2B98A

Crystal structure of an archaeal pentameric riboflavin synthase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
KKVGIVDTTFARVDMASIAIKKLKELSPNIKIIRKTVPGIKDLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYLLFKPEYLTRMAGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Riboflavin synthase
publication title Crystal Structure of an Archaeal Pentameric Riboflavin Synthase in Complex with a Substrate Analog Inhibitor: stereochemical implications
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 48
structure length 141
sequence length 141
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.9: Riboflavin synthase.
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2b98A00
2B99A 2OBXA 2A57A 1XN1A 1NQWA 2C9DA 1KZ9A 1KYVA 2B98A 1C41A 1NQXA 5IM5A 2C94A 2I0FA 1KZ4A 1T13A 2A59A 2O6HA 3MK31 1KZ6A 1ZISA 2C92A 4KQ6A 1KYXA 1DI0A 1NQUA 4J07A 1C2YA 2VI5A 5IM4A 2F59A 2A58A 2JFBA 1KYYA 2C97A 1EJBA 1HQKA 1W19A 2C9BA 1KZ1A 1NQVA 1W29A 1RVV1 3NQ41
chains in the Genus database with same CATH superfamily
1TCVA 1LQ2A 1SCBA 3D7NA 1L7EA 1SOAA 2C88A 1PSWA 1QTNA 3L6CA 3WJ7A 5EJ6A 1GGHA 2FZGA 3UMMA 3E3LA 3B12A 1P1KA 1K63A 5B1DA 1J99A 3EA5A 1OLXA 1G4UR 1R64A 3MINA 4I50F 2BDEA 4BEJA 4PHGA 4HOYA 1Z2PX 2PT7A 4UULA 1X1AA 4JLNA 2NU7A 5CT9A 5AK3A 3ZY6A 4F2HA 5C8VA 1QZTA 5DNCA 1Y6GA 5MN6A 4DCGA 5CHYA 4O1MA 2PRIA 3NMUF 5ECYA 1E2NA 1U02A 4KPEC 2EF0A 1K7EB 1XXHB 3H2JA 2B0JA 2EX0A 1KR5A 4W5HA 3V8RA 2XUAA 1OXUA 3OZTA 4AUEA 3PC6A 1FDIA 2D7CA 1K5HA 1PEDA 4OF4A 4Y2VA 3SC2B 2DEUA 2BKAA 4DM4A 3SIRA 5KYNA 3Q3CA 2FEMA 1HYQA 1RI4A 1Y63A 5D51S 2I0FA 4KI0A 5JWOA 1T13A 5IZCC 1P2BA 4UXJA 4C7OB 3DE4X 3EIWA 3CLUD 1LDBA 1XVIA 3PQ4A 3ZZTA 2WFLA 3ZGNA 3ZCSA 5JJBA 3F5MA 3KUUA 5JYCA 1K7CA 1KQOA 2I4TA 2SKDA 3BILA 3LPAA 3ZNQA 4G1EB 4UQPA 3PLRA 4RHXA 3CZAA 1OU0A 4W82A 2HOQA 3U3OA 3HFJA 1MIHA 1XZBA 2I87A 2Q4RA 1BRMA 2V9ZA 3A6EA 1H1DA 3JRWA 4LDPA 1HDEA 4J4BA 4BLWA 1Y6ZA 1JLSA 2ZRIA 2CLMB 4BY9E 1RJGA 3T7AA 2VYVA 1DC6A 2X14A 3E5NA 3O90A 3OE7D 3QHAA 4V0QA 5E1BA 5F2OA 5BWOA 3D4PA 3EZ6A 4TMWA 5JNTA 3WMRA 3G2IA 1DLJA 4JJIA 3X43A 2D0DA 1XU9A 2CBXA 3FWHA 2BMVA 2PRJA 3UJDA 1WPGA 2NZ8A 1DAPA 1SVMA 3QVUA 4U1RA 4WY5A 4I99A 4M9CA 2AOTB 2IL1A 2WC1A 3MOIA 1W48A 1VCOA 4J3FA 4BMNA 5JU6A 2QMEA 3P96A 5DKFA 4D0LB 3CVWA 4KIJA 3WWYA 4X84A 1BN7A 1PZEA 2REQB 3CGWA 3WB2A 1SQ0A 1YR6A 1XAGA 1TZMA 1XZIA 3ZWPA 5IM4F 2X4GA 3VC2A 1WW2A 4GX1A 4RY9A 3O4HA 4P4UA 1T25A 2BFWA 3G5AA 4MTCA 1QG0A 2JS7A 1U98A 4JUBA 2YWEA 3V32A 3BJRA 2NAPA 3Q3IA 3MJFA 3O93A 4QUDA 1RT9A 2V3CC 1EWTA 4G07A 4BE4A 1KDRA 3A6FA 2VQ3A 3GGSA 3KJGA 1KRXA 2AT1A 2JHPA 1BVHA 1EAYA 2CXRA 2HBYA 2QZ9A 5F9HA 1PBNA 1FP4A 2W83A 3O3MB 1CJKC 3WSWA 3AR2A 4F2GA 4BKRA 1NJSA 4ZCLA 5EESA 4LWZA 3ZU4A 5CUQA 1JRLA 1E4OA 3ZVKA 2NG1A 2ACWA 1DXOA 1Y9JA 2CFCA 2J6BA 4N18A 4MMZB 3ZXXA 2J9FA 4EF6A 2J0UB 3I4CA 3KOOA 1NQTA 3AUXA 4TTAA 1GILA 2FW6A 4MRMA 5JECA 3KXLA 3QI2A 1Z33A 4MK4A 4RU1A 3HA7A 1EA5A 5A2QA 5KINB 3VPFA 3NUGA 4RY2A 1LTHR 3INTA 2ZYIA 2WI8A 1NYRA 4G9EA 1YNOA 5DW0A 2FDXA 2GSDA 4Q3KA 1TUBA 3A2MA 3C16C 1XZKA 3DT6A 4QT0A 2IIPA 4JI0B 1N77A 4AS2A 2ZRNA 5TARA 4FWBA 4XCXA 2NO4A 5GY7A 2NO6A 4LZWA 1I1HA 4IWYA 3ZV7A 3MCZA 3WIVA 2XBUA 4P80A 1SXQA 1WVIA 1G0NA 1N5RA 1XTSA 3VKFA 4D97A 2CWDA 2NM0A 1I94B 3T1QA 5I51A 4JBIA 1W2HA 4PTYA 1UPXA 1RRKA 3AFMA 4ZRDA 4YREA 1HO3A 3ERCA 1QXSA 3CN7A 1U0RA 1SPBS 5EFZA 5T41A 3T9DA 2BP7B 2E9SA 3TTWA 1Y1KE 2WAOA 2YYAA 1U9IC 1Y1TA 4ZRMA 3KPJA 3TDKA 3UUFA 2YMLA 3V7FA 3L93A 3SLKA 4G8JA 1REQB 2Y93A 1BW9B 3RFXA 3TJMA 3T5CA 5LUAA 2GPNA 4GI1A 2H9YA 1QKKA 4BV9A 4HWKA 2J41A 1F38A 4H31A 2XGSA 4J49A 2X1VA 3UAVA 1HFKA 4K8RB 2RC6A 4QUBA 4PGMA 3HABA 1M8JA 1O3YA 1SZCA 4ZT7A 1K08A 2QMHA 2XA1A 4YWHA 5FX2A 1N7IA 2OVBA 2YINC 1ODFA 2VDOB 4L07A 1V8PA 4XKJA 3WLJA 3VPSA 4CT4B 2R2AA 2QX7A 3HXMA 3UJ3X 4CM8A 1D5CA 1ZD2P 4YDQA 3KQNA 2O0JA 4OGLA 2VXBA 3HO6A 5BVGA 1KZ1A 1A0OA 4D3XA 3Q7SA 1D09A 4RTQA 1TKAA 3K31A 1AX9A 3MWYW 3V1YA 5BNTA 2HCRA 2XKAA 4X97A 5GV8A 3NOOA 1RM0A 1JKIA 4LVNA 2E4ZA 2PKXA 2ZYAA 3MSCA 4BIIA 5IJZA 2D2IA 2FVXA 2EKQA 4R9SA 4QM7A 3V8NA 5TPWA 3KUXA 1M0SA 3MGCA 4HAOA 3U7HB 3VKHA 3OPVA 1QIGA 2G36A 1U7DA 2ZBUA 1NUQA 1YZKA 4OEHA 3IQXA 4NZZA 4COOA 1COWA 5HKLA 1IDN1 4CNBA 4GC9A 4QGBA 2XUIA 5JH7A 2IHUA 3LT2A 2D3TA 4PRYA 5ABPA 1QFYA 4X3CA 2J3HA 4RD4A 3UB2A 1KP2A 2MMGA 4UW9A 2B7BA 5HQTA 1T2FA 4WADA 2QRVB 4RYDA 1R00A 4B3IA 1DEKA 3AI2A 3ADPA 1ZIPA 3O38A 4EK9A 1ZK2A 1YQWA 5CLJA 4DB4A 3LCVB 4Y2XA 2Q3HA 1R0XA 3MUNA 3IA2A 5A4JA 4XD7D 1P39A 1E7WA 4UMFA 3GH3A 3GT7A 2ZR0A 4IHJF 2W2KB 1TT5A 4PC2A 5AXDA 3CXUA 3WG9A 4CCAA 4EYQA 4H08A 5L45A 2BC9A 2BN4A 4N3CA 4AX4A 1C7JA 1M2GA 3AEZA 3AKEA 3PS9A 4Q1BA 4YLYA 2DY1A 2GFQA 1IZ8A 1XQVA 3V46A 2XUJA 2BR3A 5GM1A 3PFNA 5IN5A 4IGKA 1JHVA 4W6ZA 4QOEA 5BSEA 1PL8A 4BKOA 1X80A 1AF4A 3HB9A 2Y1CA 3KQVA 3R5XA 5EEGA 5I4KA 2G4LA 2QGFA 2XGJA 1ID8A 5DTRA 1E32A 1GZUA 2GPTA 3SQOA 5AIBA 1CRLA 4FYKA 5AKXA 5GQSA 4RVOA 4WH0A 3GUYA 3I05A 3IQGX 1J6UA 1OC2A 1EVJA 2XAUA 2O57A 2TMKA 1JL3A 4R5HA 4F4DA 1L1EA 2B8TA 4E32A 2ZDGA 3E82A 1E18A 4WZAE 4BV3A 3ORFA 1R2QA 2JC3A 3S2IA 