4J3FA

Crystal structure of fabi from f. tularensis in complex with novel inhibitors based on the benzimidazole scaffold.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
259
structure length
259
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structural and biological evaluation of a novel series of benzimidazole inhibitors of Francisella tularensis enoyl-ACP reductase (FabI).
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
total genus 88
structure length 259
sequence length 259
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j3fA00
2JAHA 1C0LA 5BSHA 3H7AA 3JD1A 3W4KA 2GDZA 1EFLA 4I9UA 2HKIA 2ZCVA 3VH4A 2Q3EA 3I6IA 4BNKA 1VI2A 3G1TA 1QP8A 3B1JA 1ZO8A 3GHYA 4Q3NA 4DIFA 3ABIA 3BXXA 1MG0A 4FB5A 2Y1OA 4DQXA 1CYDA 4YJHB 4YAKA 3GH3A 5COAA 1DBVO 1CWUA 4N7RA 1LXCA 1O6ZA 1U3WA 4UVHA 5COBA 5CPBA 1PR9A 3VOSA 4YJHA 2BI7A 3RJ9A 4F6CA 4QO8A 1VJ1A 2BFPA 4L9RA 2W8ZA 4WLFA 4CUJA 5B37A 1R15A 4HFRA 1BXGB 5CDTA 2DPHA 1YONA 1TA4A 2AQ8A 3H9GA 3PRJA 3GAFA 4W6ZA 3NX4A 3ETGA 3GZ4A 2O7QA 4DIOA 4EJ0A 1X0XA 4PLGA 4ZQEA 2VT3A 4FOOA 3H5RA 1ULSA 2BGMA 4L73A 1T1SA 4MIOA 4NK5A 2FSVA 3ENNA 1BXGA 2XXBA 1Z74A 3ZWYA 2H63A 3WTBA 4DLBA 3DBRB 1FK8A 1U4OA 2VZ9A 1WNTA 3PIIA 1CQIA 3ITDA 4E2ZA 2AQHA 4EUHA 4KMSA 5JDCA 1PIWA 4TRMA 1E3LA 2D8AA 2AQKA 3CMMA 3DBRA 3NEPX 4YQZA 5JY6A 3HJAA 4NBVA 1PQUA 1DC5A 1JWBB 4OL9A 2ZCUA 3EW7A 4JBGA 1JAXA 3C85A 4BNLA 4G5HA 1H6AA 3D7LA 3KOUA 3T4XA 6LDHA 4PZCA 1T2FA 2GR9A 3CE6A 1FMCA 4DPMA 1E3WB 2NWQA 1RM0A 2IZ0A 5DBGA 4GX5A 1KEWA 3RFXA 2CVOA 4IJUA 4J4TA 2PH5A 4FGSA 4AJLA 3ENKA 4OO3A 1HSOA 3CSDA 1E3WA 1DHTA 5AOVA 4R3WA 4XQEA 3AUSA 4KTTE 1A9YA 2AA3A 4TVOA 1RYDA 4LW8A 3RU9A 1B8PA 1DOHA 3DB2A 1QYVA 1BMDA 3TJRA 2EW2A 3AUAA 4CMIB 1T2DA 4RCVA 1LX6A 4CMEA 5L4SA 4CR6A 1ONOA 3WIDA 4XR9A 3OM9A 3CKYA 4IMPA 1DIHA 2FSSA 3TSCA 4XRRA 4I5DA 4LRSB 5DP2A 3NDJA 4CMIA 4CM9A 1LJ8A 1MG5A 2EEZA 4BGIA 4YPOA 1H94A 3LF2A 4XX0A 5ICSA 2DT5A 2J3JA 4L76A 3ZZNA 5CFZA 2WDZA 2VRBA 4OAQA 5DULA 1J4AA 3SLKA 3JSAA 1LDBA 3H2SA 4B3JA 5TX7A 2E48A 4BB6A 4WNCA 4GKVA 3DOJA 4E5MA 4ZICA 6ADHA 1I01A 3PFFA 1NR7A 2DTXA 3JQFA 4R4JA 3W4IA 4CQMD 1LLDA 1SZJG 2Y0EA 5JCXA 3PJDA 4NFHA 1KERA 2DBVO 3JCZA 1HDCA 2P4HX 2PKQP 1DFHA 4CM5A 3MJ4A 5A05A 4EDFA 1BWSA 2ZB7A 5A3VA 2EIHA 2GGSA 4FFLA 4W9NC 4B3HA 2VYNA 1BVUA 1KEVA 4OHUA 3RUDA 1FDTA 3JV7A 4YTEA 1WDKA 4A0SA 4GMFA 1VRWA 4KQWA 3GRKA 3V8BA 4ND2A 3FRJA 3RD5A 1KYQA 3RAJA 2PK3A 1D8AA 3VPGA 1VL0A 3OECA 4CUZA 2CF6A 1U2GA 2C2YA 1P3DA 4BB5A 1KVTA 4JLWA 2BFOA 2AW5A 1MFZA 3D64A 1NR1A 2B37A 1ADBA 1P1RA 3B20A 2X8LA 3IJRA 3HADA 4FOSA 3PHLA 4Z9XA 3SXPA 3H3FA 4G2NA 1EVJA 2QZZA 2O3TA 4R5HA 3T4EA 4HP8A 5CPFA 3VTZA 1Y8RB 3E18A 3AM4A 3V2GA 2HJRA 3W1VA 1HYEA 2FY8A 1BHSA 1K6XA 4E4YA 3KLPX 3NTRA 3I9NA 1Y8RA 4ZRMA 4J4BA 1GUFA 3ZW8A 3HFSA 1P77A 4JXKA 4N18A 1ZCJA 3LC2O 3GPIA 4QQRA 3EZLA 2ZYDA 1R6DA 4JK3A 4XEHA 4BGUA 3G49A 1X1EA 1AHHA 2X23A 3C1OA 3HB4X 3GG9A 3HDYA 4M49A 1R37A 1EDOA 4CM7A 3VAZA 2VYVD 1EBUA 2QRLA 1AGNA 1Z7BA 4ITUA 1XSEA 1DSSG 3GGOA 5EERA 4WEQA 1Q1NA 1M67A 1XCBA 3DZGA 3RSHA 3AY6A 1F17A 5EJ2A 1PGQA 3ASVA 3W8DA 3WQSB 4FR5A 2EKPA 2UYYA 4BNZA 3I83A 1Z6ZA 5KWEA 3GDOA 4BQRA 4WKGA 5GY7A 4RF3A 3HE3A 3ZDFA 4EUEA 2VZ0A 2Y99A 1ONNA 1ZK2A 2R2GA 3AM3A 4BO8A 4FFNA 4DWVA 4NI5A 2Q49A 3HN2A 2Q99A 4AFNA 4CM1A 4BNHA 1NTOA 1ULUA 4XGIA 1IB6A 2J6IA 3PI7A 4FFRA 1HDGO 4UVDA 3RWBA 3KSDO 5HBRA 3UCXA 1WPQA 3UW3A 4CLXA 2Q4BA 4GBJA 3UOGA 5H82A 1OI7A 1JLLA 1H9AA 1LQUA 2HK7A 1NWHA 1SB9A 3EC7A 1HSZA 4K1LA 4YT8A 4UUNA 2GNAA 3GNQA 3EMKA 2ZTMA 3INTA 3S8MA 4BMVA 2BKAA 2AE1A 2FN7A 2BGKA 4AVYA 5JLAA 3U4CA 2Y1EA 4FDAA 2WD8A 4GWKA 3QVSA 1I32A 4DC0A 1ISFA 1DAOA 5GZ1A 1PJLA 2TMGA 2VUSA 2YW9A 4BS9A 1EBFA 3UICA 4W7HA 4MIEA 4U6SA 5T8KC 5TIIA 4OOEA 2FPPA 4LCJA 1H6DA 3OIDA 4Y67A 3WGIA 1O95A 1QV6A 1ZMTA 3NTOA 5JAZA 2GN6A 1SB8A 4JX8A 4J7XA 4CQLB 3E5RA 4EBFA 2W90A 3ASUA 3L0DA 2WM3A 3BTOA 3JYPA 1FDVA 3GUYA 3Q0EA 4ZQFA 2WYWA 1Y5MA 3AY7A 4J9VA 3RROA 5L7WA 4CQLA 3OH8A 4H3VA 4CPDA 1Y81A 1JKIA 4ZJUA 2VTEA 1B2LA 1CERA 2D59A 4BO3A 5HM8A 5F1OA 4D45A 3QHAA 3F9IA 4D0RA 1PL7A 5DCUA 3IS3A 3K92A 3WGGA 3GQVA 5KKAA 4LVCA 2OORA 2IXBA 3KSUA 4J1QA 2YFQA 5BSEA 4DXHA 1DC6A 1E5QA 1NM5A 1UAGA 3GMSA 4IDBA 3IUSA 2VZ8A 2JL1A 3H5AA 2AXQA 3G17A 1B7GO 1K2WA 4EJ6A 1BG6A 2JD1A 1TT7A 1K3TA 1T4DA 2H5LA 2ET6A 2ZJ0A 1PJSA 1LRKA 4B79A 3UFXA 1YOVB 4EEXA 4WJZA 2GZ2A 2FMUA 4FW8A 3ZWVA 2NTVA 4OKNA 3K31A 3GEMA 5JBIA 4B7UA 2HMUA 3JQ8B 4CM3A 1MP0A 4GGPA 3RI3A 2D5AA 2Y67A 5JCJD 2CMDA 3E9NA 3KBOA 4MVJF 3TOXA 2X0NA 5A02A 4Y6RA 5IXYA 3JQ8A 4A03A 3I9MA 5BSFA 5JY1A 1DIBA 3U4IA 4TRNA 1YS4A 3MCVA 3IC5A 5C3MA 1QLHA 4CL3A 3Q1LA 2OHXA 3ZU4A 2BMAA 1OC4A 2CDBA 3FD8A 2JFGA 1F0YA 2OO5A 2NVWA 5EQDA 1DXYA 2Q2VA 3GNTA 4RVDA 3WS7A 4BO1A 4ZVVA 1GYPA 2BF7A 2Z1MA 4CR7A 1IPFA 1O9BA 2BLLA 3VZSA 3ZNQA 2AEFA 4UAGA 4DPKA 3LQFA 1AN9A 1LDEA 1N5DA 1ENOA 1I2BA 1VKNA 3I3OA 1Z73A 2AEJA 2HCTA 3LF1A 1J49A 5DDIP 4K6CA 3OP4A 1WLYA 1YXMA 4J91A 2C5EA 3PGXA 3F3SA 2G1UA 2P4QA 2C0CA 3OEYA 3P2YA 1F12A 3QWAA 5A4DA 1KEPA 4B4WA 3CINA 5L3ZA 3PZBA 4YBZA 5JAIA 3CTMA 3DBLB 4YEDA 