2B98A

Crystal structure of an archaeal pentameric riboflavin synthase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
KKVGIVDTTFARVDMASIAIKKLKELSPNIKIIRKTVPGIKDLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYLLFKPEYLTRMAGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin synthase
publication title Crystal Structure of an Archaeal Pentameric Riboflavin Synthase in Complex with a Substrate Analog Inhibitor: stereochemical implications
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 48
structure length 141
sequence length 141
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.9: Riboflavin synthase.
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2b98A00
1HQKA 3MK31 4J07A 2C97A 1T13A 2A57A 1KYVA 1KZ4A 2A58A 2A59A 2C9BA 3NQ41 5IM4A 1KYYA 5IM5A 2B99A 1NQWA 1KZ1A 1KZ9A 1XN1A 1C41A 1DI0A 1NQXA 2I0FA 2C9DA 2F59A 1KYXA 1NQVA 4KQ6A 1RVV1 1ZISA 2B98A 2OBXA 1EJBA 2O6HA 1W29A 2VI5A 1C2YA 1W19A 1KZ6A 2JFBA 2C92A 2C94A 1NQUA
chains in the Genus database with same CATH superfamily
3OT1A 3AR5A 3ELDA 5EERA 1VLVA 2FP3A 1X2EA 3MGBA 4QBFA 4TVSA 4W82A 1CZLA 5BN3A 1UFQA 2QP9X 3D2LA 3N28A 1BE8A 3CWCA 1T9AA 4BVJA 5M5BA 2EQBA 1P8AA 2FPSA 3FUXA 1O0CA 5IEBA 1ENOA 4KV9A 1CU1A 1CQPA 1CUZA 3KOXA 2RBEA 1FBTA 2HNKA 1QGDA 1DP4A 1R74A 1UPCA 3QELB 4GBJA 4UAGA 4GMXA 1S0UA 121PA 1H6DA 1ZAYA 3G17A 4U4AA 4CKXA 2P7IA 3O94A 1I1HA 3T38A 3VKWA 2FZCA 4P58A 4RV4A 4ZVUA 2LRHA 3JVDA 1FY2A 1XVTA 4E31A 1JWAB 1NT4A 1AN0A 1AU9A 4YONB 3OU2A 3V00A 1J2RA 4ND6A 4K6MA 3SYLA 5AHRA 1XKLA 2Q1SA 1GZUA 1HLFA 3N2EA 2JZNA 3JWEA 4GR4A 4MAMA 3TSZA 2A4MA 4L2IA 4O8CA 1DJMA 6NULA 4K6FA 1MZPA 1J21A 4Y7CA 5E1DA 1FFWA 1DQRA 4GLJA 1GZ5A 1I32A 1WXGA 2Z9CA 3A37A 4JI1B 1GD1O 3BGSA 4QQNA 1TA0A 3HKBB 3D8SA 4CQMB 5KC8A 2C29D 621PA 3SSOA 1QQ5A 1QLWA 3O3CA 4KTVE 5HE8A 5BO5A 3W8NA 1G8FA 3N86A 1N2OA 3HDHA 4RWZA 2K7ZA 3U31A 2A88A 1Y9ZA 1QF9A 1GUAA 4IRUB 1PD1A 4ZHSA 1T6BY 1QXSA 2RC6A 1U0HC 3PQ8A 5FTNA 3UKDA 3WQQA 2AR7A 5LYJB 4NBRA 1CUGA 3QU9A 4ZVRA 3O1JC 4LY0A 1E9SA 5D6NA 3UANA 3DWFA 1OT3A 3VR3D 3TCXB 3E9EA 1ZHFA 1DARA 1QMGA 2FMHA 1N9GB 4XJVA 2WDPA 5DXAA 4A27A 1I0LA 5FOVA 4W5QA 1DAKA 1Q1QA 2BFDB 2WA2A 2BH2A 5JTTA 3OM1A 1QGZA 3VPGA 5HIKA 2EFDB 1RXVA 3C41J 4CLXA 2WAAA 3HKEB 3E1KA 1BA2A 1JQKA 1QSGA 2ZB4A 3L0OA 4RDIA 4RVOA 5DX8A 2FE1A 2X19A 3KT8A 4JEHA 4UTRA 3T3OA 4KR6A 4IIBA 3P0FA 5F12A 3S2UA 5HKKD 2FSVC 4C22A 3LT1A 4RV5A 4IKOA 2WAMA 3BREA 3LQRA 1KO4A 1VJ1A 2EARA 2FWIA 3KPUA 1C2TA 5ENVA 4DLPA 2HA2A 2OGUA 4PZPA 4XX1A 3G89A 5KDDA 4RS4A 1XEXB 2NVUB 2XBMA 3C43A 1JNYA 4P31A 1DCKA 1L4KA 2VPXA 3QSYA 4LJ9A 1NUTA 1JHVA 2XKKA 2EC5A 1WXWA 2OGZA 3OEYA 3QTLA 4WINA 3QELA 4QYMA 1E99A 3MJVA 3R09A 2GN4A 2OILA 1PT7A 3WK6A 4N5MA 1T0PA 2QTVB 3FOFC 1MA3A 4BNIA 4WUTA 1R0LA 2PZAA 2R7NA 4O2AF 2WU4A 4M8SA 4QYXA 2BEKA 2IX9A 5EZQA 2A6PA 2VFAA 4YP7A 3D1JA 3FUCA 4E11A 2CL6X 4JXJA 4ZD6A 4TWZA 3OCVA 3T5PA 3AV0B 1Y6JA 4LQDA 1J06A 1NE2A 2J09A 1XCLA 1PR6A 2C83A 1IHDA 3F0TA 1ENYA 3KQQA 1CQZA 2ZRAA 1QH9A 4TMXA 5TPZD 4J0GA 3UT0A 2HRQA 5AK3A 1UFOA 1TM4E 4Z4QA 5EEHA 3BXPA 1BG6A 2EFHB 3I05A 3TB4A 2MR6A 1NUAA 1RHRA 4LDPA 4LC9A 3HKBA 4YI5A 5REQA 3UGKA 3M6XA 2B8NA 1GG9A 2DHEA 4B80A 2EKZA 5EP1A 4BUZA 1HX7A 1NUPA 3NXKA 1HFJA 2B1RA 1TVMA 2D54A 1BGWA 3BJRA 3CLSD 1P0PA 3BH7A 3LBYA 1Q95A 1KS9A 2ILVA 4KGXA 3L18A 1QRUA 4Q6BA 3F5QA 3RG2A 4EVSA 1P0MA 3EY9A 3WGZA 1UDWA 1AKYA 1Y5IA 1FLDA 2ORWA 2WAXA 4FDTA 4KLCA 4MVJA 4Q4LA 4U7HA 5LYJA 4V2UA 1I33A 3NYQA 1V1RB 3P97A 3GFSA 3S2EA 3R23A 1BKYA 2PKXA 1N9GA 1QFZA 1E2PA 2W22A 5CMLA 4BPBA 4LZOA 2IJGX 3BE8A 2QLJA 2C00A 3DM9B 1ZNXA 4RHXA 4IQGA 3TM4A 4CV1A 1GZDA 4BCBA 3PV0A 3HKEA 3C6BA 4CFYA 1XDDA 1TO2E 4GEKA 1V5WA 5IMBA 4MEBA 3IPAA 4II2A 1JHXA 1V6AA 1LY1A 3OIGA 4HS4A 5EQTA 3ZX4A 1BW9B 3EGEA 2Y0EA 1IUNA 2QX4A 2GB4A 1E5DA 4KW7A 4R4JA 3I5MA 5CLGA 3LNTA 2R8BA 3OQ6A 4BUJA 1AQNA 4TYWA 1ZP6A 3CE6A 4ZOAA 4L3VA 2OFWA 1N6HA 2BHRA 2FGJA 1XEXA 2NVUA 3QMMA 3DEKA 1L4NA 3PSAA 4GOXA 1Y4DE 4I1SA 4J49A 5T6BA 3WL4A 4WADA 4QO7A 1XMXA 4X7PA 1SVOA 2QJWA 3ND5A 1VIYA 3Q0IA 2B83A 1HZZA 2F1IA 5M34A 3V1TC 1NC3A 4UPDA 1SU7A 4ZQHA 1YQXA 3BXHA 3NR2A 4ZVVA 3UJBA 4Z7JA 1UDAA 3H19A 4G8DA 2QTVA 4H7DA 1NBIA 2PN1A 3P9PA 2G17A 4HFJA 4MUIA 3SHOA 5K20A 4DYDA 3GBPA 3VMFA 3X3HA 5KYWB 1P33A 1PG2A 3BC1A 3H3JA 4QARA 5ESWA 2WAOA 3TZBA 2YOHA 3WQHA 3ZKWB 4B82A 3UJHA 2C7BA 3U4AA 4UPEA 3EIFA 3LC0A 4Q34A 3H5NA 4L0MA 1YT5A 2Q1WA 2R5FA 3D2AA 1JLHA 3QYAA 2H2FA 1F0PA 2V1XA 3R3SA 3EISA 4HX9A 4LDJA 4IJVA 1N2IA 3D4OA 1NVFA 1YIOA 4NDNE 1EXWA 1UZLA 2AVNA 2EJBA 4R3NA 2V1UA 1D2NA 1HYEA 4IMRA 4LVCA 4XQ9A 4OJMX 2X13A 4FGKA 1HE2A 5KSZA 3PR3A 1DX9A 1U0GA 4G37A 5JNWA 4NCKA 2H1WA 2GVDC 3KOYA 1XTZA 4PC3A 4EVRA 1R0RE 4X85A 5AKZA 4EENA 2D7DA 4C30A 3R7LA 4MYCA 1U7ZA 4F5EA 3D3QA 3DMHA 3AFIA 3G0GA 4LHVA 2OGTA 1XROA 4GI2A 3P2MA 3RTBA 2WMYA 1LTQA 3L5KA 5FWDA 3S1LA 5JS7A 3CLUC 4ZV9A 5B36A 1I2CA 2YY5A 3HV0A 2WM2A 1V1RA 3H1FA 4D56A 2IX3A 1NQWA 2A7XA 4MVWA 4L8LA 1JR4A 2RGDA 3HWRA 3N0VA 1CV2A 2NTVA 5JFOA 1JJAA 1T5DX 3LA8A 1JA1A 1U0TA 4J1NA 5JZOA 1HMYA 3FMOB 1CQIA 3K8YA 3P0RA 4IJWA 4Q1VA 2B8TA 