4J3FA

Crystal structure of fabi from f. tularensis in complex with novel inhibitors based on the benzimidazole scaffold.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
259
structure length
259
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biological evaluation of a novel series of benzimidazole inhibitors of Francisella tularensis enoyl-ACP reductase (FabI).
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
total genus 88
structure length 259
sequence length 259
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j3fA00
1UDBA 3PLNA 3WQSB 4ZICA 2XAAA 5ILOA 3KTDA 1NQ5A 1EBFA 1QYXA 4DGSA 1WDLA 3CINA 2IZZA 1VKNA 2UAGA 1ZUD1 3VPFA 2EXXA 5I9NA 4RVSA 1R4MA 3STHA 2HUNA 2I67A 3C1AA 4JK3A 2IYOA 3HUDA 3DZFA 4WEOA 1T2FA 1NHGA 1EVJA 2RHCA 3O8QA 5I7VA 2HK9A 3D4PA 1LXCA 4B4VA 3UVEA 4MVJD 1E7YA 3RC9A 2P4QA 4R54A 4YAEA 3RBZA 4BNLA 2IEBA 1SOVA 3VZSA 5LDGA 1KVRA 2X1HA 3H9EO 2JCXA 1HYHA 1PR3A 3LVFO 2AEMA 1U3UA 3IDSA 3ZWYA 2NM0A 4D0RA 4BGVA 3PFWO 2WMDA 3RUEA 4NBRA 3MJCA 2FOIA 5BSGA 4OMUA 3IL2A 2Y68A 3SXPA 3I1JA 4K6FA 3X2EA 1J4AA 3TFOA 3O03A 4DC0A 4R68A 4JJFA 1PJSA 4FFRA 3OIFA 3JQAA 1LSSA 1JKFA 5L45A 4UUPA 2TMGA 1E7WA 2YY7A 2ZJ1A 2BD0A 4WLEA 4G2NA 4ROSA 1PZHA 1YL7A 3AWDA 3NGXA 4CM5A 4OXNA 1U7TA 1LTHR 1R66A 3SEFA 2VRBA 3KB6A 1WZIA 1GL3A 1CQIA 1ENPA 3U09A 4FW8A 4PLZA 4PRKA 1T2AA 1MLDA 3D4NA 4PZEA 4CJXA 4WCDA 3GQVA 4GH5A 3WGGA 2ZCUA 1LDGA 1OFGA 2WYUA 4DLBA 1NASA 3O4RA 4ND4A 2V7PA 3K2EA 3BZUA 1SMKA 4FSHA 4ALNA 3NDRA 1G6KA 4TQGA 3UKOA 3VDQA 4FC6A 2FR0A 3Q1LA 4LCEA 4TZTA 2IZ0A 3U4CA 1LDYA 8ADHA 2OBYA 4JP2A 4BGUA 2ZTVA 2PKRA 4W7HA 1PTJA 2RH4A 1ZEJA 5GZ3A 4UUMA 4D3DA 2VN8A 5AXAA 2W4QA 4FQ8A 1BSVA 3O26A 2G82A 4OQYA 2Y1EA 3I52A 3O8QB 4RF3A 5KTKA 2AEFA 3OECA 2JAHA 4EW6A 1AGNA 4RLSA 4DBZA 4E6PA 1YB5A 1C0PA 3DHYA 1F0YA 5TRTA 2FPPA 3IUPA 4BIIA 3RUFA 4UREA 3WS7A 3W1VA 3ULKA 1XCBA 1I24A 1Y9EA 2IXBA 4RL6A 1KC1A 3E1KA 1I2CA 2EP7A 3JYOA 3OIGA 2GYYA 1GTMA 3ZU3A 1NM5A 1BHSA 4IDDA 1ZK4A 2NWQA 3R1IA 1UAYA 1IYZA 2Q1UA 4R69A 5C7OO 3NT4A 2FSSA 4IDAA 4B3IA 3ONEA 3H3FA 1YGYA 4ND2A 1NQTA 1E0DA 4YAKA 1WMBA 1PJQA 3KHUA 3MJEA 2WEKA 4NU6A 4UULA 4BO3A 3A28A 2AQIA 1VE9A 5ES3A 3B1KA 2HDHA 1DHRA 4NBTA 1SAYA 2R00C 4CMIA 1BXKA 3RJ9A 1H6BA 5GZ1A 4EUFA 2Z95A 3DZKA 5B37A 4YWJA 4RPJA 2X9GA 2J5QA 2F00A 1E5LA 2YHIA 5JBIA 1XKQA 1HT0A 5I7FA 1LEHA 5T8KA 3VH2A 1DOHA 1ZXLA 3UF0A 3K92A 1E1LA 3WFIA 1KERA 1I30A 1LRJA 3DZHA 1DJQA 5DBGA 1U8XX 1SBYA 2C7GA 3GGOA 5JSFA 3VDRA 4CM4B 1A71A 2YZ7A 3G49A 1IHXA 1WWKA 3H2SA 5AXBA 3ZHBA 3EZYA 5ILGA 2V6GA 5U4QA 1L7DA 4CLDA 4FFMA 2NVWA 3GFBA 1NPTO 1BTOA 3EZLA 5CDGA 1UP7A 1DC3A 4XYLA 3WBFA 4BNXA 3UXYA 2A35A 1ISIA 1Y81A 4HWKA 1FF9A 4IXWA 3LT4A 4IJKA 4INAA 2E48A 4XQCA 2O2SA 4IQGA 4TVBA 3WNVA 4CQLB 1GUZA 2BGKA 3LF1A 2G17A 1JQBA 3QE3A 4YRDA 3EGOA 3FSRA 1GUYA 1E7QA 4NFSA 3DOJA 3AI1A 3L6EA 4TRMA 4AG3A 3FF4A 5A06A 2BHLA 1F17A 3E9MA 1ML3A 1DIHA 2W90A 5C7IO 3FNGA 1HRDA 1GCUA 3TPCA 4XB2A 3FPLA 4N7RA 2O2YA 3ENKA 1KETA 2PR2A 4FGWA 3GNTA 4GLLA 1PJCA 1V35A 3NTOA 3ZZNA 4HFNA 1NQOA 3JSAA 3PJFA 1F8FA 1NWCA 4BQPA 5IZ4A 1VJ1A 4OKNA 3N7UA 4UVHA 4YJDA 5BNFA 3PHLA 2IE0A 2WTBA 4PN3A 2VHXA 3BYZA 5T64A 3VH4A 1LUAA 1AHHA 1DDOA 2CDBA 5A3JA 1P0FA 3B6ZA 1P45A 4ND1A 4ALMA 3UH1A 1XG5A 2ZYDA 4GX5A 4Z0TA 1R0SA 4OSOA 1H2BA 3GN2A 3JQCA 1KOLA 3HWRA 2JD2A 4QQRA 2X4GA 4QEDA 4WNIA 4A0SA 1NR7A 1ZK0A 3C85A 2PNFA 4BVAA 4FFNA 2Q2QA 4O0LA 3RD5A 4D3SA 3F1KA 4MO2A 5G0UA 4BKUA 2J5KA 1K6IA 2PV7A 2D3TA 2Q45A 2B4QA 1LLDA 3DO5A 3JQEA 3QWHA 5A4DA 1XDWA 2OP1A 3OJFA 2G1UA 1BXGA 2HAEA 1DPGA 2R00A 4R9SA 2Y1FA 1ADFA 5JC1A 4OH1A 3PTZA 3TWOA 1U4SA 3AU8A 3GPIA 4BNYA 2X9NA 5TSDA 4CMCA 3E5RA 1SOWA 3RKUA 4PLCA 4CV1A 4DTIA 5JAMA 4BMSA 2D59A 3WGIA 4ZA2A 4CQMD 4NHEA 2O3QA 1P44A 1RJWA 1T4DA 3SC4A 1R0LA 3GUYA 3V2GA 3TF5A 1CERA 1M67A 1UZNA 4CUKA 4ZU3A 3TL2A 1U8FO 4LSWA 5B1YA 3VPHA 3QVWA 3LT1A 4KUEA 4GL4A 5DT9A 3RC1A 4CODB 2YHUA 1B8VA 3RU7A 4I8XA 4Z9FA 2EF1A 3MTJA 1WVGA 4PZCA 4BO6A 1Q0LA 2AXQA 5G0TA 1HWYA 3PYLA 4XYBA 3TDKA 4PLPA 4BO9A 4D45A 2OHXA 3RSHA 2Q50A 1DLIA 1P77A 1BDMA 3WOHA 1PX0A 5F5NA 5KCZA 5JCXA 1Y8RA 2EW2A 4IGFA 4OM8A 4D44A 1BWSA 3GY0A 3PGJA 1ZK1A 3HN2A 4IBOA 4WOKA 2Y66A 1KVUA 2PH5A 1X1EA 3OBBA 4ZQEA 3DDNA 5KOIA 3L0DA 3U9LA 1E6UA 4GMGA 1Z74A 3PFFA 4DMMA 1ZSNA 1QG6A 1O94A 3HFGA 2C5EA 1P9LA 4U0KA 4TMFA 3EDMA 3DQPA 4XD2A 1WNTA 9LDTA 3TN7A 2BGMA 1EUCA 4ONEA 5I8ZA 3X2FA 4WLUA 3BMNB 4ZQBA 3GZNB 1YQDA 1JWAB 2Q1WA 2Q2WA 4D79A 3GUCA 4CV0A 3SLKA 1T1RA 2VT3A 1OZAA 2GR9A 5CHEA 1N8KA 4IIUA 1Q2XA 3ZNOA 1EBUA 4GI2A 5GMOA 1VLLA 5F21A 3U0BA 1LC3A 3BMCB 4WCFB 2ZTMA 1O6ZA 3GGPA 3WTCA 2DU8A 1A27A 3PVZA 1F12A 1YBMA 3ZN2A 3GRPA 3CZRA 2O7QA 3ZCXA 2Q3EA 3H5AA 3B70A 4HADA 4L73A 4E33A 3QY9A 5KJFA 1H0KA 4XJSA 3ZGYA 4DXHA 5FI3A 5K0ZA 1YS4A 2BI8A 4I1IA 4MIYA 1VM6A 2O48X 1HDRA 3GRKA 4CV3A 4Z9XA 4W82A 3JV7A 5H81A 1M2WA 4W9NC 5DDIP 5JAZA 2AMFA 2HO5A 2B35A 3VKUA 5CDUA 2D0IA 1WMAA 3W4KA 1PEDA 4YJFA 1EUDA 1P3DA 3GG9A 1HDOA 1I10A 2OO5A 4IDEA 3OJLA 1P1IA 3PXXA 2PY6A 2NTVA 3EC7A 3NEPX 3KYDA 5GY7A 4CMKA 4E2ZA 5MDHA 5TQVA 4AJ1A 3C7CB 5CFZA 2BKAA 