2B98A

Crystal structure of an archaeal pentameric riboflavin synthase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
KKVGIVDTTFARVDMASIAIKKLKELSPNIKIIRKTVPGIKDLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYLLFKPEYLTRMAGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin synthase
publication title Crystal Structure of an Archaeal Pentameric Riboflavin Synthase in Complex with a Substrate Analog Inhibitor: stereochemical implications
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 48
structure length 141
sequence length 141
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.9: Riboflavin synthase.
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2b98A00
2O6HA 1C2YA 5IM4A 4KQ6A 1DI0A 2F59A 1W19A 2B99A 1HQKA 4J07A 5IM5A 2A57A 2JFBA 2C97A 3NQ41 1KZ4A 1ZISA 2B98A 1KZ9A 2C92A 2VI5A 1KYVA 1NQVA 2C9BA 2C9DA 1NQUA 1T13A 1C41A 1KZ1A 1NQXA 2OBXA 1KZ6A 1RVV1 2A58A 1W29A 1KYXA 2A59A 1KYYA 1NQWA 1XN1A 3MK31 2I0FA 2C94A 1EJBA
chains in the Genus database with same CATH superfamily
3HV0A 2O1SA 2NUTB 5J23A 2WHXA 1N2SA 1V8ZA 2QU7A 1ZI9A 4RV4A 3ZCPA 2C20A 3FNBA 1QVWA 2JGLA 4G0PA 3HA2A 1VE7A 1YAHA 3B6EA 4MWBA 4B4VA 4MQFA 2PRIA 3L18A 4RHTA 4J9UE 1WEHA 2BDEA 3QPBA 1JIIA 3QX9A 1U7PA 2RAPA 3CW8X 3S55A 1F2TA 2FQQA 3BH7A 2JH8A 4RHCA 1PNVA 4G1UC 4L4RA 2RHTA 1J70A 2XKAA 2VO1A 4UARA 5HJEA 4X5OA 3V34A 1RMTA 3VKHA 5BW4A 4D56A 1PQWA 4K6HA 4Q9KA 4GI2A 1N1GA 1DKPA 1XCOA 2B34A 5E2AA 4WZ6A 4B7AA 2WYWA 2YFQA 1GNSA 3LGSA 4E07A 3BCSA 4DCPA 3BFVA 1LJ8A 2ZIXB 2PRSA 3L06A 4A26A 3LY7A 1Q83A 1QFYA 1P2VA 1UBOS 4IH9A 2C5GA 1OLXB 1G8SA 1C9YA 2PV7A 4L73A 4LV5B 3IIEA 1UXHA 3JQRA 4JT9A 5P8WA 4BWVA 1HQYE 3T5DA 2IK8A 4HUJA 1WB9A 1RYNA 3P20A 121PA 5I7SA 5DWDA 1OXMA 2G25A 2PL9A 4ZPJA 1WEKA 2DU8A 2AFRA 3IE0A 4Q3LA 5BSTA 3V4RA 2XXAB 1UMBB 3IAFA 4FQ8A 3D6UA 4WQMA 3TH5A 2FPSA 4IHAA 2I80A 4IYRA 3AXTA 1RYFA 2I1LA 4M54A 4FM9A 5J47A 5B55A 2JIRA 3EZLA 4PZ0A 1CQJB 3N58A 3WBFA 3F1KA 4BQPA 3DOHA 3FTCA 4YXWD 1XZBA 2Y0CA 2VH1A 1IVSA 3DDUA 3IP7A 1E7SA 3F6YA 2KBEA 3GDWA 4Z7OB 1MTZA 4AZVA 5KNBD 4YRAA 2YXNA 2VJOA 3WK8A 4HDNB 4O4HB 5I9LA 2JVKA 3H9UA 4UE2A 4MPJA 1L5GB 1FYEA 1XZDA 1ZUWA 5C35A 4MPPA 4YDRA 2JFYA 3O3MB 2VLIA 3K6SA 5DK6A 3DV2A 1SCKA 3GZJA 1TMOA 5ER6A 4P4SA 3U4DA 1W36B 5BW5A 1X80A 1MOZA 2NZVG 2JARA 2ZB3A 2ID8A 3C74A 4IO0A 2IS6A 5K6TA 4DAOA 1JEYA 2DPYA 4JLJA 4L5BA 1RRFA 1GL7A 3CY6A 2A9VA 5AIAA 5DX1A 3RI3A 4HYEA 3R7LA 4F4DA 4ZU6X 3AB3A 4QVIA 1R6VA 3GJZA 5G1OA 4KH1A 1U9JA 4LF4B 1JQKA 3KT0A 3PDUA 3M6WA 2M6LA 1E5QA 1ZHHA 3ZVRA 1T9GR 4BLOA 1BCRB 2ZRIA 3R3YA 4MVWA 1ZL2A 2PTGA 5TVKA 3X2EA 5IJZA 3G9ZA 2WIGA 1JU3A 1POXA 2XBUA 3G8BA 4MYTA 1UADA 5T6MA 3BQMB 4L3WA 1NDQA 1XBTA 2I4NA 2PBZA 4UNPA 4E5DA 9ATCA 2HL6A 1KOFA 5JCPA 3U4QB 1PFUA 4UMEA 5JLJA 5LP6F 1WZNA 3O47A 4G63A 4MHSA 5DVZA 1OBFO 5A3VA 2ILTA 1GPBA 2ISCA 2OECA 4CBVA 4DQ0A 4KG7A 5AKHA 1W94A 3DUWA 4NBTA 4BKQA 3MWJA 2IW3A 3WGOA 4A8JB 1GZDA 4IWNA 3F46A 2CFIA 1T9HA 1YRBA 2BGJA 3FE2A 4MVJE 5B1IA 3O8DA 5C0OE 4LHYA 4HMOA 4CZ2A 1CF2O 4XRRA 3L6OO 3QU5A 1NVXQ 2G40A 5EG5A 3CNQS 2FPPA 5LQCA 1RI1A 1OILA 1U5AA 1NBHA 3DHNA 2P9JA 3N2ZB 4TPKA 4HEQA 1HQDA 5IMBA 1JFFB 2PAAA 4TM7A 1I51A 2GHRA 1HBJA 4KDCA 3WRVA 2QP3A 3VHRA 4ENQA 4AFNA 7REQB 5KVVA 1XEXB 2NPIA 1JAIA 4NG4A 1JTVA 2XUQA 4UAVA 2NU9A 3LA6A 4FZVA 5AJZA 1FW8A 1F2UA 1KS9A 1ZU4A 3ODPA 3VJMA 3UTCA 3ZY2A 4E0BA 2CBZA 3WDLA 4CFSA 1QF6A 4UU8A 2CV1A 3WYCA 3BL6A 4KVZA 4PTYA 2AJTA 4H18A 4MJLA 5CEJA 3HNRA 1DLJA 2PL3A 3GFBA 4G1FA 1R5JA 1SUPA 3PFGA 5D3QA 3HS3A 4UHBA 5F5XA 2ZSIA 4WN3A 1DRUA 2RHWA 3FYDA 4UTVA 1QXSA 3S29A 3KKPA 4HSGA 1A8HA 1FPMA 2TMKA 1G6OA 5AKEA 2D54A 5J63A 4HDRB 3FCXA 2GA8A 3GCWA 3P5BA 3PBKA 4ZOLA 2REXB 5JAQA 2QP4A 4C3VA 1SZJG 2GBPA 2V0GA 4JBWA 3GZ4A 1NKSA 4URZR 3ANTA 2JHCA 3FLAA 5TR9A 3QLVA 4JL8A 1IL0A 3ZY4A 5LD2C 1ORHA 3M5CA 4PLPA 1HTWA 1XNGA 4JJFA 1K68A 5JAPA 4JT8A 4ETMA 4BPBA 1T10A 1DKUA 1DQYA 2P2NA 5DNWA 4KMSA 1ZIPA 1WM1A 2QMZA 5DP2A 1AURA 2POCA 1TVKA 2ZUVA 5DI3B 5F78A 3ZJUA 3R9WA 3BILA 3CSUA 3OICA 3UMFA 4FYWA 1TQ2A 3Q7IA 4GX5A 1RI3A 1H6CA 2G8LA 5L3QA 3ZDEA 1C7JA 1AZWA 2ZJ1A 4GE0A 3ZU4A 5C53B 2JASA 2AFHB 1TYCA 4KRGA 4Q3NA 3KSAC 3I61A 2Y1DA 3AVUA 1EK6A 4YCMA 1J06A 1WLSA 3RUIA 1TFRA 1DV1A 2R86A 4OGLA 3TMKA 3EF1A 3CA8A 1QMPA 3D6FA 3H5OA 2Z8ZA 2C5LA 2HGSA 3ACBA 3KZ1E 3QSGA 4UNIA 3KR0A 4ODIA 4UDYX 2ADOA 1UDAA 5BR7A 4KPEC 2VBGA 1U4SA 1GG9A 1Z6QA 2JFFA 5LIRA 2UXCB 3GLGB 1V5FA 1T8TA 2COEA 3E53A 2H7XA 2Y0EA 3GAAA 3L40A 3OZ7A 4MR8B 1SUCA 1WXHA 2I22A 1DWOA 1RQNA 2FN7A 4L4SA 3UAGA 3TZCA 3O4IA 4RZ2A 4YREA 3T3EA 1EWRA 1EP2B 1W5AA 1XSEA 1O95D 2BAGA 4LRYA 1J2UA 3F8WA 4GP6A 5FHRA 2ZIUB 5BW6B 2F43B 1ECLA 3TSOA 2QJRA 1V8BA 4CEJB 4AKIA 1E1RA 2IU4A 2V7GA 3N2GA 3QJGA 5EJMA 5HCUA 2B92A 2EKLA 5SV2A 4L95C 1JDBB 4JR0A 5HJ2A 4Y6QA 1ZIXA 3V2IA 1SHJA 3FCSB 4UU0A 5JHGB 3E4DA 1BHJA 4EZEA 4J75A 3SF0A 5CFPA 3C6YA 4CI9A 4KWIA 3C6QA 4XWYA 1DHRA 5EPUA 1BQ3A 3FMVA 4KNWA 4FEAA 4M6WB 5FOVA 1XA3A 3SD7A 3TSZA 3HO1A 3VUFA 1KEZA 3HADA 1OV4A 1VKJA 1N6RA 4XGKA 5L95A 2GWRA 2R8EA 2E82A 4O8CA 1NP7A 1XZMA 5IW8A 5ADHA 1P9NA 2IPMA 2DPHA 