2B98A

Crystal structure of an archaeal pentameric riboflavin synthase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
KKVGIVDTTFARVDMASIAIKKLKELSPNIKIIRKTVPGIKDLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYLLFKPEYLTRMAGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an Archaeal Pentameric Riboflavin Synthase in Complex with a Substrate Analog Inhibitor: stereochemical implications
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Riboflavin synthase
total genus 48
structure length 141
sequence length 141
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.9: Riboflavin synthase.
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2b98A00
1W29A 1C41A 3MK31 2B99A 1NQUA 1W19A 2VI5A 1KZ4A 2C9DA 2B98A 1NQWA 2A57A 5IM5A 1DI0A 1EJBA 2A58A 2I0FA 1HQKA 5IM4A 1C2YA 4J07A 1KZ6A 1T13A 3NQ41 2F59A 2C97A 2C9BA 1ZISA 2A59A 1NQVA 1KZ9A 2OBXA 1KZ1A 2JFBA 2C92A 1KYXA 1KYVA 1KYYA 4KQ6A 1NQXA 1RVV1 1XN1A 2O6HA 2C94A
chains in the Genus database with same CATH superfamily
1A7JA 3OBBA 1UMDA 2P9CA 1XTPA 1CKEA 4LRUA 1C4WA 3GLVA 2BGJA 2RAUA 5LBIA 2CFTA 2OGUA 3JAWA 3VR6A 1CF4A 2HBRA 2O7SA 2ECOA 1E1MA 5THXA 3A1WA 2Q2WA 3PT9A 1GEGA 4MI3A 3WK5A 4C5BA 2EFEB 3QLEA 1E69A 3V4VB 1E7WA 4MUKA 3NVMB 4MDYA 2W6JA 3NMUF 2VH1A 3SNKA 2CHFA 4ES6A 3DBVO 1Z4IA 5IAAA 2RK4A 1KI6B 1H2XA 1XVIA 3L01A 3JVUA 3ZH9B 2H00A 2OHXA 2PEZA 4YDRA 2FK7A 4AMVA 2AR7A 3MCVA 4PHHA 3GCZA 4BRWA 1JJIA 1M3SA 1SVNA 3SJBA 3W5HA 3RARA 2VYVA 3ACCA 4NESA 5CYGA 4PYLA 4AP9A 1MB9A 2YASA 2XT0A 2Q50A 1EK6A 5L4LA 1WSWA 3GF4A 1LQ2A 2AE1A 3G2LA 4QYIB 4WXMA 4FOLA 3LF1A 2YFQA 4BLQA 2W93A 2YICA 1ZNWA 2NSYA 2P4HX 5IXYA 1T0JB 1DOHA 3P71T 2XCTB 4TROA 4D9EA 1RXIA 1XKXA 1LGYA 1ZJ5A 2FPGB 1KEKA 4IDBA 1X0VA 2HA2A 2WHXA 4WZAA 1CEXA 4IMPA 3U4QA 1QCYA 1J6UA 4K26A 4YONB 4BFTA 2I3ZA 4RADA 3RYIA 2QTGA 3NETA 4BO2A 4ER5A 3ZDRA 4RSRA 4DPMA 3BOSA 1WULS 2PPLA 3OJWA 2BGUA 1PS8A 2CE7A 4MS3B 1V5WA 4QXMA 4XSVA 4PYNA 1ZHHA 2EJCA 4P22A 2BFFB 2HJVA 3JALA 4EUHA 4EGJA 3HYCA 2W6JD 1HO3A 5IAEA 1EFVB 5A4DA 1R4MB 5DTMA 1CCWA 2Z58A 3O8DA 1TECE 4H3VA 4RH3A 4FYKA 4I55B 3DTVD 4EB6A 1UKZA 5FA6A 4MPPA 3QHQA 1FXWF 3ZXXA 5EESA 4FX5A 1G4AE 1IXRC 3WIBA 3F0TA 5BR4A 3DL2A 1GHTA 4J16C 4TLDA 2EP8A 1TD1A 1Q0UA 1W75A 1GCUA 2J3HA 4QTTB 3QEJA 5C37A 3TRIA 4MHSA 5E8JA 1PZFA 1P0MA 4Y2GA 1BS9A 5B1SA 3A9WA 1B0AA 2D0IA 2WU8A 4NPCA 1L5HB 4TS9A 5LFAA 4G07A 4MWGA 2V96A 2HU8A 4RIEA 4YRGA 3DE3X 3JASA 5I4BA 4UUQA 3A6KA 3HVHA 2HJ9A 1U1CA 3NR2A 3RT1A 2BCGY 2VRWA 2WW8A 3M34A 3GDGA 5B30A 3ZCUA 4MGKR 1SY7A 3Q10A 1CG6A 2RH5A 4HBGA 5BUQA 1G5TA 1UC5B 3O1HB 1JIKA 1WE2A 1XWIA 4JITA 4RVCA 4JLMA 3BWDD 3B8EA 2R7MA 3CLUD 2R8ZA 4EHAA 4JBIA 1C50A 3K1ZA 2ZM6B 4PGGA 5LOVB 2Q8NA 2D1TA 3E15A 3FXAA 1VBFA 1U9JA 3ACDA 3QWAA 4PBTA 4XUCA 3EIEA 4ZOLF 1P5FA 3HI6A 3U3JA 1DGQA 2EL9A 2WKSA 1M72A 2WRZA 3JYOA 1XRRA 5I9MA 2G7ZA 2W11A 2Z2JA 5ICSA 4DEVA 5D86A 5KQGA 1JFSA 1RJ9A 1EIZA 3WISA 1D9ZA 1YCDA 2LUOA 1GUBA 1KMHB 1W35A 2W6MA 1GZ7A 1L5SA 4MK4A 4NH4A 3LKZA 2OEPA 2JFQA 2VSXA 3VXKA 4ONEA 5CJJA 4CRWB 1JDZA 4MUIA 2PKXA 5KJ6A 4DE5A 1B4DA 1EPUA 1RMYA 1INLA 3HVIA 4ACBA 2CVQA 1L5FA 1Z0UA 2C97A 4NU6A 3NVAA 4C20A 1ZD8A 1J49A 1JZQA 2WKWA 2Y68A 3CNNA 3ZBTA 3ZWYA 4D3DA 5JIBA 4P8RA 1WX1A 2EERA 2GZRA 2IJGX 5AKKA 1BHO1 4EG5A 3IT3A 4FS3A 1W25A 4LSWA 3OZAA 1U2GC 5SV2A 4DJEC 4ESVA 4XJVA 2HU2A 2Z30A 1EEHA 3BTOA 1U0OC 1X7HA 3FUWA 3JW8A 3A4VA 2AKAB 4WJZA 1KH1A 3M6WA 3QKWA 4KPUA 5EZ5A 5ALIA 1RHRA 3D7MA 1WAMA 2VUHB 5FWYB 2C7PA 2YW2A 4O59O 5ALZA 3NUGA 3WO1A 1RAHA 1E9RA 3OMLA 3DAGA 3NHLA 3R7LA 2NUBA 3PUZA 4QO8A 4UEWA 4G1EB 4HUQB 2F48A 1LTKA 3JV7A 1TZKA 5EMJA 3P2MA 5JTUA 4TSFD 1E2IA 3D2BA 3OLWA 5AJWA 2BM1A 4S0ZA 5DEOA 3RU2A 3WXBA 2FWPA 4RMNA 4LF8B 2EEZA 4DRZA 3PNKA 1KEUA 1UMCA 2QHXA 5SY9A 3ZU5A 1O0SA 2QTTA 1V25A 3KLBA 4IBOA 5JBQA 2NVWA 3F74A 3F47A 1QYIA 3OZEA 4MV8A 4BECA 1VG0B 3KHTA 5KTMA 1VHLA 1KH3A 4N39A 4DKJA 3C7DB 4ZXPA 1Q0QA 5F2KA 3JY6A 1NIPA 2PVPA 2IW1A 2P5YA 4WECA 4H59A 1ABBA 4YRDA 2F3UA 3IOBA 2JJ2A 1YZUA 3KPUA 3P9PA 2YJ6A 1XD2B 1XD8A 4KQFA 3T9FA 5FJJA 3A31A 2H29A 1ZVVA 1YCFA 5F2OA 4KI7A 1QIGA 3B6IA 4NHEA 2WHYA 3QPVA 2R1UA 3P9QA 1KOJA 4GMXA 4EG7A 1ULBA 4NBUA 4Q9LA 4FSDA 2HSZA 1SRRA 3B1XA 3P32A 1UAAA 2YBDA 2QEQA 1WB6A 3GA7A 2EYUA 3ZDDA 1U1GA 2EGUA 2HTEA 3D59A 1XYVA 4IIGA 3Q7PA 1V9LA 3FVRA 1KYTA 1NW7A 1J56A 1HQCA 5JVDB 1X0XA 1SVSA 3U9LA 3TSWA 4KU4A 4CR6A 3CJRA 4GPD1 2AI2A 1YZNA 4BAGA 3RC8A 4J9UE 5EL0A 3EULA 2DY0A 5J23A 1PU2A 4EJ2A 4B46A 1Z2PX 4KE8A 2BY4A 1DRVA 4PZAA 4C6SA 5BSEA 1U28C 3MYYA 2Y1FA 3ZWVA 1ISFA 1X1TA 1VI6A 1NLMA 1Z7EA 3OZ7A 3OTOB 1E4OA 2DERA 4YCJA 5JVDA 3HXTA 1XEWX 2HRCA 3PTLA 3VO2A 4AJ2A 4J76A 1SCBA 3G49A 4G1UC 4DQXA 5F7XA 2JD2A 2A4MA 1ZI6A 1SELA 2DFPA 3LECA 1PDOA 3FX2A 4MLCA 4IVPA 1O95D 4L4ZA 1CHDA 2BM8A 3ANMA 3PENA 3PQ2A 5KINB 4A8PA 5LUAA 3ZVNA 1KP2A 2ZAOA 1UOEA 5LJLA 4NR0A 4RPGA 2OCBA 2G5GX 3IUEA 3FMGA 3KR9A 3BMXA 3QPWA 3SVLA 3GVCA 2QW8A 4GT1A 1EVJA 4KEAA 3BCRA 2DBYA 3BL5A 4G63A 4CMIA 2H17A 2D3WA 1CQXA 1Z4OA 3KR0A 3MTBA 1XR3A 3V8BA 2OCIA 2FOXA 3HDJA 4UBKA 5E9QA 4A9AA 1OI7A 3K2IA 1UFKA 4FYXA 3F5SA 