2QZZA 2QW8A 3NAQA 5BT9A 3RFXA 1TT5A 4PG6A 1OC2A 1ZSVA 3E03A 1U1IA 4IJUA 3BTOA 5T5QA 1N1GA 2WJPA 4NBVA 1MFZA 4U6QA 4JBHA 1VC2A 3AW9A 1KC3A 4H15A 1I33A 3AM3A 3JQ8B 3HE3A 3IP1A 1ONNA 2JHGA 3GF4A 3GGGA 3EHEA 4DPMA 1FDUA 3CXRA 2IYPA 2RIRA 4OKIA 4A5OA 4JXKA 3DXFA 4XWYA 5JY1A 2Q1TA 3ASVA 4KTVE 5BNIA 2G5CA 4K28A 2HU2A 5AQ1A 4RF2A 2J3JA 2CY0A 3DBVO 2EKLA 3OSUA 3S1LA 4OJNA 4OXYA 2C82A 3A9WA 1J0XO 3E9QA 3EK2A 3RAJA 3D3WA 1Z75A 2JD0A 1P1RA 1DAOA 2P9GA 1YRLA 3JQ6A 4EBFA 2DPGA 5LC1A 2OBNA 4CM6A 1GPDG 3UOGA 1NFQA 3V8BA 4GSLA 4CLOA 3RI3A 2EWMA 3OIDA 3A1NA 4OO3A 5F1PA 5KNLA 1U3VA 1AXEA 2DQ4A 3E9NA 1B0AA 3IMFA 4BNNA 3DBLB 2GDZA 1E7MA 2NU9A 5KVSA 3NDIA 3M6IA 4IMPA 1MG0A 5H82A 3WXBA 1PJ3A 2PZMA 1ULSA 4OSPA 5TJHA 1LQTA 1PGJA 3OH8A 3AY6A 4KDEA 3ABIA 4AJ4A 3FI9A 1SNYA 3JQAD 1C3VA 3DTTA 5HA5A 1H9AA 2H9IA 2JHFA 3GDGA 2UV8A 3ON5A 1A9YA 3LT2A 1RYDA 2VWQA 3CH6A 4LW8A 1LDMA 2OFPA 4O5OA 3ZWWA 1NFRA 1PWXA 3DBHB 1C0KA 4R3WA 1QV7A 1JAYA 3OA0A 3FRJA 4R5MA 1I3NA 3DZBA 4CMAA 2AG8A 2G0TA 4Q3CA 5JDIA 1TB4A 1Q1NA 2X23A 4E12A 4QFCA 2QZ9A 4R3NA 4W6ZA 1E6EA 1HDCA 2P2SA 3WYCA 1HDYA 1AUPA 2IDZA 1YQXA 2NU8A 1YB4A 1DC5A 2I65A 3VH3A 4CM3A 5ITVA 1EVYA 1SC6A 2CF5A 5AXDA 1T25A 1QYDA 3VH1A 4BO2A 3H9QA 5L40A 1PS0A 2VUUA 3W6UA 3TSCA 1X15A 2YQ4A 3ZNPA 5I7SA 1E7SA 5G0SA 2X86A 5JDCA 3ZU5A 2Q1SA 3NTQA 4XQGA 1XGKA 4GPD1 4HP8A 1XQ6A 3C1OA 1KEWA 1VPDA 4YDRA 5HWSA 4FS3A 1FDVA 2PTGA 3P2OA 4PG7A 4TRRA 4B3HA 4HXYA 1HF3A 1JVSA 3BTVA 5DOVA 1T4BA 3DEYX 4R4JA 4CLOB 4L4RA 4BO4A 1Q0QA 4CMJA 4CV2A 3FWNA 4BV8A 3KBOA 4HNHA 3GVHA 4NJOA 1N92A 4XYGA 3ONDA 1UXJA 4QUKA 1E3EA 3KO8A 3WSVA 2YDXA 5TGDA 1GQ2A 3AM4A 1Z7EA 5BQFA 3UN1A 3JYNA 2OP0A 1ISMA 1QYCA 3DONA 5A03A 3VVBA 2I3AA 1BGVA 2JFFA 2X0IA 3P19A 4U6SA 2EJWA 4R1NA 1P1JA 2OUIA 2HMWA 2OORA 3JTMA 3VPXA 2TMDA 2YFHA 5F1KA 1UP6A 2I76A 4QTZA 1PU2A 3MWDB 1F8GA 4UAGA 3WYEA 1C1XA 3KYCA 1A7KA 1ZXBA 3QWFA 1LQUA 4NBWA 2DKNA 4MP3A 4YPOA 3SVTA 1IPEA 1R16A 2Q2VA 1BG6A 2Z1MA 7ADHA 3A14A 1GZ6A 3RIHA 4XX0A 2O23A 1A4IA 1HDZA 3ONFA 4DQVA 4H16A 4L8VA 5IF3A 2H1SA 3PHGA 3I6IA 5IZCA 1HTBA 2X58A 1M75A 5U1PA 2B5WA 4IY1A 5KKCA 3TZCA 4RVHA 3LDHA 4M49A 2OZPA 3D1LA 4P4LA 4AJKA 3VVCA 3Q11A 2HMUA 4G65A 4PLGA 1TVEA 3ZV3A 4P4NA 3T4EA 4N5MA 4W7IA 4BV9A 4K1LA 3WLEA 2CUKA 3FPCA 4CM9D 2GNAA 2NUAA 3ITKA 3BHMA 3CKYA 3HDQA 3I3OA 2VRCA 3NUGA 2X22A 5T8KC 1QYWA 3NJ4A 3BHIA 2QX7A 1IE3A 1GCOA 2BI7A 2DBVO 4WNCA 1WZEA 5JMWA 4RZHA 1UXKA 3UICA 4OIMA 1GYPA 2QHXA 1HE3A 4IS2A 3QJ5A 4QT0A 2O3TA 4J0EA 5CEJA 3GHYA 3RFTA 2Z5LA 4C7JA 4RQTA 4BO7A 1CEQA 2I6TA 1X13A 2NQTA 2Y05A 4YJGA 3ZU4A 4QO7A 4EJ0A 2DBQA 3QQPA 1MXFA 1B15A 5IFLA 3GZ4A 1M6HA 3OQ6A 1XR3A 1YONA 2IRWA 3O9ZA 4PLTA 5A9SA 3ZWBA 2EG9A 1XEAA 2GD1O 2GERA 1BW9A 3R0IA 1GU7A 1E5QA 4A26A 5JDIC 1DIRA 3QHAA 3RC2A 3U5TA 1R4MB 2VWPA 4I5GA 1K2WA 1T2DA 2GF2A 1DEHA 4OYRA 3W8FA 1F14A 4XDZA 3I4CA 2R6JA 3EUWA 2ZYAA 3WIEA 4EUEA 3U62A 1D8AA 4F45A 5A04A 4NPCA 1Y6JA 4YAJA 3AFNA 2WD7B 3UAGA 1ZFNA 4BNZA 1DHTA 1GV0A 2HRZA 3E48A 3Q9UA 1EK5A 4YB8A 5ITWA 5A05A 3LYLA 3U4HA 5HS4A 1H9BA 5LCXA 1U28A 5EN4A 3DMTC 2DUUA 4WECA 1ENYA 1RYEA 4ND5A 3EW7A 3WGZA 5DNAA 3WQRA 4I08A 2QRJA 2PGJA 4CQMA 1N9GB 4N18A 1BXZA 2OMEA 1GZ3A 5CG2A 1HL3A 1CRWG 1B3RA 1ZJZA 3JQAB 4RPKA 4R41A 4TROA 2VZ0A 3ANMA 4L76A 4YVFA 5F1OA 4E5NA 3MJTA 3C7DB 4RVUA 4RZIA 4P38A 1KVTA 4KWHA 2NSDA 4JN6B 4LVCA 4J0FA 3M2TA 1TT5B 2Y1GA 1E3WB 1EZ4A 4CMEA 1MGOA 1GV1A 4A27A 5DCWA 4PG4A 2UUOA 2YQ5A 2X5OA 4ZQGA 1ZK2A 4QXMA 4A03A 3DB2A 4QSMA 2FHSA 1NFFA 3Q9NA 1PJLA 3BMNA 3F6YA 1PZGA 4CM4A 1QRRA 5A9SB 1BW9B 2Y93A 2DTXA 4NK4A 3UCEA 4DYDA 2AHRA 4R9RA 1K6JA 4GSKA 1IOLA 3LSYA 4W99A 1W0CA 2YW9A 3PLRA 4WLNA 3WX0A 5EESA 1LSUA 1PL8A 2IXAA 2ZTUA 3Q3CA 3GG2A 3GFGA 1IPFA 1N1EA 1PL7A 4MIOA 4AVYA 3UGKA 1QMGA 3D4OA 1K6XA 5HTOA 4D43A 3UCXA 1MA0A 3RQSA 3WNQA 1VRWA 1K5HA 3JD2A 1NAIA 1QORA 1Z45A 4ALLA 3VZQA 4PVCA 1I3LA 3EYWA 1KVSA 4CR8A 4I9UA 1DFGA 4PFJA 3R3SA 4NG5A 2HJSA 2YYYA 2PLAA 4GX0A 1GFSA 4YT5A 4E2XA 3ZWCA 2X7HA 2LDBA 3MCVA 1PJBA 2GN6A 4TKLA 5U9CA 4Y67A 4E5YA 4AJNA 1VSUA 1Z6ZA 2GCGA 4CQMB 1A9ZA 1ENZA 3H5RA 3ROPA 1Q7CA 1MP0A 3GVIA 4DREA 2WE7A 4U5QA 4J16A 4FIZA 2EGHA 4EI2A 3QSGA 2WYVA 3RKRA 4OQZA 1LDNA 2PZLA 4HUJA 4WE3A 1GEGA 2QYSA 5F3RA 3AM5A 1DIAA 1XHLA 5KIAA 2DTEA 1P74A 1QXSA 2ZKLA 4XA8A 3FR7A 3HQ4O 4KQWA 3ZW9A 1GUFA 1E3JA 4BNFA 3TNLA 1E3WA 2X9VA 5IAAA 4FGSA 1ZEMA 3AUAA 4YYZA 3F4BA 3IJPA 2X0RA 3OM9A 2CMDA 1DJNA 1YVEI 1BRMA 2VT2A 4AJPA 2EEZA 1LI4A 1H93A 4EJ6A 2ZB4A 2HQ1A 2JFHA 1MUUA 4DC1A 4YT8A 2BFMA 1UZMA 1HYEA 4BNKA 2FR8A 3OJ0A 4MOWA 1LDEA 3RUCA 2CDAA 4MVJM 4Y8VA 2GUGA 1I3MA 3K30A 5KKAA 3V1UA 4HKTA 4J7XA 4PZDA 1B26A 4M8SA 3QWBA 4XCVA 2ZTLA 1IUKA 1A4UA 4PLYA 4XB1A 2WYWA 1WAMA 2ZB3A 3JQ7A 4ZD6A 4NZ9A 8LDHA 3ZHXA 1BDBA 1RM4A 4EZBA 4XZ3A 5L95A 5L3ZA 4IS3A 4QO8A 5K9ZA 2JFGA 1LDBA 3M1AA 1HDXA 1KYQA 2VNSA 4XQEA 4XKJA 4IDBA 2FN7A 1KY4A 1RM0A 5FFFA 1B8UA 3TOZA 1IY8A 1X7GA 3ENNA 1V6AA 2B4RO 3S2IA 4CM8B 5B4VA 1XWFA 4CM9A 3CIFA 4RORA 1HSOA 5L4LA 1DB3A 3JQFA 5DCYA 4O63O 2P68A 2VRCD 3G79A 2YJZA 2Z1NA 1HETA 3RU9A 4Y6PA 3OQBA 5C7LO 3LQFA 2NVBA 1E1NA 3IC5A 