1KGSA 2VP4A 2PBFA 2W8BB 4DC0A 3A3PA 1VMKA 1M1YB 2ZRHA 2V54A 3A9UA 2WFZA 4IZ6A 3JVUA 1XD8A 2ZU0C 4HFRA 1PD0A 4FOPA 4WVFA 3TLCA 3HO8A 1F8YA 4BJ3A 1V3TA 1YQUA 3CNNA 2B3DA 2PGAA 2BH9A 2YHAA 3Q88A 3N0WA 5L6LB 1RRKA 2LBPA 2WUGA 2WJ6A 4EM6A 5CIYA 5CDUA 3S44A 3H2IA 3ES9A 1ORVA 3ZD6A 2O3SA 3W05A 4RL6A 3DXXA 1DAKA 2C8JA 2HOQA 3TD6A 4UQLA 1ZW1A 2BGMA 3C97A 3KBBA 1OX6A 3EEIA 1LBHA 3OOWA 5B3JA 4FFOA 4J7AA 1XVLA 3QFTA 1XMPA 1N1EA 5CLQA 4RYLA 4JP3A 1WCIA 2NT4A 1Q11A 2VAVA 3ECCA 4A6EA 3PD1A 4MUJA 4X0EA 3WYDA 5JY6A 4RLQA 3KQLA 1UAGA 2C2OA 3OT1B 4YJKA 1MC8A 3L05A 4DS3A 4OHCA 2QJWA 4DG8A 4UE3S 3QKIA 4AX8A 4D3SA 3UTDA 1C30B 1BDBA 1VLMA 4IILA 5EHNA 1KSFX 2ZJ3A 5EZ6B 3AEYA 1GR1A 5K4AA 3TECE 1GD1O 4FNOA 4BJHB 5HDQA 2BMWA 5H0IA 4LCJA 3CCFA 2JGIA 5TT0A 2IUYA 4M8LA 1XDZA 5FB3A 3ETJA 2P9ZA 5KU1A 2WAAA 3G13A 3MB8A 5L9AA 2BJWA 1I1OA 3N8GA 5BPFA 4KLRA 4ZYVA 4CHTA 3HYSA 4JC0A 1XZCA 1A8IA 3FOAA 1OTHA 3NT2A 2OHHA 4RF2A 5KNCD 4L4XA 3DEZA 3D7SA 1RPJA 3U7IA 3E1GA 4R2WA 4BNFA 3Q8WA 4ZZ3A 5DM4A 2IF2A 2WF7A 4QJ4A 1X7ZB 3DBHA 1TD9A 2IHJA 2VKQA 3DCNA 1C9NA 3OF5A 3QUQA 1Z25A 2P6UA 2C97A 5JCXA 4MQEB 2V7QA 3K5WA 4R0NA 4JP8A 3MGCA 4JKYA 4ZCIA 1L8AA 4C4PA 4AG3A 1E8MA 3WLSA 4H7JA 2JGEA 1FVXA 4RZ3A 4ZWNA 3N0XA 1XOIA 3CUEF 3OIDA 2Z8XA 3M3HA 1K97A 2GERA 3MRXA 2M9MA 3C4VA 1T9CA 1RJWA 2Q6VA 2PX8A 5P21A 2AFIE 3AB7A 3MNFA 3SOPA 5HKBA 3HLTA 5BSEA 1QHIA 1XPRA 5AHOA 2R47A 5JO0A 3DWIA 7AT1A 2P9EA 3DAYA 2JJ2D 2I0FA 3DA8A 4G41A 1CR1A 1U5BB 3JD3A 4G0MA 2HTFA 4FZRA 3PF8A 2ZIWB 4K6FA 4RE5A 2Q5JA 4I3FA 2ZAMA 1LTKA 1FFCA 2GESA 3BWBA 3CV3A 1UEIA 1C81A 5CXSA 5HP4A 4CGZA 1P1KA 1XYGA 2WJ3A 3CJRA 3L92A 4IIVA 4V03A 2BHTA 2CNKA 5BORA 1U9CA 1OC4A 2VNIA 4NU8X 4OB6A 4LF8B 3C7KA 3LCJA 3BD6A 4FGLA 1T34A 4KZPA 1ULHA 3KL4A 3KQHA 5ALQA 4U4AA 3SCZA 3UCXA 1Z4JA 1HE3A 1QLJA 1X8KA 3IIKA 3HXOA 5M3BA 2GM5A 1U9IA 2GNPA 4BECA 2F4NA 1B15A 5TJ9A 4BFSA 1VJGA 5K3FB 2CNWA 1JWBB 1IWOA 2R2AA 4XWTA 4RBNA 2IX3A 1XEWX 4P6VF 5FA8A 2C7GA 5KHOC 1PG0A 3QJYA 2EBFX 5LR6A 1DIAA 1S1MA 4KCGA 4V0ME 2II6A 3BKWA 3CPSA 1PUIA 2C1EA 3ZGXA 4CV3A 4AF8A 1YIAA 4EL5A 4BKMA 5C32A 4WZBE 2HJ9A 3DV0B 3R4VA 3PB3A 2BSXA 3PQCA 3SSAA 5FNZA 1E2DA 2VJQA 5JFOA 1AKMA 2J5KA 3N2KB 3NTXA 2P68A 3HB1A 3PCXA 5I51A 3UOAB 1U0FA 1DB3A 1G6KA 1X7WA 5B1HA 4L5CA 2IUTA 2YMLA 1TYAE 1SNYA 3EF0A 3PWZA 4EPYA 1H2HA 2F9FA 1OZAA 1SC6A 1VJCA 3B82A 2A5DA 3NOVA 3IL2A 4HLUA 3NDBB 1EFHA 3ZWOA 2VTKA 1A9PA 2EW8A 3DMHA 5LMCA 2HSEA 5DFAA 1JJIA 1MXFA 2QX4A 4FONA 3S70A 2QVLA 3F5SA 4C5BA 1H85A 1AKUA 1I1NA 3QX3A 1W581 1FNNA 3WIOA 3LWDA 6REQA 1NXSA 1ZITA 3DTYA 1GAWA 4PIPA 2VI5A 3ZDXB 4GWKA 1V1MB 4LBWA 2FU5C 4S05A 1BC5A 1GFIA 1SOAA 1GUDA 1Q7BA 4RD6A 5DT9A 3GLIB 2VQSA 4EHJA 3LYAA 1QKIA 3NR2A 1SKBA 2D3TA 1H2XA 3UUEA 1A5AB 1QVVA 1ONNA 3BRCA 2VVTA 3UW3A 3W6NA 3QTLA 4ZIRA 1N8KA 3U7GA 1KMCA 4JDPA 3Q6MA 3R5KA 3MPOA 1M8FA 1T4MA 1VRWA 3EUFA 3K8ZA 3ROZA 1KI6A 5HKLA 1MU0A 1SUBA 2V8BA 3EBLA 3RVBA 3UA3A 2I71A 4ZMRA 3ABIA 2DRIA 5ESXA 1VJ1A 4QQ8A 4ZRDA 2QENA 5H02A 5CFMA 5FIUA 3BA1A 1OXVA 3KM0A 4HX2A 1S3GA 4KJXA 4RZHA 2WWVD 4BE4A 4ZZIA 1H4TA 3W5AA 1W30A 1DEOA 5LCXA 3KSUA 1XZGA 3HKEB 4O2LA 4U6SA 1JBKA 3VM6A 3FKSA 1OASA 3ZGOA 3RYFA 2HK9A 4YMUA 3F6BX 3HKBA 4Z3DA 1QANA 1L7RA 3NATA 2F48A 1RXUA 3OIUA 4Q9AA 5AW9A 1K75A 3JYQA 4YUYA 3PC3A 5JDCC 2FN4A 3F3SA 5CRIA 4TRJA 2PHZA 4L08A 2AKAB 3UJ6A 1VL8A 3DNFA 3IAHA 3AP2A 1ETUA 3CCBA 4PSUA 1RQ2A 3B13B 1AOXA 3CZMA 1B16A 3NOXA 5KZMB 1NBIA 2WD7A 3HJAA 1YJQA 4ZAZA 3V6LA 4Q1BA 3CZRA 3IHWA 4D5GA 5EJAA 3NALA 4GR9A 3MXTA 1GGKA 1L5WA 1OC2A 5JNVA 1E2MA 3KXLA 3NS7A 4L0DA 3I32A 1J20A 1W93A 4FGWA 5HSGA 1TNDA 1UUFA 1P5FA 2XRZA 4R3WA 1PX0A 1R4MB 5TSDA 3GEPA 4B1FA 1CUWA 3DT8A 4WNIA 5DCYA 5B1EA 2GPTA 1XKLA 1ZH6A 3EULA 3RS4A 4E4YA 3G9XA 5HQJA 1WCV1 2WILA 3HWRA 1CUZA 3UGTA 4OFXA 1Y9DA 4MMXB 1WXXA 4AF6A 4GLJA 3FGZA 5G02A 2PKCA 1XJCA 2I6TA 4JVOA 4F5EA 1PJ3A 2RGEA 3G0IA 5BWLA 1GU1A 1RZ3A 3TIXB 1F6BA 4RK4A 5GOZA 2P9TA 4RANA 2VZ8A 1TT7A 3T7JA 1FEZA 1KMHA 4QEDA 3QVVA 5KHAA 4Y6LA 1ZIOA 4OU5A 4CCAA 2GEKA 2KE5A 1QLHA 1NUSA 1NDUA 3CH6A 1CF9A 4YJHB 4RU1A 4DIMA 4DC1A 4A0SA 3ZUGA 2IJGX 4PAQA 1NT2A 2ZQZA 3AZPA 3H9GA 1DUSA 4N3GA 2AOVA 1M5TA 1RBYA 4XSGA 3V4FA 1EXMA 2HMUA 1A2KC 3GJQA 4EPVA 3FYHA 2VYNA 2FK7A 2GVZC 3QW2A 4TQ9A 4EMSA 1GPWB 5I6DA 5LQMA 3DE6X 4YHHB 2O8EB 1II8B 3WKDA 4GU5A 3DF7A 2PSEA 3DCJA 3I1FA 1RZVA 3EVNA 3K9HA 5FBHA 3TLXA 4ZEXA 4BRWA 4BNTA 4W1SA 1QLWA 2VHCA 3DWEX 4TQGA 4DNXA 4RIIA 2ZUFA 3GYGA 4OLBA 2IHTA 1WNFA 1KO1A 1UJBA 1WMFA 2WJJA 5FUWA 4GKBA 5D3ZA 3V42A 4ILKA 2WHPA 1GJRA 3COWA 3COZA 1VA5A 3OOSA 2ZYTX 3VU1A 1XTSA 4LY0A 4E1BA 5AFSA 1NN1A 1QAMA 2HI0A 1MZVA 2C0PA 3CUSA 3FCUB 4PRKA 4Q9NA 3T61A 4C0XA 2XAUA 3ANSA 1MT3A 3CCCA 3RAJA 3TIGA 1V6SA 2G4CA 3I4CA 3KX2A 2DJ5A 2QTVA 3DZGA 2PX3A 4JUFA 3B1XA 5K3SA 3VZCA 2V5VA 4DVJA 1NRXA 1W96A 3G17A 5SYAA 2VHVA 1FSGA 3UXEA 2NU7A 1T0BA 2P9QA 5EGSA 1AB5A 4XB1A 1XRJA 2GA9A 3CH5A 4ZCQA 4WXEA 3S2IA 2A9PA 2H9YA 1DJPA 3ASVA 1H65A 4FHCA 4ND8B 1HYEA 3ENNA 3VR6A 5CLFA 2YHUA 3S0JA 3WR5A 2W2TA 2HKIA 2HO4A 2P6NA 3M9LA 5CA1A 1VZ2A 5FOXA 3BMQA 1XU4A 2E7ZA 2AUTA 3GAZA 4EFNA 3ZGLA 1XRMA 1KAQA 