZIA 3L40A 4I1UA 5FL3A 2B37A 2W83A 4X94A 2G0NA 3DFUA 2QPAA 4FCTA 3GP8A 4ZI7A 3VUFA 4MUJA 1KEUA 2WHQA 3PFGA 2J5KA 3CUEF 4J9VA 4W9NA 3X1YA 3I5XA 1GPLA 2C1ZA 5H9WA 1G38A 3L4BC 3I9MA 3PX3A 4JJZA 3VR3D 4LG1A 1DL5A 4LF5B 3FFTA 2EC5A 4J1NA 4PVDA 4J3NA 4KLZA 3COPA 7ADHA 5EHXA 2FJ0A 4TLMB 1HE2A 4WNIA 1KMCA 5LNK6 4MEAA 1GDTA 4EMTA 2E0IA 4X64B 1EVKA 3AERB 3EZLA 4J2HA 4Q05A 4BNVA 5BN1A 2P90A 1NDHA 3ANMA 1TMYA 4IJQA 4DN6A 1SPXA 1PQWA 2FUG1 4JP8A 4X8MA 2EEPA 2HMVA 5D3KA 5CA1B 3CVYA 2ZXFA 1SHZA 1EGVB 2LIPA 2OOSA 3MCVA 4MRSA 3IAEA 1LBHA 4GBMA 2DKOA 1CEEA 5KVSA 3PGA1 1R74A 3R4CA 4RL4A 1GTL1 1U28C 4ZARA 3T61A 1QHGA 4WOKA 4CHTA 5IDWA 2VRNA 4YRMA 1EG7A 3V7NA 3CKKA 2IYFA 1KS9A 2YWBA 3A6EA 4V0LA 1KQPA 5EWMA 1DC8A 2QRVB 1U65A 2BHNA 2QW0X 2Y67A 3EVDA 4NMLA 1Z7WA 3KSMA 5GAJA 4Q3BA 5EHIA 5DX0A 4N5DA 4EF6A 4HZUB 2C4NA 2PFGA 3ZVRA 2YXPX 2P0YA 3ROFA 4OY3A 4RAQA 3ZNOA 1L7RA 5AJYA 3K72B 4HLNA 3SHTA 4I08A 4E5UA 1UOOA 3AUFA 2HFJA 3A6DA 5EGNA 4GXTA 2CE7A 2GJ4A 3KAKA 3UT5B 1IJFA 1P74A 1VMIA 2EBFX 3JAWB 1USGA 1L4YA 2FSGA 5EWLA 5BSMA 2AHOA 1HYBA 4W8HA 5CT4A 1JW9B 3VAAA 3V46A 4MROA 1VMEA 3WK4A 4QUHA 5FUVA 3K16A 4OGLA 1NZFA 1QPBA 2J6IA 4JEHA 1K7YA 3RVSA 3M3HA 2B2NA 3UV3A 2FW1A 3LH5A 3SR0A 2CFOA 1Z39A 3CHYA 1P7CA 1NMQA 3HVJA 5D01A 2RDMA 5IZCC 1CG6A 3TTYA 1OBOA 3DKKA 3QKRB 4G97A 4UNSA 3OKAA 5HE8A 3W5VA 5P8WA 1GZSA 2NTVA 3DFKA 2HWXA 3ZY5A 3IDAA 5LQRA 4KE8A 1C3EA 4E33A 1C1HA 2G9QA 3A2MA 2ID4A 1GKYA 3R76A 3W5DA 2ZAIA 4Q9LA 1GL9B 2FMKA 3ZK9A 2C5SA 1XCGB 4XOIA 3ZJYA 3VSEA 3QIVA 3TBHA 3K4PA 1QIHA 2R84A 3LF1A 1HG0A 1CIPA 3IBFA 3MJSA 1SKYE 2YC4C 2DP4E 4KFTA 1X1BA 1ADFA 1K2VN 1NUHA 3DMRA 3JQBC 5J2TF 4D6XA 5JAPA 4R68A 2DBRA 2I2DA 4PTZA 1E1DA 4TQAA 2H1OA 3REQB 1XL0A 4JITA 3UA3A 4NYIQ 1MP0A 1T34A 3LOUA 3N1UA 3SF8B 1SUDA 2CBXA 5JS7A 5G40A 3SXJA 4B44A 5GZ3A 1NVGA 3UAWA 4CR7A 2J9GA 3MGGA 4HQ6A 1M2OB 4LPKA 4Y6PA 4YCSA 4MXDA 5JZVA 4YO7A 3DVLA 3G88A 1FCJA 4J2OA 2VWGA 2HJWA 1IOVA 4U7JA 1DKMA 2C7OA 2W7TA 1UT8A 1XNGA 1MOQA 1MB2A 1IMJA 3NRJA 1P4GA 4LK3A 1I4OA 2YHBA 4TKUA 1G291 4M7WA 1G6Q1 1OXBB 2V8OA 3NHUA 1IN1A 4YAOA 3UK1A 4UMFA 1SQ5A 2DPYA 3IUPA 2GM4A 2RGYA 4MWSA 2VBFA 4FGKA 4E0BA 5HIKA 1ZBQA 2J4CA 4BNTA 5DM60 1E0KA 2OT3B 4UU8A 2QI9F 1AS0A 2HHAA 2QL6A 3KRTA 2H31A 3I83A 2ECQA 3C3XA 2O8VA 3GIDA 3R3WA 4WCFA 1Y1LA 4MPPA 3GLKA 2YVKA 1OX4B 3V1YA 5BPHA 4PBRA 2HXGA 2F3SA 3QUQA 4WXEA 4XEHA 2ZIZA 2FPGB 2OHIA 3AHJA 1C9MA 3NOQA 4BQPA 3R6GA 1RM0A 4S3MA 3ZLTA 1HL3A 1N2XA 2CDRA 4FFLA 4N9WA 4P1ZA 3TSWA 3LECA 3VI4B 3FNFA 4EW3A 4H2DA 3ROTA 2FSVC 1NXVA 3UPDA 4NYIR 1JIIA 4ZU3A 2VS1A 1PNVA 2JFWA 3DOHA 3IERA 3I4FA 3MIIA 4PZYA 4X84A 5TPZD 5T57A 3S1SA 3PZBA 1WVGA 5ERYA 1LH0A 2WJ4A 3M1LA 2BM9A 1XBTA 3SC3A 1RQNA 2ASVA 3I09A 1K0FA 5A03A 3NORA 4GE3A 3M0EA 3W90A 1U7TA 5AESA 3CH7A 4WOPA 2RGRA 4K1XA 4X5OA 1MJHA 3BRWA 3SHWA 3GF4A 4ALJA 5KOHB 2A35A 4X95A 5EN4A 3TXAA 2W6JD 4RPIA 4LOJA 1V8OA 5BXYA 1BQ4A 4I4TB 4D79A 1Y1TA 1DKLA 1MB0A 9LDBA 3R3HA 1LQ2A 3QIAA 1DFIA 1WZCA 2DH6A 2GNAA 2ZRCA 3QOYA 1G6KA 4QIHA 1FPQA 1U8AA 5AKXA 3WAGA 3ZVMA 1R8QA 1FTSA 4UARA 3AUTA 4DQLA 2DHQA 1MHPA 1DQNA 2QG4A 3Q7IA 2BGMA 4ON9A 3FR8A 1MEJA 2ZTUA 2ICAA 3BTVA 4KGZA 1EUDA 1AIPA 5E7IA 1Z6QA 3RBXA 3RSFA 5L95A 5HFNA 2HSZA 3I64A 3VPDA 2HWUA 4MZXA 1N9GB 1OI4A 4RBNA 5LUBA 4C76A 3W8DA 3SIWA 1RP7A 4UMEA 2GCEA 4ZODA 1DE0A 5A6SB 4XD7D 