4J3FA

Crystal structure of fabi from f. tularensis in complex with novel inhibitors based on the benzimidazole scaffold.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
259
structure length
259
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structural and biological evaluation of a novel series of benzimidazole inhibitors of Francisella tularensis enoyl-ACP reductase (FabI).
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 88
structure length 259
sequence length 259
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j3fA00
5JDCC 2Y05A 4NU5A 2A94A 2DTDA 4L4XA 4YWJA 4BKUA 4BO3A 1PJ4A 3OP4A 4IBOA 4RPGA 1XQ6A 4J1SA 5ENDA 3PVZA 4UUNA 1I30A 5TT0A 2Y1DA 1DRWA 4RPLA 1JVBA 3DDNA 3DHEA 5JAMA 2BMAA 4XIJA 4XYGA 4MVJF 2VUUA 5KJEA 5L7TA 4EUFA 1AE1A 1H2BA 4EUHA 4RPJA 1P1JA 1TEHA 1U4OA 3I1JA 4FFLA 2AQHA 4ALKA 3EY4A 3H4VA 1FDUA 3TOXA 4AJPA 3QWBA 4B3JA 2W2KB 1HSOA 3F5SA 4EEZA 1BW9A 1ZEJA 3GUCA 4JIGA 3WGGA 4HNGA 1ZXLA 2ILTA 3DWFA 1GPJA 3S2IA 1MC5A 4BNZA 4CQLB 4CV2A 4A5OA 2HRZA 3JYPA 1M6WA 1LEHA 1IOLA 3NJ8A 4QSMA 1HE3A 5JCXA 3GEDA 2Q49A 3WGOA 3QW2A 4CV1A 4FB5A 1QV6A 4E30A 4IDBA 3ZN2A 4H16A 4XYLA 4XQGA 4FN4A 1XLTA 3MJ4A 2PH3A 1KS9A 2AG8A 3U3XA 3WJAA 5HS4A 4RLSA 4QO8A 1EUDA 4P4GA 4XGNA 1BXGB 5L4LA 4DPMA 1IZ0A 4MP8A 3L0DA 1PJCA 1DC3A 3IDSA 1G0OA 4UAGA 4DVJA 1HT0A 2NTNA 2ZTUA 3OJ0A 4UUMA 3WQRA 5IJZA 3RC7A 4GSLA 3OH8A 3LVFO 1OAAA 2DBZA 1LU9A 5K9ZA 1SCUA 2C20A 3ASUA 4PLGA 4XKJA 4ZVVA 1VPDA 2YV2A 2JD2A 2DM6A 3PIDA 4XIYA 2BH9A 4BNUA 3H9EO 4E5MA 4ZQGA 5HRUA 1BTOA 1LQTA 3AUAA 4MVJA 1QV7A 3VZPA 5IN4A 1KETA 4J90A 4JXKA 4A7PA 4OXKA 3PP8A 3ZV4A 3HSKA 5L51A 4MP6A 1DIGA 1PS9A 1YBVA 3L9WA 4XB2A 4B3HA 1TT7A 1R4MB 1A9YA 2WMDA 2Q4BA 4BKRA 1O94A 1HKUA 2BFOA 1AXEA 3PDJA 2F00A 3IKVA 