4AJJA 1WMBA 4MDYA 4QJIA 3K73O 2GZ3A 1O97C 2YZKA 1TF7A 3H5WA 4MP3A 2Y1KA 3D4OA 1YVRA 4BNHA 4B5KA 4UCQA 3SXPA 3HM9A 4N41A 2HZBA 4LZWA 2A0FA 1P29A 3BMOA 2AQKA 4MV0A 4RD3A 1RZUA 4AVYA 1NGSA 3NVMB 3EASA 3E2PA 3ND6A 4PVDA 3ZCUA 2SKDA 4KXUA 3LY8A 4OJNA 4CL0A 1TZ2A 2BGTA 1UMCB 3JRWA 2NP7A 1CP3A 1RWMA 1JHYA 3VPFA 2HUPA 3TLJA 4IUDS 4MQBA 4AB1A 4EB8A 4O4IF 2DX7A 3DB1A 1ZEJA 3GP5A 4ERXA 3WA7A 1D4FA 3WL7A 1IIRA 3IEXA 2XBLA 4XD2A 1A5BB 2R66A 4PNPA 2PQ0A 1NVUQ 2WJVA 3WK4A 1W5FA 3Q41A 2AXPA 3QOXA 2IEAA 2D5LA 2C0CA 4DABA 1MB9A 2HDOA 3R7FA 5D5PA 3U40A 5I7UA 3L4JA 1JG1A 3U7HB 2CNDA 4JNCA 2EAUA 2ZSHA 2EU8A 4TZTA 4EAQA 2B1RA 1GZ4A 4EUSA 3ZZMA 1IXKA 4D80A 3RUHA 1WIWA 3WK6A 4N54A 2QRVA 1ZESA 1E1KA 2HADA 3R5SA 4MOWA 4QGBA 4BCBA 3BSFA 3KHUA 3L43A 3ZHVA 3HKCA 1XMIA 4GR5A 4B46A 2HLDA 4I9GA 5MDHA 2FPRA 1RWBA 3Q2IA 3UFXB 4WZAB 2GTPA 2AWOA 3CEAA 3NM4A 3O2NA 4NDAA 4JU9A 1EUCB 5LDHA 2IRWA 2DUJA 2B78A 1DBSA 4DSUA 4URVR 5K8JB 5K45A 7YASA 5EINA 5CB4A 3RROA 1NULA 2IPNA 3ETCA 4IFEA 4CCYA 4ZVPA 2XE7A 1JBEA 3AVVA 1HZJA 1Y82A 3K0BA 3TB4A 4KWCA 4QXPA 1YF3A 4E4TA 5E9QA 2OOSA 3FNIA 2I2DA 4GUAA 5E2BA 3PQDA 3ZJVA 2A0KA 3HBFA 4N39A 2E89A 1AC5A 3UB2A 3X43A 5CGZA 5FP0A 4TGLA 3UT6A 4LI3X 3DUFB 1PS9A 1QOZA 2C9YA 2JD1A 1GGEA 1IU9A 1SB9A 5IYZF 4O3MA 1ECCA 1ICEA 2ZJ2A 4TMKA 3UENA 1EESA 2QJTA 2EFJA 3K1TA 4OH7A 5ALHA 3NTVA 1P6XA 3Q8MA 3QVGA 2O1EA 1L1EA 1UOPA 4XIGS 4LV6A 4DHWA 2EX1A 3OESA 1DC6A 4JB8A 5CT8A 2PWBA 4ONEA 1NTRA 3D5QA 3T5MA 3ZHSA 3ZD7A 1YIDA 3IUPA 5YASA 4DAEA 3DLAA 3DEKA 2H2AA 3Q0TA 5GONF 2RHHA 1QVZA 3IEIA 5LP6C 1D0IA 1J7KA 4UUNA 4LX0A 2JCGA 3HCFA 4DQXA 1PW7A 1QHYA 2HWWA 1OLSA 1WETA 1N3LA 3IALA 1HL3A 2FMIA 2H51A 3CUWA 3ULKA 1YDMA 3CE9A 2BHLA 1XF9A 3HPQA 1ZR2A 3OZAA 1G38A 2OAGA 1SQ5A 4TL6A 1XDDA 3RGGA 3UEOA 5CCXA 5KHLB 1GUYA 3SYNA 1N0HA 1FVFA 5A4DA 2BE9A 1GKKA 1BXGA 2E85A 3TRFA 2C2GA 3NHLA 4NJMA 4RIEA 1WPRA 2GR9A 2RAVA 1XKTA 4MVJP 3SC2B 2RFLA 5C1OA 3VX3A 4UOQA 2QQFA 3MOIA 3VZSA 1U98A 3OZIA 2ZB8A 1XQ1A 1F38A 2HHJA 4D98A 1GQQA 1PTJA 4U6NA 3JQAB 4D9NA 5BQXA 2QX6A 3FUVA 4LQ4A 4IMJB 2A7XA 4O1MA 2C9CA 4YRQA 4CKZA 1UDWA 3LD9A 2R97A 1FMLA 2H17A 2IEBA 3FPEA 4P31A 3RRYA 3N5KA 4YASA 1RI2A 2W43A 3HA7A 4C2AA 2Y67A 1CB0A 1Z9BA 3GRRA 3VR1A 1FFWA 2XNJA 4O02B 3GMIA 1M2OA 1XRLA 1XELA 3TFQA 2BFDB 3HKDA 3WGTA 4XWKA 1MX1A 1TW2A 3IKTA 5E0OA 2E49A 1FQOA 1PEDA 1YACA 1L4EA 2W2LA 3FGPA 3MJCA 3MTDA 4MZXA 1L5HA 3U3XA 3WNCA 3ZWDA 3ZLUA 1E2BA 3FPCA 2OENG 2QUHA 4LYAA 5ALEA 1J1ZA 1S96A 3EGIA 3S8MA 4UKDA 1VHLA 4NDNE 5I9NA 3D54D 2OBNA 2WFLA 4JB3A 3VYTB 4CLHA 1G5TA 3EAQA 1HOXA 1Q1ZA 1FE8A 1W2WB 1QUEA 3V2GA 5ENZA 3N05A 1C8KA 2VAXA 2VOEA 2XPCA 3HXKA 1IQRA 1OFUA 3KKKA 1F7UA 4NZZA 1PL8A 1R6TA 1RJGA 1QVRA 1KR2A 5E9WA 3HJGA 1ISJA 3KJFA 4MS1B 3D7NA 3T1NA 1I32A 1ISMA 2CXSA 4MAMA 4W9RA 3WSVA 2HF8A 1BHSA 4V0LA 9ABPA 5AD1A 3O2SB 4O2BA 3HB9A 4OREX 2CFTA 3WHPA 3G5UA 3PUZA 4RTMA 1Q12A 4TLLB 3D4LA 4WK6A 4X24A 4M87A 4DDHA 4F21A 3AFNA 1ZSYA 2WJGA 1ZBDA 2GAOA 2VHXA 1SK8A 1S3IA 2PMKA 1KBOA 5IZ4A 3VVMA 1UDRA 1FP7A 1YJAA 3GCGA 4RXUA 4HNHA 2YS7A 3IAEA 2QRMA 3QXHA 1PR3A 1WXDA 3TGLA 1SVOA 2EARA 2GPNA 3HMKA 3HY3A 4MGIR 3LDFA 1X1QA 1K63A 4HH0A 2VDKB 3DHWC 4OQNA 5DTJA 4AIRA 3AHGA 4LF5B 2EGHA 3PQFA 2EG9A 4MKXA 3AG5A 4EI9A 2WDPA 3W5BA 3V4LA 2IYNA 4UUOA 4AXBA 1M1NA 2IUUA 4C2UA 1VMDA 1DKOA 3KL2A 4BBZA 5IDQA 4CL2A 4IG4A 2G6BA 3KLBA 1I7PA 3UCFA 4TLAA 1M2JA 4I81A 3OF2A 3RRXA 1FDRA 3C8UA 1R4NB 3CWQA 2IYOA 2PUHA 2VDWA 3DULA 3JVDA 5J5AA 4C05A 1B6RA 1JLSA 3TQSA 1A1SA 3PNBA 2JIMA 3UF0A 3AVQA 5JS1A 2WJZB 1EUDA 4Y1RA 3DBLB 1UC4B 3BHMA 3ZYCA 5JISA 5JSHA 4WY5A 4II7A 1GQSA 3S5JA 2E55A 4G0OA 2E1RA 3OZTA 5T3UA 2EFGA 1P7WA 5HQ3A 3RK1A 2R5FA 4Y6GB 3T35A 1IN8A 2G0NA 3S2EA 1JR4A 4HJXA 4I50B 5KNCH 2VEOA 2YNMD 1JP7A 4YWHA 1TUEA 3F4LA 2AX4A 2ZJ8A 4JSTA 1WG8A 3REGA 4F2WA 1A5SB 2C0QA 2A5GA 2FEOA 4WCFA 2H0RA 4D3DA 1GUFA 4KWHA 4TLMB 5H9VA 1A88A 1NVVR 1S8NA 1XF1A 1ISSA 4NU0A 3EEFA 4X71A 1XEFA 4W6ZA 4CN9A 1DI0A 4KACA 1BWPA 5JVDB 2OGTA 5F12A 5AW0A 1RSZA 2AZ4A 4FYMA 2J3KA 4AP5A 4QARA 4BX0A 5AVYA 1EDDA 1L5VA 1AS3A 3II6X 1R16A 5CK4A 2C92A 1GRVA 5HRCA 4U7HA 3DOUA 3EGOA 3ZLVA 1UBEA 2ZBGA 2OXCA 3VHQA 3GXOA 5IBCA 4U63A 1W52X 3EFHA 1ISHA 3DH0A 5C1DA 3ETEA 4L07A 3U4CA 4ZJPA 1N2GA 3BDVA 1KDTA 3VOSA 3WYGA 3VHXB 3TNLA 16PKA 1SXJB 1F9AA 2B0CA 2FH5B 2GLTA 2XDQB 2G9NA 2W00A 3K53A 4M9SA 1KMQA 5G0UA 4Z6KA 3JQ9C 4BO0A 3D3WB 4KMRA 4M0CA 1SR8A 4CQLA 4HB4A 3I52A 1I01A 3RKSA 3S28A 4K8RB 1KO5A 1SPBS 2PQ2A 5DJ5A 5AKXA 2VJKA 3MIZA 3B5IA 2HREA 5JROA 1UK6A 5KPDA 5FFMA 2LV8A 3WHIA 1GCUA 2C77A 5KIAA 2WT8A 5IKMA 5KX5A 3Q7QA 2XWQA 4R68A 5C8YF 2XMBA 1ULSA 3DMTC 3BZBA 2AFHE 1PRYA 3T1QA 5KYGA 1NJ1A 2AI3A 4QU8A 2NSDA 2YDYA 1GTVA 3JRNA 1U7DA 3P9CA 4KDFA 1TYBE 4EG0A 1RVV1 3RIXA 3NFRA 3OIVA 1DTWA 2F1KA 2HA3A 3ED1A 5EZYB 4OATA 5LA6F 3ZWPA 5HOEA 2XAAA 2FE4A 2XUIA 3AFMA 1EUQA 3Q9LA 2PSFA 3TKAA 4CLOB 2ZRPA 3DW3X 2ZI3A 4E32A 1NOKA 2AWNA 2JKVA 3CU5A 1WQ1R 5FTWA 1MB4A 2AS0A 3PFBA 4I4TA 1HXHA 1E5VA 2GI4A 4RIGA 4XGQA 2WU0A 2QTAA 2WUDA 4N6OA 4ZA2A 3QTTA 5EZSA 1GNPA 2YW9A 4DSNA 3LH5A 1ULUA 5C7IO 3QA3E 2P9FA 4KRXA 1RI4A 2ORWA 3SYKA 