4DIBA 1NHWA 1YBAA 4FD3A 1PQPA 1IE3A 4FBGA 3JYQA 4IXWA 4J7UA 1XHLA 5CDUA 1E0DA 5A06A 1BDMA 3N74A 3GC6A 2JJYA 1UJMA 1X14A 2YHIA 1N7HA 4YJFB 1H9BA 1GAEO 1GCUA 1GY8A 5TGDA 4F6LA 3LLSA 4I5GA 3K2EA 4A5OA 1KS9A 1CETA 2BGLA 4YRBA 5T64A 3LVFO 4YJFA 4Q9NA 1GZ3A 1PJ4A 3L07A 1ML3A 4XKJA 5EINA 2XOXA 2G5CA 2ZK7A 4JP2A 4AJEA 4BO6A 4DLAA 1TXGA 4MDHA 4TZTA 5L4NA 5DOZA 4YAGA 3MWDB 4E2XA 4U8GA 3ANMA 4XQCA 3FHLA 3R3SA 4BNMA 4GAEA 4PG4A 1NX6A 5TS3A 1AHIA 1VJ0A 4GX2A 4HKTA 1ZEJA 4I5EA 1HKUA 3L4SO 2V6GA 4R68A 1Y9EA 4U0KA 2NU7A 3TZCA 1E1MA 1YL5A 3IIEA 4CMEC 1Z82A 1PR3A 5IJZA 2NLOA 4D3SA 3IDSA 4OH1A 1TVEA 3I5MA 4ZA2A 2JKVA 2DBRA 3JQBC 4R51A 3TQHA 1T4BA 4E5PA 2C5AA 3LT2A 2FZWA 3SC4A 3ROKA 3B6ZA 5JXWA 4IQGA 3UHAA 4P38A 4EUFA 1N9GB 2VCYA 3ZHZA 5JSFA 3WMXA 3PLNA 2PD4A 3PJGA 1ZBQA 1NQAO 3WGHA 3H5NA 4II3A 4BV9A 4WOJA 1N9GA 2EERA 5KVSA 4O1MA 1P1IA 1Q7GA 4NBTA 1Z45A 3ZWXA 2VOEA 2B4TO 1NAHA 4WCFB 2AQIA 1B16A 3MJCA 4M89A 1B0AA 3KZVA 4R1TA 3ONDA 3WB9A 1KVSA 2X58A 2VYND 3TL3A 2CZCA 1L7EA 3BYZA 3DHNA 3JQAD 2FWMX 4WCFA 4DQUA 1I33A 3WWZA 3WTCA 3ZU2A 1HEUA 4HBGA 3NT2A 3EK2A 2IYOA 3ZH2A 4ONEA 1UXIA 4UVIA 4CMJA 2WTBA 1NVTA 1GTMA 1ENZA 3PQFA 4NG5A 3ONEA 2QZ9A 4ZN6A 5H81A 1CF2O 1DIGA 1I3NA 2HQ1A 4Q3CA 1RM3A 4J9UE 3DBVO 5U9CA 2IE0A 4BV8A 3KVOA 2NUAA 4TMFA 5G0UA 3D5TA 2CVZA 1F8FA 2P68A 1O8CA 4LRTB 5I9MA 3S55A 2CUKA 3ZI0A 5THKA 3KV3O 2PZKA 5A04A 1UZMA 4MVJP 3HUDA 2G17A 2I3AA 2P9CA 2BFAA 2DM6A 3C8MA 4KOAA 4BNJA 2ZJ1A 4M86A 1X1TA 1XELA 2GYYA 4ALJA 1PGPA 3U4HA 2Q1WA 3JYLA 1E77A 5EN4A 4J0EA 2DBZA 5KVCA 4WLVA 3QWBA 4E13A 5A9RA 2ZB3A 1PL8A 1ZUD1 3Q11A 3WICA 4N5LA 3F5SA 4G81A 4PG6A 1R0SA 5T8KA 3GGGA 3TNLA 4A7PA 4ALNA 4FC6A 5IG2A 2VWGA 4J16A 4UVGA 3GNSA 3RFTA 4IMRA 4INAA 3I4CA 3ANNA 1E7RA 3UGKA 1EZ4A 3D3WB 3OQ6A 4YA6A 3U4DA 3MOIA 1XU7A 5CHEA 3K8ZA 2E6UX 1K5HA 4RZHA 1NNUA 3UH1A 3RUFA 3TN7A 2Q46A 3D3WA 5JAQA 3F5QA 2ZTLA 3I9JA 3O4RA 4JBIA 3OICA 3FTNA 1ZXBA 3AU9A 1Q0LA 9LDBA 1LDYA 1GQ2A 3OFSA 3PHJA 1GD1O 3ZWAA 2B4RO 5FI5A 3UCEA 3E82A 1IL0A 4MP3A 5HTOA 4XQGA 2QIOA 4Y98A 5CDGA 2JCXA 4JBHA 4E30A 1XIVA 3UF0A 2X5KO 3E5MA 3JD2A 4BNYA 3IOYA 2OOSA 2Y1FA 3MJVA 4NJMB 1MFPA 2WYVA 1P1KA 3L4BC 2EF1A 4MVJH 1C0PA 2AG5A 4MIYA 2J8ZA 4IGEA 4AL4A 2VN8A 3D4NA 4NJMA 3SBOA 9LDTA 4U0JA 4TRRA 1G1AA 1I2CA 3K9QO 3WG9A 1DAPA 1WW8A 4WNIA 1DIRA 3PHGA 4JQCA 4J2HA 2VWHA 4AJ2A 1TT5B 2C20A 1PJQA 3DZFA 4OKIA 4JJGA 1PEDA 2GASA 2GCGA 2Q1TA 3AFNA 4LCEA 3ETEA 3RC7A 1HE5A 2D0IA 4RDHA 4XIJA 3WBFA 1PX0A 3WOHA 1TT5A 1T24A 4PG5A 4HY3A 5G2OA 5T57A 5FEUA 4KUEA 4PN3A 3QVOA 1XQ6A 3LK7A 4UUOA 2G82A 1A4UA 1PJCA 3CMCO 3ITKA 1U7TA 5JW6A 3PZRA 4D79A 4LVUA 4XR4A 3TZQA 1Q7BA 4CM6A 4R9RA 4XB2A 1J0XO 2Y0DA 4DMLA 3KETA 2A35A 1DLIA 3H2ZA 5C7OO 5J23A 3BTVA 3ZWCA 1G0OA 2DLDA 3VDQA 3QSGA 2IODA 1Q2XA 1LSSA 2DUUA 3VH2A 4GX0A 1V9LA 4LSMA 3RBZA 4DUPA 1I3MA 1O5IA 2LDBA 3OEWA 3O03A 4TWRA 4IS2A 4OYRA 1U3TA 2EP5A 4IXTA 4XYGA 4XJSA 3MTGA 4FFPA 1JTVA 5KJ6A 1XQ1A 1PS8A 4DLLA 5TF4A 4D7AA 3C1TA 3O9ZA 5I7FA 4XZ3A 3DZHA 2IYPA 1NP3A 4L0QA 1UP7A 3I1JA 3TZKA 4DRYA 1CIVA 3OETA 3MOGA 4FFMA 1QYWA 4J43A 3GPDG 3PDUA 3DMYA 4CMKA 3M1AA 1A72A 4ALKA 3B70A 1LA2A 4BMSA 5A9SB 1U1IA 4P4NA 2IZ1A 1D3AA 5COQA 4EITA 2HAEA 1GCOA 2NM0A 2P9GA 5TC4A 1I8TA 4DBZA 1Q0HA 4OIMA 5A9SA 2NV6A 1E3IA 2WMDA 4KDEA 1XKQA 2ZTUA 1NPYA 4RPHA 5JFOA 1E1LA 4LGVA 2ZATA 1VE9A 3L77A 3UCFA 4BO7A 2O3SA 3E48A 3ZNNA 1LUAA 4QTZA 1Z7EA 3RUAA 4W7IA 1HT0A 4DA9A 4EI2A 3ZHBA 5JMPA 1VC2A 2JCVA 3OSUA 1JWAB 1ONPA 3GOHA 4BNUA 1P9LA 5AXBA 1NVMB 1CEQA 2OGUA 3MTJA 4XYMA 3ICCA 1JVBA 4WCDA 1OMOA 2HMVA 1ZJYA 4W99A 1ZFNA 2Z95A 3JQBA 1MUUA 4YJDA 1U5AA 1N2SA 2EJVA 5JS6A 4O5OA 2O3RA 1N7GA 1PGNA 1E92A 2A92A 4JJFA 2IXAA 4L4XA 2X22A 5L40A 2C7GA 3V1TC 3RASA 4E32A 1QMGA 1VSVA 3F1KA 3WGTA 4AICA 2VOJA 5C37A 3QLJA 3LT0A 5MGBA 3K2BA 1S7CA 3LC1O 5BNTA 1RYEA 1H2HA 4M55A 4P8RA 3C7DB 5A5EA 3D3EA 2JD0A 4WOKA 5I7EA 1KY5A 4U6QA 3F4LA 5EMHA 1EUCA 3NDIA 1LU9A 3WJ7A 4P4GA 2EHDA 1V3VA 1GPDG 4HXYA 4FPXA 2X4GA 1BXZA 3INGA 4HFNA 1NPTO 4Q3DA 5A5FA 5BR7A 2W4QA 5A03A 1KVQA 4J0FA 1C0IA 1LI4A 1WMAA 3NT5A 1E6EA 1TI7A 2X0RA 3OBBA 5CEFA 2V6BA 4H7PA 1CDOA 3OJ0A 5IAAA 1IULA 1LQTA 1UH5A 2AEMA 1HE3A 2PZJA 1HLDA 4DGSA 2X9GA 1LC3A 2Q2QA 5LC1A 3AI2A 4DBVO 5IXSA 4TKMA 1EK5A 2YYYA 4MVJG 5B4VA 3FR7A 4JIGA 4UREA 4QSMA 3S1LA 2VWPA 1XEAA 4OXYA 4CMHA 3AW9A 3IP3A 2SCUA 3L9XA 1RPNA 4J6FA 3DBHB 4N5NA 1ADFA 2B36A 2I5PO 1D4FA 3JQCA 5C7IO 4CV2A 3KYBA 4GMGA 2HK8A 3HHPA 1NXQA 3I52A 4AJNA 1XR3A 4OQZA 3WDSA 3L6DA 1KETA 4MVJD 1I30A 1MXHA 1U7HA 3DBHA 1SCUA 4NPCA 1OFGA 5L7YA 5C5IA 2Z1NA 1B3BA 3L6EA 4FS3A 1PZGA 4WUVA 3PIDA 4Q3BA 1I3KA 3JQ9C 3KRTA 2ZTVA 3VTFA 2HSDA 3C7CB 2EKQA 1X15A 2HRBA 2PFGA 3K96A 4IQ0A 1XWFA 4IUYA 4A26A 5FFFA 4AJIA 5ICMA 1UXHA 4UUPA 4F45A 3GK3A 4CLDA 3FPLA 3NRCA 5AXDA 2JFFA 2V6MA 3INRA 4M54A 3FSRA 3QWHA 4FJ1A 2I67A 3AK4A 5GMOA 4BKUA 3GN2A 4UUMA 4PLZA 1PZHA 4WCFC 1GYQA 2UAGA 3WNVA 2OBYA 2P2SA 1VJTA 2QW8A 4YR9A 2UUOA 5B12A 4PRKA 4ZU3A 3WBBA 4BKQA 1VSUA 3QIVA 4D3FA 4GVXA 1KIFA 1EDZA 1U3UA 3TRIA 5EPOA 2D5CA 1KBZA 4NU6A 3C3XA 4BGVA 4E2YA 1I3LA 2B35A 2DVMA 3F46A 3ZV3A 3GA0A 