5KNCD 3MTJA 4UQOA 2F9FA 4I5GA 1Y1LA 3FCUB 3STHA 3FDXA 4GDFA 2I4MA 2VEDA 4GFDA 4OO3A 4ZYTA 1E2JA 4RTLA 3B20A 2GJAA 4RFSA 5FOTA 2ZUWA 5HCUA 3HYRA 4I9FA 1M75A 1U8ZA 2EZUA 2H4JA 2WIJA 4TLAA 4XFKA 1KEKA 4G0UA 2LNDA 2AG8A 3PDCA 3T95A 3QLUA 4W8GA 2QWXA 4OQMA 2PGAA 1GPKA 3G9ZA 5EJ2A 1OA0A 1UXHA 2GOYA 3KQLA 3TQOA 1NRJB 2IH2A 3ROKA 3GG2A 3L0CA 1A98A 3LUPA 1HZZC 3OOYA 2PX2A 2QN3A 1PFGA 4B17A 1Q83A 3BTVA 3GXOA 2YINC 3MT0A 1ZGGA 5EKUA 5G3ZA 3T9EA 3WOVA 5FBWB 2VI5A 4BNVA 1QC5B 3DWGA 3EGCA 1FMLA 3MT8A 4IDQA 4X3CA 3GH1A 1WDTA 3QFCA 4OH1A 4Y0VA 3ZJTA 1KOJA 1T5OA 1W36D 1L7OA 3ZKWA 2X2EA 3ORRA 4IF6A 4IGAA 4DV5B 3KC2A 4X63A 2P3QA 4EATA 1D4OA 5CLJA 3KQTA 3OPXA 4FDMA 1KRHA 2OPBA 4LJ5A 4B76A 3EOZA 1D07A 3PUWA 4TPKA 5MN5A 2VXCA 1WBBA 1IXRC 2H1FA 1MVOA 1ODSA 3LKVA 3C87A 5A0VA 3VSBA 4IL5A 3P0HA 2LE0A 5ISMA 1DRWA 3ESBA 4B40A 1Q2UA 4U0JA 1ETHA 2XDWA 4EZEA 1X1EA 1JU4A 3FPKA 4R0NA 1B1CA 1QDEA 1RPJA 3JSXA 3GRKA 3SCZA 4C06A 2VF2A 4TMKA 4XUEA 1OAKA 2CV1A 4TLEA 3ZJUA 3DR5A 1SBIA 4NOKA 1L3BA 1UZMA 3V2HA 3WGIA 4G0VA 2NTNA 1FFYA 2I3AA 1N2CA 3B9RA 2WSSD 4QTXA 3WQSB 1WPXA 3LD9A 4PVCA 2VDVE 2H52A 2QNBA 4CU5A 1U7OA 4I2VA 3BEDA 1GZVA 2C9ZA 4LTMA 4IIYA 4YUYA 1A8UA 1YVUA 1GYQA 3WJ7A 4FB4A 3UXEA 3MW8A 4I55A 1F7UA 3ZWNA 2OY0A 1BZYA 2X8WA 3AUKA 3HFJA 2GD6A 4G4IA 3GLGB 1NAHA 3E27A 3EUEA 3GZ4A 4B7XA 1QH0A 1QUEA 2R751 1U3VA 4BMZA 4DR3B 1U9ZA 2E0IA 2GF0A 3LT2A 3NS7A 4TUYF 2XNSA 4L9AA 3MJRA 2OWDA 4DPKA 4F86A 2DY1A 2IS1A 1EWVA 2SKEA 3EXIB 1E7YA 4P4UA 2PD6A 4XJTA 4OM7A 1B8OA 3FX2A 3PTZA 1W9MA 2CLOB 1RAAA 3I9FA 3KPYA 1PTJA 2BGRA 3QLUC 3ZG6A 4CR8A 4IO1A 5H02A 1EP9A 3S81A 3C8DA 3O4GA 2ZI9A 1T3LA 4RPKA 2GPJA 1ZU4A 2LZ0A 2XB9A 4UM9D 3UJCA 1U0FA 3V7WA 3ZQ4A 1K6XA 4EFKA 4DKJA 2X3FA 4D6PA 1OIXA 3PCXA 3JR7A 4UCQA 2WTBA 3WJ2A 5HP4A 3K72B 4X20B 2CJFA 1ISPA 4DL9A 1B93A 5LJLA 4WVLA 1JB9A 7ABPA 2GZ3A 1ENZA 1BWSA 2I2XB 3ZLJA 4HGOA 5BSVA 1MJFA 1QTRA 1F12A 4UUPA 1LI4A 1RYFA 4H7KA 4WECA 4B3TB 5BQ3A 1K66A 2VJKA 3BE4A 1X7DA 1XP8A 1MHPA 4YECA 5BXYA 5AW3A 2WSYB 4RA6B 2QT0A 1JXQA 2AL7A 1SUAA 2EL9A 2CHEA 4RADA 2NO9A 5CHYA 5KPDA 3P20A 4D74A 3ASZA 4KXVA 3WNVA 4C4TA 2Q0XA 1A8IA 3R5TA 2BOVA 1L5KA 1Q0TA 5MDHA 3OAAA 1H5NA 4FEGA 1UH5A 4JP1A 4NYMQ 2XZTA 1OFTA 3MTDA 5KAPA 4YV1A 4DR5B 4OSPA 4BQSA 2ZT8A 5LBUA 5JMTA 2YJTD 3F8SA 3OZ7A 4BHTA 2W6ID 5JXWA 4IIJA 4DIMA 1YUBA 5DGTA 3I2IA 5BSUA 4W1SA 5KO2A 2CBXA 1KPIA 2JAWA 2IEAA 4DMFA 4B6PA 1ZCBA 3O4FA 3KHSA 3S2ZA 3W6NA 4JEMA 5B4VA 5JSHA 1EGAA 3EE6A 3NBMA 3WNCA 1UEXC 4EO7A 1S1MA 4DCSA 1GXSB 1RYYA 2NWQA 1IZ9A 3OQBA 5AUOB 5LSAA 1UKZA 3GLGA 1FFGA 3E3OA 3FCCA 3ND8A 4KK3A 3P7MA 3VUFA 1G5HA 3A1FA 2O50A 1ISGA 2ZJ8A 1RHJA 2JIPA 1B00A 3NQ41 3Q7RA 3BGWA 2HMSA 3G5UA 4G1BA 2H4XA 1VJTA 2V7WA 3M6WA 4JC5A 2BVNA 4LHWA 4RF2A 1YS6A 2K2QB 3SJZA 3U7HB 4J1QA 4JELA 1PEKE 3MCWA 3L0BA 1DC4A 1NR1A 2IHYA 2NO7A 3EQ8A 3LL4A 1BS2A 4RY8A 4E33A 2X76A 1IY1A 1GPDG 4TTVA 5A1TA 2F1JA 3BK7A 2VJCA 2QRQA 4ZO8A 1P9LA 1DIBA 1M33A 1PTJC 4EK9A 3FXAA 1L5HB 3NOVA 1CRWG 1X8LA 4G0PA 4RJKA 3UJPA 4AKEA 1QGAA 3RC9A 1ZR4A 2RAPA 3EDMA 3M9WA 1XU9A 4N5NA 4IY1A 5BQFA 1H23A 2DU8A 1QQ6A 3IP7A 4NV3A 1WQ4A 3EHDA 1P7PA 1YUNA 2Q5FA 3OP4A 4MWOA 1L5YA 1KFEB 1RMQA 4GEGA 1P9NA 1TMYA 4X20A 2PR2A 4A73A 5IBCA 3L4EA 2WJ4A 3KWJA 5AP9A 1EBUA 1P18A 1P4RA 3KWFA 5ICFA 2CV0A 1E92A 2IS6A 3ZXIA 5CK5A 3A32A 2CNWD 4R2WA 3IAS1 4RLSA 1JILA 3KS9A 3EWSA 4JGGA 3EEBA 4N5HX 4RA6A 4TLDA 2CLFB 2JVIA 1T2AA 2RHWA 1JLLB 1ZHHA 3S29A 5ALJA 3RVNA 2FWPA 1C1XB 5C1BA 1SUDA 2Y1WA 2FUEA 5TMEA 1F8FA 1T8SA 2J6IA 2O7NA 2H07A 3HVKA 2D4HA 4UAJA 4BMOB 2HDOA 4JS0A 1Y8CA 3RJ5A 3QBTA 5JISA 3P94A 3MMPA 5JQGA 1G3UA 4FR2A 1UP7A 4OL0A 3T4UA 3TE7A 3TZEA 4C0WA 1Q77A 2J6BA 4DCJA 2OV8A 2BELA 1Z2PX 4JLDA 5JZSA 1EYZA 2WJAA 4DGQA 4TKMA 1S5PA 4B32A 5IT0A 3O93A 5BW6B 3DE3X 2W8BB 5F7ZA 4TMVA 1Z73A 2O0JA 3AJ8A 3RVPA 4H1UA 2D5IA 3HUDA 2O2SA 5HUHA 1PR0A 1GXSA 1GZ4A 1ULAA 2LKCA 5GY7A 3TMAA 3BMOB 2TMYA 1RKUA 4D9MA 5DBHX 5K3BA 4B73A 4D0NA 4MCHA 1KDZA 3T3EA 4PZZA 3CO5A 3QX3A 1P31A 3PZRA 2FQ1A 1C3EA 4ZXFA 2YQ4A 2W2QA 1OC4A 5HW0A 2FK8A 4TMZA 4TT3A 3SR4A 1IY2A 1B6TA 4CHGA 2PT5A 2R6CA 3F71A 4I50F 3TRDA 1WJGA 1J2EA 1CUUA 1YL6A 3JQFA 3WSTA 1JDPA 1U1EA 3NNNA 4L95C 1X74A 1FU7A 1SVNA 3NHFA 1U28A 5BQ5A 5C8YF 3RKUA 5DWDA 2AJTA 4B45A 1HL7A 2AEFA 1KPGA 3DTVB 4WPGA 3AERA 4ZP1A 1RMYA 3SZLA 1JQ3A 5HNKA 5J2TF 3IERA 1ULBA 4F38A 1SCDA 4ALNA 1ZD5A 1JIVA 1ZZGA 1SXHA 1WVMA 4RIGA 5EWLB 1Q74A 1GRNA 4OXRA 1N8KA 2WU3A 4RIIA 4BO6A 4R8MA 2LGJA 1G8KA 1P5ZB 3ANMA 5KDLA 3MWJA 4LNHA 3C6XA 4MW0A 1R4MB 1SPXA 1XVVA 3T7DA 3NALA 4DIBA 4F4CA 4Q3NA 4C3UA 5FPTA 1S3GA 3OKCA 3R5HA 2GMWA 1RFLA 3RAGA 1N1GA 1Q7GA 2WJ3A 4L5BA 3NBFA 3UHFA 1SQ5A 4EO4A 1H6AA 1BQ4A 1CNEA 4BOYA 5DH9A 4ARIA 1RCFA 3R8CA 1QCCA 3GJ5A 1ELOA 5GJBA 2CWWA 2OPHA 2FY8A 1C1XA 3WIBA 2PPVA 4E2WA 2J41A 1UWKA 2O2ZA 3C1UA 4KFUA 1J8QA 1T6ZA 3LYLA 4OYYA 4ZJYA 1QE3A 3A9RA 4X93A 3WB2A 2HBZA 1VSVA 4DJEC 4LS3A 4F21A 3CPSA 5CLLA 5LB4A 1DEKA 1YK1A 4PGHA 3ZHYA 2O5CA 1E3TA 1NW5A 3QLJA 5HUQA 1WDLA 4NEGA 3ZE6A 5C53B 3NGLA 3WOHA 5EOVA 1KP3A 2IY8A 2PEZA 2V4MA 2JD0A 5K0SA 1PWYE 3F9RA 1Y6GA 3CA8A 3RS8A 4AKTA 3KJEA 