4J3FA

Crystal structure of fabi from f. tularensis in complex with novel inhibitors based on the benzimidazole scaffold.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
259
structure length
259
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biological evaluation of a novel series of benzimidazole inhibitors of Francisella tularensis enoyl-ACP reductase (FabI).
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
total genus 88
structure length 259
sequence length 259
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j3fA00
1HTBA 3DBRA 1UP6A 3WGIA 1ZCJA 2Y68A 1P1FA 1YE3A 1GD1O 4O0LA 4R41A 4IINA 3R6DA 5TX7A 1PZHA 4GH5A 4W9NA 3ZNOA 4RVUA 5IFLA 1R12A 2POQX 3KYCA 3UF0A 1W6UA 3ZWPA 4HKTA 1LLDA 3U4HA 3TQHA 4CMBA 1U7TA 2WD8A 3I4CA 1EDOA 4XR9A 4CLOB 3AM5A 3DFZA 3L07A 3QY9A 2PZLA 1I2ZA 1ADGA 3UVEA 2DU8A 4BO7A 4WK6A 4N18A 2AEJA 3GFGA 4ZGWA 1EFKA 4Y6SA 1I5RA 3DDNA 4Z0HO 4B4WA 5MGBA 1CYDA 3WGOA 4QFDA 4DUPA 5L7TA 3PEFA 4J7UA 5EMHA 3RUIA 4E6PA 5A3JA 3RFXA 4OKIA 2QRLA 4Q3CA 4CLRA 4AJLA 3I83A 4ZICA 4YB8A 1UZMA 3DFUA 4Y8VA 1I3NA 1GUZA 1ZW1A 4C4OA 3WGZA 3GRKA 1LSSA 1M75A 2GCGA 3QV1A 4U0KA 2I5PO 3RSHA 4PZEA 3K6JA 2B69A 4MKZA 4WCDA 4TZTA 2EWMA 1WPQA 3TWOA 4FPXA 2RHRA 1HETA 5IDXA 4CV3A 2V6FA 4YAJA 3WIDA 1BRMA 2CSUA 1D1SA 1CDOA 4B8ZA 3Q2IA 2GO1A 3GMDA 4IGEA 3VOSA 1CWUA 2PZJA 3LU1A 1H9BA 3JQ8B 2D3TA 1E6WA 3OEYA 3L6OO 2Q1WA 4MKRA 1P74A 3BHMA 3A9WA 3ITDA 2PH5A 4KUEA 3ABIA 5IZCA 2RH8A 2HMTA 1TXGA 3RVDA 1YL7A 2DUWA 2O3QA 4P22A 4PGFA 4ROSA 4MP6A 1X0VA 3QJ5A 2PKRA 2EP5A 4AJIA 3KLPX 4Z9XA 1A7AA 3HADA 1W73A 3AUTA 3KSUA 1Z7EA 5L7YA 4ZQHA 3UFXA 3D5TA 4Q3AA 4IDEA 1NVTA 4OSPA 4BNTA 2JD2A 5CEFA 2GDZA 1LBEA 3EMKA 2HK7A 2HRZA 3NX4A 5JDCC 1E7QA 3QP9A 1I01A 4WCFA 1I2CA 4ALJA 4R3NA 4GPD1 1KEUA 1GQYA 4NNJA 1HL3A 4PLYA 1N1EA 4OIMA 1BXGA 2B4RO 1W0CA 4LCEA 2QZ9A 4J1TA 3ZNPA 1ZK2A 1GCUA 1P31A 1UDAA 2YHIB 4MVJG 2QW8A 3NT4A 3DL2A 1OC4A 4ND1A 5EQDA 4NPCA 3O4RA 2J8ZA 1C0KA 1BDMA 3W6UA 3F5QA 2VOJA 4OMUA 4J1QA 4HUJA 3SC4A 3AI2A 3GVCA 5GY7A 1PS0A 2AE2A 3DAFA 4YYZA 4BO9A 3IDSA 1DXYA 2VCYA 4DLLA 1E7YA 4IIVA 5DCUA 1I3MA 4PFJA 5F1OA 5EPOA 5DCYA 1UUFA 2PNFA 5A9SB 3PYLA 4UUNA 4D3SA 3ICCA 4A03A 1F8GA 3QWHA 3RUHA 1EVYA 1HDZA 5GMOA 2JHGA 3SX2A 4PLTA 3VPXA 4DIBA 3DMTA 4CR7A 1N5DA 4JK3A 3P19A 5C5IA 2G5CA 5B4UA 5CEJA 1KEVA 4OYRA 4UEJA 5DP1A 2NUAA 4I08A 3DEYX 4NIMA 1XU7A 3GA0A 4FFNA 1N7HA 2BFMA 2P91A 4CM8B 2G17A 5I9MA 2YDXA 4BO4A 2CF5A 3UH1A 3HE3A 2HJSA 4XA8A 1ZMTA 3BMQA 2XAAA 4R1SA 4PLZA 3UN1A 3H65A 4GGPA 4L8VA 5I7FA 1YL5A 3FD8A 4D0SA 5JC1A 5EQFA 1UAYA 5HS6A 4E5KA 1QP8A 1LDMA 3QVWA 1R4NA 4EUHA 1FF9A 1L7DA 2Y0EA 3BMOA 3DMYA 4ESOA 1LXCA 3TNLA 3RUFA 1PL8A 1PU2A 1JDJA 3PHGA 2WE8A 1JVSA 4XB2A 3UOGA 2VZ9A 5A9TA 4FFOA 1QKIA 2FMUA 4O6VA 4R5MA 1NFFA 3KTDA 5ICSA 3LLSA 2Q1SA 4K1LA 3M2TA 4J1NA 3RC7A 4E2YA 1M2WA 1LQTA 3PIIA 1IYZA 4TVBA 2X1HA 3LT4A 4RVFA 3SEFA 4YJGB 4E33A 4XYGA 5B37A 1EBUA 2VN8A 5JNLA 3Q1LA 2GASA 4RF2A 3ZCXA 4WCFB 3MOIA 1KIFA 4KDEA 4R3WA 4Y98A 1I10A 3WYBA 4QEDA 3SLGA 4BO3A 3WDSA 4CMEC 4BNVA 2ZIZA 5TIIA 1YBMA 3A1NA 3PJGA 4J7CA 5BSEA 4I9NA 4FOOA 3GGOA 4E5YA 3I23A 4E30A 2Q1UA 4ZQFA 2DC1A 4HFJA 3ZWBA 2P4HX 4B79A 3BZUA 3PHLA 2O2SA 3ST7A 1TT7A 2WTBA 1B3RA 3O03A 2NU8A 3OEWA 5DBIA 1I3KA 3SXPA 4AFNA 4CMKA 2EJWA 3WXBA 2FRDA 4BL5A 2QYTA 3TJRA 4CLDA 4OXYA 1Z6ZA 4YAEA 5FFFA 5KVVA 4BVAA 1AN9A 1DHRA 2DFVA 2P2SA 4KTVE 1BXGB 4J90A 1YKFA 1MUUA 4G81A 2NWQA 3WLEA 4DA9A 4AJ4A 3E6AA 1Z73A 2VWQA 2D2IA 1EK6A 5CPFA 3FI9A 1LSJA 2C59A 2BFPA 4YT2A 3IIEA 1LSOA 1E3SA 1YQXA 2B4QA 3ROQA 3WFIA 1MG0A 1TA4A 4N54A 2HRBA 4XB1A 2J3JA 5TS3A 5BSGA 1GL3A 4Z3DA 4WPGA 1LSUA 2BRUA 3LYLA 5F1PA 3LLVA 1ZH8A 4CMHA 1VSUA 5G4LA 3C7AA 4OL9A 5DDIP 3VZPA 1Q7GA 3ETDA 3PFFA 4PG6A 1QV7A 2X9GA 4K28A 2DPGA 3CINA 2EHDA 5KJFA 3JQAB 1ADBA 4CM9A 4Y67A 1ZSNA 1PX0A 2AG8A 2IE0A 5HM8A 4EUEA 2JL1A 2IRWA 2VQ3A 3CZRA 1DIRA 4ND3A 1SZJG 3VH2A 1NPYA 2J5RA 3ZN2A 2ZTLA 1NR7A 5EINA 5DZSA 2ZB3A 3AOGA 4J9UE 3OICA 3C3XA 4PLVA 1YQGA 4NH4A 4L9RA 4CQMB 4CLEA 1PQWA 1Q0HA 4XKJA 4BNJA 2EG9A 4PG4A 4QECA 2OOSA 3Q11A 4XIYA 3OH8A 4QFCA 1R4NB 4NBTA 3LSYA 3CMCO 4PLPA 1U2DA 1XGKA 3WGTA 2C82A 1GPDG 1E3EA 4Y6PA 1IHXA 3BMQB 2Q2WA 2YQ5A 1E1NA 5TRTA 1V8BA 2X5JO 1UXHA 3PHHA 3C1TA 1RKXA 4JROA 1EUZA 2Y1GA 3IL2A 5IN5A 3ZWCA 1I36A 1D7OA 4P4LA 2EKPA 3L4BA 2DM6A 5JSFA 2Z5LA 1ISHA 2QZZA 1SEVA 2AE1A 4TKLA 4WLUA 5CFZA 4XDZA 3PQEA 3I9OA 2FR8A 3AUAA 2FWMX 4BMNA 5T64A 4OXNA 5B4VA 3QHAA 4WEOA 1LI4A 1QORA 3G49A 1PS9A 1BW9A 4Z9YA 3U4DA 1XG5A 3E5MA 4GX0A 3KM0A 1XELA 1PWZA 3F6YA 2NVWA 1T4BA 3JD3A 3V1YA 1G0OA 4QXMA 5H82A 2ZATA 1NQTA 2NVBA 2VRCD 3JD4A 1LDEA 2QRKA 3VH4A 2NVUB 3X2FA 1PJLA 1HEUA 5A05A 5JMPA 3MJTA 5JC8A 4GI2A 4GMGA 1DPGA 1GPJA 4OSOA 1E92A 1M67A 3A14A 4RZIA 3NDRA 1NM5A 3MJVA 4CM3A 1HYEA 3AK4A 3GAFA 3ONDA 3I6IA 4JP2A 5ILGA 3I1JA 1UZLA 1Q0LA 2JCYA 1HSZA 3D4OA 3QRWA 4NMHA 1S6YA 5EIOA 5TJHA 3WNQA 4AICA 3PWZA 4DPLA 3VTZA 2R00A 4D46A 1ZK1A 1ZIDA 2BI7A 4RQTA 1GYQA 5H83A 5IDYA 5AXBA 4HXYA 3K8ZA 1E3IA 1R0LA 4CM9D 1QYWA 1HF3A 2BD0A 3PYXA 2I9PA 3NYWA 1T2CA 3PGXA 4B4OA 4WE3A 1I8TA 2OBYA 