3R3JA 5DCUA 4GGPA 3C1TA 4KTTE 1K0UA 5JE8A 1XQ1A 3ZHYA 4P4GA 4IM7A 2AQHA 1Y8RB 4MP6A 3B1FA 3WICA 1ISJA 4IDFA 1GY8A 2P9EA 1E3IA 3EMKA 1YBVA 1MB4A 3GLQA 3GT0A 4UEOA 2O7SA 5IN5A 4DIBA 2JJYA 4HFMA 3OQ1A 1ISGA 1JN0A 1JVBA 4N5NA 4DIFA 3DFUA 3IP3A 4DBVO 1JTVA 3ICCA 1E77A 3GH3A 5CG1A 3L4SO 5ICMA 4B79A 3G17A 2Y99A 4CL3A 3PRJA 3LK7A 1YDEA 1Y1PA 2NLOA 1NPYA 3IKVA 2GRAA 2C2XA 3SX2A 5AXCA 3QWAA 3RROA 3BMQA 4NJMA 2VZ8A 4CL8A 2O4UX 3AY7A 5CAEA 1LBEA 5EJ2A 4WASA 4WKGA 4YAIA 4LGVA 4L4SA 1ZJYA 1PGOA 3JQ7B 1V3TA 2J8ZA 2VTEA 3HJAA 4LSMA 5CPBA 4E31A 2CNBA 1EE9A 3IAHA 5L4NA 2O3JA 1O8CA 1FDWA 4NNJA 5EPOA 4BGIA 1ISFA 1YJQA 2B5VA 2P5UA 1IHYA 4II3A 1H94A 3JYQA 2XOXA 2YV3A 2UDPA 3QA9A 3DZJA 4MVJA 2ZK7A 1GD1O 4CR6A 2HLPA 3NYWA 5T6BA 3PEFA 1TI7A 3UFXA 4BMNA 1Y8QA 4E0BA 5CEEA 4YT2A 1KEPA 1R0KA 1ID1A 1C0LA 4EEXA 4E5PA 5THQA 3TZHA 1DBVO 3E82A 3W4IA 1UDCA 2GO1A 3NRCA 4J43A 4WK6A 3S55A 4BO8A 2EERA 3UCFA 4JCOA 1I01A 1NAHA 4MJLA 3PWZA 2FWMX 3AY3A 1PZFA 3KYDB 4PLVA 2AE2A 4AL4A 3FBGA 4CUZA 5FWNA 5L7WA 3I4FA 4ZHSA 1DC4A 3OEWA 2D5AA 4RLHA 4CM7A 1DFHA 2VOEA 4D42A 4LCJA 2WD7A 3WSWA 3ZV6A 1VL6A 3PWKA 3CMCO 1C14A 4B3JA 2P91A 4YTEA 1NXQA 3JQ8A 4MVJF 1DRUA 1P33A 5MGBA 3AUTA 3AI2A 3BA1A 5A5FA 5IDWA 5HRUA 4LMRA 4EUHA 3FNFA 1XELA 3NDJA 3F5QA 3EY4A 3BMQB 3JQ9A 4FPXA 4NJMB 4IIVA 2EKQA 3KM0A 3KRTA 2BH9A 3QP9A 3G0OA 4QFDA 4FFOA 1EVIA 1Y7TA 2QRLA 3ADOA 5L53A 1U4OA 3QVSA 5AVOA 4Z0HO 4GBJA 1X14A 2PZJA 4L75A 1P1KA 4L74A 4F6LA 2ZYGA 4CMIB 1QLJA 4Y98A 4BL5A 5ICSA 4FN4A 1RPNA 3D64A 3K9QO 4XJTA 4WLOA 1JAXA 3DZIA 4XR4A 1LC0A 5DOZA 5IN4A 2Y1OA 1BMDA 3K8ZA 4F3YA 4DQUA 2CD9A 4LK3A 4IUYA 4DUPA 3HDYA 5T57A 2EW8A 1Y8QB 3E5MA 1EE2A 3GEDA 1Y9AA 2B37A 3U4IA 3BTSA 3NJ8A 1KBZA 3RUIA 2B69A 3QVTA 4FFPA 1ONPA 5G4LA 3A4VA 1PS8A 4Q3AA 1U2GA 2HSDA 1CETA 3H2ZA 4NDNE 4GX2A 3ITDA 1YH3A 2JKVA 3H8VA 4I5EA 2XXBA 4J1SA 3DOCA 3WIDA 1EVZA 1VL0A 3IJRA 4XYEA 4S1VA 1HDGO 2GN8A 4LRTB 4Q3BA 4YJFB 4ALJA 3DMTA 4LISA 5JAQA 1UR5A 1HE5A 3AI3A 3TZQA 3DBHA 4J4BA 4J9VA 5TT0A 1SB8A 4JGBA 3I9OA 5C5IA 4BO5A 1FK8A 4OOFA 5G0VA 2NVUA 3H6KA 5DP2A 3U3XA 3WQQA 2AG5A 4Q3EA 1L1FA 1DFIA 4DQXA 2ZCVA 3NGLA 1S6YA 4BKRA 1JW9B 2RHRA 4UVDA 4ESOA 4BNJA 5DULA 4CMBA 5L9AA 4OAQA 5JXWA 1B7GO 3AOEA 1M6WA 2Q49A 4RF4A 1ORRA 4AFNA 5JAIA 2IODA 1XYGA 2VYND 3F47A 3H9GA 4XR9A 4BNMA 1QYVA 3H65A 3M1LA 3TFQA 2NU7A 5CDTA 1I32A 2P9CA 2JAPA 3B1JA 2GGSA 3K5PA 3WGHA 3KLPX 4DMLA 1E7RA 3PZBA 2V6MA 5FF9A 4HNGA 1UJMA 1I8TA 1GDHA 3FBTA 4J9UE 2WDZA 1HLDA 1RKXA 9LDBA 3D3EA 1IB6A 1O89A 3AFMA 3NT5A 4R51A 1J6UA 1PIWA 3H3JA 1YE3A 1NTOA 2PFGA 1EFLA 1FJHA 1PJ2A 3RFVA 2AW5A 1SO8A 1LX6A 3LT0A 3WBBA 4QECA 5BR7A 2JL1A 2CZCA 3MWEB 4L0QA 1N2SA 1NWHA 1GR0A 3RUHA 4JJIA 3TJRA 1KEUA 1M76A 3GNQA 3INTA 5COAA 1H6DA 5CP8A 4E5MA 3KYBA 1WLYA 2B83A 2HK8A 3DWFA 1ZBQA 1Z7BA 4IXTA 2W2KA 2WSBA 1XLTA 3MJVA 1MG5A 5B12A 5CEFA 1SPXA 3RBVA 2ZATA 4P22A 3GDOA 2FPIA 3INGA 1C0IA 4E2YA 4BB6A 3WFJA 5K6AC 1JKIA 3QIVA 4MKXA 1GADO 3DAPA 4MVJP 3WGOA 4NK5A 1N7HA 1ZVMA 1KIFA 1KY5A 3BMCA 2DM6A 3EVTA 3GAZA 3OA2A 4FD3A 4CUJA 3CTMA 4PIVA 4BHTA 2J6IA 3FR8A 2PGLA 3V5NA 2D8AA 2A92A 3WB9A 1CWUA 3I6QA 3G3EA 4N54A 4HV4A 2Y1DA 1TXGA 5G4KB 3S2EA 4Z6KA 2J3HA 1TT7A 3K73O 3P2YA 2QIOA 3RASA 5TX7A 4CM8A 4LMPA 4WOJA 5H83A 1YKFA 4LVUA 4MINA 4YJHA 1PZEA 4IJWA 3TL3A 2V6FA 3FN4A 3SLGA 3IQDB 3OMLA 4NIMA 5T67A 3D5QA 1L7EA 3FNHA 1H6AA 4KP7A 1GYQA 1GZ4A 1ONOA 1ZNQO 3A06A 4JNKA 1OAAA 5L7YA 5JMPA 4A2CA 1NR1A 2C07A 4MP8A 3GVPA 1PQPA 1XU9A 3GHHA 2GASA 2VWGA 1O9BA 3F4LA 4PG8A 2DTDA 4FBGA 4DPLA 1F06A 4J6FA 5ENDA 1HXHA 4J7UA 1D3AA 1XU7A 2XXJA 3MJ4A 4J90A 1NPDA 4YAGA 4RO0A 1VSVA 4ZGWA 2PD4A 1PQUA 6LDHA 3RUAA 3AUUA 2RAFA 4I5DA 2HMTA 5A1TA 4IGEA 3SC6A 4BNGA 2W8ZA 5BSEA 2Y0DA 3PYXA 3ANLA 4AJOA 3VTZA 1ZCJA 3PJEA 3I23A 3C8MA 2ZIZA 3OETA 3MOGA 2WD8A 3JYPA 3LZ6A 2FRDA 4BNUA 1LRLA 1JDJA 4YACA 5KJ6A 4GKBA 2JCYA 1H5QA 1UP4A 2I99A 3GZNA 5A9RA 2ZB8A 1RWBA 1W4ZA 1D1TA 1PS9A 4IZIA 2AQ8A 2IEDA 1PGNA 2C29D 2D4AA 3K6JA 3GVCA 2AQKA 4NR0A 4WEQA 3PHHA 4BNWA 1MFPA 1U5AA 5KJEA 2NADA 1LA2A 4HX5A 3U49A 4E13A 4HY3A 4DPKA 1ENOA 1JA9A 1G0OA 2OOSA 1DAPA 5TLSA 1OI7A 4WPGA 1A5ZA 4BNTA 1GPJA 1HE4A 4AJJA 5B4UA 2R2GA 1LJ8A 1YWGO 1WXDA 1ZW1A 3PDJA 5CPFA 3N58A 2HMVA 3L9WA 3V2HA 4GGOA 4FFLA 2EGGA 1ISHA 5TIIA 1JWBB 4MKZA 4C4OA 1DO8A 3ROQA 4ZVVA 4M89A 1AXGA 5A3VA 1ADCA 3RBXA 3JQFC 3UHAA 3MZ0A 4UVGA 1RM3A 4D0SA 2VHZA 3AK4A 1MC4A 3GA0A 2BFAA 3H7AA 3ZWOA 4DLLA 2C0CA 2EHDA 3JCZA 3VPGA 3S8MA 1R6DA 3DZGA 2SCUA 4RV9A 1O95A 2DUWA 3DTYA 3I9JA 4K9DA 3KLMX 1T2CA 4OOEA 3ZNQA 1SEPA 1I2ZA 3AJRA 1U9JA 3HADA 1DLJA 3V2UA 2NU6A 4NU5A 4WJZA 4GWKA 2D1YA 5ADHA 5EQDA 2GZ1A 3INRA 3QV1A 2NV6A 3TOXA 1EQ2A 1DC6A 1UZLA 2NTJA 3HG7A 4R5HA 5DP1A 4JJGA 4BNHA 3D5TA 1G1AA 5CDSA 4BO1A 1R4NA 4TKMA 4J49A 3PQFA 5G0WA 1EUZA 3T7CA 4J3FA 1BXGB 2GN9A 1HZZA 4L4XA 3HZZA 4ZRNA 3S2GA 3OEYA 2X5JO 3E18A 4GMFA 4XIJA 2Y0EA 2DAPA 1DRVA 3F3SA 5L4SA 2CVZA 3JYLA 3ZWAA 1X7DA 2V6BA 3HHPA 3OICA 3VPSA 3WGTA 2NACA 4LRSB 3WWZA 2E49A 1E1KA 5TNXA 2O3UA 4CMGA 3PGXA 1MV8A 3D7LA 3FTNA 1QP8A 1ZK3A 4IQ8A 3IKTA 2EV9A 2DT5A 3L4BA 5G4KA 4JLWA 1OC4A 5DBFA 