2HA5A 3WV4A 1C81A 2GPSA 3I73A 2XF2A 4U7DA 4C4SA 2W8BA 2GM9A 2W6JA 4G0XA 4UOEA 4D26A 5JSKA 3P2IA 1ID8A 2PPLA 3IJPA 2CBGA 2H9YA 5U4XA 4BX0A 1WUJS 1DQYA 3BMOA 1UPUA 3BWDD 3IODA 1X2BA 2G9NA 3VZCA 5IJ0B 1P45A 3MRSA 1J1UA 3K7EA 4PX5A 2GM3A 4MRSA 4I5IA 1IN7A 4Z86A 3KTOA 2Q99A 1G5PA 3FETA 4KUGA 4NBSA 3EVAA 1I4EB 3RJMA 2NADA 2Q46A 3GJTA 5KVCA 4Q03A 5L95A 1K9SA 4FLFA 2JASA 2XE8A 3L49A 3MS4A 2J48A 3L8FA 1SVLA 4BC0A 4NS4A 2HZBA 1FDUA 2DJ5A 2X0IA 2ATEA 1E1RD 1E79D 2FU5C 1QZXA 1GT91 5HYVA 3DTVA 3ZE2B 2F55A 1R9JA 2IU3A 4RD0A 4DCTA 1QRAA 1UR5A 1UXIA 3NDJA 1L2TA 4HNRA 4WEQA 4IDAA 4XA8A 4ZO7A 5EWLA 3RJTA 1IZ0A 4I6GA 4LRYA 3R0JA 1YACA 1R8XA 3BSWA 4FOLA 4NMWA 4XGRA 4X44A 2HSJA 2FPIB 4XDGA 4NEHB 4JI5B 4RTRA 2Z3WA 3WYNA 1D8TA 1GT6A 1O0SA 1H1LB 1R4MA 2CHUA 3D7RA 3LUHA 4I4TA 3DUWA 3G8DA 3F5MA 5AHOA 3RUDA 2G25A 4Z4HA 4IBOA 2ZREA 2ESRA 4EJFA 4QM6A 2IV3A 4S12A 1SKAA 1ZNZA 2IUEA 3RFVA 5CFZA 2PGIA 2VNKA 1U94A 3N05A 1WW2A 4N0PA 4WA7A 5J23A 3CNLA 1E0DA 3VHXA 1HQDA 4RNDB 2POCA 2IBTA 1GA6A 2XXJA 2OQ2A 4I1IA 5GP1A 1R64A 4HY3A 4JT9A 3F46A 2DPMA 4WUVA 3SIPA 5B6PA 4J7XA 2KPOA 4I1VA 4QFBA 1NBMA 4R2LA 4DQUA 3AESB 3GFQA 1W4BA 4ZQFA 1WW8A 1Q19A 3EEOA 3H1EA 2PGLA 1HEYA 1A2KC 2V5VA 3D54D 5F73A 2TRSB 5LZ5A 3HCAA 3RVLA 2ZVPX 2A0XA 3PFHA 3QJGA 5LQMA 3FPJA 1Z63A 2QTGA 3MJEA 1Y7LA 4GAEA 4IH1A 4P54A 4OAPA 4Q01A 4NJOA 4OHWA 4XJXA 1H65A 2VPWA 1PK7A 2OG2A 3LK7A 4HNSA 3RSZA 3HJUA 3N2KB 3VH3A 4CQMA 5ALPA 4UUOA 3E03A 2RHTA 4B3IA 4AW9A 5IJ0A 2PNFA 3EZ9A 3PDJA 4FW8A 3PGJA 1CWUA 1D2HA 2IHKA 3AR9A 2J5XA 3ZW7A 1G6OA 4E30A 3S6JA 2FI1A 4JYAB 3JQRA 1K63A 4FBGA 1PNVA 1TC2A 4QUGA 3BHMA 1ZVVA 5EESA 4YAWA 3U13A 2GK4A 1F6BA 2OEPA 3QTTA 3TOZA 1NSYA 4EA7A 1T0JB 3PRYA 4OJKA 1DLJA 4TS1A 4EYKA 4H1VA 3N8HA 1FSSA 2AFIB 1GNVA 4LYYA 2JFBA 3A1VA 4ZYWA 3Q4GA 2HCRA 3PTAA 3KLOA 1GCOA 2DH6A 4ZAZA 4DM4A 3ZE8A 3GPLA 4M9QA 3CLRD 1FTYA 1CKEA 1KERA 1YHNA 1YQGA 1CETA 4FEAA 1TRKA 2I1LA 4RANA 4RELA 4JQYA 5T4BA 3T7CA 2C9BA 5KQRA 1YR6A 1ARZA 1JPJA 2W98A 3L8MA 4WLVA 3RFUA 4FCTA 2FPIA 2JJ2A 2QRPA 1LK0A 3B3GA 2YS7A 3FPHA 4YPVA 5AESA 5BMVF 5DM70 1H1LA 4CI0B 2NIPA 3KU4A 1XEWX 3KJXA 1E5LA 3G2QA 4NNPA 4KPFC 5BW8A 1OT5A 2BC9A 1PJQA 1SA0B 1IVYA 4BNHA 1QG6A 2JEYA 1WD7A 2Q2NA 2YWEA 3FPBA 3LRXA 3VR1A 3WWCA 3ZWYA 2XDQB 3FHJA 3FWYA 3CXUA 3WXBA 3V34A 5ALXA 1EX1A 3AQ4A 3QIAA 3VTKA 1NVWQ 2NO1A 2J59A 1BJKA 5I7SA 4JD5A 1H85A 1U8EA 1YMVA 2PMEA 5JC1A 2G04A 4K40A 3SSAA 3AESA 1KYVA 1HG0A 1NVVQ 1Z6QA 4LISA 4AMGA 4NC9A 4RULA 3NETA 1C1DB 2CXHA 3GPIA 3L7CA 4XAQA 4BB6A 4BNKA 2DPHA 2WB2A 1HR0B 3EZ7A 3ORFA 2O7RA 1ZW1A 2VPQA 1LC3A 1EWRA 1I4LD 4JZKA 2GBIA 2IEZA 4MJ3A 2Z6UA 4CLOB 4PQEA 2FPGB 4IDOA 2ADOA 4D0SA 1WOMA 2ZJZA 3GH3A 1CZKA 5J58A 2KLHA 1UK9A 3N2KA 5A3QA 3KXDA 2ZBEA 4JH0A 5CITA 2CVOA 5DLDA 2JIBA 1RR6A 2BGUA 5J5CA 1IXZA 3WO0A 4BL5A 1UF9A 3ADCA 2QD3A 1T3GA 5DKFA 1M1XB 4NNJA 1IONA 1KIMA 1NLFA 2XNJA 5DI3B 3Q3VA 1T4CA 2PUDA 3UT5A 4M60A 4RCYA 4WASA 1JR6A 4DA6A 1F0KA 4D9EA 5I9BA 3ZWCA 4J0DA 5TY0A 4AO6A 5DHPA 4WK4B 1AQLA 3QJ5A 1AURA 5TQ2B 4HWOA 4GKKB 4G01B 1DG3A 2J3DA 3FVWA 4C76A 1FUEA 2AFIA 3RIEA 3VX4A 1Z15A 1AT1A 3CFYA 3DDHA 1KP9A 2WIAA 3RRYA 2ETVA 4LWQA 5EE0A 4DW8A 1X19A 1NVUQ 1ZRMA 1ZNYA 1H6BA 2HOQA 3FYCA 2YHBA 4R01A 4CLOA 5D6OA 1V4VA 2HU2A 2VJOA 2M2IA 4IEEA 4D9NA 3SVZA 3B6MA 3ULKA 2WABA 1UBKS 3M1YA 4OJYA 1E2LA 5AKYA 3KXPA 1UBTS 4I36A 4BEJA 1A4IA 3IE2A 1CUDA 1WB4A 5LL6P 2J5RA 4BU0A 3SC6A 3RAEC 2NMVA 2C2YA 1DMSA 1BS9A 1XR3A 1YJXA 2D4AA 4J7CA 1MRNA 3LWZA 1PNQA 4Q9NA 4BU1A 5BV1A 3AF1A 5JY1A 2XDQA 3D59A 2OZVA 3CZQA 1HXHA 1GAQA 2ZIXB 1YCDA 3FR8A 1PK8A 3LSTA 3LVQE 1P81A 5DHAA 2O54A 4K2HA 4PPFA 3GUCA 4GLOA 1J90A 1S02A 3AJ9A 3F98A 1P4GA 1Y82A 3ESCA 3I6ZA 2C3PA 1YR7A 4YHBA 3ABZA 4P35A 1E2IA 5G2OA 4AG5A 1AQJA 1I24A 1Q1ZA 4KFCA 4RQAA 2HJRA 2RFLA 4HLNA 4LGYA 4TL6A 3VO2A 1OY1A 3NAQA 3ROPA 1N36B 2J67A 4DIKA 1XTVA 2FPGA 2IYYA 4YAJA 2JI9A 4IV8A 1EK0A 1RJFA 2ZJFA 3KDSE 4XSVA 2BMAA 2IUTA 4YJ3B 2TS1A 3C3XA 1GNSA 3RIHA 1CY8A 4NZZA 4DQDA 1RLMA 3DNMA 3QKUA 2VHJA 5AKJA 4QG7A 4TQGA 3U7GA 3B1YA 2AKEA 5FL3A 3HN6A 1IUKA 3ZHTA 3C3EA 2FCRA 3GWZA 3EMDA 4HSGA 5DI3A 3IV9A 1YRBA 3WLKX 2FEOA 3FDZB 3CPHA 4NBKA 4BLOA 4KOAA 4EHHA 4WBNB 3GWGA 1EM8A 3MBKA 5A7HA 5HWSA 4MSUA 5CIWA 4LPKA 1MQ8B 2H1OA 2DQKA 5TQ2A 1HWYA 4RF4A 3RYFB 3TN7A 4LF6B 4JBWA 5LZ7A 1YZGA 3B5EA 3MJFA 2ZTHA 1ZUWA 3JALA 4NECA 4OJTA 4PYKA 4XLZA 5GZ3A 3GA0A 2ERYA 4LFBB 2JJ8A 4QGFA 1E9DA 2FVYA 2N9UA 3NIDB 4JC0A 4ZEWA 4YMTA 4PZUA 4UU8A 5KWSA 3ZJ4A 3FSGA 1DIHA 4DE5A 5JE8A 4HH0A 5CG1A 1OHHA 4TL8A 1AHIA 1EGVB 1OGJA 1Y9DA 3GZTB 3LHKA 1QGYA 5AJHA 5EMKA 1QIEA 1SCUB 3IQXA 4JA0A 3DT6A 4NFLA 4OB8A 2X9LA 4WRRA 1LLDA 2QE7D 4DR4B 3W05A 2VZLA 5I9MA 3CUYA 1CQXA 2VQDA 1VECA 4MUHA 4EA8A 2J4DA 5K3EA 4DNPA 3B3FA 1Y8ZA 3C70A 2C2BA 4R16A 2FR0A 1XE3A 4FPXA 4HPXB 3ZU3A 2VZ8A 4AY5A 2XUHA 1UAYA 2OVFA 2GKSA 4XCXA 3SHVA 4M0KA 2NO5A 3B89A 1CR4A 4K6KA 2O0LA 4R2KA 5LU9A 4R3WA 4ID9A 1PZNA 2B94A 3WDKA 2VZ9A 1DBRA 2ZIXA 4UCWA 3WK4A 1JDJA 1RQLA 2GLUA 2LPMA 2HD4A 3FWPA 1GZ7A 1PU2A 3GDFA 4OQYA 5IAJA 2AKYA 1N5LA 3IBSA 4ZAWA 1EE2A 1W30A 2YNMC 3NCTA 2DWQA 5TPWA 2PUWA 3ZV7A 4QXQA 