4J3FA

Crystal structure of fabi from f. tularensis in complex with novel inhibitors based on the benzimidazole scaffold.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
259
structure length
259
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structural and biological evaluation of a novel series of benzimidazole inhibitors of Francisella tularensis enoyl-ACP reductase (FabI).
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 88
structure length 259
sequence length 259
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j3fA00
1P1HA 1YJQA 3TQHA 2UV8A 4JP2A 2JL1A 4Q3NA 2ZB3A 3OQ6A 1NPDA 4IS3A 4XD2A 3VKVA 2QW8A 3N74A 1NQOA 1ZXLA 4BS9A 5CDYA 3V1TC 4OYRA 3JQFC 3RBXA 4HUJA 5IFLA 5HTOA 3GNQA 4P38A 3UFXA 1DRVA 3FWZA 2X7HA 4L74A 3DMYA 1D4FA 1JW9B 1I33A 4A27A 1ZKMA 2VRBA 1HDCA 1O5IA 4TMFA 3SBOA 3ZU3A 4BNXA 4NPCA 4HFRA 1PR3A 1U3WA 1K0UA 1YB5A 3H8VA 4FJ2A 4E2ZA 5TT0A 2PY6A 2WYVA 4D45A 3ZWXA 4BO4A 8ADHA 1UJMA 2W2KB 4CL3A 3JSAA 1R0LA 4IMRA 4UVGA 4I1IA 1ZIDA 1EE9A 3IJPA 5ILOA 5JLAA 4C4OA 3DWFA 1XQ1A 4E13A 3GG2A 3DBHB 3DR3A 1TEHA 2QQ5A 4RO0A 5IN5A 1ZZEA 3ZWCA 3JQ9A 4DMMA 5JS6A 1Q0QA 3MTJA 3ZHZA 1PWXA 2HRBA 2PKQO 2C29D 3DTTA 3AOEC 4BVAA 4KQXA 3W1VA 5F5NA 5U1PA 4HXYA 5TIIA 5ILGA 4RPKA 5T8KC 1DC4A 2J5QA 3FNGA 2NTJA 2XXBA 4I5DA 4ZJUA 4BNWA 3GH3A 4IQ0A 1C1XB 1YGYA 2AHRA 2WMDA 3KO8A 1UAYA 2AXQA 4JXKA 3ABIA 1CRWG 4L8VA 3S2FA 1LDMA 3MJEA 3DXFA 4PG6A 5EIOA 5KVCA 5B4TA 1BXGB 1VJ0A 2Y99A 4E2YA 1NYTA 1UDBA 3K2EA 1I01A 1XR3A 4IQGA 3ZHXA 4RJTA 3D4NA 1FDWA 1SMKA 5LCXA 2ZCVA 5F21A 4TRNA 3HB5X 2H63A 2Z95A 3ETEA 5CEEA 1O8CA 3LLSA 4OSPA 3SEFA 1LUAA 2DUWA 2CDCA 4LW8A 5T64A 2EERA 3OJEA 4I8XA 4MVJI 4W7IA 3VPFA 4H7PA 2AQKA 2VOJA 4BGIA 1H9AA 2WDZA 5A4DA 5GZ6A 2OP0A 4E30A 4U8GA 3PTZA 2VWGA 4RPHA 4UEOA 4YJDA 1MLDA 1H6AA 2YW9A 1PJ2A 4K28A 2E37A 4KUEA 4Z6KA 1HF3A 1U9JA 3GVIA 1X13A 5CDSA 3NEPX 5TJHA 4WJZA 3ZWMA 1I2CA 4HNGA 1PGQA 2J5RA 1B26A 3E9QA 4CM7A 4CMCA 1C0LA 3OETA 4U5QA 1DJNA 4B4VA 3A9WA 1U5CA 5JC1A 1BW9B 2UYYA 1NVGA 4XJSA 1EUCA 4I9NA 1X14A 3MJCA 3WJAA 3IJRA 2AEMA 3QVTA 1HRDA 3VH2A 3KYDB 3VZQA 3QVSA 4LN1A 4OH1A 1TB4A 4L4SA 4XYGA 4BGEA 2C82A 3IL2A 4B8ZA 2NU9A 2E82A 3G0OA 2NU8A 1GY8A 2UDPA 1X0VA 2X0RA 3GEDA 4OO3A 4BO8A 1UXIA 2WD7B 3ROKA 4J3FA 4WLFA 4QFDA 3PQFA 1WXDA 4AJ1A 1U2DA 3C1OA 5EQDA 3VC7A 5G0TA 4TZKA 3GFGA 3GAFA 1N1GA 4NU5A 2Y1EA 4CM1A 4CV0A 4A73A 4J9VA 4GI2A 2AQIA 2BH9A 1NXQA 3RU7A 3GK3A 1VSVA 4OGWA 3IOYA 4ALMA 1VRWA 2ZTVA 3H2SA 4XA8A 2FMUA 5HS6A 1U3VA 2CF5A 1ZMOA 1CEQA 3KYBA 3BA1A 3D4OA 3BTVA 1VI2A 3X2EA 3NJ8A 3OSUA 3UHAA 1UUFA 4QUKA 4G2NA 3DZJA 3PVZA 1ZO8A 3ROMA 2ZQYA 4Z9YA 1GCUA 1TI7A 1HETA 2VHXA 4KQWA 2Y0CA 1DLJA 3FR8A 4RZHA 5IDYA 3MWEB 4CMIB 5JNLA 4WLVA 2X23A 4TZTA 1UAGA 1Y8RA 3O8QA 3IP3A 4L75A 1WP4A 2BI8A 2YFHA 1WLYA 2QYTA 2B83A 3ANLA 2CY0A 3EW7A 4BNMA 5JW6A 2B37A 4UVHA 1GCOA 2HK9A 2YV2A 3T7CA 4CM6A 5J23A 3TZKA 4A26A 3I9MA 4E5MA 2PFGA 4OXNA 2B4QA 2Z5LA 1DIAA 2QYSA 1EEHA 5L40A 1O6ZA 9LDTA 1PQUA 2RHCA 4BHTA 5ITWA 4E5NA 1ISFA 1K3TA 4W9NC 1G0NA 2NTNA 1HXHA 3KVOA 4CLHA 1I8TA 4CM4B 1XHLA 3WYEA 2VUSA 3ZNOA 3OIDA 2VQ3A 4D0RA 3VH4A 4EITA 1XLTA 3LLVA 2Q1WA 1HE5A 3CIFA 3Q9NA 1P9LA 1YDEA 5TT1A 3FN4A 2IRWA 3BTOA 1X15A 2VTEA 3DZBA 5L4LA 4CQMA 5LDHA 3T4EA 4OSOA 4YPOA 3F6YA 3CKYA 1E7WA 2B5VA 3WGQA 2EV9A 2X1HA 1LDEA 1SBYA 4E5KA 4TWRA 1E6UA 1UH5A 2LDXA 3JQ8A 1ORRA 1KEPA 5JSFA 5GZ1A 4J4HA 1OI7A 4R68A 5KKAA 1IYZA 2OUIA 4MVJP 3I1JA 3E03A 3O38A 5K6AA 2VHVA 3GVXA 3NDJA 4HFNA 4UREA 4GX2A 3OMLA 1V3TA 4HP8A 4AICA 3AWDA 1G6KA 3L07A 3E9MA 1SOVA 3W6ZA 1AUPA 2EF1A 2ET6A 3V5NA 2PR2A 1R4MA 1K2WA 1I2BA 2R6JA 4U0JA 3WSWA 2R00A 5CDUA 3LT2A 4K26A 1ARZA 1N9GA 1ADCA 5EJ2A 3K31A 4CR6A 3F9IA 3P19A 1UZLA 1HSZA 1WDLA 1VKNA 5BSGA 1Z82A 1LXCA 4YACA 2GUGA 4XQCA 3B20A 4O6VA 2X22A 3MOIA 1P0FA 3LC7O 2Z1MA 3R3JA 5JXWA 1IPFA 4KWHA 3VZSA 1I2ZA 5F1KA 4IGEA 2PV7A 1H94A 3H9UA 1PJQA 1BDBA 1QKIA 2GN9A 3OQ1A 4ALLA 4RF2A 3VHRA 2I3AA 5I9LA 3FHLA 1AN9A 4J7XA 4B7CA 1H93A 4ZQFA 3PFWO 2I6TA 4BNIA 2OMEA 1TA4A 4HY3A 4J49A 4LSWA 1VKOA 4CV1A 4N5MA 4GKVA 4ROSA 4CQLB 2CNBA 4IY1A 4MKZA 2C7VA 3P2YA 6ADHA 2NSDA 1B8VA 3WG9A 5KJEA 4W99A 3KZVA 3V2UA 4YRBA 4CLOB 2P9GA 4PLCA 3JYLA 3TFOA 1Y1PA 1YL5A 4GAEA 3K96A 3DFUA 1FDVA 5JMWA 2E48A 5A06A 3KUXA 1WDMA 2IODA 4ALKA 2WJPA 4RF5A 4BNJA 1ONNA 3LYLA 4PG5A 1B15A 1LSOA 4OM8A 1WVGA 2P4HX 4YWJA 3UCEA 3OF2A 2HMUA 5ADHA 1ZMTA 4A5OA 2A9FA 2ZJ1A 1GPJA 4JJGA 3B70A 1T25A 3PWKA 1A7KA 5BSEA 3BXXA 4BO1A 2BI7A 1EQ2A 2NWQA 4IGFA 3KXDA 4CUKA 1DLIA 1I32A 2EW8A 1ISJA 3VTZA 2EP5A 4O5OA 3KLMX 3F3SA 1HDYA 3H9JA 4WOKA 4KUGA 3U49A 2A94A 4LMPA 1R4NB 1EQUA 3V1YA 1JTVA 1K5HA 3WMXA 5IG2A 5FFFA 3FSRA 3R3SA 4IM7A 3AOGA 1KVRA 1JAYA 5DBIA 2GN6A 3HE3A 3ZW8A 2FR8A 2Y68A 4J1QA 1RM3A 2C5AA 2ZATA 4E6PA 4R9RA 1I30A 4W6ZA 2QZZA 3WR5A 1QYVA 2O23A 3ANMA 1KETA 1MXHA 7ADHA 5F1OA 3U5TA 1W73A 3PLNA 3TPCA 3F47A 1ZK0A 1C14A 4NFYA 5IF3A 4M87A 3LK7A 1X7DA 1DEHA 1PJ3A 4KZPA 4DUPA 4XGNA 1PJLA 1K6XA 2QIOA 4Q3DA 1OMOA 4WK6A 3ZV5A 3ZWNA 4RZIA 4BNYA 3AY7A 1VE9A 4ZRNA 1KEWA 1UZNA 3WGOA 3D3WA 2P5YA 1E3EA 4O63O 1A72A 2XXJA 