1H6DA 1YB1A 2BF7A 2HMUA 4BNHA 2IXBA 4H15A 1WMAA 2EP7A 2PA3A 2GZ3A 1H0KA 3AI1A 3DAPA 3F1KA 3MWDB 4DMMA 4B8WA 1A4IA 3AY3A 3RU7A 2YY7A 4J0FA 2IEDA 5IF3A 4WASA 3LF2A 4ZHSA 4R01A 4L76A 5DF1A 3WMWA 3ZHZA 1LRKA 1AUPA 1DRVA 1B8UA 3AUUA 4FQ8A 1Q7BA 2X4GA 1UP4A 1W4ZA 1N8KA 1A71A 1I33A 5IG2A 1HDCA 2DVMA 3UCFA 3FRJA 3RJ5A 3Q2KA 1ZEJA 2OUIA 4PG8A 2W2KB 1I3LA 1PZGA 4I8XA 2D5CA 1ZO8A 1BHSA 2IZZA 2TMGA 4CLHA 4KZPA 4CLRB 1G6KA 3OETA 2O3UA 2H5LA 1UH5A 3GNSA 1R4MA 3RFVA 1UDBA 4WLVA 1A5ZA 4W4TA 3KEQA 3GH3A 1GUFA 1NQ5A 1I32A 4MVJM 4RGBA 1YOVA 2RAFA 3W4IA 1BWSA 1ONPA 1E7WA 3RAJA 4W99A 2X8LA 1VI2A 1Y7TA 2W2KA 1AXGA 1MC5A 3K2BA 3KYDB 4J43A 3K73O 1IZ9A 5EL0A 5L51A 1JN0A 1MXFA 2YHUA 1RPNA 1XKQA 4OXKA 3H6KA 1I30A 4DTIA 5JCJA 5A4DA 2VYNA 4M86A 3GZ4A 4IZIA 1KY4A 3S55A 1KEPA 3ZZNA 1U28A 4QX6A 4KUGA 2C29D 4DBVO 5KWEA 1U9JA 2O3JA 4MVJP 2J5KA 1K6IA 2VOEA 2O3TA 3H9EO 4AJ2A 1HDGO 2H1SA 4YWJA 3RJ9A 2WYUA 2IYOA 3PZRA 3C8MA 3OMLA 5DBFA 3VC7A 1ZZEA 4XWYA 2OP1A 1EZ4A 2FPIA 3WYCA 2GRAA 3JSAA 1ISIA 1EQ2A 4XX0A 1GADO 4NFHA 3ZWOA 5IXYA 4WKGA 2YYYA 2HO5A 3B70A 1F0YA 4YACA 4S1VA 2ZJ0A 1ONNA 2AQIA 2D8AA 4YTEA 1VL8A 2AQKA 2VYND 5CHEA 3ZU4A 3LK7A 2DBVO 4GWKA 2JAHA 1UJMA 2D0IA 1FDTA 2OP0A 3HDQA 1P1HA 2HCTA 3JQEA 2B5VA 4JJIA 3TSCA 5U9CA 1PGNA 3K9QO 3D3EA 3ZI0A 4GLOA 1ZK0A 3L4BC 4XQ9A 3T4EA 5JE8A 4A27A 1PGPA 2V7PA 3H5AA 4Y9DA 1GYPA 4FBGA 5COAA 5HS4A 2YV3A 3OSUA 4J91A 5G4KB 4J49A 2E82A 3CH6A 1LDGA 4PRKA 2P9GA 1GZ6A 5I8WA 4MP8A 2VWPA 4O63O 1DC6A 4YT5A 4RF3A 3IOYA 1S7CA 3KOUA 5KVCA 2ZCUA 3H3FA 2AW5A 1DEHA 3JYQA 4NBRA 1HE2A 3ZU2A 2WWRA 3PGJA 3PQFA 3ENNA 5GZ6A 1JWBB 5G0VA 2EERA 2DFDA 4DREA 4KWHA 1YJ8A 5KJEA 3H9UA 1YGYA 1LEHA 1N92A 1PR3A 4U6SA 2EJVA 1XQ6A 2YQ4A 1WZEA 1Y9AA 4MPDA 5DULA 4UVGA 3G3EA 4OHUA 3GVHA 3CSDA 3KLMX 2NQTA 3D3WA 4WOJA 1FDVA 1HKUA 2GUGA 3WGGA 1DRUA 1PJQA 3WWYA 4W9NC 3FR7A 3M1AA 3WBFA 4OH1A 2OMEA 3Q6IA 4CM7A 4BNUA 5FI5A 3U5TA 4XRGA 2UUPA 4MIOA 3EDMA 4IQ8A 2W4QA 1X7HA 1VL0A 1YBVA 4FSHA 2FPGA 3PI7A 5JPIA 2EGHA 5I9NA 1ZSVA 4JBIA 3V2GA 4EDFA 5KJCA 5ILOA 1NQOA 5TT1A 5DCWA 5L4SA 4F6LA 2GZ2A 2JFGA 4M1QA 1CEQA 1C1XA 4NG5A 2B37A 1AHIA 4BB6A 4M54A 4O5OA 2Q3EA 3PYMA 3A28A 4GLLA 4RL6A 4CM6A 1HLPA 5ER9A 1M66A 4A10A 2IEBA 4L4SA 1LC3A 2ZTUA 3VPSA 4KQWA 4R4JA 2UYYA 3GHHA 3JQAA 3AY6A 1Q7CA 3AM3A 3IUPA 3NJ8A 4EYEA 3IP1A 3KYDA 1LRJA 1DBVO 4FW8A 2B36A 3VAZA 5F21A 1Y81A 1YWGO 2OBNA 1TLTA 2CY0A 3K5PA 1AE1A 3UXYA 3DZHA 5DP2A 4DMLA 4DLBA 3DBHB 1XDWA 4NBWA 2FN7A 4EZBA 4DBZA 3LZ6A 3QA9A 2VTEA 3PPIA 2ZQYA 3CUKA 4L73A 4BNLA 3GAZA 3OFSA 3IKVA 1YL6A 4FD3A 3E9NA 1EBFA 3GK3A 1ISMA 2Z95A 2GSDA 3N7UA 4XRRA 4BOYA 2VTDA 2EW2A 5KKCA 4L0QA 3H7AA 4I5EA 1U1IA 2QHXA 4KWIA 3DONA 4MO2A 2UUOA 2NTNA 3G1UA 3PZBA 1ISFA 3KYBA 3NUGA 3UKOA 4B3HA 5A9RA 4L4XA 1LLCA 4HP8A 4BGIA 2O3SA 4RF4A 1RWBA 4FGSA 1ZK3A 5LDGA 4PVDA 1XA0A 1HDYA 3O26A 3VHRA 4E12A 3AWDA 3JQ6A 1T2FA 1BMDA 3D4NA 3DHEA 3PWSA 4FFLA 2HDHA 4GSLA 4IBOA 4J16A 3I4FA 4OJNA 3PDUA 1ZK4A 3AY7A 1ZSYA 3I9NA 3L9WA 4IDBA 3HB4X 4EI2A 1FDSA 2GNAA 1E5QA 3VZQA 1NASA 8LDHA 3ZV4A 4L4RA 4JN6B 4GX1A 4I9HA 5DNAA 2Y0DA 3V1TC 2ZYDA 1P33A 1ZMOA 3K31A 5BQFA 1PJSA 1QLJA 5GZ3A 4ID9A 2NU9A 4MJLA 1PQPA 4XJSA 1G1AA 2X9NA 4J0EA 5C7OO 4Q3EA 1WNTA 5ENVA 4EBFA 1T1SA 1SB9A 1X7GA 2Y93A 5C7IO 2NVUA 4GVXA 5JAIA 3PRJA 1DLIA 1U3TA 3ZNNA 5AXDA 1UP7A 2Y1EA 3P2YA 5JW6A 1GU7A 3H9QA 3WGYA 3OJEA 5L7WA 3L4SO 2C7VA 1O95A 3G17A 1P9LA 4HWKA 1QYCA 1GV1A 2D5AA 3EZLA 3GY0A 4HADA 1NAIA 3EC7A 4BNGA 4FIZA 2F00A 2QYSA 3RBVA 3DWFA 5G0UA 4OQZA 4BKQA 2ZTMA 3DB2A 3NEPX 1T2AA 2PR2A 3JQGB 1PJ4A 1JW9B 1XWFA 1ZXLA 5CDUA 3F47A 1O6ZA 3VDRA 3VZRA 3L77A 4MVJF 3ZWAA 2C54A 4BV9A 2X5OA 2VYVA 2WJPA 4QQRA 2FZEA 2Q99A 1LU9A 5KCZA 4RVSA 3O38A 5B1YA 3DAGA 5J23A 3KBOA 2W2LD 4MVJE 3PQDA 4IJVA 1NQAO 5CG2A 1XCBA 1NPDA 4FFMA 1J49A 3UCXA 3W4JA 1EQUA 4XEHA 1VE9A 1B15A 1IE3A 3OHSX 4ZQBA 4CM4A 3UGKA 2Y0CA 3DOCA 2QG4A 5FF9A 7MDHA 1U3UA 4WLNA 4OGWA 1XSEA 3PWKA 4XIJA 4C7JA 3BMCB 2PZMA 3F46A 5L53A 5BSFA 1WP4A 1T4DA 1B8VA 5ICMA 1U4SA 4RZHA 4CQMA 3PXXA 1F12A 3VKUA 2E48A 3D4PA 4PLCA 3PHJA 1I2BA 4RO0A 5JDCA 1V3TA 3ETEA 1F8FA 3TFQA 2PGLA 3AW9A 4YR9A 4IJWA 5IAAA 3IAHA 4QTZA 4OOEA 4JJFA 3AOEA 3HFSA 1KERA 1SB8A 1EDZA 1FDWA 3B20A 5L45A 1K5HA 2YJZA 3H5NA 5KJ6A 2EW8A 3ZHXA 4BO1A 1BGVA 3PFWO 3BMNA 3GNTA 4IS3A 1E3JA 2VHWA 4IJKA 1CQJA 3UAGA 5CAEA 1F06A 5JDIC 3KUXA 2BGKA 4E2ZA 5JY6A 4I5GA 1IB6A 1EVZA 1CQIA 1OMOA 4J2OA 5G0SA 1KVRA 3RU9A 5JDIA 1ULSA 5TT0A 3HN7A 4LSWA 2G0TA 5MDHA 2Q4BA 4DPKA 1HYHA 3NTRA 1PJ3A 3JQ8A 4PLGA 4F46A 3H9JA 4E5MA 4XYEA 4BO8A 2QX7A 3S2EA 1DIHA 2GR9A 4TMFA 3VVCA 3U4IA 1WWKA 2RCYA 2B35A 2DQ4A 3NT2A 3LQFA 2PV7A 2VNAA 5T57A 2C2YA 5BNFA 5A04A 4RQUA 1B16A 4NFYA 4E31A 2BMAA 1KVTA 4N7RA 1B3BA 4FGWA 1DC4A 2B0JA 2NLOA 4XD2A 3N58A 3VPFA 1WW8A 1N1GA 1T25A 1EVJA 3IP3A 3LC7O 5I9LA 2VHYA 2EEZA 2ZB8A 1EE2A 2PKQP 2IXAA 4MVJI 2B5WA 5TC4A 4CJXA 1SOVA 2JJYA 3GUYA 2VWGA 1R16A 1HDOA 3DOJA 3I52A 2HSDA 3RUCA 5AOVA 4FJ2A 3NRCA 4YDRA 4IMRA 4R68A 3I6QA 2GN6A 2FR0A 3DC2A 3PLRA 3RC9A 4CODB 1IOLA 4R1NA 3WR5A 4CLOA 4D43A 4BNNA 4WECA 1HRDA 3C7CB 2CMDA 1DLJA 4RLSA 