4ZYWA 5P8WA 1TQ4A 1WSDA 3KQUA 4OREX 4ABTA 3NNDA 1HFWA 3DHEA 4PXYA 1YQGA 3L7BA 3R5FA 1ZIDA 4Y7CA 2E4YA 2Q5HA 1N5OX 4QYWA 2C5FA 1T0JB 1P5HA 1PTJA 2PAAA 3GDHA 3ME5A 2QLJA 3RC7A 4EB8A 3DAHA 4CTNA 3M89A 2CSXA 3FHLA 2JCBA 4LDQA 5FL3A 3TF5A 2O8DB 1IJKA 4LF9B 1PDOA 4GPZA 4M86A 1P2UA 2MT9A 1KDVA 4DG8A 3THYA 2XHEA 3JQGA 4Q4LA 5FHQA 2PT9A 3MMXA 2IU6A 4WZBB 3AUFA 1OFVA 1JR2A 5F1YA 3CZRA 1ZHOA 1RYBA 1NP6A 4J16C 1Y5LA 4BB5A 4Q4HA 2JK0A 4B40A 1H69A 3PJRA 3H0EA 1FRFS 1XEFA 3NC1C 3NRJA 1Q7CA 3L0DA 4FFVA 4Q4DA 3WYDA 3QYPA 2P6OA 3L8FA 1U2ZA 1UKAA 4GGPA 4C0SA 1Q0QA 4LG1A 6ADHA 4I5DA 3RBAA 2IPXA 5FTJA 3ZD6A 2FPWA 2H6EA 1UT5A 1MA0A 5ED4A 2DLDA 1L5FA 1Z8HA 4WE3A 1TM4E 5KVQA 3SK0A 2YIMA 3TZ6A 3MS4A 4PYOA 2Q6KA 1GTVA 2DE0X 1V9LA 1HOXA 2JI4A 3MAJA 4P36A 4ZI7F 4NZPA 1KQPA 1F8UA 4CMJA 2Y0BA 1H6BA 3G85A 1SJ9A 1RZVA 5LBUA 4HLCA 2EATA 4GLBA 3MC1A 4D6YA 1JHPA 1U8ZA 3LFUA 3QBDA 1XVUA 4II3A 4Y3UA 5HKOA 1E3WB 2YFHA 1ND6A 5DNVA 1CLEA 5FI1B 2VJPA 2CJWB 2JLSA 2FZCA 4TWRA 2QGNA 4YCSA 3NKFA 2X5OA 3N6VA 4C5BA 1NRJB 2ONKA 3J81k 4FWTA 3AHFA 1Q0LA 3KS9A 1A76A 2D5LA 1MEJA 4H6XA 1WZCA 3A1FA 2IYXA 2V4MA 1JWBB 2A3NA 4CQMA 2YC4C 2AUNA 2H1CA 4N0EA 3E2MA 1TW3A 4JYAB 1QJ4A 3ZD8A 2D2VA 5FUMA 1ZH8A 3DOCA 4KQHA 1PNOA 1BCSB 2FKNA 3ZH2A 1M2NA 1CYDA 4GI2A 5H4GA 2L42A 3MM4A 5BOSA 4S05A 4OM7A 4ZYYA 1P8JA 2ZWVA 2IZ5A 3K4HA 3A3YA 1GGMA 1PG0A 3BJMA 4WIAA 4AMBA 4B6OA 3B48A 2IK8A 2LDXA 2VHEA 3WHPA 1X77A 1DARA 3Q1KA 2VXYA 2JASA 3AR9A 2B1JA 1E1QA 3IQEA 1U5CA 2PQ2A 1MEOA 3K5WA 1QIIA 3DMPA 3OUTA 5ERYA 4ZVLA 4CXMA 1YA4A 4LWQA 3E22A 3G2HA 4K05A 1OX4A 3KKMA 2AHRA 1KYZA 2R1TB 1ORRA 1YHYA 3RVSA 4MRPA 3FOCA 5JZOA 4OY3A 3P26A 1LVGA 3LW8A 1DOHA 1JAYA 4L28A 3RUCA 4FS3A 2AI2A 2G5PA 3QSGA 5EPUA 2GNPA 2PSFA 1GFWA 1H2AS 1TTPB 1OZAA 2BFOA 1C9JA 3BB4A 3HU1A 4NZYA 4QYXA 2OPHA 2BH2A 3CZ9A 1D4FA 3QYAA 4NYJQ 1SHJA 1QU3A 3GLVA 4FC6A 3PTZA 3GOQA 4X1YB 2QR2A 1MBZA 2F1RA 3IURA 2QTVA 3FLAA 3L4SO 1Z8DA 1K06A 1Y1SA 2VATA 2JW5A 5A3RA 4C7VA 4YFYA 2YQZA 4DVGA 4JNCA 5IJWA 4OKNA 4PLCA 5CDTA 4HBZA 3UC9A 1QP4A 2XB6A 3PQ8A 1U5BA 2B6HA 3M49A 2YL2A 1DC8A 3WWPA 1NVDA 5KNCD 1NMSA 3O6VA 5LP6F 1IM5A 1D1TA 1QR2A 2GCGA 1IHYA 1VBMA 1YJXA 2ZDHA 4QOIA 1TX4B 5E4TA 3RU9A 5HP4A 1NC3A 1ZEMA 1SVWA 3CUTA 3HWSA 1QRAA 2RAVA 3C5EA 5B4VA 2HWKA 2RKWA 4IKOA 5ECWA 4KWTA 4QSHA 1PK9A 1ILEA 3BTVA 1Q0SA 3DZHA 3GFPA 4QG3A 1G7CA 4HDMB 4AIRA 3ZE2B 5ES3A 1V8DA 2B5OA 2B9EA 4AMZA 1CUCA 2HEIA 1N8SA 421PA 4AFNA 5HKKA 3R40A 3H1PA 3ONVA 4LVOA 2IP1A 3O9MA 1UJNA 5MGBA 5A03A 4QXOA 2EGHA 5U4QA 4XM2A 1ST3A 1X14A 4I9NA 3IXMA 3TNFA 1Q1BA 3B38A 2ZYUX 5JZVA 4XQEA 1VPVA 1G2QA 2CDRA 3PVSA 5JMOA 3GFOA 2NTYC 4B3TB 1TGYA 1FVFA 3GFRA 3GRKA 3I23A 3FF1A 4MO2A 4QTTB 3CKMA 1V3QE 3EEYA 4NCNA 5F77A 4DLLA 4RA6B 3JASA 4CHTA 2BKLA 4ONEA 4URVR 5CYGA 1FB5A 2W22A 1PUJA 3OE1A 4LECA 4OXQA 4PBTA 2RDMA 1EGHA 4HLUC 1E2EA 4F04A 5LMZA 3L8HA 3DB1A 4KYIB 4B85A 4RL6A 1GNQA 3EYAA 3OHSX 5HMLA 1E7YA 2XH8A 3A7EA 4BB6A 1UBOS 2CEKA 5B36A 2YBEA 3P2IA 1W36B 1ZW6A 1V9CA 5JD6A 1CRPA 3EH2A 1ZSYA 4TV9A 1I33A 2WZQA 4B3GA 1N78A 5EE0A 1EAMA 1EJ0A 3QPAA 4LBWA 4L78A 1MRNA 1XX6A 2YXPX 4IIUA 3STUA 5HW0A 1GLGA 1C1XB 2GB4A 3C3WA 3GXBA 2WW8A 1AOXA 4R6WA 5K09A 3A6JA 4WXEA 4ZPJA 3GPCA 3NBQA 3PE6A 2XW6A 4N5HX 3WRWA 2AOUB 1ECJA 1K5GA 1NGSA 5HIJA 1DNPA 1K92A 1LPSA 4AN4A 2P75A 1OJLA 3L6OO 4I4IA 4IH1A 4YH1A 3SOPA 5L4SA 3EFOB 4BBPA 1D4AA 1ZGHA 4RDIA 4RTPA 1N32B 1QFXA 3H4TA 4HNSA 1MVOA 2GK6A 4RZSA 3DO8A 1UXGA 1I0IA 2VKTA 1JQKA 4PWZA 1NFRA 2G7ZA 9GPBA 4JLUA 4RDCA 1FTYA 1V8OA 1N92A 1Z17A 2BE9A 1RTKA 2Q3LA 4HNTA 3AI7A 1WO8A 1KI7A 2SCUA 4QEDA 3HDQA 4I1IA 3I6MA 2HT1A 1E0KA 3CNBA 3TLEA 1IVNA 1CEXA 1ZI8A 1B2RA 4L57A 4NARA 2WT9A 2E85A 4KW7A 3L06A 1RKQA 3AHCA 1LBSA 3C4JA 2EFHB 4TXLA 2FUKA 2ZK7A 1X9IA 5C5IA 2I1VB 3SXUA 1UODA 3PQ5A 4QU9A 5K3DA 1NA5A 2ZZMA 1XROA 4KQMA 5LCXA 3EXEB 2WJ4A 4MVJG 4QYMA 5FOUA 3EUAA 5K3FB 2ORYA 4KLZA 1S2LA 5CVTA 3S81A 3ENZA 1JIQA 3O4FA 5IDVA 1VXRA 4RPHA 3VC1A 3ZOKA 3BSSA 3LU1A 3NVDA 4UTOA 5EWMA 5ARCA 1DWPA 4KV9A 2EP8A 4NHOA 4Y0AA 2JAWA 4NJMA 4D92A 3ESZA 1CY7A 3A05A 3MSXA 1YR9A 3Q9SA 2J32A 4CF6A 1EK0A 1TOAA 2DR0A 3CH5A 5DNAA 2P4HX 5DH9A 3SFZA 1RWOA 2ETXA 1HLDA 1VJ5A 4KGZA 2RGCA 3MHPA 4Y98A 5CJJA 5CLFA 1XRLA 2WHQA 1L5ZA 4MV6A 3ZK7A 3ZDCA 5C8YA 3R8XA 1JPUA 4NOLA 4B79A 4AZ0B 1XMXA 2Y1WA 4DBLC 1LY1A 3PUWA 4WKBA 5KHLB 4P5DA 1Z68A 2Z9CA 5EVCA 1SU6A 2EERA 2PKQP 1MB4A 2ERYA 3FRHA 4EJSC 4XPIA 5HJ7A 4LXXA 4NJEA 2W6OA 1YK0A 3U17A 1R15A 3D54D 2XA9A 1T2VA 2C4WA 2VK1A 4JQSA 1WB4A 2V6IA 3MLEA 5KKCA 1TEVA 2FKAA 4Z9AA 1E0JA 3EPPA 3DEYX 3OZWA 2HJ9A 4EW6A 3KYJB 4J0FA 3L0ZA 4LFAB 1NNLA 2Q1WA 1Y80A 1VHTA 4WN9B 4WVFA 2JJYA 4KQEA 3M3PA 4F5EA 3GFQA 1WTCA 2NXEA 3OOHA 4YAKA 4EAQA 3NWJA 4HYEA 4TV8B 3UVEA 1TCBA 2JNWA 1MC4A 1QMGA 4K3UA 3SX0A 2R96A 2OSBA 1E3LA 3SDZA 3W8EA 2UZ1B 4UQOA 4F96A 3PEYA 1D9XA 3KHKA 4QAJA 4JC5A 1PR5A 4WUTA 4DR7B 1XVAA 3AEUB 4UUMA 3PEFA 3CIOA 1YKSA 5EGSA 1NVAA 2C7OA 3DV2A 3QVGB 4ZAZA 1DAKA 3KT8A 3LKZA 4K28A 2A88A 2ODWA 2W71A 3BVPA 4WLEA 4A91A 2BMWA 4DFDA 1ITZA 1WW3A 2X6QA 3M1LA 1NVUQ 2R68A 4PCUA 3D6VA 2FH5B 2Q0SA 2I7TA 1J42A 4Q6WA 2QZJA 5EJAA 