3QEKA 4RO0A 1A9PA 1DKMA 4E5UA 5AVYA 1P17A 4JUIA 3SFVA 2JANA 1Y5RA 4BTEA 1JRLA 1T2UA 4CMIB 3A58B 2C1EA 3OIFA 1JHQA 4EG6A 1WDMA 4B40A 4N3BA 3UHPA 3UB4A 3VH2A 3RVOA 2QJFA 4Z3DA 4C5CA 1XDUA 5COBA 3ITDA 1GPLA 3PFIA 4JYAB 3E23A 4GMFA 1A1VA 1AHHA 4WK4B 4V1CI 4W4TA 3IPRA 1TEXA 1YGYA 2GEJA 1EP2B 1FMJA 3H86A 1TJYA 2E6KA 3BMCB 4JJIA 3K0EA 2D5AA 1GPKA 3VVBA 2MSLA 4BFWA 2QX7A 4H17A 1UWLA 2VLBA 1FVFA 3E9QA 4JBGA 3ZW7A 1EP9A 3GJ5A 5ADHA 2Q1TA 3ODGA 1ZKMA 2E2WA 5FEUA 3AF2A 4BNKA 4DTCA 4TQGA 1QGED 2RB5A 3J7TA 2D59A 3L84A 5DLPA 1IN4A 2K4MA 3T3DA 2Q5JA 4CQNA 4NCAA 4LA4A 4X41A 2ZJ5A 1M2GA 1MC5A 2P3SA 2KBFA 1WHTB 1PJSA 1RQ7A 2BDUA 1L8XA 1Q50A 3IBFA 4D3ZA 1ISIA 4AX8A 3TIFA 2R68A 5CIWA 2WI8A 2R65A 4IUCS 2WD7A 3TNDA 2ODEA 3W6ZA 1QCZA 1P72A 3Q85A 4UNIA 3ZZUA 4G8BA 3D4OA 5CU7A 4JYCA 3OTIA 4PQYA 2YQ4A 2XA2A 5E1MA 3W2TA 4LQCA 1B1AA 3CFYA 4LCBA 4KK3A 1A27A 1J25A 4KXXA 2HMAA 3PRYA 3EXIB 2B83A 4M8SA 1N6NA 3M49A 4P7BA 5GV8A 3L1VA 4LXGA 1P29A 3C3EA 1CEYA 1K7YA 3MT7A 2C2GA 2JHFA 3ZE9A 1J8MF 1ZA1A 2JHAA 1OHHA 4Q3EA 1S3SA 4PS1A 4HD8A 3AYXB 4UZFA 3ZWOA 2J5XA 3BX1A 5CFNA 2RGCA 5EYPB 2HCTA 3L8CA 1FMFA 3O82A 1YUMA 3ORFA 4HLDA 4OXNA 5AMXA 4GDFA 1I4LD 2LCFA 3F6PA 3GL9A 5KS2A 3ZJUA 3G7NA 4FNAA 2PSJA 4PSDA 4X45A 5LIPA 4FMCF 3WAJA 4RNDB 4WZZA 3EZ9A 4FQ8A 4NBVA 4DEXA 4ENQA 2WEKA 2BFBA 4M8LA 4ZA2A 5KQLA 1KZ6A 4XM1A 3DP7A 2QUKA 3O8QB 3CNOA 1E7SA 2C99A 4U7TB 1RI3A 1QO0A 2B4YA 3H9JA 5HDBB 4K81B 4P34A 3OY2A 3WVNA 4BLUA 2NXCA 3CCCA 3UTCA 2VCEA 3NDRA 5LNK1 3AVWA 5BRAA 1U2RA 3H4IA 3PBKA 1EFTA 3PT5A 4OHOA 3UMGA 3W3ZB 4BO3A 1S6YA 2BKVA 2VA8A 2RGYA 1QONA 3JZDA 3IE1A 3H84A 2OHJA 1KA9H 1QGUA 1GUAA 1W76A 1Z08A 3C3PA 3EASA 3HM2A 4LE1A 1Z0FA 4OYYA 5FOXA 1S7GA 1XXHA 4INZA 2GILA 2QE6A 3EEQA 1VJ0A 1GQYA 2MINB 1UINA 3BIJA 3ODPA 1J09A 4UU1A 3VZCA 1MJHA 3MXTA 4KVFA 4UU7A 1O77A 1A9YA 1MO6A 1U3WA 2JAXA 2ZSIA 1NJGA 3I1JA 4OM7A 4L9WA 4RKFA 2V65A 2XUAA 1UJ6A 2B8EA 3VU9A 1HZJA 5DBFA 3L4JA 2D1QA 1EUZA 3FWYA 4P4GA 1FU8A 3STXA 1WZ2A 2M6RA 1KE2A 3C15C 5HWSA 4ZO9A 3FDJA 4MW4A 1QH1B 1JW9B 2VQDA 2BV3A 1EGMB 2ZRKA 5ICCA 1CUSA 2VK2A 3K6SB 1C41A 1DO2A 2OWDA 2V4MA 4IIYA 4YT4A 1HG1A 1SIOA 3K32A 5ILOA 1L4MA 1TYDE 2O8NA 4ZP1A 2DPMA 1PNTA 3FE2A 5A0VA 1PTJA 3I2FA 1SXPA 1L3IA 1YB7A 3C8HA 4LJ8A 4DIMA 4DA4A 1FW6A 1H9AA 4YCBA 2AF4C 1XJWA 1RLJA 1G1MA 5BUCA 3TEMA 3PWSA 3KZCA 2YN0A 1LA2A 3MMXA 4NG5A 3UT5B 1Y8QA 3UAYA 2ZS8A 4RMGA 5BQFA 4Y6OA 1J4AA 4P0TA 1DE0A 1OYWA 1YDGA 3MCTA 3DL0A 3IQHX 4QU9A 4EY8A 1T5HX 3CT6A 1D1TA 2DFTA 2JB9A 2VYVD 2X77A 1DAHA 1KEZA 1T0PA 3HJCA 2IZ1A 4XQCA 3WLRA 1E3QA 1WDKA 4UEQA 3NT2A 2EZ9A 3FJYA 2FZGA 1F17A 1FTSA 2IPNA 4FDTA 3WK7A 4IHQA 2C03A 2QZ9A 3RG8A 4C0BA 1NSFA 2WT8A 3WGNA 1GT6A 1R8SA 2ID9A 1QV6A 5EHNA 4YQFA 3SDBA 2F8TA 1HDRA 2MJLA 3EXFB 1FDWA 1JHVA 1O9GA 3KFXA 5EMMA 4Y9TA 1E3JA 1GPAA 4JLVA 1K8YB 2JGDA 3UWMA 1NT2A 2UZ1A 3H9BA 3QJ5A 4QNMA 4RJ2A 3RTEA 4DMKA 5L3QB 3O8BA 3D5QA 3CE6A 5F1OA 2XWSA 2ZUVA 3BXHA 3PRKE 5EHQA 2A9OA 3AUAA 4JL8A 2C2YA 4MO9A 5HVNA 3G0DA 5HXAA 4D3XA 3F78A 1CVLA 2N42A 1CIVA 3AL3A 5TS2A 3S0JA 2WG1A 3I0NA 3ZVMA 4IO0A 2V7QA 1I4DD 1QX4A 4R1QA 2WHEA 1KJ8A 3ZVLA 3OUUA 2K6GA 4P2GA 5JXIA 3FSEA 2ZQZA 3GEGA 3IVRA 2I2DA 4HVAA 1ZNZA 5BYKA 3VAYA 1WHSA 3NKVA 4QDUA 1GRVA 4KN8A 3UICA 3OZFA 2Y1KA 2Z95A 1WVGA 3T7DA 3U7RA 4UMVA 4CE6A 2VVTA 3H11B 4BQQA 3GROA 1UM9A 3M4NA 1OX5A 4UPDA 2VR1A 4LVOA 4K6KA 4EO7A 4QJ3A 4B7AA 1ILEA 3Q8XB 1WCIB 2IHUA 4N5DA 3AHEA 3HU3A 2FR8A 2ODNA 3DLBA 2GH1A 2PT7A 4F85A 2XB8A 1WTAA 5FHQA 3TTTA 4BKMA 2P0EA 2MCFA 1XL0A 4LV5B 1R8XA 2ZTLA 2COUA 2EEPA 1BA2A 1I80A 3FCCA 3H11A 4KP7A 4D0SA 2J0SA 2HSWA 1NP7A 2G71A 2PZKA 3VNQA 3ICEA 1AC5A 1FK8A 3C98A 1R0YA 4N8SA 2XYQA 3UQZA 1WCIA 4TN5A 3WWDA 1XZNA 4LC9A 4AKTA 4ECEA 5A5VA 4XR9A 2AXPA 2ASEA 3U3MA 1ZMBA 1PI3A 3AILA 4HB3A 2GZDA 2JAHA 2NO0A 4FU0A 1WPQA 4LV6A 2G1PA 4D0LB 3V1TC 3X44A 3HTXA 1PL6A 4NFHA 2JFWA 3TQFA 4FE3A 3UVEA 1AIPA 5AI6A 4LSZA 2WZDA 3C2QA 3K0AA 1F4VA 1SZJG 2FW0A 4KL8S 1GTRA 1W1WA 2J48A 2QTVA 4NJEB 1U8AA 3HCWA 5E6SB 4JS0A 3DPUA 1C9JA 5E4JA 1T3GA 1VSQA 1YR1A 3SIWA 3SKYA 3TOVA 3LDAA 2QWXA 3BPSA 4GX1A 2FG6C 4KNVA 4WZ6A 4P3KA 3KRTA 4D99A 3RCBA 1C9KA 3D54D 1XMPA 1KY3A 2B99A 4PLPA 2I8AA 3DXYA 4E15A 5AM3A 3EWAA 4C0AC 2GGSA 3CVOA 5IAKA 3AJ9A 1WCYA 2E3JA 5E6SA 4IQ4A 2WYOA 2V4ZA 1H1LB 2JGNA 3FPSA 2IPMA 1RWPA 1OUMA 2RAPA 1G6HA 4YIHA 4WCFA 5FOUA 1W59A 2WJVA 1VPVA 4AMBA 5FUWA 4E51A 2H0RA 4PFQA 1FJXA 5JWRA 1WOYA 5DHSA 4O1MA 5B2ZA 3RJMA 4W1SA 5BP7A 5KNDH 4TWZA 1BEEA 3W5UA 1C8KA 2IF0A 3IMGA 3OEED 4FOTA 5F21A 5FLXA 3VPHA 1HGXA 2Q7XA 1E8MA 1Z4JA 2FJPA 3B20A 3EPRA 3KLOA 1ZX1A 3NKLA 3K92A 2UZ1B 2QTWB 3CG4A 3PC3A 3GPLA 5JLJA 1FDIA 2EBWA 2R00A 4FGSA 4MCAA 3LT0A 4QOFA 2BDTA 3KOZA 1A7UA 4P84A 1PNVA 2IYQA 3AJAA 2O20A 5CMLA 3WNBA 5JZVA 4F2HA 1JAYA 5C1IA 1EJ2A 2EQBA 2M6LA 3WWCA 4MS3A 4LYAA 3C97A 4FHGA 4Q3OA 5BOSB 1I7NA 1I5OA 4I66A 5CCDA 4U2GA 1G20B 1FMTA 1H69A 5CTAA 4JI3B 1HX7A 2WFZA 1Y5MA 3UFXB 3CXRA 2I8CA 4K2AA 4MUHA 3RNLA 3NHWA 3DBHA 1NPTO 2IEBA 4GXRA 3VDNB 2Q1XA 3GAMA 4JSRA 3SDSA 1JEQA 4ZMSA 1T5SA 2PZMA 1TK2A 3OM1A 4HG2A 3OFJA 3DUFA 2C2OA 3N8HA 3TX6A 4CMGA 5ELLA 