3TNLA 5L7YA 1DAPA 1KBZA 3ZCXA 1MV8A 3KM0A 3P19A 1P33A 5ES3A 2PWZA 4W9NC 3OECA 3EZLA 3L6EA 4YAKA 1ZFNA 1IPFA 2BF7A 3STHA 5THQA 4BGEA 3D4OA 4CMCA 3K9QO 4GX5A 1Y9EA 5EESA 2VOEA 3ZW8A 5FI3A 1B2LA 4YPOA 4OOEA 1J6UA 1WZEA 1EE2A 5KJ6A 3JYNA 1VL6A 4KOAA 3AUTA 4FBGA 5B1YA 2BLLA 2DC1A 5TC4A 1NTOA 1KY5A 2JCVA 5AXBA 3DHNA 4BS9A 2O3RA 2DPGA 3PHGA 4XQ9A 4EJMA 1BVRA 4EJ0A 1LRJA 2GN4A 1MC4A 5B37A 4L76A 1NQOA 2ZJ0A 4L8VA 4E2YA 3WGYA 1Z82A 1YKFA 3PLNA 1QG6A 3BMNB 4R1TA 4FC7A 3TF5A 3DC2A 3BMCA 2AXQA 5JO9A 3RASA 1R12A 2HMTA 1G1AA 2YW9A 4I5EA 4D46A 5ILGA 4A26A 2I3GA 3QHAA 3GOHA 4TQGA 4K1LA 5BQFA 3DBHA 3JYOA 5EQFA 1X0XA 4PLYA 5JY1A 3S8MA 5JCJD 1DFIA 1W8DA 4R5HA 1XKQA 3JQGB 4JROA 1ADGA 1A7KA 1QRRA 3K2BA 3JQBC 4FGWA 4UVIA 2RIRA 3GGOA 3JQ9A 4DYVA 4MINA 4YACA 3U5TA 4A2CA 1U1IA 2EXXA 2PY6A 2O2SA 2VN8A 3GPDG 4Q3AA 2DVMA 1QP8A 2EJVA 4G81A 3WR5A 4DTIA 4E4YA 1PX0A 4YJGB 1T2FA 5CPFA 5BT9A 3ANLA 2G1UA 5C3MA 5MGBA 2Y1GA 2HMWA 4EGFA 3T4XA 4D3FA 4CLEA 5BSHA 3QA9A 4J6FA 1X1TA 4E13A 3ZNPA 2OL4A 4RVDA 2PR2A 3WNQA 1E7YA 3E9NA 1H93A 2VCYA 2I67A 3C3XA 1YL6A 3OEWA 5U9CA 2EKPA 3JTMA 4HFRA 4B4WA 4BV8A 1Y5MA 4BO7A 1ZKMA 5CEFA 2X5JO 3I9LA 2OMEA 2P4HX 4IDEA 2PA3A 3HQ4O 2HSDA 4HADA 2NLOA 3BTUA 1RKXA 2BFAA 3ULKA 4YR9A 1H6BA 3GT0A 5EPOA 1ZW1A 3LZ6A 1E3IA 4U0JA 1BDMA 3SVTA 1FK8A 3I9MA 3GVHA 3OJFA 1GU7A 4ND4A 1HF3A 4MVJH 3WYBA 5KKAA 2BGKA 4I9UA 1WP4A 2NQ8A 4DC0A 5FI5A 2BI7A 5IF3A 4CPDA 1QKIA 3B1JA 2BELA 3DFZA 1U3TA 1EZ4A 2OGUA 2VRCA 3BHMA 2QW8A 3QJ5A 3JQ7A 4KQXA 4O59O 4Z6KA 4WLEA 2PKRA 2QG4A 4Q3BA 4Q3CA 1DHRA 2WD8A 3C7CB 4J4BA 4KMSA 2ZQYA 4D41A 3DZHA 1B7GO 5A5FA 4K9DA 4GSKA 1CDOA 1SMKA 2C0CA 1TA4A 1LQUA 4ITUA 4RLHA 2VTEA 3H3JA 1PZGA 4AG3A 2C07A 4CLRB 3IUPA 4RPKA 3OEYA 3AY3A 1BRMA 3W6ZA 2X22A 3M6IA 3F6YA 2RH4A 