1UIRA 3OF5A 4MUYA 4MS4B 4PAGA 4Z6KA 3QVMA 1Y81A 3GZJA 2HJRA 1BEUB 2FEXA 4MV3A 5F5XA 1ZVQA 4W5RA 1R27A 3PHBE 5C1DA 2LPMA 1U0LA 2Q3CA 3ABRB 3BK1A 4F2WA 1ZA1A 5DEOA 5EP1A 1PFUA 3ZY4A 4W4TA 3JATB 4KO4S 2IEBA 3N2ZB 3EUEA 2D2XA 1UMBB 2GK4A 1WMEA 3SVZA 4DNQA 4O08A 1XXLA 1EP3B 1B8OA 2AC7A 3IVCA 4PBRA 5M34A 2H5LA 3ZQKA 3ILSA 4HNQA 2EG5A 3OLQA 3SC3A 1G3UA 1I80A 3M81A 1IVYA 4AMYA 3NFRA 5B4UA 5JCOC 1ZA2A 3PQDA 2GBIA 1XPRA 2W6QA 3VJKA 4RJJA 4KK3A 3B9QA 4PZCA 3M1IA 3QHPA 4B6JA 1M0WA 4CIAA 2QTMA 5AOVA 1RJ9B 1Y1RA 3H2GA 4KX5A 1FTGA 3E9RA 2XQVA 5CA1A 1F8YA 1L3IA 2WKRA 3ANLA 4AK9A 1T6YA 5H9WA 2B4AA 3DBLB 4X7MA 1N1GA 2VBGA 5E2AA 1W2WB 4ILKA 1KORA 2FR0A 4X0EA 5FR1A 2A9RA 5C4GB 4DUZB 5HOEA 3BF7A 4YDHB 4KR9A 2CLSA 3G0BA 3B5JA 2NUAA 3H9GA 1JF8A 3WP0A 2HA7A 4BNZA 4ETWA 1EFDN 4OSOA 3B1ZA 3L7DA 3K32A 1NE7A 3QA3E 4JP3A 1SD2A 4LBYA 4RZUA 1OPXA 1WD5A 4QDXA 5L8VA 1V48A 1A5ZA 2ZZNA 4D8UA 4HEJA 1ODLA 1JVBA 2PSSA 4XVHA 1CC1S 5LFAA 1QIMA 3NHWA 4NU8X 4P81A 2H2WA 4EI9A 1Q6ZA 2JI9A 2XYVA 3PPIA 2GHTA 2ZYDA 3W2HA 3BCHA 3HVUA 2HU7A 4INAA 4JB8A 4ZHQF 3E5RA 1Z88A 1KVRA 5FUYA 3UWSA 4BVAA 5IU6A 2CFRA 1SQGA 3DULA 1XE3A 4LF8B 4A0SA 5A5GA 2CMDA 2XRYA 4M46A 1XO1A 1YAHA 1TO1E 1B1AA 1LTQA 4I66A 4W7HA 4GP7A 5BSMA 4QECA 3OPMA 2RHJA 1KVTA 2AFHA 5KAPA 3DCIA 2BGTA 3C8MA 3KJZA 4N9QA 1DG3A 1QYDA 1DQYA 2JJ1D 4RA9A 4U7FA 2Q5OA 3OLVA 3P0JA 1E0SA 3DWGA 5JH7F 2JL1A 4R69A 3OCVA 3DLPX 3OEHD 4OA8A 2QSJA 1KJNA 2IXGA 2IYWA 1HUQA 1E7QA 4H3VA 3HZZA 3IDZA 4I9GA 1JBQA 5FTNA 1T6NA 3TR6A 5CXSA 2OLEA 2A67A 1YCHA 3GDOA 5K2OA 2BFDB 3EPRA 5AO9A 1O5TA 2Y92A 1EZ4A 2HCJB 2ZTVA 3D3NA 4RGVA 3C74A 5AW5A 3VVMA 2R85A 1BDMA 1VPDA 3C3AA 2MDTA 2YRWA 1DI0A 5B6IA 3GJ7A 3RVBA 5B6JA 3BFXA 3DL0A 1KO5A 4JLAA 4CMBA 2V1UA 4EQZA 4FMCB 2BH9A 2C3UA 3H5OA 2DWCA 5H70A 4RM2A 3RIGA 2PS3A 2FB9A 3QPDA 4B0OA 5DZSA 1TAUA 5L4NA 4WCFC 1JKXA 2C2GA 3GCXA 1U63A 2UVPA 4K26A 2QVCA 1AY0A 4GGOA 3IAUA 4CM9A 1I3LA 1T1RA 2AK2A 3F9RA 5CB6A 1X7HA 2EZ9A 4ENUA 4LJRA 3BA1A 3KAQA 4GDFA 3TDNA 2Y1FA 4HP8A 4XPZA 1E79D 4H7KA 1UOQA 2XCLA 1HEYA 3ABIA 2ODTX 3JXEA 4HWGA 1NJ6A 4P4SA 4RGQA 2YV3A 1IN8A 2OYRA 3OJFA 4F1WA 2FSHA 1X15A 3ER9A 4YC7A 3HYCA 1FVXA 2JDIA 2OCXA 4HDRB 4BC0A 5C52B 4YRQA 4O25A 3TXYA 4EKDA 1AVTA 1FIUA 3BRCA 2NWQA 1J9EA 4LWPA 3K96A 2Y1XA 1JSLA 2I7XA 3LLSA 3P7MA 4IUDS 2K2WA 1S96A 3UJ7A 1SC4A 2G04A 5EIWA 1WX1A 2MINA 1R4AA 3UW3A 3O8OB 1YFJA 2BTEA 4TYWA 1GNLA 3HFRA 5FFMA 4JBNA 5KPJA 1CUFA 1QPGA 5C31A 2MWMA 1OZGA 4X20B 4YRJA 2E37A 1UEIA 3LWDA 2CZCA 2YWDA 3FZNA 3N2GB 2WM2A 3N2NA 3PFWO 1Y33E 3IXLA 4AULA 3Q6IA 4INPA 5LKRA 3IO5A 2BFCA 1W581 4PGGA 5B4TA 2PA0A 3ZGXA 1TCAA 3JYPA 3LY5A 2HADA 3RFVA 1MH1A 1HFEL 3G82C 2O4CA 5CA0A 3GLRA 3JW8A 2BKXA 5J1SB 3BWDD 1ZJ5A 1N57A 1ATIA 4C4TA 2C20A 1WU7A 3V80A 3DW1X 4JB2A 3DMTC 3SFTA 1XAHA 4R01A 1DMRA 4LE1A 3W05A 2RSLA 4IILA 3NDRA 5I3CA 1NQVA 2CXHA 3Q8WA 4HVTA 2B1QA 2X22A 1E63A 1HMYA 2C82A 5ECDA 3NIDB 1RKXA 3BG5A 1JIXA 1DIHA 3BRWA 4FE3A 2XMSA 4PYIA 2IOYA 1P18A 1PJLA 2C9DA 2XXBA 5ALSA 2PMBA 5LYJA 2AYYA 3SAJA 3DKVA 1Y0BA 2OHIA 2NUBA 1Q3TA 4FZVA 5FF9A 1N34B 2QVYX 4Z2AA 4XVCA 2X5NA 3PTAA 2G83A 1GNTA 3AJEA 3F3SA 3QBTA 1XEXA 1F9EA 1VQ1A 4HC4A 1WE2A 2HWXA 1NVVQ 3GBSA 2IEZA 3F1KA 3LVBA 3VGPA 3IPAA 4NG5A 3AJDA 1G17A 3S2EA 4MVJM 4J3JA 4TTJA 4NENA 2B21A 3RWMB 4IYRA 3EIUA 4TVOA 3IAM1 3QELA 5GONB 4OHUA 1MJGA 3GUCA 2HX1A 1NZDA 3HQ4O 5KBYA 3FCSB 3GEPA 1QYWA 3QVXA 1T1IA 2YW9A 5CFNA 4IDQA 2IH5A 4EARA 1MRZA 5REQB 4KB5A 1TLTA 2O1XA 5AJYA 4DADA 5IAOA 5KB3A 4Y18A 2WTXA 3LXMA 3I6QA 4OHPA 5TMDA 4CIWA 3IMCA 3KVOA 1Q1EA 3LW7A 4ZA2A 1LNZA 2GD1O 3PCXA 1VG9B 5I9IA 5AIAA 2JLUA 2QTHA 1F06A 3VKUA 1EFLA 4S24A 1W76A 4R16A 2ZTMA 4ZVKA 4KNWA 5EERA 1X1RA 1SVLA 1PLLA 1EFPB 1Y9EA 2PVSA 4OBEA 1KP3A 1NVMB 4Z8YA 3V1MA 2H54A 2I3GA 3DMYA 4XGRA 1OD6A 2A7QA 2JBAA 3EC2A 4HFNA 1BMTA 1Q2UA 4RF2A 1L7OA 4XVQA 5C7LO 2VK2A 3AHGA 2AN4A 3W3AA 4E11A 4URXR 5T3YA 2XUGA 2NIPA 1HNWB 1AN0A 2JEZA 3OFKA 4XUEA 1UDRA 5BYBA 3BXGA 4JXJA 4UZSA 5H1YA 2CJPA 3QFHA 3DT9A 2P9CA 3W9YA 1BFKA 2Q46A 3R7FA 5DTEA 1WAMA 1ESZA 2KX7A 2WLTA 3KBBA 3ADOA 2VRNA 4KCGA 4Y1FA 3OZXA 1GARA 3GFBA 1YZFA 2AUMA 4CLRB 1C9KA 3EULA 2QDKA 2JFWA 2QYOA 2REXB 1PT6A 4Q7LA 1CZLA 1M1NB 4CUJA 4M0FA 4S0XA 3RK0A 3RAEC 4WECA 2PUHA 2QD5A 4RW0A 3WA7A 3DXYA 1B6RA 5EGNA 2GESA 3K8QA 5FFFA 4E5YA 1ST2A 3CGGA 3IODA 1I3NA 3FD8A 3DKRA 4L9SA 4II2A 2WJAA 4M1KA 4J1TC 4TKUB 4B3HA 4QUGA 2O2HA 3ZHSA 2OO7A 2KSQA 4N4AA 3CPHA 1P9OA 1UXKA 3EZ9A 5LQDA 1HXHA 1XVVA 1Q19A 3I01M 4RMNA 1FF9A 4E94A 2Q9UA 1KVQA 1KK3A 2B4KA 3OQ1A 4NE2A 4XJVA 1KAHA 3REOA 1TJPB 1BRTA 1F9AA 4CMGA 2AZXA 3D8SA 4IGIA 3AVVA 3NVKI 1XCJA 4QUEA 4BLSA 1KMCA 1A8UA 2I7DA 2J0VA 4LHVA 4R8RA 5I9MA 5EE9A 4V0RA 4R2XA 1GQRA 3TAXA 4LDRA 3H3JA 1R1DA 3VR3D 2AW5A 3JWEA 3PX3A 2FZ4A 3UXHA 1ISRA 2QHXA 3GVCA 3HCOA 3MXOA 4TTIA 5DMXA 2IPMA 1I2MA 3TZQA 2IWRA 2V97A 3I09A 2NXCA 5A4FS 3F96A 2J33A 4EI8A 3LNTA 4DG5A 1B8NA 1EFVB 1GITA 5AUOB 1TL7C 4YRDA 1Z5VA 2VTBA 4RHCA 1KAEA 1NUSA 4QPPA 3W3AH 1D2MA 2WD8A 2X2OA 3ISVA 4ZRNA 2RHCA 3UJCA 2CT8A 4FQ5A 3OJWA 4IIHA 5GJWC 1FJGB 1N3BA 1U2GA 1BG6A 2ODNA 1YI1A 1CETA 4H6PA 4KL8S 2GX6A 