4B8ZA 2AHRA 2J5QA 4E5KA 3U5TA 2BELA 1DHRA 3FF4A 3I9LA 4HFMA 1EVYA 3UAGA 4IZHA 5KJFA 2PZMA 1HZJA 3L4BA 3W6UA 1IUKA 8LDHA 5IDQA 1UAYA 3ZV6A 3P7MA 4Z0HO 3AWDA 4BVAA 2CDAA 4BNWA 5AQ1A 3QP9A 4D44A 3JD3A 1V6AA 1LTHR 1LSOA 4NNJA 4IM7A 4CM4B 4CLHA 1NASA 2FR0A 4ND5A 3TFQA 2VUUA 5JYDA 1KC1A 2E82A 4CM4A 3VVCA 1JAYA 2GZ3A 4AJPA 4YACA 5I9LA 1B8VA 3G79A 1PU2A 5L9AA 1H6BA 1HETA 1XLTA 1JKFA 3ZV4A 3KUXA 1MC5A 2Y05A 4I1IA 5B4TA 5BT9A 3H6KA 2YFHA 3DHYA 3I6QA 4BO5A 3M2PA 3RJ5A 1DFIA 2CNBA 3JYNA 1AUPA 4NFSA 5DCYA 5KJ1A 5G0VA 1DLJA 1GEGA 5IDWA 4XWYA 1JA9A 4DQVA 1ADCA 2D2IA 2NNLD 4BO2A 2AE2A 4RVHA 4R5MA 1X7GA 1HWYA 1RWBA 4LSWA 4R1SA 3FTPA 3JQ6A 1YDEA 3BAZA 3AI1A 4MINA 4S1VA 3H65A 4RF4A 1GUZA 5DBFA 1B14A 3WX0A 4RF5A 1V0JA 4IY1A 2WEKA 5ER6A 3S2GA 2B69A 4BGEA 3OA2A 3ZNOA 4KZPA 3GVHA 3O38A 3EY4A 4JNKA 1R12A 3ZWNA 3RVDA 4QO7A 3WGYA 2I99A 2W2LD 3RQSA 2NU9A 2GN8A 2VRCD 1YOVA 5HA5A 3LT1A 2X5JO 4URFA 4E3ZA 2V6FA 1UUFA 3STHA 1C14A 1ZNQO 4L4SA 4XYLA 1PGJA 4XRGA 4RF2A 1SOVA 2PTGA 4R3NA 2E49A 3BIOA 4BIIA 1SPXA 3Q2KA 2WE7A 1V3TA 1E6UA 3SLGA 2JCYA 4MJLA 1L7DA 1Y8QB 2B5VA 4UEJA 5I7SA 3IAHA 2CD9A 1G0NA 4BNGA 1LRLA 3EGOA 3GVPA 3OIFA 5THQA 1R16A 3F4BA 3KEQA 4HNHA 1BRMA 1UXGA 3AY3A 1Y8QA 5I8ZA 3BMCB 4MVJI 4IQ8A 4A2CA 1K6JA 1UXKA 2DFVA 1Y7TA 2FR8A 2O3JA 1GPJA 2PD3A 5FYDA 5T67A 1EMDA 1PZFA 1MGOA 2OBNA 3BMQB 1LBEA 2GF2A 2NVBA 2QHXA 2X0IA 4XCVA 2POQX 3ZWBA 1BW9B 2UDPA 3H9QA 2B4QA 4PLFA 1EQUA 3FBTA 3BMQA 1UDBA 5BSGA 1H5QA 2C7VA 1L1FA 1BW9A 1QLJA 2QYTA 5GZ3A 1E7WA 1EVIA 1NBOA 2XPCA 1D7OA 4IJVA 1DIAA 2FZEA 3ZV5A 3HN7A 2OXIA 1BVRA 1UDCA 2G0TA 1HXHA 1V8BA 1ZJZA 3PEFA 5ES3A 3P2OA 3WNQA 3D4OA 3PJEA 5TSDA 1C1DB 1SNYA 2VHZA 2J3HA 1VPDA 3GUCA 1UP4A 3CZRA 5BQFA 5L7TA 5F5NA 3FWZA 2A4KA 2F1KA 1MA0A 3DBLA 3FNFA 3N7UA 4OGWA 2GUGA 3UUWA 2Q2WA 4KWIA 1C1DA 2PNFA 3A14A 3PJFA 5TLSA 4Z3KA 1E6WA 4L74A 2FHSA 4CQMB 4Z9FA 1GQYA 4IDFA 4GH5A 4CMBA 4MVJE 1FJHA 3QE3A 4MP6A 3WWYA 1QV7A 2C2XA 4QFCA 5JYEA 3RUIA 1ZVMA 2BI8A 3CUKA 1DRWA 3ORFA 1P74A 3WLFA 3U09A 1KC3A 4CQMA 2FP4A 5KVQA 3V5NA 3G3EA 4O0LA 5B4UA 2BHLA 1DB3A 1X13A 3ROMA 1E3SA 4PLHA 2RBEA 4NQZA 1PGOA 1TB4A 3UKOA 5HWSA 4L4RA 1IYZA 1BSVA 4J4HA 4JP3A 3U49A 3H4VA 2YUTA 4R69A 4IDGA 4OSPA 4BQPA 4IDCA 1LRJA 4TKLA 3GRPA 4CM9D 5BNFA 4YAEA 4WASA 3DAPA 1D1TA 3NJ4A 1NQTA 5FWNA 1LSJA 4RVUA 5KJEA 4XYEA 4W82A 1VM6A 3LDHA 3RIHA 1QYCA 2HK9A 4PLPA 5KNLA 3W8FA 1RJWA 5G4LA 3V2UA 4EEZA 4IJKA 2TMDA 1PWZA 4BNNA 1GQQA 3LZ6A 3JQ9A 3EYWA 4AJJA 5IZ4A 4J90A 4NIMA 1PZEA 1I5RA 1Y1PA 2GPTA 2EJWA 4M87A 3VDRA 4YRAA 3DMTC 2DUWA 1T26A 3DXFA 5JMWA 4CMAA 3SVTA 4DYDA 2QX7A 1DC4A 1PL6A 4RL6A 4I9NA 3DZJA 2UUPA 2YV3A 1PJBA 3KTDA 3OMLA 5K0ZA 3AUUA 4ID9A 4LK3A 4PFJA 5L95A 3FNGA 4D41A 7ADHA 3DL2A 2I9PA 2VHWA 1FXSA 3RCBA 3A9WA 5CEJA 3DFUA 3PTZA 4JN6B 4XYBA 5TQVA 3SC6A 4J1TA 2JHGA 4YYZA 1AXEA 3PWKA 3DR3A 5MDHA 1R4NB 1ISHA 2FPIA 1GFSA 2X1HA 4WECA 4Y8VA 3GDGA 4RLSA 3WSWA 2EKLA 1DO8A 3AUTA 1TLTA 3FI9A 1AXGA 1LDGA 3GFGA 3PHHA 3BA1A 4OM8A 1NFQA 1X7HA 4PIVA 3QVWA 1X7DA 3ZHXA 1A7AA 3VPFA 2Y66A 3LC7O 4YCAA 4BUCA 3D4PA 4ZGWA 4C7KA 4E5NA 2P5UA 4NDNE 1M76A 3JQEA 4CODB 4K9DA 2RH8A 3VC7A 3IMFA 4CLEA 4E31A 2WWRA 3GEDA 2YQ4A 1E5LA 2GO1A 1EE9A 1W8DA 2DC1A 3O26A 1EVZA 3QV1A 4WPGA 1HDRA 4IPTA 2RH4A 3DOCA 4YT2A 1O94A 5L51A 1ISIA 2X0JA 3DZIA 1IOLA 3AM5A 1ZSNA 3PYLA 4I5FA 4RVGA 5AVOA 4NH4A 4UEKA 1YB1A 3PVZA 1N8KA 1YKFA 3HWRA 1PSDA 4JROA 5G0SA 3SJ7A 1JQBA 3H9EO 4YRDA 2WD7B 3JD0A 3FBGA 4WK6A 3M6IA 4EW6A 1HZZA 3HB5X 4JGBA 4J3FA 4UULA 2OP0A 3ZCXA 4B7CA 1YQXA 5DNAA 3PWZA 3ROPA 2WD7A 3KB6A 5I7VA 3G0OA 4O59O 1OC2A 3PQDA 4B7XA 3AU8A 3UVEA 4J1SA 1LEHA 2R00C 3KEOA 1ZK4A 2PGLA 3HSKA 1C1XB 2YDXA 4B4OA 2XAAA 4BNFA 3I9KA 3IKVA 3P19A 3MZ0A 3JQ7B 3PQEA 2NADA 3FWNA 1C1XA 4FSHA 1M6HA 2NTNA 5DCWA 2CY0A 4ESOA 4IIUA 1UP6A 4TROA 3ZGYA 5T6BA 4GSLA 2PKQO 1D1SA 3JQ7A 1SEPA 5CDYA 3IJPA 4ND4A 4YDRA 3GZNB 2NVUB 5IDXA 3ZWOA 1IZ0A 2J5RA 4MOWA 4O63O 7MDHA 3ZNPA 4OQYA 4F3YA 5KIAA 1ISJA 1SBYA 3BTUA 1P1HA 3RKRA 4BNVA 4PVDA 4TVBA 1PTJA 4HWKA 3RC2A 4BKRA 4D0SA 3FCOA 1KY4A 1ZSVA 4CMGA 4GSKA 2ZB4A 3RBVA 4NZ9A 1RM4A 1YGYA 4GVLA 4BHTA 4DYVA 2W2KB 2Y68A 4IDEA 4M8SA 4KDFA 3K73O 1B15A 2Q1SA 3NYWA 2Q50A 1PJ2A 4JJIA 1GV1A 3DAGA 2W98A 3S2FA 4NJOA 3KLMX 2PLAA 2QG4A 1IPEA 2PZLA 2W2KA 1T1RA 2GRAA 3DO5A 4XB1A 1NAIA 1QRRA 4YAJA 4YXFA 1F8GA 1T2AA 2PA3A 5K6AC 1E7MA 4FJ0A 3E9MA 3DEYX 1YJ8A 3W4JA 3FR8A 1SMKA 2NSDA 1Q0QA 3MJTA 5JCJA 2GSDA 3E1KA 5L45A 3WFJA 3U62A 3X2EA 2HDHA 4OJNA 2C29D 3MWEB 3HQ4O 4GGOA 1T25A 5JPIA 1GZ6A 1ZXLA 1XA0A 1CRWG 5H83A 1QKIA 1BGVA 3A28A 4Q39A 1PS0A 4C4OA 5A3JA 3NGXA 4EYEA 1YL7A 4Y6PA 1LSUA 2FPGA 3NT4A 3IP1A 1Y5RA 3EVTA 3QVTA 1YQGA 1HDXA 1U8FO 3M1LA 5LCXA 5AXCA 1YRLA 4E21A 5JDIC 4I08A 2FRDA 1UZNA 2YV1A 1SOWA 1U3VA 4LISA 5ADHA 5IZCC 4IBOA 3GMDA 4MPDA 4PG7A 2ZKLA 3VHRA 2CFCA 2VQ3A 2EGHA 3PYMA 1DJNA 2CVQA 4GI2A 3U0BA 3EAGA 1LLUA 3QY9A 4WGGA 4D42A 1HDOA 2QQ5A 2PWZA 4KUGA 4XA8A 4KQXA 4TSKA 2I6TA 4AJHA 1DJQA 1K89A 4BNTA 2RHCA 4EZBA 3A06A 1R4MB 4K26A 1ZK0A 4CV0A 5JAMA 5JE8A 5IF3A 1I36A 1ZZEA 2J5KA 2A9FA 1B26A 1MB4A 1R4MA 3EUWA 1DRUA 5DN9A 3ZN2A 4BOYA 