4GQAA 4C7KA 5DCUA 1E0DA 1N2SA 3CPSA 4DQVA 1E5QA 3WIEA 2OUIA 2B36A 4J4HA 2EGHA 1GL3A 1I3MA 3MWDB 1V3UA 3H5NA 3WDSA 1HLDA 1SPXA 5JE8A 1MLDA 4J9VA 1GQYA 5DOZA 4QX6A 1NR1A 1HRDA 2P2SA 3ROQA 3DTTA 3IQDB 4UULA 3FNFA 4L0QA 4XQCA 2PGJA 2XXJA 5CDYA 4U8GA 2RHCA 1BG6A 4AJIA 3H3FA 5COQA 4LMRA 3KXDA 1HDZA 3HFGA 1HSZA 1ADCA 2GRAA 1BWSA 1SB8A 2V6BA 4Q39A 3OIGA 4R51A 4CMJA 4BO9A 4NBUA 3GHYA 5T67A 1MXHA 3TZQA 2AMFA 2OBYA 1BGVA 1ULSA 5FWNA 4XD2A 3JQEA 4B79A 1E6UA 3I23A 4CM4A 1Q7CA 2P9CA 2IZ0A 4CM5A 1IULA 3GH3A 3HJAA 4LVUA 4BMSA 1ONNA 4OSPA 4RQUA 3UAGA 1M67A 3GAZA 1PJ2A 3H9GA 4LCEA 3LK7A 1AHIA 5DT9A 4OGWA 2DTXA 3OFSA 4CMIA 5G4LA 1LLCA 1FMCA 3ADOA 3JSAA 4IIUA 4FW8A 3DB2A 1P3DA 4L74A 4J2OA 4BNMA 3IAHA 1VSVA 3KUXA 1K6JA 1LRLA 3ONDA 3UW3A 1I5RA 2O7QA 4R1UA 1K5HA 4PLHA 3W8FA 2O48X 4JCOA 5TJ9A 1VE9A 4YAEA 2O3UA 3E48A 4CL3A 4FDAA 5F1PA 3RIHA 2DUUA 2Y99A 1YXMA 5T5QA 4GGPA 1G6KA 3DAFA 1H5QA 3RUDA 1KOLA 3FBGA 4X54A 3ST7A 3K92A 1R0SA 1EDZA 3F4LA 4IS3A 1U4SA 5I7FA 4GLLA 1TLTA 4IQ8A 3RBXA 4DPLA 4E0BA 3O8QB 1E6EA 4FD3A 2YHUA 3WLEA 2EGGA 3GDGA 3MZ0A 1NWHA 3PFFA 2ZK7A 3OSUA 4N54A 1ZK2A 4BL5A 4E6PA 4UREA 4KP7A 5H82A 2CDBA 3HUDA 4YBZA 1SB9A 3VZQA 1IZ9A 5JMWA 4EITA 2AE1A 3FR8A 1PGQA 4PGFA 4L4RA 5CG2A 3JQ9C 4NHEA 2NTJA 4QTZA 2RHRA 1DXYA 3VPHA 1EK5A 1OC2A 3RC1A 4GLOA 4R16A 3NGXA 4BQPA 4G5HA 2OOSA 3EW7A 1J49A 3BMOA 3H65A 2HRBA 5L95A 1GQ2A 4RF3A 2X5KO 4D79A 2AEMA 4E5PA 3D5TA 1VKNA 1NASA 4FFNA 3LF2A 1O5IA 1EFKA 3G1UA 3INTA 4Z0HO 3MWEB 3INRA 1TVEA 1X13A 5A5EA 3NV9A 3AI2A 4YJHB 5CEJA 4NJMA 4YRBA 3GN1A 2VUSA 1P1KA 1N92A 1ULUA 5IXSA 2D0IA 2FP4A 3JD4A 4TROA 3WWZA 1BDBA 3IKTA 3IP1A 5A05A 1QYDA 2YV1A 3K2EA 3Q2IA 2X4GA 3N7UA 1KY4A 4Y6SA 1P1IA 3FTNA 3ETGA 4PLVA 3D4NA 3VH3A 3NRCA 1MA0A 5KTKA 5DOVA 1N7GA 4UUOA 