3TL3A 1GFSA 4ND5A 3WIEA 4W7HA 4GBJA 1LDBA 1A4UA 2NM0A 2O4CA 3JQ9C 3F1LA 1DDOA 1PSDA 4RDIA 5K6AC 4F3YA 4E32A 3OA0A 1XHLA 2Y1FA 4MP3A 1BVUA 3EW7A 3JYPA 4Q3BA 4M55A 3MCVA 1HZJA 3QW2A 4DIFA 2BI8A 4CL3A 3JQDA 2EKQA 3TZCA 1PJCA 5A1TA 5JS6A 2VUTA 4CM5A 1A72A 3EAGA 2QQ5A 5LCXA 4CM8A 4XYLA 4J4HA 3BMCA 1HYGA 4PLHA 2AQHA 2I67A 3HUDA 4OOFA 4NBVA 1JLLA 3IMFA 4CM4B 4CR8A 1QMGA 4YAGA 4CMGA 3ADOA 1MXHA 2PH3A 2UAGA 2O7QA 2G82A 5IDQA 1E5LA 3GGPA 1QRRA 3DZFA 3GDFA 5A9SA 3JQBC 4BGVA 1M6WA 4MVJA 1H5QA 3ETGA 2NTVA 2X0NA 1ORRA 1P1IA 4GMFA 1UDCA 2BHLA 3R3JA 4CMCA 5L40A 3CKYA 1NBOA 2IYPA 3AJRA 3W8EA 3EVNA 4CPDA 3LC2O 3Q3CA 3JQGA 4BB5A 4GWGA 3MOGA 1MV8A 1Y8QA 2HMSA 3TOZA 3T7EA 3VZSA 1A7KA 3GLQA 2YHIA 3RKUA 2J3HA 1K6XA 4CLXA 4HV4A 3ASVA 1IUKA 2V65A 1J0XO 1CETA 3JQ7B 1Z82A 4EITA 4JIGA 1V6AA 3E1KA 1C0IA 2DTEA 1OOEA 5K0ZA 1Y1PA 3ASUA 4BO5A 4HBGA 1SO8A 3TPCA 5KOIA 2P4QA 2XXBA 4H7PA 5I7EA 2ZYAA 1N9GA 4N5MA 4E5PA 1I0ZA 5IDWA 3TDKA 1LA2A 3OQ1A 4L74A 1X13A 2YDYA 2NQ8A 3NAQA 4DYDA 3FHLA 4RVHA 1C1DB 4XGKA 2GZ1A 3IQDB 4LK3A 2Y1DA 3R3SA 2ZB4A 3DOOA 3HDHA 4BQPA 2IODA 4L75A 1XU9A 2V6GA 5ENDA 3G1TA 1KBZA 3FF4A 4C7KA 5ITWA 2PK3A 3C24A 2W2LA 3JQFC 3QWFA 3ADPA 4AJKA 2CFCA 5EJ2A 2EF1A 1EFLA 3IJPA 3DTTA 2PFGA 4YAKA 5HRUA 4KMSA 2OORA 1VL6A 1PZEA 4EJ6A 3VPGA 3W8FA 1BTOA 2V6MA 4UAGA 4AJHA 1UZNA 4Q3NA 3D0OA 4TZKA 4YRDA 3BTVA 4CMIA 3ZH2A 2ZYGA 4A26A 2WD7B 5C3MA 1N2SA 4PIVA 1KYQA 2C0CA 1ID1A 1DOHA 4QT0A 4EGFA 1OC2A 2R00C 1E7SA 1R0KA 4GX2A 4W7IA 4FDAA 5G0WA 1DIBA 4PG5A 1PJBA 3DMTC 4R16A 1NFRA 3RUDA 1PZFA 3H2ZA 5ITVA 4D7AA 3M2PA 2ET6A 3DXFA 1E1KA 4FFPA 3S8MA 4WNIA 1YDEA 3NJ4A 4FCCA 1EVIA 2V6BA 1ZEMA 3GN2A 1O9BA 1PIWA 2ZK7A 3PVZA 5KVSA 3JD0A 2R6JA 4KDFA 4R69A 5TQVA 1O94A 1LRLA 1UXKA 2FR1A 4NK4A 3HDYA 5CDYA 2RIRA 3KETA 3VKVA 1MG5A 4TSKA 5T8KA 2BFAA 4MVJD 4Q3DA 4IZHA 3WQRA 1TB4A 3KXDA 3MJCA 4J1SA 4GSKA 4YA6A 1YDWA 5L95A 3RBZA 3WX0A 1GZ4A 2NV6A 2YFQA 1XQ1A 4ZRMA 1X15A 4FR5A 3U9LA 3GVIA 3ANNA 3JQCA 4M8SA 2DLDA 4XQEA 2HQ1A 2BGMA 2J3KA 1X1TA 1Y5MA 3FCOA 1NPTO 2X6TA 3DBRB 3AFMA 3R1IA 1BDBA 3OIFA 4J7XA 4YQYA 4FFRA 4JGBA 1YONA 4LRSB 3RROA 1UAGA 4TWRA 1X0XA 3EY4A 4TQGA 1H6AA 1LLUA 2X5KO 4BUCA 3T7CA 1U3WA 3OM9A 4CMJA 4CQLB 1VSVA 2GERA 1IULA 3EYWA 2Q4EA 1MX3A 1OAAA 4ZN6A 5C7LO 3V5NA 4P8RA 1DFIA 4FN4A 3AOEC 1NVMB 4DGSA 3O9ZA 2I3AA 1EUCA 4AJOA 2NTJA 3L6EA 4JXKA 2BKAA 2Z1MA 4IDAA 4ALIA 2VHVA 3GEGA 1PWXA 3GDGA 4Z3KA 5A3VA 3AM4A 2C2XA 1Q0QA 1Y8RB 1YVEI 1XLTA 4DXHA 5DT9A 3GGGA 2G76A 4U5QA 1ENZA 1ENOA 1V3UA 3BYZA 4INAA 4ZQEA 4ND2A 3GDOA 4N5NA 3QVXA 4R51A 2IDZA 1M76A 3RC2A 4HNGA 5JCXA 1JAXA 1IPFA 1TI7A 4BO0A 4ZJUA 4YJDA 3WBBA 4URFA 2JCXA 4RVGA 5F5NA 3FSRA 3HG7A 3ZWXA 3HWRA 2PZKA 1HDRA 4HY3A 3ANMA 1TT5A 3PJEA 1U4OA 1KY5A 3LVFO 3ZDFA 1BXZA 3RASA 1SCUA 4EW6A 1Z74A 3NTOA 4ONEA 3OBBA 4NK5A 4B7CA 4CQLA 1GQ2A 2CZCA 3S2GA 1X1EA 3KVOA 3LC1O 4BGEA 4YAIA 1CERA 1GEGA 2X9VA 4CV2A 3PJFA 2A92A 1WDKA 4K26A 3JV7A 1LNQA 3IC5A 2QIOA 4OKNA 4P38A 4ILKA 5CDTA 1NTOA 2HUNA 5ER6A 4D0RA 3FPLA 2DT5A 4YJFB 2D4AA 3OECA 3AU8A 1Y5RA 2Z1NA 4KTTE 3E9QA 3AU9A 3Q9NA 4J9VA 4LMPA 3VPHA 4CL8A 7ADHA 3TZQA 1YXMA 1YH3A 3NV9A 1OZAA 4XYMA 4I5DA 4YEDA 1B26A 2CVOA 4PZDA 3JCZA 4H16A 1E6UA 4A73A 2DBRA 4A0SA 4S3MA 1HWYA 3IJRA 3ULKA 3HQ4O 4GKBA 4BMVA 5TSDA 3NGXA 2DBZA 4BV8A 4WGGA 4K9DA 2AEFA 3G0OA 3BHIA 4JCOA 1U8XX 3ON5A 4NI5A 3U4CA 1E3WB 4P4NA 1X7DA 3WGQA 4PLFA 2XXJA 2HLPA 2FPPA 3GG9A 4BNYA 4F6CA 3EZYA 2A94A 4X54A 4ZVVA 2WD7A 2OZPA 2WEKA 2Y66A 3VDQA 4KOAA 3QVTA 4LMRA 3RI3A 3R0IA 4QSMA 3V8BA 1T24A 2B4TO 4DC1A 1HE4A 3HB5X 1DB3A 2AQ8A 4XCVA 1JU9A 3DBVO 4BNMA 1RYEA 3P7MA 3LT2A 2PKQO 1WVGA 2I3GA 1PL7A 5TJ9A 2NSDA 2I65A 4DWVA 1K6JA 5KTKA 2HAEA 4BNZA 4RPJA 5ADHA 2AHRA 2Q2VA 2NADA 1WMBA 3W4KA 3UW3A 1LX6A 1NX6A 4I1IA 1N9GB 1CRWG 4NDNE 4BO6A 3GHYA 3VTFA 1GUYA 3H2SA 3CZMA 1EEHA 3ZHBA 4EJ0A 3EVTA 3OJ0A 1GEEA 2VNSA 1J4AA 2DUUA 4WJZA 4CMIB 1YQDA 4IQGA 4IGFA 2C5EA 2GLXA 2X58A 1M6HA 3KO8A 2O4UX 3TL2A 1P0CA 1UR5A 1PGJA 2EIHA 1AGNA 4JQCA 4UULA 5G2OA 1LTHR 2FZWA 2YV2A 4XQGA 5AXCA 1H94A 1QYXA 4BHTA 2ZCVA 3K96A 3FBTA 4DRYA 3KSZO 3O8QA 4B7XA 1ZXBA 5KIAA 2A35A 2OO5A 2DBQA 3JYOA 4W6ZA 2JD1A 5JAQA 4RORA 2NU6A 2Q45A 3U0BA 4RJTA 2VRBA 1SAYA 1VJ0A 3NDIA 3GPDG 2JD0A 5F5LA 1C1DA 1GV0A 1YJQA 1O0SA 1SEPA 5BNTA 3IKTA 2GGSA 3JQFA 1HT0A 1OBFO 3BMNB 5KVQA 3UUWA 3ZU3A 3F9IA 2W90A 3QSGA 4UVHA 3DBLA 2GYYA 3FNEA 4OM8A 5IN4A 4LCJA 3BIOA 2YFHA 3CEAA 1WDLA 2CNBA 2VUUA 1JKFA 4BNWA 3Q0EA 1MFPA 1IL0A 2CF6A 2ZB7A 3ONFA 4WCFC 2FSVA 6LDHA 2Y99A 1GAEO 2UV8A 4TRRA 2E6UX 4E2XA 4YRAA 1JQBA 1ARZA 1RM5A 1VRWA 3FNFA 2EKLA 1YS4A 4HX5A 5K6AA 4IDFA 1P1KA 2HU2A 3ITKA 4LGVA 4AVYA 1DO8A 2P68A 3CTMA 1JWAB 3BMOB 1ZUD1 3LT0A 4GAEA 4HFRA 3MJEA 2I99A 3BA1A 1P1JA 1E7MA 5I7VA 3RC1A 4IUYA 4CMEA 2ILTA 4FJ1A 2DTDA 3RD5A 1L7EA 2Q49A 1B0AA 1O8CA 4RLHA 3ZV5A 1MB4A 3OIDA 4QO8A 1ML3A 3E82A 1SPXA 4AJJA 5LC1A 1KOLA 2VHZA 3QE3A 1R37A 2LDXA 5DN9A 3ZWNA 4EEZA 3RBXA 2XOXA 4P4GA 2CDBA 3M6IA 1PQUA 3FWZA 2NNLD 3QIVA 3DZKA 3HDJA 3BTOA 1WXDA 5EESA 2GN4A 1DAOA 4BKUA 4CR6A 4UVIA 1ZFNA 2P5YA 3S2FA 3W6ZA 3QQPA 2Q46A 5T6BA 3DZJA 4DQVA 2OL4A 