1I2CA 1VRVA 4LV6A 5IVIA 2JLXA 1ZUD1 1SOAA 2JC3A 2WM8A 1B41A 2WSYB 5KQMA 3QOFA 1K97A 5M5BA 1X1AA 4NY1A 1Z6ZA 3KR1A 1KGDA 1S8FA 4U6QA 1VJRA 3FVWA 3T3MB 3TLAA 4GBGA 4LSZA 2M2IA 2E89A 4I4LA 1KAEA 2XXAB 3PWKA 3FI0A 3PQ6A 2OAGA 2BGUA 4CEJA 4RLQA 1P2DA 1XTKA 1JQJC 1Y37A 3PHIA 1FVHA 4PEVA 3L05A 3SEAA 3TSZA 1M2WA 3G9QA 3K94A 1DJQA 3WK8A 4TT3A 1KBQA 1Z0UA 4QATA 5KOIA 3SZLA 3AU9A 1LI4A 3SCZA 4FVTA 1K06A 4QJ3A 3G5UA 3GJTA 3JYPA 2PRZA 2BFNA 3CY6A 1JSRA 4LNAA 2B6HA 1DG9A 3MFYA 3EGIA 2D1YA 5ARCA 4C4YA 5JNVA 2ZT7A 4R41A 5K8IA 3KWMA 5HIMA 4ZDWA 4CDMA 3BMNA 5CYGA 2O8DA 1S7CA 1AT1A 4LOHA 1QH9A 2AN4A 4L0DA 5GGYA 5BWMA 4FNMA 2IA5A 1STOA 4W1PA 2JFNA 3P9ZA 2XGGA 3HDTA 4OJQA 2X9VA 1BCSA 5LKAA 1KK3A 3UAYA 1GNRA 3HCPA 1DMRA 4N01A 3KL4A 2X2EA 4ESVA 2W2XA 5DLYA 2ZYGA 3ZD6A 1ZIYA 3AETB 2BBWA 1KDOA 2B2XA 1J33A 1SOUA 1Y8RA 1Z25A 2AFHA 3B8EA 2PHZA 3MWDA 3R0ZA 4HGNA 4C05A 2H16A 2XLCA 4J0JA 1XU4A 4RK0A 4CN9A 1Q0TA 3LG2A 3CJQA 3TLGB 6ABPA 3SQWA 2XYGA 1TU0A 1XZDA 4B3CA 5JDCA 1AQIA 2C3YA 4JYAB 1UJCA 4QBFA 3FJOA 4BNNA 3KS9A 4ZMSA 4A91A 1NGSA 1V7ZA 1IU9A 4RS4A 4DLLA 4OQ4A 2AF3C 3C0KA 3JWEA 3EE6A 3P94A 4QPNA 3STTA 3UMSA 3EZ2A 4TUYA 4D9IA 3AUXA 3UA4A 1FRFS 4HGRA 2ZUDA 3BCSA 4LF8B 1B8UA 3JD0A 4DDUA 2ZG6A 3NU1A 2E4AA 1MAUA 5DYNA 2B1IA 5EYPB 1JILA 3NWPA 3QF4A 4M8SA 2ZIXA 1CUFA 1SXJD 2CZGA 3WBJA 4EH1A 1YJQA 2V7UA 4W5NA 2IHYA 4L5IA 2J30A 4DJAA 3VKHA 3C5WP 4NATA 3BXGA 1C8VB 1R6AA 1SPBS 1Z16A 3JVDA 1PN3A 3STXA 1Y6FA 3I1YA 2YWHA 3O74A 1UMBA 3NH6A 3ZWPA 1XZGA 3RF6A 3SC2A 4GEGA 5KIAA 3NWJA 4KHZA 4YAGA 5AVTA 5FUQA 3I62A 1FDWA 4G8CA 1TEVA 3N70A 1EFLA 1DIRA 4DLBA 1Y7LA 4RGBA 1TFRA 3KR2A 3OX1A 5DIFA 2B7LA 1YJ5A 3G5TA 3PF9A 4BRZA 1AA6A 2FTKE 1XPUA 1BFDA 1U90A 1Y4SA 4O25A 2R1TB 5IH3A 3HJUA 4DSOA 2GTPA 1L4UA 1IZZA 2GHIA 1SQGA 1JG7A 1XDDA 4MX8A 3EQZA 4O8CA 3UB4A 1ZGZA 2R68A 2FY8A 1OVGA 4G65A 2AXEA 3CJRA 1B2RA 3H5IA 3ZE2B 3HB1A 1NPDA 3F4LA 3LIIA 4G2NA 4MOWA 1U0NA 5EMKA 1TF5A 4QDUA 1BS1A 1C7IA 1HOXA 4QU5A 4X1YA 3JQGB 4AJKA 5HW0A 4HUTA 2BEVB 5KU7A 1I3NA 1I4WA 3UUEA 2ERXA 3ZWDA 1Z0SA 2HPHA 1YACA 4RF4A 3DW3X 3A6HA 1G17A 2HBQA 2VI5A 4YWHA 2ORED 2VRCD 2Y3IA 4CM1A 2GCPA 3DZKA 3S99A 5KQGA 1W47A 1XT6A 2C9ZA 1T8SA 2Q0HA 2YHIA 3IEKA 2ECFA 3ITDA 2VF5X 3ZCTA 5FTLA 5JHHB 3LXUX 3ZE7A 5JATA 2WLSA 3B48A 1K9VF 2APJA 3AGQA 3KAPA 3NRCA 1I1QB 2G0TA 4RZ2A 3RWOA 4C03A 3Q3VA 1X0VA 1GAXA 1YRHA 4EJMA 3K31A 4TS9A 4MQFB 4F91B 1QNLA 3O8LA 5F5NA 2PMDA 2PX4A 3U5ZB 1UDAA 2KQUA 4RTLA 3FOFC 1QAQA 5EESA 3M33A 2LNDA 3T3DA 1KI6B 3HU2A 4FC6A 1PDWA 1HFWA 2P3LA 4EO7A 5LB4A 1BWQA 3W2IA 2FF5A 5FEUA 4LWPA 5IYZB 2E49A 4EO9A 1FMTA 2DKFA 1OXVA 2RK6A 1P4HA 3GPIA 1ZJ6A 3CB4A 3DDSA 2AXPA 2GEFA 3P2MA 3PT9A 4C2BA 4LJ4A 2QRLA 3P2IA 3THWB 2G0AA 2C31A 2EZ4A 3CPJB 2CUTA 1JR2A 1YFKA 2J9ZB 3EJWA 1OAOC 3IO3A 5ECYA 4F6RB 2F8TA 1RHKA 4OXNA 3PRYA 2WMYA 4MR7A 2VDRB 4NKRA 4R6XA 4V0ME 5LLTA 4DDTA 2K6GA 1M34B 2XNCA 1NW5A 1YKFA 1JIJA 3B1YA 5KCMA 1IQPA 3WK6A 2QGFA 1X7YA 4IWNA 2AD1A 4J0IA 2PG3A 2O5RA 2QBYA 1TNDA 3V7YA 4GL2A 1VLZA 2RI0A 4XR4A 1A9QA 4WLNA 4YRTA 1RMTA 3ZDRA 1E92A 1F6DA 2ZBPA 2JD1A 2P6PA 1DXYA 1I0LA 4MR8A 4JI1B 3P0HA 4CFZA 1NT4A 3NTRA 1UBHS 4PX2A 3OCVA 2PRKA 4Q3KA 3F98A 1ZWKA 3WSWA 2PTGA 3RCBA 4IDOA 4MR9B 4KPUA 2DPHA 3GT4A 2PUEA 3KKQA 4D0RA 3LUHA 4YMWA 2V55B 2ZBVA 2A58A 2IV2X 3Q0IA 2HJ9A 3O1JC 4W5RA 1WDTA 2AMFA 3TEFA 