1A4IA 1PJTA 1IPEA 3OQBA 4KOAA 2Q46A 2BELA 4ZICA 2NACA 3ICCA 1GEGA 4DGSA 5KKCA 3RUEA 3WNQA 3NT4A 4IJUA 3IKVA 4BNNA 4NI5A 4KTVE 3RKRA 2D3TA 1SB8A 3PWSA 4E5YA 1B8UA 3NTOA 4MKXA 2UVDA 2ZJ0A 4WCFA 3RQSA 3QWFA 3PYLA 3CH6A 3RBZA 3ZV3A 3Q0EA 1E6WA 4CMKA 4YTEA 3ZWOA 1T2EA 3MTGA 3Q3CA 4K1LA 1LJ8A 3TJRA 5JYEA 4DWVA 1ULUA 2FR1A 5JYDA 1ZJZA 2C2YA 1DFIA 3GN2A 2Q2WA 2V65A 1IY8A 4ZGWA 1RM4A 3ZZNA 1N8KA 3JQBC 2P2SA 2EGHA 3PHJA 4FOSA 5ER6A 3A06A 4HNHA 3DL2A 4YJHB 1GPDG 1HKUA 3AUSA 3FWNA 4ND5A 3WTBA 3RSHA 3RU9A 3AI2A 1M75A 2CVOA 2PKQP 3WGYA 2FR0A 2W2LD 4CUJA 3JD2A 4HADA 1LLDA 3JQ7A 1ADFA 5A1TA 3AU8A 4J7UA 1RYDA 1E3SA 3ADPA 2ZB8A 4ZVVA 3BMCB 2Y05A 3DZIA 4FOOA 4G5HA 4AJPA 1YL7A 4DIFA 1HLDA 1JQBA 1NAHA 1MXFA 4AJ2A 1X1TA 3L9XA 4PFJA 1LLUA 3VAZA 3ONDA 1BMDA 2P68A 3HQ4O 2QRJA 1I0ZA 1V8BA 2D1YA 3QW2A 3DBRA 3P2OA 5TNXA 5L7WA 3E5MA 3WIDA 4Q9NA 1EFKA 4MKRA 1U8FO 1PQPA 1SOWA 2J8ZA 2AMFA 4NJMB 3OJOA 4CLDA 1QR6A 1YQDA 1C0KA 3KRTA 1D3AA 4JX8A 4D46A 1KY5A 1VJTA 5A9SA 1ISGA 2AW5A 3ZDFA 4HFJA 3ZWAA 5CG2A 1PJBA 3WYBA 4RVSA 1CWUA 2G5CA 3ZI0A 1VL8A 2BKAA 4TSKA 3DBVO 2G76A 4EW6A 4AJLA 2PH5A 3A1NA 3TZCA 1U1IA 4D43A 1ML3A 3WFIA 4DVJA 4WKGA 1LA2A 1I3MA 1VC2A 1I24A 1N5DA 5JY1A 1QV7A 1ZCJA 2TMGA 2IDZA 1E7RA 1YONA 5BQFA 1Y8QB 3AUAA 3FRJA 2Y1OA 2I67A 1ZEMA 3BMOA 3U09A 1DOHA 4JJFA 2JFGA 3G3EA 4LCJA 3GVHA 1WZIA 2PGDA 4NDNE 3UCFA 2VYVA 4PLZA 2VHZA 4BB5A 5CDGA 1E3JA 1MFPA 4YJFB 5G4LA 1WNTA 1SPXA 3EGOA 4OHUA 4RORA 3GA0A 2Q49A 1ZBQA 2IZ1A 1UXKA 4W4TA 3RFVA 1KVUA 1WZEA 3JD1A 1NFFA 1RWBA 2PK3A 3K92A 1P77A 5IJZA 3BMNB 4WPGA 4D7AA 1YO6A 1T1SA 4WLEA 4BO0A 1PJSA 1E0DA 3CPSA 3JD3A 2I99A 3FF4A 4J1NA 2P4QA 5JC8A 5JCXA 4J0EA 5JO9A 1BHSA 3AU9A 2C5EA 1TLTA 4CJXA 4E32A 5CEJA 1ZK3A 4ZD6A 2DPGA 4YEDA 3HDJA 3JQGB 1FXSA 1EE2A 4A03A 1GAEO 1RKXA 3FI9A 1W8DA 3GGPA 3DOJA 3ETGA 4D3SA 1P3DA 2HK7A 2BFOA 4BQPA 1P1JA 1L7EA 3VKUA 1ISIA 1YH3A 3JQAA 5EL0A 5GY7A 1KS9A 2G17A 2GF2A 3VOSA 2J3JA 3H9GA 3JTMA 5FEUA 3W8EA 3PJGA 3OH8A 2WSBA 4R54A 1NR1A 3HADA 4Y6RA 5A05A 1T26A 2D8AA 4TVOA 3NX4A 4I5GA 1B3BA 2YV3A 4IINA 4LMRA 1L7DA 2I5PO 5I9MA 4HWKA 1FMCA 1H5QA 3B1JA 3HJAA 3PIDA 1J6UA 4B4UA 4GLLA 4UVDA 4MVJD 3KM0A 1BXKA 3KBOA 4ND3A 4NFSA 2DT5A 1EUDA 4WEOA 1UZMA 4IIUA 1HWYA 2OXIA 4BO7A 4BNLA 3GHHA 2O50A 4MDHA 4Z9FA 1CF2O 1C3VA 4YT8A 4LVUA 2PZKA 4RCVA 5THQA 4LSMA 4CLRB 5DT9A 4YRAA 3ZNQA 4FN4A 5DP1A 2GASA 2DBRA 4FB5A 4Q3BA 3COSA 3GAZA 4WEQA 3VDQA 3SC6A 2VNAA 2IXAA 5TGDA 4O0LA 4CODB 1TT5A 1GYQA 4CR7A 4BNFA 4M55A 1DC3A 1V0JA 4J1SA 4CQMD 1HLPA 3GUYA 3K30A 5DP2A 1MC4A 3ZWYA 1IHYA 5CP8A 1JN0A 5CDTA 3A14A 2P9EA 4XDYA 2CD9A 3BTSA 1M67A 1SB9A 4PZDA 3T4XA 3PHIA 1S7CA 3GQVA 4ALIA 2IE0A 1PL6A 4RVGA 3U4IA 2NU7A 4M1QA 4D0SA 3RUIA 3Q11A 4H3VA 4RF4A 2AEFA 1NR7A 1HTBA 1H6CA 5A02A 3LC2O 1ADGA 1RPNA 3TOZA 4QFCA 5ER9A 3G49A 1N1EA 4DQVA 2DU8A 3JYPA 1QRRA 4GWGA 3JQ9C 3MWDB 3ZU4A 4WUVA 4II2A 5C5IA 2SCUA 1Y9EA 3NDIA 1O89A 1V9LA 3F46A 3SXPA 3JQ7B 2B4TO 3ORFA 1DRWA 4GSLA 3VDRA 2O48X 2ILTA 3OA0A 5HRUA 4EGFA 4JP3A 5IDQA 1U7HA 2X4GA 2X5KO 4N5LA 3IMFA 1SC6A 5JDIA 4I5EA 4R9SA 4BL5A 3L6OO 2GO1A 4D79A 1J4AA 4YJGA 4BMNA 3GEGA 4MOWA 3D0OA 3ITDA 1E6EA 5DCWA 4XRRA 2HK8A 3CINA 2NLOA 4H15A 4BGVA 3DBRB 1LEHA 1GV0A 5TSDA 4F3YA 2HMTA 1DPGA 1QYXA 4E2XA 1V35A 3W8DA 2O7QA 3C24A 4R3WA 2YHUA 5FF9A 2OZPA 4D41A 3BMQB 4YCAA 2X9VA 4M49A 4DLAA 1I3KA 4M86A 4CL8A 3GMDA 3PDUA 1KEUA 5I9NA 3RFTA 1O9BA 3RASA 1QYDA 3PIIA 2ZTMA 2W4QA 3DBLA 4MJLA 1KERA 1WDKA 4YQZA 4RLSA 2GLXA 1EK6A 2I65A 3TL3A 8LDHA 1DAPA 5BNIA 2EJWA 1CDOA 2O3QA 1TT7A 3JYOA 4PZCA 5ICSA 5G0VA 4CV2A 1DHRA 3PZBA 3NGLA 3OECA 4PLHA 4AJ4A 1ZJYA 1E5LA 2HLPA 4GMFA 4XB1A 1F8FA 3MJTA 2VYND 1JAXA 2Y66A 4J0FA 1LI4A 1IHXA 3CMCO 3GVCA 6LDHA 4NG5A 1NTOA 1NFQA 2CDAA 2CMDA 4KDEA 4GVXA 1DC6A 1N7HA 1QP8A 3UN1A 3ZWPA 4ALJA 1YOVB 4YXFA 1MUUA 1R0KA 3CSDA 2YHIB 3GFBA 3I3OA 5U4QA 4CLEA 3H2ZA 4WGGA 1XU9A 3O26A 2AE1A 2Y67A 4IDAA 3P7MA 3ON5A 4CM8B 4YDRA 3RC2A 2YUTA 1NP3A 3MCVA 1NBOA 4GQAA 4RPGA 1ZXBA 4MVJH 5H83A 2PGLA 2EJVA 3U9LA 3JQEA 3IUSA 3E9NA 4IPTA 2Q50A 2P5UA 2JD2A 2UUPA 3H65A 4CLXA 2C7GA 3I6IA 2VZ9A 1HZZA 3TZ6A 4XQGA 4MIYA 1GFSA 2DQ4A 3QV1A 3I9OA 4JNKA 5EQFA 2XAAA 2R2GA 3UF0A 4P4LA 3PQEA 3VVBA 5TJ9A 4NFHA 2NVUB 3PGJA 3BHIA 4ZA2A 1HSOA 2ZB7A 5JDCA 3SVTA 3CUKA 3K2BA 4IUYA 4N5NA 7MDHA 1Z45A 4BO2A 2C54A 5DOZA 5AXDA 5L3ZA 3PFFA 1O94A 1LBEA 1R15A 3JQCA 4DPLA 2GERA 4OL9A 1PZHA 4GWKA 3H5NA 3F4BA 4ZN6A 3IUPA 4MVJE 4GVLA 3PRJA 2J6IA 4XGIA 1PIWA 1A7AA 5B4UA 3TFQA 1X7HA 1BTOA 1BVUA 4DL9A 3NT2A 3AI3A 3EZYA 3PHHA 1EFLA 5T5QA 1EBFA 2BRUA 4YAEA 5MDHA 3QWHA 1ZUD1 3DZHA 4RL6A 3WB9A 1DHTA 1ZSYA 2HUNA 2OO5A 3ONFA 2FZWA 4E0BA 3VPGA 1IUKA 3EHEA 4WLUA 1PGOA 3NUGA 1XWFA 1DIGA 4M89A 4QQRA 3S1LA 4UAGA 4CM9A 2DC1A 5IZ4A 2EXXA 4MPDA 2NVBA 3DAFA 4F45A 3DONA 2C20A 3OHSX 2JCXA 4QEDA 3C85A 1IZ9A 5C7IO 1ENOA 5L51A 3CE6A 2GZ2A 5KVVA 2Q2VA 2PH3A 1NWHA 1HYEA 4IZHA 1IULA 1NX6A 1NVTA 4JBHA 1E1KA 4R4JA 2RAFA 4GL4A 5C37A 2NM0A 3RUFA 4R01A 2CDBA 3GZNA 2PNFA 4IDCA 3RI3A 2O4UX 2CUKA 3DMTC 1Y5RA 4JGBA 4I08A 1OFGA 3EUWA 2D5CA 2JD1A 1NWCA 3DMTA 1JKIA 2DFDA 5K6AC 4G65A 4KWIA 3FNFA 