2QRJA 4YT8A 1HXHA 2WYVA 4NZ9A 5BR7A 5TF4A 3NKLA 4XDYA 4D44A 1SOWA 3C7DB 4MDHA 3GN1A 4RPHA 4YBZA 2AA3A 5T67A 1GQQA 5JO9A 3OJOA 3WTCA 4DPMA 3GZNA 3JD2A 3F3SA 3QWBA 1K0UA 3T4XA 3JTMA 5JYEA 4WNCA 3VVBA 1RM0A 3RQSA 4QO7A 1OI7A 3INGA 1KC3A 2O2YA 1MP0A 2J6IA 4NBUA 5K9ZA 1B7GO 1Y6JA 4EJMA 1PTJA 4D79A 1GDHA 3GT0A 3WQQA 1Q2XA 1HDXA 4R54A 3OP4A 2VT3A 1DFGA 3JQ9A 2JAPA 1YRLA 1ADCA 3L6DA 3HN2A 1DFHA 4GVLA 4CQMD 4WOKA 2A4KA 1QLHA 3ONEA 4BKOA 3BHJA 4E0BA 4XQCA 1DSSG 1A27A 1E1MA 4HNHA 3GVXA 1DIGA 3KZVA 4F45A 1ISJA 2EXXA 1U5CA 3KSDO 3INTA 1KVQA 3VH1A 5G0TA 2LDBA 4KP7A 3GZNB 1BXKA 1E3LA 3E8XA 4MVJH 2H63A 2YUTA 2I76A 4BQRA 2X0RA 3RUEA 5GZ1A 3F4LA 1R6DA 2DAPA 3M1LA 3DHYA 3RFTA 4OQYA 3DQPA 4TROA 1JVBA 4GL4A 2PD6A 4IDCA 3KHUA 1Z7BA 3DZIA 3GEMA 3WSVA 4II2A 4IDGA 4Q39A 1O89A 1WAMA 1P0FA 2VHXA 2VZ0A 3HFGA 3E48A 1AHHA 1QV6A 3SJ7A 1P1RA 2DKNA 4FOSA 1Y8QB 1P44A 2OGUA 4TRNA 2PGJA 4IXTA 1T2DA 4LW8A 5JYDA 2VRCA 4I5FA 4UUOA 5TNXA 1K89A 4DLAA 3E18A 2BH9A 5THQA 1JTVA 2O3RA 3QWAA 2JHFA 3FNGA 3GUCA 4ZD6A 1VKNA 4NJMA 2PY6A 1DRWA 4YPOA 1JA9A 5IZCC 3WS7A 2NACA 4MIYA 5CPBA 1IPEA 2O23A 4PZCA 2W98A 1XEAA 3ENKA 3RIHA 1EE9A 4XYBA 4QUKA 2WDZA 4WLEA 4G65A 4NU5A 1KEWA 3DTYA 3H9GA 4UEKA 1NYTA 4YJGA 4BKRA 1DAPA 2AMFA 4J6FA 3ZNQA 1T2EA 4IIUA 4MIEA 2P5UA 4PRLA 4PVCA 4DC0A 3KYCB 1LUAA 1H6BA 1RYDA 3GPIA 2TMDA 1K3TA 3TZKA 4JP3A 1UXGA 2VT2A 4TKMA 5CG1A 3WLFA 1KC1A 2ZKLA 1D8AA 3INRA 1R0SA 1B2LA 2BFOA 1PR9A 3NDJA 4YRBA 3CMMA 2D59A 1Z45A 3CIFA 3NTQA 3OA2A 1L1FA 5CDSA 3SBOA 4UEOA 4XZ3A 1MC4A 1ULUA 4J2HA 5CEEA 6ADHA 2Y1OA 3DO5A 1BVRA 1F14A 4RPLA 2J5QA 1VM6A 2PTGA 4B3JA 3UICA 1NAHA 4B4UA 1P3DA 4YT4A 2HMWA 4RV9A 2B83A 3ZWWA 4Y6RA 4CM1A 4Z0PA 4K6FA 3L9XA 2XPCA 4CMAA 2J3IA 3GEDA 1QYDA 5BNIA 4FB5A 1LLQA 4NJMB 5F1KA 5AQ1A 2EV9A 8ADHA 4AJNA 1RM3A 3JQAD 3GVPA 3ANLA 3TF5A 3ZHYA 3TZHA 1VLLA 2VZ8A 3JYLA 1SNYA 3ZGYA 4HFMA 4D45A 4FC6A 4PLWA 4NHEA 3V1UA 3WJ7A 1DC5A 4YJHA 4PN3A 4AJPA 4O1MA 3GF4A 3FTNA 1VKOA 4KQXA 4BNIA 3ROMA 1YB4A 2PWZA 5JCJD 3Q9UA 3GR6A 3EHEA 3GG2A 1IY8A 5LDHA 1NR1A 4R9RA 3QWIA 4IS2A 1TVEA 4MOWA 2X23A 1I24A 1RM4A 4GKVA 1Q1NA 1QR6A 1U5AA 1ONOA 2JFFA 4UUPA 5G4KA 3LT1A 4BGUA 3DZBA 3E5RA 4N5LA 3B6ZA 4NQZA 2HKIA 2VYVD 1XR3A 1E0DA 4A7PA 4AG3A 3U62A 4JLWA 2CD9A 3FBGA 2E49A 1ZNQO 3FWNA 1QG6A 5A5FA 3C1OA 1H9AA 1YBAA 9LDBA 4YCAA 4IPTA 3GQVA 5A03A 1RJWA 3SVTA 5JO0A 1PJ2A 2C7GA 2YV1A 4TVOA 1T1RA 4DIOA 1NWCA 4CUKA 2RH4A 1XYGA 4E2WA 3PHIA 5FEUA 1C3VA 1DJNA 3FTPA 3I9KA 4J4BA 4W82A 3KEOA 2I66A 4J3FA 1HE5A 4CUZA 3U49A 3E9MA 4JNKA 4B4VA 1MA0A 5H81A 5FWNA 1EUDA 2BLLA 3W1VA 4LVUA 3WGHA 4U0JA 4E21A 3PDJA 4BNXA 3ZW9A 4IMPA 2A9FA 2EGGA 1E3WA 2HK8A 4UVEA 2WSBA 3GC6A 1ZJYA 1KVSA 3WICA 1LDYA 5ES3A 2IZ1A 4BO2A 1V0JA 3OJFA 3V2HA 1TEHA 4AJEA 3FNHA 2X0IA 1E77A 4FS3A 3RCBA 3CE6A 4LRTB 1HZZA 1O5IA 2GPTA 3H8VA 1KETA 4J4TA 3RKRA 1C0LA 4LVCA 2GN8A 4DQXA 5EN4A 3H4VA 1LDNA 1ZKMA 2C5AA 5C37A 1QSGA 2FOIA 1YOVB 1NFQA 5AYVA 3FR8A 2CVZA 1PGQA 3DBHA 3OJLA 3PJDA 3WB9A 3I9LA 2HK9A 2FP4A 2X22A 5L4LA 4A5OA 1GR0A 3TOXA 4JJGA 4B7UA 5T5QA 1CF2O 2OFPA 3S1LA 4D3DA 1DIAA 3D3WB 5HBRA 3ZW8A 1NNUA 4II3A 4U7WA 1BSVA 4A2CA 4D41A 1WDMA 1ZBQA 1P45A 2PD4A 4IJUA 3RUAA 4BS9A 4DL9A 4CUJA 2PLAA 3ZV3A 1U8FO 3WFJA 1E6EA 2HMVA 3ZU5A 3F4BA 2G1UA 3TRIA 5JAMA 1GZ3A 3MJSA 1KVUA 4TRJA 1JKIA 1C1XB 2ZJ1A 3GMSA 4FJ0A 1PS8A 3LDHA 2I6TA 3ZV6A 2OXIA 2JKVA 2AG5A 5L9AA 4XGNA 3GRPA 4JBGA 1V3VA 3PLNA 3EGOA 1GTMA 1H6CA 4DYVA 4YXFA 4OO3A 2ZQZA 1DHTA 5L4NA 1BG6A 1SBYA 2E4AA 2FSSA 4ALKA 3DBLB 4RPKA 3STHA 3B1JA 3H5RA 1H2HA 5IJZA 4OAQA 4G2NA 3TZ6A 1SMKA 3I5MA 3BTSA 1FJHA 3ORFA 4YQZA 1XIVA 3E03A 3IS3A 3WNVA 3TFOA 2CDCA 1K2WA 2CDAA 1OFGA 3L0DA 3C85A 3K2EA 4CV0A 4PG7A 2Q1TA 4AJ1A 4E5NA 1LQUA 1A9YA 2H6EA 1GYRA 3O8QB 5JAZA 3QLJA 2X7HA 1J5PA 1H93A 1ZJZA 1CJCA 3B1KA 3KRTA 2RBEA 3OF2A 1Y9EA 2D1YA 2GD1O 4XR4A 4GQAA 3GOHA 5KNLA 1WZIA 2WYWA 1VJTA 4RF5A 5DBGA 3WMXA 5HA5A 3AI3A 2OHXA 4LSMA 4R5HA 4WEQA 4KUHA 2JFHA 4O59O 5IXSA 5I8ZA 3F5SA 4M89A 3MEQA 2PD3A 1NHWA 4Z9FA 2DPHA 1JKJA 3QVOA 5KKAA 3U3XA 3CPSA 3K30A 4FC7A 2AXQA 1LC0A 2UVDA 1C0PA 2O48X 4R1TA 3WWZA 4RPGA 3WQSB 5A5EA 4ND4A 4B3IA 4U6QA 4ZA2A 3ZWMA 3K92A 3SJUA 2X86A 2BGLA 1ENPA 3SLKA 9LDTA 3WYEA 1U3VA 4UUMA 4BMSA 1FXSA 3RWBA 2Y05A 3GFBA 1YO6A 4DVJA 2O7SA 3U09A 5COBA 2CVQA 3COSA 2SCUA 1DC3A 4M87A 3DZGA 2PGDA 4EUFA 1HLDA 4CV1A 2W8ZA 3BAZA 4G5HA 4ZRNA 2Q2QA 3I9MA 3MWEB 4ITUA 1MFZA 5B12A 5IZ4A 1QYVA 1MLDA 1VJ1A 1D1TA 4ALNA 4NU6A 4BIIA 4E4YA 1VPDA 1DJQA 3MTJA 3VH3A 5B4TA 5JXWA 5JMWA 4RCVA 3G79A 2Y1CA 1NVGA 4JX8A 3ZWYA 4E3ZA 4NR0A 4R1UA 1R66A 1IHYA 1ENYA 3NGLA 1D3AA 3P5SA 1PEDA 4Z0TA 2YW9A 4DQUA 4IDDA 4AL4A 1V35A 1T26A 3P2OA 2F1KA 5COQA 3B1FA 2X0JA 3D5QA 2XF8A 3BTUA 4K6CA 2P9CA 3AFNA 4ALLA 4NFSA 4IY1A 3GNQA 4BNKA 2WE7A 5U4QA 2GF2A 3C1AA 3A06A 1VC2A 1GCOA 3I3OA 5TGDA 5CP8A 4XGIA 4M49A 1N7GA 3QVSA 4BKPA 2O50A 3OIGA 5DOZA 3ROPA 2P9EA 3WSWA 2BELA 1A9ZA 3V2UA 4ALMA 5CDGA 1PL6A 5DOVA 4RVDA 1R4MB 3MJ4A 5BT9A 3PIDA 2FY8A 4WUVA 1SC6A 3JQBA 3D1LA 5THKA 4D3FA 3H3JA 1QXSA 5BSHA 1C14A 1GY8A 2R2GA 1E1LA 3N74A 1V9LA 3D7LA 5T8KC 3UCEA 1G0NA 3ZWVA 4YJFA 