2FWRA 2PZKA 1C7RA 1DP4A 3CXUA 1E3DA 4PZZA 4UOEA 4QZVA 2V3CC 3NEYA 3SEZA 4DLBA 2AEJA 2GRAA 1CB7A 1XTJA 1Z17A 2QTHA 1IPHA 3PGJA 4X90A 1RM4A 2ERYA 4W5TA 1H0HA 2IEDA 3H4VA 4ESOA 1H42A 2QQ5A 4DIUA 1QZXA 4QRIA 4HEHA 2JRLA 2IS4A 3ANYB 4G0NA 4KPUB 2WJ4A 3WJ2A 3IHLA 3BXOA 1W19A 1LC0A 3CGGA 3PR2B 1HQKA 4FN5A 5HIIA 4OK3A 1GEEA 1ODJA 2P79A 4DUGA 1NE2A 3VZDA 1FP4B 5A0TA 5BQFA 4L8GA 4MR7B 4WFIA 1TLTA 3A0UA 4UXHA 1UBJS 1QIHA 4DLYA 1JIXA 1UPAA 4NYMR 2FXVA 1M1YE 2AB0A 2R60A 2WT4A 2DR3A 5CXXA 3RRFA 3NTQA 1J2YA 1PAUA 2IZZA 5GVSA 5SY6A 4ESVA 1MGOA 2VATA 5UKDA 1QRUA 4MMYB 4RVSA 3AVWA 4A8HA 1GLGA 4UC0A 4C78A 3RU7A 3G9QA 3G7SA 2XTNA 4UM9B 3ZCTA 5GONA 4DQKA 1CJSA 4DPLA 2R1VB 1Y37A 2VWHA 3K31A 4D4GA 4I1RA 1ZGHA 2HPVA 2RGAA 3EIWA 1L4MA 1GCOA 3KLOA 2EKDA 3K2QA 3GU3A 2J5RA 2EXXA 3KU1A 3QTBA 4B3MB 1SKMA 5ANRB 4V0OA 2IV2X 2PIAA 1WSAA 1P18A 1NJ8A 2SECE 2Y6UA 4GLFA 4IDEA 4MMZB 5DGXA 3RASA 2CK3D 2XODA 3HN6A 1EQUA 3K9GA 1A4RA 3NRBA 4BNLA 1E32A 1U7OA 2G36A 1X39A 3DO8A 4IKEA 5AVWA 1AMOA 1GPLA 2BZ1A 3BWYA 4XIFA 2EX0A 3PDIB 2NIPA 5EJ8A 1JJAA 1QGZA 1KK3A 1C3EA 1D2GA 1GNRA 4I50F 1BDIA 2JJYA 4AYXA 3IVGA 1JR6A 4OI0A 2H06A 2YWDA 2FX5A 4U5XA 1YJBA 1KYYA 2TRSB 2W2MA 4RYDA 5AHKA 5ITZA 2OY0A 3PQ5A 3T5TA 1BXRA 1PX2A 1J1UA 2J0UB 4IHJB 3G8AA 5HMLA 2EBHX 3UV7A 4PF1A 4JQZA 5HOQA 3BTUA 4K9QA 3THXA 5TB5A 4W99A 4YDSA 4NP6A 5K1ZA 3R23A 5DHRA 2ZXFA 1PL6A 3F5FA 1HQCA 3GUHA 4ZQEA 1ZC3A 2E48A 4N47A 2DTDA 3R3WA 5ITSA 2GBLA 2XMGA 3L93A 4MRPA 1FYWA 2DQYA 2Q6TA 4HO1X 3H83A 3PK0A 1T2NA 2H52A 5AK4A 4B4UA 4BEWA 5CBPA 3EGCA 2I8AA 2IE0A 4FHEA 3VR4A 2VT2A 2DQ4A 3OOEA 4A03A 1NIJA 1T5HX 2KLBA 1I14A 1EEXB 3HEAA 4NENA 4EBFA 2JBAB 5JD4A 4P53A 3JAWB 4F0JA 1GKIA 2FZKA 4Y2RA 1RHQA 4X95A 1D07A 3BTVA 4YGXB 2GEFA 1AG9A 1Z6ZA 1PFWA 1JZQA 5FO1A 2P30A 4IDCA 2JLAA 4XQGA 2IOFK 1P61B 4JELA 5JMOA 1XDUA 4L4YA 4DCGA 5C8ZA 4G4SP 4Q5IA 2QUIA 2BV3A 1G98A 3R0VA 1JSZA 1F4VA 4OYYA 1XZPA 2XYPA 2C4UA 4I36A 5AXAA 4DLZA 4BAUA 2V7XA 2H48A 3NP7A 3PA8A 3ID6C 2ZE8A 3LPAA 1RC8A 1M1UA 4BOYA 4R54A 3H3XA 1K27A 3DDOA 3P71T 1BJKA 3A27A 1K5HA 1RNLA 3X1XA 5AKLA 3TBKA 4RDCA 2ZYWX 1C1XA 1TUBB 1VP3A 3KEFA 3B38A 3GHHA 3DLHA 1QK5A 4R9UC 1AKTA 1LX7A 1ZNXA 4L3OA 2A9RA 4YJ2B 4YAUA 1UAYA 3N1UA 3KPYA 3OEED 5JT1A 1SVNA 1Y9JA 3QXCA 1NT4A 2W6JA 4IS2A 2NAFA 4RHXA 5LSAA 4LXIA 4EG8A 5HGXA 2HU7A 5EGNA 1UJMA 1V5WA 1Y1QA 2BBWA 2PO5A 1U7XA 4DLSA 2H4JA 3TTVA 3B36A 1Q50A 4UOZA 1W5BA 2WR8A 2F3PA 1JFLA 4PV7A 3BE4A 4ID3A 2IV3A 3WWPA 4DDMA 4Z3KA 5LB4A 5CAEB 2ZT8A 1Y80A 2JIZD 2RGXA 1SWVA 1C0LA 4YY3B 1M34B 1CZHA 1OX4A 4WN9B 3A1SA 1W2HA 3SX4A 3VH4A 5K0BA 4QAJA 1IZ8A 1I2DA 4PG5A 4CDGA 2ZM6B 3NONA 4QULA 3RFCA 1K4KA 1GWNA 3Q9UA 2WU3A 2DWQA 3H5LA 4FFPA 1G20A 4OB7A 2JB9A 3C3BA 4OXNA 4WDQA 5KAPA 1XO1A 3JASB 1XLWA 1F0PA 2PXAA 2B35A 3JD1A 2HFJA 5FWXB 1OI3A 4W8GA 1QU2A 2W9XA 4JOQA 4MWZA 1KO8A 3V32A 2I2AA 4MLCA 1G291 5FF9A 4DBZA 5ED4A 1JKJB 2C2WA 1HDRA 4PPNA 3FDZB 3C3EA 4QSMA 2PTHA 3BXZA 3I8OA 4F1WA 2NU8B 4ZI3A 1WQ4A 1E3WB 1PI3A 2NT3A 2ZR9A 2WKQA 4URYR 3CLHA 3W7AA 4BFXA 3QJ5A 5AKYA 5BYJA 3HVRA 2PA3A 2QAGC 1J22A 4RY0A 4KRYA 1F8FA 1U7WA 3AR2A 1N8NA 3HQ4O 2QTRA 1Q1BA 4D46A 4PO3X 1KZYC 4PLZA 5C4GB 2JFWA 2BJHA 3K5IA 5F5NA 2HHLA 2R8XA 3LC1O 3GVCA 1LCIA 1OTYA 3PR1A 5KBYA 3I5YA 1A2OA 3C3YA 5EQDA 3EDOA 3OBIA 3SSNA 3DDSA 3L7YA 4C0QC 4LWPA 3IVAA 2IXBA 3GLIE 3MD9A 3GUUA 4O25A 4LJ5A 3BT7A 2ECQA 5F98A 4M9ZA 2XGJA 3ER8A 1OYWA 4QHSA 4O4LF 3LHDA 1AQUA 3MYYA 3VZBA 4KNYA 4NOKA 4UCFA 1UBHS 5AHXA 2ATEA 1TYEB 1ES9A 3AF3A 3ET5A 3QUCA 2R25B 5E38A 3IUMA 4BO7A 2ZRLA 5C8XA 2J7PD 3E4CA 3E8XA 1LW6E 5B6IA 4NICA 2F62A 5DISB 4BS9A 4U02A 4X66B 1TM7E 3R0XA 3ANLA 4JVNA 4IZOA 4AUKA 3WRXA 1WBBA 3K0AB 4MVCA 1EVYA 2B98A 2REOA 1UMDA 3K7EA 1QIIA 3L3BA 4JI1B 1YXMA 3OZCA 1N9GB 1ONSA 1YO6A 4RVOA 1TECE 4S35A 3NU1A 1PQYA 3W4JA 1U0NA 2H7VA 2CVZA 3I1YA 3GA0A 3IPCA 3RJ9A 5B6PA 5HZGA 1KJIA 3D2LA 4F9GA 5I3ZA 4FCVA 3S27A 8ABPA 4PTLA 3U56A 5IN4A 5BMVB 2CC2A 1MP0A 1O0SA 4H9GA 3SQOA 1L5ZA 4FKBA 2Y77A 1U2QA 3P0RA 2ZSFA 1KR5A 1EZ1A 1T6NA 4HK4A 4BFYA 2BHRA 2RGWA 4FCCA 4DIFA 3T3HA 3WRWA 1S4MA 4J07A 2RC5A 3SFVA 4ZYYA 2ZJ6A 4QFDA 4DIOA 3R5TA 2NWQA 4JUBA 4BTEA 3BBLA 3RVSA 2RGRA 4UDXX 2CMGA 2GF9A 4PZLA 1IUOA 4L8FA 4FT4A 2HW8A 1Z45A 1U8XX 3B9PA 3KSRA 4UCXA 3RBVA 5AUNB 3Q4GA 4U1RA 1R4ZA 2XNKA 2QTBA 1JQ5A 1QCYA 3N74A 3B52X 5IH3A 1C8LA 3T7IA 1U8AA 4RZXA 2Q4BA 1GPJA 1ZK1A 4ZI7F 3LKDA 3U6KA 4JOBA 4BLVA 1FTYA 1N8TA 3HVHA 5HFJA 5ECWA 3G7NA 5E7IA 3TO5A 3IPRA 5HF9A 4DV2B 2O59A 5AWFC 3TTXA 2QY6A 4YJ2F 2DGDA 3IOBA 2YC4C 4YR9A 3GB9A 4Q7EA 5B36A 5AM1A 5IARA 1QIMA 4P32A 3V8RA 2RAFA 1XRSB 1HI9A 2HTEA 1SCUB 2JKYA 4L28A 1AUQA 5HILA 2IWHA 1DRKA 5F35A 3SBXA 1F17A 4JCOA 3GJ6A 4KGXA 4WA8A 4Q9JA 1JA0A 1M7HA 5JNWA 1CJUC 5B4UA 2GNAA 3RB8A 5CPFA 3FROA 1BHO1 1MGPA 1YSCA 2AD5A 3ND7A 4QTXA 1DXHA 2HQ1A 3GQBA 3OQPA 4L27A 2IH5A 2QLFA 5DN6A 3T52A 3QFHA 2NXCA 1T35A 4H6PA 4F1JA 5FV7A 5BN5A 1R12A 4K9OA 4A15A 3EVDA 2WQZA 1V8OA 2Q2NA 3I72A 2OXFA 4FFMA 4HNAB 1XHLA 2Q3BA 1O96B 4LA4A 4M7RA 2IZ6A 4L3VA 3K1AA 3GT3A 1T9KA 1T1IA 2VDJA 4IG9A 4DIKA 1CZUA 1BU5A 1DTEA 3PPVA 1ITZA 1D7AA 1W5TA 3IA2A 4OGFA 