1U8FO 3M1LA 1SBYA 2X5OA 4WE3A 1X15A 3BXXA 3OIFA 2JFFA 4O1MA 4CUZA 3VZSA 1Y8QB 4Y98A 4RJTA 4PLFA 4QO7A 4BMVA 4WECA 2A35A 4DA9A 1LLDA 2AEJA 2DBRA 2Q2VA 3TFOA 1DO8A 5JC1A 1YRLA 4H15A 3ABIA 5A3VA 1PU2A 3JYLA 4GPD1 4GKVA 1PL8A 5KWEA 4GAEA 1GYRA 1HYEA 2ZB4A 5CAEA 1U28A 3T7EA 4A03A 4J49A 2FPPA 1ZCJA 3DHYA 3ZWAA 1XIVA 4S1VA 1E1LA 3JQ8B 5L7WA 2E4AA 2IODA 1DIHA 2SCUA 4CUKA 3WGIA 3CEAA 3VVCA 1HYGA 1ZJYA 2VHVA 5DBFA 4IXWA 3TZ6A 1LSSA 1LDYA 2ZATA 4CMAA 5C7IO 3LLSA 3Q9UA 4EZBA 5A1TA 4TZTA 1PIWA 3FPCA 1PQWA 4IM7A 1YB5A 3PTZA 4TZKA 4UVGA 5CDTA 4IMRA 4YT2A 1KEPA 1X1EA 4D7AA 2NTVA 2B35A 3ROKA 4DLBA 1E92A 1LA2A 2XF8A 3HWRA 4EW6A 3IUSA 3DBLA 5I7VA 4B7XA 2ZYAA 4E5KA 3ROMA 2Y0DA 4E21A 4CMEC 3PWZA 3RUFA 5EERA 4NBVA 2ZKLA 3RKRA 3RFXA 3GEMA 3ZWPA 3C8MA 3L77A 2J5RA 1AUPA 2TMDA 4IZHA 4KUHA 5A02A 4WCDA 4J7CA 5JDIA 4IZIA 1TT5A 1D3AA 4YEDA 5IDYA 1LLUA 3ZV6A 3AWDA 1HXHA 2RCYA 4C4OA 1HEUA 3D3WB 4RF4A 3SX2A 1P0FA 1P74A 3PFWO 4GWKA 3FHLA 1NQTA 5TGDA 2CZCA 3JQAD 3IJRA 3NJ4A 4BV9A 5IDXA 2FPGA 4BQRA 3EYWA 1QYCA 1O8CA 3ANMA 4ZA2A 1R4NA 3WXBA 2PD4A 1XR3A 3GHHA 2PZMA 1P44A 4RVHA 1ID1A 2VRBA 3DQPA 1KVSA 1MGOA 1FDVA 2H6EA 3WSWA 1K2WA 3P7MA 3OETA 1R37A 1U5CA 2QRLA 3JQ6A 3Q3CA 4YAJA 1E3WA 4RL6A 3QSGA 3UICA 5ADHA 1ISHA 1PJQA 4BHTA 2WD7A 1O95A 1PGOA 4OKNA 3JYQA 2JAHA 2CVOA 1SEVA 3EGOA 2YQ4A 1PS0A 4P8RA 4IJVA 2I3AA 3HE3A 2NM0A 1KVRA 1GV0A 2W2LD 1D8AA 4A73A 3GG2A 5A06A 3K6JA 3FSRA 4QFDA 1WXDA 1GZ4A 5DN9A 4EUEA 4JP2A 1A4IA 5AOVA 5H81A 1B16A 5T6BA 1UZNA 3AI3A 1DAOA 4RPHA 3O03A 2YYYA 4R68A 4P4NA 2JAPA 3TFQA 4RDHA 3OHSX 1A5ZA 1N7HA 3ITKA 3SXPA 2EEZA 4QFCA 4HUJA 1DLJA 3FI9A 4Y9DA 4MIEA 1ISIA 2EIHA 4JNKA 4RO0A 3PJGA 3S2GA 4RGBA 1Z7EA 1SOVA 4H3VA 1HDCA 2QIOA 2FZEA 1P1HA 3CZRA 3GVCA 2B5VA 3ENKA 3I6QA 6ADHA 2DAPA 