1EPUA 1JIVA 4JI6B 4MRVA 1JFFA 2OILA 2QUHA 2X2PA 4KWCA 2C0PA 2QJWA 2WJPA 4L08A 1LZKA 5EXEA 1KYTA 3GPIA 3MTDA 3HKBA 4Y6PA 5K3AA 3LXUX 1UQRA 5G53C 5LQCA 4QU8A 3DWIA 1Y82A 3P9PA 3A6LA 3NIGB 2FYTA 2YWHA 2ZWMA 4UVDA 3OCCA 5LKAA 5ED0A 3IBTA 3EGXB 1BYIA 3WJ1A 2M6RA 2ZJZA 4JFAA 3GT0A 2OOSA 5LB2A 2ZWAA 2LP4Y 4JC4A 5JBQA 1D2GA 3CINA 5DU2A 4ZV7A 3D02A 2DX7A 2IYFA 3ZE0B 3NBFA 1TIBA 3BRQA 4MQBA 4H7FA 3UO8B 3ADKA 2FSIA 3WNZA 4R6XA 1H2FA 3TLXA 3GGOA 2OBMA 3GRUA 1MV5A 1UXIA 3QJ5A 1LRJA 1VJ0A 1E58A 2W8ZA 2YWXA 4TV9F 4C08A 4DHEA 2OA0A 5A0FA 3LBFA 3RUDA 1ZISA 4PAOA 2GDZA 3LHDA 4DGSA 4F7WA 4TQ9A 4ZIRB 3MG9A 1Q20A 1CRQA 2EJTA 4OYRA 4R9UC 5E0OA 3N74A 5E6SA 5ER9A 2AJDA 3ZCUA 2JGAA 5EG5A 1BS2A 3MGGA 1XUOA 5ICCA 1XMOB 2O54A 2G5TA 1Q77A 5DGDA 3L4BC 1QAMA 3ZU3A 2C5SA 1X94A 3BBPA 1BMFA 1TADA 1PYDA 1QX4A 1U7PA 4LMPA 3SNKA 3UKDA 3V1KA 3W6PA 4CGYA 4ENWA 1DKLA 3QMVA 3RS4A 1XKXA 3GLHB 3N5CA 4X61A 1P2SA 2FEAA 4DQ0A 1BVYF 1BD3A 3VTFA 3WIDA 4YNBA 4MV8A 4K8OA 4B82A 1XF1A 5ALXA 2FXIA 1QH9A 1U2RA 2DR2A 3ZXSA 3OIGA 2QYHA 3R6WA 4FFSA 2VPIA 3C3XA 1HOTA 1U0NA 2QBYB 1JMYA 5JDIA 2D5AA 1FU8A 3NB0A 4HYQA 2WYIA 1XAIA 1G5TA 1Z0SA 4E7PA 1RPJA 3BIJA 2XDAA 3BF8A 4ITUA 2NUTB 4P0QB 1WEKA 3O0TA 2XI4A 3FUVA 5G1NA 5ANRB 5EIBD 3R0ZA 3L7JA 1LNQA 3EB9A 4Z3DA 1KMQA 1VSQA 2M6KA 5F7XA 3OOJA 3FGNA 3ROZA 5K20A 1ADJA 1C3OA 3MRSA 1ULTA 1UPBA 2NO9A 2WHEA 3UV7A 2R1ZA 4FW9A 4DA8A 1XPOA 2WOOA 1VGQA 2RHLA 3FLBA 4MA0A 1G6Q1 4N49A 4NH0A 3DXFA 3IA7A 3RAPR 4ATNA 1AK2A 5TE9A 2HA3A 4PZLA 2E4WA 3MUOA 1L1FA 4O3MA 1L5RA 2JB9A 2R8XA 4IUBS 4F45A 4H7JA 4J75A 4RLFA 1W4CA 4I3FA 4IBOA 3MB8A 3FMIA 2OXCA 4FNMA 1VL0A 3R7LA 4V2UA 2DPXA 2I4NA 3VJRA 3SY8A 1RC8A 4JHLA 2BUAA 3ICEA 4RSGA 4JXXA 4LZOA 1IY8A 1IHOA 1LPAB 3F1LA 4NU0A 2NPFA 2P3OA 2GO7A 2B99A 1N2ZA 1TJYA 2B4TO 3EXG2 1OKKA 4DMRA 1DOAA 1V7QA 4MW4A 2DBQA 4TZTA 4P58A 5C8YF 3FPBA 5EJIA 2B3TA 4ZFNA 1JHZA 2OP1A 1LWOA 3ZU2A 2B7LA 2G82A 2XVZA 5C2JB 4P82A 1NF9A 3AW8A 2A1IA 3FKSD 3KTAB 1DEHA 3N5KA 3C3MA 4XSHA 3J81A 3CF4G 1X7YB 2JG3A 3V7NA 1G2OA 1RFLA 3VYWA 5HXAA 5EKTA 2ZTUA 3JQ8B 1IY9A 1BX3A 2J5BA 1AN9A 3AL2A 5KUTA 1Q0TA 5H68A 4OTZA 3EAQA 2B34A 3NHPA 5LU9A 5KX5B 3P9ZA 3TPZA 4P7FA 5LBIA 3NHYA 1SCUA 3MF4A 1FFXB 4FLEA 3QVKA 3TDMA 1XMPA 4EGQA 3ZLJA 4JIMA 1I4EB 1YR8A 2H07A 3O95A 4FGSA 4DNFA 2YVUA 1EFHA 3T9EA 1ZCBA 3F6BX 1XA0A 2C2WA 5ALMA 2O0HA 3PNYA 4H7PA 1WNFA 4R2KA 3WZ2A 4NFLA 5AM0A 4RE6A 3OICA 2PFGA 3QFFA 4GP6A 3T7JA 3ZDYB 2OAEA 4URHA 4JD5A 3AETB 2NYRA 1DAFA 3UWDA 4KJZA 3DOHA 4X94A 1H2RS 3CLRC 3CW2A 1J0XO 1CVLA 3PVZA 4R31A 4M8KA 1RM3A 4A0FA 1AS2A 1V6AA 4TRJA 3ZY5A 5GVSA 2VTVA 2G06A 3AV0B 4IOKA 2HJWA 2VYFA 3I28A 1PWYE 5H02A 5ADWA 2FY8A 1I6LA 2VWHA 3D1VA 3FNHA 4OIFA 5L7YA 4TN5A 2CHFA 3OOEA 3X1WA 1PT8A 1M1YA 5HX7A 4YO7A 3LYAA 5FWNA 2CN1A 1OBOA 5CBPB 1M0TA 3OQPA 4P8RA 1YVDA 2BPOA 3ITDA 3T9AA 3PFBA 3SMVA 3ZCTA 4BIMA 2Z3VA 3EGDB 5KVAA 3L18A 2D2EA 1FEZA 5CCXA 4ARUA 1NBMD 3DDWA 1Y42X 3VGJA 4HUTA 1FRVA 1S01A 3I2FA 4GYWA 2BFEB 4X60A 3RWOA 1YUMA 1NBME 2V5VA 1U7TA 4F8YA 1U2DC 3WDLA 4UAGA 3AKYA 3FSEA 1CVRA 3LOPA 4MKHA 2JGKA 3U3KA 4MWBA 3EN0A 1I6MA 3GW8A 3VOSA 2G9ZA 3VPGA 1SBCA 2Q6OA 1WPXA 3FJOA 3UCXA 3RJ5A 3I30X 1R9NA 3DTVA 4LTNA 2A84A 5IK2A 4EHDA 5LQUA 3RJTA 1JXQA 1Z5PA 4BNUA 3K1AA 1XMVA 1V35A 1N8NA 3O8DA 3ZBQA 1G63A 4JYMA 4RK0A 1DBVO 4W9RA 1RSZA 4NBLA 1W7AA 1P7CA 5CG1A 5CA1F 2XD4A 4F9EA 1I7NA 4PG4A 1BA3A 3AXSA 3UOAB 4FYXA 2YICA 4D4KA 3TW8B 1JU4A 2ZUVA 3F47A 3CLKA 1NJGA 4TUYB 4QU0A 1J2UA 5EZYF 2IFTA 3EMVA 2W2NA 3DV9A 3DZJA 4DNPA 3GZNB 4PSAA 3Q85A 4FKZA 1MB2A 1AUPA 4FR5A 1OH8A 2KJQA 4V2IA 1UKBA 1RYZA 2MU1A 4L5AA 5LWQA 3QKIA 1JLMA 2VSOA 5KTYA 1XDBA 1UM8A 4RM3A 1BZYA 1FP1D 2PJZA 1USWA 1EUDA 1OX5A 1TXGA 3AT1A 3DV0B 2Y2VA 4XUGB 5IT0A 2AOWA 4M8LA 2YCBA 2VQSA 1U1EA 1YS4A 2GN8A 5DYIA 3L5OA 3A2KA 2OAP1 2VP0A 2WIBA 3ZI0A 2XXJA 3LLCA 4AF6A 1YK1A 3TQSA 4OUDB 2GCNA 4RY0A 1CZUA 1V1MA 5BN3B 2WABA 1U7XA 4WLOA 1DINA 1ADCA 2X8WA 4R8MA 4U2KA 3DZFA 1KJQA 3TFWA 3TQFA 4D2IA 4MP8A 3A1TA 1CUDA 5CTAA 3SXJA 1JG2A 1K7YA 2Y6UA 2AE2A 2VHCA 2BRUA 3NV7A 2YRFA 4QDOA 4Q18A 2XF8A 1X1TA 3JQRA 2Y0DA 5A06A 3K5HA 2VUTA 4IINA 4I50B 1VPLA 3DHVA 2B94A 3I83A 4KVAA 1G20E 2F62A 4KQKA 5AQEA 2IV3A 3TKLA 2R7LA 5LD2B 4Z4FA 1UDCA 5A62A 2PZJA 2AD1A 2QN6A 3E9NA 4Q3EA 3W5CA 1Y9DA 1JHUA 4XA8A 1Y3FE 3FJ1A 3OZUA 1WZNA 4AVYA 1VRVA 1VRWA 4FGLA 3V48A 5FV4A 6CHYA 4PS0A 5KOHB 3RVMA 4TYNA 2XWQA 2P0YA 2XKJE 4G63A 2X9NA 2PZKA 2OO5C 2R97A 1SA0B 3EXHB 2WIJA 4DRXB 4LPSA 4OP3A 4IPTA 2DHQA 4BNKA 1AT1A 1PL7A 2V9CA 3FJYA 1GVNB 2NO7A 2IJGX 3ROEA 2JANA 1B4DA 1KY5A 1L7VC 2QAGB 3JYQA 1ZOIA 4XARA 1AIPA 4GF5A 1L4MA 2FOLA 2J5RA 2B36A 5JATA 4MWZA 6LDHA 5DYWA 5TPZD 4UEQA 3F8WA 3PUKA 3HPQA 3NHAA 4H0CA 3ONFA 4DR2B 3FIUA 4X1KA 5TQ2A 5BSGA 1NU8A 2X0DA 3TLBA 2FTKE 4ICIA 2LTAA 2YWGA 1TA9A 1TYCA 2CLFB 4BRUA 2O5CA 4E2YA 3IIEA 1SOVA 2WWFA 2CL7X 4PSDA 3E1KA 3PDCA 5K6AC 3PEEA 4MR7A 1CS4C 2BRUC 3X1MA 5L3ZA 3GT3A 3U9SA 4IJ6A 5EKSA 3PNVA 3EGVA 4CM7A 2Z6AA 4WI1A 2ES4A 3I9V1 3BAZA 4WZ6A 5ALVA 5BPHA 1ZN7A 5CPFA 3EGCA 1IEQA 3N9IA 4S1OA 1A8IA 4HGOA 5BWBA 2JFNA 4O4JF 1M72A 4UM5A 2EW2A 2IGBA 2AG0A 2GPAA 