2CZQA 1UPBA 3TD9A 3TLZA 3W06A 1E99A 3WYNA 2E4AA 3EZXA 3FCEA 3HDTA 3ONNA 3IPLA 2OBBA 4O33A 5AUPB 2CFSA 2CMDA 2CXHA 4FGJA 3AW8A 1BEZA 1G8GA 4I46A 4IIBA 4PPYA 4RHYA 1SRQA 1DC4A 5FKJA 2PSDA 3RE1A 2TMGA 4F3RA 2YJGA 1KEUA 2QF7A 2QX9A 2CVQA 4NV1A 5KU7A 4B4OA 3GD5A 4MVJA 4J7CA 3PZRA 2AC4A 3PU6A 1X38A 3IQXA 4I1SA 4M1YA 3FSGD 2UYGA 2A58A 1B14A 1AQJA 4EVIA 5JQGA 1I5OA 1WVGA 5JMPA 1Y5RA 2W4QA 4G5SA 1EFPA 3PI7A 3FRIA 3KXIA 5JS8A 3GVPA 3K9QO 2Y1CA 1EFVA 1PE0A 4MB0A 3B2QA 1HTTA 1N5MA 1S9HA 4FQ5A 5DNDA 3QF4A 5L3RA 1JDNA 5K0LA 3FB1A 3H0EA 2QDXA 4UBKA 1UQTA 4RQBA 2X42A 2VDPB 4DCTA 4HDMA 2QVCA 4TMXA 5GZ1A 1I3LA 4FS3A 5C81A 4HZUA 4IDNA 1E0KA 2ZG6A 4QTUB 4Z86A 1T0HB 1V5GA 2XKBA 1ZGBA 1E1QD 1GVHA 3DKRA 3IJEB 5EIBD 4CPDA 4LHXA 2BEWB 1CK4A 3N59A 2J7KA 2F1OA 3WRYC 3RF7A 4J29A 3X0DA 4MYHA 1CQIA 3V4VB 2NADA 1FYDA 2YV4A 1VPWA 3FHCB 1HYBA 3MINB 4C22A 1U2EA 2ZJ4A 1P2BA 2PH5A 3CEHA 4YRRA 4EY5A 3NUGA 1ELOA 1GGNA 2VK2A 3SZLA 2CJWB 3TIFA 1A7JA 2Y3IA 2CL0X 3CW2A 3I01A 4S3MA 5KINB 4BWYA 2GPWA 1ZISA 2QZJA 3RTBA 2Y0BA 2P8JA 3VO1A 1OT5A 3VTZA 2IQ5A 2IZOA 5J9FA 3UJ7A 4DADA 2YWBA 2JRCA 5C3MA 5T8KC 2XIJA 3TR5A 3VR4H 4AN0A 4TWJA 4XCXA 2ZCVA 2F17A 2GHTA 4N5MA 2VYVD 1SBZA 5CITA 4DRXA 4Y2JA 4YCNA 3TVDA 3R8FA 2FK8A 5FX2A 1GZSA 1MBZA 4DR3B 4J0EA 4KNVA 2QAJA 1T2AA 1UZNA 4EUKA 4FDVA 3BK1A 3IFSA 2J4FA 3LDAA 1IVYA 2IUSA 2XHZA 4MS4A 3ZE8A 1BE0A 4BC1A 2PL1A 1KQFA 4A5OA 1RYBA 4WZAE 3TLYA 4EB6B 1UT8A 3RTCA 2ZI6A 3C1UA 1ABEA 1UOOA 3UQYS 4DG5A 1SC4A 2Q6LA 2NO0A 4GF5A 3KVVA 3ZK9A 4AY3A 2ST1A 2WIKA 4V38A 2P1DA 1EVIA 5DBGA 4AM8A 4AROA 1KMMA 4B45A 4OFZA 1YBVA 2P40A 4US0R 2F9MA 3M2TA 5IBQA 1JR3D 1E62A 3H8JA 2JVJA 3OJCA 3WMXA 1UR5A 3BCRA 3N8DA 1PK9A 3VR3D 4BFWA 1JEQB 2G72A 3M6MD 4PLWA 2FZEA 1WBDA 3BJRA 1YQXA 3I34X 3B7WA 1DAFA 3P9YA 4ZU3A 2RK3A 2ROQA 3RWBA 2BSQA 3TD2A 1CZRA 2W2KA 3WHKA 2GDZA 4AKEA 4DJFC 1BD3A 1N9ZA 4P4UA 3VH1A 4BLWA 6AT1A 2MDTA 1S3SA 3H1GA 2K2QB 2ZLBA 2N47A 5DWVA 1EVJA 1DAMA 1HM5A 3PE4A 1W44A 1PVOA 5CT9A 4LJKA 3WHLA 2BSAA 1U7ZA 2XJ4A 4RH0A 4R31A 1SOVA 3BMNB 1IN6A 3FOWA 4G4IA 4QBTA 3ZWXA 1Q0TA 4K9SA 1ANKA 3VKWA 3ZIAD 4CKBA 3GV0A 4QDJA 4XAQA 5ETJA 1WU7A 1MORA 3AIIA 4EGFA 4EY8A 3PEUA 5F2NA 3N0RA 4MIYA 2G4LA 1FP1D 3OVMA 2GYWA 3ONDA 2OV1A 4OD0A 3MTIA 4CKYA 4P08A 2CVPA 3O9VA 4B3BA 5L3SB 5LN1A 1XPOA 4MUHA 2NO5A 4G5XA 4MS3A 4E09A 3E5MA 3BE5A 4Q19A 3P9KA 2O0HA 3BFJA 5AI0A 3OBBA 2V7UA 1TVEA 4JJ6A 3NJ8A 1VDMA 3CJTA 2V7PA 4LXXA 2X9NA 1JGTA 1TJYA 5HNKA 1UQUA 3JWHA 3U61B 1Z0AA 3QU9A 3TN7A 4ID9A 1IZ0A 1JXQA 1QIGA 1OXTA 1K98A 3QYPA 4DV6B 3QVOA 1Z5GA 4Y2UA 5AVXA 2VSXA 3K3PA 2PLRA 2QVZX 3IUQA 4J1TC 4NYIQ 5I7WA 1I3NA 1TJPB 2Q1WA 3AUFA 3PLAE 3GUYA 1OH8A 1J0BA 2WHEA 3NC1C 2H54A 1UDCA 3EPRA 1C1DA 3ZEAA 5ECDA 3HY4A 4E70A 3DDHA 1OROA 2GCOA 3HR7A 4MX8A 1DARA 1RYHA 4DWVA 3NHPA 3B5EA 4HP8A 1EFRD 4TYWA 3WXBA 4R1MA 2B99A 4ENTA 4Q48A 3BPSA 5K0GA 1X14A 1U4OA 4FYJA 3DQZA 4LJ7A 1NV9A 1WKVA 2DSNA 3AR7A 3R7BA 3R75A 3RS7A 4AMYA 4B3TB 4D99A 1KOLA 3D9QX 3M4XA 4BNYA 4MQ6A 1UZUA 2QN7A 4YGYA 3C45A 3FAZA 2X7XA 1SN7A 5FCDA 4LOJA 3AH8A 3VJLA 2PD6A 1N0VC 1RHJA 1Z28A 4RWZA 4WESB 5IBRA 4Q01A 2Z9DA 3ZX4A 4E03A 2X4LA 1Z5VA 4WKCA 4PSKA 4P2GA 2B9EA 4P9NA 3CRW1 4OM8A 2Q4OA 3LDUA 2CXRA 1QPBA 2PUTA 3I6YA 3FPHA 3L0OA 3IUSA 2OCYC 2HY7A 2RCYA 3M4ZA 4JP5A 4LSMA 2AZMA 4MRRA 2Q1UA 4PBSA 3IP8A 4QDKA 3WFZA 3DCIA 5MGBA 3U09A 5BSMA 4NNPA 1UJ5A 2CCGA 3GZNA 1HK7A 1ZJZA 3KKMA 1EGHA 3HN2A 5CX1B 1UKZA 4UUQA 4NEQA 5TLSA 1KYVA 3NT5A 4AY5A 3K0EA 3JZIA 4QFBA 4D8TA 2DWUA 1QZUA 1V47A 2O50A 1NU6A 4JUAA 4LAFA 4TYQA 2EZ8A 1I24A 2PD3A 3IMFA 1NDHA 3NKVA 5U9CA 2ZRAA 3ZVMA 1TPYA 1TT5A 2RHCA 1U3CA 3IILA 3NHZA 1QB8A 2WE8A 3IULA 1UBMS 3ZGVA 2PWPA 5G2OA 2H1RA 1L1QA 1NR5A 1U1IA 4NE7A 4CMEC 4HNVA 3U7JA 2R8PA 4WFJA 2FN3A 3E82A 4FJ2A 1SCQA 3HMQA 4RPLA 2QD4A 4X1KA 3ZE7A 2AFIA 4O5AA 4NQZA 4NONA 4K0RA 5IM5A 1ZICA 1Z4LA 5K51A 4Q7QA 4FN4A 1Z6YA 1KEEA 4JBGA 1Y8AA 1LNSA 1V43A 1X94A 1NVEA 1JLHA 4DIBA 1RJ9B 3A6HA 1YCFA 2VJAA 1XMSA 5J58A 3QE9Y 3NOOA 1ZSVA 2I6XA 4E1VA 2GXUA 2YL2A 2AJ8A 5DBOA 4HFMA 5DE3A 3WVNA 4ASUA 4AZ3B 4R2JA 3HYLA 3R6WA 3BJIC 3CURA 5GMOA 2IITA 4TYPA 4NABA 4B3SB 1YMQA 5HM6A 2BGLA 3ZU6A 3U2QA 4PYJA 4FEEA 1XVVA 2OHXA 2FZWA 2E4XA 2WUVA 3ZR4B 2H5IA 1O8CA 3EVEA 3ORQA 1LSJA 4FZJA 3IMEA 3ZKWA 2C5AA 1D7OA 1QTIA 1GRNA 2RDMA 5DLPA 3EDMA 4CDMA 2FEXA 421PA 2O8DA 3CX4A 2FKNA 1P9OA 1BFDA 2I03A 3M2PA 3ESXA 1P33A 3D1VA 2I99A 4ZHQB 3KEMA 1MQSA 3TVYA 1NYLA 1T8SA 1KEWA 4CUJA 3EQ6A 4DV4B 2V7TA 1N5JA 1P39A 3DT6A 2B30A 2RH4A 2ADMA 3ELWA 4RSRA 4CFZA 2AG6A 4F86A 4ZCTA 3K9FC 4R84A 3R7DA 3H8WA 4V0MA 3ZHTA 4QL3A 3TJRA 3T1YB 5AK5A 2H2IA 1FBNA 3IJRA 2C88A 2ZVQX 4GVPA 4LZZA 3I5UA 4LZLA 4PHFA 4WZBA 2PUEA 5ELLA 1E4VA 1JHOA 3VJRA 3MVEA 4WK0B 5CP8A 1ZDMA 4BVJA 2DERA 2OC4A 1K6EA 3CT4A 5B37A 5AOCA 4DMFA 4TL9A 1YT5A 3UB3A 1S7CA 2G04A 5KTRA 1CXZA 1TCVA 4N40A 4Z8XA 1PG5A 4BKUA 3K9NA 5A9SB 4DT1B 1SCAA 2ZYHA 4JA0A 4KPYA 5D1NA 4KLZA 2G1UA 3GG2A 1XNQB 1L2TA 2J3DA 1O0CA 2ZWPA 1SKUA 1U1DA 1SCNE 1SXJE 3HJUA 1Z2DA 2VAPA 4QUIA 4WKBA 1BMTA 2H2WA 4XWAA 1HDZA 1C4WA 3CN9A 1ND6A 5JD3A 5GJCA 1RQXA 4HQ6A 2VP5A 3IT2A 1S2GA 