4RETA 3H18A 4F9TA 3BWYA 4MB6A 5C3UA 4ZOLF 4AJEA 2JAQA 2O8CA 1EVYA 1SC6A 3AUAA 3UN1A 5K0FA 4WEOA 4X71A 3O83A 1OQAA 4RFSA 1DB3A 4LDPA 2Q6TA 3BFPA 2YWCA 3C6MA 2F2TA 1FF9A 4HEQA 4AS3A 3R74A 8AT1A 5AW2A 1GIAA 2QZ4A 5EAIA 1DIBA 4E1BA 4MARA 4IIHA 2Y9MB 3BCUA 2RI1A 3TRKA 4KQFA 2WJZB 3DZCA 2R62A 2BTOA 3N8IA 3P5SA 3A10A 4Q3AA 4IDDA 5CGZA 4YDHB 2X6TA 3OJLA 2JKZA 1FDVA 1X7WB 3X2EA 1DKNA 3DO6A 5C8XA 2YS7A 4PZEA 3A31A 1QIIA 2X8LA 5J5CA 2QRNA 1PJTA 3OD1A 1LSUA 2XTNA 4WNCA 121PA 1U8EA 3OPNA 3AW9A 4CQMD 2WJVA 4EGFA 4JZKA 5KJCA 1GLNA 4NARA 2W98A 5KPJA 1ZXBA 1UBSB 4BJ3A 1DJPA 1SKYB 3A25A 3EQ9A 3HXMA 2FW6A 2GLXA 4GR5A 1Z56C 1OWOA 4BIIA 3MRTA 5A4JA 2VT7A 2GWHA 2WSSD 5JROA 3TNDA 3CF6R 5CTJA 1PZXA 2YWDA 3WJ2A 4AB1A 4C43A 1KY2A 5KTYA 2PRSA 1TLFA 4R5MA 2A1TR 3BFVA 2CMDA 2HC9A 3I5YA 4YJFA 2KW5A 1ST2A 1A9XB 1GTVA 1UL1X 1PNQA 2O2HA 2XR1A 2ZU0C 3W2EA 1XTTA 2IPNA 2QLNA 2ZKLA 3F6EX 3GFVA 4NV1A 3WK5A 1P0PA 4DQ0A 3B9RA 3SFZA 3LWDA 3QPVA 4HPWA 1LXCA 2A4KA 1MQAA 2ZT6A 3QA3E 2OV2A 2ZJ0A 1M9NA 2OENG 3P0RA 2OR3A 4JVNA 2P4EA 5ALGA 3ZJ4A 1MJGA 4UQPA 1TZJA 4QOFA 5DEIA 5BY2A 1U3VA 2IH4A 2W0MA 2JHPA 4Q9NA 1EINA 4MGIR 1Z5WA 1NN5A 2DULA 3DOOA 1EHCA 1HURA 1TTHA 3SK0A 5IABA 4RCYA 2WPNA 3BDVA 3IDQA 5EWJA 3V1NA 4AP9A 3R41A 4OUDA 1E7YA 4ZKDA 1P72A 2PBZA 2JIZA 4Q9DA 2RC5A 5DHAA 4QICA 3VV2A 2VPWA 5JBNA 5ALEA 3N75A 5CX4A 1XLTC 3PVSA 1GM5A 4P9NA 4MVJG 4HQKA 3TVDA 1Z29A 2I78A 3ADPA 4ZCIA 4D81A 3AVWA 3RTGA 1CFZA 1E5QA 3F8SA 4ZGBA 1AURA 2OILA 5SZJA 2Z5GA 2Z8YA 2VJAA 3L7KA 3LCUA 3VFDA 3IAS1 5TPWA 3LPCA 1TTPB 4M38A 5J4VA 4J0CA 1Q0RA 5KTSA 1BXGA 1GL7A 1D3AA 5JISA 2RK3A 2GHRA 2QLBA 2VYND 3EYAA 2C5EA 4RHTA 4M6WB 4XCQA 2B4KA 4ECAA 4M1OA 4Q03A 5DB4A 3BWVA 1V3VA 1D6JA 2Z56A 4YUAA 1YA6A 4CEIA 3LZCA 3QYAA 4EB8A 4OJYA 1IY8A 1M1YE 2XB9A 3U3KA 1PJ4A 1GO2A 3E6AA 3H2JA 4PRLA 3ET4A 3KWFA 4PXSA 4GS5A 1F8UA 1P1HA 4WK2B 3NHSA 4P2BA 3SIXA 4Q4CA 4UUPA 3QHAA 3MCTA 1V25A 2CDCA 4I81A 5JMOA 1L4NA 4LZJA 5BV0A 3PC3A 2YCBA 2BFEA 2ZI7A 2IU4A 4TMXA 5BQFA 2VEOA 2AT1A 5LQMA 3GJ8A 2PLWA 4F12A 3WGUA 2CMFA 3H16A 3EY9A 4DDKA 5HZHA 1CUAA 2WI8A 5ENZA 4RMGA 2B9EA 1HRDA 2OSVA 2IYNA 3T41A 3FOEC 5ELLA 2QXYA 1G5HA 1L7PA 3IKMB 1DC7A 4FB5A 3TQIA 2IYEA 2QMZA 4GRDA 2GI4A 1KP9A 2H7VA 2OM2A 4LS3A 1TCBA 1DG3A 2XUAA 4O0LA 3QVMA 5K3AA 1PYGA 2G8NA 4RHYA 1GG2A 4DJEC 1YZTA 5IEJA 5K6AA 4WT7A 1T0JB 2C7PA 4DUZB 1DAMA 1EBBA 3KQSA 1QIFA 4EFNA 1IONA 2N46A 1A8QA 1D2RA 2C4VA 4G0PA 5F7OA 4RZUA 4BO9A 1B42A 4ZHQA 2PX2A 5EVJA 3F7NA 4FYVA 5C34B 4MINA 2KE5A 4NZYA 4A8JA 3GLRA 5HS6A 3V4ZA 3GJRA 1SCNE 3K73O 4D99A 1DMSA 3FSRA 2RHHA 5C8YF 2ZZKA 1W8DA 3E9EA 3IVCA 4X1KB 5EE1A 2X1MA 3AYXB 2Z5LA 4Y6LA 2R751 4WLEA 4DIBA 3MHPA 2VZLA 4E4TA 2B4RO 1YIOA 4Y2XA 1LC0A 3LVBA 1T9GR 2BE9A 4ROTA 4ARVA 3TO5A 3CRW1 4CKXA 2H1HA 1EFRD 2V7VA 4ISBA 1I01A 3DG9A 1AQ6A 1PKEA 4QSMA 4JI6B 1XZQA 4CNQA 2R66A 2AOUA 4RD0A 1TK9A 3EZFA 1IOZA 1ECLA 4DLUA 1XEXB 4YASA 5HJ7A 1CRWG 5IT9A 1GCUA 3ONWA 2XEDA 4YAJA 4B6JA 3EWNA 1V9CA 1N32B 2POQX 4IVRA 4M0EA 4UQOA 3WKBA 2JJ1D 3GHHA 5K8TA 3UT6A 4ZYLA 5E95A 1K6EA 1TZKA 2HK7A 2MINB 1GQOA 1PFYA 2FZKA 2YBEA 4OFXA 2QVLA 4W6QA 4Y2TA 4YMIA 5EXXA 4GFDA 1UJ2A 2BFDB 1Y8QA 1AGXA 2ENUA 3Q41A 3K8ZA 3T15A 3ASUA 2C8KA 1MBZA 3FJYA 1C1XA 3MWKA 4P4GA 3KQNA 4QG7A 1T8YA 4J0EA 4II3A 4R1UA 2OD7A 3AEXA 1B00A 3KKEA 3EC7A 1ZINA 1CUCA 3VOSA 3S81A 3M2TA 4D9BA 