5EZYF 1NPDA 3ID6C 5JMPA 1LDGA 3OU6A 1NE2A 3V5NA 1SWWA 5AW0A 1SIWA 2WSSA 4YH1A 2ZRFA 1KVTA 4B6GA 2C4UA 1OBFO 3I04M 2FXIA 2XMGA 4MVJA 1O3YA 2WKRA 2IU6A 1W49A 4OQEA 1EZ4A 3BJZA 3HDQA 4G0UA 3UJAA 2AJLI 2ZS9A 4PQFA 2A78A 2JVIA 3PHIA 3U4GA 5F77A 1PF7E 1L5KA 5IJ0B 1C9YA 4OATA 4RGVA 4J2TA 2FFJA 2JIPA 2ACVA 5B4UA 2V6JA 3AONB 4NBLA 3VNVA 1I13A 4QUGA 4I50A 3M33A 3T5GA 2HK6A 1G5HA 1XLTA 2P9QA 2ZBGA 5CYPA 3PIIA 2I67A 2AN3A 2Q5IA 4NZPA 1Q2XA 1QIHA 1RWQA 2O3RA 3DT6A 3B1KA 3RUFA 1RLUA 3U6BA 1YI1A 4RBNA 3AUUA 4CLRB 3QU2A 3VYUB 3GFPA 3JQRA 1ZK3A 2HRBA 2RIPA 3ELYA 4FFBA 2PYZA 5B2FA 5TGTA 1ZVKA 4M0FA 1V95A 1UZLA 1XQ9A 4NU5A 1Z3CA 2F4VB 4XD2A 4DDHA 4GLLA 1NF2A 1OR8A 3FZEA 5A62A 5ER9A 3WGQA 3EVGA 2OO5C 1DHTA 2A5LA 3F4KA 1KMHA 4Q1VA 2BF4A 1BIFA 1BE6A 3IAXA 3IHTA 2HWXA 5JISA 2IH2A 3L0PA 4QLBA 4JIGA 4LRWA 3ZDQA 2C0QA 3GLUA 4DQLA 2PT6A 4K9SA 2NV6A 4CCAA 1IQPA 4IEEA 3U62A 3CUYA 2VG8A 4RLFA 3H5LA 1RQ2A 1ZU5A 1KMIY 3H1BA 3OG9A 1AZSC 3RSSA 3B89A 3KB1A 3VC2A 4Q7LA 3R7WA 2MU1A 3GJRA 3PXBA 1NVGA 3ZDAA 1U8TA 2OYSA 3U0BA 1A04A 3QVXA 2A9FA 2WTEA 3FHTA 5KTKA 3MS4A 1AKRA 3H3FA 5ALUA 4RS4A 4YHHB 3QOWA 4N03A 2XNKA 3HL0A 2IU0A 3ZWMA 2HM7A 4FDAA 1KDYA 2Z6UA 3HRKA 1LI4A 3PWZA 1YRWA 3IBTA 4KAAA 3R7WB 3G1UA 1IHXA 2TYSB 1JTFA 5LWHA 5U4XA 5L7WA 4DYDA 5EJ2A 4GE3A 4O4JB 3TZQA 3WI7A 2WOOA 1SMKA 4QUKA 2QR5A 5JI3E 2BFMA 1IC6A 1EP1B 1HL3A 1EBUA 4K87A 3EUFA 3HJHA 2I6SA 1O7JA 2ZJ1A 1VA4A 3WBFA 4PX5A 3CO0S 1UPUA 3H1TA 5L40A 5LMCA 3VNUA 3OE7D 5FNVA 4LXYA 3KJHA 3TXAA 4ZK6A 1KKUA 4BVEA 2FMFA 1R88A 3U2QA 5I7EA 4IGEA 2Y1LA 4B84A 4F4HA 4F8JA 5JJCA 4BNWA 3U44B 4BKUA 2J31A 4OY3A 3BD7A 3SXPA 3H2KA 4BQEA 1BXGB 1TCVA 2VDRB 4LOKA 5F3RA 2Z9BA 1NDHA 4EHKA 4R54A 1O96B 1R9JA 2C20A 2FETA 3UMJA 2EDAA 3FTDA 2FLVA 3Q3GE 5EKSA 2IPAB 5JH7B 4Z4FA 4DS3A 2J4FA 1XCPA 1NMEA 4H7DA 3OE4A 3FWHA 4HFRA 2ODBA 4TV8F 3V4ZA 4ENRA 1NXSA 2ZXUA 4GI5A 4C4SA 1N2JA 2JJMA 4JLDA 3HWRA 4UAUA 2NUAB 4DXHA 4FEEA 3WA7A 1EHIA 1YB1A 2UYOA 3A36A 4HGPA 4YP5A 1BCRB 1CUXA 1CQWA 3HWWA 3HKCB 5C8XA 3B5EA 3DH0A 1WM1A 4EEXA 1C14A 3UF0A 2ZIGA 3D4PA 5C35A 3PCRB 3LBNA 3WKDA 2D2IA 3CZCA 1U1EA 5JQGF 2IX3A 1WO8A 3FJOA 2E1RA 1O57A 1OTYA 3PNYA 2XMBA 4FFBB 1NTRA 2FGKA 3EGDB 3IHLA 3T7JA 5CHYA 1GPMA 2BIFA 2XITA 3GRKA 2Y1OA 3OTGA 3VFDA 3ET5A 4X1IA 2HJWA 3GXOA 4LRYA 3AI7A 4ETIA 1LPNA 4LBVA 4ZVRA 3ZYZA 2TMYA 1KI7A 1ZH6A 3NB0A 3BXZA 4QUDA 4AJNA 3CLRD 2ZBRA 1Y1KE 1QYXA 3K6KA 1USGA 1QGDA 2B21A 3NBAA 3DEFA 4MRPA 2GN2A 5HQJA 5IC6A 1LKZA 4D6YA 5LXTB 2ZANA 3I9FA 1IXYA 3WLMA 3TIVA 1JKIA 4P33A 5TDHA 4A1OA 1C0LA 4I8XA 1QV7A 3G13A 2HSGA 5B64A 1VLZA 3IAHA 3E6AA 3HVUA 5IJZA 4W5QA 5JQGB 3QVLA 4A27A 4DMGA 4WT7A 4EFKA 1GL6A 3ESDA 3LPNA 1G5QA 1Z35A 3P96A 1RC0A 4GLOA 2JAUA 4RVSA 1M8JA 2JGLA 1S02A 2LVBA 3FCOA 3NXSA 1YTUA 4BE7B 2VCYA 3Q9SA 2B3DA 4G4GA 4U63A 1QFZA 4LF7B 1R37A 2FLKA 3C8DA 3EFEA 4PCAA 2P9ZA 2WM3A 4DNFA 5JJKA 1VZ2A 1BX0A 1H23A 2GD1O 3H2HA 4JHXA 5DP1A 3BIOA 1YZLA 5B3JA 3IXLA 4DMFA 4EJSB 2HF9A 2K5UA 4YO7A 3CZRA 2QAGB 3KT8A 2J0EA 2I5PO 2ZYDA 4MDFA 1QFSA 2JI7A 2IFTA 4NF2A 3Q9LA 4C89A 1EEXB 4RXTA 1C80A 1V16B 3K0SA 3CONA 3ESRA 1AKEA 3UXMA 2EHJA 1H65A 4AVYA 4OQQA 1W94A 1ZL2A 3VISA 4MOWA 3JYQA 2AOVA 2CXOA 1EA5A 4G5XA 1UJ2A 5BORA 1DARA 4B45A 1OW3B 4FSXA 5BQ3A 4GEKA 4RLSA 4C3UA 1KPIA 1SURA 1NJ8A 3NKFA 3I9NA 4HNQA 4OYHA 4MB2A 4L3WA 3EVEA 1AXEA 2PWBA 3NM4A 3DBRA 5FBQB 5FOQA 5KPDA 4H1WA 3B7PA 4U7WA 4DLXA 2O7NA 1E0JA 3ABIA 3LCMA 3PJDA 3FMVA 1ZUIA 3C39A 5G40A 3WGGA 4RZHA 2G9QA 3RRJA 3USCS 3KJZA 2XAUA 4EW3A 1Q6YA 2ZS7A 4L6IA 2MSNA 5HOQA 5IANA 5LP6A 3DEJA 4PHGA 4EPTA 1TPYA 2CVOA 3UANA 2C1XA 4U2EA 4DDTA 3D3JA 3W8RA 2HLPA 1QYCA 3CKYA 4DZRA 1QB8A 3D64A 2FUKA 2I55A 2QTNA 3OLYA 3MM4A 3UB3A 5KUTA 1Z16A 3RAEC 4H4EA 3RS2A 1E0AA 2TS1A 4GI3A 3GRZA 4GUDA 2IHVA 3BMOA 1DKNA 2GHIA 2BD0A 4BVAA 3I01A 5KSZA 1N9KA 1GG5A 1DO0A 4QQ8A 4JLJA 3S2YA 3B1VA 4WWHA 2J3MA 3ZI0A 5B5SA 2BMFA 2BDEA 4JDUA 2BE9A 1TYCA 1LJ8A 2JFNA 3HR8A 3VR4A 2VA9A 3CZAA 3GLQA 5K09A 1A9OA 1AN0A 4IM7A 5TV2A 1QM5A 3KQLA 2PJRA 1G59A 2P4UA 4YUAA 1ZGCA 2CXQA 3I01M 3IELA 3M6AA 4QICA 4XW2A 3S29A 1BX3A 3UK1A 4DIUA 4BFXA 1UDCA 2VHZA 1N78A 3H3XA 3FHOA 1FSFA 2HF7A 4MTCA 1D03A 2HBQA 3A0RB 2XT6A 3NOQA 4FHZA 4NQRA 2F1OA 4C22A 4EH1A 3UUWA 3WLIA 2YWEA 4TLBA 4OJNA 5FOTA 3FSJX 2QQEA 1F5NA 4JCCA 5HZMA 2RGEA 3D6FA 4DYHA 3OOJA 2IHYA 3RM3A 1J8QA 1PW5A 3LPMA 5H59A 5KYKA 3NP7A 1XZGA 2BFEB 5BNWA 4D81A 1SEVA 1P6QA 4IFIA 4AF8A 3Q98A 1B1CA 3AEKA 3IUNA 4HQ6A 4O29A 3TCNA 3OECA 1BS2A 1NVVQ 2H2WA 4H31A 4UEKA 4G8CA 2E55A 3GIWA 2Z4SA 3HXKA 4K1LA 4ZQCB 4AUNA 3AHGA 4Y9DA 1ORVA 1RJDA 2AUMA 4G5RA 3BREA 3NRCA 1FTNA 3HXLA 4GFDA 5EMHA 1UKEA 1MO3A 4GX0A 2PUDA 1IM8A 3QNWA 1VKOA 3MLAA 3P8ZA 2KWIA 2OG1A 2BFOA 4A2PA 2GSWA 2H1FA 2LP4Y 4IGFA 5DM60 2BFPA 4RZUA 5GOZA 3IILA 3U9SA 2JGAA 1KBOA 4GEGA 3VKWA 2PZJA 3AT1A 1DQNA 3V1LA 3D0OA 4R98A 1JI3A 1CXZA 4URWR 1LF5A 1LS1A 4HEHA 3QEMB 1TCAA 3DOCA 1BW9A 3KV1A 4TQAA 5EXTA 3RAJA 1TEZA 3JPWA 2WILA 1LFAA 1HT2E 3ETDA 2ZZMA 2P2SA 5JE8A 2WSBA 1FUKA 2RBGA 3SQLA 4E4RA 1T9BA 4WXHA 3D7KA 3AM4A 2VRBA 4PEVA 3PXEA 4I9FA 1LB1B 4HAXA 4MVJI 4ZTUB 3FZGA 1GNLA 5L95A 1Y7HA 