1VLLA 5DSTA 4Q48A 2EKDA 1E2LA 3CZQA 3OY7A 4PRLA 2EKZA 5ELXA 2PX5A 4Y2QA 3DAOA 4DC1A 3K1JA 4CKWB 1ZOSA 3IVAA 3NGMA 5SY6A 1TZCA 3A28A 3W34A 4V0SA 2E49A 2Q45A 3JU3A 3LCMA 3QNMA 2AG1A 2IYYA 2JH9A 4PYNA 2YNMD 1PVDA 3LE8A 1YVRA 4QDJA 2IA5A 4V1CB 2O8EB 2GAAA 1RM4A 2PGAA 2W4IA 3QMMA 1Y8QA 5F9MA 1W0KA 1J90A 1YULA 1DBIA 2ZOSA 5CA0F 3V2GA 1FDUA 4J6FA 4C9BA 3HB1A 2FWIA 4LW8A 4D3DA 5DLYA 2BGLA 2DPMA 1SUBA 3EISA 4A0RA 4ID3A 5DXJA 2GXUA 1XK7A 3OMWA 2XSZD 2EWVA 1XNGA 3K70D 2FPRA 2SKCA 3C6KA 2HN9A 3HMKA 4BB9A 4RDXA 2WWYA 2ORVA 3IUQA 3D3JA 2DAPA 1O5OA 3RRZA 2JIRA 1TI7A 2A9KA 3FVTA 4QOFA 4Q7QA 1QJCA 4AYWA 3SJZA 1NVWQ 4JSTA 3LUKA 4K2HA 5JZMA 4HMOA 1MR3F 2XZPA 5K8VA 7ABPA 2KI5A 2AA3A 4D9NA 1Z0AA 2C77A 2I9PA 4OBXA 4LDJA 1CLUA 2DFDA 4OK6A 3WY9A 4BQQA 5KTNA 4EG1A 1MO2A 2NACA 2V4UA 3UAZA 2P1DA 2YYYA 3BMQB 3BXXA 1ZMOA 3I76A 1WMAA 3K6RA 5B64A 3FBGA 2PGNA 3KRTA 3V3KA 4ETMA 1B2LA 3L0SA 4Z3KA 3NLLA 3W7BA 5IC4A 3SVLA 1F6WA 1G6KA 1YUNA 2APJA 4Y9DA 1JWLA 2FMXA 1GZDA 3KIPA 3CVYA 3WGGA 4KVGA 4F9GA 2QMZA 1WP9A 5TGZA 1QVVA 4PC6A 1J9GA 3O8NA 4HATA 5ALGA 3UF0A 2KW5A 4MWOA 4ZOQI 3HTXA 3VI4B 1DC5A 2WDPA 4E5PA 4L6CA 4GPIB 3KSUA 5L3QB 1KRWA 3EZYA 4GP9A 3NTOA 4DWOA 2ZVPX 1UDWA 2P2GA 1T8SA 4IDNA 1T4CB 3SNHA 2JGDA 3WB0A 2ZUDA 2O5EA 3RFFA 3WYBA 4L8FA 4KE6A 4DCTA 4TMKA 5BN1A 2VA8A 1AQ6A 3FI9A 3LPNA 3TE6A 2EFCB 1XMQB 1ORVA 1PNQA 1VMDA 4E03A 5JAIA 3LDFA 2F55A 4G0VA 2FU5C 3OX4A 1Q1NA 3JQAD 3UGTA 3BT7A 3CRW1 2IYEA 1KBZA 1XGKA 1L5QA 3U4DA 3CFYA 2OLKA 1YC2A 1T9CA 3MBKA 5KWIA 3PP8A 3ABSB 4JOSA 5TLSA 2GN1A 1SVSA 1Q22A 3IRVA 1CUEA 1F2TA 2CLHB 2OAGA 1ZR4A 1CU1A 3UHFA 3VR0A 3VYTB 1V9SA 4RL4A 4YAOA 1QHHB 4KOEC 1JFVA 2BELA 3CNEA 5MF6A 1ZC4A 4OJQA 2DTEA 4NRDA 5BV7A 5A9SA 5AHKA 1G8SA 4TLMB 4QJ4A 4RZXA 1CDOA 1GPJA 4BQIA 1HLGA 4KUHA 1A5SB 4GLOA 5DSZA 1V6SA 5LZ8A 4PFKA 1C0IA 3GZTB 4RTJA 1NMYA 1S3IA 4WACA 3KQQA 1AU9A 4LZZA 4F6RB 1DTWA 4P35A 1NW6A 1MIOA 2P9YA 3VU8A 3WBBA 1FRZA 1H1LB 4GX2A 1VHJA 2CXNA 4QEKA 3RLIA 4CKEA 1OWNA 2XCSB 5FHRA 4US2R 1Z9BA 1QS0B 3R3ZA 2FR8C 1P60A 4URZR 2G88A 3SXPA 1GQFA 3T5TA 1IUPA 4K9MA 3PLAE 3P45A 3CSSA 3QF4B 1LEHA 3DL7A 2YR0A 3QE2A 4LXUA 5KYVA 5THXA 3R7AA 2YJ6A 3R5SA 1XTKA 4WNAB 3WMXA 1IZ0A 2DLNA 4AYTA 4ZJZA 3L4JA 3DONA 3U4QB 3EA0A 1H2HA 5JJIA 2K5UA 1L9XA 4HGQA 5AHWA 2JKZA 4B4DA 1N0VC 3MCAA 1AKEA 1Z3CA 2FPUA 2CBGA 4NJOA 4KXXA 3Q87B 1Y3IA 3CONA 4O63O 4P0TA 5ENZA 1Z0FA 4DCJA 4B4UA 3CLTC 3NC4A 2QQ5A 4DLKA 2WJ3A 4G8BA 1V95A 1ZQ1A 4XWOA 2PUFA 5KZMB 4TMYA 4NPAA 4KG7A 4OUKX 1EP2B 2XGOA 1TK2A 5AWFC 3P0IA 1Z0UA 3GRYA 1SXHA 1PZFA 4TS4A 4ABYA 4FKMA 3ZQ6A 4EP1A 1PE0A 1X7ZA 2FXVA 5A3SA 4X6XA 2DQ4A 4YLGA 1UC9A 3W6NA 3ETJA 2OHJA 2RH8A 1DKRA 1F0KA 1Q95A 3C43A 1DIBA 1EX6A 3VC3A 2HD4A 1M5RA 3EIEA 1UWKA 4ZVQA 4JB3A 2QX6A 4EG7A 1B14A 3GUVA 5D01A 2LE0A 2PX8A 2B37A 1CQIB 2ZRGA 1P6UA 3KTOA 4MLPA 5JMPA 4WFJA 3RHFA 1J21A 3U3DA 3VR4H 1XU4A 2VLIA 1YJAA 1EK6A 4F97A 5JI3E 2VFAA 3QWFA 4HQKA 2EKPA 2B6NA 4B3RB 4BXOB 1PD0A 4MWGA 3AIMA 4MIEA 4L76A 1R8YA 2VG8A 4NX2A 1K9SA 1GD1O 2VYND 1JLLB 1GG9A 5ALEA 5J4YA 1S1CA 3V5NA 3FRIA 2JJQA 4UU1A 2M2IA 3LVRE 3GK3A 1S8NA 3VU3A 3EIQA 4HFRA 4W7IA 2Q0HA 3ROQA 1KHTA 3WLAA 1DWUA 2O8VA 4D5GA 1XA4A 4PGAA 2GGSA 3UWPA 3X1YA 4LZLA 5CX1B 1IUKA 2JHGA 4OIMA 3WNDA 1PQUA 3ONNA 4OI0A 1H2WA 2GZ3A 2X0RA 4B8ZA 1QGYA 3E4CA 3E3MA 1YUBA 3W78A 3CU5A 1JSXA 2AN9A 4OHKA 1UPTA 1YL5A 3ENKA 1NSTA 4EIWA 1PVOA 1BQEA 4ZAYA 1BHJA 3ZHYA 1XXHE 4BFCA 1EXDA 4G4IA 3IBCA 3TGWA 3WL6A 2D1QA 4YRSA 4ZMSA 1G66A 1KSFX 2G28A 3EXAA 4ZI7B 4JUCA 3D7RA 3JQ7A 5ILGA 1S4QA 1G5FA 3LRPA 4WL0A 5AOBA 3SEAA 2BGNA 5BQFA 5JZSA 3EUFA 4LOKA 2QSYA 1AXGA 3LQ1A 2YJ5A 1AZWA 3G0IA 4GOLD 3ADDA 4KREA 1VE1A 1RXCA 1W47A 3HDJA 1O94D 5DVZA 1WY7A 3AUTA 1M9NA 2ZLBA 1L8LA 3KEMA 3VJMA 1DRVA 4DQDA 3EXFA 4JIGA 4Q15A 4M7RA 3EJ6A 4JWTA 5CD9A 5LQAA 1F7UA 4J29A 1W4AA 3ZX5A 1KDTA 3ETHA 2E4UA 2BBWA 1T4BA 2LRHA 3NWPA 2LDBA 1LBQA 2RB5A 3AVTA 1ZM3A 1B74A 2QE7D 4CKYA 1K1EA 3QIVA 4J2OA 3VAZA 1PR4A 4B3FX 4GVXA 3SJBA 2JFOA 2N9UA 2ZRMA 3CZMA 2JRLA 4HZUB 4K40A 5FBQB 3WIBA 4KTTE 2RJNA 1FP6A 5CH8A 2QAIA 1RJDA 1UBMS 3O74A 3K9NA 3Q2IA 3TSOA 4OU5A 4JR2A 2DFKB 3AUKA 2Y66A 3P0RA 4C4RA 5M04A 1BVUA 2BF7A 1CW2B 4KBGA 1QIHA 3RCBA 2HMVA 1A5BB 3OT1B 1LV8A 4R84A 3SG0A 4R8KA 3H4IA 1W9MA 4RTRA 3H7AA 4EZEA 1UK6A 1X1BA 4A16A 3M6LA 2RGWA 3MJEA 2B8WA 4A5OA 1NY6A 1K66A 1PD1A 4CMIA 2GS9A 3LHSA 4BLTA 3C1UA 3L1JA 4U6QA 1CQZA 2R1UA 1DO8A 1VA5A 5LB4A 4D25A 3D6MA 2PEZA 3D3EA 2OD9A 2BI4A 2ZG6A 4G4SO 3CQ9A 4JK3A 4G85A 5HTOA 1DUSA 2PKRA 2ZIXA 3BE4A 3IQFA 1RQ2A 3T94A 5DXAA 2ZM6B 1VOTA 3N05A 1TK9A 1WF6A 1U2EA 2F3UA 2H4HA 4CDMA 1VP9A 4YALA 4PINA 4X92A 5IAGA 3ICWA 2EP7A 3NHSA 3WTBA 4TKVA 3RYFA 2CYCA 4MI9A 4JI7B 1NDQA 1G5RA 4W63A 4JQCA 1X3SA 2PAFA 2Y1EA 3LL4A 2NU8B 1PZMA 4XIIA 3JQFC 4V0LA 4B81A 5IUJC 3LUCA 3RTBA 5F7JA 4LYDA 5EMNA 3EIFA 3FDIA 2H8KA 1G8FA 1E1RD 4HD8A 3NT2A 2WTNA 4JJAA 2BFBA 4LDNA 1LH0A 1UFQA 2XQFA 4RMJA 3ZBUA 4CM4A 2VR1A 2ZBRA 4EL0A 5LP6B 4DQXA 1J0DA 3SYMA 1CR4A 3T1TA 2CUZA 3RVOA 1DFIA 1US8B 4V3BA 4LXGA 4QRIA 2JZOA 2V5AA 4HEQA 1LBTA 2QK4A 2WYOA 3KKPA 1L5MA 2KB0A 4R9NA 4JI1B 4EX6A 3F8TA 2QUJA 