2Q9AA 4U2BA 4DXAA 2PN1A 3RTBA 4HNVA 3MAGA 4UJ5A 1JT2A 3LT4A 1IEWA 2F43B 2CMGA 4I7EA 4EGSA 1QM5A 3FPFA 2VPZA 4L74A 4DV0B 4TMYA 3AJ8A 4HH1A 1KDVA 2CVFA 4EAQA 4KR2A 4H35A 1QANA 2B3TA 5JSHA 2SKCA 4HAZA 2BMEA 3QI7A 1TAGA 2PA3A 2DC1A 3K0HA 3PJEA 3HP7A 3UJDA 1LBSA 2CVPA 5FO1A 2FHSA 3QFRA 1A2OA 1N6LA 3NHJA 4LV8B 4R7ZA 3ZHZA 4M1KA 4RCZA 2O3RA 1L8XA 5FA6A 2VDWA 4GPAA 1GCAA 5C31A 1GN9A 1QO7A 2JGJA 1YGPA 4OGGA 4QPJC 2XWJI 1R6BX 2G1UA 4WEQA 5KSZA 1UC9A 4N18A 4Z1MA 1KAHA 4XARA 1MJNA 3RYFA 4D8VA 2E48A 2FKAA 2YQZA 3AYZB 1XCMA 3A70A 5CVJA 4DLWA 4RNDB 4YRBA 5JYBA 4U63A 4JH0A 4X00A 4CQLA 1Q0UA 1TJYA 1Q7EA 1RWOA 1PU2A 2W8BB 2RGNC 1CBUA 2RHOA 3JASA 1CUBA 1P1BA 1D0IA 1RAAA 1U0GA 1T9KA 5KTMA 1HXHA 5TMEA 4G1MB 4BHTA 1NAHA 1QS0B 4YCLA 3VKWA 4DV7B 3T4XA 2R3SA 1QK5A 3GOHA 1A9OA 4PZAA 4ZAYA 1VLLA 4U8GA 2AKAB 3ZDCA 3GT3A 3OLQA 5AVJA 1XU7A 3JD1A 3WMEA 4DJFC 4Q7EA 1O0CA 4JEMA 1CY7A 5DXFA 4UDYX 4FXOA 4Y1GA 1FLDA 2JVIA 3F3MA 4RKEA 1KNQA 4CETA 5LIRA 4PLPA 3M6LA 4O4JA 2G1AA 2PGOA 4JMPA 2JH9A 4TV8F 2QQ5A 3DYBA 3OZCA 3PC4A 3IE0A 4F4HA 2PJRA 3REGA 4BVFA 1YMVA 1YVRA 2HMAA 2QORA 3HU3A 1HOTA 2G4VA 4HYQA 4PNPA 2P9TA 2H5LA 1JR6A 2C5BA 1TYCA 1NKSA 2OGWA 3A04A 4JXKA 3MGAA 4U6NA 3A58B 2HTFA 1Q5PA 1XTQA 4QLOA 1YR6A 2C5AA 3ZQKA 3CUWA 4X7MA 5DLPA 4ZMRA 2VEDA 1W5SA 4GX5A 4MMYB 1S8NA 3ANNA 1MABA 3A1NA 3DBHA 3BORA 1HTBA 4MPJA 4OJKA 1E1CA 1LTKA 4ES6A 2I6SA 1XMQB 2B1RA 3H87A 4LJLA 4YT4A 5EMMA 3OSUA 1RXVA 2CBGA 1ORHA 4KNWA 4FGJA 3O0TA 2RAVA 2F3PA 2A9FA 3WQSB 1V35A 4IIDA 5HBRA 1I2BA 2GR9A 4B8ZA 1TJNA 2IHTA 2WU4A 1L7OA 5F35A 4AWBA 4CG1A 1SCIA 4XJXA 2QNBA 3JR3A 3HJGA 3UB3A 1ATZA 1HH4A 3WFIA 3WIVA 2CV0A 1NWHA 1JECA 5JECA 1U0EA 3FBGA 3P9CA 3L6RA 2IELA 3QFHA 3ZG6A 4KZKA 1GPH1 5LYJA 1HMYA 2PXHA 5FF9A 1QR2A 4PZLA 5KYUA 3LJKA 4ZJUA 5A7GA 5T6BA 3KOUA 1P8AA 3K5PA 4M98A 1G6HA 1JXAA 3MILA 3V8BA 5C4MA 3KD3A 2PJZA 5CPFA 5ALNA 2G4LA 3WFZA 4BUZA 3H9EO 2IZ7A 4YPOA 5HTOA 4GICA 1U2RA 5DHUA 3KJIA 3KJXA 2CUZA 1RQPA 1UOEA 2A1UB 1P2GA 4AUNA 1Z4QA 3PP8A 3WMRA 1OY1A 3WWOA 2XQJA 3MZ0A 5KYYB 1WQ4A 2OVFA 1CUSA 1M74A 3EXEA 4JFRA 4JOBA 4TT8A 4ZVNA 2D4HA 2W93A 1GSHA 1JVSA 3T5MA 3Q2IA 2A9JA 5KHAA 3X1KA 3PVZA 3KB2A 5TARA 4EM6A 4YXFA 4FSDA 4XYBA 3VNBA 4TV9B 1VI5A 1Q20A 2P2NA 1E4EA 1JAXA 3BRQA 4AY4A 1U8ZA 4AI6A 1J8YF 3X1WA 2ZI5A 3BS4A 4HAOA 3ZD7A 3R6LA 1YBHA 2A92A 2YZ7A 3G9ZA 2GTIA 3IX7A 3MWLA 1GPMA 2QEQA 3CVXA 4HATA 1WHTA 4WY5A 2IZOA 4BKMA 4WH0A 4EMSA 2GK7A 3IELA 4FDUA 4NECA 2XUIA 2VOJA 4N40A 4KH1A 1Y81A 2GXQA 3IQZA 4OHKA 4D8YA 3DKIA 3WL6A 5EJMA 5EUMA 4DDVA 3DE2X 2B4YA 4MS4B 1QPGA 4EHBA 4PSCA 1VE7A 4KXWA 5CG2A 2QUJA 4RJJA 4ADSG 1T5HX 2BFMA 4CCWA 3FNQA 1BAPA 3TNLA 1MFPA 2CJWA 3W34A 3SLKA 3VVCA 3VHXA 3B1WA 2P9HA 3I2HA 1E6UA 4DF3A 4HH4A 3L9XA 1DTWA 3N3AC 4OGWA 3E5MA 3T8YA 4EVSA 4IIXA 2D4AA 3U7HB 1OHHD 4BFUA 1MO2A 4UJ3A 2C5HA 1JDJA 5LKRA 1ULSA 4WQMA 2LIVA 2VSXA 3HVUA 3IPXA 1VIAA 1VA5A 3F6PA 1Y3BE 1B0PA 3W9UA 5CCBA 1VRWA 4ZZ1A 2J32A 4G9BA 3EGOA 1H69A 3SLRA 3SJAA 4B35A 4H31A 4K9PA 5LL6P 3T7DA 3KIPA 4CUZA 5BV1A 2WYUA 1Q1NA 1YVUA 2LCFA 3P1JA 3C3YA 1PSWA 1CE8A 4J1QA 3CNOA 5G02A 1JQBA 1MOSA 3PQ5A 3Q98A 4DCUA 5EL0A 2C7BA 3IB3A 2COUA 1DWUA 1QH1A 1L8QA 4ZRNA 1NUPA 5AK5A 4CHGA 3IBTA 1E3MA 4N0MA 1TU4A 1TQ8A 1Z2OX 1Z7GA 3SFVA 2DZDA 3TE7A 4RVGA 2ALJA 2NU8A 5KI6A 2Z2KA 1RYNA 2VOEA 3UHJA 3ZHQA 3H1PA 1E1RA 4MJXA 