4RTNA 1MB0A 3BA1A 5FUYA 1KQNA 1SVIA 4FOSA 2BGIA 2CEKA 4RZSA 3UCFA 2GEDA 4F1WA 1BQ3A 3HBAA 1YBFA 1XTBA 1MU0A 1C3OB 2R2AA 2AQKA 1A8QA 3NBQA 4MUXA 3U1TA 3ZWWA 3MFYA 1VJTA 3V1YA 4H08A 3AF0A 2P6MA 5ESDA 1I94B 3T0GA 2QVBA 3DHNA 2A5JA 1LQUA 2C2BA 2JK1A 4FFMA 4QXAA 3V7YA 1PFKA 4QJBA 4CL8A 5FR2A 1CP2A 2XCQA 3PS9A 4YQYA 1MNQA 4KXWA 4A8TA 1GUZA 1AX9A 4OQMA 2JGDB 1C30A 2Y2UA 3ZHSA 3LK7A 4P32A 1MJNA 2E5WA 3FFWA 1XF1A 4OQLA 2FAXA 1XL1A 4QWMA 5EINA 5H02A 1XJ0A 4KQHA 1PZHA 4LGYA 3OU2A 1ZD4A 1TAUA 1N2CE 5KTSA 6LDHA 4AIRA 2R6DA 1ZESA 2X22A 4OA5A 2DUWA 1Q7EA 3DV9A 3EK2A 2DT5A 1RNLA 1Q21A 2AGVA 3KPJA 5AXDA 4GI2A 1B00A 1KO5A 2B2NA 3KU1A 3O6VA 4BZPA 5BUSA 1EX6A 3DC2A 3PQCA 4JL6A 2GMWA 1JV2B 2MYUA 2B20A 1FRQA 3DMTC 3OX2A 3AYZB 4MRMA 4PNHA 4XX0B 5F51A 1ZK2A 2A0FA 5DXJA 5DEIA 4G6ZA 3ZUPA 2PKQP 2WLSA 3H1EA 3W1VA 3NATA 5IM4F 1JVBA 1P45A 1N4AA 1V7PC 3LX8A 4C4TA 3GUZA 3TINA 3THYA 4GDMA 4KAJA 5GQSA 3FW1A 3GGPA 1OKKA 4BE4A 2ZEJA 3AG6A 4QQRA 5FDFA 4R2HA 3QYFA 1BMFD 4EX6A 4RTPA 3HXQA 3ND6A 1SQ0A 4JLUA 1FC0A 2Y99A 3KOUA 4KSBA 2IYXA 4PANA 2Q6KA 3FSGD 4ETMA 1K5GA 2PY6A 2F17A 1Y3AA 5BV1A 3KSZO 3SWWA 1GL3A 4I3GA 3TEJA 1VE3A 5C5IA 2AOUB 4GQIA 4D9FA 5DV9A 5BY2A 1Z47A 3HPRA 3Q9UA 1PT6A 3DW1X 4Y6GB 3R7DA 2JH8A 4A7PA 4X90A 1XDSA 2Q6LA 1K7CA 3NT5A 6ADHA 1TYZA 5KOJB 2YINC 3R5XA 5IN4A 3NJRA 1DRUA 2GPNA 1U5CA 3LW7A 1W4RA 2GPSA 3DCYA 4AI6A 2WWHA 5C4IA 5GOTA 4TMTA 2RHCA 3RYIB 3X1XA 3RC3A 3VYTB 3DOUA 2Y6UA 1XROA 2QVGA 3PITA 2VKQA 3IHWA 4U8GA 5EHGA 4BRZA 3PFNA 4RPJA 4UUMA 4Z7NB 3H6GA 1TOAA 3KB6A 5ALFA 4TT8A 4FZ3A 4EKYA 4JC8A 1M66A 1TLFA 2QP3A 1LLCA 4W9MC 5EJEA 3N9IA 1H85A 2UUPA 3T12A 2HCBA 3REQA 1JR3D 5IYZF 2ZR8A 5K9ZA 1PWHA 5AUNB 1IY0A 1FNSA 1BU5A 2JA2A 4NE7A 1PZNA 3UY4A 3DGEC 5HYVA 1LVGA 1UDRA 3CT4A 1N8SA 1P5JA 1VXRA 4IPTA 5D3KA 3SCZA 3SGLA 4G56A 4DLAA 3SK0A 4EGQA 4JBNA 3ZUGA 3ZQKA 1G0NA 4P4UA 1P6UA 3CF0A 3IO5A 1FRZA 3SEFA 3JVIA 1ZONA 3E8XA 2AE2A 3BBLA 1NX6A 1LPSA 1CUVA 3DLTA 1SUBA 2Q21A 4PVDA 3QWIA 2A5DA 3MUNA 1Y6QA 1X7YB 2FZEA 4O5OA 3ZU3A 2J3EA 3LQFA 3O31A 2XB4A 3TRJA 4U7DA 4BJHB 3DDWA 1B43A 3NX4A 2IH5A 4NNJA 2HPHA 1YFZA 2BMWA 2AXQA 2Q9AA 3TLKA 3VKGA 4GW3A 3X1ZA 4YALA 1I3KA 2XTJA 2FPPB 1BMQA 1G7SA 3A9UA 3ZWPA 3DE2X 2IYUA 4ZC8A 4HQRA 4RKRA 5A6SA 4AROA 5EHXA 2DXIA 5AJYA 3RNOA 2UUOA 4JI6B 2ZDGA 3KB8A 3NXKA 1HFEL 5FOSA 2FPMA 4G5HA 1WIWA 2BEVB 1C1HA 5K0NA 3RIGA 3U13A 5LDHA 4LQDA 1KO1A 3WGOA 4WESB 4DMRA 3HEBA 4RXMA 3HZRA 3DBOB 1BWPA 4RM3A 2GHTA 2WA1A 4WKCA 3L4SO 4CMJA 4G1VA 4AP6A 3FYTA 4YMIA 2OVFA 2H2HA 3T1OA 4ZN6A 5BVHA 3ER8A 4PCLA 3EVNA 1P60A 1EZ1A 4EBBA 5FXMA 2AG8A 2VHXA 1W5AA 3SJCA 3I4FA 3TSOA 4MW6A 1AA9A 2ZAMA 2ZIZA 2RHRA 3IX7A 3P9CA 1G18A 3LNCA 4H3HB 4LTNA 1VMDA 5J59A 1KYZA 5EZQA 1AQ6A 4XIGS 4CR8A 4NBWA 4Z8XA 5C53B 1A88A 5L3SA 4KFCA 2ZQYA 2BUAA 3EDCA 3GZ4A 4GP6A 3TIGA 1PFWA 3OD5A 3IEIA 5INTA 3CLUC 4N0PA 5GIPE 2PIDA 2WDPA 2WIKA 3H7AA 1O95C 2AIRA 3HR7A 4KQCA 1SM4A 5TQJA 3TBFA 1O4WA 3USES 1JHUA 1NC3A 4KWCA 5LDGA 4BO1A 4A1FA 1MG0A 5KDOA 2JIOA 3C6QA 3RBXA 1IB0A 2ZYTX 3EGIA 5CDSA 1J2JA 1TVEA 1EQAA 4QRIA 2DP4E 2Z6QA 5IK2A 1P1RA 2GBPA 5CG2A 1WXHA 4BNVA 3H8JA 1XDBA 1J0AA 3HU1A 4X8LA 2O2EA 2D7CA 4WACA 1V4VA 3SR0A 4JY7A 1EBBA 5CFOA 2ICAA 1U5BA 2UVPA 5I8PA 3QKRB 4HUJA 3TSAA 2PZFA 3TK1A 1GNVA 3T3PB 3DEKA 3NBYC 4EG0A 4AICA 1VGQA 2X8JA 1YK0A 4JLBA 4UE6A 1PX0A 5HKLA 3CN7A 3LG2A 4JUFA 1J2UA 3A06A 2NQTA 3B8HA 3T5TA 4PLVA 3AMVA 4UDXX 1VE1A 1LNSA 4X63A 2WAXA 4ZRMA 1PT7A 2IXEA 2YC2C 2VJAA 5TB5A 3CKMA 1R3DA 4XVCA 1DT5A 2OHGA 2R5FA 4FZVA 5CP8A 5KKCA 1YZKA 1A8IA 3L43A 5DYTA 5IJ9A 2X5OA 3LUAA 3CX6A 5B58T 2CJWA 1NFQA 1V39A 4Q48A 3KOXA 2EZTA 5FJIA 5IDXA 4X62B 4CL3A 4JGIA 2NU7B 3FB4A 4D57A 2P77A 4IIJB 4F4DA 2I2CA 4MICA 4KIUA 5DK4A 2WHRA 3ZE1B 1J9ZA 1UJMA 4O4HA 1PGNA 1ULSA 4MV5A 5DNVA 3WAKA 5M5BA 4HLUA 2EKQA 1CF9A 1IDOA 2ZSJA 3ITKA 4LWOA 1AUPA 4NE2A 1ISSA 1L4FA 2MWMA 3AHIA 3O4JA 5FRDA 5K6TA 1KQGA 5HNKA 4AKIA 1V1RA 3R76A 4WOKA 3QG5A 3IALA 4B3FX 2JFPA 3DKIA 4RJJA 3TTWA 4DOMA 4QOIA 4XYBA 3G2MA 3WGVA 4FJ1A 3RODA 3TTSA 3QP9A 1CB7A 4IEFB 4IQ8A 1P9OA 3EXG2 3KBOA 3HSYA 4FFNA 4FDVA 5HW0A 5K0EA 4MMZB 1C3EA 4Y2JA 4AJIA 3DZGA 2WJAA 1GFWA 3FBGA 1TM3E 1XQ6A 4WGGA 3M3DA 1TNDA 4BWGA 4OFWA 5CH3A 1G8AA 2VZ8A 3B5IA 3AY3A 3D7LA 3PA6A 2WFLA 2JG3A 4QEDA 13PKA 3BE8A 4BN0A 1LBQA 2Z6VA 3BGOS 3EYAA 4HJRA 2AI3A 1U8XX 5FB3A 3LWNA 2NNLD 1Z2AA 3HZOA 2W71A 1OBHA 5EHIA 4X8HA 4E2WA 4I5IA 3DLCA 3THXB 4GKVA 5TS3A 1TK9A 1ORWA 3ZZMA 1EE1A 1RXEA 1Y0BA 4PSVA 4FXPA 3D7NA 4I55F 1QRRA 5DM0A 1SOUA 4RVDA 4WXEA 5FQOA 1N92A 1XGKA 2XOKA 2Z08A 1YWGO 1JDNA 4H1TA 4ND1A 5CAEB 3GI1A 3IKLA 4PAWA 3PJRA 1TW3A 2YVKA 4V2IA 5LMUB 3OFVA 2B4QA 4ADSG 2CB9A 3DULA 3LX6A 3SPXA 1A7KA 1N3YA 3IDOA 3BHNA 4LZOA 4Q7EA 4RPCA 3R5SA 4G89A 4X54A 1HMPA 2JW5A 1NL3A 2QMUA 1XZ8A 1T0IA 2C8KA 3CMCO 4JR2A 3LBIA 3W8FA 1M1YE 3ZW8A 2IU4A 3SE7A 3PE3A 4BJ5A 3ZK8A 2G1UA 4MQFB 2ACEA 2WZBA 3NQ41 4DLUA 1DKQA 3DO8A 4BKQA 2O06A 1UXIA 3OCVA 4A92A 4B4DA 5BO5A 1OBOA 3H99A 2Z83A 1WSAA 1VHDA 1G19A 4CM7A 2C00A 5KWVA 4OXQA 4UNQA 4BVHA 3I6QA 4COOA 1P44A 5AW4A 5I7VA 1EVIA 2GCGA 3L1UA 1XMSA 2GK6A 3QUQA 5GONF 3WDSA 