3T4UA 1AKMA 3C15C 3W9SA 3SYKA 3G9QA 1TMGE 1BNCA 1JB9A 3PJDA 3V2IA 4XASA 3RH0A 4NL4H 4AJ2A 1XL0A 5EZSA 2G0AA 1OYYA 1W5TA 3KQMA 2XJ4A 1N5MA 3LKDA 1MW9X 1NXPA 1U1IA 3BZWA 3IULA 3T1VA 4B76A 3E84A 1U2QA 4KO8A 2DR3A 2HR1A 5EJ7A 1VLMA 3IEUA 5T57A 3ZDDA 3DEHA 4R1LA 2PJRA 4IJ5A 4NAHA 5ALTA 2JAUA 4IY1A 1ZX1A 1ARZA 4PQRA 5DOZA 4J3NA 3T6KA 1DG1G 5DHTA 5EE5B 1NT2A 3FY4A 1UC4B 1J22A 3B6ZA 3CX7A 1GQSA 2Q49A 2R62A 4N8SA 2GXQA 3SLGA 5E3HA 1ZNWA 1XXHA 4FGWA 1NW8A 2OP0A 1ZXXA 4KSCA 4YAIA 2WFZA 5AI0A 2CYBA 2EAUA 3KKQA 1X1SA 4UUOA 4WY8A 1HC7A 1ICIA 1J97A 1RLMA 4EKYA 3WAGA 1QE0A 1P31A 2Z95A 5SYMA 1FUKA 3LCCA 5EUQB 3S40A 5IEJA 3SC2A 2XHZA 3FFWA 2P2DA 4D9CA 4BN4A 1KI4A 2H08A 2WP0A 2ZJAA 3WL4A 4S04A 4YHHB 5BRNA 3THSA 4TTQA 3VR5D 4C7OA 3UXYA 1O4WA 1QK3A 3EEBA 1ID1A 2YJ4A 1V1JA 3BJEA 3RYHB 4L9RA 3DTYA 5TMPA 4HGRA 4X3PA 3QG1A 4N3BA 5FPQA 3PE4A 4IWNA 5KYXB 2JFGA 3M2TA 1KJJA 5DP1A 2HI0A 4C76A 3NWOA 4U5XA 3UWMA 1D6NA 1N1EA 3GCWA 1GTL1 4J7AA 4M4SA 2ACKA 2GJ4A 2HSDA 2XUDA 1GTG1 3OLCX 5H82A 3TTUA 5G02A 4BLPA 4ZCIA 4G5QA 1HURA 3T5BA 3DB2A 1XPUA 2V8BA 2QD2A 2BM0A 4UTRA 2ACEA 4RSHA 1P0FA 4HSEA 3PEWA 4PPFA 2II6A 1NQUA 1OUMA 1UAYA 5BWCA 7REQB 4K46A 2AI1A 2H1VA 4UBNA 1TVEA 1B6GA 1YASA 4ZYXA 3OM1A 3GGDA 3QV1A 2XRMA 2AOTA 2UZIR 3ZIDA 3KKKA 3JAWB 3MYYA 3D2BA 4MUHA 1U28A 4LQLA 1RFGE 3GWGA 2J85A 1AK1A 3MINB 2Z08A 3DHWC 2I7CA 2REQA 3D4NA 1URPA 1Y48E 5DBOA 4IDAA 2GZAA 4D9JA 2ZJ4A 3V2HA 2GEUA 1JMKC 4MS3B 2AMYA 1XA3A 4X8OA 4PCLA 2R66A 2VDWB 2JBWA 3G6KA 3KR2A 1GWNA 4KTVE 2XNDA 3LH5A 3IB3A 1LW6E 1RQGA 3GIDA 5DWDA 5H3LA 2OYCA 3TR5A 3KSAC 4NV0A 4RXMA 1AUQA 1Q84A 1QLHA 3PPXA 4POOA 2B1GA 5LOVA 4YLEA 2YV2A 2QU8A 4CFZA 3E4DA 1OW3B 3CSUA 1I2AA 2XUFA 3ZK9A 4ZVOA 3LKVA 1X1DA 3LZ6A 3AV3A 4G0WA 4YDSA 2HSJA 3SQNA 2J0UA 4K9SA 4NEHB 5I5GA 1GNVA 4EGSA 3HZOA 1C7ZA 3CKYA 4NBWA 1YDWA 3ZCPA 1MOSA 1C50A 3OOYA 2H2FA 4N7BA 1OGIA 4U63A 4BEVA 1YU9A 4CKBB 5DLQC 1RS0A 4RHEA 3SQMA 3ZJUA 3A6PC 4FQ7A 2R6R1 4KLCA 2I54A 4FFBB 1XZCA 4DMKA 1ZRMA 1O2DA 4EELA 5HIMA 4J1NA 4ZVNA 1Z75A 3TD9A 3NORA 1P73A 2R84A 1DKOA 2WY2D 1MA3A 2FWRA 3F5SA 1EWVA 3IXQA 4IQGA 4J7XA 4OK3A 5AVQA 5LQMA 2CY0A 3ASVA 3E15A 4HTFB 3GELA 1JG6A 4J6EA 4HQNA 5HA5A 3FHOA 3ZWWA 4BGIA 4D8WA 1R0BA 2RI1A 4EYEA 3HBAA 2BIFA 1UINA 1KGSA 2QVZX 3NKVA 3NYRA 3PL1A 4WZBE 2DWOA 5IABA 2PMEA 3E1GA 4INOA 5C1IA 1Z62A 3NALA 3JRNA 3ZCQA 1NYQA 3RT1A 3H5IA 2BP7A 1MU0A 1K4YA 5DCWA 2PY6A 3UPUA 2X8AA 3JALB 1KFKB 2CL6X 2IS4A 3OU2A 4H4EA 1OBFO 2WJZB 3BK7A 2ZXEA 4C7BA 1BW9A 3P2MA 2P3QA 1Z12A 3AR8A 2NU6B 3P5BA 4GFDA 3KKZA 5EE3A 3G2LA 5L51A 2P6RA 1GUAA 5AW3A 5JLJA 5AKYA 3RADC 2OFWA 4WK6A 1O0CA 2Q5EA 2ZIZA 3IAXA 4JI5B 3IUJA 2JI8A 1WHTB 1KF0A 1CIJA 3IP7A 4ND1A 1BROA 1E99A 2O0MA 4AN1A 1P0PA 1EX7A 2X58A 2Y77A 1UT8A 1WUYA 2VBIA 3BMNB 1NLZA 2NSJA 2UYHA 2C98A 1E3TA 1RKBA 1Y9ZA 1BU5A 3P4XA 4PWYA 4J43A 3WMEA 3E5HA 1MLDA 3QP9A 1SB8A 3G0CA 3HCRA 2R60A 1R6UA 2B4YA 2OHHA 4GM4A 4BQFA 1AB6A 2OHVA 3DD1A 4I4TF 2J9FB 2XOKA 3AIKA 3ASYA 5JCJA 1QKJA 3ABQB 3MPOA 4UXIA 2CKMA 1NASA 1J2JA 1RHQA 3N8IA 4X24A 4YV0A 1EIZA 1XP8A 2D54A 2GHQA 3UG6A 2PMWB 3U44B 3FCOA 4TSKA 1DTEA 1H05A 2RGXA 4G81A 3ZEAA 4NULA 1C8VB 5HPYB 5AK0A 5EXPA 4IDCA 3IDOA 2ZBQA 1UADA 1JJBA 2C0CA 3QE4A 1CR2A 4S1WA 4CF4A 5E6UB 5JXWA 3RGWS 4A8HA 4Y2UA 2P27A 4ZOBA 3SC6A 2HLPA 4DJDC 3SS7X 3ZXIA 5HCIA 2YY5A 1DZIA 4AXXA 1JTEA 4NPCA 4TTRA 4RELA 3KOMA 3H5VA 3HP1A 2QIOA 3DEAA 1I51A 1NQWA 2JATA 2QQ0A 1CXZA 2ZFUA 4FX5A 5DV9A 2X8BA 2QRVA 3ONWA 4NBVA 4S1TA 3DVLA 2W2XA 3KUKA 1YRQA 2NVOA 2ZB2A 3HKDB 8GPBA 2Z57A 1OZHA 3NT5A 4R1PA 4LMBA 4EFKA 4JX9A 5JSHA 5EWLB 2OFPA 5TS3A 1GL9B 1XZHA 3E9ZA 3IE2A 4B34A 2JJ2A 2W2KA 4YONB 3V7WA 2R6DA 2NVWA 3OEED 3W7VA 3Q3HA 3U19A 2I33A 4JJ7A 2ZSUA 3EVAA 4F8JA 1PZXA 3H9QA 1DBRA 5J23A 3FHTA 1G21B 1ZOOA 1G55A 3B1XA 4C7MA 4PG8A 1MPTA 4DM7A 4P3XA 2WHXA 4EJMA 4Q3BA 3T0GA 4TXJA 3ZVLA 4EW1A 3EFEA 1H9CA 3AKDA 1IC6A 4QZVA 3N2LA 2ZBFA 4RD0A 2PX0A 2WICA 4GOND 1KK0A 4WKPA 2CJXA 4C5AA 3DF7A 4L5CA 4OKSA 1QTIA 3O26A 3PUZA 1EXWA 5D2CA 4AKEA 1IYZA 1Z5OA 2H1RA 4OQQA 1OY1A 5C35A 5JOQA 1NOJA 3R3UA 4Y6GB 4ZALA 5I7SA 1E3MA 2HGSA 2VHUA 4RPIA 1AGYA 3HY3A 3VH1A 4NZOA 4X41A 5CVVA 2AZ4A 4EGAA 4ZHQB 2Q5QA 4P4TA 4F5WA 3L6EA 4LGMA 4DR6B 3CF6R 4FX2A 4LYEA 1YZ3A 4HGNA 4YB8A 4AWXA 3PDIB 5DN6D 1ZVVA 2I1WA 5JQGF 1HSZA 1H8EA 3G9ZA 5TPWB 2YKGA 2XDYA 2X0JA 3K9QO 1KPHA 1SUIA 3K9CA 5FP0A 2QVXX 1Z5UA 3H99A 4YP9A 4DG9A 1VMAA 3OFJA 1II8A 2OVFA 1KEEB 2QTGA 3USES 2PMKA 3HRKA 2FWBA 3OMLA 4FOOA 2O8DA 1L2TA 3W4IA 2P8JA 5JH7B 1U1CA 3HDTA 4JJEA 1N3IA 4JDUA 1UF9A 2YXLA 4AP6A 4ZEMA 3A3PA 3WNQA 1J7KA 1U94A 2EQBA 4ZDIA 3Q9NA 3TRJA 2VPXA 5JANA 1HQCA 2IOHA 1SKUA 1V16A 2EQAA 4NCXA 3PRHA 4XFKA 3M4JA 2DBVO 3KB8A 4FGZA 1K4MA 3DH0A 3HB4X 4A6EA 4B74A 5H83A 6ABPA 1SUFA 1T9GR 5CAEB 1IMJA 1NRWA 3VR6D 3EPHA 4LQDA 2P90A 1IJEA 2XDQB 3IT1A 4L3WA 3EASA 3CJRA 4P3KA 4RVUA 1D2AA 1S3GA 2Z30A 2ZIUB 2PRKA 1T8YA 2FAXA 2X19A 3R5KA 4LJ5A 1CJBA 4O59O 3FPSA 1H65A 3K1TA 4O4LF 4TTPA 5TV2A 3UFXB 3W90A 4L51A 1OLSA 4BAGA 5CCBA 1T43A 3FTNA 1Z36A 2WSSA 3OCZA 4UDXX 4D7AA 1ZMXA 4N0PA 3UQYS 1ADFA 2VF5X 3IHTA 5G3ZA 3GH1A 3LP5A 1ESEA 