1KXJA 1NVBA 1YRWA 3JQPA 4O6VA 1OXUA 3WQHA 1LPAB 4RHEA 4MP3A 1CNFA 3BFJA 1ZZEA 1DDGA 2EZUA 2XQKA 3ZV3A 4B85A 1RAHA 3FNGA 1UWKA 1AKRA 4TYNA 2R87A 3RYHA 1BGWA 1NW9B 1XVVA 3DMDA 3ICCA 1I2ZA 3LKZA 3U9TA 2CWDA 3E3MA 2OQIA 4EECA 1EXDA 3R3ZA 3ZCPA 3CNBA 4HAVA 3NDRA 4OD0A 1E9DA 4YLYA 1E9AA 3L4BA 1DKPA 3AHHA 3OFJA 1E5XA 2CJPA 3REFA 2ZZMA 4F4FA 4I1SA 3ORQA 1E4YA 1Q11A 3Q6NA 4MI6A 4UREA 5JS2A 4CM9D 2HW8A 5JFGA 4G67A 3OAAA 3RSZA 1O97C 4NYJQ 3WLHA 2WJ6A 4BDTA 1V1RA 3B53X 3GRUA 4OMDA 3DYVA 4L9RA 1WE2A 5CDFE 4Q4DA 2IZ6A 1TO2E 2VUIB 2VCHA 3GG9A 5DTMA 4Z0HO 1LW7A 1TPZA 1Q7RA 2VK8A 1JFRA 1Y4AE 1QWSA 1IXKA 2HYDA 1HK7A 1NE7A 3C7TA 3LBFA 2MCFA 4BTLA 2XY4A 1GEEA 1V8PA 2E1PA 2FRDC 2BTQB 2J0UA 1K86A 1WMEA 3GK3A 3EIHA 3KX2A 4PV7A 1N8TA 3UWMA 3V4PB 1R37A 3G7UA 4PR3A 4YRRA 3DM9B 1UOPA 1KE2A 4B2LA 1KRHA 5CRIA 3NEPX 4CRWB 3AWIA 1KAOA 3OX4A 3BIOA 4JSTA 4RU1A 4YJHB 5G0VA 2GFQA 3HCNA 4E2WA 4CL0A 3DDUA 4G26A 3STHA 4UBNA 1RQRA 2AN9A 2WZBA 3QYJA 1RYDA 2Z1MA 3T9BA 4ZVOA 3ZLJA 1QUFA 3Q6MA 3GDFA 2E6KA 3CLSC 5ENDA 5EY5B 5T7BA 1MT3A 1X2EA 1XCLA 2NSYA 3R7WA 5IN5A 4NYJR 1TX4B 5CH3A 1CR1A 1JIVA 1XROA 3H1GA 3H9UA 4ITVA 2JCGA 1N6HA 1FDIA 2JDID 2XZDA 3EG9B 1BE6A 2OFWA 2UZ3A 4K9QA 3BHIA 4E4YA 3OURA 4R3UC 1WOYA 2OHJA 1K66A 3NHRA 5HHTA 1QJCA 4X9XA 2D2EA 6Q21A 1J1IA 4P31A 2LV8A 4J7AA 3D1LA 4B33A 2WDZA 4NAUA 2AV6A 5D5HA 4LF7B 3L8YA 1N8SA 4HEA6 3D4NA 1WOMA 4IXTA 4JI0B 2FEKA 5D1NA 4BNGA 4W5HA 3U3RA 1SQ0A 3WIEA 4CLEA 4HBGA 2NXCA 1G1MA 1A77A 2DH5A 2XMBA 4QTXA 4XLZA 4C0BA 4JJ4A 4RC9A 1EJ2A 3ACCA 3RHZA 4YMHA 4F2PA 1CQJB 1G8MA 4OQEA 1G8KA 4CKEB 1OT3A 2OWEA 2NTJA 3IOCA 4PYRA 4EY5A 5DP2A 1RYBA 4WXHA 1Q0HA 5BWLA 3NMUF 3OKCA 1CVLA 3WJ1A 3V6LA 3JQBA 1TM3E 4O4LF 1IEXA 4OXYA 4KWIA 2HIMA 3TW6A 4F9GA 3UV6A 4K9MA 3I0NA 3MEQA 4FYJA 5IT5A 5JD5A 4OYYA 1KU0A 2Z2IA 3M1AA 1B3RA 1YZYA 3FWYA 3K0CA 4KGXA 2CXOA 2HA7A 3REOA 1GZUA 1MJ5A 4B6SA 3U4QA 4FBGA 2NTEA 3TM5A 1LD3A 1VG1A 5JVDF 2GM5A 2EEZA 2YFHA 3L6CA 4IIYA 1XZNA 3HV0A 4QT0A 1V1MB 3UZUA 1H4TA 5JCXA 1TK3A 2G88A 2JAHA 2V74B 2HSDA 4F4UA 2M6RA 3ANTA 2ZPUA 5H0IA 3TWOA 1FVFA 3BMOB 3ESYA 5A05A 3QUBA 1UKBA 2Z3VA 3UMFA 3FLEA 4P80A 3VPGA 1CS4C 3E3AA 1RQLA 1EB9A 1NUAA 1ZSVA 3KLBA 3RHFA 3LZ6A 5ICMA 4AJIA 4F2HA 4KQ2A 4M76B 1C7QA 1SZDA 4R16A 1X7ZA 2JLSA 3OO0A 1XZ8A 4OQDA 4MULA 4WFKA 5J4HA 2CGEA 1RPJA 4B3GA 3BVPA 2O06A 4EB6A 4LBVA 4CIWA 2NZYA 2ZIVB 2ECKA 2WWXA 2EL7A 4Y6SA 2VQSA 3FDJA 1D1TA 2IOFK 1C3XA 3LSTA 4NJMB 5HRCA 4I5IA 2W48A 2F62A 5AJUA 2ZXEA 1E7RA 1Z5OA 4LYEA 3SEZA 2HSEA 2BBOA 2GS9A 3UAGA 1V8ZA 3ME5A 1O0BA 1RLTA 1YRLA 1L5VA 4MV0A 5TQVA 1ZISA 1U5CA 5LZ2A 4UBIA 3JVVA 1EMDA 1FU8A 4Z4QA 2J87A 2W2KA 5THXA 3IR7A 2GRJA 1G1AA 1OYWA 2IYPA 3IHTA 1F8GA 2REQB 5MN4A 1WDKA 1CY0A 3FWHA 4PTYA 4ALIA 1FJXA 3HUEA 3JAKB 3G6WA 4R31A 1QCYA 3TZLA 1UBLS 4B84A 1BS9A 4MKZA 4KQMA 3GA7A 3G9UA 3RAPR 4DZTA 5HP4A 1LBEA 3ZHRA 1H42A 5HQ3A 2AJLI 2PM8A 4K9LA 3L1VA 3G1TA 4EUEA 2WD8A 3F9RA 4M22A 1PV2A 5JFTA 2PDAA 2GKOA 3VJRA 4YCBA 3WLQA 3RQSA 3E22A 5EPOA 3TINA 5HM6A 4LHXA 4C6TA 3HB7A 1U94A 3HKEB 3BXHA 4IQ8A 2YZKA 3WICA 4ZXFA 3DNPA 1RWWA 2VHQA 4JODA 5JJ5A 3W8FA 3AM4A 4BUJA 3QE2A 5TQ2B 3EDYA 5FLYA 2OZKA 4F38A 3AI2A 4UBKA 4PCAA 3IUJA 1L8AA 1VLJA 2X5JO 3TIFA 4DM3A 1C29B 3FYSA 3DS8A 3KAQA 1PKXA 1T2AA 1SU6A 4WZBE 3ZEIA 1YDMA 4EUNA 1RABA 2EP5A 1MC5A 3T95A 4JJKA 4Q9JA 4XVCA 3E53A 