3OQ6A 1IZ0A 4R9SA 4UREA 4EEXA 3ICPA 1W8DA 2FHSA 2UDPA 2YZ7A 3AUSA 1LJ8A 3JYNA 2CUKA 3KB6A 2WMDA 4IXWA 4MKXA 4Z6KA 5L3ZA 3X2EA 1NWHA 5FYDA 5AXAA 4ZU3A 3JQ7A 5A02A 1F17A 3HZZA 5HTOA 5HWSA 1U2GA 3FN4A 4HFNA 2GN9A 3WG9A 4NJOA 5JY1A 4UVDA 3CXRA 3HHPA 5AVOA 5I7SA 4GGOA 1X14A 4D42A 2Q50A 3UHAA 4LN1A 1HE3A 4Q9NA 4WLFA 1WLYA 3MZ0A 4IQ0A 3ROKA 2C20A 1TT5B 5EERA 3I9JA 2HJRA 5TLSA 4LISA 3EUWA 1MGOA 3EK2A 1HSOA 2JCVA 1J6UA 3KV3O 3A4VA 5U1PA 1H2BA 3HJAA 3W8DA 1ADFA 1YB5A 4GX5A 5KJ1A 1EMDA 4H3VA 1R15A 4YJHB 5F3RA 3FPCA 3PK0A 4I9UA 4MINA 1BW9B 1NXQA 2VWHA 1CIVA 1JAYA 2DTXA 2H9IA 1UXJA 2Y67A 3NT5A 3S2IA 4JBHA 5JLAA 1B14A 1FDUA 1ISGA 1NP3A 1E7RA 1Y8RA 3PP8A 3LF1A 3JD1A 2C07A 5JFOA 1FMCA 4IM7A 1PGOA 1Z75A 3D64A 2AEMA 3SC6A 1EK5A 2RHCA 3DR3A 4RDHA 2NU7A 1FK8A 1ZVMA 3TN7A 4ZQGA 3IUSA 1U7HA 3PTZA 5FI3A 5A06A 3WOHA 2IZ0A 4E13A 1P77A 2VUSA 3BXXA 3HNPA 4YVFA 4BNFA 4U8GA 3WJAA 1UXIA 1AXEA 1PJTA 4TRMA 3OQBA 4XJTA 3DHNA 3WTBA 1B8PA 4WLOA 2E37A 1D4FA 3HSKA 5JBIA 1NHGA 2ZTVA 1KS9A 2WM3A 3MTGA 4PCVA
chains in the Genus database with same CATH superfamily
3WGIA 4ANFA 3AB8A 3GFVA 2IHTA 3W5AA 3VJRA 1QBGA 3C6ZA 4O0LA 4R41A 4W5HA 3L01A 2WJHA 5IJXA 1JYFA 3R6DA 1KO5A 5BV2P 4H4DA 3ZNOA 4RVUA 1MTZA 1XCLA 3HA5A 1R12A 4CEJA 3SSMA 1P4AA 3EQZA 5EMLA 3ZD6A 3KYCA 3FLEA 4RY9A 4GKAA 3UYLA 5HQ3B 1W6UA 2QR5A 5EEGA 2JGFA 2WA2A 1YQEA 3ZWPA 2G9QA 3O2QB 1E2NA 1Z06A 3AM5A 2OC4A 1SGWA 3DFZA 3E35A 3QY9A 4ASUD 5C8YA 1TK9A 3QUAA 2LPMA 4MW4A 4DLRA 4BO7A 4CEHB 5JROA 2WSYB 1NA5A 4N18A 1CX9B 3ETJA 2ZIVB 4NBLA 3LP6A 2F3TA 2Z8XA 1GSHA 1I1QB 1G3MA 3CF4G 3RVBA 5EIFA 4CDRA 3H5WA 3I61A 2B7LA 3THRA 1SBNE 4MJ3A 4Z0HO 4B4WA 2V3CC 4MJ7A 5EJ4A 1CYDA 4AP9A 3TLCA 3MBOA 1DKNA 3LRXA 4NYIR 3SVLA 3KPYA 4KQKA 1GL6A 4BB0A 4N5DA 2DWOA 2C58A 2AXPA 2QDKA 4JLDA 2IY9A 4P7KA 1NUUA 1UPUA 3QM1A 1XJWA 3DFUA 1ZW1A 1Z6QA 2FZCA 3GRKA 2N46A 4QNNA 4RE6A 2GCGA 1V16B 3F6SA 2JA2A 2GAIA 4OFWA 4K0RA 4X8LA 5JT1A 1NI5A 1AS0A 3KPUA 5TEVA 4KRGA 2KE5A 4PZEA 3EZ9A 1RLOA 3FZGA 1OY1A 3BFJA 2PX2A 2A0WA 2VH2A 2Z4TA 1U8EA 3GEPA 1BX0A 3OTGA 1LS6A 3TWOA 1HG1A 1JR3D 2RHRA 3DPIA 1BD3A 4IVNA 4YAJA 1BRMA 2CSUA 3I5UA 3B3FA 4FKMA 2XXAB 2D1FA 4B8ZA 2DCMA 3QKSA 3WB1A 3PTAA 3SQMA 3DFIA 5BOVA 2GS9A 4EM6A 4NE9A 3R7WB 3S1AB 1TU4A 1M8PA 3GAAA 2AYZA 3H87A 3OEYA 4FNGA 5DSTA 5GM1A 1VBFA 4BRWA 5K8VA 1YBHA 3QMPA 1YR2A 4H17A 3CUYA 3QBTA 5KYWA 4ZYUA 2QX4A 2CW5A 2RH8A 1OGYA 3PGLA 5AM1A 3RVDA 2DUWA 1CQIB 1ZH0A 2O3QA 3PPWA 4MQUA 3O8LA 4O4JA 4WFKA 1YR1A 2WP8J 2AJCA 3EY9A 3QJ5A 4X60A 4CTJA 3Q7PA 1KEKA 3V6MA 1AB6A 5ETJA 1N4AA 1QC5A 4C1BA 2XA9A 1P5RA 5EZ5A 1Z7EA 5EHGA 2AFHA 1LBQA 2DP4E 1SUWA 1ZBDA 4Q3AA 1G3IA 4YMGA 2P6RA 2HIGA 3L02A 2JD2A 3LFUA 4ZXFA 4NFLA 3HBLA 4EGSA 3C15C 1X8XA 1N57A 5JDCC 3E84A 3QP9A 3KHTA 2HLDD 2R7AA 4DKXA 4ALJA 3EEBA 1KEUA 4HPWA 1OAOC 1W5TA 3C74A 1N1EA 3LQQA 5JFGA 3IP9A 1CHDA 1U5BB 1P8AA 2WDPA 2ZBUA 3WKDA 1UDAA 3LCCA 4D8WA 1YACA 1K8XB 5IKEA 2YHIB 1RFGE 2Z4RA 4MVJG 4PTLA 3ZYZA 4FWTA 4GQBA 2IEGA 4EY7A 3NT4A 3DBOB 4F2GA 3OF3A 2WAXA 2ECPA 3DWIA 3FUTA 1JP7A 2VOJA 1KH1A 2VUHB 3ELWA 1BRTA 3K0AB 1JF8A 4MDYA 5FYQA 2CDRA 3GVCA 4CBVA 1U0SY 3S5JA 5GY7A 2P79A 1PS0A 3AR3A 5TB5A 4US2R 3SBEA 1G8HA 4DLLA 1TVMA 1W36D 3WIBA 2GQ0A 2IHKA 16PKA 4UHDA 2H2FA 5DCUA 3ZCPA 5F1OA 4AIRA 1OBVA 1QO9A 5EPOA 2OSVA 5DCYA 3K5IA 4N7BA 4NARA 3A9SA 3H9CA 2PNFA 4CIYA 5FEMA 2WU1A 4UUNA 4ZEXA 8AT1A 4D3SA 4MRNA 1EA5A 1F8GA 721PA 3RUHA 3VU3A 1QH8B 5GMOA 4JY7A 4PLTA 2V03A 4CR7A 3G2IA 4Q4JA 4QULA 3ZVMA 3NM5A 1DBWA 2G5CA 4GRDA 1I9GA 3DV9A 1JJAA 4NBKA 4DDVA 1OT5A 4QYMA 1UL1X 2ZVPX 4WKPA 2NUAA 3SS8A 3OU7A 4NIMA 2AJDA 3QELB 2C9BA 4Q4JB 3WQBA 1Z2OX 2R7KA 4Q7KA 1JEYB 1XJCA 4ZO9A 3COVA 3L0YA 3S1SA 4NCJA 3R6TA 5J2UF 4PGMA 1J9EA 3LW8A 3UH1A 1NKTA 4MDFA 1P3Y1 3BMQA 2W9XA 3RSZA 3HJHA 1J06A 3TEFA 3HP1A 1YL5A 5J4YA 4JT8A 2G6BA 4Y1EA 4LTDA 2CXNA 5DLEA 4V0KA 4E5KA 1U6KA 2FQXA 1QP8A 4P7FA 1R4NA 2H8GA 3BL6A 3I2JA 2I7DA 3D6TB 2Y0EA 1N9ZA 4JUBA 1JXOA 3RUFA 3UQZA 1PL8A 1YOBA 3PHGA 1T0BA 1C7FA 2BFCA 1H1LB 3IV6A 3K0AA 4XB2A 2JKYA 2VZ9A 5ARCA 5AW8A 1L9KA 2PUHA 2FMUA 2FMIA 4DIKA 3DT9A 1NFFA 3KTDA 4R98A 2A7QA 2Q1SA 1RRPA 3LLSA 3M2TA 4K1LA 1VBMA 3OZFA 2R11A 3R6GA 1ZGHA 3RC7A 3IUQA 4D74A 4MRMA 3OZCA 2XQIA 4UEQA 3RV3A 4HX9A 2P6NA 3BRQA 3SEFA 2X14A 3U3KA 4F4HA 4QQNA 5DLDA 1N77A 1BN7A 3Q8XB 3H1TA 1H4VB 4TLBA 2HA7A 3LFHA 3FYSA 3RSFA 4RF2A 2XV1A 1BE8A 1KIFA 1V8DA 2HXYA 1YZNA 3PC8C 1L5GB 4ZYTA 3WYBA 4BO3A 1FJGB 2IDKA 2QNBA 2CJPA 2PH7A 1BJRE 3VKFA 1F0NA 1QC5B 1W581 5AICA 2RHJA 1YBMA 4FNOA 1YNOA 3OCJA 3UUFA 2I4TA 4L57A 1V2HE 3DLAA 3LJKA 5BSEA 3BDIA 2MIIA 3THOA 2WJGA 4BE4A 4E30A 4IO0A 3B7WA 3D8BA 1DWOA 3M4YA 1EHIA 4O2RA 5G3ZA 3ADDA 1C4KA 4HFJA 3ZWBA 1JHUA 3AHHA 3FNBA 5B55A 2W70A 1DZ3A 2L2QA 3PHLA 1RWKA 4E94A 3ST7A 3I2HA 2V97A 2NU8A 1EXVA 3SXPA 4AFNA 5HK9A 2HQBA 4NSNA 1ISRA 2O2DA 2PZEA 2O5CA 1WCXA 2IGTA 4HEJA 1ZDMA 2DUNA 2WQ7A 4WNYA 1YMQA 1Z88A 1B41A 2GTIA 2QYTA 5CA0A 4UQLA 3H2JA 5EE1A 1M2GA 4YAEA 1P4SA 1TD9A 1AN9A 1DHRA 3L06A 4LZAA 2P2SA 1CV2A 1VL5A 4KTVE 1ZI9A 1YKFA 4XJVA 5D5PA 5IT9A 4U5XA 3WQHA 2NO0A 3KD3A 1XVLA 4LHEA 