2XQKA 1XRRA 4RBNA 1WHSB 4UUQA 2Q5LA 3MWDB 1NXOA 5EAIA 1ZWLA 2OYSA 3SGLA 5LIRA 1Z0IA 2F67A 1CUGA 1E3WA 1U65A 1L8XA 2IUFA 4I1UA 5ENDA 3V6LA 4ZI3A 1U1GA 2A0WA 2CJWA 1UBCA 2JD0A 1G18A 2HSZA 1C1DB 1N2JA 2PLWA 3JTMA 2W2QA 4X71A 4HS4A 1XL1A 1G98A 3TX6A 3ZOZA 1CK4A 5T4FA 2FF5A 3HUDA 4INJA 1ZG3A 1TEXA 4GH5A 5HIKA 1GIAA 3I92A 2EZTA 2B61A 2TMGA 3Q7IA 3WBFA 2J87A 3OTWA 1RXEA 4IIFA 4MUEA 2CNOA 1OWLA 1TT7A 1UZMA 4UM8B 3G89A 2I9KA 3FHCB 5H80A 1J1ZA 3WKAA 4QRHA 3ASZA 1BCSA 2IP4A 1Z4LA 1F3LA 3DG9A 5EP4A 2PRYA 1EWYA 3B9PA 3THYB 3PENA 1W2GA 4QPDA 1FDOA 3MW8A 3T3IA 1SK8A 4KQXA 5AM2A 3QEAZ 1AHNA 2RGYA 3QUSA 2J9XB 3B1WA 3KHTA 3L77A 3CKLA 4NFYA 5CYFA 1RLUA 4XIFA 4E5MA 2H7YA 3K6KA 3UY4A 2QKYA 1VE5A 1IWPB 1F5SA 1YACA 2WSIA 3IOYA 1ZITA 3QLJA 5JPIA 3W5DA 1UZAA 2EW8A 2G8NA 4YMVA 3SHOA 1SZPA 1RJEA 1ZRNA 2P35A 2R1TA 2WOJA 1FRNA 3S2ZA 2YBDA 3IKTA 4F7DA 5JTTA 2VHVA 4IDDA 1JV2B 2YJZA 1NVGA 4O6VA 5IEBA 3ZIAD 4E2FA 1WB9A 2RK3A 2E5WA 1JDBC 4CR6A 1KEVA 1OJ7A 1EFTA 1Q16A 4X1YA 2GPJA 2J07A 4RHUA 3Q3JB 5DCYA 1RVV1 5DYNA 1RRMA 3LA8A 2F1HA 1YKFA 1N1MA 2ATEA 2O1EA 4MQ4A 5KJ6A 1CUWA 3M6FA 4EG0A 5AVJA 2CCJA 2PMDA 5TVGA 3A25A 3G8DA 3NI2A 4WEQA 3G1UA 2IDMA 2AJLI 3A26A 4JCOA 5U1PA 3R8CA 1U7HA 3DE0X 4OI2A 3UN1A 1U2SA 2HU8A 2Q1YA 3E6AA 2JLXA 2P9TA 2VH1A 1E60A 3ZDXB 5K8UA 3DZBA 3A8TA 3EJWA 3MFQA 1RJFA 5HMMA 3CBQA 3RIXA 2N75A 1Z73A 5FBLB 4N7RA 3QKSB 3CX6A 4MAAA 4MRAA 2A0YA 2I1QA 3ZE8A 5BMVF 4HDMA 2GMWA 3HR8A 1CNEA 2YFYA 5KQGA 3QXHA 1WBDA 3OZSA 4EUFA 3A1UA 4ZCMA 3UPTA 1KAMA 1M7GA 3ILHA 3VO2A 4HXYA 4ZDKA 3DMHA 2QRPA 2P67A 1B42A 1ISFA 4UCXA 1Q50A 5AJZA 3UB4A 1I3OA 1JZQA 2RK4A 3I9V6 4NZ9A 4IP0A 4ZZ3A 2WG2A 3IPYA 4M1QA 3GGJA 2QNBA 4HAIA 5I9LA 2KYRA 3D7SA 1ECLA 2GYWA 2OCYC 2X8JB 4KE9A 2RGGA 4IICA 5KAMA 4KUGA 5DGXA 4BJHB 2J9YB 2DUMA 3WKCA 1O7JA 1QP7A 4E5KA 4AG3A 2CCGA 1CKEA 2D06A 3IRUA 1JDTA 4YRTA 5TEWA 2QSUA 2QJRA 3G9TA 3ICOA 3I9OA 2ZI7A 3VV3A 2ORED 2WSBA 3KAJA 3H3XA 4MWDA 4DLZA 3OQOA 1DEAA 4AUNA 3AY0A 4RMIA 10MHA 3O0DA 4TL6A 2P91A 3ZV5A 3DYIA 5CVDA 1FU4A 1ISPA 4RQTA 1JI3A 3BXEA 3R3WA 1FE8A 1ZFNA 2XQGA 1IOVA 1DIAA 2ZRQA 2OXIA 4YXWD 4R8SA 2H1OA 1XEWY 2HRCA 3HEAA 1I0ZA 4BMSA 4RH3A 3V4RA 1SHKA 2OO3A 2QTNA 2ZU0C 2W2MA 4XH9B 1UK7A 3A9TA 1TJ4A 4HY3A 3U7RA 3JD3A 4AROA 1FTQA 1DJPA 2DVMA 1MENA 3K53A 2MR6A 4BZXA 2WJVA 2BZGA 2RHOA 1T3GA 4ZVUA 4K03A 1FNDA 4E4RA 4YRCA 4F4JA 1DQRA 2AOUA 1IVSA 2Q3FA 4B2LA 4QTXA 3VV2A 2WIDA 1PJ3A 4DSZA 7ADHA 4RJTA 5KOJB 2P1ZA 1GO2A 1O8CA 3EFOA 4RJ2A 4BQRA 2GVDC 2ONZA 3O91A 4COKA 3PITA 1P8AA 1JIUA 3B2EA 1YHNA 5DBEX 5C7IO 3I9MA 2O2JA 2JI7A 1OU4A 3PXDA 1VFPA 1IY2A 1MORA 3K9GA 2DOKA 1Z3IX 4JI2B 4G0NA 4JITA 3BMXA 3R7WB 4FFOA 3WLSA 1YDGA 3T7TA 3MWLA 3EQ8A 3S29A 1PU2A 5CB4B 1PCXA 1P7ZA 1W5SA 2P2YA 5D8DA 2Q5CA 1GT6A 1TM7E 3COYA 2EOAA 3PD1A 4LKRA 4C22A 1EBBA 1VJCA 3O9VA 3WV4A 4EDHA 5HYVA 3I62A 1FS5A 1CUAA 1MW8X 1F1JA 3FAZA 4FDUA 2O8CB 4OP2A 3EGEA 2R6JA 4LKOA 1XVLA 3NOQA 5KNDA 4B4OA 4MVWA 3IB6A 2IIQA 3U6BA 3LA6A 3JASB 2MSDB 3EXEA 3UHJA 3CV3A 1EHYA 1R8QA 2IZ0A 4G01B 2HWUA 4BFZA 5K3FA 2GARA 1XYGA 2M6SA 2RHTA 3KHUA 3G0GA 3M9XA 3QWIA 3IQWA 1L5YA 3KTDA 2PZMA 4HX5A 2WB2A 5BR7A 2KS6A 2HF9A 4RVSA 3OAAA 2VP9A 3KKOA 3S28A 1SWWA 2OD7A 1ZLYA 4MW7A 5FLKA 2QP4A 3ZZUA 2QD1A 3LC7O 2GA8A 3PC8C 1ZSVA 1TVCA 3K4QA 3Q11A 2X0EA 4NNOA 3HI6A 1GPLA 4Q3OA 4R0VA 5ALOA 5M29A 4NONA 1UEXC 3RSCA 4DEVA 3HNOA 2A9PA 3NJ8A 5JSQA 1HG1A 3H11A 4M21A 4QT4A 3K0HA 4YDRA 4AMVA 2DMRA 4AZ0A 1DG9A 4BFXA 1KMMA 1T5LA 3W9BA 2XX3A 4OQFA 2Z6QA 4NK5A 3I9JA 4M6WA 2XGMA 4OB7A 5BNFA 1C81A 1JQLB 1SVOA 3Q72A 3NAGA 1H3NA 4XQ9A 4JS0A 3ANNA 1YA8A 3OBIA 2DQZA 3OF3A 3B52X 2BJWA 3L6DA 5EQDA 2VPYA 3EVTA 1PZHA 4TXHA 3C8ZA 2WF5A 4ND5A 4QRDA 4GMKA 2GUWA 4BTLA 4WN9A 5I4IA 4NCJA 1QF9A 1Z7EA 3O2NA 5K3CA 4EJSB 5ICSA 4W5QA 1MC1A 4TV8A 5C81A 5CGZA 2J5KA 5CYPA 2QNIA 3OJEA 2FUEA 3VPHA 1BFUA 2O2ZA 2PKQO 4WBNB 5AUPB 1UBSB 3RQSA 2AJBA 3H83A 4ZCTA 2UZ1A 1V41E 3G02A 1II0A 3AEUA 2A8YA 5HK8A 3ZQ4A 4HQFA 3ITKA 5LOVF 3ST7A 1C0PA 1ESMA 1W49A 3PUYA 3QVGA 5FYQA 2CXSA 4O8ZA 1QVRA 5KYWB 4CLEA 1QANA 1STOA 4K81B 4YK7A 1F6DA 3H8WA 2ZVJA 3HJCA 1X86B 3TIIA 5AW6A 4CT0A 1EH5A 3UATA 2MSCB 4L27A 8MHTA 4B9AA 3U7IA 1VI2A 2AXPA 5EWMB 4MS4A 2I8AA 3CBGA 2ZE6A 3Q7EA 4LHWA 2ZE7A 1R5NA 3WLKX 4NBKA 3T1OA 1EQAA 2HK8A 4MUKA 3ZHXA 1VI6A 3AOGA 4ZT5A 3R7DA 5AW4A 3X1DA 3B3GA 1PT5A 3EMKA 4K6CA 4Z1MA 3KNZA 1YNSA 2EJBA 4J94A 2F4VB 1F2VA 1SNYA 1UQUA 1GM5A 3I2IA 4B35A 1XQYA 2QZ4A 3E48A 3JATA 1QQBA 4FOLA 3TMAA 1LX6A 1UMBA 3WS7A 4F3CA 3U1VA 1JH8A 3HGTA 621PA 1QO9A 3WZMA 4GXNA 3AL3A 3KQPA 3P5SA 5DB4A 4Z0NA 2GJKA 2VT2A 4P4LA 4RLHA 3TJZA 2BFFB 2X1HA 3WYFA 5AHRA 2RGBA 5BUQA 6Q21A 2C4TA 1YOBA 1ZIXA 3NEAA 3EBPA 3JQ9A 1U8YA 2V59A 1WXGA 4HL6A 1I4LD 3P19A 1UBHS 1L7XA 2WV9A 2UUAB 1Q57A 1BO6A 4G5FA 1RJ9A 1SWVA 3I37X 4MGYR 2BW0A 3MAGA 3MTGA 3OEWA 4P86A 4RKEA 2J48A 1A8PA 1HGXA 1W34A 3LT1A 3L8EA 4MB2A 4POAA 3C7CB 3DBLA 5F1PA 4G0PA 2Z2YA 5D85A 2GCOB 5DI3B 3ZW8A 4DQLA 2IUTA 4Z9XA 3VNUA 2H1SA 1OVMA 4HPXB 1SR8A 5AICA 1B8UA 1ENOA 2QR3A 4LYAA 1BE1A 1I4TD 1KEWA 2DKFA 4LUCA 5SYNA 4B1FA 3C7KA 3AVQA 1NNI1 2FGJA 3H5LA 2GD6A 5AQ1A 3SKXA 