1A5TA 3C1UA 1UPAA 5BXQC 4FWBA 2BR4A 1QAMA 4RM2A 3F74A 1YCHA 3ERCA 4H7PA 3UWDA 1QX4A 2X41A 1P2UA 2Q0SA 3GMSA 3CG0A 3HYLA 3L82B 4M0KA 3S27A 3T1QA 4CI0B 4ZICA 2YFYA 2B35A 4NPHA 5JYEA 2FYTA 3ED1A 1G8YA 2H4XA 4RVNA 1P80A 1CX9B 4KXLA 4YR7A 1FDTA 2FJPA 1AE1A 2HCBA 3U56A 5HR5A 4L27A 3U48A 4HNUA 1JXOA 1XL1A 4X8HA 2DWUA 5LZ8A 1NIJA 3DXYA 5HE9A 1Q1QA 2QR3A 2VYVD 1YCFA 4B2PA 4HVCA 4ZVVA 5BVGB 1U5BA 4ZAZA 3MF4A 3WBFA 2X22A 4BMZA 1KPIA 4UTVA 3S0JA 4P0QB 3UH0A 3N8KA 2EX1A 3U7EB 4BV3A 1YMQA 1CERA 3HJBA 3O5AA 1HNXB 1U6JA 3TJMA 1QRTA 2IDKA 4EQ6A 2GCOA 5JJCA 5JUWA 1KRWA 2ZWPA 3KUCA 1NQVA 1RJWA 3FVQA 4RA9A 4NESA 1XAHA 4RXTA 4WJKB 1NV8A 2J6CA 3FY4A 3HDHA 1XTVA 5IC4A 1QTRA 5KQSA 4EBFA 2DEUA 1FUUA 3BIJA 4LQLA 3O93A 4DV4B 2VH2A 3W5CA 4I50B 4BFYA 2AB0A 2VA9A 5FFFA 2PMEA 2JGEA 1P6QA 3KALA 2ZRLA 3KDPA 3K5WA 2ZJYA 1NUTA 3EXG1 5DZSA 1ETHA 4W8GA 4D9HA 5LJIA 3KU4A 4FDLA 4TRNA 1E6MA 1Z62A 4PG8A 3HHEA 1DBWA 5L3VA 4HXYA 2Q9CA 3JCZA 4JU9A 3MINB 4GD3Q 4V38A 2NO9A 4X6YA 4XCXA 3STVA 4CDRA 2FOXA 1TYEB 1G55A 1JNYA 5JU6A 1C2YA 4HNHA 3IXQA 2FLWA 3RRZA 1T1JA 2A8YA 3VU1A 3EZ6A 2EKLA 3PBKA 4LZNA 3L4JA 2NV6A 3I01A 3IS3A 2WNSA 3ZPXA 1ZONA 5JG7A 4A8PA 4G0NA 2IU0A 4P4TA 4JP3A 3RS7A 3GW8A 3BSFA 4PS1A 4TQUS 5TR9A 4JX9A 3UCFA 3UJ9A 3WZLA 3ADDA 1MX3A 3LC7O 4YONB 4BO0A 2I8AA 1KF0A 5FI1B 2QGNA 4XGIA 2VQDA 3ABRB 2C7VA 1XPOA 1E2IA 4XQGA 3BBLA 1Y48E 2FPOA 3NBAA 4NQZA 3OOWA 4EJ2A 4X7PA 3FSGD 1MTZA 4H7DA 3B1KA 2JD0A 3QEOA 2OFFA 3VO9A 3DTVB 3QZUA 3TTXA 4V24A 6REQB 1KHTA 1V5GA 4I5GA 5IJXA 4TZ0A 5EJ9A 3K9GA 2H1WA 4Y0VA 2MSCB 2RBKA 1Y4UA 1Z2CA 1FXUA 3DP9A 4RXMA 2IT1A 3LI2A 3ZHOA 4KKVA 1CLEA 2EGHA 3FDZA 5JQWA 3A2KA 3CSUA 3F5DA 4QDJA 1RJDA 1IOWA 3VU3A 4QEDA 3UANA 4BZPA 2YYZA 4EUSA 2ZCUA 4IH9A 1K5GA 1MW8X 1U2SA 4PC3A 4QARA 3AVUA 3COZA 3GLFE 1UZNA 3O8BA 1W93A 4JDUA 1E1QD 4HFNA 5AICA 2Y0DA 1J42A 3LHIA 4AROA 4TPKA 3A05A 3GBPA 1UMDA 2ODWA 2CDAA 1IBLB 5KSWB 2OFOA 4CLHA 5LQKA 3EEOA 3OPYB 2ZP1A 3HL4A 5HTKA 3WQRA 2V4UA 4ZO9A 4QQNA 1RWNA 1NMYA 1OFTA 3IAHA 4BLQA 1V96A 5KVQA 5I8WA 3Q3GE 3CZ5A 3IESA 3VO1A 2HX1A 3QUSA 5DK6A 3VA7A 3QWHA 1IVNA 3I0MA 3BK1A 1QJ4A 3AZPA 4YBZA 5I8PA 2WM3A 5JYDA 1FZQA 3ZI4A 3OF2A 1SZCA 4U7WA 1CXZA 3SZ3A 3I1FA 2PH5A 4IS3A 4WSOA 3QSGA 4MUGA 5HKKA 2QTNA 3OQOA 3LX4A 2H11A 3ZUPA 5J23A 2AEFA 3FAKA 1LS1A 5FLEX 3N74A 5LOVF 4IEIA 4DLRA 2WJYA 3DW1X 3CNQS 2ZRIA 3I28A 3QU9A 4I3GA 4GI5A 5AM5A 3CLRC 4KE7A 4D3FA 3QF7A 4M8LA 1F7UA 5FUXA 1GPNA 2WJIA 1UDBA 3C98A 3KVRA 4GOMD 5E6SA 5CEFA 1VZ2A 2JJQA 3SC4A 2P91A 5FJIA 3HR8A 5HGJA 2Z04A 2CL7X 2OCGA 2YWJA 4Z0TA 4B48A 5I47A 3HBJA 3FI9A 2PNJA 2QIOA 3PL1A 4X1IA 5EMJA 3DJFA 4MGYR 4N6OA 1M7BA 4CQJA 3M6UA 5LNK1 4RNCA 1OAOA 3NETA 2ZK7A 2GZDA 2I7TA 3F7MA 5HF9A 5CB4A 1TQDA 3S6JA 2E1RA 1KMHA 1TEXA 1G2OA 4UAJA 5DMXA 2QZZA 4RPHA 1GY8A 1HV8A 2CJYA 1IQRA 1ECFA 1ONNA 4B1FA 1PTJC 2OQ2A 2ZDGA 5HJEA 1QRDA 3V9PA 3L6BA 1BE1A 3AB8A 1R0RE 5FTJA 3V2UA 5KYXA 1IHOA 1DCMA 1NN0A 3MBOA 4FBMA 4PBSA 4QBHA 5CJPA 3HPQA 1NJ2A 1QLWA 4Q82A 5HDQA 1EVIA 5L7YA 4BLVA 2VJMA 3WC4A 3EUFA 3DEKA 1XMVA 3R8XA 4F93B 3OMLA 3FLBA 4CMJA 4LZAA 3BHJA 4FBLA 3DULA 4DIMA 2PX6A 1FSPA 3FWPA 5FUYA 1NVKA 4MV9A 3BQNB 3DMHA 2BWJA 1N5IA 2DFVA 1ZN2A 2CY0A 3ILHA 4IIJA 4TRJA 3S2GA 3C4JA 3DCJA 2UYHA 4YECA 2Y92A 1LJLA 3C3PA 4JHXA 3V8EA 2QZ9A 5A3RA 1ACJA 1FXSA 3BH6A 3LRTA 2RHLA 2AQIA 2C88A 3DKRA 