3WLAA 1CETA 4TKVB 4OIFA 3RUFA 2GLUA 3RWOA 3D2BA 3NHRA 1BMDA 2WT9A 3SM3A 3STVA 3TWOA 4KXQA 4MUXA 1V16A 3SG0A 5JYEA 4CV2A 2BEKA 4RM2A 2XB2A 1NR7A 2JEYA 1G8AA 3FMPB 1HDOA 2W48A 3FCCA 3LQ4A 2IY7A 2J6HA 4ZAVA 5LMNB 4RMNA 3REQB 2G06A 3ZH9B 3SVTA 1HFKA 2SICE 2X0DA 3HI6A 1F6DA 3A6PC 5BN4B 1Z08A 4UUAA 1PN3A 4DWJA 4LOKA 4AICA 1SPXA 2DLDA 4PINA 2IEZA 3KALA 3KAJA 3PNKA 3QV2A 4MPTA 2VS1A 2BEVA 3CLRD 1U6KA 2CUZA 4YP0A 4UMVA 1IQUA 1LFAA 1JAXA 2J3HA 3S6JA 3MRVA 4DDVA 5KVCA 3SWWA 3FOBA 1F2VA 4BMCA 1VL1A 1RACA 5A6SA 2J9RA 4IKOA 1ZD2P 2VAWA 1P44A 1AGPA 3O83A 2OCIA 3EDCA 1NBME 2H1LA 3DOEA 4J6FA 4KQ6A 1V26A 5DTIA 5IT0A 3L1IA 4HVAA 4DMMA 4CTMA 1W4LA 1QKJA 2LD4A 4KKXB 2G9QA 4CLRB 2EERA 2R4TA 1O6GA 1P1RA 3DQQA 1XVUA 4RTOA 2ZDQA 3ELDA 4AYTA 1V11A 5LZ9A 1G18A 5EWMA 4ZT7A 3UQZA 5CG1A 3VPSA 4LYYA 2GHQA 3MLBA 3EOZA 1IJKA 1S8FA 1F2DA 3OJXA 1R6XA 3VNUA 3QVMA 1YFZA 3KJGA 4JYMA 1H2EA 2OLEA 2ZQ5A 2OD7A 2H1HA 2VQ6A 2XGSA 3LQRA 4P84A 2YKGA 5L4NA 4KB5A 2I6FA 1IEXA 2OBMA 1QYWA 5J4YA 3BX1A 1JDZA 2PANA 2BFBA 5KKCA 4LXHA 3W9SA 1KHHA 2FUEA 4JITA 4KQWA 4HYYA 5K8UA 1Z4MA 2QSZA 3OHPA 4I55B 4HF7A 5ES3A 2HMYB 3Q8LA 4J4TA 5IXYA 2UYHA 3ZLBA 4EMBA 2IYEA 2BM8A 3U5ZB 5AJTA 1JPVA 4RESA 2YICA 1JDJA 2RGCA 1V37A 3SJZA 1QZZA 3CUYA 1ZUNB 1W0JA 1G1MA 1BMFD 4HTFB 4KE9A 4B31A 2IPOA 4Y6PA 1R9NA 1W1WA 3UHAA 1CE8A 1QVAA 1H0SA 2DCMA 3DW1X 3AF1A 3ZHZA 1TB4A 4HB3A 2CL7X 2A9KA 4XWOA 5BYKA 2YWRA 5DXJA 5EPOA 1KP3A 2OGUA 5T8KA 1MCZA 2ZBUA 3HL4A 1LBEA 1WJGA 3H8VA 4JLBA 4L6CA 4YV7A 4QPJC 2YJZA 4ZHQF 3U19A 5FV4A 1ZOIA 1CUCA 2WOJA 5CTJA 3L0BA 3BORA 4IGAA 5BOSB 1NU8A 1T29A 2QDKA 3U3OA 2NO4A 3WYAA 4IJKA 4JNKA 1I7SB 3OJOA 3GLFB 1HORA 5CCDA 1C9DB 5AVQA 1RABA 1KU6A 4MWGA 3RVNA 4GR4A 5DXAA 4YRLA 5AH0A 1B3RA 2GPJA 3JARB 2PSJA 1NLMA 3BBPA 3V33A 1R74A 4A92A 4F45A 1E2UA 2CB0A 3G0HA 1DJMA 1HEUA 2CJXA 3GMTA 1WMDA 3U3ZA 1JXOA 3WGIA 1E2FA 1OZGA 4RVUA 1QRRA 3FWNA 1W36D 1U3VA 3D81A 3IXMA 1WHTA 1DCTA 2HD4A 1V1RA 2DEUA 1B0AA 1C9MA 2WK1A 1G2OA 3AERA 4LKOA 1EWYA 1HFEL 1WVIA 1A4XA 2AH5A 3MMSA 5LVAA 1HNXB 1U2SA 3SYMA 1JFTA 2J4CA 4MQUA 1G6HA 2F8LA 4XYMA 3L6UA 1TCAA 2JGDA 3FWHA 5JNLA 4YFYA 2FW9A 3IHTA 4J2OA 5BVHB 3O75A 4M99A 5JG7A 2NX2A 3LY9A 4TTRA 3V55A 4GKJB 4WINA 1SVUA 4H4EA 3DKIA 4MUFA 1JIUA 2HH9A 3EZ7A 4PS0A 1DG9A 1UXIA 1NRWA 1R0SA 4LQLA 1J0AA 2I4TA 1BG6A 2YXEA 3KQKA 3OTHA 1U1EA 4L9RA 3COJA 4ZHSA 1W59A 2ZRKA 3OCZA 4QATA 2OUKA 4KDEA 4KYUA 3BZUA 2ZVPX 1FPQA 4TVSA 5JYCA 2JF0A 1XTBA 2BPOA 1P9WA 2Q3HA 1WLYA 2RD2A 1YMVA 1MO5A 4OPMA 2IVFA 5AUQA 5A4IS 2Y9MB 3BQ9A 3V1UA 5BVGB 7MDHA 2Q8QA 2MYTA 1ZNWA 2BEJA 4KQFA 5JAUA 2PFSA 4G0VA 4Z51A 4NCIA 1MZPA 4W5HA 5K5EA 4Q4JA 4WH0A 4TZ0A 3VDMA 5BYBA 2FRVA 1ZC4A 3GRAA 4P3KA 4DANA 3GN2A 1E7WA 4GZ3A 3DLTA 4LRXA 2I4RA 1PEYA 4RJJA 5FTKA 2C57A 3G2LA 4GYWA 2FB9A 4ZEWA 4DNPA 4F5YA 1MHPA 1LPOA 1XKXA 2GYVA 2JBWA 1I13A 4C7OA 4PIVA 4NATA 1M34E 4BAZA 5K7SA 2DETA 2GN6A 3ILYA 4M4SA 4A0QA 1HT1E 3V8VA 1NG9A 2OESA 1GDDA 1L7AA 3WKBA 3USCS 2X8LA 1T15A 3CX6A 3TLMA 4E5UA 1HDEA 3HCNA 2PEYA 3B20A 3PYLA 3ZHRA 1BXZA 1GTL1 4LVOA 4S12A 1E6EA 1W73A 4WOJA 3HCAA 2FEAA 4XPIA 5DM60 4XA8A 4QPNA 1F6WA 3ICVA 4F8EA 4EMTA 1OKKA 2FPOA 2JAUA 3SZRA 2J9FA 1H94A 3M6AA 1DAOA 3RJ5A 5LP6A 1YA6A 3Q11A 3THSA 4AJ4A 3DLBA 4LXYA 4GNKA 3TKLA 4FX5A 2ZUWA 3CONA 3SZGA 2JH3A 1FF9A 1GTJ1 3KAPA 5DGTA 3RIGA 5JNTA 5HEKA 1TE2A 8LDHA 5K8CA 3BF8A 1CVIA 3HYNA 4HBGA 3WQRA 4GQIA 3DONA 3Q3GE 3AILA 4NARA 2RKOA 4B6OA 4DR1B 5TQVA 2GH1A 1NQUA 1A2BA 1BAPA 3GJXC 3ZBTA 2BWJA 1JECA 1IHDA 5DDIP 1AMNA 4BYMA 1S89A 1P8AA 1RXYA 1XLUA 2QMQA 2CY0A 4IHQA 4A2CA 3E8SA 1H8HA 3VNSA 1GO2A 3FA2A 1K6JA 1QCCA 2QSYA 1IHYA 1UP4A 3SQXA 5FI0B 2QRLA 5IT4A 3IR6A 4G84A 1KOJA 1T3HA 3THOA 5G0WA 4Z1OA 2ACVA 2ZBDA 3GNSA 3IVRA 4U7GA 4YQZA 3OHSX 1DCMA 4WLVA 5HFAA 2FA9A 3SXJA 4F4JA 1X74A 5DX0A 3KUCA 4EO9A 1MFPA 4C0JA 2QPOA 3OMLA 4B73A 4DMKA 4YCCA 4JB0A 1R0ZA 4D3XA 5AW8A 5DNCA 1Q22A 1I2CA 1MABA 1P80A 3MWEB 4H6XA 1NONA 2G1AA 3MQ4A 1R2QA 3DG9A 1QCZA 4HMQA 3WC4A 3WWEA 4E2FA 1BSVA 3IELA 1RQRA 3FJYA 4AZSA 3AJ9A 2JIOA 4ZPXA 2PE5A 3HXPA 3UG7A 5KYXB 4W82A 1ST3A 5BR4A 1I30A 1KI1A 4F6CA 1G8FA 5HHTA 3JVVA 1G8MA 1MNQA 3H2ZA 2FSUA 3R24A 4FBMA 4M9UA 4HN2A 5E1BA 3TZ6A 5LP1A 3GAMA 3KQMA 4W6QA 3UT5B 3J81k 2WJPA 1NVKA 2B25A 3FVRA 5FNVB 4OB8A 2ENUA 2A5FA 4PN3A 1GKUB 3WSTA 1XK6A 4RDHA 3U7QA 5FPQA 6LDHA 4BVLA 2I78A 2JLYA 3ZTYA 4XJTA 3Q85A 3MTEA 4A27A 2CVOA 2ET6A 2ZIXA 4MA0A 4N9QA 1JILA 3QVUA 3C5HA 3C8ZA 3OJEA 3N8NA 4BFLA 4BVBA 2GHIA 1OLXA 2CYCA 4F5WA 1SUAA 5JFTA 3BE6A 3VPGA 4TMTA 3HYTA 2EBWA 1BHQ1 4JT4A 5TF0A 3R9IA 4GBMA 3KB6A 2W4IA 4K9DA 4QUAA 2BY4A 3U4AA 5JJLA 2FUG6 2AQ8A 3WL8A 3LC7O 2PXHA 2P69A 4LISA 3TLKA 2XXAA 5A7GA 2OTCA 1UMBA 4IUBS 2FZ4A 3DR5A 1PK8A 4N0MA 4TV9B 1DINA 2OO5C 5JR3A 3RRNA 5JSFA 4TKUB 1XV5A 1AK9A 2O5RA 2PT9A 2RIRA 1U8TA 5B4TA 1WR8A 3IQDB 4FZ3A 3AL3A 1L9XA 5TMBA 2BCGY 3WL3A 2GBFA 2XEXA 4PG7A 3AK4A 3L02A 1Q7EA 1H3EA 1QH0A 2C5BA 4UTOA 2DFDA 3PC8C 2J0QA 2V0NA 3Q0EA 1E3JA 1YBMA 4X62B 1BYIA 1G2PA 1B8OA 1CT9A 4C6RA 1J6UA 2PJUA 1XZIA 1RAEA 4BGUA 4TT3D 1JALA 1MC5A 2BZGA 3D6NB 1AE1A 1RS0A 1ZH4A 3BICA 3M1IA 3NYRA 4WBNF 5BWMA 