4JLNA 5FQNA 4C7MA 4YYZA 5AVSA 4OYHA 3OT4A 1Z75A 4DN6A 2YZGA 1Z33A 2RGRA 3HU3A 3IDQA 3NDPA 3OQVA 1UJ5A 2VKTA 4N18A 4RPHA 2UYGA 3V6LA 4QE3A 3QOYA 4C0BA 5EJ5A 5JYCA 1RBZA 4JI4B 1H0KA 2AHRA 4ZOLA 3VNSA 1W0JD 2XHZA 2V0NA 4AK9A 4CM5A 2GARA 5ECGC 1FQKA 1T34A 4MW5A 5CXQA 3AM1A 3DVRX 2ENWA 5HFAA 2A67A 1U1IA 2NXWA 3P0JA 1ZLXA 2ZAIA 3DEFA 4LVUA 3C3YA 5ENZA 4YJ3A 5A3SA 4QDKA 3QVTA 4BVLA 1Z2AA 2VNHA 4LRWA 2GEUA 1ADCA 2PLRA 4HD8A 5DTQA 2G0NA 4C7OB 3HDVA 1HQCA 2AXQA 3DCNA 4LRSB 2R8EA 1YB2A 1UWCA 3N3AC 3ZU6A 4ABYA 4WBNA 2GD2A 1N5JA 1PGQA 1OU4A 4DZRA 5ERYA 2W2TA 4UEJA 1B23P 2IXAA 1Z25A 2P9GA 3WNQA 3SD7A 3KDPA 5CRIA 2FP4B 3RYFA 2FMIA 4U2DA 3MTQA 1X13A 2O57A 3M1IA 4GI3A 4I2NA 1MFZA 2N47A 2JFNA 1TGYA 3QUAA 4KKVA 4K9LA 2H65A 3KJNA 4RZIA 1TM1E 1MVNA 1XK6A 3JZFA 4YJ2F 1WXIA 2H6EA 5EZYF 3GZJA 3UV3A 1XDSA 3NBYC 3WWEA 3IE0A 1SCUA 1NMYA 3L07A 1G5RA 4P36A 2FUG1 1QF6A 2GXUA 2OCBA 1SZCA 3OPVA 4S3MA 1VPDA 2FFHA 4RJ2A 2W00A 4Q1BA 3P19A 3TGWA 3RK4A 2J5KA 4EUSA 1GTL1 1M1NB 3GRYA 3QPWA 5H7XA 1M66A 2IA5A 3FNHA 4EYSA 1YDFA 3I9MA 2HHLA 3RIGA 4DDHA 2WF6A 2CXPA 4EG7A 4PXYA 1NRWA 3OX4A 3LDHA 3A6GA 4KE7A 3SOPA 4EWLA 1CY4A 3DP7A 1FF9A 5GONB 2A7QA 1LPOA 1T3SA 3GARA 3L79A 4P7BA 1F2DA 4AX8A 2R62A 3KTAB 3F7TA 4GMGA 5K0ZA 1TC1A 3ZQUA 4D81A 1BXKA 5TGDA 4R6XA 4C4AA 1Y34E 2VRBA 3QW4B 3P4XA 3KU1A 1QBKC 3B3JA 5G02A 3OZTA 2WBLC 5KQPA 3URMA 2Q50A 1Q0HA 3IDZA 3PNPA 2XB2A 2Q8QA 1HDXA 2HC9A 1GDDA 4H4DA 5C7LO 4H3SA 2HWXA 3IR6A 1N33B 1I3OA 2JZCA 5BR4A 2VEOA 3R74A 1Y1SA 1TT5B 1AZLA 2JKVA 3I3OA 3OZBA 5ETJA 3VH1A 3ZGNA 4CHTA 4OHBA 2HA4A 1VRWA 4DV6B 2OCYC 4HH1A 2VCEA 4MUNA 2C92A 2ASEA 3ZYCA 1JHZA 1RWOA 3HR7A 3N07A 4GVPA 4AG6A 3ZVRA 4C7OA 2CUNA 1EFHA 1RJGA 2FMUA 2Z83A 3JYHA 3IO5A 3N6RA 3QFHA 4LXYA 3BIJA 3UTDA 1J9GA 1NXWA 2P9YA 3WYEA 5EXSA 2C5EA 4HWTA 2QL9A 2GKOA 5KINB 2AEJA 2I65A 2PANA 4GQAA 1IULA 1Z8DA 1J0BA 2RI0A 2FP4A 2XCIA 3EXHB 1YVPA 3GL9A 1X1QA 1M0TA 2FKAA 2E4VA 4BGDA 4ENPA 1HK7A 4DLAA 1BJRE 2EVWX 4YUAA 2L82A 2CYBA 3RV4A 1ZM3A 3L8ZA 4EX6A 3U60B 1M6VB 4JKIA 3T3DA 5CR9A 3GP5A 4PHCA 4YI3A 1CRLA 3M2PA 4M8LA 4Y9RA 4MNTA 1KEWA 3FZQA 1JIUA 4C9BA 4JP8A 4EG4A 4RENA 4EKNB 2FSHA 3J7AC 2IYTA 1M1NA 1H1DA 2R00A 4LE0A 2ROQA 4EAAA 4W9NA 4GX5A 2VHCA 3UG6A 1Q1GA 4LZLA 4L15A 4PG4A 3SBDA 3ACCA 4QTTB 2YX1A 1CZRA 5K6AA 2X9NA 3GJ4A 5GONA 2HK9A 1ZU5A 2J9FB 3HUFA 5DTMA 3WGNA 3KTAA 4DSOA 2PD4A 3H18A 3Q8MA 3P26A 1G5IA 3QVMA 2OMEA 1NGSA 4MI6A 2QB5A 1V95A 1Z18A 2DHQA 2H31A 2JHAA 4KMOA 2CE2X 2IZ5A 1BWPA 2WMNB 5EIHA 1EP3B 3W90A 3MWDB 2UZ3A 3OEED 4BAGA 3EC7A 3LOQA 2H2DA 3PNSA 3QXCA 3SM3A 2JGMA 3VR5D 4P81A 3RIMA 5FO1A 4YNBA 1RM0A 5BWOA 5IM4F 5KTPA 1J97A 3LGAA 4LSZA 4MZXA 3A1WA 4E09A 4LF4B 3ENNA 1P7YA 3BCRA 1GLVA 2ZYDA 4FD3A 1NXPA 1TT5A 3LNCA 3ZLBA 1DRKA 1RWVA 1XDUA 2N1MA 3CZAA 3WBJA 3PIDA 1Z0DA 2EGUA 2W93A 4HC4A 4MWCA 1OX5A 2ZTVA 3IT3A 3UK6A 5DISB 2IGTA 2RHBA 4JLKA 1SVIA 5KEIA 2H2IA 1XT6A 4F91B 2OSBA 1PN3A 2QSYA 3EC1A 4LSMA 4C0JA 3V7UA 3NDBB 4UKDA 2W2LA 5EIXA 3RG8A 5LMCA 3UYKA 1XVUA 4RETA 3EXHA 3ZEAA 4LGCA 2QGNA 4G0NA 3B78A 1M2FA 4F5WA 3EA5A 3S28A 1EJ0A 1ZK1A 3B2QA 4D8UA 4LZPA 1ADBA 3EJ6A 1RYBA 3NB0A 4LG1A 5H4GA 1K1EA 3TW6A 2BGWA 3R0ZA 2J5BA 2VNIA 2WIFA 2XF8A 1TI7A 1TL7C 1JDVA 2PRSA 3WYAA 4XPIB 1M6VA 4YIHA 4MR7B 3ZWMA 3N7AA 4LC0A 3OQOA 2XI4A 2XVMA 1VLHA 4G6ZA 4MV8A 4CM8B 5KYKA 3G3EA 1F6DA 1HM5A 1Y3CE 1EWQA 1QO9A 1W96A 1BCSB 5I3CA 2VA9A 3RFTA 1HTBA 4XZ3A 2RC5A 3IS3A 1OAOA 3IIIA 5DASA 3PFNA 4UUAA 5JASA 3GEDA 1L7RA 2WR8A 3RRXA 1KJNA 2WU1A 3GMTA 3PJGA 3MGAA 1N5MA 1XA4A 5K6AC 4L07A 4DEVA 2J9FA 3WQBA 4YTEA 4EY8A 5EKSA 3DFIA 1RHQA 3BGOS 3NM6B 5JVDF 3LUCA 2VWQA 3O1IC 1SCNE 3QLVA 5DNDA 4TVBA 3MWDA 5H4HA 5BP7A 1NDUA 3LPNA 5H82A 4DA8A 5I7OA 2VBGA 5DZSA 4WNAA 1Y3DE 3LFUA 3SC4A 1FFDA 1KI3A 4FWBA 1KKLA 4LEIA 1CLEA 2G8LA 2VJLA 4JP3A 2ST1A 3OHMA 4A16A 1U2SA 3UAGA 3L06A 5CYFA 2MMCA 4ONEA 4ZARA 3KL4A 3ISVA 1NJ5A 4BFTA 3F3YA 1CFZA 3HCBA 4EG8A 2X9QA 2YVKA 5D85A 1NX6A 1KZGB 2IYQA 1U0LA 3H16A 2E1PA 2XUDA 3O7WA 4GPIB 1QP4A 4JVOA 1IXSB 2HCTA 3OJ0A 4OXXA 2COKA 4DIFA 5GOTA 1E1CB 5DPMA 4G09A 3AL2A 2PKEA 1T9CA 1PR9A 3C5VA 4KE8A 1YO6A 4J43A 3ZWPA 4DTCA 1E3WB 3MWKA 5JHGB 1MOQA 4LDRA 4JWTA 2FPWA 3ZGZA 4OB6A 4Y6GB 2X6RA 3V9AA 5E0KB 1YRHA 1T36B 3MGGA 4M76B 4TTTS 1ZFNA 2BFNA 3F9IA 4FMPA 4IGKA 1Z4IA 3GRUA 3ROZA 4AYWA 4N8EA 4M37A 1L4HA 1U9CA 2W11A 4UBNA 5LJIA 1JLRA 4Q0MA 3V97A 1WEKA 1OFVA 3KQUA 1XC7A 3D0RA 4DNOA 4XPIA 4JQZA 2GZRA 3M5PA 4MR7A 4NENB 3SMVA 4CM8A 2VSQA 1RP1A 1DT3A 1HOXA 1C3XA 5CT4A 1T2EA 3NVKI 1JV2B 3QKSA 3JQ6A 4YC7A 3QFRA 4OY3A 1QZ3A 1BCSA 3L77A 2VYNA 1O7JA 4XDYA 3WGJA 4B85A 5EPOA 2QTZA 2Q6KA 1GPLA 2UVDA 1OAOC 3G1WA 2Q4EA 4P5PA 1W19A 3G5LA 1UJCA 2BUAA 1OB2A 5HGXA 1Z82A 2EJWA 2CFSA 4MTLA 4ASUA 1L5WA 3OC6A 2AJLI 1GQRA 1ORWA 4BMCA 1TYDE 1QHSA 1U1FA 3QQ5A 4DKXA 3EGXB 1P9RA 2Y1KA 1XRLA 5CVCA 3LGSA 4LDQA 3B1VA 5BWLA 1DG1G 4HEQA 1KI7A 5JLAA 1L8LA 4DUGD 5FFMA 3NANA 4N47A 2OA0A 4JYMA 4N6OA 3QLVC 1ORRA 2ODTX 3UJ3X 4ADSG 1NZFA 5LXTF 3UICA 2TMKA 2B25A 2FPMA 3GUVA 4KO3S 4OOFA 1XXHE 4EUNA 4URFA 1JQEA 3GJZA 4JLMA 1A3CA 1AXGA 1JT9A 3KSRA 4OUDB 1Y1PA 5A04A 3NRBA 4UMVA 4HVTA 