3UC5A 3C24A 5FTKA 1M2JA 2G5GX 1PKEA 1F2UB 3OMXA 1Z8NA 3HWWA 3T1HB 3OZBA 2AN1A 2QLNA 1N33B 3CMCO 2XITA 4UNSA 3MWEB 4D8YA 3KVRA 5CT5A 4M0PA 4HT3B 3UXEA 4M53A 1JDVA 2Q21A 2QPOA 1VA4A 4UPDA 3BQNB 1Z83A 1BX1A 1SU8A 1GYPA 1M73E 2F64A 4EG3A 4B44A 2CW5A 4EVSA 4P4GA 2FCAA 3BXHA 5J63A 7MHTA 1GRRA 4AKSA 3JWPA 3NAMA 1M6WA 1I5RA 3R3XA 2WWWA 3HO8A 3V1UA 4HN9A 3IJEB 4RWZA 4REMA 3TOXA 4JZYA 1FYEA 4ZPXA 3QENA 2CXXA 2TMDA 3TW6A 1IM8A 3FPFA 2D5CA 3BWMA 4EBFA 4JT2A 2HXYA 4FCVA 3PL5A 4IGEA 3C3JA 4N5DA 1J8YF 4YBRA 1AE1A 4BVEA 2BFDA 2FUG1 3LP8A 1K27A 3KR0A 4CDNA 4DIUA 3UJNA 4GECA 5IF3A 3LIPA 4BCBA 1RKVA 4MYSA 2GERA 2BHNA 2WVAA 1X13A 2NN3C 1LI4A 1Y5MA 3HCPA 1JT9A 5IT4A 1NR7A 2Z56A 1JEDA 2JJMA 2QN7A 4XW2A 5EZYB 3ZKWB 1Q44A 1IIRA 3FZQA 1ZUIA 4PIVA 3FLEA 5EY5B 3AUJB 1E62A 1T2EA 2QVBA 4YCNA 3D0KA 5AVYA 5BURA 4QICA 3B78A 2GFIA 5KTOA 3OO1A 3TKAA 1AKRA 4C14A 4MV1A 1JHRA 4TX1A 2FK8A 5LIPA 3EFHA 3QPUA 2FE4A 4PSVA 4LFCB 5A6SB 1GAEO 4DQKA 4WAUA 3U37A 4WCFB 4KDRA 5CT6A 1EWRA 1TO2E 4FDAA 1M6YA 1SHZA 4HDRA 4LZJA 4EKIA 5AVTA 4A8JC 3B85A 3WKDA 1JDNA 3T41A 4F4FA 3OQMA 2BAGA 4LRQA 3HJNA 3O8OA 1GA6A 2A5JA 1YRYE 2QQFA 4U2CA 3WFJA 4D96A 2GEDA 3DBVO 2IXAA 1ES9A 4H7EA 3CRQA 4X20A 2YVLA 2AFHB 1P9WA 4ZEOA 5AVXA 1NYLA 3N2GA 4Q1CA 3ZHCA 3UB3A 9MHTA 3WMWA 1TO6A 2XNHA 4G1VA 2FFBA 4NABA 2KE5A 4WD3A 3KXDA 3V8MA 1JKMA 4WA7A 4GPD1 4Y9TA 2MIIA 1Y8AA 4B5KA 2CDAA 5ALIA 2ZJ8A 1WDLA 1UJ4A 1OXBB 3W77A 3Q8KA 3C2QA 5IVPA 3DKPA 4RENA 5EJGA 3D5TA 4ER6A 2UUBB 2UYCA 4DTCA 3UCFA 4S2UA 3CG0A 3KPYA 5JVDF 2OBXA 3MD0A 4PE5B 5T8KA 3HBJA 4TM7A 2YFQA 3OZCA 2EL7A 3AEQB 3K4PA 2C2OA 4MGKR 4YJDA 2JGLA 3ISTA 4MJXA 4AXBA 2BCGY 3EPKA 3CUKA 3O47A 1U80A 4ZU1X 1Y37A 5AM1A 1MFZA 1JW9B 5CNIA 1Z82A 4U6NA 2QL7A 3QVOA 1TJ3A 4PYLA 5FKJA 2J0QA 2FZKA 1RPNA 4F2PA 2QSZA 1RWMA 1GV1A 3S0JA 1W46A 1W85A 4DRZA 3ACDA 3PGXA 1OI3A 3S5UA 5PGMA 2ZULA 2C5HA 3GYGA 4D8VA 1P2DA 3PI7A 4V02A 5CGQB 1XDDA 1JDJA 1KY4A 5D3MB 2EXXA 1M1XB 3TRHA 2OZKA 2X5JO 1VCNA 3EGIA 3LP6A 5KKAA 4I19A 5EKXA 5NULA 2IP2A 4BC1A 1GKIA 5LZ9A 1Q3HA 4WXPA 1XZAA 4X7BA 4AKTA 3H97A 3RLFA 4EG5A 2FLWA 2P9EA 5REQA 1LWNA 2GZHA 2AX3A 1FSGA 2MINB 3ITNA 1GZ4A 4QJIA 4XTRA 4O4JB 1OTYA 1RXUA 1LDEA 1NJ1A 2CMKA 1PJTA 3ZW7A 4BATA 5JPCA 3KXKA 2EYUA 5FQOA 4BV2A 4UZEA 2JZNA 4WT7A 5H4HA 3K2BA 4BGDA 2BHTA 4YA6A 1PQ4A 2PVCA 3CVOA 4B6SA 1TEZA 1IAVA 2PUEA 3DE1X 4X1IB 2Y99A 3FTCA 1DBSA 1EFPA 5DNDA 1OIVA 3JWIA 3FUWA 5KJCA 5BUZA 5CA0B 4JVMA 3VBEA 1GU1A 3FUCA 2F17A 3K0AB 3OIUA 4N03A 3GAMA 2ZJBA 1JHQA 1H4VB 2E1RA 4P4NA 1RCFA 3HV0A 2IPNA 4I46A 1OYVA 3U3JA 4DC9A 2SHKA 1JTVA 5HGJA 4WDQA 5K0SA 1SUEA 3TRIA 4QUIA 3UBMA 5JZ9A 4PO3X 2GYVA 3GDFA 2Z2XA 1KQ3A 3O8LA 2WIFA 3HM2A 1FFDA 1RMYA 2C0QA 4MVJA 4P53A 1KZHA 3G2JA 4ZKDA 4HJXA 2J0EA 4IEIA 4TVKA 1MABA 2XMRA 2ZPAA 4CLRA 1RPZA 4AO7A 4D4HA 1A88A 2QT0A 3HRHA 1M1NA 1NTRA 4JVLA 4OQ4A 2AW3A 2YY6A 3G59A 3A3KA 4JFRA 4QFCA 4CE6A 3RPEA 5DN9A 3GR6A 3NHBA 3U3XA 4MXDA 2ENUA 1TKBA 2FN4A 3THWB 3H1TA 3K0CC 1NFFA 3N8KA 1P7WA 3BHIA 4TKUA 4NENB 1MT3A 3OQIB 2IKQA 2Q7DA 2DQYA 1NM5C 5EIBC 1YIOA 5AM4A 2AHOA 2XOXA 4LRXA 3CTMA 3TOVA 1TUIA 4EB3A 1MO5A 2G72A 3T5PA 5CVCA 3QU4A 4JXKA 4OQEA 4LA4A 4U2EA 1RHUA 4BRZA 4J0CA 5BOVA 2VZ8A 3WWCA 1P9RA 3UKOA 3NTRA 1D07A 3FNQA 4IS2A 1X87A 4C2BA 1PRYA 4LOIA 4DDMA 1YBMA 3AF5A 3NCTA 3M4YA 5A02A 2CLCX 3O8QB 3VVCA 2B1RA 1ONSA 2Q5IA 4WJLA 3K5PA 3D8UA 5CEJA 1PGPA 3W2TA 1M2HA 3CX8A 3EQ2A 3GP5A 5ESXA 2LCQA 1ICEA 4QVGA 3WK7A 1DJOA 1EFVA 1NE2A 1XMSA 2V7GA 3R6TA 2W2TA 4H1HA 1FQKA 1MKYA 3T5GA 5JRZA 1C0EA 1FVOA 2JBAB 3B89A 1B76A 1MP0A 3WADA 4IRMA 3HPRA 1UPAA 3BXFA 4D4LA 4K1LA 1BH2A 4UEJA 1F4LA 4L95C 4E1AA 1JLKA 1L6IA 2EIXA 2RGNA 3GEMA 5LYJF 2IC5A 4MVJH 1TQ8A 1DCKA 1QU2A 1U0EA 5GVRA 3DEKA 1H85A 3GJQA 3KEGA 1K3TA 1U04A 2VK4A 1NW4A 4BN5A 2GLTA 4DYVA 1AF7A 2QTBA 3F7TA 4TLCA 4ZQFA 5JZBA 221PA 1CJSA 5GGXA 4F0JA 3QNUA 4Z4QA 1OFIA 3BL6A 4CQNA 3TO5A 1V4NA 5JYBA 1Z6XA 5D7BA 1VBKA 3I01A 3KO8A 1QIDA 5EI5A 3EGXA 4TSFA 4CG1A 4A9AA 1Y1QA 1HK7A 1Y6RA 4GWKA 2Z2ZA 1OTHA 4PR3A 5E1MA 2O6HA 1AMNA 2C5AA 4LGCA 2O23A 2B25A 4J0QA 4NZNA 4PEVA 1SEVA 4W5WA 2I2WA 2OOKA 3C0KA 4YMIA 1ZD9A 2GAFA 1M34E 2J45A 1GCAA 1Z22A 5COBA 1TUEA 2JF0A 1FBTA 1E2QA 1L3BA 2OE2A 3NTLA 4FHZA 4ZIRA 2JIMA 4XGKA 2Z8YA 2PLAA 4DTIA 4ZYLA 3DLAA 2HIHA 2YH2A 3GLUA 1EVZA 5KQMA 4G41A 3O7WA 1YBVA 1LXCA 2K7FA 1RWBA 1IULA 4UXHA 1IEVA 4ALMA 3MLBA 4YRRA 1RABA 2OWDA 2HL6A 3OCXA 4JVSB 2V7TA 4ZYVA 1WS6A 3OIFA 2D1YA 1SQ5A 3Q7TA 4JL8A 1QDUA 1ZAKA 3QW2A 1L8AA 3GLHA 1LSSA 5E9AA 5AD1A 5D7NA 3L8ZA 4EBBA 2H48A 1QG6A 5GOTA 1EFAA 1CX9B 3IX7A 1KYXA 3HCAA 3VC7A 4BWFB 3N0VA 2EP5A 3LQQA 4YRGA 4KPYA 1IBCA 3PA6A 1H8HA 1VBNA 2VTBB 1YZGA 3QPVA 4LY9A 3D5EA 2QBYA 4ZICA 3NJ4A 2QAJA 1P0QA 3IIJA 5KYUB 5HVNA 1SKYB 1MH9A 3N8HA 4Q82A 3HBNA 4DIOA 2HF2A 5FI5A 5IVHA 2VNSA 1NG1A 2HK6A 1P45A 2I65A 3H9CA 2J3DA 4YX9A 3EDQA 2V6JA 1C41A 2TMYA 4KXYA 3THRA 2I55A 3ET5A 2QYSA 3A4NA 2HNAA 1KDPA 1TM2A 3DJFA 3W5IA 7YASA 3KZCA 1Q92A 4I81A 4XSGA 1W4LA 3RUEA 2GRUA 3S70A 3WHIA 4CV3A 1MX1A 4NH4A 2F43B 1E9DA 1T0IA 3I8SA 2C7VA 5DGCA 2PPLA 2SICE 2ECQA 1QG4A 2JAXA 4JLSA 3BIXA 1SCAA 4IMPA 4ZVRA