3U7GA 4ZVKA 1MW8X 2GN1A 5FBZA 4R6WA 4FFVA 3WK9A 3IEMA 1R27A 3PR1A 1JN0A 5AI5A 4HWPA 1PSWA 4Q37A 3RABA 1JLKA 3EWNA 4MQLA 4KPFC 5AW7A 1N2IA 1RM5A 3P9YA 2AD1A 4LV8B 3RADC 3ZEIA 4E1BA 1UZNA 2EFGA 1FFXB 4M87A 4CU2A 2ZB7A 3SC2B 3QJYA 2BMDA 2J41A 1X39A 4ZMBA 4G1CA 3TLYA 2KHZA 2EBHX 4PSCA 4JC5A 3BXFA 2GLXA 2G9UA 1IY9A 3UCEA 5LKRA 2D06A 5D5PA 2Z5FA 5BQXA 1ZK4A 4YXWA 1TVMA 2J0VA 3NEPX 4JT8A 4BJ1A 5AJUA 4PYRA 3DE6X 1SD2A 4D4JA 1XLUA 2FMKA 3EIOA 1RWMA 1PZGA 1P8JA 3TEFA 1MR3F 4W1RA 5H3LA 2Q4RA 1KK3A 5B53A 4PC7A 4YAEA 3KOMA 4PPGA 5FWNA 1RCUA 5CA0F 1Y9EA 3LY5A 4PLCA 2QZ4A 1EFAA 4J0HA 1AKTA 1I9CA 1X1SA 1RKQA 2I3BA 3R5FA 4BEVA 4BXOA 2FSSA 1JT2A 4L5IA 1SCQA 1UXKA 1XEWY 1U2GA 3E3NA 4RQAA 2ENUA 1DC5A 2EKPA 4WK6A 1A8HA 1ZEJA 3OFKA 1M6EX 3DQPA 3V7WA 4E13A 2XECA 1C1YA 3UC5A 4P4TA 4WBNF 1E18A 4KIWA 4OLFA 5HFJA 4EMUA 1T26A 3DPSA 1HQDA 1I9GA 4H27A 4D3SA 1PG0A 1PJLA 4M7WA 2O54A 3L1IA 4BTVA 4L73A 2BHRA 1WA5A 2X6TA 3WV4A 1D0SA 1Y7PA 1BHSA 2VNHA 4MGYR 4PM4A 1WW8A 1GKLA 4YS6A 3VR2A 1DO8A 3WMFA 4NEQA 4R16A 1U7OA 4P82A 4P5EA 1EK5A 5EUBA 1YZVA 2LZ0A 3IJRA 1SPBS 2R6ZA 2QNBA 3DLAA 2QU8A 3G02A 5CLHA 3ZK9A 4C29A 4P80A 1K63A 9GPBA 1KL7A 4EK9A 1SG0A 5CRIA 2RARA 2AD5A 4XFJA 2VP5A 3VNRA 5KNCD 1IBCA 5LVAA 2IGBA 2M1XA 2OOSA 4Z54A 5A9SA 1JLSA 2B5VA 2H7CA 3O4RA 3PNQA 3BE5A 3LCJA 5A06A 1YDMA 2IDJA 2VHCA 4A6DA 1RRKA 4WPGA 2Q8QA 2CDAA 4TLLB 4WXPA 1DIBA 1YACA 2PL9A 3JAKA 3OM9A 4G8JA 4ALNA 2JCXA 2OE2A 5H5JA 5HIJA 4OHUA 5A03A 2O0MA 1GYRA 3NIFB 3ANLA 1W85B 5KC9A 2X9NA 1R4NB 3QYJA 1U3UA 4UQPA 4O2AF 2O8BA 1G64A 5JNLA 1G3RA 1N9GB 3P9SA 5D87A 4DXAA 2P2NA 2D1RA 5FULA 2A2ZA 1JT9A 2CNWD 3K1AA 2EKBA 1QRSA 2H07A 3HPQA 3LPLA 4GOND 4JUCA 3E5HA 4TUYA 3ZJVA 3U4AA 1U80A 1YK1A 2G28A 1G9SA 1ZMOA 1PVVA 3DEIA 3HE3A 4N1AA 4ZRDA 3FUCA 5F78A 9LDBA 2GNAA 4PAQA 1Y4SA 4M86A 1YJXA 2V7GA 1HLPA 1MZVA 1KYVA 1TI7A 3D8HA 1QH0A 1KK1A 5HJEA 1WBBA 2QQGA 3MTQA 4N47A 3K1AB 3FBWA 3DWGA 4YCMA 1QMPA 3EPPA 4DF3A 5DRYA 1NA5A 3QEBZ 1VIDA 3L0CA 3RC1A 4FWTA 2WIAA 4IKEA 4DCCA 5E3JA 2AC7A 4JVSB 2H6EA 4AUKA 5F7OA 2IEZA 4ZZ1A 2WYHA 5LQNA 1T5IA 1JQKA 2JLCA 4FB4A 4MITA 1DJPA 3QG1A 3DZKA 3TMKA 4E6EA 2IY8A 2O52A 4M54A 2GPBA 1CZNA 2PUCA 2J3LA 1TKAA 2ETVA 3GOQA 4TSRA 1AXRA 1E2LA 1UC8A 4L4XA 4EY5A 2PS1A 1N2ZA 1FFAA 3ENZA 1XMXA 4L7QA 3SBXA 1FX0A 4XZ3A 1P2GA 3CB4A 1S5PA 4O4LB 2JIDA 4MRVA 3KVNA 4LXIA 3DZ8A 1IHDA 3QI7A 3F1LA 4BO0A 1DELA 1E9BA 2BF7A 5REQA 2DUNA 4JT4A 4YRFA 3MWKA 3N0XA 5HM8A 2ZKIA 2CCKA 2W2MA 1CZKA 4UE3S 1UL1X 2QRZA 1E2PA 4DJJA 2PFSA 4MMXB 4J0IA 4LBYA 4QBIA 3ECSA 4PXYA 1AQJA 1ZIXA 4WFKA 5EKXA 1HQKA 4OMDA 5D1NA 1XZPA 1F0YA 3LU1A 2VQFB 2QU7A 1DIOB 3GDHA 1RAGA 1EXMA 1NGSA 3EA4A 5G0TA 1XF9A 5JV5A 3A3NA 2VDVE 3HU5A 3ROGA 3Q7QA 4I46A 2VHWA 1WB4A 2UZAA 2REBA 2HX1A 2C0PA 2R1ZA 4FBLA 2XGJA 2Q45A 2NPOA 5I9IA 3NFYA 4LVCA 5AK5A 3QLVA 4NBNA 3K16A 1RM4A 4OFBA 4R2XA 4X93A 2HMUA 2O57A 2VC2B 5JAPA 5C51B 2ZE6A 2D5LA 2VDWA 2W2KB 3KFVA 5JD4A 3AX6A 1HM5A 4DA9A 3GPIA 1S2OA 4M0MA 4QO7A 5IDVA 2VNIA 4ZHSA 4BC0A 4ARUA 2Q5QA 5KDLA 1SG9A 2FPUA 2YYYA 4A5SA 4Z9AA 4DWOA 3AB7A 4KQIA 4LZLA 3JR3A 4KPYA 1JDBB 2OBYA 1IG3A 2ZBVA 5CHEA 3VR4H 5CTJA 4G0PA 3KQOA 4O2LA 1EDDA 5FO0A 1AS2A 3P4UA 4WN9B 2PGLA 4TM7A 4AQ7A 5AHKA 1VB5A 3EZ7A 3M6FA 4R8LA 4OGFA 3RSQA 2XZDA 3EXAA 1HYGA 3KUUA 3M5CA 4B4WA 2ZRHA 4ILKA 5KTPA 3BAFA 1HK7A 1YCHA 1ZD2P 3FOWA 1NHGA 1B73A 3PNOA 2WJHA 1UXJA 1VYVA 3EXHB 4MUFA 3HL4A 2ZSAA 4RKQA 5E9WA 3Q12A 3TW0A 1OXBB 5CVDA 4DFDA 5MGBA 4TV9F 3GLFB 1ETUA 1KY5A 4FW8A 1VBKA 3BGWA 3CLHA 1V11A 4MB6A 4LVNA 3TOSA 1MABB 4B4VA 1RJ9B 1SKYB 1XU9A 5FP0A 3ZPXA 3ZGVA 5BN3B 2E37A 4UE2A 5FL3A 5C8VA 3WGIA 2R97A 1R5OA 4Z2YA 3LBYA 4L15A 3F98A 2BP7A 3UWPA 3DAHA 1KO7A 3MCWA 4B09A 3WOHA 2XMDA 4EVQA 5HSGA 2ZREA 1U9CA 2JCBA 1FQWA 1NUSA 3GJZA 5CW1A 2A94A 1H2YA 1YBVA 3SYRA 5CK4A 4EA7A 1WXGA 1D6MA 3NNNA 3O0TA 1ECBA 2HWKA 1O94D 3CURA 3IV9A 5AVTA 4B3MB 4MHTA 3E5RA 1OWMA 1MIHA 2NAFA 3PUWA 1I0IA 1MHTA 4D8WA 2VAWA 5EIHA 1ZGZA 1N3BA 4GZLA 4CL0A 3I23A 4ER0A 1K0FA 5B12A 4ZU1X 3TUJC 1XCJA 4HXGA 4NI5A 1B74A 3JALB 4HC4A 2IDKA 5BOVA 3V3KA 3PNMA 1E2NA 1IEVA 4QUBA 1IQ0A 2AYZA 3LZDA 4RVHA 4LDZA 2VHQA 4PTYA 4QSMA 4TTSA 4EENA 2NP7A 3NZEA 4RV4A 2GF9A 4MUEA 5LLSA 2RE8A 3R2JA 1ZSVA 5DT9A 2B94A 4MGHA 3U37A 1DJMA 3KVOA 1M0WA 2ISSD 1ZOPA 4J2OA 4NECA 4RQBA 1KBZA 2XZTA 2A86A 4HNGA 2CC2A 1B23P 2Y93A 1AUXA 4UD6A 3REQB 3ER9A 1AURA 4WJLA 4O0LA 4NMMA 4F5ZA 3JCZA 3SP1A 3QITA 3RROA 2I3DA 1U9ZA 1Z7WA 1VPTA 3EWIA 1Y6ZA 3DZFA 4GOMD 1JEQB 4LHVA 3ZKWA 3MB5A 2C88A 3ZU4A 4QYMA 3LJKA 2E4ZA 2V7PA 1IATA 4ZJPA 2E9SA 3TR6A 1Q91A 1FVOA 1FZQA 3D5EA 1E92A 5HKKD 3RJZA 5F73A 2IHKA 4C87A 1JU4A 3RTDA 4PNZA 1KPGA 2OBXA 1H2ZA 3M1LA 4HDRA 1K2WA 2CBGA 3QFHA 3BB4A 4F5DA 3QY9A 4BMVA 2EATA 4OQFA 4U7JA 3SIRA 1GZUA 4LJ7A 3A6LA 3ETGA 1RPJA 1PSZA 1YRBA 1Z2NX 3DYIA 2C7OA 1RPNA 2H1VA 2XZPA 1I8TA 2EU8A 2QTAA 1U11A 3ZLJA 1FMCA 2FOIA 3LZCA 3N74A 1MKYA 1LLDA 4PV7A 4EW2A 3OZIA 3DZCA 3PUYA 3LUFA 2IQ5A 4BNTA 1BD4A 4XCVA 4XWGA 1OLOA 4TKUB 1RP1A 1E0DA 3PPYA 4C4YA 1HT3A 2UAGA 1XHLA 1SCNE 1WS6A 4EY7A 3EZNA 2BR3A 2AS0A 9LDTA 1VLVA 2FYTA 2NZUG 1MEOA 4IIJF 4ZJUA 2HJHA 1AKMA 