4AUNA 4Q7JB 2FEWB 4F7WA 2IZ7A 2GESA 3GYBA 3HJNA 5M3BA 2JI6A 5CPFA 1EK6A 1FLAA 1TM7E 4LE2A 3FI9A 2AC4A 4JT9A 2IH4A 2BFPA 3CX7A 4YT2A 1YC2A 1VJRA 4WFIA 3SD7A 1MQ8B 5HCNA 4DWOA 7ABPA 3I58A 3BFVA 1H1DA 1QB8A 4DEYA 4EY3A 1MG0A 3F6EX 3VU9B 4ZMBA 3ZEIA 4IGKA 1RLUA 4MUJA 3FHJA 1U0OC 3CWCA 1I4DD 2XIQA 4WPGA 3D81A 1LSUA 3LVQE 4TWZA 4OP1A 5E7QA 3VTKA 1GQOA 3OM8A 3ZBPA 2AN5A 1CNEA 3C7AA 4MR7B 4RH3A 4WXMA 4YV0A 5JZSA 3PFFA 3UV7A 1QV7A 2BR4A 2X9GA 3R09A 4DT1B 4CEHA 2C4VA 3C1UA 4K28A 3IMEA 4EPYA 1RC1A 4PYNA 4CM9A 5DHFA 3PJRA 1U04A 3MAJA 3ZHOA 4OJKA 3U19A 2AG8A 2H0QA 3B6IA 3DLIA 3EXG1 2FEOA 3H99A 4MWEA 2IRWA 3ONVA 4ND3A 3VH2A 4EJSC 5KNDA 4Z4QA 2AOXA 4EGAA 1XF9A 2QVLA 1NR7A 3HN6A 5CU7A 2HO4A 4CEJB 4MW2A 1W88B 2ZB3A 3BJIC 3ZCUA 3AOGA 5JS1A 5ALXA 3UWDA 4UXJA 3VR4D 3T38A 3LDUA 4KLZA 3A3PA 4X20B 1PQWA 1IY9A 5SICE 1OIWA 5AVRA 1KPGA 2EG9A 3IOEA 4M1WA 4QECA 3Q11A 1D5WA 1ESZA 1ZIYA 1EG7A 4XIYA 1GNTA 1PLJA 4ZVRA 3ZUGA 5KWIA 4QUAA 2C3UA 1JR3A 2BDTA 4ISBA 4PLPA 4ENVA 3ITEA 1XGKA 4EHAA 4DMCA 3L43A 3DTNA 2X7XA 1EYZA 2GN1A 1SUCA 3AR2A 5KQMA 3N2KB 1TU3A 2UXCB 3CG4A 1IHXA 1E1NA 5P21A 4BQNA 4FHFA 4KLCA 3KQSA 1OTYA 3C1TA 5C52B 1EUZA 3K53A 3A6DA 5CGQB 4NZYA 2ZJZA 3MB5A 5ENZA 1CSEE 2EKPA 2F90A 5DV9A 3L4BA 4LRYA 1XALA 1D4AA 3L8HA 4AN0A 2VQFB 1UBFA 1YI1A 2P9YA 3NMUF 9MHTA 2QZZA 1TECE 1P9WA 4CG3A 2COUA 3COYA 1DOAA 1U9IC 3R3UA 4TKLA 5AP9A 3WADA 2FG7C 4XDZA 5AW9A 3T15A 5CFZA 4DV4B 4Y0NA 4WGFA 5CYPA 3AUAA 3OQNA 3U7GA 1T9HA 3V1LA 4BMNA 4IIXA 4O4JF 4P5DA 5T64A 5KNDH 1A96A 3QHAA 3U9LA 5K0LA 4ZI7B 1JKJB 3SR4A 5A6VA 2AWNA 3FCYA 4Z9YA 5J63A 5JADA 3THYA 3FTCA 1EM8B 2ADOA 2NMVA 4M7PA 4REMA 3ASZA 3GJ8A 4NE2A 1EFVB 1W2GA 1ZISA 1N9KA 3CONA 5IAKA 5CCDA 2ZZMA 4QUBA 3WNBA 4Z7OB 3JD3A 2JGKA 4WVFA 1G0OA 3H1FA 3ZE1B 4J0CA 3NYQA 2NVBA 2G88A 2IYRA 4M53A 4OMFG 3A10A 2ZJ3A 2NVUB 1NE7A 1PJLA 1HL7A 1SUAA 2CHGA 2FWNA 3MJTA 4EBBA 4BVKA 3G2NA 4RKWA 5AESA 1FRQA 1FS5A 1Z4JA 3CEJA 3D7KA 4LFCB 2BEVA 4TXHA 2PXHA 4NYMR 1PUJA 4CM3A 3GFPA 1XWIA 4OK3A 4P4SB 5J58A 2R47A 4TWBA 5GAJA 3KJXA 4IWXA 2DQSA 1Q0LA 2JCYA 3IXLA 4KYTA 4AICA 4F1WA 4RM2A 3PWZA 2I71A 1IU9A 2R00A 4D46A 4D57A 1K7YA 4XEUA 1CY6A 2G9NA 1PT8A 1RQLA 1O6CA 3QU9A 5AXBA 1WVMA 2J0UA 4HXYA 1XAIA 4HGQA 1PK7A 3Q3IA 1JIVA 1R0LA 3RNOA 3RADC 2PLWA 5BOSA 1LW6E 5CX1B 1XMXA 3PYXA 2I9PA 1G5RA 1T2CA 5ALMA 5CB4B 1Z33A 4WE3A 5I9SA 3U4GA 1YB1A 4H15A 4BRZA 3W05A 1ECGA 3AI1A 3DAPA 1GGJA 2DKFA 4GEGA 4NG4A 4UHBA 4ZVUA 2GZDA 3MWDB 3SBXA 1BHO1 2DBYA 4K88A 4G5OA 2Q4TA 3RU7A 1N75A 2PKEA 3ZY3A 1P9RA 3G8YA 3TPFA 3HU2A 5IF3A 3LF2A 3GU3A 2JATA 4YMIA 1KEEA 3NC4A 4RTMA 1WOYA 3SVZA 1LX7A 2V0CA 1EVLA 2D4HA 1LRKA 2HGSA 5KNCH 1L5HB 3QXJA 1B8UA 2EOAA 2FN9A 3AUUA 3N3BC 5EP1A 2X4GA 1W4ZA 1VYHA 4HNAB 7YASA 1I33A 2XWJI 1EU1A 2XCRB 1MPTA 4ZGBA 1PN3A 4G1FA 3RJ5A 3G6KA 1IONA 2OUIA 4HJRA 2IS6A 4HUQA 2ETXA 3WBJA 4B0OA 1AC5A 4QWWA 4OX9Y 1AK9A 3NBXX 4GZMA 4U7TB 2IZZA 5FPSA 4KQCA 2W71A 1SIOA 4KZPA 5K03A 1A9XA 4XVUA 1CD5A 5CW2A 3H83A 2NYRA 1W5SA 3OETA 3A6ZA 1GNPA 2O3UA 3MWEA 3LPNA 1EXNA 4HYQA 5DWQA 4BFVA 3IIKA 1EHYA 1A5ZA 1SQ5A 1KDRA 1XZEA 1GUFA 3VHXA 2HPZA 1P3JA 5JV5A 3FF1A 2Q7XA 2R25B 4G63A 3W4IA 3RS8A 1GPWB 3L8FA 2W6CX 4G85A 3QEBZ 1ZOPA 3LZDA 4R0NA 1MW8X 4J43A 5L51A 1X8KA 4EG1A 1JN0A 3B60A 3PUJA 3RE1A 1HQYE 3N6RA 4OXKA 4DTIA 5LIPA 1NV8A 4PIPA 4AKIA 1YS2X 3SQOA 1M2JA 1Z7WA 2I22A 2VI5A 3GZ4A 4OLJA 1GAWA 2J08A 4F11A 1G4UR 1U28A 5LMNB 2QJWA 2AD5A 2BONA 2C29D 1W93A 3D1VA 4MS4A 4OHVA 3VR2D 4YDHB 4DKJA 4AZSA 2A1UB 2XTMA 3BPSA 1DE0A 1U9JA 1VP3A 3N7AA 2NV0A 1CS0A 3D6JA 3DE6X 3ZC3A 1K6IA 3DXZA 1QYRA 1SQGA 3S29A 1MO2A 2DRIA 1MOQA 1Q6ZA 6PFKA 5FOVA 4V2IA 3P9IA 2GVZC 3PICA 4DQLA 2ZSUA 1EFRA 1Y9ZA 4I14A 2B2NA 3AMVA 2WG2A 2RHTA 3ZE0B 2UUAB 2WWGA 4OJMX 2Q6VA 2CMHA 3EXHB 1EZ4A 2O05A 2WNIA 3K1JA 4RLFA 3WYCA 5FTKA 2VP3A 3EXEB 4NFHA 4FP9A 3SPXA 2YYYA 3MJFA 4J75A 4LOLA 1K97A 4S1VA 1UJ5A 1YFZA 2B8TA 2HLHA 3PE4A 2VYND 4RIIA 4PZYA 3EB9A 2M6SA 4GWKA 2HJVA 1V48A 5GIPE 1UK8A 2D0IA 4X66B 4ZCIA 3A2KA 2BFBB 2GI4A 3BB4A 1G66A 4JJIA 4UCWA 3TSCA 4B40A 5GONF 1PGNA 2M2IA 2F8TA 3D3EA 1LPSA 4M0EA 4RD1A 3V80A 3TGWA 2WOOA 3H16A 3GLTA 3OIWA 1I1NA 2PX4A 3L4BC 3T4EA 5JD4A 1NRXA 1KJJA 4A27A 1PQ4A 4PSDA 3R9IA 3VMFA 2H1FA 2HUPA 4DR5B 3E53A 3EXFA 3AP3A 4G0PA 1JMYA 2G70A 2P2DA 1HE1C 1REQB 1SHKA 2B6HA 4FYJA 3SNHA 5ITSA 1FFBA 2QLNA 3OZRA 4RJ2A 5ESWA 3CNEA 2IVFA 4EJ2A 2BZSA 4PRKA 1GZ6A 1CQPA 1ODLA 4G0XA 2ODNA 1Z26A 4HAVA 4MLPA 2D2EA 2P62A 2XQJA 4ZCPA 1BFUA 3F8SA 1X80A 4MICA 3QFRA 4RF3A 4CHTA 5I7HA 4E1BA 3IOYA 1C9EA 1S7CA 5E1BA 3KOUA 4PRZA 2RHDA 3H3FA 4B5KA 5ECDA 1DEHA 1ULBA 3C3JA 1JKMA 3JYQA 4AMBA 4NBRA 3TNYA 1HEYA 1GN8A 1QGAA 4ZI7A 3KKQA 2WWRA 3PGJA 3UJNA 2CB0A 4KLAA 4UOEA 5G0VA 2G6TA 1NVVR 3V4FA 3A4TA 3O4VA 2NSHA 4CKZA 2JZCA 4KWHA 2OILA 5KJEA 2H17A 5B36A 2QLTA 4IUCS 5AI9A 3BKWA 1N92A 5F76A 5DULA 1WZEA 1Y9AA 1TYBE 3K6RA 3OQIA 1IN4A 5IJ0A 3P9YA 4X8OA 1L3CA 1AK1A 1RP1A 3D3WA 1U2RA 3QUBA 4KACA 2GUGA 3OLXA 1DRUA 1K3FA 1OBHA 1Y5LA 3MLEA 1XRRA 4W9NC 3HR4A 4X5OA 4JOQA 1QIEA 2HLNA 3FR7A 3ND8A 4DXHA 3WBFA 4ZCMA 4G0UA 4OH1A 3SWWA 3CC8A 4CM7A 4D9KA 