3LHFA 2ZUTA 4ZVSA 1QO7A 2HEGA 2PHZA 4MHOA 5EGNA 3BIWA 4ZI2A 3HBAA 4MWGA 4O2BF 4ZC8A 6GPBA 5I7UA 2C57A 1OV6A 4BFLA 1CJTC 2DGDA 5HA5A 1PJTA 1E1CA 2ZIEA 1ZCJA 3K0CA 4WKNA 3LYHA 2YR0A 3AFHA 1L8QA 1FFAA 1ZK0A 3HSKA 3ND9A 1E3WA 1NXSA 3WHKA 1NF9A 3ZC3A 4AYXA 4PG5A 1O95D 4CU2A 2B6NA 3LPAA 2DM6A 5FORA 3RFXA 1NUSA 4BP1A 2AD5A 2FR8A 1ZD1A 3A4YA 4GKAA 3W2FA 3WLJA 1FDTA 1T36A 2A0FA 2QG4A 3H1GA 2I2WA 2MWMA 2X23A 2YQ5A 4XYEA 4KU4A 4E7OA 1NYRA 2ID4A 5J47A 1X1DA 5JMWA 5DNUA 3GUZA 5JW6A 4UEQA 1T9GS 3ZVNA 2OAP1 4GMDA 2YHAA 2VWHA 4HFMA 4JHXA 1Q11A 3C6ZA 3F2VA 4CQJA 5C1OA 2Q4DA 2OUKA 3AINA 4FMDF 4RYDA 3QE9Y 1LF5A 1CNFA 4KR3A 4RPGA 2B2XA 4MYSA 4NENA 2BR5A 1OYOA 3MVEA 4LHEA 2NXNA 4BVGA 4K6OA 4Y2HA 1MAAA 2RHHA 3BERA 3BGIA 5FBQB 5JO0A 2O3RA 4XW2A 3O8OB 4Y18A 4NEQA 3RB8A 4ALIA 3TZCA 1IEQA 1SEVA 3L7MA 3D6TB 1KSJA 3LUGA 5AT1A 1TUIA 2B7CA 4M0FA 4BX2A 4L5YA 1SVSA 3GFRA 2IDZA 1OPRA 5F9MA 2ZAOA 4MB2A 4C0LA 4U8GA 2WUVA 2I78A 3G2NA 4H27A 3I5AA 4MROA 4MGHA 5HE9A 3T8YA 4ZI7B 1TK9A 5AICA 3D6FA 3CJRA 4KJZA 4BRUA 4YQZA 4MV6A 4BVAA 5DGXA 4L5AA 2H85A 5BRNA 1ZXBA 3EGXA 3ZDEA 3HS3A 3MJTA 3RD5A 1B74A 1E9VA 1N1EA 2IBMA 4JGIA 2O7QA 3F78A 3W2GA 1I2MA 4KN8A 2PUBA 2BCJQ 3VC7A 4GPZA 4QJ5A 4P9NA 1P44A 2ZJ4A 3UKOA 1KFCB 4M1MA 5JEDA 2NPIA 4P3NA 2QRLA 2DLNA 1G38A 3GFPA 2G4VA 3EAFA 4KXXA 2UZIR 4NS1A 2P0EA 5FH9A 3V48A 1QAQA 2BUBA 4OUDA 4Y2JA 2BSXA 5JOQA 4QNNA 3IBYA 3M3PA 2EF1A 3NI2A 2OK7A 2M98A 1IWBB 5J1TB 4F4JA 2I2DA 2SKDA 1PHRA 4IKEA 1T91A 4ZICA 1O97C 1SXQA 3HO8A 1UPFA 1C3LA 5AUNB 3IBTA 1N2HA 4K3UA 4LI0A 5EY5B 1EAYA 3GCXA 2QZSA 3UJAA 5KX5B 1Y1RA 4OQ4A 1BE1A 2BM9A 3W3AH 2P3SA 4RPLA 1BIFA 1YZNA 4M0MA 1ECGA 1P1RA 3JS5A 4WERA 4ZCMA 2RGNA 1AHPA 4N3AA 1VJ0A 3K0CC 2JLWA 4LZWA 3LQ1A 5FPQA 2CLDX 1X6VA 3Q72A 3NUGA 3VAZA 1VJDA 3S40A 3WYDA 1L4BA 2EATA 2RK4A 2H51A 3ITDA 2FR8C 2CDCA 2LV8A 6ABPA 3SVTA 1TAUA 1DJNA 3H1PA 3SYTA 2VXBA 4JJKA 3VVBA 1CDEA 5DCLA 1FU8A 5DHFA 2X4IA 2Q3MA 5JWOA 3HUTA 4JYZA 3CONA 2YXLA 4OP2A 1Z6YA 3I34X 3SR3A 3LE8A 4KN5A 1JHYA 4BVEA 4EB3A 4EY5A 1F9AA 1BC5A 5IT9A 4BQFA 3OO0A 2YZ7A 2GHRA 3K0FB 5M2QA 1E4OA 2WJIA 4NBTA 2FZLA 4ZT3A 1FVHA 1P7ZA 1GGMA 4GBED 4GXNA 1RZRA 1HNXB 4RKRA 2W6ZA 3OM0A 3O8OA 4IG9A 2UVQA 4N3GA 4EPXA 3E81A 5TEWA 1EXMA 1J5PA 2NUPB 3HCRA 1GFSA 3H2JA 4NV0A 4HN9A 1LC0A 2OHFA 4NZOA 1NMEA 4Q1FA 4ZYXA 5I51A 4WK2B 2XNDA 1G60A 4RZSA 3AVOA 4GM4A 3BL5A 1ZJ6A 3DL2A 3WRVA 1JEAA 2I8AA 3JYPA 4RTOA 4RF5A 5D3KA 1Y6ZA 1UWLA 3CZ5A 4RMHA 3TM5A 3KUKA 5FUXA 1QB7A 2O20A 4A10A 5JJIA 4PE5B 4F06A 1KVRA 5LLTA 1EG7A 4J6FA 2MSCB 2NM0A 3WGYA 1GKKA 1MO5A 2C4WA 3WWPA 1CUHA 2F3QA 3IALA 1GY8A 4MLCA 3UJ8A 4AJNA 1XEFA 2YOFA 4U3JB 1IAQA 1C30B 1M7HA 1N5OX 5HILA 4YROA 2E48A 4A91A 3KJHA 1SO8A 2Y9PB 4IDHA 2Q8PA 4WXHA 2YJGA 1POXA 2AI3A 5C5IA 2C61A 4KI0A 1B8NA 2CSXA 3QYFA 1VRVA 3O8LA 4G67A 1CUJA 2R8OA 2AR9A 1GVNB 2IU6A 2PQ0A 3U3DA 1BHJA 2QG6A 1MUUA 2WZBA 4N49A 2EFCB 1S6YA 4GI5A 1IOLA 4UAUA 2FA9A 4D6XA 1GRVA 3HYNA 3NIBA 4OGKA 3KR0A 4D82A 2VAVA 1U63A 2EHDA 2RGNC 4YFVA 3V8RA 1CXZA 5M7EA 4OCZA 4CVNA 8ATCA 3R7BA 4Z7QB 3ZLVA 3V4RA 1YB7A 3LT5A 3TZKA 3NT4A 1C3OB 5FP0A 5BN5B 2W90A 4A1FA 4C04A 3CF4G 1KNXA 5KNLA 4YCBA 3ZI4A 1KY3A 4PINA 4W99A 3VYRB 5JNTA 3HYTA 3A2LA 3ZVMA 3PS9A 4MVCA 5GV7A 3WNDA 3GLFE 1YKGA 2KMLA 4JCCA 5LZ8A 1LV8A 3K0FA 2JCYA 1GGVA 2AN5A 3C3BA 4WY8A 4B3CA 2PL9A 4J0JA 5B3JA 4INZA 3ROEA 2JCBA 4IUBS 3D3WB 4YAKA 3OOWA 3Q3CA 1TU4A 5K3FA 3SJ7A 2X7JA 2NUPA 1GR1A 5LM3A 4BQEA 2GVNA 3CZMA 2B35A 4KG7A 5JH7B 2OKGA 3QVXA 2C04A 1PEDA 3CV3A 3B6KA 3GAMA 3VU3A 5IKEA 4ZFNA 5CURA 5MF6A 2X4DA 5F3RA 4D4KA 5K3AA 1DTEA 1EB9A 2GPYA 1NJ8A 4RVGA 4NRDA 4CL3A 1V8OA 2PZGA 4OXQA 4RE6A 5AVRA 2E21A 2K87A 2IOFA 5EQDA 5H3LA 1RXEA 2GN0A 2E89A 4Z9BA 5HG0A 1SCJA 3KETA 2QN1A 1XBTA 4JL6A 3P9NA 1DOZA 3CNHA 2YWGA 4LJ8A 5CM8B 1UOQA 3BFXA 1HY3A 1PT6A 1FXWF 4KPUB 4CMIB 3AKCA 3Q7TA 3TBKA 4I4IA 3HYSA 2AMFA 4PRZA 3LTEA 2G76A 1C30A 1LSSA 3JVIA 3T1OA 3Q88A 4M46A 1QFXA 3ZDQA 221PA 4D9CA 5B57C 3C0KA 1ACMA 1X3SA 5FO0A 1NASA 2NSLA 4HCJA 3PB3A 1DPFA 2O5EA 5JNSA 4OBWA 1RAEA 1QYXA 1Z34A 5E2BA 1GN9A 5EINA 3ISJA 3K5IA 3RBVA 2J3QA 4A2WA 1ZBQA 2D00A 3GVHA 4M9SA 5E0OA 4BRSA 4TQ9A 1L3IA 3OF3A 3SEFA 3OFSA 3AKYA 1ONNA 4BNXA 3TIIA 4HNVA 1OH7A 3A3YA 5IP5A 1AQYA 1RZVA 3D64A 4P53A 4ZO6A 5T4FA 4OUKX 2FOIA 4ZCRA 1MB9A 3EHEA 1L1FA 4OX9B 2O8CB 4U0KA 3HM9A 4C89A 3F3SA 3OLCX 1DKOA 1NI3A 1C3OA 3UK7A 1DZIA 3WSWA 1UMDA 1ZOSA 4TXMA 5B53A 1JR3D 4UCFA 2OWEA 4B2IA 2DB3A 1SMKA 3BZUA 3N8IA 1V9CA 3CIFA 2EOAA 2GFIA 2IDKA 3VR0A 1YVDA 4LBZA 3HSSA 3WLEA 1MC5A 1JLSA 1PJ4A 1NVBA 5FLYA 4K8RB 3T7JA 3SAJA 3D81A 2Y1DA 5TEVA 2WUGA 2Z56A 2ZYAA 5B3JC 2W37A 3FJYA 5AUPB 1G1AA 1I5OA 1WDKA 3L46A 4UZEA 1WR8A 3BQ9A 4FDLA 2Z8YA 3ICQB 3QBJA 1DQZA 3DBRB 3V8BA 1E63A 1IBCA 5LZ9A 2H2GA 2O0HA 2QVCA 5BNWA 2D1FA 1NUQA 5JU6A 2X5OA 1ZIDA 1SKMA 3RS3A 3WMXA 5KNDD 2XUOA 2PMWB 3TW8B 2OZLB 1CDZA 4R2JA 5H59A 3SXPA 3HHPA 3TQTA 3UWSA 421PA 4BVKA 4EYOA 4Z99A 4PV7A 2HHAA 4RABA 3MMZA 2ZJ5A 4CM9A 3CLTC 4HAUA 2DUNA 4JR2A 2WQ7A 3FTFA 1QHXA 4RTJA 2Z98A 1M2VB 4FILA 2K2WA 2ZLBA 4JR0A 2R6DA 4K9QA 4L0CA 3PC7A 4KPUA 3F1KA 2COUA 4TYYA 4F04A 