1LLCA 3GR6A 3K73O 5KWEA 4B4OA 4Z3KA 1HE4A 3E5RA 3HN7A 1IE3A 1IB6A 5GMOA 2Y1FA 4BNTA 1PGJA 3KOUA 1LSUA 2EW2A 3TF5A 4NBRA 5HA5A 1K6JA 1E7MA 1B14A 2R00C 4I9HA 2NQ8A 4CM3A 5T57A 1IZ0A 3ETDA 3FPCA 4YQYA 4FC7A 1SAYA 3ZWBA 3HHPA 5JO0A 1GUZA 3ZW9A 4FJ0A 4JIGA 3FR7A 4UEJA 1BWSA 1F14A 4BNKA 3UUWA 3B1FA 2DUUA 1FDUA 2OL4A 4XQ9A 2O3JA 3WQSB 2J5KA 4R1UA 3GC6A 4RF3A 1LLQA 1XYGA 4ALNA 3LDHA 5L95A 4GGOA 1JU9A 3F1LA 3NV9A 3EVNA 5F1PA 5AXCA 1DXYA 2RH8A 2Q1UA 3E8XA 1L1FA 4YVFA 4BO9A 4LRSB 2YDYA 3TWOA 4PRLA 1XIVA 2DBVO 4ND1A 1R12A 4PLVA 5BNTA 1HDXA 4IDFA 4XR4A 3GHYA 1QV6A 1U3UA 2X0JA 3ZU5A 1JWAB 4OQZA 1B16A 3HNPA 4J91A 4RVHA 4IDGA 3PHGA 1ONPA 4FFMA 3RKUA 1NQ5A 3GGOA 3M6IA 4NU6A 5DULA 4DIBA 4Y67A 4XB2A 3E48A 4S1VA 4U6QA 5DOVA 3HG7A 4E12A 4ILKA 1ZK1A 4C7KA 5EINA 3UGKA 1YE3A 1Q0HA 3UH1A 1PJ4A 5KVSA 2W8ZA 3VVCA 3RWBA 3MEQA 4IS2A 4GX1A 3EK2A 1UXHA 4BKOA 2ZTLA 1BG6A 1P44A 1Q7BA 5FYDA 2BMAA 1PGNA 3I6QA 4WLNA 5EESA 3RUAA 1O0SA 4FFOA 3OICA 1J0XO 5CPFA 4RLHA 1GQYA 3C7CB 3KLPX 1HL3A 3F1KA 1LX6A 4ZQHA 2HKIA 3K6JA 3OJFA 3AW9A 2A4KA 2HJSA 3ZWWA 3QLJA 4GGPA 4ID9A 1GZ4A 2J3KA 5JBIA 5I8ZA 2VUTA 3E1KA 4YT2A 4IXTA 2UAGA 2ZQZA 4DC1A 1GD1O 4BV8A 2WE7A 3KSUA 4L4XA 1P1FA 4FQ8A 1E3WA 2NADA 4D42A 3HB4X 1OOEA 2AQ8A 1LQTA 4MP8A 2XPCA 1E92A 1JWBB 5A3VA 2H5LA 4RV9A 4RPLA 1A27A 1T2CA 1QG6A 1YB4A 4EUFA 3LC1O 1D7OA 1RM5A 1U2GA 4GLOA 1KIFA 5G0SA 1W4ZA 3TNLA 4BO3A 2PD3A 1VLLA 5JY6A 4OMUA 3KEQA 3KYCA 3GDFA 4BMVA 3KSZO 4HBGA 3S2IA 2GDZA 2HAEA 3SC4A 4G81A 2Z1NA 2VHWA 1J49A 4XKJA 2FRDA 1S6YA 5G4KA 1U28A 1JKJA 5A3JA 3GT0A 2V7PA 4R3NA 3MJ4A 5AXBA 2GYYA 1PR9A 3DEYX 2WD8A 3WNVA 1DIRA 3CEAA 2D59A 3MOGA 1H6BA 5F5LA 5B12A 2GN4A 2RBEA 1C1DA 3ITKA 1KVQA 5KJCA 4INAA 1ZSVA 3UCXA 1YKFA 2ZYDA 4GX0A 3X2FA 2BD0A 2FY8A 1KC1A 4EBFA 3ZH2A 4Z0HO 4EZBA 2Q4EA 1QMGA 2P91A 3PYXA 4WCFC 3L6DA 1Y8RB 3O8QB 5A03A 4PVDA 2EKPA 4AJJA 5GZ3A 3W4JA 3OP4A 1XGKA 2PWZA 1FDSA 4ITUA 2BGKA 4LISA 2ZB4A 1E7SA 4F46A 2PZJA 4CMBA 4HV4A 2ZYGA 3WBBA 3H3JA 4PLPA 3DO5A 2GSDA 4MVJM 1F06A 4IZIA 2CFCA 1LRLA 3VH1A 3UXYA 3GUCA 2OOSA 4TQGA 2VWPA 4GPD1 5C3MA 5G2OA 5TQVA 3DB2A 4ND4A 1ZSNA 1Z74A 4FIZA 4FJ1A 1J5PA 3F5SA 4J6FA 5KJFA 3D5TA 4O1MA 3HZZA 2CZCA 3WQRA 4CMGA 5F3RA 4GKBA 3CTMA 4RVUA 4BO5A 5DCYA 3KSDO 1M66A 2EEZA 3D3EA 1Y5MA 3EAGA 1P74A 2WM3A 1R6DA 3Q6IA 1I36A 1NAIA 3NRCA 3WS7A 3PJFA 3HFSA 1P33A 3L9WA 1QYCA 3WGGA 5G0WA 1SZJG 4L73A 4R1NA 2EG9A 1YDWA 4PLFA 2VN8A 4LRTB 4XYMA 1EK5A 3JYQA 1KVSA 2OBNA 3SX2A 4CQMB 2W2KA 3I23A 5CAEA 1E5QA 1QXSA 3BTUA 4QECA 1YVEI 4FFRA 1TXGA 3AM4A 4A0SA 4LVCA 4PIVA 1BXZA 1ZNQO 3KTDA 2WE8A 3DBHA 3JQ8B 4BNVA 1KVTA 1JDJA 1UXJA 2VT2A 2VOEA 4J90A 5KNLA 3KB6A 1E77A 2WYWA 4XR9A 1CERA 4KDFA 4U6SA 4XYBA 2DKNA 1VM6A 4XCVA 4JBIA 1LDBA 3C1AA 4PCVA 3TZHA 4E4YA 1R4MB 3GPDG 1LDYA 1NHWA 1C1XA 5EERA 4DQUA 4UUPA 1H2HA 5TLSA 2OGUA 1N9GB 4XEHA 1BXGA 4OKIA 4UVIA 2CF6A 1PTJA 1Z7EA 4QO7A 4FW8A 4PGFA 3I9LA 4R16A 1HZJA 3C8MA 4L9RA 1PQWA 1OBFO 2H9IA 3GOHA 5JCJA 3N7UA 1AXEA 2FP4A 1U5AA 2NU6A 4E5PA 5EMHA 1W0CA 3O03A 5C7OO 3RD5A 4JN6B 5A9RA 3AJRA 3CZRA 4ZRMA 1H0KA 1DC5A 4Z9XA 1YJ8A 4P4NA 4AJEA 5MGBA 4FGWA 3E82A 4N7RA 1DBVO 1T24A 2F00A 4OJNA 1EVJA 5JAMA 4PVCA 5A5EA 3TDKA 1EZ4A 4J4BA 3NT5A 4JK3A 3RUDA 1EVYA 4I5FA 2BGLA 3DHEA 4NBUA 3QWIA 4XRGA 1VSUA 2NNLD 2GR9A 1H2BA 2VUUA 5CEFA 2I3GA 2PD6A 1BW9A 3AM3A 1I5RA 4RDIA 1GQ2A 5DZSA 1ZEJA 3BYZA 3ZWVA 3SJUA 2HRZA 1W6UA 1B2LA 3PK0A 3NGXA 4NIMA 1GDHA 3GMSA 4J16A 5CG1A 1PZFA 2WEKA 3I52A 3PLRA 3KYDA 3GRKA 1QSGA 4OIMA 1CJCA 1IL0A 1FDTA 2F1KA 3DC2A 4BB6A 4XJTA 3WFJA 3V2GA 3NJ4A 1LNQA 3W4KA 2WD7A 4XIYA 2HMWA 4YA6A 3M1LA 2FSVA 4ONEA 1UXGA 3I9JA 4URFA 1JKFA 5HM8A 4AJNA 1YBMA 3RUCA 3NAQA 1SNYA 3OIGA 4FDAA 1GYPA 2OFPA 2AQHA 3ENKA 2O3RA 3QA9A 4DRYA 2IEBA 5ICMA 3I5MA 4PRKA 1C0IA 1GU7A 1YL6A 1T2DA 1BVRA 2RIRA 5HBRA 3WGZA 2D2IA 3JQDA 3ZGYA 2X5JO 1LSSA 3OEWA 4B79A 2YJZA 2YYYA 5IAAA 3WSVA 1T4BA 3DZKA 3FD8A 3H5RA 5L7YA 1ZK4A 1LU9A 1HDZA 4J4TA 1DO8A 2VT3A 2JCVA 4CM5A 3CXRA 3DTYA 2POQX 2HMVA 4YT5A 3RIHA 3WIEA 3LQFA 5EPOA 1NQTA 3PWZA 1SEPA 3NYWA 4HFMA 1HE2A 3ROQA 4CMIA 2FPPA 1JA9A 2HMSA 3C7DB 4AJOA 4AJIA 4Z3DA 3B6ZA 1PZEA 1P45A 2PA3A 4RQUA 4BUCA 3VPXA 2QZ9A 3H4VA 2RH4A 3IC5A 5COAA 2Q1TA 2JFFA 3ROPA 3UKOA 1YBVA 1BDMA 3QJ5A 4MP6A 4Y6PA 5I7VA 4CM9D 4DREA 1RJWA 4E33A 4FSHA 3D3WB 3OA2A 3DQPA 4BNHA 1A4UA 3OJ0A 4DPMA 2FSSA 4NBWA 1DIHA 2CVQA 1LTHR 3AUTA 4NNJA 4E2WA 5A04A 4R1SA 4CM4A 3L4BA 2HCTA 1PS0A 3ENNA 4E31A 4B3JA 1PJCA 3D4PA 2O4CA 1VPDA 4EJ6A 4WCFB 4HKTA 3AI1A 5IZCC 1Y81A 1D1SA 3KHUA 3PJEA 4L76A 3K8ZA 4X54A 3U3XA 4CV3A 4A10A 1F8GA 4XX0A 4NK5A 5IZCA 1EDOA 3TOXA 4N54A 4R5HA 2BHLA 2OORA 3EYWA 1WMBA 4UVEA 2Q2QA 1MC5A 1OC2A 1XG5A 5BR7A 3QVXA 5IN4A 1C0PA 4EYEA 4CMEC 3JQFA 2YQ4A 4IBOA 5ENDA 1X7GA 4S3MA 3S8MA 3OM9A 4AVYA 4B8WA 4OOEA 4CMEA 2Q4BA 5U9CA 2X0NA 3E6AA 3LT4A 5DN9A 3RAJA 1LDGA 1DSSG 1RM0A 5LDGA 1HEUA 4B7UA 1ADBA 1VL0A 1XQ6A 5THKA 2YY7A 5JDIC 5L53A 2VRCA 2EIHA 1YBAA 1ULSA 1B7GO 3Q2KA 1NASA 1PU2A 2W2LA 3I9NA 3KV3O 2YDXA 1LRJA 3WLFA 2NTVA 3UVEA 1MG5A 1FJHA 1ZH8A 1MA0A 2C2XA 3G1TA 1V3VA 4FCCA 4MP3A 4GSKA 5KVQA 4UUNA 4YAIA 