4JHLA 1ESNA 3GZNB 1IJBA 1M0TA 2H9IA 2Y67A 4M46A 1U4OA 2FPWA 1K3TA 2I03A 1SVMA 1RYEA 3U7FB 2J87A 3VDXA 1JP7A 2C5BA 4RZ2A 4DCTA 2SECE 3ADKA 3G0BA 1G5PA 1VG1A 4RPKA 1ACLA 2XIJA 4X6XA 5A5DA 1JEYA 1PQYA 1NOKA 1MQ9A 2B78A 4QGFA 2D4HA 2BP7B 3KXLA 2PQMA 2W6ZA 3D3WB 2HZ7A 4Y6QA 5G0SA 4D5GA 2G06A 4TSFA 4N18A 4ZANA 4EFLA 1FDSA 3PI6A 4KR9A 1T9AA 1RP7A 2H51A 5J4KA 5JY1A 4JENA 4FYYA 3HYNA 4L57A 4YJHB 2OGZA 2CVPA 4NNPA 4R4JA 1V3VA 4FQ7A 2JF0A 1NULA 1HE5A 5EQTA 4AYTA 5H9VA 2VTBA 1E5LA 5FPHA 2TMKA 4RMIA 5I7RA 4DGQA 4P3YA 2A6PA 4DLWA 2A84A 3LT5A 3VAZA 3O8OB 3P2KA 2WTBA 3H1GA 3MVEA 2SNIE 2JZOA 1ECLA 3RRNA 1Z06A 5EIWA 3GRVA 4TTPA 3DMDA 3FOCA 3JQ6A 2OHOA 4NPHA 2P78A 2J67A 2EF0A 5AKZA 1N1DA 1DRKA 1Z63A 3MTIA 4G4SP 4AJJA 1MPTA 5BR1A 1F2VA 3O8OA 4JP3A 5HUHA 4LYHA 2P79A 1XMJA 2ZIEA 3ABZA 3D6HA 2CLMB 4HX5A 3TJZA 1JR3E 2I2FA 3PYLA 1K0UA 2IZ6A 5IT9A 1E2DA 3C70A 1PVOA 1LSJA 1NVXQ 3AFNA 4FZRA 3TRFA 2YKGA 5A4FS 2IS2A 4E94A 1JEAA 1C0PA 4ZVSA 2O2XA 1B8OA 1QS0A 5ALGA 3N76A 2XEDA 3KO8A 2JLSA 2GTIA 4HUQA 3ZEAA 2VJCA 2RJ3A 1M0EA 3VVMA 1NDQA 2O5VA 1G38A 4H6WA 5IHXA 4KWHA 1EE2A 2FRDA 3HG7A 4R0NA 4D82A 4G4IA 1UBLS 4KXYA 3UGQA 1KRWA 4N49A 5ARCA 4HDRB 4WXRA 2EAUA 5F52A 3C3AA 5CB8A 4AQYB 4D9NA 2ENWA 3M6XA 3PU6A 5BMVB 3A1TA 1Y5LA 4WKNA 3TQTA 3FNEA 5HF9A 1DPGA 2OZPA 2QMOA 2ZI5A 3MMZA 4TTTS 5DNEA 3WP1B 2OUKA 3WQSB 2WIJA 5D2CA 4ENPA 1L7QA 3JQAB 4IFBA 5JADA 1CD5A 3RHSA 1IHUA 2FWRA 1TZJA 5AKIA 2XHEA 3GRYA 2DAPA 1MX9A 3RVPA 3GP3A 2CMKA 4UZSA 2VAXA 3EIHA 1BH6A 3BT7A 3KL2A 5ERGB 5JROA 2Q0QA 1W19A 1X15A 4F21A 3N2GA 2PRKA 1SUDA 2X9QA 1SU6A 4NV0A 1WMFA 4UCFA 4YREA 4C4OA 5JALA 1GCIA 2B0JA 3I9V1 4ILEA 3LXUX 3GK3A 4UXHA 3WWYA 4RD3A 5CR9A 3AL0C 3PL1A 4JJAA 4F11A 2P30A 2X2FA 3JYHA 2DUJA 5CUQA 3S55A 1XVLA 2CXRA 3UWDA 1NF3A 2BT4A 2DBQA 1RAAA 2Y1CA 3NIGB 1QBKC 1L5RA 5EWJB 3WNDA 1RKXA 4TV8B 2JFHA 4QTYA 4V1CB 1M1UA 1WZNA 3Q6IA 4US2R 3D3WA 2CNOA 1QOZA 1KR2A 2PZGA 3I45A 3H9CA 4JROA 5CT8A 4ZYLA 1VL6A 2X58A 1I7QB 5T5QA 4X60A 4UASA 1NLZA 2FW1A 4Q7QA 5ICGA 1CS0A 4MO2A 3WKEA 5BQPA 4URVR 1XNRB 2G82A 3L7AA 1NXTA 3AC0A 3QVMA 4M9XA 2P6PA 1PK9A 4Z0TA 4U7GA 5AI0A 1BGXT 1LPAB 2R44A 3UG6A 3KAQA 2ZUSA 5HQ3A 8ABPA 1Q0TA 3B6ZA 4NEHB 1KXJA 5A7HA 3DOOA 4Q3NA 2JASA 4IWXA 3E81A 1Q15A 2N47A 5DKFA 3M1YA 3VOTA 2HA6A 2Q2OA 2VF5X 1OWNA 3AKCA 4ARIA 1UFVA 2LKCA 1YB5A 2H8KA 3GZJA 5ALPA 1M67A 3TPCA 1Z0AA 1DINA 3RSOA 3U3OA 3K9FC 2ZCJA 2Q2NA 4IMJB 3QZUA 3WHKA 3AEZA 5G4LA 1LH0A 3RREA 2FZ5A 3BMCA 3VMFA 1GGNA 3Q41A 1R1DA 4KFTA 1BVUA 1A3CA 5HE9A 1XHEA 3D4NA 4C2AA 5IULC 4J7UA 2Q2VA 2D5CA 4E5MA 5MFZA 1X1DA 1X8LA 2H9YA 3LWZA 3IMCA 2OLJA 3X1YA 4R2WA 4RY2A 2WJWA 1DSSG 3A3KA 3L4EA 3QHAA 3A1NA 4HB0A 2V7WA 1RJWA 2RHOA 2IUTA 1ZNYA 2RBEA 2YQ5A 1SB9A 1J1UA 1P4HA 2OTCA 3H87A 3FWKA 4XIJA 3ZIUA 3ILSA 1QS0B 1JEEA 2GM9A 2P27A 2QW1A 3WYGA 4UCWA 4KKXB 4Q7MB 5BURA 3SAJA 1YU6A 2DKOA 1MRZA 7MDHA 4D43A 4URXR 3WTBA 2BGRA 3KQWA 3T3HA 3DAFA 421PA 1TUGA 1W4LA 3O4GA 4M9CA 4J29A 4JDPA 3CHYA 4LJLA 2EJUA 2W7TA 5HCNA 5BVGB 3T1NA 2PGNA 1YQDA 2QLNA 3A14A 2XUHA 3IBYA 4BE9A 3H05A 4RK1A 3HNOA 1M8PA 1UJBA 4H3KB 3GJ8A 3TUZC 2VDQB 2HUNA 3U60B 7REQB 4FI3F 4MKFA 4MV4A 2N9UA 1UBRS 3SFTA 1C1XA 7AT1A 1P73A 3GDOA 3NNSA 2D2XA 1NBAA 1EFHA 3AU8A 5D6NA 1AKYA 2VNJA 3TDKA 4ALKA 4I5GA 4WBXC 3RS7A 5KYNA 1CRQA 1E1YA 2C7BA 4UXIA 3KAKA 4RSMA 3CKLA 1TTTA 1WZIA 3G8DA 1K9SA 5EYPA 3LMKA 3VZDA 1TAGA 3Q7SA 3ZWXA 5BPFA 5KZMB 2XXJA 4EJMA 4QATA 3G9XA 5IC5A 4JQYA 3ZCQA 1W48A 3ZXIA 1DB3A 2CZQA 1ZUNA 1O97D 1OB2A 3MSXA 3H8SA 3H8VA 3VR0A 1EM8B 2AVDA 3MJTA 2FZ4A 4Q82A 4I19A 1F2TA 1E20A 1NW6A 1CUGA 1PS0A 3BFJA 3WLSA 1M54A 1C0EA 1T15A 1GAQA 1U04A 2QRKA 3MHPA 1JTVA 5K8IA 3PX3A 2J6HA 4A10A 4JV5B 3OFND 4MKXA 3I53A 3LQKA 5A0FA 1NJ1A 5NULA 5DWDA 3VOBA 4CT5A 1IZ9A 2PPVA 3K96A 3LRTA 3IR7A 4GG1A 4J07A 2VK1A 4RF2A 5G0UA 1LEHA 2O7RA 1ZNXA 4CI0B 3E7WA 2IDZA 4HQFA 3G2HA 3GLHA 4M99A 3IOMA 3WQQA 3L0IB 1GR0A 5CGZA 4ZCIA 4ZJZA 1ZSNA 1AK1A 3I05A 5A02A 2C04A 2QRVA 3CX4A 4NZ9A 3BZUA 5EZYB 1ND5A 1KY2A 1RVDA 2YRFA 4LIPD 5B6PA 3L7DA 3EQ2A 4PLTA 2X8AA 1M5UA 1H8HA 2Z4RA 1NNEA 2YHAA 4OP2A 3JR7A 4WHMA 5TR9A 2A1UB 3UCXA 4CN9A 1XEXB 4HLQB 1MX3A 1NRIA 1OVMA 1NW9B 3HEAA 2UZ4A 1NMSA 1T8RA 4HQNA 2ZRMA 5J9FA 3C5HA 4QULA 3GX1A 1TT5B 4P3XA 5FNVF 1TIBA 3M9WA 4M2LA 2Y6VA 4R7ZA 4F9TA 1U02A 4R5HA 2A1UA 3RKUA 2Q2QA 5K5EA 3ZX4A 4Q39A 3E9EA 1KC1A 4QDXA 4YP9A 3VSDA 4GYWA 2L17A 1KGDA 1KZ9A 2PCJA 3ZDBA 1N1GA 2CFCA 3VR5A 2G09A 3DDUA 3KXDA 5EQFA 4CNBA 1ZR2A 2XBMA 2ZG6A 3B70A 3GPCA 4Q9IA 4KVAA 1N1EA 2YXLA 2ZAGA 1IBSA 2ZVQX 2DFLA 1UDAA 3DC7A 3MMNA 4ZOQI 5KIAA 3FB1A 2COKA 4NJEA 4LGMA 4EZBA 2A7QA 4JSYA 4G0WA 3R3YA 5K8VA 1Q57A 1LSOA 2Z1DA 4IHKA 1EK2A 5JD5A 3A9RA 1B16A 3HFRA 5EJFA 1OJ7A 1VDZA 2F43B 4GLBA 1KYIA 2VUSA 3AGPA 5B3JC 3OC0A 4XWYA 4YMWA 4PLYA 3GDFA 4MROA 5EEGA 4YYEA 1NBOA 4GBGA 1ZBQA 4FKZA 1GPH1 3IQXA 2QZJA 3G2KA 1H1LA 2GWRA 2I3AA 2JDIA 1VI5A 4RFLA 2ZIXA 1KE1A 4D0GA 4L0CA 3H83A 3FPGA 1GDDA 3COZA 3U80A 2VT7A 4BV8A 2P67A 2YIJA 2DHRA 4HB4A 4Q02A 5I9SA 1VL2A 3I4CA 3V4OA 5TT1A 1T6BY 1VLJA 2OESA 3DDZX 2XYVA 1T3LA 4MDHA 4ZT5A 3WSWA 2OSVA 3A6FA 1ETHA 1FBTA 1BQEA 