1YWGO 2EP7A 3ZWPA 1M6WA 3VPXA 1NYTA 4RLHA 2RIRA 4PLWA 3ZHYA 1PS9A 3A1NA 3GF4A 1OZAA 3PLRA 2OFPA 4NHEA 2I66A 4A73A 1PJ3A 2NQTA 5AYVA 3SX2A 3X2FA 3L6OO 3LT4A 3GVXA 3S2IA 4R01A 2CF5A 4MP8A 3OQ1A 2V65A 4GL4A 3RKUA 3DQPA 4CLOB 3D5QA 3BMNB 3TF5A 4NMHA 4OSOA 4YAIA 4PZEA 1NWCA 2EXXA 2BH9A 3VH1A 1YE3A 3R0IA 4XDZA 2X86A 2Y1DA 4HFJA 4R1UA 2QRKA 4CLOA 2DFDA 1NFFA 4HADA 1JU9A 3BMNA 1F06A 3QWFA 5KCZA 1FDUA 1WMBA 4RJTA 1ZIDA 5HRUA 5HS6A 3E8XA 1DFGA 4OMUA 3D0OA 4LMPA 3DMTA 2F00A 3KM0A 4U7WA 2X9NA 4YT4A 1JVSA 1X0VA 2UVDA 5IN5A 5T5QA 1N92A 2BRUA 3N58A 4AJ4A 4NU5A 3OJEA 3WSVA 2YDYA 1EUDA 4MO2A 1U4SA 1ZMOA 2O3UA 1QXSA 4GPD1 2ILTA 4J49A 1ZK1A 4R54A 1XGKA 2EWMA 5DOVA 3GAZA 1VKOA 1IZ9A 4NBWA 4ZHSA 1T2CA 3F6YA 3OHSX 2G76A 2J3KA 2NTJA 4E2WA 2GN4A 5AXAA 3JQAB 3BHMA 4IJWA 1VL6A 2D3TA 4NR0A 4QT0A 4WLOA 3WLEA 2H9IA 1DC3A 4HX5A 4MVJM 1JKJA 1HTBA 3OA0A 1PJTA 3OJLA 4RGBA 4RPLA 2CSUA 5JC8A 3JQAA 1U28A 3QJ5A 2I3GA 1ENYA 1CQJA 4IZIA 2NACA 4ALIA 1U9JA 3OIGA 1IY8A 4QECA 5HS4A 2YQ5A 2UV8A 3KYCB 4BNXA 3GG2A 1LDNA 3PDJA 4PLVA 3B1FA 3WJAA 2DPGA 4UVEA 3GR6A 4R1NA 3C24A 2Y93A 4MKRA 2DBQA 1NQ5A 3KYCA 3K30A 2CDCA 3BZUA 1P1JA 3DONA 4PG8A 1GL3A 4RO0A 3WXBA 4BMNA 2V7PA 2AG8A 1Z75A 1ZH8A 4NBRA 4QFDA 4W4TA 3WYBA 3TL2A 3GLQA 3K6JA 5EIOA 3HNPA 3T7EA 1YL6A 2Y1CA 2NU6A 1H93A 4XQ9A 1QYXA 3DZBA 3ICPA 4KWHA 4A27A 3I23A 5KOIA 2D4AA 4ALMA 1YVEI 1I10A 4CLRB 3DAFA 1HDYA 1K6IA 2R00A 4BO0A 4RV9A 1U2DA 2XF8A 5G0TA 1SAYA 3JQDA 1UXJA 3VZRA 5CAEA 4GLLA 4BKPA 1JDJA 4Y6SA 1J5PA 3Q9NA 3WGZA 4CLRA 3HG7A 2C07A 1GADO 4BL5A 4LN1A 1V35A 1V3UA 2O23A 3IL2A 2H1SA 4S3MA 1W73A 4TQGA 1PQWA 4C7JA 1WZIA 1VLLA 1SEVA 2R6JA 4GQAA 1A9ZA 3E6AA 2O48X 2IEBA 1E1NA 1U5CA 5EESA 3W8EA 1E7QA 1O89A 1QYDA 3PK0A 3TFOA 3D1LA 4RQUA 2VT2A 2VWQA 1GU7A 5TT1A 1LDMA 2VHXA 3LYLA 2DKNA 3GVCA 1CJCA 3AOGA 3M2TA 4D3DA 4DPLA 5KVVA 1GDHA 2AMFA 5BNIA 1ISGA 1GV0A 1P31A 2VUTA 3K5PA 3KSZO 1ZK3A 1YBVA 3PXXA 3HDQA 1E7YA 3CH6A 2GLXA 3JQGB 5DBIA 1S6YA 1HE2A 4Z9YA 4XJTA 3KHUA 3JQGA 5DZSA 3ADOA 4IINA 3F47A 4P22A 5JO9A 4ZQBA 1AE1A 5K6AA 4GX1A 2PGJA 3DFZA 3RUCA 4RDIA 5ITVA 4P4LA 3RFVA 2PH3A 4ZRNA 4UEOA 4A10A 3PWSA 4II2A 4I8XA 2B5WA 1GZ4A 3UN1A 4F46A 2HRZA 3WIEA 5F5LA 3EHEA 3WQQA 4CV3A 4KP7A 3WGOA 3SJUA 1Y9AA 2B0JA 2H6EA 2YHUA 4BO4A 4MKZA 1HLPA 1T2EA 2FR1A 5JO0A 5TJ9A 3TZHA 1P0CA 4CM8B 3HDJA 1WDLA 1K0UA 2VHYA 3BMOB 1OBFO 4J7CA 1ZSYA 4GWGA 5JC1A 1GEEA 4OXNA 2IRWA 3ONFA 3ADPA 4NK4A 3AOEC 2O4CA 5F3RA 1E1KA 3AI3A 2EGGA 3IUPA 4CM8A 3BMOA 4QUKA 5ILOA 1P0FA 3IKTA 3H9UA 4EJMA 3GGPA 2ZQZA 5JDIA 1HDZA 3NV9A 2BD0A 2JD2A 3MEQA 3NKLA 4FFOA 3WFIA 1YDWA 2O2YA 5U1PA 3BHJA 1QORA 4PRLA 3ZU3A 4B4UA 3Q9UA 1NQOA 1XDWA 2EV9A 4FCCA 4YWJA 4GKBA 5IZCA 3OQBA 1FDSA 1RM5A 4FGWA 4E0BA 3VZPA 4MKXA 4CL8A 4ZQGA 2WE8A 1ZEMA 4I9HA 3ZWWA 1HYHA 1M75A 2OZPA 3E03A 3NTQA 1R0LA 3RC9A 4N5MA 4AJ1A 4WE3A 3RUEA 1EQ2A 3CEAA 4XGNA 4ND3A 3KYDB 2VNSA 1W0CA 4CMCA 1O0SA 1OOEA 2X7HA 1C3VA 3T7CA 2C54A 3FN4A 3LLVA 1HE4A 2OMEA 2E37A 2Z5LA 1XG5A 1RKXA 3ZW9A 2DQ4A 1DRVA 3RC1A 3TDKA 3H8VA 3L9WA 1P1FA 4E5YA 3KYDA 1MLDA 1F14A 1YO6A 4JCOA 2HJSA 2WSBA 1R66A 1YQDA 4R41A 4DTIA 1EK6A 3BMCA 3NGLA 3ROQA 2JFHA 5L4LA 3A4VA 4OOFA 4YT5A 4B3IA 3CXRA 2Y1GA 5TNXA 2X6TA 2DTDA 1H2BA 2A94A 3P5SA 3UXYA 2DTEA 2VNAA 1KEUA 3I4FA 3B1KA 3Q6IA 4H16A 3GEGA 4KUHA 1ISMA 1UZLA 3TPCA 4IIVA 1SO8A 4D46A 3GVIA 4IDDA 4HV4A 5LDHA 3ULKA 5GZ6A 3TWOA 3WR5A 1HL3A 2OL4A 2I65A 1N1EA 5ER9A 1YB4A 4PLCA 4N54A 5ILGA 3C1AA 2GZ1A 3GY0A 1A27A 2J3IA 4QXMA 3JTMA 2ZYGA 4O6VA 3I9OA 4D43A 2ZQYA 4IGFA 1HF3A 1XU9A 2HMSA 3V1YA 4Z0TA 5CEEA 2XXJA 2YY7A 1DPGA 2Q4EA 1MV8A 2PV7A 3CIFA 3R3JA 2OUIA 1WZEA 3EZYA 5JDCC 2YHIB 3WMWA 2D1YA 4PZDA 4WLNA 2WJPA 4R16A 3VH3A 4L75A 5I8WA 3R1IA 5CP8A 3PGJA 2PD6A 1ARZA 2HO5A 3NAQA 4H15A 1HYGA 5B1YA 1U8XX 1NHGA 1MC4A 4PCVA 1KVUA 2PGDA 5ENVA 1LLCA 1E7SA 1I2ZA 1Q7CA 2DAPA 3ZWMA 2O4UX 4W9NA 4CR8A 4RPGA 3EVNA 1GUYA 5KJCA 1E3JA 3DWFA 3VVBA 4XGKA 1N1GA 1LC0A 2B83A 1A5ZA 3JD4A 4RVSA 5TJHA 3NJ8A 4DL9A 1B8UA 5JNLA 3ON5A 2EW8A 4PLTA 5F21A 3QVXA 2GERA 4DREA 3PYXA 4RPJA 1G6KA 3ANLA 4CUKA 3Q3CA 2YJZA 2EG9A 5CG2A 1MXFA 5FI3A 5KKCA 2NU8A 3OJOA 5KTKA 3GN1A 3QA9A 3PP8A 4Z6KA 1EUZA 4DC1A 1MX3A 2IDZA 3VZQA 4ND1A 1UDAA 1NPDA 3QRWA 2X9VA 1GR0A 1QR6A 5DT9A 5A9TA 1TEHA 1DEHA 3NUGA 2GD1O 3GFBA 1ZKMA 1EE2A 4NBUA 1WP4A 1W6UA 4WEOA 4RVFA 4FC7A 2GN9A 3BHIA 4ZD6A 2C59A 3V2HA 4BNIA 1BDBA 5A1TA 1WXDA 3EDMA 3LSYA 3RBXA 1HRDA 3DDNA 4MVJA 4J1NA 4IS3A 1M2WA 2LDXA 4XDYA 1LLQA 2RCYA 3MJSA 3VPHA 3JQFC 2X5OA 1JW9B 1IHYA 4RPKA 1KOLA 3SEFA 3TZ6A 1PWXA 4E12A 2HLPA 3C7AA 2P91A 3OF2A 4K6FA 1YBMA 2VHVA 3ETDA 2O50A 3KO8A 4DVJA 2QRJA 4IDAA 4BKOA 1ORRA 1BXKA 2VYVA 1WVGA 4QX6A 1I0ZA 1VL8A 1R4NA 2BFMA 1Y6JA 5L53A 3DZKA 4GLOA 4LMRA 4B4VA 3RU7A 3GHHA 3PPIA 4TZKA 2C82A 2Q45A 1ENPA 5ENDA 1NFRA 4YB8A 1J6UA 2OP1A 2IEDA 2RHRA 4L8VA 1H6CA 1ADGA 3DTYA 5TT0A 5G4KB 2NQ8A 2HU2A 3F1LA 4AJKA 3GDFA 1P45A 1P44A 3H9JA 1E3EA 1A4IA 1FDWA 4WLUA 4Q3EA 5LDGA 1EFKA 1M66A 2HUNA 3U9LA 1YH3A 3FPCA 1EEHA 3WQRA 2YV2A 5G4KA 3QW2A 4QEDA 1W4ZA 2O7SA 1LNQA 3NDRA 4RORA 3VPSA 2PR2A 1SC6A 3WYCA 2HMTA 3Q2IA 1OAAA 4RQTA 