6LDHA 1T25A 5TF4A 2NU8A 3VPFA 2VHWA 3PJEA 3D0OA 2X8LA 3HZZA 3ZNQA 3KYCA 2C7GA 2NVUB 1B8UA 4FPXA 3RUAA 2DFVA 2J3HA 2G5CA 3D5QA 3ON5A 3RWBA 3KYDA 2E6UX 3VTZA 2ZYDA 1EVJA 3ICPA 1XQ1A 2WDZA 5L3ZA 2X0IA 4NZ9A 1UJMA 3PEFA 4R9SA 3KSUA 4I9NA 2J5KA 3BIOA 4IJWA 2HU2A 3D64A 1EEHA 3K31A 3OICA 3G17A 5KJCA 1T2EA 5AQ1A 3R1IA 4QEDA 2Q99A 4ALMA 2WSBA 2GDZA 3HHPA 3VH4A 1H94A 1ENYA 3G1TA 2JKVA 3KHUA 2VYNA 3B70A 3ZU5A 4WLUA 4MPDA 3WFJA 3A9WA 4XEHA 2VYND 7MDHA 5DF1A 2GNAA 4FCCA 5KVVA 3UFXA 4W4TA 1CJCA 5L45A 3GA0A 4RZIA 1WZIA 1LXCA 4PZDA 3M2TA 3ZH2A 3T7CA 4ND2A 2J3KA 2YFHA 3AUSA 3EMKA 4PG4A 3W8EA 3UCXA 3UOGA 2W90A 3FRJA 1C1XA 2GF2A 3RSHA 5IZCC 2I65A 1CIVA 5K6AC 3GY0A 4LCJA 4MVJI 1YQDA 2UUPA 3LLVA 1HE2A 2GD1O 3DBRA 1AN9A 3TPCA 2D59A 1BW9B 5A03A 5ICSA 2OP1A 3H9QA 3ZGYA 4IJKA 3HN7A 1CYDA 1IYZA 3PWKA 4E5NA 4AJ1A 4M55A 3DOCA 1P0CA 2VT2A 1WDLA 4AL4A 1NX6A 4L73A 2X9NA 4CL8A 2P5YA 3NT4A 4ONEA 1A71A 4DRYA 3WYCA 5KKCA 5KCZA 5G0TA 4BB5A 1GEGA 3ANNA 1B14A 5JPIA 3UKOA 5CHEA 4BNVA 4BGIA 8ADHA 3GQVA 3AFNA 1N1EA 3DZIA 1XELA 2DKNA 1ZSNA 3M1AA 1GFSA 3A14A 4U6QA 3BHIA 3RBZA 5I8WA 1YL5A 3U09A 4CMHA 1LI4A 2Y93A 3FR7A 3X2EA 3ZW9A 3CKYA 4YAGA 4AJKA 1YVEI 2BGLA 4BNWA 1U2DA 1RYEA 1I32A 1DFHA 2GR9A 4WLVA 3ZHZA 5FYDA 1BMDA 4AJHA 1PZHA 2D5AA 4WOKA 4MVJD 1NVGA 2CMDA 3GVPA 3H5RA 1QYVA 4BO1A 2VYVA 5ITWA 4GMFA 2I9PA 4ZD6A 1UP4A 1HDXA 3MJEA 5F1KA 2FHSA 4J1QA 4YDRA 3VKVA 2JL1A 3TZKA 2B4QA 4TKMA 5L40A 3GPIA 3I3OA 5JLAA 4PVDA 4PIVA 4LGVA 2EERA 5HM8A 1JKFA 2J5QA 4H7PA 1EDOA 3GMSA 4NFSA 4MVJP 3SC6A 2JJYA 4NPCA 5B4TA 3KVOA 4GKBA 1SEPA 1C1DA 3FTPA 2J8ZA 4D42A 2RBEA 3PYXA 5A9TA 2GZ3A 1PR9A 4HFNA 3CZMA 3AI1A 2NADA 4UEKA 3W8DA 2VQ3A 2J6IA 4I1IA 4AJLA 4CMBA 4NMHA 1YB4A 3H6KA 4E2XA 2Y1EA 3PLRA 3QV1A 2VZ8A 2C5AA 4CLOA 5AXDA 5AXCA 