4NFYA 3P5SA 2HK7A 3NT2A 3BAZA 4J1QA 4ALKA 3I9NA 4MKRA 4BMVA 3H4VA 4UEKA 3ETDA 3GC6A 4E21A 2VZ9A 3ZW8A 1SCUA 3ASUA 3FTPA 5THKA 1JU9A 4WLFA 4B8ZA 5AOVA 3WMXA 2GSDA 3KVOA 4M54A 2VQ3A 3CSDA 4GVLA 3IIEA 2YV1A 3OF2A 4H7PA 2VUTA 4MVJI 1DXYA 1R12A 2I66A 3PQDA 3OFSA 1CIVA 4YEDA 1ZZEA 4ALIA 4KZPA 4BGEA 2W2LD 2DLDA 4LN1A 1I3KA 1QSGA 1H6CA 5DZSA 5C3MA 4HFRA 4DIOA 3E6AA 4E4YA 1NX6A 5A02A 3PK0A 4CLEA 3HB4X 4BB5A 3L07A 3WGYA 4R01A 1V0JA 2PWZA 1WDMA 1I5RA 1NQAO 5KVQA 1LRKA 3ZNNA 2UYYA 1LSJA 3ZWPA 1PGQA 2C5AA 4UEJA 5EERA 3CEAA 4CMHA 3ADPA 4I9HA 2ZB7A 5KJCA 3RUDA 1R37A 3RCBA 2WWRA 1SEVA 3GEGA 3DMYA 5JLAA 5I8WA 1B8PA 4PRLA 2DBZA 5IDXA 2CVQA 4UVIA 1ZIDA 2BLLA 1KVQA 2E82A 4J7CA 4Z3KA 1I0ZA 1U5CA 2HJRA 1EDOA 2B0JA 2XPCA 3KV3O 1LLUA 2PKQP 1OOEA 4WCFA 3PQEA 3T7EA 4A7PA 3ROMA 1E3LA 4FJ2A 4CLXA 1J49A 1P1FA 4RQUA 3HDHA 5DN9A 2UVDA 1KS9A 4QX6A 3ETEA 4NFHA 4NQZA 5B4TA 3PJDA 2FY8A 1FXSA 2J3IA 5G2OA 1WW8A 3JD4A 1UH5A 2X0NA 3CZMA 3DC2A 5IDYA 5JYDA 4AJEA 1E92A 4M1QA 3TZ6A 1JKJA 6ADHA 1PWZA 3PYMA 4G5HA 4XGIA 1MX3A 1G0NA 4PLFA 4E32A 4JQCA 3Q2KA 5ER9A 4MVJH 5COQA 4MVJG 2PD6A 3VTFA 5COBA 3LC1O 3Q0EA 1PR9A 2IZ1A 2BMAA 3JQBA 2F1KA 5ENVA 1ZKMA 3F46A 4BNVA 3ZWMA 5TC4A 2X5KO 1V3VA 3PHIA 2VUSA 2B36A 4FOSA 1T26A 3IUSA 4CPDA 3ZWVA 4CQLA 3MOIA 4G81A 1YOVB 2C20A 5I9MA 1LLQA 3WDSA 3NKLA 2FSVA 3KUXA 3NV9A 2O4CA 1ZMTA 5JYEA 2BRUA 4IJVA 4FJ0A 4D41A 1C1DB 4K6CA 5J23A 3PDUA 1ULUA 3HFSA 1ZSYA 3DHNA 1EK6A 3QVOA 5DF1A 3LC2O 2RCYA 4JIGA 2PD3A 3GN1A 3F5SA 4HBGA 4Q3NA 1Y5RA 5AYVA 4Z0PA 2DBRA 1WPQA 2EKPA 1A7AA 2X0JA 3IOYA 3M2PA 4XDYA 1YL6A 3K2BA 2GZ3A 1O0SA 5JO9A 4KDFA 1PQWA 4YRAA 3QVXA 5KJ1A 5HM8A 4XGNA 3PI7A 3RVDA 3MEQA 4YQYA 5JFOA 3G1UA 5JC8A 4J2HA 2Y1CA 4F6CA 1OBFO 1NBOA 5IXSA 2ZQYA 3NX4A 4FJ1A 2YFQA 4MIEA 2QG4A 3HDJA 4CM1A 2VWHA 4KUGA 1XIVA 1FDSA 1T2EA 1YXMA 3JQGA 5FYDA 2W2LA 3DOOA 4TZKA 4Z9YA 2D2IA 3S2FA 3VHRA 3UW3A 4J4HA 1V8BA 1X1TA 4O6VA 1DRWA 2W2KB 4J91A 2X8LA 3K31A 4C7KA 5JS6A 3WLFA 1R15A 3MJSA 1J5PA 4BKQA 1PJTA 3BXXA 1ADBA 2ZJ0A 3F9IA 4W9NA 5JCJA 4ZN6A 4FDAA 4JP3A 4EYEA 1E6WA 2HRBA 3OJEA 4A73A 5EMHA 5BSFA 3DBRB 4AJIA 3C24A 2GZ2A 2AA3A 3VZRA 1YJ8A 1CQJA 4JBIA 4Q3DA 1CJCA 1WP4A 3FHLA 4I5FA 4GWGA 3ST7A 3L4BC 1Z82A 4EDFA 2BFOA 1O5IA 4GLOA 3ZV5A 3LLSA 4IDCA 1P1HA 1LU9A 4IINA 1QV6A 2EJVA 1C1DA 3LU1A 3D0OA 1QKIA 2BELA 4YBZA 4WLVA 1TA4A 1GEEA 4WUVA 4KQXA 4XRGA 1B16A 4B4UA 4BO0A 4IDGA 3GMDA 1HLPA 4BKPA 3DFZA 3ETGA 3I5MA 4Y6SA 3VZPA 3EVNA 2P5YA 5IXYA 4RVGA 4B4OA 2A4KA 3UUWA 3LF2A 4P8RA 3O38A 5GZ6A 3TZKA 5A5EA 1B2LA 3VAZA 5LDHA 1GQYA 2O3SA 1YB1A 3CE6A 4PCVA 2VHYA 4ZQFA 3HN7A 3AOEC 1UDAA 1UAGA 2H5LA 3V1YA 3GDFA 4M55A 2FPGA 3F1LA 3QWIA 4UVEA 1NVGA 3WR5A 3BMOB 4B7CA 2J5RA 5IG2A 3DAGA 4R1TA 2CSUA 1HE2A 1U3TA 2VCYA 1LNQA 4XQ9A 1VJ0A 4XGKA 3OHSX 5IDQA 1M66A 4L9RA 5JCJD 4DYVA 1HEUA 4YA6A 2E37A 1W8DA 3I9KA 4IQ0A 3MTGA 4CMEC 1TLTA 3LLVA 3KETA 3WG9A 2HCTA 2Q4BA 3W8EA 2C7VA 3GPDG 4BKOA 4CLRA 5KWEA 1D4FA 3GEMA 5TS3A 2PGDA 3CMMA 3PIIA 4GX1A 2NQ8A 5A9TA 5C37A 2CDCA 4NH4A 4Q39A 2YDYA 4TRJA 3R6DA 4J2OA 4XYMA 3TRIA 1PGPA 3VC7A 3N74A 1C1XB 2E4AA 3KYCB 1RM5A 4TRNA 3DAFA 3ANNA 4Y6RA 2VHVA 3W4JA 2V65A 3WJAA 1WDKA 3COSA 4EITA 3DR3A 4FCCA 3H5NA 4JX8A 1ZH8A 2EIHA 2UUPA 3DHEA 3PP8A 4ZRMA 4B4WA 4EJMA 2Y0CA 1VJTA 3H9UA 3CPSA 1DIBA 3ORFA 1B14A 3KSDO 3GNSA 3JQDA 4FOOA 1IZ0A 3C3XA 1U2DA 3V1TC 5HBRA 1T24A 5JW6A 4XRRA 3SBOA 3ZHZA 1UXIA 2X6TA 3VOSA 1GYRA 3L77A 1SZJG 4AJLA 1Q0HA 1Q7GA 3CUKA 3JQBC 4RCVA 4U0JA 2EP5A 2DFVA 3PWSA 3L6OO 3WJ7A 2C59A 2GLXA 2Y67A 3KEQA 1ADGA 3HSKA 5EL0A 4TWRA 4OXKA 2J3KA 2LDXA 3Q2IA 3ZWXA 1N5DA 2C2YA 3G1TA 1YL5A 1H2HA 2D5CA 1LLCA 4FR5A 3AUSA 4A10A 2VYVA 4RJTA 3WMWA 1BVRA 5CDYA 2OL4A 1UUFA 3JD1A 3SJ7A 3BHJA 5L7TA 2DC1A 4M86A 3ROKA 4YJGB 4DL9A 2B4TO 4BQRA 3IS3A 3JQGB 3DL2A 3FD8A 4KMSA 5KVVA 2H6EA 3FWZA 3AOGA 2I3GA 4RGBA 1R4NB 2A9FA 1AE1A 3TQHA 4ILKA 4CLRB 2C54A 4B7UA 2YV2A 1Z73A 1GAEO 4GKVA 2FMUA 3WTBA 4F46A 4YRBA 3I9MA 2FR1A 1K3TA 4DA9A 1S7CA 2O3RA 4B7XA 3FCOA 2CVOA 1LSOA 5TF4A 4XEHA 1CDOA 1K89A 4Y9DA 4KOAA 1X0XA 3D3WB 2PKQO 2VNAA 3DBRA 3GK3A 3C7AA 4GAEA 2A94A 5IJZA 4KUHA 1EEHA 4E30A 1T1SA 2BF7A 1NVMB 3GAFA 4H3VA 3HNPA 1YBAA 4BOYA 2NVUB 2XF8A 5TT1A 1TEHA 1EQUA 4N5LA 2G76A 2NNLD 2Q99A 1Y5MA 4AJHA 5BSHA 5BNTA 1IL0A 3I9LA 4DLAA 5IZCC 4MVJE 4YQZA 4D46A 1I36A 4YJHB 3ZDFA 1AHIA 4TSKA 3PJGA 1I2BA 1FDTA 1QLHA 2VTDA 4J1TA 4S3MA 5JO0A 4D3FA 1AN9A 3QLJA 4B8WA 4RPLA 4BUCA 3E8XA 2WM3A 3OJOA 3ZU2A 1B3BA 5K6AA 4PGFA 3KSUA 2POQX 4GQAA 4E5KA 4MPDA 2OXIA 3P7MA 2JCVA 1YQGA 2QQ5A 2FP4A 4OGWA 3JD0A 2I5PO 1HSZA 3HB5X 5FI5A 1Q7BA 1P31A 1DSSG 4Z3DA 4UUOA 5I7EA 4ND3A 3GVXA 1YOVA 3KOUA 3GMSA 2VOJA 3GR6A 1CYDA 4U7WA 3B20A 2YHIB 3KZVA 5DBIA 1PSDA 1YO6A 2CFCA 2PZKA 4YR9A 4E2WA 3RWBA 3BIOA 5EIOA 1ZO8A 4J4TA 4OL9A 2ILTA 4IMRA 5EINA 2WE8A 3BTUA 3LC7O 1IULA 4ITUA 1XSEA 4FC7A 4GVXA 4ZQHA 2O50A 3QRWA 4CLHA 3I83A 4R1UA 1EFKA 4ID9A 2RBEA 3T4XA 4XIYA 1IZ9A 2HMSA 1U7HA 1UXGA 2AE1A 1OMOA 2BGLA 4R1SA 5FEUA 1PL6A 5JDCC 2I9PA 4EEZA 2Q46A 2W98A 1NYTA 1DIGA 4PVDA 2HKIA 1X0VA 3SJUA 2H63A 1D1SA 2BFPA 2YUTA 4TVOA 3GOHA 1EDZA 3OP4A 5L51A 3W8DA 