1JHXA 5CDGA 3LA8A 2BEUA 2YXNA 4LECA 4CF5A 5CCXA 3HJNA 3HC7A 1I3CA 5HIIA 3IEUA 1K6IA 4WVFA 2B2XA 1PWZA 4DR2B 3PQFA 4L8FA 5B4VA 4A36A 4BWVA 1T43A 1UKVY 3NG1A 5C1DA 3WTCA 1GZHB 4Q5IA 1UC9A 1S7CA 1LDNA 1EJ0A 4HSGA 2R25B 1T9HA 5SICE 3Q8WA 3RSZA 4FILA 3TIIA 2QP4A 1AY0A 4BZZA 2QBYB 3SKXA 2FEXA 3GLHB 3CVUA 2H7YA 1T3HA 1JAZA 821PA 4DR1B 4ZYTA 1W9MA 4KNYA 1HLFA 5CFMA 1YMUA 2RGDA 2QRVB 3A37A 4H60A 3U4CA 3Q3EA 4BEWA 4CF7A 2P0YA 3M6LA 3V34A 2XUQA 1GN8A 4C3OB 2V8BA 3U48A 3U3ZA 1EWKA 3WFJA 3BL8A 3PQ6A 1N6PA 4FGKA 3DUFB 1L4EA 4WCDA 3SJZA 4D56A 4HXYA 4PG8A 3D4LA 4MTLA 1WXWA 1UMBA 2P9HA 3TJMA 2BCJQ 4Z9FA 5AKGA 1W8IA 2MTBA 5F64A 3TAHA 4FS8A 3NHMA 2NACA 1FJGB 1Z13A 3H4VA 2PFKA 4KQEA 2ATIA 2R62A 4HFJA 4RL6A 4YPFA 1GM5A 2A9KA 4PQGA 4YACA 5A5GA 2I54A 2YOFA 3K1TA 3UN1A 3D6NB 3QRWA 1FS5A 3N0RA 5LZ8A 2E4AA 4Z53A 5TJHA 4MJLA 4AO8A 1RTKA 1B15A 1IY2A 1EI9A 3KEMA 2C5HA 4JB2A 4PTZA 3SX0A 4DADA 1QUEA 4EFDA 3EX7C 3TQHA 1HUQA 1QO7A 4ID9A 3GLGA 1M2OA 4LNHA 1PIWA 1Z45A 2IUSA 3AXSA 4QKQA 1HE1C 2PZBA 3PEVA 2LWIA 3KC2A 3O73A 1NUTA 2QTRA 1ZD1A 4ZOCA 3W6NA 4ENSA 4HXEB 3ZWCA 4CLRA 3EF3A 3QE0A 5AM5A 1OIWA 1Z4PX 4HN2A 1BXRA 1M6VB 3F2VA 2ES4A 1P33A 4AZVA 1RQXA 5AKXA 4YRMA 1N0IA 3MD9A 4XX1A 2Q4EA 3CW8X 5HILA 1P77A 1WPXA 2ST1A 4JEHA 2PGJA 3EUEA 1V11B 1L5VA 1NWHA 2CV2A 2DKNA 2HHJA 2O19A 3DOFA 5E4FA 2C2XA 1M34B 3PF9A 3C6XA 1XA4A 3DFMA 4V03A 3DZDA 1YONA 3T41A 3BRWA 3PQEA 4MW9A 2ZI4A 2VP4A 4GVLA 3ADBA 1EWQA 5JCJA 5IXJA 5CDFE 4RDIA 3T94A 4EPYA 3SFZA 4RHFA 4GL4A 5KYTA 3O8NA 1YVEI 1TEHA 3A27A 2RGWA 2GERA 2XF2A 1R0RE 4JKYA 3VJKA 1E79D 1O58A 3DB1A 4OSPA 2Y1GA 3V48A 5GJBA 4CKWA 1XP8A 2ZYSA 3AVVA 1PR4A 1E9DA 1SIBE 1Y5NA 3NWEA 3RE1A 4MYSA 5JZBA 1FDRA 1VIVA 3AKZA 3OC6A 5FBHA 3RUIA 4WZAB 5F3DA 3TXYA 4FC7A 4I3FA 3DP9A 4JI0B 1GPUA 1RPAA 4TTQA 3PSAA 5C8YB 2XF8A 3GEMA 4IS3A 4LMPA 5JNUA 3WK8A 4CM8B 1PYDA 1XQXA 4ZWNA 1W4CA 4QOGA 3I2JA 1Z12A 1R4MA 3UJ6A 3E3MA 4KSCA 1IYZA 4NRDA 4WESA 4WUTA 5ECGC 4DM3A 1JDUA 3DDNA 3GFGA 1QB7A 4IZIA 4BGUA 1O0CA 5FWAA 5HG0A 2MR6A 3W5IA 3T99A 4WX2B 1S1CA 3PHHA 4IZ6A 1UJNA 4M1WA 2G4VA 5CVJA 1WSBA 4RAOA 4IGIA 4V0OA 5DLQC 1SHUX 4YJGA 1RWXA 3B1FA 1II0A 5EQJB 2HADA 3X1MA 5B7PA 5KVSA 5A5FA 1FNNA 2XGMA 4UPVA 4ZPXA 2ID4A 2Y71A 3L1HA 3M9LA 1EHCA 1T36B 2CFSA 3WSTA 1L7OA 2BTQA 4WK0B 2WJ6A 2HF8A 1R9NA 3EVTA 4S35A 3VAAA 5BSUA 3JASB 3OJFA 5IF3A 2EG5A 1RYBA 2F1IA 1WY5A 2GZMA 2GLUA 3MJHA 3K72B 4Q9HA 2AHOA 2ORYA 3EVAA 5AO9A 4PG7A 3UOAB 3QOYA 4B0PA 1UQRA 2OO5A 4C7VA 4R8RA 1RT9A 4BYMA 3DDSA 3Q40A 4OTZA 3O26A 5T57A 3PC7A 1E4VA 1RBMA 1XDWA 3R0JA 1G5RA 3QVKA 5AJZA 3ZY5A 4E5DA 3OOSA 4EW6A 4Q0MA 3BE4A 3ZCSA 1Y4DE 2X86A 1I33A 3SC6A 4J0JA 4GKAA 4N4AA 1RHQA 4I81A 1I0LA 4UREA 2ZOSA 3AKYA 3G17A 1ZOLA 2O4UX 3T54A 4O08A 5LOVA 2Q9CA 4N7MA 4ZQGA 3HVRA 1EK1A 4INAA 5B1HA 4BX0A 1LZKA 2R7KA 2XEXA 2IS4A 6ABPA 4QQNA 3FTCA 4B44A 1ENOA 2B92A 1DX9A 2CZGA 4GYJA 2MR5A 1PNQA 2NQ8A 2FWAA 4DUGD 3WB1A 1IBMB 4M9UA 4QTXA 4RIFA 2CK3D 2DH6A 3C7CB 2Q3MA 1ZYUA 3IP7A 1P1KA 1ONBA 4MR9B 1TTQB 5TJ9A 2X8JB 3IMKA 1U5AA 3OM0A 3H0EA 3P0RA 5GPBA 3SHQA 3EPKA 2DU8A 4LE2A 4JKIA 1BVHA 2Q41A 1Z8DA 2ZZKA 3I6MA 1LRKA 4F71A 4HCJA 4IUBS 1S1MA 3RIEA 4X9XA 5C52B 2NSLA 1FFCA 1X1CA 1RWKA 3DVQX 3WKCA 4NXNB 1KTVA 3W2IA 3NS7A 4PRLA 3RLFA 3G9TA 3VU0A 2R8RA 1OI3A 1KOGA 1H2EA 1X7GA 1GGEA 4OK3A 5FTJA 4CMAA 3SQWA 1EQUA 1N75A 2J9ZB 3E7FA 4KBYA 1EA7A 4XVRA 1NG9A 4W1PA 3C3XA 1I3LA 5M2QA 3EDMA 4NDAA 1TGYA 3N8NA 3PXDA 4OXYA 1XZHA 4EKEA 1XKQA 1CJCA 2WPNA 3GAAA 1JL3A 2FHPA 4TM8A 3GARA 5LD2B 2XKKA 1M74A 3CSUA 1NW4A 2FW8A 8ATCA 1IFXA 2AFIE 2ECFA 2UZIR 2Z2ZA 2ZFUA 1NYRA 3DMPA 1BDMA 1NBHA 1VMIA 1J5EB 4UUOA 4JC4A 5G53C 4F9GA 3PR3A 3QMWA 2PJDA 3ZIAA 2FDRA 3ORQA 5CNJA 3ZE7A 1L7NA 3BXPA 3HEMA 3UH1A 2ZT7A 3GLIB 4Z2AA 1CR0A 1HDZA 4INJA 4JODA 5CT5A 4TL7A 1KFBB 5FF9A 3UAOA 3V8VA 5EJ7A 1RQNA 2WR8A 1CETA 3E58A 3JQ9A 2OM2A 2P0AA 2YC4C 1NF8A 3ROXA 4KQ6A 5BSHA 1HNWB 1ZN9A 5AW5A 1KNXA 5BMVA 1ZICA 1GT91 3NBXX 4FFWA 2YCLA 2QJTA 3EXEB 4UFNA 5KOHA 1YAHA 4X1YB 4F38A 3L8YA 4MVJF 3VHXA 4HO1X 3QVSA 3O75A 3B53X 2Q9UA 5IUJC 4CXMA 5DHFA 3NH9A 1MJ5A 5ERYA 4PX2A 1R6VA 2XWQA 3AJ8A 3E9YA 3ONVA 2ORED 5ESWA 5H70A 2A7XA 4ZTZB 3Q8LA 3RI3A 1RTTA 3W05A 2WIDA 3FNBA 3LQQA 1JQDA 2V97A 1HL7A 2VP0A 3K94A 3AHFA 1QVVA 2YZGA 4GX5A 1PP4A 1ODCA 1HLDA 1VCIA 2CLEB 4FCTA 2ZM5A 4MHOA 2D8MA 5LXTA 5DX1A 2C77A 2VSYA 2QL9A 3F1KA 3VQTA 4ARZA 1E2MA 3A04A 3WNCA 1L1RA 4GMGA 4ZVMA 1X7WA 5ENZA 4TRNA 1MDFA 2IV7A 3U7QB 2WABA 4RW0A 4DBZA 3MWFA 5C5CA 4MR9A 3AESA 1CPYA 4QGGA 2QX9A 5D3MB 1H1TA 2QLLA 4FEAA 4WOPA 3IUJA 5KNCA 4DQKA 2DH5A 3D6AA 3LA6A 4L76A 4YASA 5FR1A 4ZHQA 3ZBUA 3VU8A 1Q83A 1ZBDA 2HA0A 2NADA 3WLOA 2X7HA 2J5QA 1UOOA 4GGOA 1EMDA 2D0OB 3U7QA 3A4NA 2X7XA 3KSRA 3PTZA 4D7AA 1B8VA 1QPBA 4PQRA 3UJ3X 2YV2A 2M6SA 3BEOA 4R8MA 1HH4A 3NAZA 1FTGA 1Q77A 3B1YA 1QLJA 3ETLA 3IUQA 4IV8A 4B81A 1NKSA 2ANCA 4PRYA 2GKGA 4F84A 2FVYA 2W5UA 4L5AA 1LXCA 1QR2A 3QOFA 3SMVA 4I5EA 2DFVA 4QLAA 2ZT8A 2FV8A 4UDOA 1YIAA 1MNAA 3ZY2A 6REQB 3KQUA 1FSPA 3CGGA 3V2HA 5JZ9A 3C3BA 2FP3A 2Y8EA 2YJGA 4JJ7A 5IW8A 3DWIA 4DCJA 3I28A 1WUHS 4HAOA 5G41A 4G25A 4AJ4A 5IUNC 