2JCYA 3D64A 3JD4A 3LT1A 4K6FA 3GF4A 5JFOA 1ZFNA 4TRJA 3T7EA 2P9CA 4DQXA 4YAGA 4Y6SA 4HX5A 4I9UA 5A9SB 2O2YA 1K6IA 1XA0A 5I8WA 1Z7BA 2Y0DA 3AOEA 3W8FA 3PJDA 4J2OA 1DFGA 4WNIA 5DDIP 3RVDA 2FZEA 3WICA 5T8KA 1GQQA 2PGJA 3W6UA 5C7LO 3OBBA 1XU7A 1GZ6A 1OZAA 2O2SA 3RROA 3W4IA 4RDHA 1B3RA 3HWRA 1YXMA 3QVOA 3QSGA 4J9UE 4QXMA 5A9TA 2XOXA 4CQLA 4K9DA 3TL2A 2C0CA 2JJYA 1I3LA 4YRDA 4CLOA 3QWAA 4Q3AA 3UICA 3GPIA 3L77A 2LDBA 5JPIA 3RC1A 3BMOB 3DHNA 1GYRA 1Q0LA 4U0KA 3QHAA 2Q3EA 3SJ7A 4AG3A 1A5ZA 3FNHA 1HDOA 3TSCA 3ST7A 1BSVA 4R1TA 3ANNA 3JQ6A 2BFPA 5FI3A 3LT0A 1LDNA 2H6EA 2VWHA 4NK4A 4R5MA 1ID1A 2Q99A 3DDNA 2EGGA 2A92A 4BKRA 5DNAA 4PG4A 1AE1A 4MIEA 1ZVMA 3EMKA 4IXWA 2I9PA 2E6UX 1HYHA 1GR0A 4ZU3A 1P31A 4NH4A 3RJ5A 4DXHA 3RJ9A 5H81A 2W98A 5I7EA 4NBTA 3QQPA 1HT0A 4DPKA 1PL7A 1M2WA 1EMDA 1M6HA 3GNTA 1R4NA 3GDGA 4TROA 1UDAA 3HUDA 2Y93A 5JDCC 1B0AA 3B1KA 2I76A 4BNGA 3AFMA 2DAPA 1PS8A 4BV9A 9LDBA 3NKLA 4AL4A 4ESOA 3JQAB 1DRUA 4P22A 5I7FA 2B35A 1T1RA 3R6DA 4GBJA 5BSHA 5KJ6A 1OAAA 3UOGA 3Q1LA 3PQDA 2X9NA 4YB8A 3GNSA 4Y8VA 1YRLA 2DTEA 1YWGO 2JAPA 4WNCA 4BQRA 3MJSA 2DTDA 4IDDA 2JKVA 3RUHA 3DHYA 1HDGO 2AA3A 2DBQA 2IZZA 1ZK2A 2VTDA 2X6TA 4WOJA 5CPBA 1N92A 2FOIA 3ZU2A 4QSMA 1X0XA 2FPGA 4TKLA 4Q3EA 1LC3A 2X86A 3OEYA 3AK4A 3GRPA 4KMSA 4QO8A 3LF2A 2YQ5A 3CZMA 3AFNA 5EN4A 3EDMA 5AYVA 2WWRA 1F17A 4XWYA 4MVJA 1PZGA 1E1NA 1GZ3A 3WTCA 1QLJA 1HYGA 3RFXA 5A5FA 3DZGA 4LGVA 3VPHA 3ZN2A 1CYDA 2AG5A 3WMWA 4CMJA 1U7TA 4YAKA 3L0DA 2HJRA 4FC6A 1MX3A 2HQ1A 2ZK7A 5LC1A 4YT4A 1PEDA 3R0IA 1K89A 3AY3A 3QY9A 4D44A 1TT5B 4E3ZA 4IDBA 3MJVA 4CMAA 4YJHA 4ZQBA 3VH3A 2IYOA 2A35A 4W9NA 1E1LA 4QTZA 4DYVA 5KIAA 2IYPA 4WASA 4OXKA 1LSJA 4NZ9A 1HE3A 4AJKA 1ZW1A 2X0IA 1YS4A 1AXGA 4OXYA 4U7WA 3MZ0A 4JJIA 1M6WA 4XZ3A 1T2FA 1GV1A 5K0ZA 3BMCA 1PGPA 2EP7A 1R0SA 2QRLA 3KEOA 2D5AA 4KP7A 3WX0A 4C7JA 4DLLA 3EY4A 3AY6A 1DDOA 3IIEA 5G0UA 5ITVA 3HFGA 3V1UA 1KBZA 1UP7A 4EJ0A 3JYNA 3U4CA 3HSKA 1NM5A 3FNEA 2NV6A 2RHRA 3NTRA 5HS4A 4B7XA 4NJMA 4JROA 4D3FA 4Y98A 1H6DA 2YFQA 2DFVA 2IXBA 1XDWA 2GZ1A 4IMPA 1CQJA 1E3LA 1BRMA 3O4RA 4LCEA 1BGVA 3M2TA 4OOFA 4F6CA 3U62A 3BIOA 3WGIA 5IXYA 1KYQA 5JCJD 5KJ1A 1MV8A 2HSDA 2QG4A 3ONEA 4XDZA 2V6BA 4CUZA 3WBFA 1SO8A 1E7YA 3DAGA 4PLGA 4YJGB 1QLHA 4PLWA 3ZV6A 3WDSA 2DPHA 4TRMA 5JAIA 5TF4A 3G79A 4F6LA 2VCYA 1Y8QA 5H82A 2VYVD 5AOVA 2AG8A 3BAZA 5L45A 2V6MA 3HDHA 4NR0A 4RGBA 1WAMA 3LZ6A 5FWNA 2YZ7A 4DLBA 3OIFA 1WW8A 3GDOA 4A7PA 1D8AA 1NPYA 1Y7TA 3A4VA 2PLAA 3H6KA 5CHEA 3Q9UA 1JLLA 3ICPA 4YJFA 2VNSA 2ZIZA 1N2SA 2BF7A 1T4DA 3DBLB 3QVWA 2BLLA 5AQ1A 5AXAA 4MO2A 4OAQA 2E49A 2Y1DA 3ASUA 1Y6JA 5JMPA 1FK8A 2D0IA 4BKUA 4ZQEA 2Q1SA 3BMNA 3ZV4A 3VZRA 3G1UA 2EKLA 2E4AA 2AE2A 4PLYA 1LRKA 4Z0PA 3EZLA 1GADO 4B3IA 2QX7A 3GEMA 3S2GA 4KUHA 3LF1A 3IP1A 5AVOA 3U0BA 3K9QO 4UUMA 1ONOA 3JQGA 1T2AA 1QORA 3JQAD 4E21A 3BHMA 5DF1A 4WLOA 3INGA 2Y1CA 2EKQA 3RC9A 4EEXA 4P4GA 1N7GA 3DFZA 2VYNA 3LVFO 3PHLA 5L4SA 5COBA 3TN7A 2DM6A 3OFSA 2DBZA 3U4HA 2OP1A 3HN2A 5DBGA 1YB1A 4M54A 5CFZA 4TVBA 3ASVA 1DB3A 2GGSA 3UAGA 4IQ8A 4FFNA 2B69A 4R41A 4FPXA 1I10A 2B4RO 4DIOA 4MVJF 1MGOA 1E3IA 1F0YA 4EDFA 1E7QA 3L6EA 1AHIA 1XELA 2JFHA 4NJOA 1R37A 2I66A 4IIVA 1JVBA 3F4LA 4PG7A 4FFLA 2EHDA 4XYEA 1KC3A 1WWKA 3QE3A 4AJHA 4DC0A 1KOLA 1H9BA 1NPTO 1TVEA 5I7SA 3V2HA 4FGSA 3WXBA 4W82A 5JAQA 3IAHA 3STHA 3WGHA 4BOYA 2J3HA 5BSFA 3H9EO 1WMAA 4EEZA 1UDCA 4Q3CA 2X5OA 4QX6A 2G82A 4L0QA 3ZCXA 1XEAA 4MIOA 4Y9DA 5KOIA 4FR5A 1CIVA 3M1AA 2NVWA 4FFPA 4JCOA 5KTKA 4CLRA 3AUUA 4RVFA 1EVZA 1LC0A 4A2CA 4PN3A 3V8BA 3ZHBA 4BGUA 2J3IA 2C59A 4JLWA 1GUYA 2D4AA 3PZRA 4WE3A 2JHGA 4M8SA 3JD0A 3FBGA 3GZ4A 1NFRA 1P0CA 1ENZA 3AM5A 3VZPA 1NQAO 2CSUA 2IZ0A 4BMSA 5L7TA 4NHEA 3GY0A 3HDQA 5DCUA 2ZYAA 4J43A 2WTBA 1Q2XA 4BNUA 4QT0A 4JBGA 5JE8A 1P1RA 1X1EA 5BT9A 4IDEA 1UP6A 4IJKA 4YBZA 5B1YA 4UUOA 4BNZA 2JHFA 2G0TA 2PZMA 3D1LA 2JD0A 4K6CA 3FTPA 3H7AA 4YR9A 2H1SA 2TMDA 2O3TA 2WYUA 4DBVO 4EUHA 3H5AA 1CQIA 3I4CA 5TS3A 5T6BA 1MFZA 3I83A 1ENYA 3INRA 1AHHA 4N18A 5L9AA 2VZ8A 3UW3A 2O3SA 3GZNB 1EUZA 2ZTUA 1GL3A 4R69A 4W7HA 1ISHA 4R51A 3GVPA 3JQBA 2DLDA 4DA9A 2BFAA 2VRCD 2VWQA 1UP4A 1JVSA 2X9GA 3GGGA 2B36A 1B8PA 1O95A 3CMMA 2NQTA 2PD4A 3SLGA 1PS9A 4II3A 4L4RA 4RPJA 2EWMA 2GCGA 4UEKA 3WWYA 3PGXA 2Q45A 1U4OA 3KETA 1MB4A 2QHXA 2V6FA 1DFHA 5IDXA 5T67A 2O7SA 4EI2A 3HDYA 1DAOA 1AGNA 3A28A 2X58A 3IS3A 4NQZA 3IDSA 5ES3A 2CVZA 5B4VA 1YQXA 1UR5A 2FWMX 3FBTA 5KCZA 2XF8A 2OBYA 1ENPA 2PZLA 4GH5A 5L4NA 2B0JA 3O9ZA 3PEFA 4DYDA 4PG8A 5TX7A 3WYCA 1Q1NA 3F5QA 4XYLA 1XCBA 4NBVA 3VTFA 5IXSA 2GZ3A 3BMQA 4Q39A 3C7AA 4EJMA 2O3UA 1MP0A 2YV1A 3M2PA 4EUEA 1VJ1A 5K9ZA 4BIIA 4XQEA 3VPSA 1SCUA 3I9KA 4IJWA 3RCBA 1G0OA 1EBUA 3GG9A 5JAZA 2HU2A 3E18A 4GX5A 3INTA 4WCDA 3WJ7A 3H3FA 1F12A 1G1AA 4J1TA 3WWZA 1PX0A 4PLTA 4ZQGA 4AFNA 3C3XA 3C1TA 4LK3A 4MINA 1Z73A 3WGTA 3RC7A 1GEEA 3OJLA 4BKQA 4J2HA 2GPTA 2Y0EA 2VZ0A 3WQQA 1U4SA 1NNUA 3BZUA 3TZQA 1E1MA 3U4DA 3ADOA 3FTNA 3QP9A 3ULKA 4XIJA 1YOVA 4XGKA 2C07A 3NDRA 4RVDA 4DTIA 2QRKA 2YHIA 2AEJA 3PXXA 1MG0A 3GN1A 4JQCA 2HO5A 5FI5A 3P5SA 1A9ZA 1NVMB 4CM8A 1XKQA 1D1TA 1GUFA 1GTMA 