4NI5A 5TJ9A 3AU9A 3JD3A 4MDHA 1FMCA 2GN4A 3NTRA 1NNUA 4ZJUA 1MXHA 1NP3A 2GPTA 4EGFA 4KWIA 4IPTA 5KVCA 3WGQA 3L6DA 1EMDA 5HS6A 3DBLA 1E1MA 3ICPA 4RPGA 2DFDA 4RVFA 3ZI0A 4J1NA 7MDHA 4BNIA 4JBGA 3PIDA 1CF2O 2ZQZA 4YT4A 3KEOA 1W73A 1N9GA 4II2A 4DRYA 1W6UA 3EAGA 3FNEA 4RVDA 5JNLA 4RDHA 3W6ZA 1SB9A 4O59O 3VKVA 1ARZA 4WGGA 1NVTA 4PG5A 1HYGA 4UUNA 2JD1A 2ET6A 4RPHA 5EQFA 4BS9A 1U3WA 4R16A 4RDIA 1QR6A 1P0CA 4YXFA 3PHJA 5JPIA 1NHWA 4W4TA 4IZHA 1BVUA 4U8GA 4WCFC 3U4DA 1N7GA 4Q9NA 1YDWA 1KEVA 2OGUA 2FZWA 4D7AA 3KSZO 1X7HA 3ZV4A 1GQQA 1MC5A 3KXDA 1E3SA 1UXHA 3WWYA 4AICA 2DVMA 1V3UA 4CR7A 3RJ5A 4AJ2A 4PLHA 4JROA 2CF6A 4E3ZA 2VYNA 2P4HX 3RC7A 3WYBA 1HZJA 2NTNA 1HKUA 1JLLA 4YCAA 5JY6A 4DWVA 2E6UX 4K26A 4I9NA 4NBUA 4NMHA 4RF5A 4FB5A 3PZRA 4O1MA 4DVJA 2RH8A 3ZWNA 2VYVD 2Q4EA 4URFA 1VKOA 3PPIA 2AEJA 3JQ9C 3BMOA 3L9XA 4X54A 5F5LA 5I9LA 2FZEA 4HFJA 4M87A 3H9JA 2QRKA 1D7OA 1ZMOA 1V9LA 3QW2A 2PK3A 4OHUA 2VHWA 5ER6A 1VI2A 2PA3A 2QYTA 1VL8A 1A72A 2DPHA 1XA0A 4PLWA 1PJ4A 3Q6IA 2PH3A 3K96A 3ZH2A
chains in the Genus database with same CATH superfamily
1OAOC 3QUCA 4EYQA 1QF9A 3JW8A 3A05A 5E3IA 4QREA 3OHMA 3O8CA 3IQIX 1I7SB 4K5QA 4IFTA 2CLSA 5ILOA 1NQ5A 2X3YA 3NIBA 1QYXA 1ZQ9A 3L7MA 2VSXA 4DLSA 4JI1B 1N6LA 3ZS8A 5MGNA 4PF1A 1VKNA 5KNCA 1ZUD1 4M6WA 5I9NA 3PC7A 3MQFA 3ELWA 2Y77A 1R4MA 2K4MA 5FRDA 2A5GA 4S12A 4JK3A 3F6EX 3HUDA 4GYYA 3DZFA 4G3XA 2J9YB 1T2FA 2ONCA 3IAUA 1EVJA 3N75A 2W70A 3S99A 4D6XA 2Q5FA 2D5BA 1QQTA 2O7VA 2OHGA 4MQEA 4PQRA 3I5AA 3O8QA 4LY0A 2FAXA 4RK4A 4DA7A 2KBFA 5G40A 3UVEA 5L8VA 1E7YA 4N9QA 4M7PA 2XCUA 3DXYA 4YAEA 3RBZA 5JS1A 4PXAA 1INLA 1RFLA 4RIEA 2N1BA 2X1HA 3H9EO 3ISTA 2JCXA 4DIMA 2IH4A 4KXWA 4MQLA 3KUUA 3BIFA 3C70A 3C98A 4NHOA 4QQ8A 5BXYA 2XIQA 3HM9A 4YRSA 4RY8A 2FYTA 1TIKA 3DDZX 3LHSA 1PR1A 4RSRA 4TV9F 4UUQA 3T5CA 3B6MA 3IIMA 4D0RA 4DE5A 721PA 4NBRA 2Y4NA 1C9JA 3MJCA 4JKOA 4X1OA 3IL2A 1XEXA 2G0AA 1IXSB 4KAXA 2PEYA 4WZBE 3SXPA 1HFKA 2VPQA 2OTCA 3I1JA 4GM4A 4RJIA 3X2EA 3GIWA 3MK31 3O03A 2IBMA 3OT1A 1WQ4A 2WZCA 1LSSA 1JKFA 5L45A 2OQRA 3CB4A 4UUPA 2Q9UA 2ZJ1A 3ESRA 5DO9A 4AMVA 2QORA 1YL7A 2GPAA 3FLMA 4R9VA 4BBAA 4HEA6 1GFWA 3NGXA 4F4JA 4F5ZA 3B12A 2P0AA 4CM5A 3C0KA 2JC3A 3O92A 4LE1A 1U7TA 3W9BA 6YASA 2QRPA 5JZSA 3A3YA 4M7WA 1R66A 1UJ6A 3RS2A 3OLXA 3HYCA 4LYYA 3SEFA 2O8EB 3AEUA 1HQKA 4LRWA 2VRBA 3IR7A 1XK7A 4MB6A 4UCQA 2VPPA 4KX3A 1GL3A 4HYYA 5G41A 1ENPA 3U09A 3I8XA 1AKYA 1T2AA 5LXTB 3I5UA 2XGMA 4CJXA 1OYWA 4K6OA 3WGGA 5C81A 5JCPA 1KY2A 1LDGA 1QOQB 4Z49A 1OFGA 4MGYR 5C1PA 4DLBA 1HMYA 1YS7A 2R2AA 2H54A 3K1ZA 1ZAKA 3L7BA 2IHUA 4RD6A 3CU5A 4FFSA 2R8RA 3QGMA 4FSHA 4INPA 3WNZA 2DFPA 4ALNA 5E3JA 1OXBB 3V8QA 3I8OA 3TIVA 2DSNA 1Z2CA 4FC6A 4CIYA 3Q1LA 3D3NA 4LOHA 2PZEA 4JXJA 4RKQA 4CGZA 8ADHA 4M1YA 2XNKA 4BGUA 5K8CA 4X6XA 4IILA 2BEWB 2RH4A 4UZEA 1RQNA 3P9RA 4WFKA 5P8WA 1P60A 1YFZA 4IDHA 2Y1EA 3WLHA 5EMMA 4YN3A 4YI3A 1PR0A 5B1IA 3HCCA 3ML1A 2ERXA 4RF3A 3F6SA 4X61A 4ZOBA 4DB4A 2AEFA 3OECA 2EHJA 4IEIA 4MYHA 3WB1A 4EW6A 1QP4A 3G5AA 2Z2YA 3HBAA 4ZARA 1JIIA 2AIRA 2IWRA 2JDID 5AM0A 2WUWE 2I29A 3DHYA 1SQ5A 3K0FA 4FUQA 3F67A 4JEUA 4XH9B 5TRTA 5BVHA 3K6SA 4NXMB 1GZ7A 3FYUA 4Q4JB 1PFQA 2WJIA 3RUFA 2IEGA 1N7JA 3W1VA 4BBPA 4DKXA 3E3LA 3T1HB 1NXSA 3B6IA 1Y9EA 4KCGA 5FLEX 3QEMB 2O5RA 3QX8A 1L4MA 2DUMA 3NYQA 2P6NA 3C5CA 2ZUWA 3UY4A 5EJEA 1FRFS 1GTMA 2R6HA 2GB4A 2AMJA 2C3UA 4OY3A 4EVRA 2PANA 4MWSA 4G1FA 1U99A 4WZAA 3W3AA 2C96A 2FZLA 1IYZA 1Y9JA 2Q1UA 2P2NA 2FSSA 2P4SA 1NOJA 1VE7A 3DEZA 4IDAA 2QN9A 4ND2A 4TM8A 3V7NA 4U7DA 4WRRA 4F06A 1E60A 1H2FA 1JQLB 1T5LA 2JDIA 3NMUF 4BEBA 3QY0A 1PJQA 4JVSB 5JJKA 4X71A 1E2UA 2ZRMA 3SS9X 1DAEA 2RC6A 1Z6YA 3PITA 3QUBA 5UKDA 4CDMA 2HDHA 4FU0A 1RPTA 2R00C 3M33A 1BXKA 1F2TA 1H6BA 3I2YX 5D3KA 3CKKA 4NMXB 3ZLVA 1E5LA 2ZI4A 1Z29A 3B2EA 2WNSA 3G0GA 4OI4A 5JBIA 1PL0A 2C83A 2IGBA 3FYDA 2JIMA 3BE5A 3C6ZA 1QOPB 4OB6A 1ECGA 1X7ZB 4AC9A 3AKZA 4P33A 1X94A 4D9EA 1DOHA 1ZXLA 2IZ5A 1C4XA 1E1LA 3WFIA 3TDNA 2C98A 1I30A 1XC7A 2W2PA 1PWEA 3CV3A 4HYTA 4TYPA 4JC5A 3QKTA 2C7GA 5E8RA 3WIOA 1CRPA 2Q4OA 3VDRA 4B46A 2R66A 1A71A 2YZ7A 2Q6LA 5K1ZA 5K0EA 1UAAA 1WUYA 2PH1A 3NONA 2FP3A 1P6XA 3HMKA 3BGSA 3ZHBA 4C87A 3EZYA 3H84A 5U4QA 1SZCA 4WOPA 4G0OA 5LB4A 2PSHA 3VC3A 1G8MA 2HA2A 4CU5A 1LW7A 2ORIA 3I9V1 3UK0A 1HDEA 1FUYB 3PWKA 2ONJA 5HUJA 2UUBB 1E2HA 1MOPA 3GLKA 5DSXA 3W90A 3CGGA 4ENUA 1M8JA 4UTXA 4ER6A 4ML3A 3PE4A 1XD8A 2EBWA 4XYLA 4BNXA 3L46A 3UXYA 2XUQA 1ISIA 1AUXA 3SF8B 5JYBA 2M32A 1FB5A 1CS0B 1KZ4A 4INAA 3J81A 2E48A 4XQCA 2QRZA 4IQGA 4OFWA 4CQLB 2KSQA 1EWYA 3ZWDA 1GUZA 1HT1E 3ND9A 2G17A 5D00A 3VVMA 5CRIA 4WY2A 3H8SA 3HTXA 4AZ0A 4FXOA 1RXCA 5F9MA 4V0QA 1E7QA 4NFSA 1UPUA 3AJDA 4QUDA 4R8LA 2JA2A 3ZI4A 4AG3A 5LP6A 2Y6VA 3GCWA 1GNRA 3IAM6 1HZZC 4LPKA 5M34A 3E9MA 3NVKI 1IUPA 1ML3A 3R9XB 2R8ZA 3MTDA 3FNGA 1HRDA 4JLMA 1GCUA 3TPCA 4XB2A 3FPLA 1C50A 2QV7A 2PH3A 3HUEA 4DMKA 1KETA 2XE7A 3L82B 4FGWA 1HEIA 2F3RA 3GNTA 4GLLA 1V35A 3QVKA 5CYGA 3AVVA 4CYMA 3FSGD 4TTVA 5JXGA 3KKPA 2ON6A 1VJ1A 1C8BA 1Z16A 2YIVX 3F8SA 3KT6A 3N7UA 4JUIA 4OKNA 4ZWNA 1F4VA 1U94A 3PHLA 4Z4QA 1CZUA 