2A5FA 2GM4A 1OE0A 3QW4B 4YJ2A 4IIUA 5LZ4A 3MLBA 1US8A 2WSYB 5EXEA 1ANKA 3OQ1A 4S1VA 4ZC1A 2FPSA 4M22A 3RU7A 1I7DA 1E96A 4KFUA 1NQXA 3I92A 4QRDA 2IK8A 5FNVB 2GEKA 1N5IA 1ZO8A 3O3CA 4N54A 4OCZA 4UUNA 4UM9D 1YI0A 5ADVA 2LW7A 4X95A 4MSUA 5CLGA 3GLIA 1ZJWA 4YYZA 1Z4LA 3VM6A 4F6LA 5GM2A 1RHUA 2FG5A 3DNFA 1IJEA 1L5YA 4P86A 3GW8A 1RI1A 4OIFA 5EY5B 3O9MA 1IJKA 3E70C 2CF5A 3P9IA 3PNSA 2CL7X 1G8JA 4GM1A 4BZXA 4BOYA 3PXGA 1W2GA 3RV3A 4FW9A 2QAGC 3NBKA 1QTIA 2YV4A 4OLAA 3T7SA 1CZHA 1TM7E 2D1SA 2ZBEA 2NXEA 4TN1A 3H1AA 1TQ6A 2QLMA 2NU8A 1U0RA 3G1WA 1CUAA 2JFUA 4MS1A 1D3AA 2IV3A 2DBRA 3MQFA 3THOA 5D8DA 5AUQA 3PA8A 1DADA 3WYBA 4BTLA 3B1ZA 4F86A 5BNIA 1IH8A 5JSZB 4RVGA 4NOKA 3IVCA 5TGDA 5DGTA 3UHJA 4B3HA 5K0BA 1ZWLA 4IVQA 1YB4A 3CZQA 4E2FA 2ZBPA 2MSWA 2Q07A 1RFLA 2XUZA 4ZO6A 4R1MA 3SF8A 4S04A 3W2EA 1G42A 2K87A 3NWPA 4RESA 1UOPA 3IP6A 4EFMA 3W7AA 2DEUA 1QGOA 4IXMA 2O6LA 2UYCA 3FF4A 1OFIA 1YS6A 3OQIA 4YC7A 3NIWA 5HM6A 4LRTB 3IUPA 4OM8A 4A26A 4E5KA 2V74B 4JMPA 1LBHA 2AYYA 4M9ZA 3QVGA 2P2ZA 4I1RA 3TNLA 1JWBB 1Q0SA 1X7WB 2H9AA 2VRCD 5BW8A 5AKHA 2GN0A 1A4IA 2OXFA 4HZUB 3OPYB 3BMOB 3AOEA 3L06A 3ZV4A 2UUCB 1NJSA 2B1RA 2B34A 2BFBB 4D46A 2YV5A 1W5SA 2FUG6 1DDIA 3MRTA 5BN5B 4YUVA 4Q4AB 1DKOA 2VYCA 3G8CA 1D1SA 1DIRA 2PYDA 2FW9A 4QAQA 4TPKA 1F51E 3E0XA 3QVGB 4CCYB 1KI8A 3RFFA 2YV1A 4XIFA 1V7QA 4AZ3A 2CL0X 3JRNA 2ZRCA 1DOAA 3PDWA 1NC1A 1J0DA 4FT4A 4Q3CA 2IEYA 3I6IA 4DLKA 4JL5A 2FH5B 4FK8A 1ECJA 3NUZA 1MQ8B 4B7XA 1DQSA 2HYDA 1K98A 5ARBA 4NSNA 2EQ5A 2B4KA 3MJCA 3O90A 4OYLA 2WWTA 3QXXA 3WWPA 2H1RA 2WAMA 3BD9A 2Y9MB 1TF2A 3RASA 4J4TA 2RI1A 2HY7A 1I2ZA 4Y2YA 5C7LO 3PG5A 3SE0A 4G1MB 3ZY4A 3T06B 2PKEA 2RD2A 3WK4A 1WXFA 1JAHA 1MJGA 3L9XA 1ORDA 3EQ6A 4BQFA 3RVMA 2AN1A 5IZCC 3LLUA 1HE4A 4LZWA 2PH5A 3O94A 1SXJD 4BDTA 2OHFA 1NI4B 1W6UA 2A0WA 2XTNA 4L6CA 3CX3A 2GJ8A 3GAZA 1RKUA 1ICIA 1VE7A 1Z6YA 2QF7A 4I2NA 4QGHA 3WRXA 3HADA 2WJGA 1FEZA 1GO2A 1FBNA 2IC5A 3IP1A 1KEEB 2H8GA 4X7MA 4CM9A 1ZH4A 2BW0A 3W6UA 2ON6A 2R1TA 3X0DA 4EVRA 2VF8A 3KQPA 3PQ8A 1NONA 5KNBD 5DULA 4L9AA 5A71A 4FCWA 3RDPA 1JA9A 1SD1A 3HKDB 5P21A 1JVSA 1YOVB 4H18A 4LHEA 3W1EA 1H0SA 1VP3A 4KMMA 1FQOA 1PD1A 3HRHA 3M5WA 3K5IA 3EEFA 1QDEA 2IHTA 3WLQA 4DDUA 4D4KA 2MOKA 1AKVA 3HJUA 2Y3IA 1T24A 5EJ8A 1VSBA 4QJ4A 1SOWA 2ZYRA 2Y1EA 2RGAA 3MT9A 3RS5A 1N6OA 5DK6A 3N28A 1Z26A 5IARA 4B5LA 2P68A 2FHSA 5ALOA 1NV8A 4ON9A 1TO1E 3O91A 4Q93A 4QBKA 1I7SB 3RYFB 4P0PB 4RFSA 4L9SA 4XASA 5JMWA 4BCCA 4UKDA 3SBOA 4E5NA 5FNZA 5D7BA 5JBNA 2CXPA 2H48A 1PFGA 4DG5A 4EY4A 2C98A 3K70D 4KUGA 4HTFA 5G4KB 5GONA 1ZU4A 1BWRA 2C0CA 2HJSA 3DEAA 3NAGA 5TT0A 3SYMA 1DT3A 1XKLA 3R6TA 4KVZA 1TU4A 3UIEA 1OREA 4AWAA 2PVSA 3QWBA 5J3JA 2VKTA 3KNZA 4KNWA 1U8FO 5KU7A 1OOEA 1YVRA 4EHJA 4AU1A 2ZATA 4BEJA 1PR3A 1R0KA 1K86A 2ZCUA 4IH1A 4LEIA 2YFKA 2NU6A 3KE8A 4MPDA 4F06A 2KI5A 3THWA 3L46A 3ASZA 4LHZA 2O3TA 2Q4DA 2OHIA 2QYHA 3CJTA 5DISB 3GV0A 3OKAA 3EAFA 4N5HX 1QMGA 1V7CA 2CNBA 2FQYA 2ZI6A 1JEDA 4FONA 4B3CA 1RKVA 2EX0A 2LDXA 5DM4A 4Q4CA 3SVZA 4UTXA 5T8KA 1YKFA 3FYUB 1CRWG 2G5CA 3SJAA 3KE9A 1WF6A 1QHGA 3FGPA 3IMFA 3ND8A 4ERXA 5JMOA 3THWB 2XWPA 1L5NA 4L72A 1SN7A 1ZI8A 1ZCJA 1UXOA 3HXPA 4LOJA 3PL5A 4ABYA 1MC1A 2NVBA 2OQIA 5KWSA 4CFYA 2NTEA 2X4DA 3IE0A 5KSOA 1GG8A 3NCHA 1J2EA 2C3MA 1MN6A 3K8OE 1YR3A 3PKZA 4C6TB 4I36A 5K03A 2Q1SA 2UYGA 5DHQA 3C5CA 2EFCB 5HQTA 3PDIA 4IRUB 5D84A 3G79A 4NU8X 1T13A 2PL5A 4ZGGA 5CA0A 5FPKA 1MT3A 4QPDA 3R3WA 5C81A 2YVUA 4DMCA 3TSYA 4G84A 2GD6A 4P7KA 4RTRA 3K1YA 2ADMA 1EFPB 3MNFA 3A9SA 3DF7A 4J0GA 4NJMB 4CIDA 3UPTA 1PJ2A 2OD2A 2X13A 3C41J 4XGNA 1GU1A 1SKAA 3MRSA 2H7XA 3QTBA 3LPCA 3TVYA 5CA1F 3U31A 1XCMA 3BBPA 1Z17A 3F5DA 3R5KA 4FKBA 2WWVD 3SSMA 2B6NA 4H0NA 2EW2A 1Q6ZA 3NC0C 3SZMA 1IN6A 3AR4A 3GG2A 4MIOA 4ICIA 1N4DA 3HJFA 3L18A 2NP6A 4OPMA 3LXRA 4JP5A 4RGQA 3GT7A 4KR2A 1I7PA 2JIMA 3KQTA 2D8AA 4AY5A 5K20A 4AY2A 2DZDA 3OOEA 1BDHA 4RC9A 3VYVA 4BMOB 4ZCTA 4DMLA 4QJIA 1XJQA 3CRW1 1G5IA 1DAIA 1QX3A 3N86A 4XGIA 5AXCA 2GWHA 1IOZA 2RSLA 3Q6NA 2C61A 1UF9A 2FU5C 2IZZA 4IMIB 4OFZA 1U0SY 4PX9A 5CIYA 4KW7A 3WHPA 2B1GA 1P1JA 1JNYA 2CNNA 4G41A 1Z0IA 4KN5A 2OV2A 2WU1A 3W8EA 4RFSB 1T2AA 3CV3A 3VBCA 1JG1A 1D8TA 1Y1RA 5F7ZA 2WV9A 4A0RA 3W79A 3O8CA 4AG5A 4I4TA 4BIIA 4CKWB 4ARCA 1QIDA 4KXVA 1SQ6A 2EBFX 3KT6A 1GGKA 3N8KA 5KYUA 2P65A 2C84A 4CDNA 3ROTA 3W78A 5K0CA 2A0KA 1ATIA 1V35A 1XFDA 2W0SA 3UATA 1AUOA 2BBOA 2XPCA 4M1KA 5JASA 3W7BA 2JFBA 5KCZA 4R2LA 2A8YA 4R1SA 4KV9A 4I4TB 1FFEA 3URMA 3R41A 2BGKA 3HH8A 5EJ6A 2UXDB 1Z39A 4L02A 3RANA 1C7ZA 3RRBA 3AVUA 1C7RA 2H06A 3CUTA 1SBHA 1JG2A 1GRQA 3AHDA 1LPBB 3BCHA 3N2KA 3N5KA 5AJXA 2VOJA 3EHDA 3L02A 4K7JA 1RJGA 5BYAA 2YZ7A 4R68A 2GJ9A 1JPUA 5DMHA 1IM5A 4G37A 3M81A 3PWTA 5DNAA 5SY6A 3OZGA 2FNAA 2XE8A 1Z6TA 2WPDA 3HR4A 2NAPA 3W0LB 4V24A 4P9NA 1C7JA 4MPJA 3BWYA 2COEA 4WLNA 5DHUA 3TTXA 5LYJA 1REQB 5CEEA 2EBUA 4GOLD 4CQMA 2WB2A 2OYRA 4DA8A 3ZHVA 1E2JA 1YL7A 4GC9A 3U39A 4C6TA 1QZUA 2O2IA 5A4KA 5I7OA 4I9HA 3Q88A 3DBLA 3IKTA 4L22A 3OQ6A 4R1UA 2QTMA 4WJKB 3ZU2A 4Y0VA 3R44A 2A30A 1YD7A 2QGNA 3HDVA 1GPBA 2HA5A 2IYRA 2PBFA 4KDEA 4HVLA 1UKYA 3BG5A 4OA8A 3SXUB