2IHJA 4MP3A 5EHZA 4YRDA 2X0DA 4DR2B 4LSWA 3WWOA 4LJ4A 3QKWA 4OA8A 3G2HA 4CQMD 3EZ6A 5KNCH 2I4RA 5IJXA 1RVV1 3CEMA 1F8UA 3ETJA 3VDXA 2OBFA 5JDIA 3BFJA 3EODA 2B30A 3W8FA 2X0JA 4BRWA 1H4QA 2ZE5A 4GUAA 3IYLW 3IB3A 3G1TA 4CI9A 4E94A 3IPLA 4E5UA 5I5GA 4B3RB 1P75A 1ZKMA 4MVJD 1R1DA 3KEOA 3NM4A 3R3XA 5ALQA 1D0SA 4FHGA 2Q6IA 3TRIA 3TAHA 1NKVA 4HH4A 3DQQA 1H8EA 4E2YA 2IXFA 4JOQA 4RVFA 3NKFA 1UOOA 3RSCA 4QXPA 1M5UA 2EX4A 2O8CA 1Z5WA 5C8ZA 3IP9A 5DJ5A 2PWAA 2WTUA 4DLXA 1E1YA 4RGYA 3T61A 1VI2A 4S1PA 2Z3ZA 4XOIA 5H0IA 1P6XA 4Z4FA 4C43A 2O1WA 5B37A 2C99A 4H35A 1GTVA 3BKXA 1BS1A 2HCJB 1QYIA 3MYYA 4FGJA 1JA9A 4AWAA 5HQJA 1TT7A 3K1TA 4IFIA 1Y8RB 4TMTA 3WKCA 3R9XA 2PJUA 5HXAA 1QK3A 4FFLA 1LBQA 1OR8A 1RTKA 3H17A 4HEA1 5FBKA 3SZRA 3U1VA 3A2KA 1MC4A 1NWCA 2BW0A 4NZYA 1I5EA 4UBJA 2JFYA 1CUCA 5HF6A 5L4LA 2JAHA 3DBRA 5L7TA 2Z6VA 2FJPA 3ONFA 3QXHA 5A9TA 5LWQA 5G3YA 2A86A 4R9RA 2FWAA 4KOEC 3L0IB 3RANA 5A6SA 3UAXA 3QVKA 3A4VA 5CH8A 3W1WA 1QRSA 2O59A 2CK3A 3AEQB 4BFCA 2KX7A 3TW8A 3NATA 4RD1A 2OZLA 1DDOA 2P40A 3HVRA 4QBGB 1I1NA 2OAEA 2CVZA 3SIXA 1BU8A 1DV1A 3EGOA 4TS4A 4OAOA 3WLAA 1M2VA 1PSZA 2F67A 2Y93A 5TGZA 4DARA 5JS8A 5M29A 2Y0BA 3QVWA 4C6TB 4GXRA 4OHZA 1QQBA 1IB0A 4M2LA 3SX0A 5ALRA 4DCUA 1J20A 2Q3DA 2YC2C 3ZWWA 2YC4C 1GTMA 3MRTA 4S1WA 1BD4A 1GGJA 1A7AA 4EGFA 2CEKA 3O8BA 3V1UA 2P62A 1DXYA 3P45A 1Q0RA 4C20A 2R4UA 4WXRA 3PU6A 1I4TD 2PSHA 4G56A 1AY0A 1GUFA 3NYRA 2PJRA 1YQDA 2WFZA 1MU0A 1EGMB 2HK6A 2ZBPA 4QRDA 3T7SA 3TX2A 2PUGA 2PRYA 4FSHA 1NC1A 3VHLB 3HJGA 3SDBA 1AGRA 3GDGA 1UT8A 2XEXA 4D45A 1EIWA 1ACLA 4RORA 3ZIDA 1HE1C 2I22A 3K6SB 1J39A 3NIWA 2Y0DA 1MEOA 1YS4A 2Y1OA 3FTPA 3L1IA 1LPAB 3FY4A 1XYVA 1LXCA 1VCHA 1OYYA 1COWA 2FEMA 3RVKA 5I6DA 2QI9F 1EGHA 5MFZA 4OHOA 1OFHA 2ODQA 3TQHA 1E77A 2I76A 1PFQA 2C9MA 3KWMA 1J99A 3O2QB 3DMGA 3A1TA 3M5WA 4JJIA 4KQ9A 3UUEA 2ZT6A 1XYGA 3JAKB 1JNXX 2HA6A 4H2DA 4WK6A 4GGMX 2BN4A 4YRTA 3VKGA 3FKSD 3HB9A 3PJEA 3PUKA 3O3MB 4WESB 4AULA 4DFDA 1Y8RA 1JQBA 3MQ2A 4PNHA 3W8EA 1B43A 4AN1A 5EJGA 6REQB 1X8JA 2JAOA 3QEAZ 1T5IA 4JJ4A 2W7TA 1KJ9A 1DUVG 5IT5A 3QX8A 4A5SA 4DBZA 4UHCA 4D8WA 3FW1A 2HQOA 4PHHA 4ZMBA 1K0FA 1IHPA 3EZ2A 4XIYA 5HFJA 1KH2A 2XUGA 1J23A 1RZ3A 2JFWA 2JFFA 1DC5A 2ACVA 5LB2A 3T15A 4CKZA 2AXPA 3AEQA 3ESXA 3G2KA 1ZX1A 3ZDBA 1THTA 4QYTA 1Q16A 3LWBA 1A1VA 1IL0A 1M7GA 4FCCA 2EWWA 3T4XA 4D3XA 1GTZA 5ALEA 3U7FB 2WJYA 2O2DA 1EK1A 5DMXA 5F35A 1E4EB 2JJ1A 2QR5A 4PFQA 4C6TA 3BG5A 4J2TA 4F4UA 2X0RA 3RQIA 2ORED 1A7UA 4E03A 2OORA 2OV4A 2WM9B 4LNUB 4YCDA 3E5MA 5AVVA 3QEKA 4B8ZA 1SCAA 3MGCA 1S9DA 2CVFA 3EFBA 4P7KA 1XDGA 4CQLA 4R1PA 1J1IA 1Z13A 1JU3A 2X2OA 2QPOA 4TKVB 4TUYB 3EEIA 2QVGA 4MPJA 1M1ZA 3DOIA 3AK4A 1V8FA 3HNOA 1LV7A 1MJ5A 2F3PA 4WWHA 1L9KA 5LZ2A 2XX3A 4O4IF 1XRMA 3DVSX 1ZMOA 3L40A 4INJA 4L5JA 2O4CA 5K2OA 2AN1A 3SK0A 2YYZA 4D1YA 2AYYA 3K6SA 4DUYB 1ZD9A 2BT4A 2C5GA 4Y0NA 3B53X 4N0QA 5G0SA 4TYPA 2UVPB 5D00A 5B5SA 5I8WA 4HN2A 5E9AA 4P3XA 5LQSA 3OEWA 3VKVA 1FUKA 2Q5HA 1JEDA 1RYZA 4GM1A 4JIGA 2XV1A 2JD1A 4LDNA 4MVJI 1WX1A 4ND7A 3P0IA 5H70A 3S27A 4UQLA 2ONCA 5GGXA 3OTGA 4QUEA 1YE8A 3JAKA 2ZR7A 1Y5NA 3OTOB 3ZZTA 1VKOA 3PKIA 3SBXA 3HPRA 2F17A 2Q2WA 1WUTA 4WESA 4B7ZA 1JDNA 2LWIA 5JG7A 4F6CA 4JKYA 1ISIA 3RODA 4JDUA 3H7AA 4FOPA 4L51A 4KSCA 4YHHB 6REQA 2QVZX 4MIYA 3ZZMA 1KZ1A 2VZEA 4DZTA 1JI3A 1L7VC 5CW1A 2OO7A 1FJ2A 1F1BA 2XZPA 4IGEA 3IO3A 4NAVA 5J63A 5BN1A 3TW4A 1PVOA 5GAJA 1R15A 4LXUA 4TWBA 1RWPA 3NHZA 3QPDA 4CG1A 3K4PA 4P86A 5CFQA 3U81A 2QXTA 1G4HA 2BMFA 5LA6F 1XQXA 5CBPB 1NRIA 3BF7A 4H18A 3OZCA 1CR6A 1JALA 3W1EA 5KVVA 2I54A 1M1YB 2CCGA 2G0TA 5LWHA 1ZSNA 3LHSA 5E3IA 4K86A 3AJRA 3EXEB 1KTIA 5HJ7A 3H4MA 1KFBB 3TTWA 1QONA 1IOZA 5DRYA 4B6FA 2XLBA 1JAZA 4QOJA 1HDRA 3PE6A 3MD0A 2UUCB 2C1XA 1S2NA 1JKXA 5ALOA 4RXMA 1E4EA 2GSWA 2GEFA 1T1EA 2Q4TA 2VSXA 4MW7A 1UZAA 4YCMA 4TZKA 6CHYA 3G9UA 4P4GA 1G8AA 2X58A 2Q0QA 2WUFA 1ZOOA 3QPAA 2OORC 3TS1A 1JVSA 1TPYA 3NHSA 1NW8A 1GLNA 5FR1A 3CJQA 4EKYA 3TTVA 1W4LA 4LMRA 3FTDA 2HYIC 3ZV3A 1U98A 2PIDA 4TKVA 5CYGA 2JHFA 4TUYA 4F4HA 2Y67A 4DHEA 1XZJA 1R9GA 3IP5A 3U44A 3T1QA 1U2TA 2GTHA 4PU0A 4KGZA 1E3SA 1VIVA 4UNNA 2QMYA 4DOMA 3GGCA 2BTOA 3QWAA 5F1OA 2GPAA 5JDCC 4WLUA 3GHYA 4YQFA 3I04A 2CNLA 1O8BA 5IAAA 1R0YA 3VDRA 3NH9A 2C7PA 3H6KA 1EE1A 5E2AA 2GGSA 3UWKA 2XXAB 1FNCA 2NG1A 2CFCA 3TI9A 2XMBA 1JG3A 1MOSA 4UBMA 1KAEA 2UVPA 3D7NA 3TR0A 3J81k 1AE1A 4W8HA 4ZZ0A 3DOOA 3MRVA 1OLUB 1E1KA 3R9KA 5K1ZA 3IPYA 1GILA 3M81A 3ZD7A 3GDWA 1JEYB 1U7XA 1ZINA 3U19A 1H2HA 2WMOB 2IPOA 2H08A 1IBRA 4FZVA 3FB1A 1HYQA 1PQ4A 3CPJB 4KVAA 2DG2A 3VZRA 1N6KA 2VDMB 2XH8A 4PPGA 2QIOA 4ENWA 5LNK1 1XRSB 4JX9A 4K9KA 1U8AA 1NM5A 3C1OA 1C14A 1X1CA 1KI8A 2C4UA 2WVAA 3MUNA 4XYMA 5TQVA 4AJLA 2A94A 1KAOA 4ZEXA 2GM4A 3U6KA 3PIRA 4C4XA 1MKYA 2C88A 3BWCA 1Q7BA 1HE4A 2H92A 2VRCA 2BP7B 4UMEA 5DWQA 2NVBA 1M67A 3JRXA 2ERXA 2EF0A 1TJYA 2GZ1A 1FP1D 3O75A 4GOLD 4L1KA 5BPFA 1QE0A 5CBPA 5L6LB 3CVVA 4WBSA 1XZFA 1GV0A 1GCGA 3QY9A 1M1YA 4CMHA 1PT9A 4ZVTA 4DJTA 1JSRA 3D4IA 4TRNA 1FFHA 1X92A 4LKRA 5KI6A 2BSAA 2IPNA 1EIZA 1EPUA 1V3QE 2OD9A 4Q93A 5TF4A 3K70C 2Q3BA 4RWEA 3F8WA 4X1OA 1M2OB 4G1CA 