4TRJA 2ZYAA 5EQFA 4PLYA 3ST7A 4HNGA 3HDHA 4YJGB 5DF1A 5ITWA 3PFWO 4Q3AA 4CJXA 1B3RA 3TOZA 2VTDA 5CDSA 2IZZA 4Y9DA 4Z3DA 8ADHA 3AJRA 4XIYA 2Y0CA 4FJ2A 3VKVA 5CG1A 3BTSA 4YJGA 5C7LO 1R0KA 3GT0A 4J2OA 1DDOA 1YB5A 1A71A 5F1KA 3QWIA 4XD2A 5IN4A 3O8QB 1KVRA 2I76A 4RZIA 5K9ZA 2P5YA 1I24A 3FNHA 4FN4A 4ZQHA 3KXDA 3LU1A 1C0KA 1WDMA 2ZIZA 1A7KA 2PKRA 1QG6A 4AJOA 4FQ8A 5DP1A 1YJQA 3R6DA 3O8QA 1ID1A 4PGFA 3IQDB 3PHIA 3MJEA 3JYOA 4YQYA 3FNEA 3RUHA 4G65A 4Z0PA 3DTTA 1NVGA 1WAMA 3QQPA 5IDYA 4BO9A 4DMMA 4E33A 3W6ZA 1GYRA 3AOEA 4U5QA 1ZW1A 3H3JA 2E4AA 4NFYA 1FF9A 2QYSA 4B8WA 5EL0A 3DC2A 3CPSA 4YVFA 4HUJA 3WGQA 3VKUA 1QSGA 3AFMA 5FF9A 4ALLA 3V1UA 4EGFA 4E6PA 3WYEA 3GZNA 2NVUA 1UR5A 4X54A 2JHFA 4WLEA 5G0WA 2Q1UA 1JN0A 4M1QA 3COSA 3DHEA 3OJFA 2P9EA 4FIZA 1BTOA 4ILKA 3HFGA 2O2SA 3ZU5A 5IFLA 1H0KA 4AG3A 4PVCA 5I9NA 2RAFA 3HZZA 4KTVE 1P33A 2JAPA 2FOIA 2WYUA 3DOOA 2HMWA 3S2EA 2DU8A 1IHXA 3U3XA 4CV1A 2YZ7A 4OXKA 4K28A 2ZB8A 5TRTA 4R9SA 3E9QA 2O3QA 1WWKA 3G1UA 4ROSA 5U4QA 2PY6A 2W2LA 1XYGA 3CZMA 5F1PA 2VRCA
chains in the Genus database with same CATH superfamily
3ZYZA 1TK9A 3Q8KA 2DKOA 1C0LA 2C4KA 2GPJA 5SV2A 2R68A 2P4EA 5EEGA 4QAJA 1PHRA 3W4KA 4BZXA 5M3BA 4DV7B 2BEUA 4I9UA 5KOHB 2ZYUX 2HKIA 2ZRDA 3IVCA 1V7CA 1Z37A 2B94A 3DH0A 3CNLA 2HJHA 2C0QA 6YASA 1O95C 3NJRA 1P0MA 4LXYA 1MG0A 3SQWA 4A82A 4P4SA 1CYDA 2GYVA 2IPXA 1Z4MA 3L7IA 3HY4A 2J3DA 4XDGA 5GJCA 2WICA 4MWDA 4N7JA 1CWUA 1QH1A 1LXCA 1O6ZA 4N7RA 5D3QA 4EB0A 2AOTA 5JJ5A 4RGQA 2VKQA 2XA1A 1U3WA 3JWIA 4BZPA 5COBA 3ZBTA 3RSFA 1DXHA 4JEMA 1UBSB 3NVDA 5HCIA 1G5FA 3OZAA 1OX4B 2AFHE 2I7VA 1U81A 3HNRA 4RYDA 5H80A 4D8TA 2DJ5A 5LR6A 3BXHA 3IHKA 1VJ1A 2FXVA 3QEMB 3NHMA 3LUKA 3UAWA 1I7NA 4WLFA 4YPVA 4Q9JA 3U81A 1QHYA 2EFDB 1J8QA 3OIWA 4P7BA 2AQ8A 3B53X 2PJRA 1C4OA 1GFWA 3GAFA 1W4LA 4W6ZA 1RBZA 3NX4A 5AUQA 4EG5A 4C04A 3HDVA 2O7QA 2VPQA 3BT7A 3HKEB 2K87A 1ATZA 2VT3A 1HTWA 3FOWA 1SBCA 2BGMA 4L73A 2CCGA 4MIOA 4NK5A 3A3OA 4MI1A 3H8JA 4RTMA 1JB1A 2VP6A 3DBRB 4DIDA 4AY4A 2JS7A 3WLPA 5DNYB 3CHYA 3ND6A 1O96A 3CF0A 1QHIA 4EUHA 2FLKA 4O2AF 3TIVA 4TRMA 3OESA 2OD9A 5E9WA 1CR2A 1XTRA 3NEPX 2V5VA 4NBVA 2XBLA 5LIPA 5C1PA 1DC5A 3LUPA 4Q7MB 1JWBB 4HNVA 3UM9A 4MPJA 3EW7A 3C2QA 2JJ1D 3PHBE 1SCNE 1L7AA 3D7LA 4G4IA 3T4XA 4EGAA 4N76A 2GCNA 2GPWA 4RA6A 4EY3A 4PZCA 3S0JA 1XDGA 5DXAA 3CE6A 4DNQA 1ZM2A 1PT6A 2ETVA 1FMCA 3IOBA 3NNNA 4G8CA 4DPMA 3GLIB 1E3WB 2PUJA 5SY6A 5TQ0A 5KCMA 1RM0A 1HR0B 2X8BA 4DSZA 2NN3C 1F7UA 1Y6ZA 2J0QA 1ZL0A 2BAGA 3CBGA 4X85A 4EHKA 2PH5A 4B71A 3P2IA 4OO3A 3PGVA 4QICA 4XVCA 3UQZA 1DHTA 5AOVA 4FGJA 1F5SA 3AUSA 3JRXA 4KTTE 3TCKA 2PVPA 3D7KA 3V1MA 3IT3A 1ZU5A 3OJWA 3N2NA 1U0GA 5DLPA 1QWSA 4MV7A 2B6HA 4B6FA 3OKPA 4BRSA 4QBIA 1C8BA 1QYVA 3FTDA 4EPWA 1OJ7A 3OLQA 3AEQB 3D8BA 4NESA 4UD2A 2X7XA 1GILA 4LWZA 2VT7A 4PQRA 4CU5A 2VQEB 1LX6A 3TAXA 2QM3A 3DHVA 1KYWA 1Q84A 3QKTA 3M49A 3MRXA 3FFTA 4N3CA 1QO0A 3TIIA 3I1YA 1GNLA 1KYVA 2B98A 3MJRA 1GPNA 1HMYA 2C2BA 3NWBA 2N47A 4Y7DA 2FWRA 5FHRA 3WIDA 4EG4A 4IMPA 5EJGA 1TDJA 2IHUA 4XRRA 5EMMA 3FKJA 3SS9X 1PNTA 2SKDA 2VYQA 4GXRA 3RFFA 4CMIA 5DGIA 4ESEA 821PA 3LF2A 3LMKA 4XX0A 4EVQA 4L76A 4OJMX 4WVLA 16PKA 3ZZNA 3ZTYA 1LS1A 3A6LA 3BE6A 3JRWA 4G85A 3SLKA 1E9FA 1M1NA 2C97A 3H2SA 2IL1A 4RHYA 4B3JA 4Z4IA 2BZ0A 3IXQA 5TX7A 1X7YB 2E48A 1BS1A 1D9XA 4GKVA 4WNCA 2PCJA 4E5MA 4ZICA 1I01A 3ANYB 2IUTA 5DSZA 1GPYA 2ONJA 3JQFA 4R4JA 1R4AA 4FB4A 1SZJG 4K3VA 2G9UA 1Z26A 5AUNB 4HVTA 1MBZA 2HY7A 4JOQA 2Q5CA 2YHSA 3EDOA 3OLXA 4YFYA 2E6KA 4NFHA 3QF7A 5KPJA 1KERA 5FUVA 3UG7A 4KE9A 2DBVO 4DQDA 4C7OA 2K7FA 1HDCA 5LP6C 1KI4A 2JGJA 3VAYA 4DWOA 4IZOA 5TGZA 5L6MB 2AYYA 3K4PA 1M34E 1AJEA 2ZVQX 1BWSA 1UJCA 1J00A 1ZOIA 2ZB7A 2MHCA 3UHJA 3EXHA 1KMIY 4B3HA 2I33A 4HQOA 4OHUA 1EYZA 3HEMA 2AKAB 4C6TB 1KO5A 1SWVA 5CXSA 1K3FA 2VFAA 1TADA 5DEIA 1V43A 3GRKA 3FRJA 2XCTB 2PK3A 5BRJA 1E59A 4Q1EA 1L5RA 2ZBPA 3BGIA 4XFJA 3TECE 1U2GA 2VF4X 1P3DA 4JLWA 1WVIA 2OCDA 1N5MA 4KLAA 3B82A 1MFZA 1FVFA 3PD0A 1O9GA 3RUPA 3CVYA 1WXGA 2H54A 4MW2A 3C39A 1BMQA 1TEVA 2W2QA 3C3JA 2IVZA 3BDVA 4KV7A 1KQOA 3JASA 4OD0A 2PMEA 4RCYA 2ZR8A 3OZWA 4ENVA 3HJTA 2O0LA 1Y8RB 4MWEA 3LKZA 3RSCA 3AM4A 2WWXA 1FY2A 2NO4A 3KL2A 3R7WA 3UZUA 1CX9B 2HJRA 1FMFA 1F1JA 1MAWA 2FY8A 2P3SA 5IMBA 2DSTA 1MMFB 1L0BA 3OTQA 4HDQB 4U2CA 2D13A 1IEQA 3NBYC 3F6PA 4GMHA 4J4BA 4QD3A 4D45A 2P2ZA 3HFSA 2X1MA 4EFLA 3QI2A 2FKAA 1JG1A 3LC2O 3GPIA 4QQRA 3EZLA 5ELXA 1EQAA 2D74A 1NA5A 3GMTA 2C7BA 1XDZA 1SCQA 3SKVA 5AI4A 2WKRA 3W3AA 5K3FA 4Y2PA 5K0NA 3T1QA 4AY3A 3TLCA 3S70A 3QU4A 1AGNA 1BS9A 4HQRA 5J2TF 1E2DA 3RIGA 1C3LA 3GGOA 3H0CA 5E3JA 1TZ2A 1XCBA 2KPOA 1UKVY 2EATA 2MJLA 3AY6A 3DZGA 4UBLA 4V3BA 1C9DB 3ASVA 4Y2TA 4YJ3A 3W8DA 4FR5A 1C5KA 2O20A 4BQQA 3I2HA 1M1YB 2ZUEA 1KI9A 4ZVQA 1YKGA 3E9DA 1CUAA 4A6XA 4BNZA 5KWEA 3BWMA 4C01A 3PQ5A 4N1AA 3MMZA 5TQJA 1QIKA 2PXCA 3HE3A 2HV9A 4EUEA 4B6GA 2JDID 3AM3A 1DBPA 2HA5A 1F2TB 1T4CB 2A9JA 1JEQB 2IOFK 3G7UA 4M8NE 3RADC 3K8YA 3PCTA 4DWVA 5KOJB 3FSGD 3C70A 1DQYA 2B2NA 2WV9A 4NZMA 4BFVA 4BVFA 1XRRA 1XMOB 4LQLA 2PIDA 2H52A 4CM1A 1NQXA 4UHCA 2H11A 1ULUA 4XGIA 2IDJA 