4NMHA 1QYWA 1EVIA 1DJQA 4BKPA 1Q7CA 1PWZA 3ZNNA 4YAJA 5DBFA 1DIBA 2DVMA 3FPLA 3EC7A 2ZKLA 1R16A 3IQDB 4TRRA 3D5QA 2Y1GA 1PSDA 3PI7A 4H16A 1M76A 3ZHYA 3DOCA 2FHSA 1A71A 3N58A 3G17A 3S55A 4MVJG 1HDRA 2NVUA 4OQYA 4D3DA 4FS3A 1SEVA 4OKNA 3PDJA 5B37A 4DBZA 2OHXA 3PYMA 1VL6A 3WOHA 2V6GA 3I4FA 4B3HA 1E3WB 1KEVA 4PZEA 3L4SO 1A9YA 3DOOA 5TC4A 2B5WA 3JV7A 4UULA 4P8RA 5ENVA 2RCYA 3S2EA 2ZCUA 3RBVA 1EDZA 1RYEA 1V6AA 2FPIA 1IOLA 3DZFA 4CR8A 1XSEA 4WECA 2W90A 5TRTA 2FN7A 4FBGA 3BHJA 1Y9AA 3K5PA 3LSYA 1U3TA 4B4WA 3KYCB 1U8XX 1Z75A 1R66A 1Q7GA 3GLQA 3NTQA 3QIVA 3Q2IA 2BGMA 3H9QA 3JCZA 3PP8A 4KTTE 5G4KB 3SLKA 3WLEA 2PKRA 3QRWA 2BFMA 1CETA 2DTXA 1PL8A 3LU1A 4CPDA 3TRIA 2IEDA 3D7LA 4O59O 3QWBA 2UUOA 4IJVA 1V3UA 2PTGA 2GD1O 1LQUA 2G1UA 4RQTA 2HDHA 2JAHA 1I3NA 3L4BC 1C1DB 1P1IA 4Z0TA 2X8LA 1YQGA 5HWSA 2VHYA 4YYZA 1KY4A 2GNAA 4GMGA 2NUAA 3DAPA 3IKTA 2GRAA 2GN8A 1P1KA 1FF9A 4FD3A 4ZHSA 3R1IA 4BO6A 1WPQA 5COQA 4CMHA 5IDWA 4TKMA 1ISMA 1NHGA 4DMLA 1OC4A 5BNFA 1Z6ZA 3EVTA 4J7CA 3PPIA 4ND2A 3FCOA 3ZNPA
chains in the Genus database with same CATH superfamily
1MAUA 1P1HA 4O4JA 1QGDA 2UV8A 4JP2A 1J2TA 4TLCA 3OQ6A 3VZDA 4XD2A 4XVQA 4MGIR 3I58A 3R7WB 4C01A 3N74A 1NQOA 1PBTA 1O5TA 5ESWA 2W70A 3COJA 2PMCA 1KYVA 2ATIA 1FQKA 3A9VA 1ABEA 1TC2A 1RI4A 4IIEA 1B0ZA 3PSHA 4P38A 2ZP1A 2RKWA 3GD7A 5HK8A 3AVYA 4BFVA 3DMYA 4Y2JA 5J2UB 3ZV7A 5KYWB 3PQ6A 1ZKMA 3ELUA 2NAFA 3SBOA 4KAAA 2XMSA 3VU3A 3QELA 4JI6B 3VR2D 4HFRA 1U3WA 1N3BA 2VPZA 2JBHA 2HNBA 3EIHA 4MA4A 5D7NA 1ZVKA 4D45A 3ZWXA 8ADHA 1IRXA 3SSAA 5IABA 3OOSA 1PSZA 1AQNA 5F52A 3FB4A 3LY5A 3IJPA 5ILOA 2DQSA 4JELA 2R1UA 3DWFA 1XQ1A 3FWYA 1EFUA 3WVNA 3KV1A 3F73A 4ES6A 1N5JA 3DBHB 3GEPA 3SI7A 1TEHA 3N05A 2DUNA 3LRXA 1P2BA 3AG5A 4MRSA 5GGYA 3T61A 2O8EA 3ZWCA 3OEEA 4CU5A 3MTJA 2P11A 3OPYI 4QYMA 2PKQO 4O2AB 3FDZA 3AB7A 4MGZR 8ABPA 4G1UC 3D6VA 1NVBA 1SUBA 4MQ4A 4U9IS 2R4UA 3NYQA 3N07A 4FYKA 1G3QA 1OFIA 3GCWA 2QTLA 5BW8A 3FNGA 4U2GA 2X9LA 4Z53A 4NOKA 5CBPA 3OCUA 5A4FS 2JJQA 2WT9A 1TA9A 2HGSA 3NPAA 3IXQA 4L8FA 3LL7A 5HBGA 4MW6A 3ABIA 2Z58A 1FP6A 1IBCA 1LDMA 2GETA 3KTOA 2QZPA 3SJAA 2QMZA 2XUKA 3W90A 1EU1A 3E2IA 5ALKA 3V4VB 5HGJA 4YCSA 4K9SA 3WL8A 1SK9A 2B0CA 3RTBA 3DD1A 3K2EA 4BRZA 3QE2A 3ZHXA 4RJTA 1JHAA 2V0GA 3JVDA 1FDWA 2TSYB 1RWNA 2FP4B 3BRWA 4Y9RA 1CEXA 3AHGA 2VC2B 1Z7GA 1JLSA 1S2MA 3SC2B 4KE7A 4Q1BA 3U7RA 3IRVA 2I9KA 2G04A 3OJEA 4I8XA 4BGIA 3VPFA 2AKEA 2VOJA 2X9QA 4LZLA 3GJ8A 1L7MA 3MCTA 4JUFA 4LE0A 3WIUA 4DJEC 2O8FA 5CVEA 1Y7LA 3O1JC 3PF8A 2VWGA 3GDWA 2R7MA 4YJDA 4C0BA 4BLTA 3AF6A 1Y4AE 2V7UA 3DYIA 1JEDA 5CLIA 1JFFB 3M6LA 3TZEA 5CFLA 2IEIA 1MOSA 3EXIA 4H0FA 5CDSA 1YHNA 4NQRA 1WSDA 5EQTA 3MW8A 3HGMA 5CBKA 4FLMA 2O1WA 1B26A 3E9QA 3VPAA 4OX9B 5KQRA 3HDGA 3RRXA 2R751 5JBQA 3PXDA 1R9MA 2QAGA 4TTPA 2CLEB 3A9WA 1U5CA 4HYEA 1HPLA 1SBHA 2UYYA 5DLDA 5B1SA 1R0YA 1I7QB 3IPXA 3LOPA 1X14A 3MJCA 5EHZA 2HV8A 2QBYA 4YMTA 3LTEA 4AY3A 5I9BA 3DCNA 3WWOA 3NM5A 4PFSA 1OJ7A 1TB4A 4OH1A 5J2TF 5AKKA 2QAJA 4TTRA 2BE9A 4DVGA 2OYCA 1L4EA 2E82A 2XUPA 3G0OA 3GEDA 1QFMA 5B3KA 2H18A 1UC4B 1Z07A 3BSFA 4PR0A 3Q7QA 3GEIA 2MYTA 1UXIA 5CK5A 2FSPA 2VDUE 4WLFA 1J7KA 4QFDA 2XIQA 4AO7A 3NDBB 5K01A 3LKBA 2E18A 1Y6GA 4REMA 3VC7A 5ETJA 5G0TA 4TZKA 2R66A 5DMXA 1J2YA 2XKBA 4G5FA 3T9EA 2H85A 1XE3A 2EFCB 3CKMA 4NU5A 4WNAA 4CV0A 4A73A 1EG2A 3MJRA 4J9VA 4U2FA 4DFDA 2H00A 1JG3A 4O5AA 4IKEA 3WB0A 3FHTA 1E62A 3WMRA 3EXHA 3K0AB 4KVZA 2OVBA 3IOYA 1XN4A 4I4CA 2X8JA 4ALMA 4KRFA 3C7KA 2IHZA 5FBRB 2DPLA 1CUBA 1KPGA 1TLLA 1U90A 3CB2A 3NC0C 3IT0A 3HEBA 1G8YA 2D5LA 3CZ4A 4UBLA 5D3ZA 4H7JA 4W5JA 2C2HA 4G0QA 4QPCA 5KTMA 3R9IA 3DUFA 1W34A 5HR5A 3ORHA 3NJ8A 3H1FA 1X7ZA 4O4JF 4DCTA 3V1KA 1KOFA 4G2NA 1MABB 3DZJA 4QUKA 5KOJB 4UM7A 2YVLA 4L6AA 4DS3A 3RG2A 3LKVA 1QE3A 3QNWA 1D2HA 2ZQYA 3AFHA 1C0EA 1D6MA 4COKA 1HETA 3HP1A 3CXUA 1DLJA 4ZEOA 4KO4S 2CGEA 2MU1A 3EIEA 3FMIA 5IDYA 1WKVA 3PFCA 4Z3OA 2OUKA 2VDPB 1XI2A 1A7JA 2GNPA 5ESRA 1WP4A 4MTCA 1CS0A 3JTEA 2VAMA 1VGVA 3ISTA 4NCHA 3ANLA 5J5AA 4AZ0B 1TEVA 2OKGA 3PX3A 2J0VA 5JW6A 2AOUB 3I8SA 3WHKA 1K5GA 2ZRKA 3HVUA 3CU5A 4OQPA 3T7CA 4LDAA 4Y9UA 4BVKA 4F2PA 2XW6A 4YY3B 1L5SA 3QZUA 3UJHA 3VO9A 4A26A 3ADBA 2B4QA 1AZTA 1DIAA 2R6HA 4NCNA 4V02A 3TD6A 2KJQA 1KQOA 1IZZA 1T9ZA 2IUTA 3G0IA 1LNZA 5CH8A 1J06A 1FLDA 1RXSA 3DTNA 1ISFA 1E6LA 1K3TA 5ALVA 2MYNA 1G0NA 1P0IA 4C4RA 3KVOA 4B6QA 2GYUA 4CLHA 1NW6A 4CM4B 2BFEB 1UKEA 3PKJA 4Q9HA 2QGNA 1H2XA 3NYRA 4Q93A 3TL6A 2YZKA 3BK7A 3IBGA 1W5BA 2CNDA 2D4HA 4H31A 1RVDA 4AMGA 2B8NA 2JAOA 5FHRA 1HE5A 4U6NA 1O6BA 3GFVA 1P9LA 3LPCA 3Q9NA 1L5ZA 3FKJA 1N4AA 4IX1A 5IC4A 1F2TB 3BTOA 1QH1A 1TAQA 1EBBA 5LDHA 3QU5A 2FW0A 3MGBA 1SOAA 1PI3A 2OHJA 3CKYA 4POAA 1E7WA 3AKZA 4WZ6A 1MAAA 1UPUA 3MM4A 3ED1A 3X1MA 1W0JD 2EV9A 4KIUA 4ZT2A 5FPQA 4C4PA 1AN0A 4TWRA 4Y2GA 2C5SA 2LDXA 4NZOA 1NM5C 4RJKA 4J0HA 4UXHA 5LQSA 4A6PA 4HRVA 1OZ0A 2OHVA 1OBHA 2RARA 2NXEA 2FPKA 1CDDA 3DTVD 3VU1A 4EKIA 3P9KA 1FFSA 2HO4A 4J4HA 4UQPA 2GJ8A 5B6IA 5A3RA 5GZ1A 2AOVA 4R68A 5KTRA 3FTCA 3TTUA 1QGUA 5IVKA 4BMPB 3ELWA 3NDJA 4HFNA 4HQLA 4I1RA 2BH2A 3KJGA 1K4YA 4KWEA 4UREA 