3R0VA 4N0DA 1TUGA 1LEHA 2H1CA 4A6DA 5CA1B 5BMOA 2VPTA 4JLUA 3V7YA 1WZEA 4TS9A 3WBFA 1FYDA 2WF7A 2Y05A 2AXNA 3BBLA 3KBOA 4Q7JB 2A30A 2R7LA 5G40A 1SRQA 3ETGA 2Q5CA 3VZBA 4IQFA 3OP1A 1L5RA 2SHKA 2XTJA 3IAAA 1E2HA 2BGJA 2IIBA 3EZLA 3UMYA 2A9KA 2OXEA 3A4TA 2OR3A 4FNAA 3MWLA 4ZAYA 4W5WA 4JV5B 4M1QA 2AD1A 4L8YA 3CUVA 1SVMA 1FPMA 1UAAA 2GN2A 2R6AA 3LECA 4WXPA 2XXAA 3H5VA 5BUCA 2QTLA 2PMBA 4XM2A 2HA3A 4UBOA 1XNHA 4YRAA 1VE1A 3WRYA 1OLUA 4KRYA 2R87A 1ULTA 2ZIVB 3DYVA 3EC2A 1XTRA 2YXBA 5C52B 2H4FA 4A2PA 4ZTUB 5FWXB 1Q0LA 2ZCUA 3BFKA 4OEHA 5HJ2A 4AUKA 4INPA 5GZ6A 1G3MA 5G53C 3KE9A 3KSUA 3SBOA 1YDHA 2I66A 1UC4B 2XCOA 2XMGA 1GZSA 3A6KA 3GJ7A 4OQXA 1D6MA 4TT3D 4X84A 4ZOCA 5DYIA 3VR3A 4U2CA 3RYIB 1O08A 3W4KA 1OCEA 2PWZA 2Q8NA 4JEIA 2AV6A 3RE1A 2RB4A 1NULA 1NM5C 1PJZA 3NNSA 3OU7A 3Q7IA 3QOFA 5EP4A 4H1WA 4E7PA 3VJRA 4GUDA 5DHUA 1N2ZA 1PJBA 3ZWAA 1TYEB 4LWPA 2X86A 1EQUA 3FTCA 4MTCA 1Z07A 3L6EA 2IHNA 2GHQA 2BP7A 1H8HD 3CEHA 4E6PA 1F9EA 5HKKA 1AUXA 3Q41A 2DPLA 4QDZA 1JAXA 3INNA 4J1TA 5BNZA 3NZEA 4NCAA 2BMJA 1Z37A 3EEYA 1KK2A 4M49A 1KEEB 2C7VA 5EZSA 4EEZA 5LYJF 3T3IA 4MVJF 4CT0A 4JYPA 3R7DA 5TR9A 2DH5A 3FTEA 4B48A 3RV3A 1PLKA 2XNKA 4J0IA 4NAUA 3AZQA 3FMVA 1I80A 4I4NA 4KUEA 3RVOA 1U2RA 3CCFA 2QENA 2VBCA 2IEBA 1M2OA 2JD2A 5AW4A 1FYWA 3NRJA 5KOYA 1PNRA 1P1KA 4LJSA 4NPHA 5A0FA 4DYVA 3VM6A 1FQJA 1ZL2A 4G89A 2NAPA 5CEJA 1NE7A 3KZVA 5AK4A 4D5EA 4EYGA 5IN4A 1ZUNB 2Q1UA 2QW0X 4TX1A 2PXHA 5CT8A 3O1HB 4L74A 4XIIA 1DBIA 2II6A 2FSIA 3FGOA 3P0EA 3L6UA 3O1LA 4DJFC 4Q7QA 4KNYA 1Q50A 1XOIA 1DFIA 1CB0A 4FBLA 4I50A 5IM5A 3RJZA 1I3KA 2H7VA 5EUCA 3RS5A 4B3MB 2GD0A 4QDTA 3AR4A 1RQRA 2YJZA 2BR3A 5JI2E 4IXTA 3EQ9A 5K8IA 1T5LA 3U1BA 3H0KA 1B2RA 1W5FA 1YE3A 5C8YA 2C0PA 4Q24A 4H7FA 2EX1A 3U3OA 3WMFA 2HL6A 2NUBA 4CEJB 5J2TA 4I9HA 3T3GA 2QVLA 4M7PA 1E9EA 2ZIZA 4EPVA 1PV2A 2XVXA 2HJ9A 3DW1X 4XGNA 2ADFA 2DLDA 3WRYC 2P2ZA 1P7VA 3BXEA 1F8GA 3L0ZA 4N9WA 1RHUA 5FFNA 5FHQA 5FWXA 4BKUA 4YRKA 1VP3A 4ZYZA 2P91A 4CMAA 4IXNA 1H69A 2H9AA 3L1UA 4ITRC 5EQFA 4WBXC 5LP1A 4Y1FA 2WKPA 1OWPA 4ERNA 5ARBA 1SHKA 1HFEL 1FPQA 4XQGA 2ZIGA 3UH1A 3KZCA 3C6YA 3F5DA 2WICA 3LA6A 4M83A 4J94A 4BE9A 3RRZA 1Y7IA 3QPCA 4YR9A 2P1RA 2Q5QA 2X7HA 3U9LA 2AG0A 2P3OA 3EIUA 4CFSA 5T6MA 3S55A 2R6ZA 1D0IA 5SZJA 4DDWA 4D0RA 2JLVA 2QZ4A 4J29A 3NC0C 4ZCTA 1GPMA 2B20A 3I45A 5HRAA 4D3DA 1RYDA 4J1TC 2GAFA 1KDTA 5J4YA 3KXIA 1KEEA 1XB2A 4LTDA 4F93B 4JUDX 3QVGB 3IUJA 2DFPA 5EKDA 3H0EA 2VDUE 4K9RA 1P4SA 4RH1A 1CG6A 1N7HA 2P9FA 3Q6IA 1PE0A 1WHTB 1ZD3A 4HV4A 1AKTA 1L3CA 4LV5B 4EF6A 2H0AA 5CBKA 5JFTA 4C0XA 2Z0MA 2NU9B 1JJFA 2MIIA 4XWTA 2CMKA 5BR1A 3AGQA 5LMUB 2BTQB 1TADA 1LPBB 4NHOA 1UZUA 1J8MF 2WA1A 2QVBA 3R5SA 3W77A 3AF0A 1CS0B 4PN7A 2HQ1A 4M9CA 1WSDA 1W36B 2ZUDA 1EWKA 2HH9A 2JVJA 3OQHA 1ZITA 3PXUA 1NBMD 4JT8A 2AFHE 3VGJA 3GJ8A 4L4ZA 3A8TA 1JHPA 1EDOA 1NDHA 4CIAA 2CL0X 3MJSA 1WSWA 2E7ZA 4IR7A 1DIOB 4IIEA 3O4HA 1QLJA 1PVDA 3K8QA 1B73A 4FUQA 1N6PA 1BE0A 2IE8A 4CF4A 3VR5H 3DKPA 4PWZA 1L4FA 3UCEA 1QHHB 2WTNA 1AZTA 8AT1A 2HPAA 2HXGA 4P7GA 4YQYA 3FGPA 1SN7A 3R40A 3TLXA 5H3HA 4CEJA 1NQTA 4OHFA 1RXWA 1HFWA 4FONA 3D9QX 4OH7A 5AYVA 2CXXA 1WXQA 2INGX 3R3ZA 1CY7A 1FJHA 1KU6A 1ZZEA 3CLSC 4R1LA 4XQ0A 4V0RA 4CBVA 1OZAA 4Q9DA 4K9SA 4ND5A 1UJ4A 1UP6A 4OYRA 2CWDA 2VRNA 3AB8A 1PJRA 1YR3A 3GGDA 3OX3A 1L8OA 2PRIA 4RKEA 1P0QA 2FPXA 4YMIA 4ZAGA 3RLFA 1FA9A 1KEZA 5FI3A 4H77A 2FN9A 5KYTA 1GKYA 1GRQA 2FWNA 3ICCA 2DBQA 4HDMA 4DMGA 1MX1A 5HZHA 3C5HA 4OKNA 1KIFA 5KTRA 4MDHA 4PVDA 3ILHA 1UM8A 4MPRA 1GKLA 1R0SA 1S8AA 4LAFA 3IMFA 1WXXA 2WWGA 2WKWA 1TKCA 2JGJA 2ZJAA 2BY4A 5GQSA 2XT0A 1Z4OA 4ZQCB 2OV1A 1YZFA 1K8QA 3G7UA 2Y0PA 3SWWA 2EW1A 1MRZA 1DJOA 2GAAA 3LAWA 2JJ2D 4ZDIA 3QVUA 1BDBA 4UTOA 4YP9A 4BNGA 3R8FA 4RJIA 4UE6A 3PT5A 1A7JA 2FSSA 2ZRIA 3NCHA 1NNUA 4F9GA 4UM9B 2G1AA 3SEAA 1BO6A 3ZXSA 3D8UA 1A77A 2XODA 1CFJA 2NU9A 2RGXA 1XZNA 1ZN7A 1DC3A 1Q3KA 1ZIPA 2C5AA 3AR7A 4R1NA 1KARA 4B35A 5EMHA 3ZCQA 1HLDA 4BASA 2BTQA 5LMNB 4GP7A 1UL1X 1SVUA 4R7TA 3REOA 3RS4A 1LJLA 1CS0A 4DMMA 1GL9B 4J4BA 2PFGA 2YFYA 4LUCA 4C2AA 3I53A 5GJCA 4E88A 4HGZA 2PGOA 3H5AA 3I0ZA 4J9VA 1NXOA 1A9XB 2IXTA 3IP6A 4WFKA 2CMHA 1BH6A 1JF8A 1OZ0A 1YJAA 2HGSA 4OQNA 4X9XA 3W5VA 3O74A 5JIBA 3HABA 5CJJA 3I9LA 1C4XA 1NT2A 2D7CA 2EDAA 2OV2A 4WI1A 1E20A 1P73A 2BL4A 2Q5EA 2VP2A 1TAQA 1IBMB 1S2IA 1BN7A 3CW9A 4DLZA 2ZYGA 1R50A 4F8EA 1QHHA 2HB6A 4G41A 1O96B 3QV2A 2A9FA 4QT4A 3AILA 1B1AA 1C7IA 5EXEA 3BULA 5G1OA 1RYNA 5KWVA 4Y2GA 2BGLA 3QLTA 3LZDA 3U0VA 3HWX1 3I1IA 5AJXA 1J1ZA 2BLNA 3UXMA 1AK9A 2OHVA 3FWKA 7MDHA 3SMQA 3EUWA 3DZBA 4EHKA 3TLAA 3I8SA 5IXYA 1OWLA 3DULA 1E2BA 2CHGA 5B12A 3AF5A 5BMVA 2BGIA 4MAFA 3TSAA 3QEMB 4A36A 5CCXA 1I0IA 1QVAA 3IQIX 1I36A 5P21A 3D8BA 13PKA 3FYTA 1MA0A 4EPYA 1SCQA 2OP0A 3FIUA 4P93A 2JI6A 1IYZA 3ANYB 4U7FA 2EYQA 2ECPA 1BGXT 4WCFC 4Z9AA 5K51A 4EGQA 2WJJA 3MRXA 3WYFA 4KE9A 1SXIA 2BJHA 3FLAA 3CR8A 1VC2A 5TARA 1TJ4A 4TMFA 4QXAA 5EJ8A 4JLSA 1H05A 2REBA 1IEWA 1IN1A 4BE7B 4JBLA 1XTBA 1X8KA 2H1LA 3FSEA 4B09A 3BZWA 3K0EA 4DG9A 3H3FA 3PXDA 1HT0A 1PS9A 4CPDA 1ITZA 2JGFA 5HZMA 1RLJA 5JS1A 1PWHA 3BPSA 3Q8XB 4XKJA 5KJ6A 