5T64A 4LYAA 3F6PA 2W6JD 3DTVB 1AHHA 5CJJA 1P0FA 4LC9A 1XTKA 3B6ZA 3B7WA 3WY9A 4EKNB 4ALMA 5ELMA 2A67A 5BN5A 5HYVA 2GF0A 4A8JB 1XG5A 5AI8A 1R0SA 1WDTA 1H2BA 2XJ9A 3GN2A 4R71A 3OPMA 1R5OA 1F8YA 1T5SA 1YKGA 2F6RA 2XT9A 3W05A 3IDZA 4EG1A 4MGEA 4ENQA 3MAJA 1VA5A 4M1KA 4OXXA 2QTZA 3I0NA 2GCIA 3PC3A 3IUMA 1JA0A 5JOQA 1GU1A 1KZ6A 5G0UA 4BKUA 5FWXB 5I7WA 3EVDA 5J59A 1XV5A 2J5KA 3FYSA 3MTEA 5BWMA 3AJ8A 3QWHA 1GKYA 1XMOB 4Q12A 5HIIA 1XDWA 2WIAA 1BGXT 2G1UA 5FUYA 1BXGA 2CHUA 4PC6A 4MV5A 5K0LA 2QVGA 1F1JA 1H2YA 2B2CA 8ABPA 2I7VA 3OX2A 4N8SA 2P3QA 4QARA 5KREA 2O8CA 5JC1A 2A6PA 3ETLA 5AVXA 3DZ8A 3AU8A 3Q15C 5SY9A 1KK3A 4QWWA 1S9DA 3F8WA 3MILA 3ORQA 4I9FA 4Q05A 2ZIFA 4L9WA 4AS1A 2V98A 2SKDA 2ACVA 3HU3A 4GKAA 4BMSA 3KV1A 5F77A 1GLGA 2BJVA 2D59A 1JR3D 3VKGA 1P44A 2WF6A 2HHLA 3GUYA 3WLJA 1CERA 1SR8A 1NNSA 3BMXA 2QUHA 3RYIB 2RAUA 4ZU3A 3TL2A 1VKRA 2OGTA 5AOBA 2EBFX 3WK6A 1JG1A 2JIRA 3LT1A 3LPCA 4OBWA 4KUEA 3DVQX 1VHLA 3LXXA 3U3JA 4RTOA 1B8VA 2P77A 4ER5A 5KNBA 1YDFA 4Z9FA 4DUGA 3LBAA 1N2CE 2QI9C 1K86A 2WV7A 3NHJA 2G0NA 4H7EA 3R8CA 5KOJA 3PYLA 5IBRA 3TDKA 4D45A 4UMEA 2JLQA 4M9SA 5T4BA 2NU7B 5CVCA 4F56A 5T41A 4JYZA 4BO3A 1P77A 5K3SA 1PK9A 2RCNA 2IHVA 1BDMA 1QUEA 2JZOA 3WOHA 2WP0A 2V0CA 3A2NA 3H0CA 3ZOKA 4YRZA 2RHTA 2YIJA 4HDRB 3L7JA 4YRLA 1PG5A 1Y8RA 3AV3A 3KALA 4UAUA 1NNEA 4D44A 2FWRA 1BWSA 3GY0A 3PGJA 1XDUA 4WOKA 3RHZA 5BW4A 4ZQEA 1IATA 4HDOB 1Z74A 2FPSA 3CURA 3IXLA 3VU0A 1RJDA 4MPPA 4V0RA 2QNBA 1EM6A 1O94A 3HFGA 4DILA 5E6SA 1SVWA 3BCUA 4U0KA 2CK3D 3DQPA 4ND8B 4XD2A 1CUGA 4F9EA 9LDTA 2BGMA 2R3SA 1EUCA 5I8ZA 3ZBTA 4PAQA 1SZDA 3X2FA 2VPTA 2C5FA 4FILA 1GQSA 4XCXA 1F7VA 1AQ6A 1QHNA 1V96A 2C9YA 4LZZA 2FTKE 5DB4A 4NH0A 1T1RA 2VT3A 5TPZA 5JISA 4RTQA 3BICA 5CHEA 2FWJA 2Z9BA 4MVYA 5EXXA 5JDIA 3TIIA 4FZ5A 1TA0A 1Z0SA 3PPXA 1VLLA 4I1SA 1LC3A 2WI8A 3BMCB 3O4VA 4WCFB 1O6ZA 1D07A 4AN1A 2DU8A 2VQDA 1EB9A 1S7GA 3NIFB 1A27A 3HA2A 3PVZA 4H2DA 4E5VA 2UXCB 1P7PA 3C39A 1JSLA 1TK2A 2ZJAA 4AO8A 1FJXA 1OIXA 4S1TA 4YO7A 2A9QA 2ZSIA 1L3CA 3NBMA 2Q3EA 4GXRA 4IMJB 3B70A 1ABEA 2VQ6A 1JPVA 4P0TA 5I01A 1JDTA 1R9MA 5GQSA 4C6HA 1C4OA 3PVSA 1OXUA 1D2GA 3P9CA 4XJSA 1QG0A 3B82A 3F7OA 4BTLA 4ISBA 2AGVA 3L79A 5FI3A 2DCUA 2RGWA 5F23A 1U2SA 5K0ZA 1LTQA 1YS4A 3QVJA 3LPLA 3OLCX 3ZYCA 4MIYA 3WRVA 4AUKA 2H59A 2DR2A 1OYVA 1R5JA 4Q4AB 2ECKA 1HA3A 1D2NA 1WQ1R 2WTEA 4NV1A 3CO0S 4V2UA 5H81A 2F55A 1Z13A 3GFVA 3V7WA 1N5JA 3BFKA 2WM9B 4PYMA 5B6IA 5JAZA 5CIYA 3SIRA 4KO8A 4FP9A 1Z4IA 3UM9A 2WZDA 3KEFA 4KFSA 1WMAA 1IEXA 4YJFA 3LWNA 4TVKA 3QHPA 1P3DA 1J56A 2IYZA 3DGEC 4M0DA 4ROTA 1T0HB 3PRYA 4AZ3B 2XBLA 3OJLA 4Q9JA 4TMXA 1XNGA 3A1UA 4FOTA 4PS1A 1KTIA 2PY6A 4MQEB 3NEPX 5GY7A 3MCTA 4CMKA 1PJZA 4F9GA 4G8CA 3RVRA 2AZTA 1C8KA 2GPNA 3ZC3A 4BB0A 1L8QA 2GA8A 2P9TA 2Q9BA 5K8LA 1XWWA 1FXWA 3OZXA 3RFXA 4PG6A 4I0WB 1OC2A 4PHGA 3QJYA 4IJUA 2C7QA 3GGDA 5HFAA 4J8PA 1WM1A 5T5QA 3V2IA 4RZUA 4U6QA 4JBHA 4G37A 1AVTA 1OPRA 2ZU6A 3A9SA 1KC3A 1Q95A 3EGXA 3JQ8B 1P2SA 4QELA 4GI3A 1S4MA 4RGQA 1GPH1 3PCTA 4GOXA 1IXZA 1KQPA 2VK4A 1PF7E 3N59A 3LLCA 3EHEA 4HDKB 3KT0A 4G0UA 2O2DA 2XMBA 2RIRA 3H1AA 3K71B 1W4RA 4JXKA 4YRQA 4EB6B 5BNIA 1Q1AA 4NE9A 5GOZA 3Q7RA 2CNKA 1RRKA 3LPAA 1LZLA 3LJKA 5B1SA 4BE7B 3USZA 4RF2A 2J3JA 1E3DA 2XMRA 1RAEA 3WHIA 4DRXB 2IYTA 2VF7A 2H2WA 3S1LA 3UV3A 4OXYA 1MC8A 4C21A 3KOOA 1Z15A 3A9WA 3E9QA 1WZCA 4XSGA 4BTEA 5D01A 1SC1A 2JD0A 2O5EA 1DAOA 2XQVA 1OLXB 3C48A 4CM6A 2OBNA 1SGWA 1WMFA 1NFQA 2IQIA 4FOPA 3V8BA 5EZYF 3FHJA 4IVPA 3Q3GE 2EWMA 5CA0B 3OIDA 3EEQA 4H1UA 1QDLB 1E61A 2C94A 2DQ4A 3BCSA 3E9NA 2D74A 4A8HA 4DDWA 4BNNA 4KMRA 1PSWA 3U61B 1DXOA 3BORA 5KDDA 1QH9A 1HI9A 3HXMA 1MQ8B 2CN1A 2GDZA 2LKCA 5AM1A 1J42A 5JALA 2HA3A 3T7RA 2ZULA 5F35A 2J3EA 2KJQA 1OA0A 5H82A 2Z2IA 1N77A 4I6JA 3V46A 2PKEA 4W5RA 1ULSA 4OSPA 1M34B 3EXG1 3R6WA 1LQTA 1Q3KA 5JH7B 3OH8A 1XQYA 1QCCA 3FH0A 1OKKA 2Q4RA 4G0PA 4I66A 5EJMA 3ZPXA 4IDQA 4DV0B 4F7DA 5DI9A 3WLLA 1C3VA 2Q5EA 5HRAA 1J7JA 2V4MA 2G40A 3K8OE 1AKTA 1LS1A 3HCRA 3PRKE 4P6VF 4DMCA 1PVVA 4BMOB 2XVYA 1R3DA 1QRDA 1EZZA 1F6DA 2XOKA 3D1VA 3FMPB 3G5UA 3QVVA 3O3CA 4O2AA 4ZC1A 1LJUA 3ZWWA 3L7YA 2BHRA 4R3WA 5KYUA 2Y3IA 3S2SA 1DOZA 1JAYA 3KK0A 3KWMA 4JI0B 1DG9A 3FRJA 1TC1A 3LVBA 4FYIA 5E6UB 4DG8A 1MVLA 3I6YA 3FYCA 2BFBB 3PF9A 3DZBA 2OE2A 4YV0A 1AKEA 4M9RA 1EINA 2G0TA 3DJFA 4P82A 2BM0A 4YAFA 3ROGA 4FGKA 4QFCA 1IEWA 1AKQA 2PX0A 3R09A 5HQJA 4BAUA 2UZ0A 1O97D 2P2SA 1YVRA 3HBFA 4NAHA 4N65A 4BLOA 1EU1A 3UIEA 3VI4B 3C3KA 5IH3A 1GGHA 3HWSA 1SBQA 2IDZA 5KDOA 4CM3A 5MN4A 1GZUA 3LDFA 3TOVA 1SC6A 1TA9A 2C4MA 1T25A 1SU7A 1UFRA 2RG7A 2Z4SA 1OLSA 3D3QA 3NHWA 1DZIA 3SMQA 2I6GA 2GD6A 1GLVA 2PFSA 4RQAA 1CZRA 3OZGA 1T9CA 4BN4A 5I7SA 4R1OA 2AN4A 2WSYB 1T8TA 1ECFA 5KYKA 5K3AA 4AZWA 4V02A 1RJGA 3Q3VA 1KMHA 5JDCA 5C18A 5KO2A 4HAZA 3VAYA 3DKIA 1JJBA 1QIEA 4K9RA 4AMUA 3NTQA 1XGKA 1XAGA 5I4BA 4D8VA 1XQ6A 4D1YA 3GLSA 4GO1A 5ALOA 5TDHA 5J4KA 1G8SA 1T0IA 4LYGA 4LY3A 2IU4A 2P40A 3FUUA 5C8DA 2PTGA 4PG7A 3GJRA 4IX1A 4TRRA 1B2RA 1C30A 3SBDA 3ZHCA 2BISA 1JVSA 4CN9A 5A0FA 1HQDA 4ACBA 4CLOB 4ZYVA 4CV2A 4FINA 4JB0A 3G8DA 4TYMA 1C9MA 