2FX3A 2KLBA 2XJ4A 3OMLA 1WCXA 3QPAA 2J7KA 3B3AA 3ND5A 4FOLA 3W6ZA 4KPEC 4G6ZA 1PLJA 1KSJA 4OATA 5CLQA 5EGSA 1Z5WA 3OZEA 3U7EB 1UZAA 2AX3A 2BOVA 4YR7A 3MHTA 2EVWX 1QHEA 3I01A 1N9GA 4JJAA 1HQKA 2IV7A 2G67A 1IVNA 4MLDA 3ZHUA 4CR6A 4MAMA 1WDLA 1GTSA 3K5IA 4WZZA 2J9YB 1AM4D 4WSOA 5DYNA 2FUKA 4CDRA 1B1AA 4JLAA 5DBOA 4D0LB 4KXWA 1TCUA 1F8YA 1XTQA 1G9SA 3QUAA 5A7GA 2M6SA 4NF2A 1M1YA 1J8YF 1Z17A 2Z1MA 2ZBVA 1XDZA 1IPFA 3W2GA 4KWHA 4NPHA 5CX1B 5JXWA 2AH5A 3K9FC 1V3QE 1RAFA 4PZUA 4YRJA 3RGWS 4OG2A 1OLXA 3H9UA 3L8EA 4OYYA 4JUDX 2OYRA 5IEJA 1QKIA 4DDUA 4KEAA 1XB2A 4ALLA 1F60A 2H65A 2PVPA 2OB2A 3BFPA 4UE6A 3VHRA 4FCVA 4H17A 1TCCA 2ZIWB 3TH5A 2OFXA 3W5DA 4TXNA 4BX8A 1A3CA 1KAMA 3PXEA 2I6TA 2O2CA 2OMEA 3AVWA 2V9ZA 3FHJA 4J49A 4HXGA 1A8PA 2PPVA 1QK5A 1OLUB 1ONSA 3B6EA 2RK6A 1M1NB 3DQQA 3H9CA 4ROSA 4CQLB 3FTEA 4YDSA 2BTQA 3WNCA 1YT5A 2ZWMA 2NZYA 1KI7A 6ADHA 2VCEA 2QTCA 1IM8A 1CZHA 3LECA 2FRVA 5SZKB 1GITA 2P9GA 3O8NA 4N03A 1WXHA 4PLCA 2A0XA 3JYLA 4DR3B 3VSDA 1JAIA 1W49A 3SJZA 2Y4OA 4GAEA 2IWRA 4WBSA 5JMWA 2PRZA 2E48A 1GG2A 4BGDA 1XTIA 4LY0A 1J2UA 4EW3A 3REOA 2GCEA 4YCDA 3D7NA 1L4GA 2XRMA 3O83A 4NBSA 4OHVA 3HR7A 2BKUA 2P65A 4IFBA 5CK4A 1EFPB 2QI9C 1L1RA 4BY9E 3QTTA 4CQJA 4LSZA 1R0ZA 4RF5A 1QZUA 5H16A 4F38A 1XZCA 4D8YA 2WLTA 3TM4A 3PS9A 1WVGA 1ZICA 1PTKA 2RB4A 1R8XA 4OM8A 4E4TA 1LI5A 1BEZA 2HMUA 4QDTA 1ZMTA 4RY9A 4A5OA 2X4DA 4OSEA 1IZ8A 4BU1A 1CZNA 2D3WA 5JNUA 4NFLA 4UNRA 4ATNA 2BFCB 1A7KA 2JKZA 5DLPA 1OQAA 2HCJB 3WYAA 4BO1A 1EQ2A 2XRYA 2WJ4A 3HL0A 3DDHA 4JB0A 3AUJB 5AW6A 4CUKA 1CY2A 1DLIA 1D4OA 2H5EA 2NYRA 3G9ZA 3I6ZA 2EW8A 4GWLA 5LNK1 5EJMA 3VTZA 4C14A 1ABBA 1EK2A 2A0KA 3KLMX 1J2EA 4O5OA 4OLJA 1P73A 1HDYA 3X43A 3FCYA 1KWGA 2ATEA 4WOKA 5ESXA 1AV7A 4KUGA 4GL2A 1SVNA 1A2OA 4YRGA 3C3YA 1AB5A 1Q0UA 3JWHA 2Q2OA 4BX2A 1RXCA 4ZALA 2VBFA 4MQLA 3L2OB 4ZOLA 4PC2A 1J9GA 5HKAA 1AKWA 3R3SA 4IM7A 3CUYA 2RC5A 4JNCA 2QVLA 3AOGA 3ZVNA 4KGVA 4DEXA 2VUIB 2B82A 3DEHA 2FR8A 4CEIB 3B9QA 4U3JA 2C5AA 4YV0A 3Q5DA 1I30A 4DQ0A 3BS4A 1RI3A 1A9SA 2GRUA 3KB8A 4NCXA 3WK5A 3WR5A 1H05A 3ANMA 5CEEA 4MKIA 3OPYB 1NSTA 1W581 4QDUA 1KDRA 1R0RE 1DDIA 2ERXA 2HA6A 5KINB 2P41A 4PCAA 1ZK0A 1NBMD 2OC4A 1J0DA 3KQOA 2HZ7A 3BE5A 1G9XA 2BYTA 3JZFA 2A8YA 4Q3DA 1OMOA 4WK6A 3ZWNA 1V16A 2G88A 1RKQA 2JZOA 4HPXB 2IYRA 1G21B 3KLBA 4IV0A 1L5YA 2QSJA 4ZRNA 4AP5A 4B34A 4CETA 3L1KA 2Q0HA 1E3EA 4FNMA 3OF5A 1KE1A 3G5AA 1W4BA 2W6MA 4MJ7A 4QHTA 4JUCA 3TR5A 4A4DA 2JGIA 1G3UA 3B1WA 4HB0A 5EHXA 2FPGB 1GEGA 1QRSA 4REQB 3NT4A 1KJIA 4RAOA 4BNNA 4O2BA 3B5EA 3NXKA 3HCPA 3HJUA 4TTJA 3GLTA 3KT6A 5HK9A 2G9NA 2HSGA 4N6OA 4CTOA 1TKRA 4MQFB 3KEFA 3E53A 2ZJ0A 3FOCA 4N47A 2OQVA 4EX6A 5JATA 1T0HB 5DSXA 4YLGA 3RBZA 4PV7A 4UHEA 3Q0EA 3OQMA 1VXRA 3CNLA 4NEQA 4YTEA 3UZUA 2BN4A 1A2QA 3PD1A 3IXMA 1GOTA 3R6LA 3LWZA 1LJ8A 5L40A 1UBTS 1CFZA 3EJ6A 5CX4A 3TJRA 4DWVA 1BE8A 1ULUA 2FR1A 1ZJZA 2ZBUA 3JVEA 1NYLA 2X2OA 3QPBA 5PNTA 2Q2WA 1M2GA 4EUFA 5ED0A 1G8FA 3N2KA 2DLCX 3K1JA 3K1AA 1N7IA 3PHJA 4FOSA 5ER6A 2YNMA 1EX9A 4HNHA 3AUSA 1HKUA 4ND5A 3FWNA 1T3SA 1T43A 4GU5A 4NZZA 2ZYVX 3KWLA 5G41A 3RSHA 4R2IA 2VUHB 4XWAA 3RU9A 5IS2A 3PEWA 1L7VC 2CVOA 4AG6A 3CGGA 1DGQA 4LRXA 2FR0A 2QMUA 4KFUA 4M3NA 4FFBB 3DP7A 3UHOA 1ZNYA 1UBNA 2YY5A 3JQ7A 1ADFA 4WHMA 4TXLA 2MMCA 4QYSA 1XJ5A 2M6KA 4G0UA 4V3CA 3ADPA 4K0KB 1R7RA 4E5DA 1BU8A 5BURA 1YQTA 1L0BA 2Y05A 3EEBA 4FOOA 4G5HA 4NJEB 5GWXA 3EB9A 1HT2E 3FPJA 1UDWA 4FZRA 4B2LA 1QIFA 3OZSA 3L9XA 3A1VA 3R3VA 4MWCA 4G8BA 2HPZA 1P72A 5HW0A 5FTJA 1G55A 3V55A 4EFKA 1TK3A 3HQ4O 1V8BA 2D1YA 5L7WA 4NY1A 3JATA 3MWKA 4WA8A 4M8KA 2X6QA 1Z4MA 3OURA 4MKRA 3WISA 3EA5A 5B3JC 2J8ZA 3RTGA 3W2FA 3ITEA 3EWSA 1LPPA 1JJ7A 1RDFA 3CRRA 3ZE7A 2FKAA 1A9XB 2HY7A 3AEUA 3LPLA 1G8JA 4URWR 4HNAA 4XM1A 4ER0A 1ISGA 2AW5A 3ZWAA 1YR9A 2WJZB 3L6UA 3E8SA 4HWTA 4L50A 3ETNA 1VL8A 1I3OA 2BKAA 2MSEB 3MWYW 3R44A 3ZI0A 3HXOA 1GPBA 5EUMA 2PH5A 1GPH1 1ZDMA 4BV3A 1ORVA 2IKSA 5BSWA 5LQUA 1KOGA 2ZITA 2VSOA 4E5UA 4MZXA 3WFIA 1O77A 1ULTA 1OGIA 2GHRA 4J1TC 1VC2A 3TRKA 4F7WA 4NCAA 3PT5A 1QV7A 3PC3A 1ZCJA 2AB0A 4BIIA 4OQQA 2GZRA 4XTCS 5A4AA 4D9MA 1Y8QB 2FGKA 5J5CA 3M6FA 2HEIA 1ZNXA 3ZOZA 3GGJA 1CHNA 2GYVA 1PK9A 2X42A 2ABWA 3WL4A 2I67A 1ZEMA 2AX4A 3LQ4A 3MSXA 4IEEA 3A2MA 1DOHA 3A9RA 4NHOA 2CMFA 2ZRPA 3NH6A 1ZC3A 2IITA 2BSAA 4ED9A 3E9CA 2DX7A 3G3EA 4ITVA 5E9QA 5LU8A 3GVHA 3E8MA 2AOTB 1GPLA 2PGDA 2EZ8A 4WXYB 3UCFA 4AMBA 1SPBS 3NIFB 3FLMA 1Z62A 3TKYA 2PHZA 1SIUA 2ZUDA 4HQKA 3TRDA 3NTXA 4R2XA 1K8XB 4FP9A 1KZ4A 1MFPA 2X4IA 5FL7A 4BB5A 1KOJA 4QT4A 3EGOA 1E2MA 4OHUA 1YB2A 4ZOLF 5EJ8A 2ONKA 1E98A 3P52A 1ZBQA 3QU2A 4NKRA 3SF8A 1B6SA 1WZ2A 1EXWA 2IZ1A 2C9MA 3QMMA 1NOIA 1TD1A 2H5IA 4W4TA 5FUBA 5C4IA 2FWNA 1Z4IA 1M3SA 3AHCA 2VJLA 1YJCA 2O2GA 4MICA 1MX5A 5LQNA 4GM4A 5ALQA 3RARA 4X6YA 3FUCA 1Q21A 3BMNB 1Q3TA 3JWGA 3N86A 2WWVD 4D9FA 5KTNA 1WBDA 2CVFA 2XZLA 3N2ZB 1ZM2A 2ZEJA 5IPFA 3OX4A 5FOSA 4M8LA 3TIFA 4EF4A 1TPZA 3COYA 3O84A 5KS2A 1BHSA 3OTWA 1AKVA 4E32A 2HT1A 2EBHX 4MV9A 3B9RA 4EO7A 1ZK3A 2WICA 2WAYA 2BEUB 3JQGB 4KMMA 5GJWC 3SEAA 1EE2A 2QZSA 4JLOA 4OI0A 1GAEO 3P9YA 4X8OA 2H17A 8ATCA 