1V2HE 2BDTA 1EBFA 2DUWA 1PGJA 2JI4A 3ANXA 3G8CA 2P2SA 4MR9B 3BXFA 4PPYA 4DLVA 2B98A 3OLXA 2YXNA 3ER6A 3AR2A 2I4LA 4PLTA 3ER9A 1F06A 3SFZA 1N3BA 4D5GA 4MUMA 1UPBA 3AY7A 2DPYA 4MRAA 4F7WA 1JECA 1PW7A 3G7SA 1ZC3A 4URZR 3W0LB 4PLVA 2QUIA 3ORYA 2JGAA 4PW0A 3WIDA 1EK2A 4JXZA 2XTNA 3ASUA 4HFNA 1W36C 2GCIA 3EUFA 1A9XA 4OQPA 5EZ5A 1YXMA 2W48A 3ICVA 5F51A 3ZWDA 3I09A 2H8KA 3I12A 5FWNA 2B6HA 3PC3A 4EF4A 3UG7A 4FE7A 4QICA 1HNWB 4GPEA 1BFUA 2BZSA 2H4ZA 3SF0A 4L27A 4WX2B 2NYUA 3KOUA 4YRMA 1BX1A 3LJKA 3PYMA 1O96A 3RBZA 2VCYA 2XWQA 4PZYA 1FX0B 1PJSA 1U3FA 4DCMA 2YVLA 1TMOA 1WTCA 4JASB 4MICA 2EG9A 3IJ5A 4B4OA 3R7SA 3EVEA 3KPJA 5F7JA 4IMJB 1GQ2A 3AXSA 3F67A 1PWXA 3IAFA 5HM8A 4CLEA 4BP3A 3U4IA 4IX9A 4P4NA 2W6IA 5E3JA 1RT9A 4NV1A 5H1YA 3WGGA 2O14A 5AJVB 5E6UB 5I45A 2V59A 2YVUA 1GYRA 3QEMA 3NOQA 1WY5A 1M6WA 3PDUA 2B99A 2CUKA 3RS0A 4BNDB 3P96A 2CJWB 4KR7A 3SEQA 1JEJA 1PQWA 2C9DA 5FJJA 4KNWA 4UUBA 3C45A 1UIMA 2XCRB 1W93A 3IUEA 4M1OA 3K4HA 1URPA 2GUGA 5JV5A 3RVMA 1OTYA 2V7GA 3PPXA 2B4TO 3OLZA 4LI3X 2QXUA 3AUYA 4M1ZA 2DULA 1FUIA 1WV0A 1PJAA 3LGXA 2YOGA 1G4UR 3IUMA 1VQ1A 3KAQA 5HIIA 4NLLA 4EM6A 5JSFA 1SHUX 3R3UA 1N3IA 1I1QB 1P72A 1WQ3A 3IAEA 4F4DA 4YCSA 4MR9A 1ANKA 4OX9Y 1FMJA 1RI3A 3QYJA 3T7RA 5EQJB 1DFHA 3RGWS 1SPBS 1EZ1A 2VHWA 1WLSA 3IAHA 3SHTA 3WTCA 1A97A 1M3SA 4HS9A 3DVLA 4GLLA 3SFTA 5JD4A 3BOSA 5AWFC 5TMDA 3HJBA 4G5OA 1OX6A 3S5UA 5AW1A 5ER9A 2Q7DA 2PGJA 3STTA 3W8RA 3KLBA 4KRFA 2VDPB 4GECA 3JQ8B 2NXJA 1VBKA 3ECCA 4MYHA 4PGFA 5D86A 1ZCFA 2CNWA 3OTIA 1KK0A 1T43A 1N3YA 4BVFA 2VT6A 1ZESA 2RB5A 1NBEA 1KQ3A 2PUVA 3FB4A 4ITVA 4KXMA 2ODNA 2FCAA 1QFJA 3DMFA 3IILA 1JXAA 4L75A 1FX0A 1EU1A 2J4FA 4YJ2B 1KU0A 3FMGA 4YUVA 3EZXA 1JTVA 1J4AA 3E05A 3HL4A 2JW5A 2HDWA 4GX1A 3I3SR 3GJYA 1LD3A 2B1QA 1GTRA 1W6RA 3BCHA 2UZ0A 4GXQA 5CT5A 4H3HB 1T26A 3DEHA 4P5DA 3ZJYA 2VT7A 5CB4F 2C3OA 2ZRGA 2D1RA 1E4VA 3OA2A 1HDGO 1YB6A 2ZAMA 4TZTA 1CC1S 3LY7A 4BNDA 1UFKA 2CJWA 2ZU6A 4LJ6A 4FEEA 1V71A 1ONPA 4Q82A 1ICIA 3E84A 2JF0A 3PGA1 3NGMA 1G7RA 4J2HA 4O0MA 5ERXA 5KTSA 4HSEA 4MUGA 4BBPA 4MWEA 5CEEA 4KQCA 1ZWKA 3Q98A 3O82A 2D2EA 5C1PA 4JHLA 1K4YA 1EE9A 2MTBA 1EVEA 2PKQP 3LKZA 4F84A 5LQRA 3ILXA 4R0VA 1WZUA 1KRWA 5E7QA 3JXEA 2R4TA 3M89A 4G1UC 2BFWA 5BV7A 5KX5A 2OZPA 4F3YA 2RHRA 5AFSA 3V8MA 4MJLA 4R40A 1Q20A 2HY7A 1MG0A 1Z3CA 3NASA 3OZAA 4N5DA 3UTCA 2W5UA 2X1LA 1PD0A 2HJSA 3PD7A 3QVOA 5BN5A 4H08A 2IHVA 4AYTA 1FK8A 4B2YA 2NGRA 1MV5A 4Z7NB 5DXFA 4KXLA 2WUEA 4TYQA 2FZ4A 2C59A 3GAAA 4NF2A 3ZN2A 5THQA 4PZAA 1UM9B 4P33A 1OA1A 1P29A 3HJHA 3MJ4A 3STWA 2DWUA 1VYHA 4K88A 1L7EA 1Z0SA 3JQ8A 3OLWA 4L28A 3VRHA 4YPOA 4L8GA 1WD5A 3ZK7A 1AUPA 1D0VA 3OMLA 1OWNA 4A0HA 1DHRA 2QGFA 4W6QA 5ADHA 2VJBA 4RZHA 2FRVA 3C2QA 3AUUA 3CNQS 2E4AA 2FQWA 5FLKA 4F9EA 2QQ5A 3DDSA 1H2XA 5TT1A 2JH9A 5AW0A 1E8NA 4N8DA 3WGTA 3SYNA 4MYTA 3TTTA 4LQ4A 1W87A 3HVHA 4YJ2A 1BXGA 4AZ0B 1TF7A 2LP4Y 2VYQA 3NBKA 3MS7A 5ABPA 2PQMA 3KR9A 3PQDA 3I1JA 5DT9A 1BRMA 2QRHA 4IAOA 3UB3A 1DKMA 2H5LA 3K8ZA 4GIBA 3TLYA 3JRWA 2RHJA 1E6LA 4HNUA 2AI1A 2WFLB 3QW2A 5IH3A 4ZPJA 4S04A 5AOAA 3ACDA 1ABBA 2DYKA 2WYOA 3NT2A 5AJYA 3WP0A 1OZFA 3ME5A 1UADA 2Q6OA 3K15A 4LJKA 5HHTA 1DAGA 3OZRA 2H5IA 1TPZA 2CC2A 4M3NA 3STUA 4A0QA 4DQKA 2AN9A 3EA0A 3PFGA 5HTKA 1SUSA 4C6RA 3CZ4A 2F2TA 4HTFB 5L3VA 2PZLA 1Q22A 1A4XA 3PQCA 3QVVA 2O0MA 4DV0B 2I03A 3BX1A 4I8XA 1U2ZA 4PCLA 2XUPA 2OBBA 2Q5LA 3U62A 1MPTA 2ZSFA 1M0WA 1FW8A 2ID8A 4TN1A 1PI3A 3AI3A 1V43A 3ZK9A 3AQIA 3PNQA 2Q1XA 5BUZA 2Z1MA 3MHPA 1Y9AA 4HHEA 4OBXA 2OM2A 2A84A 4UU1A 2XRYA 3DT8A 2YVQA 3K31A 1TTQB 2MOKA 2HNAA 3CGGA 5KJFA 3MLAA 1N5RA 3PGVA 1NY6A 2X0FA 3MCTA 4EI2A 2DZDA 2XTMA 2BEUB 1PJLA 2XQGA 4RD4A 1U9JA 5E7MA 4J16A 2AG1A 1IEXA 4Y1RB 3R5JA 5ALKA 1QDUA 4OGFA 4UEOA 1EB8A 1MO4A 1UM9A 3H9QA 4J76A 2A57A 2P5YA 3PUJA 4XWWA 2OLJA 3QHPA 4N3NA 4I1RA 4EO9A 3EIHA 5EZ6B 2IYNA 4EAQA 1B8UA 3C3PA 2FN7A 4LXTA 5A4FS 5B4UA 1CRZA 4MGIR 1BMDA 4IIHA 2YDYA 2E87A 3C98A 2P35A 4QXMA 5AW5A 2QQ0A 5JWRA 4KBYA 5JNLA 1W2HA 1O0BA 2F43B 3N7TA 2OBLA 2OMKA 2QOEA 3U9SA 5DE3A 1JE1A 2IYUA 2M9MA 2V5AA 3HVUA 6YASA 4RD6A 3MINA 4JOCA 3OLVA 1T35A 2D5AA 4B6JA 1W52X 4Q7KA 1QP0A 2FZVA 3SQDA 4AZ0A 4OHCA 2VP9A 4MLZA 3RROA 3FPLA 4BTLA 2XT9A 3QTBA 3ZE0B 4ROSA 1XTKA 2BFFB 1QYWA 2Z43A 3KPVA 1QZTA 2WD9A 3TFQA 4L72A 3L1JA 4RLHA 1JTEA 1KSGA 4HQRA 2J3HA 1RQGA 1NN0A 1G6KA 3JWHA 2WFLA 2A2ZA 2J0SA 3E61A 1NXTA 4KODA 3ZZ0A 3UENA 4E4TA 3FYUB 2ZJOA 4TQAA 4US2R 4L3WA 4E07A 3A70A 3MCZA 1NJSA 3KUDA 3I8XA 4PG6A 3KO8A 3CRRA 2CJPA 5LYYA 1PGPA 2ZBQA 1HV8A 2EDCA 4Z7OB 2GPNA 3HR4A 3OPYB 3A26A 4HTFA 4O1MA 4R31A 4X8MA 4LC1A 2BD0A 1TJNA 1UAGA 2ZUCA 3QU5A 4AMBA 4HPJB 4O59O 5FX2A 2IOHA 4I3GA 1AF4A 2G06A 3N76A 1PZFA 2QIPA 4X8OA 3TMKA 2JGLA 4Y2QA 2D2FA 4WZBE 3PNKA 3ZCVA 1SCBA 4K46A 3P2OA 1MGOA 1XMVA 4BCDA 4KFTA 4JOSA 5IM4A 5BUQA 1G5QA 1GFWA 3VNQA 3JRNA 1ECLA 4XGIA 5CTAA 1DCMA 1EFRD 1ND6A 1PW5A 1TJ3A 1Z7GA 2C5BA 2G6TA 3GJQA 2VDLB 3P32A 1KZ7B 3W5IA 1E9RA 4HXYA 1RI4A 3OKPA 3ZE1B 3DLBA 3OTWA 2BEUA 1MTOA 4BMSA 2FMKA 5ICMA 5JCZA 4ISBA 1QPBA 1V41E 2AQ8A 3DMPA 4Y1RA 1P4JA 5CDTA 1E89A 3CPEA 5AVQA 2XQKA 4CIYA 3G5AA 4OLFA 1JWBB