3PHBE 3PNVA 4HXEB 2ADFA 4UBMA 3B3AA 3ENKA 3E7PA 5THXA 1SAYA 1NVBA 3AOGA 4DCOA 2AK3A 5C18A 3U4HA 1JIKA 2C54A 1WZ2A 2FOXA 4IBOA 2JLSA 3JYLA 2FPMA 4Y9UA 2CHVA 2OSVA 2P2DA 1XGKA 2X5XA 2Y92A 3OPYB 4NK5A 1CR4A 2G9VA 1Z0JA 2ZRFA 3FRJA 3DZIA 1NW4A 1PZXA 3CF0A 4IF6A 4TZ6A 4AJIA 2G17A 2LR0A 2YS6A 2X2EA 1KRHA 2EFCB 2CYBA 1X1SA 2GNOA 2BFAA 1VIAA 4IIJB 2VLBA 1ZPDA 2GD2A 2X2PA 3EQ9A 5BWNA 4V02A 1PG2A 3OTQA 1BCRA 3LXXA 4PQFA 5EUCA 3O8RA 2WDZA 4XQ0A 3PUIA 4ROSA 5M7EA 1LY1A 1TO2E 3KOMA 1XD9A 5FTLA 5B5SA 2CXNA 5GIPE 4A9AA 3A4LA 2P35A 5EC8A 1WDMA 1GTMA 1IUKA 1L7DA 3COPA 1QG2A 3TZQA 1W25A 4HL6A 1UQRA 2XF2A 4CU2A 4TVBA 1UCFA 2XNHA 2FEMA 2AR9A 4KN8A 5MFPA 4Q1EA 5F2KA 1LS1A 5FPTA 3MOSA 4TSFD 2B21A 1N2ZA 1ZEMA 1QFJA 2YVUA 1YNOA 3AJAA 3L79A 3OPQA 4A8JA 1JAYA 4FD3A 3ZV7A 3ET4A 4D9CA 4B43A 3THYB 1RR6A 1G21E 1PVDA 2XD9A 5G4KB 5AM0A 5JSYA 1VG1A 4J4BA 1Y4SA 2Z2JA 3V80A 4EJMA 3JATB 3L1UA 4TMFA 3W9YA 4QGSA 2V4ZA 4G9GA 3SSMA 3E9CA 3CEPB 4MP6A 1J97A 4YRGA 3T0FA 1QGDA 2GOYA 3KSZO 4G85A 4B6PA 3K94A 1JN0A 3FWKA 5ITWA 2RH5A 7REQA 2DLNA 1KYWA 4N12A 4JL5A 1BWQA 2WIDA 4BFZA 1NTOA 4DMRA 3DZCA 4X93A 2QXYA 2MSNA 3QKTA 3T3MB 4EX7A 1TJ4A 4IV8A 1W8IA 5A9RA 2G9ZA 5JZBA 4X20B 3DBIA 4QYMA 3T7TA 2WD8A 2Y1LA 1VGQA 4IMIB 2AN5A 2BBTA 2ZUBA 4L8YA 4C0BA 2VPYA 3R8CA 4YNBA 4EEXA 3ADCA 1W4BA 4KQKA 3A1WA 1JHRA 1FUEA 5E1MA 2A33A 5KDOA 5JH7B 1VB3A 2QTFA 3OF3A 4HQNA 2XDAA 1KO4A 5B2FA 1N25A 3LC0A 1UZAA 1JE0A 2Y99A 5EERA 7ADHA 1COWD 3FZNA 4HDRA 2H1IA 4DMLA 4IR7A 3OD5A 1WMAA 2WTMA 2BE7A 4IH4A 2GUWA 2X86A 4KO8A 4YP5A 4Y1GA 2LIVA 1KETA 5DYWA 5KOHB 2J9YB 3C6MA 1NAHA 3K2IA 5CT4A 4F5DA 5AVTA 1O4VA 2VJMB 3TPCA 2J45A 3PQ7A 4BY9E 1CV2A 1BJTA 1MO2A 1Z3CA 2COKA 3QLUA 4N0EA 4NPAA 1JHDA 5C7YA 4TTTS 5JJ5A 1RWKA 3H11A 4YWJA 4B3CA 2OQVA 4UVGA 2QVGA 3KEOA 1DOAA 1U6IA 2R5WA 1HG1A 2P3QA 3KNZA 4H77A 5DI3A 2D2VA 2IZ1A 3A04A 5CVJA 2H4ZA 3C8HA 2BR5A 2VCYA 5AQEA 4FMCB 4Y0NA 3FYUB 5DNVA 4BMPB 1DXOA 3GFPA 2OWDA 5LKRA 1CUXA 2CKMA 1Y34E 3H1AA 2AFHA 4MWEA 1YRQA 3PEYA 2ORIA 3IVXA 4B3XA 5J2TB 2Q2WA 3TUZC 1YGYA 4QNRA 1D09A 2ZTUA 4OI2A 3EPHA 2FMKA 4RGQA 5E2IA 4LFBB 4U9HS 3FHLA 2PT5A 2R6AA 4LE2A 4Q9HA 1SFRA 1UKCA 5KTPA 1H6DA 1YJCA 3L0SA 4I7EA 2IYZA 4PLVA 5ALYA 3LL4A 1V1JA 2GS9A 4L8VA 4MRMB 4MR8A 4NG5A 4O4JB 4HGYA 2YWGA 4W5WA 5JCJD 1N77A 5E6UB 1PGNA 2AGVA 3QELB 5GIOE 4YJ3B 2GT1A 3QYAA 1QFMA 4KBYA 4CM8B 1GFSA 1HETA 4FDAA 4Z49A 2C96A 4R2KA 4LSZA 1ZXBA 4YRKA 3I9NA 2Q6IA 3U49A 3NIWA 3MAGA 3UJAA 5JAHA 2ETXA 5I9SA 3RVDA 1X1CA 1E1DA 4CEJA 1TEZA 1IM5A 1F0NA 4KE8A 3L8GA 5HDBB 5HIKA 2A6PA 4ACAA 1R0LA 2CLLB 1C3JA 2KYRA 4Q3EA 4F7WA 1JHAA 3RSCA 3AJRA 4M0KA 4EG5A 3DD5A 2W71A 1ZBQA 4NFLA 4G0YA 3RK4A 3PDHA 1KQGA 4J1NA 4AQ7A 1UJNA 2PMFA 2D0IA 4WVLA 5EKSA 3FGOA 5EQTA 3J7TA 3GA7A 2W83A 4IIJF 3DBOB 2MSLA 3IPXA 2CSUA 3A7DA 3OJLA 5MN4A 2ZRNA 2IYPA 4X45A 2XUDA 2ZCUA 2I4IA 1QB7A 3OEYA 4C7KA 5KNLA 1E77A 3SS7X 2OK8A 1OLOA 1YZNA 2IYRA 3VC3A 1RXIA 1M1YA 4DDUA 4G37A 3DO6A 3L7MA 1KTVA 5B2EA 1L3BA 5EIHA 3SF8B 1CDOA 3EMDA 3HVIA 3QOWA 2C9OA 1RRMA 1H1LB 3KZXA 4IDFA 3I9V1 4LBYA 2ZTVA 1L5OA 6PFKA 2NXEA 2PZMA 1PSWA 4OMCA 2OGZA 4DVGA 4KREA 1Q3KA 3KYCB 4HXFB 1XJ5A 4RZUA 2G9RA 3AETA 4HAUA 1ORRA 2OG2A 4KR6A 2EKPA 1PSZA 3AF0A 4HAXA 2ZI9A 4N01A 3NG1A 4YLGA 5KQMA 1QYCA 3PFFA 4FGKA 4PNZA 3UJNA 2JCXA 3DE0X 2FWAA 3AFIA 1BO6A 2H07A 1IY2A 4UEOA 4E2WA 5C51B 1W5SA 3P9SA 1CRPA 3CE6A 2VKTA 3JCZA 2OMKA 1LFDB 4QO8A 3S2UA 3AKYA 2LE0A 4QDOA 3RS9A 3OT1A 1BRMA 2HIHA 2EF1A 2JI6A 1TGVA 2RB5A 2JC3A 1K6MA 5H80A 1ZUD1 4HNSA 3WP1B 4B9EA 3A6FA 1C30A 2YH2A 2PMDA 3Q7EA 1IUPA 1JA9A 1MB0A 2D74A 3CKKA 4MUMA 1FLAA 4RY9A 1E98A 5F33A 4BNDA 4FS8A 1RC0A 1UWKA 2B1IA 3HDJA 4UXIA 2ZYSA 2C8KA 4HLNA 4LGMA 5G0TA 2I3BA 3WDKA 1JU9A 4EHHA 4XYLA 1Q92A 5JD5A 1XLTC 3NCHA 4TMYA 4Q4AB 1MQAA 2JAWA 4YP9A 1J39A 1NC3A 2BBSA 1X3SA 3RTGA 2CL6X 4JC5A 4PIMA 4WWHA 1CLEA 4JLSA 5M5BA 1QE3A 2JEZA 1CJCA 5DI9A 1FFEA 4KP7A 5CA1F 3PT9A 1U99A 2G3YA 1VPTA 2BC9A 2IW1A 1GZVA 2LRHA 2G9UA 2QP9X 2XOXA 3CB2A 3HDVA 1DS6A 2F7SA 4RY8A 4Z0NA 1ZMRA 5I4CA 2XECA 4G97A 5EKUA 4F72A 3NYQA 1ZN9A 4MQEA 1MJHA 4RENA 4Z0PA 3CWZA 2GN1A 2PGNA 4B6GA 4KGVA 4TN1A 1RKUA 3QYFA 4FWIB 4ZVRA 3LE8A 4IGFA 1U80A 4OJYA 1QMGA 2QRKA 3TEMA 1RRCA 2PVSA 4CLEA 5JAIA 4IIXA 5H81A 1XZLA 2CDCA 4LUCA 3LSTA 1YB1A 1XTRA 2P9BA 3H5TA 3H2JA 2JGMA 1CY4A 3V4SA 4AD8A 2HRCA 3PJEA 3UMYA 2Q6OA 1NW5A 2GJ4A 4RETA 4L78A 1U90A 3COSA 4C30A 3WMGA 3AY6A 3J7AC 1OU0A 1KZHA 4P7JA 1QJCA 1E4YA 1IMOA 1BDMA 4LOAA 3T7CA 2ONZA 5AICA 1U5BA 4PGHA 4XE5A 5LQRA 1GSHA 1JYEA 1CUGA 4M1EA 4E5VA 3LMKA 4LDNA 2VBIA 4WBSA 3SQDA 3OZBA 5E7QA 4TMWA 4OXYA 1CQZA 1ESCA 4UD2A 1A0OA 3ORHA 4PAMA 3GOHA 2X0FA 3B6MA 4ALJA 3CEJA 1E9DA 3KYBA 4MKGA 3B3GA 4U2DA 4MKRA 5FI3A 3X3HA 2AOTB 4OHMA 2JJ1D 3MRSA 4B9AA 2OBXA 1USIA 2CCKA 5C52B 2GZ1A 4NE2A 2W6ZA 1JJ7A 2EFEB 5KTKA 5TJHA 2QIPA 3JQGA 1VCNA 2R6CA 4XGRA 2FETA 3LTEA 2O8NA 1R5NA 4BPRA 5CCEA 3NXKA 2ABWA 1E8DA 2AMLA 3A9RA 4NAUA 2Y1WA 3KJNA 3OIYA 4RHFA 3RYCB 1B0PA 1T4CA 2NUBA 1NVGA 1MAUA 3NHWA 2Y1OA 1U0RA 4FMDB 1NVVQ 3IEUA 3S2ZA 3I3OA 4B71A 5K3CA 5KQLA 3S81A 2OCGA 4INJA 1PLLA 4I1PA 2VNJA 4JJEA 5FHQA 1O7JA 