2QTZA 1HDGO 3RWBA 5JAUA 5HBRA 5LUAA 4CLXA 1WPQA 4JYAB 3ZD7A 4GBJA 1JQEA 5IJWA 4OA5A 1LQUA 3K6RA 4K9MA 3F8TA 4KQ1A 4GPZA 4N5IX 4ERNA 3KPYA 1MN6A 1QIEA 3EC7A 1YR2A 1OTYA 4Y1EA 4UNRA 4YT8A 2D0OB 1PWYE 1V6SA 3DE4X 4LNAA 2GNAA 5DTIA 4IVQA 4BMVA 4CF3A 1OBOA 1MGPA 3E9CA 2BKAA 2EP8A 4D9JA 3QUCA 2FN7A 2ZWIA 3B6KA 2BGKA 2WOOA 4FW9A 1GCAA 3GQBA 5E3IA 5JLAA 3WLJA 5C7YA 2NSJA 5EIHA 2FPPB 1ISFA 2R6DA 2XTZA 1I7PA 4UHDA 4IUDS 3ROXA 3WKEA 4PSDA 2TMGA 4LE2A 3WO1A 2R97A 4S2EA 4BN0A 3QU2A 5B30A 5BN5A 2HPZA 2HCJB 4Y67A 3U7HB 4DA4A 2Q4DA 3NTOA 3PHCA 4BU0A 5ICEA 2YN4A 1I4WA 2ZLBA 1ULHA 2Z2JA 1C7IA 3GGCA 4N6GA 3WRYC 4CQLB 5KINB 5LP6F 2O8BA 3IBCA 3MOSA 2C1EA 1QF6A 4NBLA 2J0VA 4FKMA 1ZIOA 3JYPA 1W6RA 1DAEA 3GUYA 1KMHB 3IX7A 3R2JA 3MLEA 4IHAA 4Q4LA 3ENZA 3S2ZA 2JF0A 5FTJA 2W2XA 4B35A 2WW8A 4LJKA 1QDUA 2FQXA 4X66B 3DFFA 4ZJUA 2VTEA 5REQB 3CZ4A 1CERA 5L3QA 1LTQA 2XWBF 4HYTA 1FBTA 2WZDA 3BEDA 3O2SB 4KVAA 5F1OA 3F9IA 1CFZA 3PNLA 2J32A 5DCUA 1ZD4A 3K92A 1E9RA 3GQVA 3SFTA 4BQSA 2W00A 1OF1A 2OORA 2WABA 1SQ5A 3KSUA 2YFQA 1EA7A 4YMSA 1NM5A 1UAGA 2O7VA 1ZIXA 2OCKA 2RBKA 5I3ZA 3IUSA 2VZ8A 1JEOA 3LKDA 2HT6A 5JAOA 3AHGA 2NUTA 2MDTA 5GIPE 4XWWA 1E4OA 2HLDA 2UXCB 3A4MA 1T4DA 2H5LA 4UJ3A 3DFKA 4RVNA 1CEYA 4GXTA 3RAGA 1A50B 1NBME 3TEFA 3UFXA 1SXJE 2ZJYA 4MKFA 5DT2A 4KAJA 5K99A 9MHTA 2FMUA 4OKNA 1AGYA 5EFOA 4MSUA 3EUEA 3GEMA 2PXAA 3K31A 3L0YA 3SBXA 1KYZA 1STOA 3TCNA 4F6RA 4YMHA 1RU3A 3DR5A 3RRYA 4CCYA 3ZJVA 3JQ8B 2HIGA 4QBHA 3RI3A 3TKAA 1E0AA 1TEXA 2Y67A 3N8HA 2W58A 4AZ0A 2DLNA 2WT9A 4ZYXA 1UCFA 3IQGX 4CBVA 4WTOA 5JCOC 1YRQA 4Q4CA 1P6UA 3IESA 4A03A 3GDWA 5JY1A 4R8SA 1V3QE 4KXWA 3U4IA 4TRNA 3SJAA 1JHMA 5IU6A 1CUWA 3VKHA 1QLHA 1V2GA 2R3SA 4PYOA 3BPSA 5F7XA 1OWNA 4CL3A 1P29A 4GXQA 5D8DA 4UOEA 2YJ3A 1OWLA 5CA1F 4RA9A 2O8EB 2YYZA 2PUTA 1EWRA 3ER9A 1P9OA 2C8KA 2OO5A 5AJHA 4QRDA 2NVWA 4ZAXA 3RF7A 4EY4A 1SY7A 2Z2XA 3JWHA 4ITVA 1XHFA 3VGJA 1NMZA 5FNVF 3H1BA 4ZVVA 4DM3A 4K6OA 2PXXA 4AKIA 2Z1MA 3W9UA 4HAZA 3VZSA 2AOWA 4C08A 1D2GA 4LI3X 2BFBA 3BJIC 4C0WA 2BJHA 2P0EA 2GTPA 1N5DA 5GV7A 5KUTA 3KTOA 1Q77A 5EAIA 1D03A 2XHZA 2BM0A 3I3OA 3IEXA 2HCTA 5FI0B 3WGNA 1SQSA 2JGRA 3LF1A 3Q3EA 1J49A 1XD2A 4M6WA 4ZCSA 1RJ9B 2JVJA 4FLFA 4RY0A 1WLYA 2CEKA 1FEZA 1NDUA 4JWTA 3PGXA 2G1UA 4TPKA 5HZMA 5SZJA 3P2YA 2GBLA 3KB1A 3AQ4A 2XNSA 1F12A 4X93A 4L27A 1X1RA 2QQFA 3TLYA 5A4DA 3NTLA 1T9AA 2G71A 3CN9A 4C5AA 4ZCPA 2ZSJA 5FI1B 3GLSA 4YBZA 4G89A 5JAIA 4CIYA 5AVJA 1N33B 2HSWA 2XHEA 2HM7A 3G2MA 2WTEA 3ROEA 3T7JA 1XPRA 1RXVA 5TEWA 1G55A 2J4FA 1WMFA 3HB0A 4FD3A 2ZBUA 1PQPA 2QDKA 4J0JA 4J7UA 1MC1A 1FPQA 2ZM5A 1RRCA 1BDMA 1UKZA 1QBKC 3LVRE 1HV8A 1UJMA 2DFTA 2YHIA 5ALIA 5CVJA 2ZQ5A 2IVFA 5B3KA 5GIOE 3IERA 4QQNA 1GCUA 5TGDA 4PGMA 5ADWA 1ST2A 5DNWA 3K2EA 3DKKA 2UU9B 4DIMA 1KS9A 4AO8A 2XXAA 3GJ5A 3QLVC 4N40A 2RC5A 5T64A 4LOLA 2ODBA 4NOMA 4EHBA 3R3VA 1U1FA 5CXXA 1TVCA 1NYLA 3OHMA 1S3GA 5J40A 2IELA 4NARA 1XLWA 1XE3A 3D1JA 4RV5A 5MFZA 3WWEA 1MCZA 1T4MA 2QGZA 4REMA 3R3SA 4DFDA 1UZUA 2JAOA 4EYQA 4GAEA 3ISVA 3PGKA 3ZGNA 2WA1A 1VJ0A 4HKTA 2DWQA 3ASYA 1TIPA 3QBVA 1KDZA 1C7JA 2EX0A 1HKUA 1XMPA 1JE0A 3HVJA 3L4SO 4TV9B 1Y9EA 3P0RA 2NU7A 4HSGA 4JLSA 4JEHA 4R9UC 3FUTA 4U0KA 3T9AA 3KTAB 1JPNA 3CRW1 3MWJA 1YL5A 1XKLA 2V1UA 1WHSB 1HG1A 4LY9A 4U7JA 1AZLA 1Z82A 1Z0AA 4J8PA 5IJZA 5BWCA 3QX7A 4TSFA 1VECA 1U5BA 1N1DA 2ZWOA 4JEIA 1E3QA 1K8YB 3DAYA 4ZA2A 3FYUB 2AFIA 3QXGA 4LX0A 7AT1A 1S4QA 2DBRA 3BMXA 3RM3A 1J5XA 2PSFA 1SKQA 4RD6A 1ZVJA 1OB2A 1W29A 4HEA1 1GTSA 1YZYA 1DVRA 1YZVA 4TXMA 5HF6A 4CEJA 4F1WA 1T4BA 2IUFA 4C4ZA 2C5AA 2ZRBA 3LT2A 3G5AA 3PC4A 2FW9A 3ZY4A 2A30A 2OA0A 3ROKA 5JXWA 4NPHA 1YVPA 5KHOC 4IQGA 2C7OA 5E6RA 3D6MA 4I1PA 4XE5A 5K0SA 1M10A 4RY2A 1YBHA 2G07A 2VNHA 3G0CA 4EGSA 4XDHA 2WPDA 3UAOA 2ZANA 4MJ7A 2ENWA 2PU5A 4CIDA 1JG3A 1EXVA 2ZRHA 1F4VA 5ALVA 1N9GA 3RS2A 2H4XA 2DPMA 1A9XA 2MT9A 4MTLA 1V8PA 4WY8A 2CHQA 2INGX 5K03A 4WCFB 2OAGA 3RJTA 1B16A 1C7QA 2WHQA 2OV8A 3JATA 1F60A 1KQNA 4UQOA 5H3HA 4E15A 3GP5A 3U5ZB 3OPVA 2E18A 3AB7A 4K7JA 1OWPA 2D06A 2ASEA 2DWOA 2EBFX 1Z0KA 2R6FA 3KOWA 4KQ2A 1KVSA 1TJ5A 2HQRA 4ZDWA 3O1HB 2IWHA 3TL3A 3OQOA 1GGEA 3ROFA 3BYZA 3UWMA 1CUDA 1UL1X 1QANA 2IKQA 4G6ZA 2DR0A 3WWZA 2V4ZA 1XZMA 1V96A 1Z0DA 3K9LA 3WTCA 3EVCA 421PA 3RYCB 1JR3E 4QBFA 3WIOA 3TB4A 1TYBE 2IYOA 2PBFA 3HKCB 3KLBA 4YP7A 5GADl 5JXJA 2FDCA 3DVAB 1EVQA 4D3YA 2QRVA 3PQFA 2OV2A 4NG5A 3VFDA 4MMXB 2NUAB 4RZ3A 2C31A 1RYZA 2PSJA 3OZEA 2YJ4A 2ZI7A 3EAFA 3R74A 4MZDA 3O21A 2YZKA 1LZKA 1YDFA 3ICOA 4KBFA 4OY3A 3T5GA 5JWRA 5H81A 1DIGA 4Q3CA 4DLPA 3UMCA 2H57A 4AKEA 4S1WA 3EVGA 1V39A 3RRFA 4UEWA 2CVZA 4L78A 3CNQS 3BIFA 1IIBA 1O8CA 2P68A 2WUFA 4LRTB 3KJGA 2WWVD 3JVDA 3TGWA 2R66A 3ZI0A 2OPBA 4DMHA 2H07A 1YA4A 3C3PA 1P2UA 1U4NA 3KELA 4O4IA 2G17A 1OUMA 2Y4OA 2E4UA 3C8MA 2PHZA 1XF1A 3ORSA 2LBPA 4KOAA 1A9TA 4PZ9A 2ZJ1A 4M86A 1S7GA 1XELA 2VUIB 3EQZA 4JA0A 2E3JA 2Q1WA 3M6XA 3TSZA 4YAOA 3QWBA 4ZP1A 4Y0VA 3IKMB 1JDBB 4N6NA 4EY8A 2G3YA 4N5LA 3EDCA 3ZDAA 1X87A 1ZMBA 3GGGA 5T8KA 2I3BA 4E2FA 3QHQA 3KT0A 4QT4A 5FIUA 1J8FA 3OZCA 4QLBA 1TEZA 5TVGA 3I0NA 4HVLA 4NP6A 4OQ4A 2FW7A 