4D3ZA 5A4AA 4QRHA 4XTRA 3NWJA 4U2CA 3PQ7A 2EQ5A 3L7IA 2VDJA 4LRXA 2W6QA 4QNNA 4TXNA 4XYGA 1UXJA 4XPIA 1UKYA 2QGFA 1Z0FA 1Y63A 2CXQA 4KAFA 5AK4A 3KO8A 1RE0A 1JA1A 5TGDA 1GQ2A 5J2UF 3UN1A 1I7NA 1J8YF 1ISMA 4B33A 4HG2A 1E3TA 3OFVA 3VVBA 4CG3A 1ZYUA 4JUBA 3ZDZB 2DJIA 1NI3A 3GRYA 4H31A 3OD1A 4PC1A 4R1NA 3RIEA 2WOJA 3GPLA 1WD5A 2OORA 3W0LB 2GJ9A 1XE3A 1GUAA 3L05A 4QYXA 5HFJA 4AUMA 5FOQA 1MABA 1NXWA 2FI1A 1O95D 1I14A 2NT3A 3E5NA 3G2JA 4QTZA 1X19A 4KO4S 3WYEA 3VX3A 3ZH9B 5AOCA 4L5IA 1A7KA 1ZXBA 3OZVA 1BE8A 2CLLB 3FETA 4IDOA 2DKNA 4BECA 2X6RA 4GLBA 5EEGA 1KQGA 5EIBC 4Q1FA 2Z1MA 5LNK6 1FMLA 3A14A 1T3LA 1PFWA 2GK7A 5CTJA 4GR4A 2O23A 1HDZA 4IMIB 4UTZA 2QIPA 3IDOA 3IAEA 5IDVA 4H16A 3OCVA 4L8VA 1JPJA 3ZBPA 5I3CA 1Y9ZA 1GXSB 2GK6A 1EDDA 2B8EA 4L5AA 2PKWA 3K2QA 3IYLW 1R8QA 5EWLA 4EHJA 5U1PA 2QZSA 3S44A 5IZCA 4I4IA 5JQGF 1ATIA 1FFXA 1L5RA 1XTQA 2BW0A 3ESBA 5KKCA 1OH6A 2C4NA 1AQJA 5K09A 4M49A 3ZQUA 3A7EA 3MBOA 3OZWA 4MWCA 1G2QA 2XNDA 2HMUA 2G72A 1RRPA 3GCXA 4JL8A 5DXJA 5FPHA 5KNCD 4YMIA 5KOJB 1E2BA 2O0JA 3LP8A 2OAP1 5IU6A 1P4JA 1M34E 3E1SA 1IWPB 5FV7A 1QU3A 2IS1A 3SPXA 2GNAA 2OFWA 2HEGA 3BK2A 2A0WA 1O96B 5IJXA 3WGUA 2J08A 4R8KA 4DKJA 1G7SA 1GTG1 4FDUA 3GROA 2BHNA 2GZMA 4TS4A 1KK0A 4QGSA 3NUGA 1I2AA 2J9RA 4R2HA 1MJGM 3T95A 3DNMA 1JH9A 4H27A 4UMFA 2QX7A 3P9YA 2ZFUA 1MX1A 3QKWA 4K40A 4RZHA 1UXKA 3RU3A 3UICA 4GP7A 4DDMA 1HE3A 4JUCA 4QT0A 1YB7A 2O3TA 4J0EA 5CEJA 2JGIA 3KZOA 4L16A 1TUBA 2Z5LA 2D1RA 3VYVA 4BO7A 1CEQA 2WJGA 1X13A 1RKQA 2Y05A 3GMIA 4Y6LA 5C8ZA 2H5IA 4QO7A 5AW8A 4EJ0A 2DBQA 5H70A 3ZDAA 2YNMD 4TV9B 2H18A 2Q41A 1B15A 2QZ4A 2YRWA 3N5KA 5IFLA 1M6HA 1VBMA 3KPJA 2H17A 3ORYA 4IIJF 4FX5A 4G8BA 1XB2A 2XGOA 4PGAA 3HUTA 3PPVA 4O4HF 3FSEA 4HH4A 4FZVA 4Y6OA 4ZJZA 2GERA 3AYZB 3H42B 4BLVA 5AVTA 4UBKA 1XZLA 1E5QA 1IWOA 1OX4B 2J9GA 5M3BA 3DHVA 2XUZA 3RC2A 3OC6A 2AI1A 2FKAA 4MV8A 2PMFA 1A9OA 1DEHA 4B3SB 1GG8A 1NBWB 2E5WA 2ZRHA 1DQZA 1J9GA 4YMSA 3U62A 5A04A 4Z5XA 2VJQA 2RGYA 2CLEB 1R00A 4DUYB 4NPCA 2OXFA 1TTQB 3SX0A 4AK9A 5F52A 4TM7A 4HO1X 2JBWA 3FE2A 1ZJ6A 3ECSA 1COZA 3LXRA 4G5QA 4JVNA 1QO7A 1EK5A 4NICA 3ICWA 4EPYA 1PV1A 2A7XA 2W2MA 2QMQA 3D7RA 3ESXA 3A2KA 1X9HA 1H2AS 1BOOA 4JMLA 1H9BA 4NBSA 2WAOA 3ZGNA 1G3QA 4WN9A 5JNVA 4AKIA 1WB9A 1ENYA 3B1WA 3MVEA 4OHCA 3LS2A 3EW7A 4OX9Y 1YASA 4PBTA 3E3AA 1XYYA 3TQTA 1JXQA 4MQBA 4WKCA 1CRWG 2FSPA 1Y80A 3IHKA 4C29A 2O8FA 3P27A 4RPKA 4Q9KA 1L4KA 1JSZA 4Q16A 4P5EA 2ZSUA 3OZDA 3LA8A 4G1CA 4TROA 1KF0A 3V8VA 2IJGX 3ANMA 3IP5A 1N2BA 4NBKA 4MQUA 2IUSA 1CUCA 2HIHA 1SQ0A 4PYJA 2F9FA 5IT0A 1U4NA 3GIDA 5BYBA 4W1SA 4ARCA 4RVUA 4P38A 1TJNA 4WESA 4ESVA 2EP8A 3OE7D 1IN6A 4UHJA 5L3VA 3ZIAA 2JJ2A 3DOFA 2Y1GA 1EZ4A 5E0OA 3IAS1 4JJEA 3TE6A 4IFEA 2G67A 4R8VA 2UYQA 3OQIA 4UM8B 3IHLA 3IAFA 2XZTA 3IB6A 4YMHA 2YQ5A 2X5OA 4MK4A 1K3UB 1AH2A 3AFIA 1ZK2A 3HB1A 4Q15A 2J0VA 2Y8EA 1XZAA 4PX2A 1RAGA 5H9VA 2VTBB 3ND7A 4BB9A 1XALA 1XVIA 4Z4CA 4MUXA 1PJLA 5C2JB 1RHKA 2IYFA 2QL5A 3WI7A 2WF7A 3U7IA 2XTAA 1E2JA 2GJKA 1BW9B 2QA5A 3NHUA 1XDGA 1XZKA 4NK4A 1W93A 3GV0A 1XROA 4DYDA 1CY8A 3OO0A 3ZXUB 1Y7LA 3LI2A 1P80A 3T54A 4Z7OB 4FR2A 2QW0X 2I2FA 1HT3A 1KAOA 2DF8A 5EESA 3U80A 3VOTA 1EFTA 2QQFA 3G2IA 4B4DA 1DI0A 3NNDA 3EXHA 3OMWA 3QMMA 3IAXA 4MIOA 2IPXA 5E7IA 4GR5A 3CVWA 3D4OA 1K6XA 1N1MA 2X9LA 3K3PA 5DX1A 3UCXA 4DF3A 5BYAA 1V8FA 2R1VA 3U9SA 1NP7A 1M73E 1KYVA 3EBLA 3WNQA 2PPVA 2LPMA 3OE7A 1HOTA 2PLWA 3T1YB 1Z45A 1QHXA 1Y42X 3VZQA 1T6BY 3UJAA 1BA2A 4N8DA 4CR8A 2OYCA 1DFGA 4C06A 1JQKA 2FNAA 2H65A 3R3SA 4JC0A 2HWKA 3F8TA 3FUTA 3WGNA 4NG5A 4DN6A 5M5BA 4AAYA 2F62A 2REBA 5ALXA 2QSUA 3SC3A 1TVCA 3F7TA 4HXEB 2PLAA 3UW1A 4DM4A 5I5EA 4GX0A 1VMEA 1JEQA 1TD9A 2FSHA 4TOIA 3DD5A 1RSZA 3FNBA 3ISVA 5JYCA 1L5FA 2LDBA 2GN6A 3A2MA 2O2JA 1KRXA 2RHGB 1KXJA 4IICA 5BSRA 2OLKA 1M34A 1VSUA 3O4IA 2J87A 2AOUB 1NBAA 2GCGA 3RSOA 1ENZA 1WR8A 3OCYA 1MP0A 5BO5A 4Q4HA 5FAXA 4FIZA 2FLVA 3IP8A 3L1IA 1NN0A 1X1BA 2WYVA 3S29A 1G8KA 3A10A 1OFIA 1VZ2A 4LDNA 2H2GA 4OQZA 3LWZA 4UXJA 1IQPA 2EU8A 4WE3A 5FUVA 2QYSA 2QX8A 1VL2A 4D74A 1XHLA 4RSMA 2QRUA 4F2PA 3WK8A 1F5NA 1QXSA 2QRQA 5DTEA 1SCQA 5B7NA 1BDIA 3EZ7A 5HUHA 4BNFA 2X9VA 3QZUA 1VFNA 4FGSA 1JEYA 2VA9A 3AUAA 1IHUA 2GM4A 4G01B 5K0SA 4HVAA 4DHWA 1H2RS 1E9CA 2P4UA 2EEZA 2V3WA 1GPUA 5KUTA 1JR2A 2SNIE 1CUWA 3K8QA 4PNZA 4U2FA 2G4VA 4X7MA 3RJTA 3GB9A 3RTCA 3PDHA 4DC1A 1XN4A 3GELA 4DDUA 1QTQA 3T12A 1FFBA 4HCJA 1FLDA 1NVDA 2F3QA 1LDEA 4QDJA 1E1DA 4YLEA 4MVJM 2OO3A 1OW3B 1BXRA 2GUGA 2O0LA 3K30A 3NHLA 3QXGA 4LZNA 4HKTA 4LSZA 5KKAA 1OXMA 4QU0A 3L8HA 1W2GA 1B26A 3RT1A 3ZNNA 4HMPA 5K01A 3JAKB 3ND8A 3DVSX 2NGRA 4NLLA 4FNMA 4YJ3F 1H66A 1ZGZA 1HNZB 1OU0A 5CYFA 1R4AA 1JQ3A 3KTAA 2C4TA 1AUOA 4JGIA 3P9SA 1WAMA 1AKRA 4MUNA 3LSTA 4ARVA 5LLTA 2XCSB 2OR3A 1ZJ5A 1WU7A 1GT6A 3R0ZA 1TW3A 1J0DA 4MEAA 4BRWA 3L2OB 4IF6A 2OENG 2EOAA 2NP6A 4WTOA 5GIOE 2V7GA 4B84A 2OXRA 2WKSA 1NMXA 4RHYA 5ALYA 2YXNA 2YWJA 2ZSFA 5FPSA 3IQEA 3GRAA 5K9ZA 1HDXA 2A30A 2VNSA 4DFDA 3EASA 2WVAA 4IDBA 5JATA 2FX3A 2FN7A 4ZMSA 5CT6A 1FMJA 3BJRA 3TAXA 1RM0A 2BTOA 3IURA 1V1JA 3LUDA 1IY8A 1X7GA 3ENNA 1QMPA 2WV9A 