3QZUA 3EARA 1ZWLA 3PB3A 4MYTA 3U56A 4XRGA 1QHEA 2C9OA 5ARDA 1OJ7A 3SM3A 2W4QA 1TJ4A 3GDWA 2EX0A 5JPIA 4PX3A 4FB4A 4BEBA 4EDFA 1MF7A 2J6BA 2ZFUA 1A1VA 3R2JA 1TM3E 3QOFA 2I2XB 3H2IA 4ZANA 3FJOA 4YRSA 4RD2A 5JAUA 4K2HA 1C1XA 4QBGB 3N2EA 1ZVQA 3BE6A 1GPYA 1K5PA 3HB1A 5CUQA 4HCJA 1V1MA 4W1PA 3FGPA 2QBYA 5JVDB 2IEBA 3UT5B 1XHFA 5LLDA 3IILA 5IDVA 4D4LA 1PD1A 1YAHA 3NOVA 4DG9A 4UNRA 4DV3B 3VPSA 4KQWA 2YNMA 5DX8A 4R4JA 1GXSA 5I48A 2WMNB 3NUZA 3RWOA 5ALRA 1JNYA 3EASA 1NJGA 3VA7A 1QUEA 1XMIA 1QRTA 4NEHB 1G5PA 2B36A 1BWQA 4NJEA 3AHIA 1C7ZA 4JYAB 3O8RA 1KNXA 3UUEA 3AZOA 5A7FA 1YWGO 4AYXA 1TLTA 1K63A 1NDHA 2C2MA 2YZKA 3COZA 3IQZA 4Q9KA 2W58A 1XFAA 4JEHA 5F4ZA 3M5WA 3EGDA 4DMLA 1G2IA 4DLBA 3JY6A 4NCBA 5DHRA 3QVJA 1ECCA 2AUNA 2H2WA 1N34B 2EFYA 5AKKA 2BM0A 4KR0A 2FN7A 2H0RA 2JGJA 1AQYA 2P2NA 4KWEA 2QB5A 3M3PA 3V4ZA 2VL7A 2W22A 3CR7A 3LHSA 4ND8B 3RHFA 2VTEA 4C0WA 4BNLA 5E3HA 1KF0A 1IZZA 3FNIA 2C57A 5INTA 2WUDA 2ADMA 1K2VN 2C2WA 1AV7A 3U80A 3A6FA 1E1CA 4XRRA 1K9SA 1UWVA 2EW2A 4FGZA 3SR3A 2CE7A 3H7AA 3ZCSA 1Y37A 5CA0B 4OK6A 1FXUA 2O1SA 4UQPA 4B17A 1AQUA 1E58A 1R8SA 1Z5OA 3PZBA 4ZTZB 4YBRA 3NUGA 2PIAA 5DHAA 3TD9A 2QN2A 1LLCA 2JGEA 4HP8A 4L22A 1V11B 2CJWA 3QF4B 1CEXA 2CUTA 1M1YA 1W48A 1XA0A 3U5ZB 1SVKA 3VPDA 3QU2A 1VKZA 4C6HA 1G291 3VHRA 1QOPB 1ILWA 3JQ6A 1AX9A 3D4NA 4GSLA 4R83A 4QYWA 2J3DA 4J16A 5GJCA 1N5OX 2W42A 1EWTA 4A5SA 2VDPB 4F4IA 1TK2A 3CGWA 4PYQA 1Z62A 5HK8A 3HRIA 1W0JD 1PR6A 2FK8A 3D6VA 4J0JA 5LZ7A 1FDSA 3ZZ0A 1ULTA 2CJYA 2WKRA 3B2QA 4ZPXA 4M1OA 8LDHA 5KS2A 1I7QB 5JNRA 3WDMA 3KVYA 4H6XA 1IPHA 1XRPA 4GICA 4W5JA 4DYHA 1P33A 1ZMOA 1H2ZA 1RADA 1PJSA 5BQFA 2JGNA 2IPXA 1ADJA 2NU9A 2ZYVX 1K68A 1BJKA 4Y2SA 2X9NA 4Q3EA 1WNTA 3EJ6A 4G2TA 1ODCA 4KSBA 4EBFA 2DE0X 1T1SA 4WKOA 1IN1A 4JYMA 4KGXA 3DM9B 3M9XA 4GVXA 2JH3A 1DLIA 3QYPA 5AXDA 3P2YA 3UMFA 1GU7A 4BDTA 3DULA 4YNBA 3VO2A 1ORTA 2LXNA 1W2HA 3H9QA 3IXQA 4LC1A 3OJEA 1DJPA 5L7WA 1IB0A 4JVMA 3G17A 1KTIA 2ESRA 4QLAA 2ZE5A 1Y6RA 2IYFA 1AJEA 1QYCA 1GV1A 2D5AA 3FWKA 3EZLA 3MRVA 4QFMA 4LF5B 1SY7A 2HYDA 4W5QA 3FTEA 1WKBA 3RTBA 3W2FA 1P2FA 4HX2A 2UYGA 4BFXA 4Z1MD 3LHDA 2Q8PA 3PXBA 2HFKA 2OORC 4BMPB 1XHEA 2AXNA 5E4FA 2PR2A 3QBVA 4LNUB 4D96A 5C5DA 2PQ0A 2QD2A 1KRHA 1UMKA 4HDRB 1OAKA 3GJ6A 5HUHA 3FVVA 1CZRA 1E2JA 3I2GA 3I2YX 1IATA 2CSXA 2GCPA 3IQIX 5HCUA 2JJ8A 2I1LA 2PT7A 2BBSA 3U4QB 5JXGA 2HFJA 1LU9A 1GZ7A 5KCZA 4QGBA 4H0CA 1E4OA 1JFFB 1M2EA 4HEA1 5LLTA 4YRJA 5LA6B 3KSAC 2BEJA 5LMZA 4KLNA 4MVJE 2O8FB 3G9XA 5I4IA 4IJVA 5K3DA 5FOSA 4AXBA 2TRSB 4C4RA 5KWJA 1XYYA 3I45A 1XCBA 4FFMA 4KH0A 4P81A 1V7PC 3X3HA 1EQUA 1PHRA 1NYLA 2G08A 1IE3A 3GJSA 4ZQBA 3O8DA 5BSWA 1RYHA 3UGKA 2Z1DA 3PHBE 5JG7A 1JTEA 3F98A 7MDHA 1U3UA 4W8HA 3R40A 1E20A 4ILEA 3PWKA 4XIJA 4A6XA 3BMCB 1TAHA 4IGIA 4EHIA 1I94B 2FLWA 1TEVA 2NAFA 1WP4A 1L5FA 2X6QA 1T4DA 4KPEC 1JILA 2P9HA 2XOKA 3HBNA 2IIQA 5ICMA 3PXEA 4CQMA 5I7WA 4HUTA 2LW7A 1T8UA 2IYWA 4BVLA 4FCWA 4WACA 2DR3A 4N12A 4DR3B 2D3WA 4DMHA 1FTWA 1I2BA 4RO0A 4YV2A 4Q4AA 2R86A 3ETEA 4BB9A 2PT9A 2ZWAA 3AW9A 3FUUA 3KZMA 4FFVA 4IJWA 4HSGA 1J7JA 3GX1A 5KQRA 2Q28A 3HYNA 3AOEA 4FONA 2W48A 3AGQA 3HFSA 3WLTA 2HT6A 4XWKA 1SB8A 3LBIA 4BASA 1NZFA 4IAOA 2X3YA 4LDPA 2O8CB 5AHXA 1RMQA 3B20A 2HPAA 3GJTA 1EWQA 1T43A 3EFEA 5G41A 5J43A 4HDQB 5LN1A 2XGMA 2VHWA 1CQJA 3UK7A 1QF9A 1W44A 2IYZA 3CX3A 2NZXA 1QK5A 1U6JA 2WVAA 3RHZA 4MS1B 3EZXA 3OUZA 3K9NA 5JY6A 3QX9A 3UXEA 2GYVA 3FDZA 3ZOZA 5KCMA 2YICA 1OMOA 1H3FA 1P8JA 3HS3A 2W2MA 1WUKS 4J6EA 3WRXA 1KVRA 4NTZA 5FWYA 2X0EA 1ULSA 4FLEA 2UZAA 2GXSA 3CO0S 3HN7A 4LSWA 5MDHA 2Q4BA 4E5UA 4DPKA 1XU4A 2PS3A 3H17A 2XBUA 3NTRA 4RZSA 5HZHA 3H9JA 1X38A 4BDSA 4K2AA 3S1AA 4BO8A 4FYYA 1DIHA 1E3DA 1Z35A 2GR9A 3MTEA 1PD0A 3DYVA 1P18A 3RRXA 1WWKA 2NO6A 3NEAA 1XWWA 3UK0A 4A0HA 4LHZA 4YRNA 1QPZA 4E5DA 2GMWA 2PV7A 4DG5A 1CZNA 2AL7A 1B16A 5BMVF 4NFYA 2QSUA 4YP6A 2R8BA 2BMAA 3ZGVA 1NVWQ 1YUBA 3VRHA 4DB2A 1CJUC 4GP9A 3CT6A 3IP5A 3Q7IA 1T25A 1JNXX 2EEZA 2QAGC 1PCXA 3IVRA 5AW2A 2Y0BA 3HP4A 1KGDA 1EE2A 3FFXA 1A9RA 1JPJA 5EE0A 2PKQP 3RW9A 3Q3JB 1I6KA 4JI5B 5AVQA 2ZEJA 4ZQEA 3K70D 4I5IA 4C7VA 2JLAA 3ELBA 3EEOA 2B1RA 3PQCA 5F5XA 5TV2A 3TVTA 2A0UA 3I05A 4KV9A 1RT9A 3P32A 4QRHA 1NE2A 5HGXA 2BM9A 1V45E 2OLJA 2XD4A 4QPJC 2BM8A 4IMRA 2QEQA 3K1YA 4P0TA 3ZY4A 1CVLA 2EKDA 2FR0A 3AL0C 2CUNA 1KR2A 1WCYA 3CNOA 5HQJA 5A2GA 4FQ5A 4R1NA 3ILHA 4PR0A 4JGGA 4RVNA 4YC7A 1C41A 4D43A 5L3SB 4KIFA 3KJZA 3RFUA 4BNNA 5AVTA 5JISA 3GOQA 4XLTA 4LY0A 3RVJA 1T8SA 1NVDA 4AWAA 4QBFA 4RLSA 1GFSA 2WM9B 4ND5A 3CCBA 1V25A 5CAEB 4EB8A 2GJ9A 1GAJA 2OHFA 4GBJA 4W7HA 1LDBA 3BJEA 1A4UA 1T8YA 2E89A 2ID8A 2JLBA 1Q2UA 2Q6TA 3JQ9C 4LZJA 1VI5A 4QYSA 4Z99A 1NT2A 1SELA 2VDWB 4RZ3A 4DIUA 2R4TA 2DHQA 3H7IA 3C70A 3STTA 4IV0A 4ENSA 2I7VA 4F3YA 4Y2RA 4FBMA 4ZI2A 2P9TA 4IX9A 2WPDA 3SXUB 4FVTA 4ZOEA 2FH5B 3HDTA 4DCNA 5CJPA 5TVKA 4CT5A 2OVFA 1HZJA 3QW2A 1TO1E 3H5VA 1XD9A 3R5TA 5D3MA 4LX8A 4CL3A 4IX1A 2Z4SA 1E2KA 1ULAA 2DFPA 1N2ZA 2IXFA 2UKDA 3A4LA 4LOKA 1MZVA 2B78A 2WHXA 4M8LA 4PEVA 4UMDA 3HY6A 4KH1A 4KWTA 3BEDA 3O94A 3W1WA 4CM5A 5A1TA 5ICFA 4D5EA 1XTRA 1SIWA 