3EXHC 5E2BA 3L2OB 3V4LA 1RZUA 1CD5A 1VIDA 1XTPA 3ELWA 3AM3A 3ICOA 1JKJB 1ZU5A 4TWZA 1LF5A 4ZT4A 1B93A 3IVRA 4B8YA 1M2VA 4LJSA 5C35A 2ZSHA 5IBCA 4RWZA 1VMKA 5K3FB 3T7CA 1ISPA 4L57A 3ER8A 1ZHHA 2ZYSA 5G2OA 4EDFA 3IJ5A 4C2TA 3RJZA 5DO9A 3UJHA 3FMFA 2YJ4A 3RRBA 3KHTA 1LDYA 3STWA 3FOBA 1JG1A 2QRMA 3LM8A 1JX6A 4AQYB 1E2GA 2WKRA 4YREA 3JQAA 3IMCA 1UIMA 3HO8A 1NLZA 1SFRA 3RASA 4XFDA 5AKKA 3H13A 3OT1B 3NVDA 2ZW9A 3ZIDA 3QEMB 3X2SA 4CE6A 1QIDA 2I3GA 3EGXA 1KK1A 3IP7A 3LT2A 2JGFA 1Q12A 3G2MA 1RI5A 1IULA 1SBZA 2HK9A 1YF3A 2YYAA 4FMPA 4KYTA 3UBMA 3CLUD 1Q21A 3EUAA 2HOQA 4RORA 1Y9JA 2Z6VA 5IT0A 3LWZA 4KSCA 3H1AA 1PSZA 1A95A 1BCRA 2PLNA 3MA0A 3MAAC 4UBJA 1E6CA 3N2KA 3LFHA 2RHDA 3OY7A 2IQIA 3WA6A 3EZNA 4CMBA 4EEKA 1ECCA 3J81k 1WKVA 4B3JA 4IQFA 1YAHA 4TVSA 2EZ9A 1ZAKA 1N7IA 2D2XA 2GD1O 3S5JA 3UJAA 4EI9A 4MRAA 2XE7A 3IP5A 1U4OA 1J70A 1WCIB 3FGNA 4FMCF 4MSUA 3OLZA 4OQPA 5FXMA 1JBKA 3ZD9A 1A1SA 1NMXA 2R9VA 2JHAA 3O91A 3BJRA 1QQBA 3BAFA 5F3DA 2FQ1A 3GMIA 2QE7A 3H86A 3A3OA 3OU2A 1KPHA 1R0CA 3E1GA 4N39A 1JHPA 2B36A 2EOAA 2HPZA 5C18A 4B3XA 4B6RA 1NYQA 3ZZUA 5I7FA 5K0SA 1XLTA 5DRTA 2P8SA 3ZHXA 4WCDA 2K2WA 1F5NA 4MJ3A 1HDXA 3CIOA 4UHKA 2C0PA 4ZA2A 1L7BA 2WP8J 5NLLA 3LVFO 5IDVA 4R8LA 4IQ0A 3O4VA 4LAFA 3L79A 4TXJA 1TO1E 5JYCA 4X66B 2CZQA 1J39A 1ISIA 4F84A 5IBRA 3THOA 2VHWA 5AVVA 3MSCA 3QSYA 1E5VA 1O9BA 2CLCX 2YZNA 3FOCA 4GWKA 2IYAA 2QPLA 3LD9A 2UZ0A 1J2RA 3DWFA 1PGPA 1L8LA 3B5JA 2B5VA 4KDCA 1VKRA 2YXBA 3LT0A 2CSUA 2BN4A 1GG8A 4GGPA 1XDSA 5FAKA 4M0UA 5K9ZA 2A84A 2ZAMA 4MJ7A 1Z45A 1DTSA 2DCMA 3K8YA 1OXXK 3LX5A 4N0PA 4TTSA 3ZWCA 1TVKA 4HWOA 3VZBA 2FPIB 4GPD1 2HCJB 4I8IA 2OCXA 1L5KA 3PDIA 2QTZA 3PUWA 5E6UA 5LCXA 1WCYA 3L04A 3G2NA 3HU5A 3AVYA 3OIUA 4RJLA 3ZZ1A 4QTTB 1EDDA 1L2TA 1RHJA 5F9MA 5BV8A 2ZXUA 2J3QA 3KOWA 1I0IA 3UV7A 2Y2UA 3U3DA 1BH6A 3VSDA 4ZJPA 3A1UA 3RUEA 1RU3A 4AFNA 3LUKA 5D1HA 3FHOA 1MAVA 2WTEA 4EVRA 1ZAYA 1JV2B 3AEQA 2Z6UA 2WVGA 4Q4JA 2EF0A 4PE5B 4WZBB 1EAYA 3O47A 2PUFA 1XCJA 1UEIA 2QA5A 3QXSA 2XBUA 1S2GA 4DHEA 1N5DA 3QPWA 1Z3CA 2J48A 3F6SA 4EUFA 3D8HA 3UKOA 1GEGA 5A9SA 1H94A 2XPCA 3DMTC 3PB3A 2JL1A 4U7HA 1ENZA 1JWLA 3UMYA 1AKTA 1T5OA 2KI5A 3F3YA 3GRAA 3BMQA 3CUTA 2ZRDA 4TM8A 3R0XA 3PPIA 5CK5A 3ROQA 4AJJA 1ABBA 3BWMA 3AV3A 3TI7A 1H6CA 4JLUA 4IIBA 1FFDA 2Y71A 5TMBA 1G9XA 1C14A 3QG1A 4NHEA 1DVRA 4OKSA 3DR5A 4KBFA 4O8ZA 4D92A 1M72A 3DXFA 4FD2A 3VQTA 3KTOA 3D4IA 3JALA 2WILA 1ZC3A 3PX7A 2FU5C 3DPUA 1MC8A 1PLJA 2VAXA 4ALMA 3FZEA 1Y6RA 3V8RA 3O8QA 4CL2A 4H7EA 1OFIA 4PAOA 3VISA 3N7UA 3LHKA 1HX7A 4DEXA 1IAQA 3HXPA 1TU3A 4KK3A 5D6OA 2HUPA 1TVCA 3SSMA 3X1XA 3OP1A 4GHWA 5T8KA 1LSOA 3I72A 2JIBA 4E94A 3CUKA 1SUCA 1V8BA 3NUGA 1PFKA 3C8ZA 4FEGA 4YGXB 3ZCRA 3LGXA 1JLSA 3DDHA 1CQPA 3P52A 5ADWA 3UG6A 1UBEA 5FL7D 3E0XA 1L4BA 4LE1A 3ZX5A 4BC1A 4QM7A 1EFKA 1QONA 4BYMA 2ONKA 3AQIA 4XM0A 2Y77A 4MHOA 4HAXA 2FWIA 2VUUA 4U7FA 1GZDA 4NR0A 2R5WA 4LOKA 2JJMA 5TNXA 1HRKA 3U4HA 4M0CA 4XWKA 5FLXA 1RCUA 1DT5A 5BVHB 3AL0C 3VR6H 4BO3A 4US0R 4V39A 5C52B 1R10A 4EJSB 3N7TA 4BE7B 1PL8A 2CHFA 3TPZA 2OZLA 2JA1A 3KQTA 3KQOA 3A4IA 3LDUA 4DGQA 2W2MA 3RFXA 4Q4HB 3G79A 2ZSBA 3ANLA 2KLHA 4FLEA 4JK3A 1IY9A 4M55A 1UMCB 4YP6A 1I1HA 2QX7A 1VL0A 1VB5A 2FDCA 3DB2A 3TRIA 2WJGA 3GNQA 4MIOA 3T5DA 2XMQA 1AKQA 4B4KA 2AZMA 2PTHA 4R05A 1JEYB 4MV5A 1WIWA 2R7NA 1XG5A 1CZUA 3NC1C 3LL7A 