3J81k 2UXBB 4UHDA 4PX9A 2B34A 2VSFA 4OPMA 4W1PA 2HLHA 2JFNA 3DOJA 3KQTA 3ZCTA 2IGTA 3A4NA 1NJSA 2OLKA 2PGNA 3UMCA 3IMCA 3LGXA 2I6GA 1D5CA 4MGEA 3VKUA 3OC0A 5BSRA 4ZGBA 1UMBB 4RFSB 3MB8A 4FEYA 5EL0A 3EZ2A 1Q6ZA 4KRGA 2WG2A 4C4XA 4INOA 2J08A 1KS9A 3I09A 1WUHS 1CZRA 1AKRA 4O2BF 3JTMA 3CLUC 3DWGA 2ZCJA 3PJGA 4N7BA 5CHYA 1GKKA 2IZ7A 2W2PA 1KPHA 2A84A 3CVUA 1MHPA 5AJUA 3NC1C 2OV6A 1NR1A 3H4IA 4NABA 2VAPA 1NOJA 4LYFA 4OHKA 4E4RA 2NW6A 1KMNA 2ZJOA 1B3BA 4IINA 4KXVA 3W7BA 1ZI9A 3KUDA 4FD2A 4MV1A 4OB6A 2I5PO 5I9MA 4HX2A 4HWKA 4RZ3A 5K03A 1WD7A 3GCZA 1FMCA 5BQXA 1V41E 1YAJA 1A77A 2GVDC 2J9XB 3VTKA 2RHHA 3DLPX 5GAJA 4B73A 1U1DA 2PO5A 4UVDA 4QUDA 3KM0A 3FNBA 1B0PA 4ND3A 2Z6AA 2DT5A 1EUDA 2HMYB 3QE0A 4IIUA 3LFUA 1FP4B 2OXIA 5A3SA 4ZI7B 2GT1A 2B8JA 4ME6A 1TU0A 2BR4A 4MDHA 2Z6UA 3FX2A 1SH7A 1N77A 3VA7A 4YT8A 4MRVA 2YBDA 2G8NA 1IAVA 5AI5A 3G8BA 4RHTA 3I53A 3S3TA 4H1TA 4OJKA 4YRAA 5TVGA 5IARA 5DP1A 3ZNQA 1TJNA 2AEEA 1FFDA 4YV1A 2EEPA 1XDUA 3QUSA 4IDPA 3VDQA 1W36C 3K05A 2WSIA 4K0RA 4AO8A 2PZGA 4B2IA 3OT5A 2ZRIA 1SIOA 4CODB 5ISMA 1QGED 3ELDA 3D3KA 4IWYA 3Q5EA 5AH0A 3JVUA 4LDJA 5BRJA 1WO8A 2J9FA 3BWBA 1V0JA 3S27A 2V03A 5CR9A 1OB5A 3MK31 3DE5X 1P1BA 2F9LA 3DDCA 5BN4B 1IHYA 4RK5A 3S1SA 1UWCA 2JGRA 2P9EA 4CHTA 4XDYA 1K98A 1Z63A 4N5DA 3QFHA 1M1UA 5JBNA 4PZDA 3VOTA 4N48A 3DOIA 3PHIA 3SIWA 3GQVA 4EL0A 2IE0A 3DLBA 2TYSB 1Y3HA 1Y1TA 4FHEA 4DLVA 3IE1A 3ZYZA 2OE2A 5GJBA 4D0SA 3Q11A 3KQKA 3D8RA 2WIDA 4D97A 2ZAGA 5DM1A 3UJ9A 2FF5A 2QS9A 4MQMA 1HTBA 1SU7A 3LC2O 3ZCUA 1ADGA 1OILA 1RPNA 3TOZA 2WJ3A 1GRNA 2QD1A 4G5YA 3VNVA 1WY7A 4JT9A 4AX4A 3P26A 2C2MA 5TB5A 1XZQA 3BGDA 3UEOA 3KSMA 3HP4A 2QE6A 2WSSA 1F6BA 4KJZA 3MWDB 4PAGA 1VHWA 2G28A 4AM8A 4TPKA 4F92B 5D51S 2SCUA 4H7IA 5B36A 3K5HA 1X2EA 4P3XA 3AERA 1P2SA 3B1XA 3CZ9A 3ICWA 4P3OA 4D4LA 4L3VA 3JYHA 4C78A 1AK9A 2GCOA 3WQBA 1OH8A 3GLFB 4JP3A 5IDQA 3HA5A 4N5LA 3PXBA 3REGA 4TL8A 4FDUA 2JEOA 5GTDA 5JXJA 3P9NA 4I5EA 1UMCB 3R0XA 3W9UA 3L6OO 1WB4A 2C9CA 4TXMA 2OEPA 5K8JB 1D7AA 1U0TA 2ZJYA 3BXFA 4FFWA 3PTAA 2J9ZB 4KXQA 4GEKA 2B3DA 4C2AA 3NFRA 4CF3A 4DQKA 4H1HA 4XRRA 1FS4A 3CINA 5DCWA 3ZXXA 5F77A 2BEWB 2E85A 3FAKA 1CUSA 4LI3X 3AEKB 3B3GA 4HDAA 1D1QA 1RJFA 4GQIA 4KN8A 5DYYA 5TGZA 1NUAA 1P5JA 3N0WA 5EC8A 3TQRA 2E21A 4KU4A 1CXZA 2RAPA 3KJNA 2IKQA 2O7QA 2ZT5A 5ALUA 1TTPB 2OZPA 4D41A 2YOGA 4M49A 4FMPA 1V37A 5LKAA 2H9AA 4JI7B 2FB9A 2O8DA 1CJBA 2QLFA 3GMDA 3PDUA 5BO5A 5I9NA 2FQYA 4G0ZA 1DKQA 4LPSA 1TE2A 2AFIB 3RFTA 4CBVA 4ZVNA 2W4QA 5LYJF 4B3MB 2WSYB 4EL5A 4ENTA 2GBGA 2Z2XA 2IHKA 1DAPA 2O3QA 3A36A 1TT7A 3C6KA 4G5SA 4K6MA 5BWBA 1H3NA 5TMBA 2CL5A 4EOGA 2WT8A 2IOYA 4MH0R 1Z56C 5AHOA 5GIOE 1DG9A 3ZJYA 1ZJYA 3OTHA 1E5LA 3R4VA 4QJIA 3QVMA 4GMFA 4OM7A 2JLXA 3H4MA 4MW5A 1Y42X 1NXWA 1PWHA 1GRRA 5JXHA 1LI4A 2P2YA 2VK4A 4OQDA 3FIJA 5CURA 1V48A 4NG5A 1NTOA 1S3IA 2CMDA 5E38A 1DC6A 1N7HA 1QP8A 3NAMA 4G5OA 2XI4A 4PF1A 3UN1A 1GRQA 4ALJA 1YOVB 2B6HA 2ECKA 3CSDA 4NBKA 2YHIB 3I3OA 4U1RA 5C1IA 2NP6A 3H2ZA 1XPJA 2H06A 1IXSB 1RYHA 1XU9A 4OK3A 3NOXA 3IQXA 5JR3A 1FIUA 3CX6A 2ZBPA 3P7MA 4QQ8A 3DLAA 5FLXA 3VGPA 1EE1A 1GGHA 1E59A 4F6RB 4RPGA 1ZCBA 2VHUA 4MVJH 3U9LA 1T0PA 4US0R 1GL7A 3GPCA 4UBJA 4IPTA 1R0XA 3BL6A 4XSVA 4V1CA 4CLXA 4A0RA 4MYCA 1BMFD 3F7NA 3SAJA 2VZ9A 2V7XA 4LV8B 4R1OA 5GPBA 1J23A 1RQPA 3LX6A 1VSTA 4MI3A 3QU7A 4RZUA 4NVRA 2XRFA 1O4VA 5EQFA 3VYVA 3WYGA 1DTEA 2RHTA 4I55B 1AMOA 5J3JA 3MUEA 4XFDA 4TWIA 2CUZA 3KCNA 1FDOA 3QENA 4J29A 1VDZA 1JJBA 2XGSA 4RH0A 2HA5A 3BVPA 3W77A 3C98A 3ZKWB 1KDZA 2EX1A 1ZGHA 3B48A 2AUTA 5E9WA 4ZJYA 5JDCA 1Q3HA 1YRYE 1YS2X 3H6HA 2QD2A 3U60B 3CUKA 4ARUA 3K2BA 3JAWA 4QPNA 4DV3B 3I6BA 5BPHA 2V7WA 2IQIA 4TWAA 3ZX5A 1O7JA 2C54A 4QDJA 3VSEA 1E2LA 4X95A 5AW4A 1QHGA 3QBTA 5CIQA 5L3ZA 4PYKA 2JAUA 4R1LA 2GS9A 3EEFA 3VM6A 3ABZA 1KI1A 4DPLA 5KYXA 3AUKA 1NNSA 1ECCA 4GWKA 4K46A 1Z5PA 5IBQA 1M54A 3IUPA 4YDQA 3OI7A 1B1CA 3K09C 5AOCA 2F3PA 2XZOA 3A1DA 3P5BA 4C6TB 3OE5A 3NWJA 1QHHB 2ZYSA 3KKQA 3OESA 4GOMD 3CEJA 5ENZA 1X7HA 4ZVSA 1N2ZA 2R11A 1JHPA 1VYHA 1WY5A 3E3NA 3O8LA 4I8IA 2WIBA 4XB6B 5DM4A 3TEFA 1EFLA 3W5SA 1SCBA 1XT6A 2BRUA 5DXAA 3H1EA 1ZUD1 3DZHA 5JI3E 2VHQA 4O4LB 1T9KA 2BSXA 3NC4A 2ZXFA 3V34A 3LW7A 2DWUA 3NRJA 3QI7A 4HLDA 4WESB 4X0EA 5EJGA 3RS7A 3VPGA 1AC5A 1D1PA 3EHEA 1MEOA 3KB2A 3HXPA 3QVJA 5DGCA 4ZVLA 5LLSA 2X0FA 5JAOA 5K2OA 1DIGA 1CS4C 1UQRA 2MT9A 4QQRA 2QJFA 2P7IA 4JP1A 3FYUA 3ER6A 4L0CA 4RLQA 4MPDA 4G8JA 3PHCA 1VLZA 3RH0A 4F45A 3G0CA 4UNIA 1JU3A 3OHSX 4BPRA 1RWVA 3CCBA 3EH1A 3WKCA 4QL3A 2YNMD 1QFYA 4D5GA 1OWOA 2QB5A 4F06A 2WRZA 3GLGA 3KXLA 2Z1DA 2I1WA 4NG4A 5L51A 4M53A 2PH3A 4TKUB 1V1RB 3U3JA 1XQYA 1NX6A 4N39A 4TTAA 1E1KA 2ZUFA 2RAFA 2NM0A 4OJTA 5IT9A 4R01A 5K0NA 4B76A 1TO2E 2GJAA 1MAHA 4FE4A 2O4UX 3ILSA 4BZWA 1NVWQ 3AP1A 4WI1A 1Y89A 3EUWA 2D5CA 4LX8A 1NWCA 4OMCA 2V54A 4CHGA 4ZK6A 3DMTA 5ALNA 1JKIA 1O6CA 1QDEA 1RQRA 3AG6A 4MUJA 3RS5A 3U7FB 1CEYA 2JFZA 1LLCA 1USVA 1T1GA 3CX8A 2M2IA 2WJIA 1XZDA 1U1CA 3PXUA 5HNKA 1HE4A 1HOTA 1RRMA 3HN7A 2EF0A 1ZJWA 1IE3A 4LNHA 5JQGA 2Y1FA 2YJ6A 3RFCA 1FMTA 4BNTA 1OH7A 1LSUA 4XIIA 1JMYA 2EW2A 