2JARA 1VCIA 4Y6QA 4QOEA 1B4DA 4KQHA 3S2IA 1K6MA 1XWFA 2AFIA 4RORA 5B4VA 2BEUB 2FSUA 2QWXA 2V03A 4OH7A 4PHFA 5C1DA 1E0JA 2O0HA 2P68A 3RIMA 4G85A 3G79A 4OFZA 2A1UA 3LUCA 3RK0A 4DIEA 4JJ8A 5EFZA 4ZEWA 2I1QA 4XE5A 1VMKA 2G1AA 3RTBA 4HS9A 3V7YA 3R3JA 4EOGA 4KDCA 5DCUA 1K0UA 3D7MA 4RFVA 4Q9LA 3SYTA 1JX6A 3HPQA 4MP6A 1SU8A 3AHDA 4YUXA 1V9SA 2Z5GA 4LZJA 4MV6A 1ISJA 4IDFA 2P9EA 3HL4A 2OQ2A 1CJMA 2YUIA 1YBVA 1MB4A 5EJAA 2F9MA 4MHSA 3GLQA 1CNFA 3L40A 2AXEA 5D2CA 1FDOA 2JJYA 2W0MA 4UHBA 5EWLB 3LKDA 4BVBA 4HAUA 3L92A 4WA7A 3DFUA 3IP3A 2PGIA 1NNLA 3I1IA 1M2JA 1U65A 1FQOA 3GH3A 3JSXA 3L4SO 4ATNA 4BRUA 5BV0A 1X6VA 4MYUA 4AG5A 5ICMA 2J5XA 4DBLE 3EEOA 3R9WA 1QF6A 4XGQA 4Q1VA 1DNPA 1IOVA 3NBYC 2B7CA 1DJMA 3LYUA 4UBJA 1K2VN 1YDEA 3CX6A 3IKVA 4G8JA 2GRAA 4WA8A 1AB6A 4WXPA 4UPEA 3SX2A 1Q0TA 5AXCA 3RROA 2C4WA 4HZGA 4V39A 2VZ8A 7ABPA 1M5RA 5FL7A 4LKRA 1V1MB 2HCFA 5I45A 2P2YA 3KR1A 4CL8A 2I71A 5CNIA 2G8LA 2RFLA 1KMIY 4D4KA 1TZJA 2F64A 5IVDA 3L7LA 3DH0A 3TMAA 3ORRA 4V2IA 3AHHA 5B1HA 4H60A 2IHJA 2IUEA 3M4XA 2QRHA 3PFHA 5FOWA 5JV5A 4LGCA 1G17A 5E2AA 2PYIA 4UDXX 4GEKA 3TAHA 3REOA 4EDHA 2HUPA 1PRYA 5FHRA 5JD3A 1O8CA 1FDWA 4CEIA 1SVMA 2FUG1 3HXLA 5EPOA 4BGIA 1ISFA 3L0IB 2FQYA 4HQLA 2IQ5A 3T3IA 4BQFA 3UHJA 1WXEA 1Q14A 4I4TF 4OQDA 3JYQA 5HVNA 2H2HA 2YV3A 5LXTA 3K32A 2IYLD 1N5OX 2NXWA 3DTNA 3KVVA 3QA9A 3RYIA 5JNTA 3GRVA 4KR2A 1UJ5A 4EY4A 4F2DA 5HG0A 1US8B 1G21A 3NYWA 4U2KA 1N3BA 3UFXA 3C6BA 2I2DA 1Y8QA 2OHHA 4E0BA 4G23A 3FPFA 3GUUA 1W0KA 1O97C 2YW2A 3N3BC 1KEPA 1YQWA 2GM5A 1OASA 1REQB 1USKA 2G1JA 4OGKA 3CPJB 3CW2A 3MMPA 4N6GA 1BD3A 1GWNA 2D1FA 1QLWA 2CFOA 2G1KA 1DBVO 3E82A 4BCCA 3WMFA 3DFIA 5AKZA 3NRCA 1Q2UA 1N2OA 1Y8CA 3S55A 3WJ2A 4BO8A 3TOCA 4TT3D 2EERA 4JCOA 1O57A 4BRZA 2ECQA 5FPKA 4MJLA 4QBFA 2FWMX 3FTEA 1PZFA 1OZFA 3IQZA 3KYDB 3O31A 3VR2D 4OL0A 2FQQA 5HGXA 3I4FA 5EKDA 4RLHA 2OKGA 3DPSA 2VOEA 4DR6B 3ASZA 4YQFA 3T7SA 2H4YA 1B6SA 2AF3C 1F5SA 2ODAA 2ODPA 2ZUCA 1CF9A 1GXSA 3B1ZA 3BF7A 3EIFA 1QX4A 4O2RA 1C14A 5FBZA 5J2TB 2NXNA 1ZQ1A 1NXQA 3FDFA 1X7XB 2OORC 3DLTA 4RZ2A 5MGBA 2FUNB 2YS7A 2P7IA 3ZLUA 2BEKA 2XNCA 2GPBA 2TMKA 3AI2A 1DINA 3MT7A 3QIAA 5A5FA 1G59A 4D4LA 4YP1A 1SUBA 5D7BA 3PPYA 3OQOA 4E4TA 1G2OA 1C3LA 3NC0C 1U2TA 1XELA 2WY2D 3GJXC 3EAFA 3JQ9A 4NJMB 1HDIA 3HCPA 4N0EA 5KYVA 5K45A 1RXVA 1M2VB 1GGVA 4IIVA 2EKQA 2FMKA 3ETHA 2IZ7A 3KRTA 4LJ9A 3KDPA 1QTRA 1MOZA 1Q6ZA 2G70A 4QFDA 5ALEA 2QRLA 2JVKA 4LZOA 4WKOA 1U4OA 3QVSA 5AVOA 4WBNF 1N57A 4U2GA 1N6IA 1OAOA 1VRCA 2PLNA 2I4OA 3O9VA 4JHLA 1P1KA 1M1NA 5IEJA 2O8DA 4KACA 2ZYGA 4UHDA 3KWLA 2ASVA 4F4DA 1RMYA 1MTZA 3D64A 3FUXA 5F4ZA 1CHDA 2RD2A 3JQRA 3DD1A 4WLOA 2B1RA 2XXAB 4K0KB 1LC0A 4MS3B 3ONVA 5C1OA 2II6A 4M8LA 3MWEA 2LKDA 3IDQA 1K88A 2YWDA 3K70D 5FA5A 3SU8A 3O1JC 3U4MA 2JIZA 4HS4A 5FR1A 5BRAA 1X7WB 3MUEA 3AVWA 4K9SA 1EE2A 1UANA 4O4LA 4YPVA 1M2KA 3MLEA 3U4IA 2P2GA 2B69A 3QVTA 4Q4AA 2W83A 2XYVA 2P78A 1N9ZA 1ONPA 5G4LA 4AP5A 5LL6P 1Y6ZA 4NYMR 4Q3AA 4YJ2F 2HSDA 4LRQA 1ODSA 3K9BA 2P1DA 2PJRA 3H8VA 3GJSA 2XXBA 5D5PA 3S1AA 4DCUA 4KRGA 1Y7PA 2GZDA 5ALDA 5SYAA 4B47A 4O8ZA 1EVZA 4L28A 3IJRA 4V38A 1GKKA 1FRZA 1V6CA 2GN8A 4YJFB 5B3LA 2O0KA 3FHCB 4B3FX 2V0NA 4B76A 4EKEA 1H3FA 4KK4A 5KYNA 4LISA 1TPZA 5JAQA 2P1ZA 1UR5A 3UB2A 3AI3A 3HLTA 4FYKA 4AXXA 3EF0A 3AP1A 4B0PA 1IC6A 1W0JD 3DBHA 3QBDA 1WUKS 4HB2A 1O5OA 5TT0A 3NTLA 5BNWA 1Q1GA 2HJGA 4KWCA 3DVAA 2YX1A 1P4HA 5THXA 4JLNA 1QJ4A 2F67A 3FKQA 1YS6A 4OOFA 5EIAA 5G02A 3SYMA 3VO2A 3W2GA 2N75A 4HGYA 2WIDA 3VU9A 3WQQA 1JBKA 4XM0A 1UJNA 3IBSA 1F2DA 5EQJB 2WT4A 4WD3A 5CYPA 3LXMA 1S6YA 1WCIA 4HQKA 1RJEA 5FBQB 4BKRA 4BZXA 1H23A 4QA9A 3ZLTA 1XTJA 2W2XA 3OZSA 2VK8A 3I32A 3M4YA 1X39A 4ZT4A 4PPGA 3K0EA 3V42A 4D4JA 1M6VB 1KSJA 4L4ZA 3Q5GA 3PGVA 4AFNA 1KYXA 4N7MA 4OP1A 3NATA 3SQNA 4XARA 3TZLA 5JAIA 2PKYX 3UWPA 3UBTA 1JFVA 1PD0A 1VJGA 4IVNA 2NU7A 2QLBA 3B78A 4KQGA 3QVLA 5CDTA 2P9CA 3B1JA 2K2QB 1XQVA 2AH5A 4ZFNA 4DMLA 5I7RA 5EWJA 2WB4A 3JWPA 1VYVA 3WK9A 3IIJA 5FO0A 1UJMA 1MZVA 2XTJA 3WL5A 3AVYA 4YIHA 5FI1B 3PICA 3PUIA 2IXTA 2FG5A 2VJPA 4Q9AA 4Z1MD 4Z4FA 4BXOB 3WZMA 2PGNA 4WXYB 1PIWA 1ZD9A 3H3JA 1PJ2A 1TFUA 3E53A 3EC1A 4IH4A 3LT0A 4QECA 3GAMA 4E88A 4RAOA 1N2SA 4HH3C 4IDNA 1GR0A 3OZRA 3TJRA 1DKPA 2HK6A 3WC4A 2F2TA 1KEUA 1ST3A 1NJ2A 3GNQA 1Q91A 1OLOA 1WUIS 2W2NA 5COAA 5T4HA 3VPCA 2HYDA 2WQ7A 1PZMA 3B7GA 1WLYA 4FT4A 2HK8A 3ZZUA 5ALIA 4TYYA 2R68A 2W0SA 4UNIA 2O2CA 3RKSA 5CEFA 3KQLA 4TPKA 3ZEIA 1ES9A 2C5LA 1JMVA 3GDOA 2N47A 4E2YA 3INGA 1C0IA 4FSXA 1LI5A 2QLFA 3Q7EA 5A7GA 3WFJA 5K6AC 2H9AA 1JKIA 2TSYB 4ZOLA 3WISA 2GAOA 4MKXA 3N2IA 3NTXA 3Q9SA 4K7JA 3UKDA 1DP4A 2QT1A 1ZVMA 3BMCA 3EVTA 3AF1A 3F3YA 3GAZA 3CJQA 2A0FA 2CXRA 2WWYA 3CTMA 4PIVA 2WLSA 1T2UA 1OPXA 2EKDA 4LJ5A 3V5NA 4QE3A 1Q16A 2A92A 5EZSA 1CWUA 3HBLA 3MD0A 1U6IA 5A1JA 2WSSA 1EP3B 2BZSA 3CUTA 2IU6A 4WZBA 3K6SB 4DLXA 5A62A 2MINA 4U3JB 4Z6KA 2AUMA 1K5GA 1SM4A 1MT0A 1QPZA 1TYCA 4D6YA 3DLAA 1S3IA 5DM1A 5TX7A 4CM8A 1RCFA 4D0LB 4N6OA 5K0TA 4LMPA 2BDUA 4WOJA 1YKFA 3B85A 1XVVA 2BEUA 3LWDA 3MWYW 5CLIA 4P4UA 1M1XB 2XRMA 2JLYA 1PZEA 1TOAA 3TL3A 4C08A 1W1UA 3B3GA</