3PDUA 4PHFA 1BH2A 3OTQA 1R9GA 4GX0A 2FQYA 1U63A 5BR4A 1DELA 3M4NA 1N5OX 2EZ8A 1UIRA 1SUIA 2C9YA 4GOJA 4CCSA 5G1PA 1GUZA 1QHFA 1YZKA 2DFPA 3I30X 1I8TA 3LUDA 2RGNA 1KVRA 3MVEA 4ZALA 4C01A 2YOFA 4RV5A 3RS2A 4UE6A 3CW2A 4OGFA 1C3VA 4KPEC 1LSJA 2GUWA 1MB4A 2YJTD 1Z75A 2QUBA 3BE4A 2BRUC 3R2JA 5JC8A 5JQGA 4E3ZA 5IJ9B 1BMDA 1MAWA 3AY3A 5IX8A 2WWIA 4FP9A 1AK1A 3KEGA 3R0JA 1F8FA 1CY1A 3VNQA 2D62A 3VR2A 3QW2A 3IOYA 2A0KA 4DYVA 2I91A 4FFBA 1AXRA 1W0CA 3OOJA 2H9IA 4M0LA 3D5EA 4AF7A 3NKLA 1R6TA 3D0KA 3TI9A 1JR3E 4Y0AA 3RUAA 2ZUBA 3MC1A 1XAGA 4JI7B 3BL5A 1Z2AA 4DC1A 3DD5A 5E8JA 2PGAA 2XW6A 2XYRA 3IALA 3THSA 3W77A 4ZQGA 3FMVA 1JE1A 1X94A 3RG2A 1I80A 2QRUA 1NVXQ 1RWBA 4Q7MB 1SWVA 4WAUA 1XLVA 2A2ZA 4HH0A 4C7BA 1L7MA 4LBYA 2IJGX 4QQFA 2WF6A 5JSKA 1WBDA 4X3OA 3UATA 4EKYA 3OETA 4JCCA 3EY4A 2I03A 2ISSD 2ATXA 3CNEA 1NF8A 1RMQA 1BGVA 4L2IA 4MQBA 3UJ7A 4CG3A 1T29A 3FDIA 1IZ7A 2UVPB 3IJEB 2DCUA 4J6EA 2WB2A 5DWQA 1M6NA 1S4MA 3H5NA 3CVVA 2NQ2C 2BP7B 1HC7A 2HJHA 3RJ9A 4CCYB 3ZY6A 3GB9A 3PNQA 5AVXA 3AR7A 4C04A 2EVWX 4QECA 4Y2PA 1JFTA 3JVIA 1DO2A 1Z17A 1H23A 221PA 5AHXA 3WB9A 1L7NA 2IUUA 2O05A 5JJKA 2UXDB 1M6VB 1O4WA 2CC2A 1SKAA 3Q0EA 1X9IA 1ZH4A 3AF2A 1RP1A 5FAXA 1KDYA 4MVXA 3KYDA 4CYMA 3GFRA 3P4YA 4KXYA 5DVZA 3ZKWB 4GE0A 1GCGA 1XHFA 2H6EA 2OORC 3CNLA 3PC6A 5GV8A 4DB4A 1RE1A 3B9QA 5H59A 4EG7A 4DMGA 2YXEA 1Z37A 3BH0A 3G8CA 4MW6A 2JI9A 2XOEA 5GJVC 3O8OA 3TTTA 1P5RA 3ZW8A 4EEXA 4FFRA 1R4ZA 1N2CA 3UPTA 4YRPA 1WS6A 4KIJA 1QYDA 2GVZC 4JBYA 2BHSA 2GK3A 3G0GA 1ZNZA 1ZOLA 3AUYA 3CKMA 1FFYA 5G4KB 5GJWC 4N0QA 5H02A 5TX7A 1ISJA 4LEIA 4WLUA 4O4IF 1L5HB 2D06A 1X1QA 2UUOA 4EOGA 1NJ6A 1EQUA 1MXHA 2IXBA 2IPMA 3PC8C 2VBIA 4UMVA 3KLPX 3PNVA 1NR7A 3I9NA 4PGMA 2ILTA 1AOXA 4CDNA 1P7WA 1CFJA 3TUZC 4IH4A 5ALJA 1AV7A 1HGXA 1EX1A 3CUSA 3EIUA 3AIKA 4BKUA 4CV3A 1RHMA 1TJPB 1C0EA 2FP4A 3DQPA 2HO5A 1C4XA 1MGPA 1Q22A 2R1VB 2P4SA 2TMYA 3H2IA 5EUBA 2E4ZA 1I51A 2OP1A 2VKTA 3NM6B 5H7XA 3ZLBA 5AKYA 5CFQA 1H4QA 4ZRDA 3HXQA 3CF0A 2PGIA 5LXTF 2VHZA 3P2OA 4GZMA 1E1LA 4NYMQ 1BVHA 4IGIA 1T8UA 4EL0A 1MV8A 3S40A 3ZNNA 1FMCA 1XRSB 1CJBA 1TADA 1C4OA 3GDWA 2F67A 2JATA 3C5VA 1SB8A 1ZUIA 3PPVA 4HY3A 4BGDA 3QY9A 5B2FA 1RZRA 4AUMA 2K5UA 5GOZA 3N07A 5B2ZA 1BVYF 5CM2Z 1M76A 3EMVA 2GZ3A 3DFMA 1T13A 1NC1A 3CRVA 4OHBA 4F2GA 1I32A 3Q8WA 1TZ2A 2RD2A 1PR4A 1K6JA 4PGAA 4RYLA 4I4NA 4AMZA 5JHGB 5C51B 3T3IA 4WX2B 1YOVB 5EINA 5CIYA 2B5OA 2YFQA 3W7VA 5IH7A 2BW0A 3L6EA 3NUZA 3ZIAA 4R2KA 3LOPA 1T5TA 4DVJA 4Y0NA 3QNMA 2NVWA 3O3CA 1CYDA 3GUHA 3LXMA 4XGQA 3A6ZA 5K0JA 4P7GA 1T4CB 3FCOA 3PQEA 1Z6TA 3AFIA 1OWMA 4GIBA 1I9GA 1E79D 3OM0A 1YR7A 3SYRA 1FX0B 2ECPA 5ALWA 5EP4A 5FJJA 4EI2A 3AESA 3PEVA 4ZZ2A 3HMQA 1H2YA 2OKCA 4KXUA 4D56A 3KELA 3HVIA 1PFQA 2NWQA 3UUGA 3WKEA 4AUEA 3MT9A 4I66A 2W0SA 5TVKA 5IVPA 1XZEA 2SECE 1UM9A 2Q41A 3P19A 1E1KA 3S44A 1RI3A 1EK2A 3CBQA 5HUQA 2Z9DA 2WWYA 2D2VA 3G8AA 3TB6A 3WWDA 1VI6A 4CKYA 2AZTA 1EDZA 2HU5A 1NSTA 3L1UA 3NHBA 4JQCA 4KX5A 2QQGA 3DZDA 4MYRA 3TGWA 3ZU3A 4LZZA 1ZKMA 3C97A 4JL5A 3RVBA 4UXJA 4XWOA 3OLYA 4HPXB 3UFXB 1PJLA 3AKCA 2WFLA 2H1LA 2I1WA 2WINI 4KHPB 1W0KA 1KJWA 2LWIA 4OYHA 4JLSA 4R1NA 5CLQA 5A2GA 1OAAA 4S04A 1L4KA 1SXHA 3ASZA 5LB2A 4G9EA 3LWNA 1Q77A 3CS3A 1SK9A 3GT0A 3BA1A 4BQFA 2IWRA 1EEHA 3ZWAA 1M6WA 2PRIA 2EXXA 1ZD2P 3G2HA 4RD2A 1EXVA 2W2LD 5ALIA 5CXSA 3VPHA 1GUAA