1ZMXA 2Q21A 5F1YA 5FL3A 5LCXA 5JZ9A 3LL7A 3X1MA 5KYXA 3AESB 1KI6A 3ETNA 4M7WA 2BJVA 1LV8A 1N5RA 1X42A 3BHNA 2AQHA 1YGPA 2I67A 2Y9MB 3GZJA 3T7TA 3HUDA 1DMSA 4MPTA 1UXOA 2NUPB 4GXTA 4CKBB 2XCSB 1SXJC 4CR8A 2AHOA 4OI0A 3ADOA 2UAGA 2JGRA 4HYYA 1V96A 2XGGA 4WERA 3WK6A 1SVLA 3UENA 1LTKA 4GBMA 4UCXA 5A9SA 1WHTB 3BXOA 3O5AA 3SZLA 4M2LA 1ZOIA 3TI7A 1TRHA 4R2MA 3NBAA 2NTVA 2O2IA 3MXOA 3V7FA 1AMNA 2IH5A 3T1YB 2VTVA 4BFWA 1F9EA 3R3JA 2VBFA 1SK8A 5A4IS 2JVJA 5J9FA 3JZAA 3CKYA 2IYPA 2YYSA 4RD0A 1D6SA 4BJ5A 3PDWA 4DLXA 1CF4A 3SZRA 4LNUA 1M8JA 4GWGA 3MOGA 5J3JA 1S3SA 3TOZA 3VZSA 1NBHA 3T7EA 4BFCA 3HJFA 1A7KA 3OWXA 4X62B 4PPGA 3G0DA 2OOKA 5JEEA 2HA4A 1YJ5A 2V65A 4PXSA 1O5OA 1CETA 1Z2EA 1ZQ1A 4P33A 1Z82A 1DWUA 3E2MA 4N39A 5E3IA 4JIGA 4JBYA 4N8DA 4EITA 2IUEA 1OASA 1WMEA 2DTEA 1OOEA 3WKBA 5K0ZA 4KWCA 2DB3A 2R6DA 2QN1A 1DKOA 1EFRD 5KOIA 3CVYA 3VQTA 2ZI5A 4B2YA 4K46A 1NUAA 1UEIA 1XMPA 1I0ZA 2QUZA 1ZONA 5TPWA 2IFTA 3CSUA 1G20A 3OQ1A 5K51A 1ZVKA 3P1JA 2NQ8A 4GNKA 4CWAA 2W6PA 4DYDA 2YR0A 3L40A 2X0DA 5LNK1 3W5BA 3GJXC 2WUGA 2DSNA 3W5CA 2Y1DA 3R3SA 1J99A 2NXWA 4BQPA 1HNWB 3ZYCA 4L75A 3DT6A 4ERXA 3CM0A 1IBSA 1ACJA 2VAMA 2AMVA 1KBZA 3G1TA 1VXOA 3BULA 1D2AA 2CGEA 1GAQA 3CB4A 3HR7A 3WHLA 4G5YA 4NMWA 2XYGA 1IDN1 3JQFC 4QNMA 5DHPA 1GRQA 2GAOA 1NP7A 5DNWA 5EJ2A 4PNEA 1R4ZA 2V8BA 4IQ4A 5G1PA 3WK8A 5JNWA 4I9FA 1Z6AA 1XVVA 3FYUA 4CF5A 2Q0SA 1JAIA 5HF6A 3O8CA 3BQNB 1IBKB 4YP7A 1BE1A 4UNSA 1G19A 2A9KA 3VPGA 1O95C 3HO8A 4OBWA 1IK6A 1S2LA 1E9BA 1SA0B 1TIBA 1PI3A 1TYEB 4UAGA 3ZEAA 4DTCA 3LZCA 4OLFA 3UJ7A 1N2SA 4FWIB 3KDAA 3HPQA 3IE2A 1KJQA 3CF4A 1DOHA 4UUQA 1TK3A 2CJWB 2OPHA 2WAYA 4B1FA 3CHYA 3CUUA 1R0KA 1T1IA 2BZ0A 4Y2GA 3QOWA 1I1OA 1K98A 3DMTC 5ESDA 4ZALA 1NFRA 4ER6A 1HQDA 2XSZD 4DCSA 4YGYA 2TS1A 1SVNA 1C3JA 2C95A 2R97A 3DXFA 1YDEA 4FFPA 3ZGOA 1C3XA 2WV7A 3KJNA 1JSXA 4HEA6 2V6BA 4Q16A 2QN3A 3JD0A 3ESYA 4E1VA 2BDUA 2AS0A 1YDMA 1UBUS 2QY9A 4HJXA 4EPWA 1IZYA 4HVLA 5K01A 2N47A 2FR1A 4UM9D 2I2AA 2NO4A 3S5UA 3VKVA 4DJJA 1CEYA 1YIOA 3R7AA 4KQMA 3S6JA 3TXXA 3VO8A 5IM4A 3VDXA 2BFAA 4F8EA 5AJZA 2IT1A 2C3MA 2ODEA 1UIRA 2G9RA 5BV0A 4O25A 3THWA 2D7DA 4GSKA 3T3MB 4HEHA 2QD1A 1ND5A 1DL5A 4P3NA 1GZ4A 4I4LA 4PFQA 2NV6A 4RK6A 3SCZA 1Q1GA 1XQ1A 4L2IA 2ZT8A 1W5EA 1DKUA 2OCXA 4XSGA 3LT5A 3ND5A 2BGMA 3TINA 3ZWDA 3PA6A 3FCOA 4CL0A 3OJCA 4G1UC 4EYSA 1TPZA 1VIDA 1Z07A 3R1IA 3GT4A 2QVBA 3MCWA 4MQBA 5C8DA 5E6RA 1VECA 1KI2A 2J3MA 3EIFA 5ALYA 4XQ0A 2GZMA 1RI5A 1ZCFA 3Q40A 3QFHA 1T0JB 3UWKA 4TQGA 1NTRA 5JEDA 1LLUA 2P1RA 2X5KO 5EY5B 4FHEA 4Z1OA 1BWPA 1MV5A 1QFSA 1U3WA 4PXYA 3RS4A 4BZQA 3R7DA 2JI7A 2GERA 5C8ZA 4JFAA 2R85A 5T3YA 1ZGZA 5C7LO 4A6DA 4QG7A 1T1JA 4AZ3A 1VXRA 3AOEC 4HB3A 2JIQA 3O9ZA 4QJBA 1Y8ZA 4AJOA 3HBJA 2WMYA 4NE7A 1EJBA 5KHOC 5DGCA 1YE5A 4HWTA 4JXKA 3PL5A 4LZNA 2OSBA 3IVAA 3TDNA 2I91A 2BW0A 2VHVA 1PWXA 4Z3KA 3AM4A 3VZDA 1J97A 1A9QA 1G3UA 3BXPA 3Q8KA 1AY0A 1ODJA 3D43A 4F5WA 4AS1A 3Q3EA 5JMOA 3TYXA 3QVGB 3GGGA 4U5QA 1V3UA 5DW3A 3VYVA 1Q57A 2G71A 4ND2A 4N5NA 5FLKA 3QVXA 4UUBA 2EQ5A 5A4JA 1M76A 5KYNA 2B82A 2A1IA 4MI9A 1RAFA 4UM9B 5JCXA 1IPFA 4LJ7A 1RHJA 1S8AA 4BO0A 4DDKA 1RCTE 1KZGB 3IKJA 2JCXA 2UYCA 2QYHA 1IWOA 2BGRA 3HG7A 4OYYA 1LPAB 5DM2A 1HDRA 2FW6A 4HY3A 4NENB 3SEAA 4HWGA 4R6XA 1OX4A 4TMTA 4F6RB 4TXLA 4YAUA 3RBAA 1MAAA 5CVJA 2FEAA 3BIJA 5FUQA 2OFOA 2YC2C 1GGKA 4O8ZA 2WLSA 3DYIA 1P2UA 3H3XA 4F6RA 1ID8A 5EXTA 4BFZA 3KVRA 3OPXA 3PF9A 3Q7SA 1OI2A 3T7DA 2QD5A 2VK8A 4YAIA 1A88A 2X9VA 3NVAA 4M0LA 4Z1MA 1SCIA 2JC3A 1WDKA 2ZTSA 4K26A 4WRRA 2PQ6A 1FUUA 2FWPA 3DTVA 3H2KA 4JEUA 3HVHA 5K1ZA 1T9BA 3WLRA 1J09A 4OKNA 4ILKA 1NURA 2DT5A 3P2EA 4JA2A 5G40A 2DCUA 3WLMA 4YJFB 1T6ZA 3EEFA 3AU8A 3KVNA 2XBLA 2Z1NA 1XB2A 4ZI7F 1TF5A 1XO1A 2JIMA 3GFRA 2W6ID 1GWNA 5KX5F 2O20A 3KT0A 3H18A 4OATA 2B34A 3NNNA 4EKYA 4OHMA 1T8RA 1WLSA 2H3EA 2MTBA 5IJ9B 5HBGA 1GLVA 1N0UA 4I5DA 1B26A 2CVOA 4G67A 4YEDA 5TMEA 2AC7A 4LJKA 2OKGA 4H16A 5F3DA 2IWHA 1CYEA 1KK3A 4MX8A 5FRDA 2DBRA 4A73A 4E07A 3PRKE 2R4UA 3MUOA 5B1SA 2ATEA 1BO6A 2VPIA 4GPBA 4MEBA 6GPBA 2HDOA 3CLSC 3HQ4O 3AT1A 2VHTA 1P29A 5F2EA 2VQEB 2R1UA 2OHOA 4JYCA 3ER8A 2DBZA 3NM6B 4WGGA 3GJ7A 1DT3A 2J07A 3FVWA 4JBNA 4K9DA 3RS7A 2C00A 4IH4A 4LBZA 4DJ5X 2AEFA 1BS9A 2FEMA 2H2IA 1VCMA 2VAPA 3I0NA 2X41A 4H1UA 4JCOA 2QVXX 4NS4A 3EXHA 4EK9A 3OTWA 1A2KC 1YU6A 4DM4A 1DXHA 1PV4A 1U2QA 1UQTA 1AKQA 1E3WB 2OD7A 4L6IA 3U4CA 4YLYA 4HQ6A 3T3IA 2QTAA 1F6BA 5FFMA 1ZGCA 4X9XA 3VSAA 3RLFA 3VVLA 3WGQA 4BNYA 2I7XA 1I3OA 2C4KA 3MS4A 4AUMA 4JUCA 4BJ6A 1GQSA 3NIGB 2IPMA 1QFJA 4KSCA 2IOQA 2AEEA 3ZE9A 5J4VA 2Y66A 1T5DX 4LBWA 3W78A 1XXHB 3GRCA 4KOAA 4L2IB 4BPRA 2EKBA 4M7RA 3QE9Y 5IRCD 2B1IA 1T24A 2B4TO 3M6VA 1UMDB 3EIEA 4MVYA 5BSUA 5I47A 5E9JA 2XMSA 4XCVA 4GLBA 3H5LA 4NBSA 1JU9A 1XZLA 1DAMA 3OC6A 1D1QA 3OX3A 3P7MA 1KA9H 4YUWA 3IA2A 1UC8A 1SU4A 1H05A 3HCEA 4MQ6A 4LE0A 1PL7A 1XCJA 3VHXB 4D8VA 3V7YA 2I65A 3VOBA 4WXYB 1GPNA 4X91A 1GGNA 1C50A 2IX9A 4N47A 3FFAA 4RPJA 3TSZA 5ADHA 3LX8A 2DLCX 1GHTA 2FPWA 3RGGA 4WOCA 1WMBA 4KREA 3QBDA 1Z25A 2RKWA 2JPDA 4P1ZA 2QY6A 3VU1A 2VXCA 1UM8A 1R64A 3FM9A 1LH0A 5IC4A 1RXYA</