3S3TA 3DV0A 1WW2A 4JQOA 5CB4F 3L82B 1G9TA 2BVNA 4W7IA 1USUA 3AEQB 3CLUD 2CD7A 5THKA 2ZSAA 4P22A 1D9ZA 3OSUA 3CLSC 1MN6A 4RPHA 1KTIA 1Z74A 1Q74A 1U8EA 1ZOLA 1U9YA 2PVCA 4DR6B 3NH6A 2CFRA 1T3ZA 3P1JA 4F12A 2H0AA 4HKTA 2J30A 3NGLA 4N5IX 4TXLA 4U2BA 2J85A 2B4AA 2QD1A 3HRIA 4BLSA 2KB0A 4D97A 1E9CA 4N7BA 4JEHA 2F67A 5K05A 1TC1A 4W5NA 1KNXA 4R9NA 1EB8A 4EMUA 2HXYA 4PWYA 2IY9A 3BHNA 2IVZA 1IJBA 1OI2A 1DUVG 5B3KA 2FMXA 4OHYA 4P4GA 2WTUA 2P4EA 4IIYA 1F8UA 1UIRA 4I1YA 4B6SA 4YBZA 3O4JA 1V1MA 3SMQA 2O8FB 1RKBA 5J1SB 1ACJA 1OF1A 2WW8A 3GEBA 1OX5A 2VHJA 5EOVA 4YCSA 4NE9A 5HUJA 5IXJA 1CZKA 3K71B 4CQNA 4AKGA 3FZEA 2XVZA 5JNSA 4JLKA 4PGGA 4EH1A 4JH0A 2JJMA 1RPAA 3IKJA 3M7IA 3OFVA 4V2IA 3PS9A 5K0NA 3DFKA 3P9XA 2FW8A 4X85A 1J23A 1LVGA 1XZFA 1WUHS 3IPAA 5DLEA 2OLKA 4HI0E 1G4UR 2C03A 3HBNA 4D45A 1GL9B 5TS3A 4REQB 3HKEA 1EGMB 2C3PA 3DAHA 2R1UA 2ZBFA 1RAGA 3WWYA 3FVTA 3NUQA 1YFLA 4JROA 3B2EA 5EIXA 4P5PA 2X1MA 2BMJA 1C4OA 2HAEA 2EP7A 4D79A 5K0ZA 1U2GA 3NDPA 3AG6A 5DYIA 4BVAA 5BUQA 1GPKA 3ICOA 3OUTA 5ILQA 1UBRS 3E23A 4G89A 5CJJA 4D0NA 4KJZA 2I5PO 2PZGA 3H6GA 1T4DA 2ID7A 1TM5E 2WYUA 3E3OA 4K6OA 1RCTE 5KYUB 1WXEA 1P3JA 4H4CA 4JI6B 1WV1A 4DYHA 3OG9A 5J4LA 8OHMA 1H2ZA 2GTHA 3HLYA 3FCYA 4TL8A 1GZHB 4MLDA 1R4MA 2ODPA 4Y7DA 3I9V6 2R6FA 3HHPA 3VPCA 2VYFA 4UZFA 3EBOA 5CLLA 3IESA 2VUIB 4NYMQ 5KAMA 5HCIA 5H4GA 5ERXA 5ELMA 1M7GA 4LDZA 3OKAA 1CUEA 4D8XA 2I33A 3AYZB 4U7DA 1SU4A 2P41A 3FMGA 4MVJD 1NKTA 2O8BB 1BFUA 3F6RA 4G5QA 4M0DA 3G2PA 1OR8A 2RG1A 2QM0A 5FULA 4CWAA 1C29B 2FLKA 2HSDA 2ZB4A 5D3MB 1YHNA 1ZH8A 2ILVA 1P6QA 2ZYRA 2VTEA 3KYDB 4O2BF 1UBLS 1A72A 2EFDB 3G3EA 4Q6BA 2ZVJA 4YJHA 5L7YA 4V3BA 4IRMA 3N9IA 1FP6A 3A7EA 3VR5A 3UANA 3DE2X 1ADYA 2PLAA 3DAGA 3VU9B 4QYTA 5AW6A 2EYUA 5KO2A 3EZNA 4MZDA 5AKJA 2ZIAA 2J6CA 2QX8A 4LJ6A 1GYRA 1BOOA 3DOFA 3FDFA 3G5LA 3QBEA 4GPEA 4NX2A 1ZVMA 5ADVA 3DAOA 1II8A 4FLFA 1RWXA 2VHEA 2YN2A 3C6BA 2A9FA 3FJOA 4OVKA 3A70A 1B3BA 4NZPA 1HNWB 1H3FA 3VPHA 1JEOA 4HNRA 4WJLA 2RH8A 1GG5A 2ZSBA 3EVFA 4HB2A 2WE7A 1FMTA 3GLFE 2VEDA 3BSWA 3KKQA 3KCNA 4F1KA 2MT9A 1U0SY 2FW1A 2PMBA 3EOAI 3IVCA 4UEJA 5HF6A 2HA4A 3ANMA 3BGSA 4MUKA 4QJ3A 5M2QA 4LVCA 3BXFA 2J9GA 5CH8A 5EFOA 5EMNA 4EPRA 2G07A 2DR0A 2RH9B 1KI7A 3FYSA 3ZC3A 3SIXA 4EY6A 1YZQA 3EW9A 5K6RA 5HTOA 1ADGA 1GSAA 1UF9A 4PC1A 1FTQA 2ZETA 3DQPA 5HFNA 4N5DA 3WRYA 2GN8A 3RC9A 1BE1A 1WHSB 1H6BA 2XH8A 2ARKA 2HJRA 1OWMA 2O7QA 3G2OA 4O8ZA 2FQWA 2O2HA 2X8JB 1U04A 2W6CX 5ALGA 4CDNA 5HPYB 3STYA 5KQRA 5TDHA 2VHTA 3MBKA 4RFSB 3LWNA 4TLEA 3AM4A 4PC6A 1R4AA 1EI9A 1BA2A 2F3TA 3CUVA 3VX4A 1ODSA 2QEQA 3FHJA 1PJLA 2NO1A 2QPAA 3W2GA 1FJXA 5C2JB 2LZ0A 1B6GA 2V98A 4DZTA 3MT0A 3M33A 4MAAA 2XUAA 1W0KD 2EEZA 4IPTA 4GUDA 2L18A 4D42A 2X0NA 4MLPA 2AF3C 1THGA 1Y3FE 3ZQKA 2X4IA 3AUJB 3PTZA 4FEGA 2HDHA 4OL9A 2P65A 3OKCA 2O05A 1M6WA 4G56A 2WSSD 1E1CB 2XMRA 4FFDA 4O59O 5LOVF 1Z5NA 2UXDB 3HDHA 4C6SA 5AI5A 4DA4A 5JJKA 4ENUA 2HCBA 2IXFA 1WWKA 3OCCA 3BERA 4BX2A 3VR2A 4HDKA 2OYRA 1JWLA 4OY3A 2XWSA 3CRRA 4MK4A 1V45E 3DC2A 4WRRA 1UMCA 1O0BA 3QEOA 4YC7A 1MG0A 1KKMA 1XCLA 2ETVA 2CBGA 3CR3C 2H92A 2OV8A 3PUKA 4YMTA 4REMA 2WJIA 1Y8QB 1YOVB 4Z9BA 1PWHA 1Z2CA 1GZ7A 2DPLA 3ODGA 4R2LA 4ZOAA 3EDYA 3S1AB 1C1YA 5AM3A 3FWYA 5IBPA 3W5IA 4DLLA 2QQEA 2HRDA 4BGEA 5I8WA 5GWXA 2R7MA 3E1KA 3V1KA 1RHMA 1EX6A 1V3QE 1KEPA 3E6AA 3OE7A 4B2YA 2PYDA 3MELA 4HAWA 1W88A 3LOPA 5D51S 3BIJA 2Z08A 5LU9A 3OQNA 2Q1YA 2IKSA 4OFBA 2C5HA 1HL7A 4YAFA 3PHJA 4H16A 1TPZA 4CDRA 4L85A 4WJKB 3GC6A 5K2MA 4XVUA 4HD8A 4LNUA 2IOFA 3MFYA 1MEJA 2B8JA 4TKLA 3JQEA 3TG2A 1SKYB 3BSYA 1YH3A 2YVKA 3UFXA 4WZAA 1EWKA 1U0EA 2KX7A 2P7IA 3G68A 1EUCA 1QQTA 2H63A 3EVZA 2AOXA 4KVFA 1FJGB 2WUFA 3CYFA 3JAKA 3DOJA 3L6CA 3PL5A 2ZB7A 3T1HB 3D6JA 2J6IA 1N7HA 4QOEA 3Q5DA 4F6RA 3D7MA 1R0YA 1MG5A 2AQHA 3RS0A 5A62A 1R8XA 4LGVA 5KDDA 3EWAA 5CLGA 1AVTA 1E8NA 3LGXA 2BUBA 2Q1SA 4I4TF 2QTWB 4P83A 2Z8YM 2Q9AA 2CNBA 1H05A 3G2HA 3DUFA 1DIGA 4FSXA 1CR0A 2MINA 2ALJA 1PJRA 4F4HA 2OPHA 3A6LA 4MCHA 2XYVA 4L4ZA 4HRAA 1YJXA 1UFQA 5G0SA 2YN4A 4NSNA 5CFRA 1NMSA 3WOVA 4U7FA 1HY3A 1MJ5A 1HYGA 3GOQA 1EVKA 1R8SA 3SKXA 1U1CA 1N4DA 1NF8A 3ROFA 4DJAA 3VYRB 2IBMA 3HK2A 4P0QB 5A02A 4A6XA 1Q7TA 1JW9B 1QBKC 4IFBA 4PLGA 3N5CA 4CGYA 4F3CA 2XWPA 3IE1A 3OEHA 3IBTA 3C5VA 4DSTA 1ML4A 3CVJA 3IDFA 3OI7A 3PA6A 3N3AC 5I7EA 1VPEA 4EJ2A 1Q0ZA 1A82A 1NYQA 4AWBA 5I7OA 2JAQA 3IUEA 1H9BA 1T4BA 3KZNA 3PEEA 3D8UA 3MUFA 1GNLA 1UM8A 3ILHA 3LO5A 4G01B 4H2DA 4U6QA 1E1YA 1ND5A 3EUWA 5J43A 3BH0A 1PBTA 1W2GA 4AIIA 3EIFA 3L7DA 4M8KA 4F56A 4Q15A 4AJOA 1URPA 3LDGA 3YASA 1HH4A 2VPIA 4QTYA 2ZJOA 1A7AA 3OZRA 3LUJA 1N2CE 3BMCB 1U9IC 2GD0A 3ZWWA 2HXSA 4ZZ0A 3CN7A 3ORYA 1TDJA 1MEOA 5FBLB 1LDMA 1T3SA 1A9SA 1A76A 2PX5A 2RIPA 3QUAA 3ROXA 1R8QA 3BWEA 3JQFA 2FX3A 4FB5A 3VVBA 4TRMA 1G8JA 2DQSA 3JQAA 3DSRA 4CE6A 3ONVA 5JS6A 3PP8A 3P52A 4B85A 1T6YA 3WLJA 1FFDA 4AU1A 4UU1A 3F5DA 1OYYA 3TW4A 1PK7A 3DLCA 5T57A 1XRNA 5AXCA 1BE8A 3ETLA 5ER9A 3KJIA 4C0AC 2FX2A 3DMYA 5C8YA 1K6IA 1J00A 5ESWA 3GJ3A 1U0OC 4NOMA 4R1UA 5DYYA 1YR7A 2JDID 1TRHA 2PNFA 4H7HA 1YFKA 5THQA 3IT1A 1ENPA 2XJ9A 4IDBA 1PBNA 3C3AA 5AXBA 3EA0A