2ZSUA 3SC3A 3FOBA 3H9BA 4OXRA 1U0NA 3NNNA 1K6JA 1PKXA 2R00C 2ZT8A 3GLHE 3SZOA 3ROEA 3DS8A 4AXBA 3AHDA 5T57A 1IZ0A 3ETDA 1MO2A 5FA6A 5LP6C 4FC7A 4CTJA 1Y34E 1A98A 4F71A 2AD5A 3B13B 1IXYA 2VHCA 4R2HA 1II9A 5JAUA 2KYRA 5JO0A 4KR3A 1WPXA 2E9SA 4HRXA 2FTKE 2OV2A 4UU8A 3W5CA 4J0DA 1UOQA 2YIMA 1Z2EA 4NTZA 4JIGA 5NLLA 1QIEA 3T4UA 3FR7A 2QQFA 1NJ5A 1KI9A 1F14A 3V4LA 4IIJA 3L8GA 3K32A 3B1FA 1G16A 2BV3A 3VU8A 4WACA 3LUKA 4C0LA 4JU8A 3TLJA 3WQSB 3H8SA 1XEXA 4LDNA 4RF3A 4ALNA 1NVFA 5HSGA 1P2TA 1JU9A 1Q0ZA 3ZHSA 3PLAE 2OPHA 4HEA6 4MR8B 3OFNA 4ZVPA 4K6OA 2BMDA 2NXWA 2RH8A 3E8XA 3WZLA 4BO9A 1UIMA 5E4YA 5HF9A 5IASA 2B7LA 3DWEX 4PM4A 2WF9A 3SQOA 2IYNA 4ND1A 4C07A 1X39A 3HY6A 1P7YA 1EXVA 1HDXA 2WIFA 4X85A 3FPBA 1U3UA 4DF3A 3ZU5A 4JC5A 2W2NA 3A10A 5FWXB 4R8MA 1EWRA 4J91A 3PHGA 3WLAA 3BWDD 3GGOA 5GONA 1RHJA 1RRVA 1X2BA 4AZTA 2FEMA 5CJJA 5A0TA 4DIBA 1SULA 1WUTA 1M8KA 4DWJA 1EDBA 3HL4A 3ZC3A 3D8BA 4U6QA 3HG7A 2Z8YM 4YRRA 4H7HA 4ILKA 5EY5B 3V42A 3WHPA 3WKAA 3P96A 2B5OA 5FKJA 1Q0HA 3OO0A 3R77A 1ABFA 1JU4A 1N0WA 3BIXA 4OHRA 1U2SA 4PYOA 1PT7A 4NV3A 5ADVA 2C5BA 2RFLA 3PTLA 2GN1A 4EG0A 2VQDA 1W1IA 4FS8A 1FYVA 1DOZA 1UXHA 3AP3A 4BNDB 3PDIB 2ZTLA 3AVPA 4D6YA 1P44A 1ZJ6A 1G17A 1YI1A 1PGNA 1XRJA 3TVTA 5EESA 1NNEA 3OICA 2Q3FA 2GK3A 4O4IA 4A0GA 4R8VA 3OQJA 3QF7A 3A3KA 2G6BA 1SQGA 3OIVA 3RU3A 1XZMA 1LX6A 5E95A 2I8CA 2ZRGA 3K6JA 2NT3A 2WW8A 1T4CA 2VP4A 4FR0A 5CD9A 2HJSA 1WOYA 3QLJA 1EFTA 3OOJA 4ID9A 1E2JA 1N2JA 2I2CA 4ZAWA 1I6WA 4KLCA 2ZZNA 1EWKA 4RTKA 3LRTA 1XL1A 4XFJA 4CKCA 3QX7A 4Z7QB 2Q4RA 2UAGA 1G8PA 2FEOA 1GD1O 1DAFA 4RSRA 4XD7D 4MV3A 1DAIA 5FTLA 1WEKA 4B6SA 3KSUA 1J21A 3IUNA 4UHHA 4WN3A 4RESA 5I4KA 4FQ8A 1K7EB 1E3WA 2NU9B 2NU8B 3KLOA 4NS1A 3T9BA 2Y8EA 3TAXA 4YRFA 1E92A 4KPFC 4JR2A 3O93A 5A3VA 1SZCA 2H5LA 3NBZC 4NYIQ 4CXMA 1A27A 3OWHA 3T9CA 3N8GA 1N7JA 3HJCA 3LC1O 2OCIA 1RLMA 4GLOA 2QV7A 1NUTA 3V1MA 2XNKA 4I1VA 2YVAA 3KEQA 3EVFA 1G19A 2E5FA 2C1ZA 2I71A 3N8HA 4L5AA 1K63A 2ZPTX 3S2IA 5C5DA 2HAEA 1EIZA 4IG4A 1IM5A 4MPTA 3DE4X 1U28C 1VG9B 1OLSB 1VZ3A 5TQ2B 2GEDA 2AZMA 2VHWA 1J49A 1Z6PA 3VFDA 4XKJA 2FRDA 3DT9A 2ZAYA 5G4KA 5C8DA 3MA0A 1IONA 3LCRA 3THOA 4BQFA 2OVFA 5A3JA 2PIAA 5A4KA 2V59A 3MJ4A 1UJ6A 1JXOA 4IVQA 5AXBA 4ANFA 2GYYA 4J75A 1PR9A 4F9FA 5C8VA 1PAUA 2ISQA 3HHEA 2ZPUA 4PZ0A 1QO7A 2GFQA 4MRPA 1JHVA 3CEAA 1E64A 2D59A 1UPCA 3HYSA 1W1WA 3JPWA 2OCYC 3W8RA 4IXDA 4JHLA 1CRLA 4INAA 5IMSA 2FV8A 2ODEA 3G2KA 4Q00A 2DWPA 2XCUA 3UCXA 3KZXA 1B74A 1FBTA 3R6WA 4GX0A 4Z8XA 3X2FA 1VIVA 2BD0A 3R0JA 1KC1A 2PU5A 3V6MA 2CEAA 4EZBA 2Q4EA 3PYXA 5A03A 1Y8RB 3O8QB 2K2QB 3K70D 1NQVA 4MAFA 5GZ3A 4IJ6A 5DV9A 2GNOA 4ZWNA 4B6RA 1B6GA 2PWZA 2BGKA 4QGAA 2ZB4A 2HJWA 2HBRA 4AW9A 5JQGF 4HV4A 4XUGB 5AKHA 4PLPA 3DO5A 1NDUA 4EK9A 4UDOA 1LRLA 2ILVA 2IUSA 3I4LA 5AW3A 2HBYA 4N0QA 1XLUA 2P4SA 2XWQA 5FLKA 2VWPA 1TADA 2JGAA 4GPD1 3R7WA 1B76A 5TQVA 1KQNA 3Q7IA 1L9KA 3L02A 1YBFA 2SKCA 4FIZA 2JATA 4J6FA 3SKYA 2A1IA 1WUIS 2G25A 1KF0A 3HZZA 3NS7A 1QWSA 5AR1A 2R1ZA 2OHHA 3VVLA 1PHRA 1ZR2A 5KYWA 4DSOA 3D3EA 4IIJF 2XE8A 4LFCB 4FYWA 1P74A 3TUIC 1V9CA 1NAIA 5F23A 4DR4B 3I12A 3R5HA 3VR6A 3NIDB 1X70A 4B46A 4DRZA 4DR1B 4C6HA 2G9VA 5D87A 2VN8A 3JW8A 4ZVUA 2WSSD 1AS2A 1BCSB 4CQMB 1OZGA 1QXSA 2UZ1B 3AWIA 2GK4A 3BTUA 1MJNA 4MQ5A 1YVEI 4QECA 4FFRA 4MGHA 2OXCA 1TXGA 2CLHB 3PFIA 4P82A 5CGQB 5EOVA 5C52B 3HMKA 2GZHA 3ESRA 3K0CA 3IV6A 9ABPA 1EWQA 1OT5A 4PTYA 3DBHA 1J2JA 4K9NA 2IV3A 1ZGZA 4ZDKA 3WKBA 3NIBA 2PUVA 1D0SA 2VT2A 3ZD8A 2FF7A 4XQ0A 1Y3IA 2Q3BA 2FE1A 4AI6A 3KB6A 1VL2A 1E77A 3P2KA 3ODPA 2ODAA 2WQZA 5LWQA 4HPWA 1UJ2A 4M0EA 4O2AA 4YRKA 4A23A 3CBGA 1ECGA 3D54D 4LOKA 5GONF 1YR8A 4XYBA 2D2FA 1XDGA 1A2KC 1T35A 5ULLA 1IK6A 1VLQA 5DNVA 3C1AA 3TZHA 1GL6A 1T3ZA 1H1DA 1BS9A 3QM1A 2DH6A 3ZTTA 2IPOA 2MR6A 3VGJA 2QNBA 5EERA 4BLOA 3BH0A 1EWYA 3IEXA 4QWMA 5TLSA 1IXRC 2YJ4A 1PTJC 5AHXA 3N8KA 1C7JA 3PCRB 3I1YA 3WP0A 3PPVA 3Q8XB 1T3LA 1U65A 4LQ4A 4O4IF 1YA4A 2HJ9A 4PGFA 3I9LA 4JOCA 1GA4A 2C8JA 2IHBA 4QJ4A 5DGIA 2WPDA 2FP4A 3BH7A 2XDWA 2WZBA 3K35A 3ZK7A 4F11A 1EINA 3SC2A 1RXEA 1W0CA 3TIXB 1AQUA 2AKAB 4UMVA 4UPEA 4WX2B 1SKMA 3ZXYA 1OLOA 3L05A 4WH0A 2PT9A 4ZRMA 5B7NA 3HYCA 3PNKA 3TTYA 1IY2A 2FPXA 1VKHA 3QOXA 4P4NA 3E82A 2O7NA 1W46A 4Y6GB 4L5CA 1CR4A 1KZYC 5AOBA 3K2QA 4DTCA 3DKPA 1DQPA 1JFFA 4WV3A 5J4KA 4PY2A 3AZPA 2DHEA 3P0RA 4DSTA 5IUJC 3AW8A 3EUAA 1OWLA 1UKAA 3RUDA 1EVYA 1AUXA 1KYYA 1YMVA 4GZMA 5DHTA 3TW4A 3EVAA 3KZNA 1A69A 2GR9A 3M82A 1H2BA 1J25A 3QA3E 1FVFA 3DWIA 1RHMA 2VUUA 1HUQA 1PJ8A 2JRLA 1IN5A 1RWWA 2Q1XA 4IV5A 2CCGA 2JVJA 1I5RA 1O9GA 2PA0A 1AX9A 1UT8A 2V5UA 4J16C 1GQ2A 1MQ8B 1RYFA 3T3GA 3BYZA 1B2LA 2OHOA 3FDIA 3NGXA 2ONJA 3GMSA 1DU4A 5FOUA 4D0GA 1S96A 2XTZA 3ZQ6A 3A25A 1O1YA 1P9OA 1R0CA 4TYPA 3IYLW 1C4XA 4BZQA 3QVLA 1E5XA 1CJCA 2ZRAA 1IL0A 1G7SA 4HD8A 3TX2A 2AYYA 4OHWA 4B45A 3DC2A 1Z15A 6YASA 3DE2X 5EJ6A 4KDRA 5K05A 4QA9A 1CQWA 4RD0A 3VYTB 2HMWA 1X74A 3LCUA 3M5DA 4PE5B 4YA6A 4ONEA 3WDLA 4CI9A 3WLPA 3JQRA 1X7YB 1VKJA 4URFA 5L3SA 1NMSA 1Q92A 4FUTA 1W8IA 1CJUC 3BOSA 4WUTA 4DC0A 1KIMA 1Q7TA 4EY3A 2A14A 2QF7A 2B4KA 2V7BA 1DXHA 1PFQA