3FYSA 3GNSA 3OFND 4IMRA 4X9XA 7REQB 1K8XB 3I4CA 3CZQA 3K9GA 3ETNA 2ZUBA 1CC1S 4IKPA 1RKVA 4GQBA 1MVLA 1H9CA 1TNDA 1XWWA 2XBUA 3FOBA 1Z6GA 5DWDA 4POOA 3MOIA 5ULLA 1U8TA 3K8ZA 3LY5A 3LUAA 5AJUA 5IULC 4RZHA 3CRQA 1NNUA 3A1CA 1OSNA 4S1PA 3V4RA 4A8JA 2Q46A 4LZOA 3WL5A 5IHPA 2ZTLA 1UBCA 1NI4A 4HGQA 4F5EA 1E9EA 4JBIA 2GZMA 4MV4A 4MKGA 2HL6A 3AU9A 2JATA 4DUZB 9LDBA 1WY7A 2XYPA 3NXSA 1AO3A 1H3FA 3HR8A 4B3XA 3PHJA 2BJVA 1GA4A 4M8KA 1G18A 3IPYA 1QZUA 4OFZA 4GD3Q 1CB0A 1UWLA 3RSZA 3TLKA 4DA7A 5FA8A 1ULBA 5A7HA 3F98A 1G41A 4COOA 3ENVA 3VM6A 1MO4A 1AKNA 4E51A 1KEEA 1H2YA 4IG9A 2LE0A 4XQGA 3T1HB 4Y7CA 1GGVA 1QHNA 4JBHA 4BFLA 1NIJA 2QNBA 1VSTA 4CEIA 3ZDZB 2QD5A 4ZCTA 3E5MA 1DQNA 3JD2A 2FMTA 1Z08A 5BNZA 3LUHA 4BNYA 5HJEA 1YJCA 4I3FA 4EMUA 1EB8A 2OCPA 2QY6A 3HXPA 2FMFA 2GF0A 5FP0A 3SICE 2XZOA 4L0CA 2O8FB 3I32A 2EF1A 1FW8A 1SD5A 2C4UA 4WL0A 3SR3A 1LPMA 1UJ5A 4BDSA 4MS3A 2A58A 4LC9A 1I9CA 3U3OA 3D4NA 9LDTA 2E4VA 4NJMA 1MHPA 2FTKE 2H29A 2ZI5A 3H3XA 2IH2A 3WG9A 1VPWA 1IZYA 4H6PA 3PHGA 4NL4H 5FRDA 4MUKA 1R5BA 2NQ2C 2XUIA 4HWRA 1PEDA 2GASA 1B6SA 2GCGA 2NAPA 4LCEA 2HZBA 3MAJA 1R9JA 4QUBA 4W1SA 3RSOA 2GMWA 4S1NA 4EYSA 2D0IA 4XIJA 1S3SA 3WBFA 2IIVA 1J23A 4G67A 3WOHA 4B2LA 5AVUA 1TT5A 1WZCA 5K5EA 5AO9A 2JLBA 4PG5A 1GCGA 2IYAA 2EFJA 1C1YA 1QFMA 1QAOA 3W6OA 3QVOA 3OOSA 4UUOA 6PFKA 1PJCA 1XQXA 1PL0A 1V8OA 1LBIA 3A26A 1TCBA 1GTRA 1L7PA 3PDIA 3PZRA 2P65A 2PRKA 1ADYA 3TUZC 1ELOA 2E4YA 3PNVA 4LVUA 1CJSA 3TZQA 1Q7BA 1JGTA 2Y0DA 4DMLA 1QX3A 5AK4A 3KETA 5KYYA 1KDOA 3QEJA 3TKLA 3P0IA 3LC0A 3H2ZA 5C7OO 2BGNA 3IV9A 5J23A 1ACLA 1P17A 2AN1A 2XUFA 3AEKA 5HUQA 3W9BA 1Q2XA 4ZZ2A 1LSSA 4E21A 5JXIA 3KQUA 1V9LA 2G9QA 4E3WA 4L22A 1I3MA 1O5IA 3D0RA 2JK1A 3I3SR 3A4LA 4TWRA 4IS2A 1KFCB 4BWVA 1MX9A 3F2VA 1FNCA 3HVIA 3F96A 3VO8A 1A8QA 2IE8A 3TD2A 5FL7A 1M8JA 1YZUA 4HG2A 3U1VA 1U3TA 1BVYF 4IXTA 5LMUB 3QEAZ 4ZVUA 4JR1A 3QBDA 3MTGA 1NVVQ 4FFPA 3MQ4A 2FE1A 3FPGA 2FSHA 3T52A 4DLLA 4L8WB 2G1AA 4MVWA 5TF4A 5KQRA 3PLAE 3C1TA 5LZ4A 4I1OA 1IHDA 1FW6A 5ED4A 2L69A 5IYZA 3C41J 3I1JA 3OETA 4WKPA 2YVKA 3CZ9A 2ZEJA 4CWAA 1GJRA 3PFKA 3CR3C 4U3JA 5C9ZA 4M0CA 4ZO8A 2EDCA 1MA3A 2IYXA 5CLHA 1P7CA 3PDUA 3D6FA 4DLYA 2G9NA 1UBLS 1LA2A 4DJAA 1KRXA 3KOZA 2V5UA 2IZ1A 3FDXA 3NH9A 3A32A 3OD1A 2HAEA 3SEAA 4ZI3A 1FFSA 5EJ8A 4H77A 3GXBA 1MJGM 5EMKA 4F4IA 2IFTA 2PV0A 3VR2D 1NPYA 4RPHA 1BWRA 4Q9LA 2NO7A 4QNMA 4EHDA 3NIGB 3VVMA 4AQDA 1IN4A 1XC7A 1GN9A 3QPDA 1IWOA 3U3ZA 2V7QA 5DB4A 4COKA 3ZNNA 1EP9A 1GPWB 1IJBA 1TU4A 3O8DA 4N5HX 3RUAA 2OO5C 2AFHA 4YJ3F 4W7IA 1VLQA 2P9QA 5JRDS 2FR8C 4DA9A 4EI2A 1W30A 1ZJ4A 1ZHFA 2JCVA 2FU5C 2IW3A 3OSUA 3OAAA 4M0LA 4WCVA 3VJLA 3SF8A 3ZLTA 1EX6A 1H3NA 1TKRA 3EIXA 3UANA 1NYQA 2ZVDA 5L6LB 4ICIA 2G83A 5EJ7A 3ZQJA 2A4MA 2XQVA 1INLA 1UADA 4WCDA 5JATA 2CFOA 2Q8QA 4AIIA 2XGSA 2WJHA 3ZXXA 1QPGA 4AP5A 1N2HA 1YCGA 4Q1BA 4W99A 2BR5A 2EZUA 4RV4A 1MUUA 2CXUA 2V58A 2XITA 4L4UA 2Q5IA 4Q7QA 5F35A 2OV6A 5F73A 1NKVA 1PGNA 4IDPA 1TLLA 1V1MB 2W2OA 4XW2A 3MCWA 1T8TA 5SZKB 2C7GA 3V1TC 4ZAFA 3QLJA 1VYUA 5MGBA 1E63A 3LC1O 3KOMA 4PX3A 3Q8LA 2X5NA 4M55A 2C8JA 1REQA 5C80A 3UG6A 2G09A 3AP2A 2JD0A 3AF0A 1LQ2A 3F4LA 3MAGA 5EMHA 3WE7A 3P0FA 4JYCA 4ILEA 1KBOA 1X92A 1W5AA 2QTMA 4DKXA 1BXZA 1GPAA 3B3GA 1Z4KA 1OX6A 3K1ZA 3NRBA 4QRIA 4ZOQI 3L1UA 5KYGA 4B3SB 3EEIA 5K3CA 2VBCA 2RH9B 2FWJA 3A11A 4WI1A 3FWHA 2NVOA 4EH1A 1KVQA 1Y7PA 2J67A 4Z2YA 1C0IA 1LI4A 4GLFA 1Q91A 4S12A 4WACA 4X20B 4PCLA 4DIEA 5JECA 3AEYA 1ZN8A 3SNHA 2C9BA 1SC3A 3AW8A 3AL2A 4OQLA 2CJWA 1Z0FA 2VT6A 2GBIA 5K8VA 1VI5A 1IJEA 3EQ7A 2AEMA 4QPJC 3U6KA 2BDUA 3T3IA 3IP7A 1HE3A 1MC8A 5BWNA 1HLDA 4DGSA 4NFLA 2PH1A 5JJBA 4ND8A 1QFXA 4CL2A 1JI0A 3ZZUA 2V97A 1VLHA 1EK5A 1Y8CA 4TKMA 1B74A 4PC3A 4P1ZA 5JS2A 3FR7A 4QSMA 3EWAA 3BL8A 4W8HA 5CA0B 1XEAA 3B8HA 4K9OA 1J70A 1NATA 4LF5B 2C03A 1JBEA 2SCUA 1QG2A 3HXTA 3K20A 1TFUA 4HPWA 4P4UA 1YRBA 4RESA 3DBHB 3IO5A 3MMNA 4JQYA 4D25A 4FWIB 1P39A 2H3HA 1SIUA 5I48A 3FIJA 1NXQA 4AJNA 4D74A 4KO2S 2WYIA 5IBCA 1B76A 3LCVB 1GZ5A 2ZSFA 2DHCA 3PGMA 4D1YA 4CQNA 2IHNA 3VAAA 3BKWA 5LNK6 2QMUA 3QF4B 1SCUA 4NPCA 1OFGA 4FGZA 1X3LA 3UWOA 2BGIA 4TVKA 2BZ1A 3E35A 4YAWA 1AV6A 1DGQA 4WUVA 4JC4A 1PZGA 3T5BA 4Q3BA 1I3KA 3KRTA 4X00A 4F93B 4MROA 3VTFA 5EWJB 3QVVA 4AD8A 2C77A 2V96A 3GYBA 2Q5OA 4X97A 5K01A 1H0SA 1E2LA 4IQ0A 1KNXA 3OCUA 1PT8A 3N2YA 4KPUA 3UC5A 5ARBA 2I1WA 2QJOA 4AJIA 3CCBA 4UUPA 1M34A 5AM4A 3Q9SA 2RD2A 3CS3A 2ZIAA 3FPLA 3ORQA 2AKYA 2OAEA 3MCAA 3LLCA 4QJ4A 4B3GA 2OZLA 4BJ1A 1V5EA 1T0PA 2AEEA 2GS9A 3G02A 3NBMA 3FSRA 2YHBA 3ROZA 4FJ1A 4QU8A 1CS4C 3STUA 3EEYA 1FRFS 1R0BA 4C2TA 3SHTA 1CY2A 4UUMA 4O3MA 4EPYA 4DG5A 2JH9A 4B40A 4HTFB 3C6YA 3WV4A 2FZ4A 1WCV1 1VJTA 3EMDA 1FQJA 3OM8A 5E6SB 5B12A 4RHEA 2QN1A 4EUKA 3W34A 3KQMA 3PUHA 4GBED 2O5RA 2VATA 3BXPA 2JCSA 4YNBA 4BKQA 2ZPTX 3DGEC 1T43A 3NEAA 2D1FA 2EQAA 1U3UA 3A25A 4K9KA 2VNJA 3CJRA 4YDQA 3O3CA 1PFWA 5EPOA 1FYDA 5BV7A 1DJMA 3QSYA 2B35A 4LJ4A 8ATCA 1E79A 1PT9A 4DZRA 1WVMA 3E7DA 3GA0A 2ZXFA 1LI5A 3H1EA 4E5KA 2J5QA 4GYJA 1RXSA 4S1TA 4U7HA 5KQPA 3UWPA 2BEJA 1FCJA 3FF4A 4HFMA 4HPJB 5JD6A 1TM2A 5GWXA 2GEFA 3B3AA 4IZHA 1VA5A 3EPJA 4YUZA 2PZMA 1HZJA 4B1FA 2VDKB 1M33A 3V42A 3W6UA 3ZGOA 1IUKA 5EKDA 4PYJA 5A0FA 3R8CA 5EFZA 3M0EA 1KP3A 3NBFA 4DV0B 5AUOB 3P4UA 1NJ8A 5GJBA 1T5SA 2A1IA 4D4HA 3SJCA 1TQDA 5LA6B 4PPNA 2XOKA 4IM7A 1NW5A 4CM4B 3GLHB 3RYIB 1JLRA 4OHKA 3X3HA 3T1YB 4B3MB 1B42A 2AF4C 2RGWA 4QHSA 3KJFA 3DUFB 2VUUA 2Q07A 2G9ZA 3VYUB 3RVOA 1E0SA 2CHGA 1E9BA 1KC1A 2E82A 1JAYA 2GZ3A 2NXWA 4YACA 5I9LA 2KSQA 3QPBA 1B8VA 3G79A 4RXMA 1OR8A 5DNEA 1PU2A 1HZZC 1Z2EA 3H99A 3SBEA 1V6CA 3FHJA 1H6BA 1YVRA 2IGTA 4KGVA 4AZ3A 1PKXA 2I4LA 5B4TA 4YCDA 2SBTA 2B20A 3R3XA 4H4CA 4MWCA 2AR0A 3H6KA 4HQNA 5ESRA 4YMIA 5ELLA 1BHQ1 3CIOA 3WAKA 3PWTA 3RG8A 1ORDA 4QTXA 1GFZA 5I01A 1YV9A 1C8LA 2CNBA 2FCRA 4TKVB 5H5JA 3RQIA 3JYNA 1TGVA 1HY3A 5DCYA 4AXXA 2FH5B 2ADFA 4ID3A 4Q9AA 4D8XA 2GEBA 4PYQA 1H69A 1SK9A 5IDWA 1SUWA 2XB4A 1RAHA 3DAHA 2J5BA 3U6BA 1O57A 1VJCA 3NS7A 3QLEA 2AOUA 1IUPA 4BO2A 5I4IA 4R5MA 3SU8A 3JWPA 4KL8S 2JVKA 1DE0A 2H1HA 2R60A 4BNDA 3L93A 2EOAA 4FDLA 3WK7A 1RWBA 4LSWA 1BX3A 1XVVA 2YVQA 5NULA 1D2HA 4BQIA 1NMEA 2I1QA 1YDEA 5C8DA 4S1VA 3U3MA 3H65A 1FSPA 2BCGY 3PRKE 4DSTA 3IIIA 2AH5A 3NYQA 3HCOA 4LAFA 3OA2A 4UHHA 1GKUB 2XZTA 4CCWA 4BASA 4L51A 4URXR 2IIQA 4BB9A 4U7GA 1NNLA 2QUAA 2FRVA 3H2KA 4QO7A 2PYIA 5F98A 1PTJC 2YVUA 2W2VA 5DGTA 5IRCD 2NU9A 2GN8A 3B5IA 3P0HA 3V55A 1OX5A 2O2ZA 2RKBA 2V55B 2H31A 3LT1A 4P82A 5HA5A 3T54A 1XRNA 3SEQA 3STHA 1C14A 1ZNQO 5ERXA 4CE6A 4XYLA 1XZBA 4RF2A 4O2BB 4CG1A 5JH7B 2RHTA 2R4UA 2B30A 3BIOA 3KR2A 1IJFA 2Z83A 3Q2KA 1EGAA 1UC9A 2WE7A 4WOPA 2P2LA 5IHXA 3TQTA 2IXDA 3P27A 1WMDA 2BFEB 3NBUA 4MJLA 4ZT3A 2O2IA 1NXTA 3O4GA 3IB6A 1GTVA 1JAZA 3NHJA 3KAKA 4ARZB 5HK9A 5KTOA 4IJ5A 3VV3A 1HQYE 4XM2A 2XLCA 1R64A 1QLWA 1J0CA 3FVTA 1BRMA 1JP7A 1KZYC 3C3WA 5I8ZA 1TJNA 5C46F 2EHJA 1KRHA 2G77B 3BJRA 3TJZA 4W5RA 1FLDA 1M5RA 2F3QA 2WJZB 3ZDRA 3DT6A 4OU5A 1DTSA 3P9YA 3NHYA 4LNUB 1RQNA 2OBNA 5DI9A 3TLGB 3EZFA 1DMSA 2GF2A 3CVJA 2FSIA 4E5SA 2QHXA 3BB4A 4M7OA 2POQX 3ZWBA 1BW9B 3RDPA 2RGDA 2YL2A 3ADCA 4DEVA 4PLFA 5IM5A 1QONA 1MVNA 1VB3A 2ZRJA 4QOEA 5TR9A 4CT4B 1CRQA 5L3SA 4AULA 1NKTA 2VXCA 2DBYA 1J7KA 1SH7A 1K8QA 2OCXA 2Q7OE 3WBJA 4R8MA 5GZ3A 1YRAA 2D2VA 2XYQA 1NBOA 1D7OA 4IJVA 1NBMA 1DIAA 3RWOA 1SXJA 4JLVA 2BF4A 4MYCA 3TW8A 4LYDA 3HN7A 5F5XA 4URHA 2PJUA 1R6UA 3WADA 3ZCSA 1ZJJA 2RGGA 3PEFA 3WNQA 5HJ7A 3W5BA 1RHUA 1D6NA 5H02A 2WIAA 4AECA 3PJEA 5F7OA 1CZNA 3IOMA 4EM6A 2HD4A 2O5EA 1P6QA 3TINA 3ZQ6A 2PMFA 3OEHA 1IFXA 3CZRA 5KWSA 1WW2A 2A4KA 2F1KA 3DBLA 4OGWA 1ZRNA 2GXUA 4XB6B 5K2MA 3UUWA 4KWIA 2HWYA 3I5XA 1C1DA 3QU7A 1JFFB 3GUHA 3A14A 3PJFA 4F56A 2PZFA 5BQPA 3HRHA 4L74A 4M0PA 2FHSA 4CQMB 1XMVA 1H5UA 3OIYA 4L28A 4Z9FA 5J63A 1FP6A 4GH5A 1P5ZB 1FSSA 1G5QA 2W8BA 3QE3A 2FEOA 4MP6A 4WDQA 3N7AA 1N8SA 1DNPA 4PRZA 4F97A 1K7YA 2YS6A 1UEIA 3PR1A 3R6LA 1I3CA 4LXTA 3GRUA 1YKSA 1C81A 2ZUTA 3U09A 3DTNA 1KC3A 1ODKA 3BWCA 4KE6A 4MV0A 3FF1A 2Q6LA 4QC2A 3OCJA 1WU7A 1DB3A 1X13A 1WXXA 5HOQA 5HFNA 4DV4B 4EG6A 2Z8YA 2W71A 1R6BX 1TB4A 1UPBA 4B2PA 4OGGA 4RC9A 3P4XA 4JP3A 3ZCPA 1QO0D 2BGGA 3H4VA 4RNDB 2YUTA 4J0DA 1PSWA 3UB2A 1LRJA 2WMYA 2ZIFA 3LW7A 1WSAA 4B0OA 4PQGA 4YAEA 4YJ2F 4WK4B 3NJ4A 4XIIA 1Z2OX 2IPMA 2BMFA 1JLKA 2FE4A 5JD5A 4XYEA 4QOHA 4AAYA 5BQXA 3G9XA 3AR9A 4UZSA 4NCBA 1KJYA 4JU9A 2EX1A 4YXWD 1DADA 2J30A 2HV8A 3H6GA 1AZSC 3LX4A 5BW6B 2GA9A 4BLSA 1RNLA 1EWKA 4WZBB 2GHTA 4AP6A 3PNQA 1Z8NA 3OURA 4K86A 4O4JB 4OXIA 1RQPA 3HCEA 3T3DA 4EECA 4EHAA 3KUCA 2J3EA 2TMDA 3CJQA 3MWGA 5DRTA 3SG0A 1GQQA 4UAVA 2PX0A 4AN1A 1WL8A 3JQ9A 4BNNA 4C0JA 2F43A 2AXPA 2AXNA 3HUUA 4X63A 3K4HA 3RS4A 2G4LA 1IU9A 1PZEA 1IDOA 1MW8X 4ZHQB 3W5CA 2XTNA 4NATA 2GPTA 2JLSA 2R6GA 3DOIA 4GGMX 1BXRB 3DXFA 5JMWA 3MTAA 2GETA 2PSDA 3B12A 3FRHA 4CKCA 1DC4A 2CXNA 2OLKA 3R3ZA 3IBTA 5TXGA 4CL0A 1USWA 2H00A 3LQ1A 4RIGA 1C4XA 2UUPA 4A6EA 4D80A 4K1XA 1JLHA 3ME5A 1ZN9A 3AY0A 1F3OA 1QF7A 4LK3A 2WNSA 2J9FB 4L72A 3FNGA 1MRNA 2HDWA 5F2EA 5FLYA 4D41A 3EVEA 3FSEA 7ADHA 2GH1A 1JR2A 2QTRA 3RCBA 2NT4A 4JGIA 2QL5A 4CG2A 4HZGA 4MS1A 4R2WA 4JN6B 3DT8A 4XYBA 5TQVA 4J1TA 3T7TA 4D4IA 1GLNA 1AXEA 3QZUA 3HLKA 3F74A 3GCZA 3IGFA 4HXFB 4RNCA 3VR0A 1GFSA 3T5DA 4YRZA 1JIJA 2CFSA 4BKMA 2EKLA 2VDVE 5E4TA 2RG7A 3AUTA 4BVLA 4LHYA 1CEEA 3FI9A 3TVYA 4ZOLF 4IWYA 3NAGA 4TXJA 1LDGA 3IAUA 1IXZA 4UNNA 4MW1A 4PIVA 4HDAA 1CIJA 3GGSA 4Q4DA 1XZJA 2FUNB 2Y66A 4QDOA 4YCAA 4CRWB 3D8RA 3GNLA 5LSAA 3N2EA 4E5NA 3ZOKA 4YMTA 1YQUA 1J24A 1U28C 4MKHA 4MGEA 1TU3A 3BQMB 4YECA 3VC7A 1SC1A 3ELWA 2HBZA 3TTTA 2GO1A 5F9MA 2AX4A 3KJIA 3O26A 3W0LB 3R4CA 2JIQA 4RX1A 2CVPA 1KKMA 4G09A 4QJIA 1TPYA 1J97A 3HGQA 4PU0A 3WJ2A 5F2NA 2Q5HA 3G23A 3O8OA 1Y9DA 1ISIA 1ZH0A 2H0AA 3AM5A 3PYLA 1U90A 4I5FA 2OGWA 4YV7A 4UEKA 3PVZA 3HWRA 4WDRA 5CT5A 4ES6A 3PC2A 4LIPD 1RBQA 2OQRA 2AR9A 3P20A 4JROA 1KYXA 5G0SA 1JQBA 5J1TB 2JLYA 1CR1A 1SOAA 4YRDA 1NUQA 1W4CA 3HU1A 2R4TA 5B6PA 1G19A 3M6IA 1K6EA 3IEUA 3IQWA 4JQOA 1CXZA 4Y9UA 5IX8A 4BBPA 1R8YA 4J3FA 1LV7A 5LYYA 3NBKA 5M5BA 1Y48E 4GT1A 1BMFD 2OBBA 5BVGB 4P6VF 3I6MA 1W4RA 3GA5A 3P45A 3ROPA 1WXEA 2NW6A 4RH0A 1ODCA 4ZAVA 3T61A 4UBMA 4B7XA 2COKA 3UVEA 1JR3A 1KBQA