2CDAA 5F3RA 3FN4A 3IC5A 1EFLA 1UH5A 3QWAA 4K26A 1DLIA 1J4AA 2Y0EA 1GZ6A 1EBUA 1UP7A 2VUTA 2OO5A 3GNTA 2D3TA 4F6CA 1DIBA 1I24A 2B83A 4CMKA 4IY1A 4GWGA 2FSVA 4W82A 1IUKA 1GV1A 3TQHA 3ZWNA 5JS6A 3FNEA 4BB6A 3BMCB 4OH1A 2NU9A 4RZHA 1JW9B 3RROA 2HMVA 4AJ4A 4P22A 1T4BA 1FDWA 3DBHB 5DZSA 3V2HA 3AM5A 2UVDA 4XYBA 2O3JA 1I01A 1YBAA 2R00A 2YQ5A 1I3KA 1L7EA 4HX5A 5ENVA 5C5IA 2D8AA 3EAGA 1O6ZA 1DOHA 4WLNA 5DBGA 4OO3A 2EW2A 3LSYA 4WCFC 1Y8RA 3DR3A 2VNAA 1YONA 1UXGA 3WBFA 5JAQA 1PZEA 2X0RA 3WGTA 3U49A 4HV4A 1DIRA 3QVTA 1I10A 3U4IA 4XWYA 5B4VA 2WYUA 5TT1A 4XRRA 4E32A 4F6LA 4YJFA 2NSDA 3KLMX 4ZQFA 4UVEA 2Q50A 2GZ1A 3JQCA 1PS8A 3ENNA 4XZ3A 4PLTA 2OORA 2QZZA 1IB6A 3OJLA 4GI2A 3F4BA 1YJQA 4OL9A 5IDQA 4U7WA 1T4DA 3HDQA 5T57A 3ZWBA 5IFLA 4BO5A 4YQZA 1CQJA 3UHAA 5JAZA 2YHIA 4R69A 4MO2A 1NYTA 3B6ZA 1O0SA 2Q45A 4W6ZA 3LC7O 2PZKA 2GGSA 2VWQA 3ETEA 3LDHA 4BO2A 1CF2O 3QE3A 3E1KA 3TZHA 2TMGA 3KEQA 3U62A 4CMGA 1CETA 1PJBA 4OKIA 4GBJA 3VPGA 1V3VA 2NVBA 4PLWA 4CODB 5H83A 2PD3A 4TVOA 2B4TO 3ZV5A 4UEOA 1I3LA 5IN5A 2X86A 3WGHA 5LDGA 1NR7A 3FD8A 3ZZNA 3ZNOA 5L4NA 4CV3A 1ZXBA 1GUZA 2NQTA 2VRCD 3BZUA 3RUHA 4D0SA 2FPIA 3C1TA 3ICCA 3RAJA 3L6DA 3A4VA 3GMDA 2G0TA 4PFJA 1VL0A 3G0OA 4L9RA 1DB3A 4J7UA 1ENOA 2FR1A 2BD0A 1Q0QA 3FCOA 3RC9A 5A3JA 1R16A 4MIYA 2FSSA 3KV3O 3PYLA 1LDMA 4NG5A 4RVFA 1KERA 4PG5A 1UAGA 1XHLA 3KB6A 2UV8A 4BNKA 2HUNA 1R6DA 3BHJA 3GGGA 1V35A 2Q2QA 5COAA 5JYDA 4IMPA 2D1YA 3TZCA 3ROPA 3WJ7A 4Y6RA 3GEGA 2ZTVA 4M89A 4YCAA 1H6DA 3AY7A 1VLLA 4FC6A 4ALLA 3UCFA 2H1SA 4ALIA 5TRTA 1PWZA 3BAZA 3MJTA 2P5UA 3AW9A 2YUTA 4KUGA 3ZU3A 4L75A 3C1OA 1PJSA 3S55A 1Z74A 3LT1A 1DDOA 3V1TC 4YRDA 4MOWA 4QXMA 3R0IA 2O23A 4BMNA 2VWPA 4DLAA 2OFPA 1CQIA 5TSDA 1IE3A 3DONA 3EVTA 2Q1TA 4YYZA 2BGMA 3E18A 1C0IA 4O63O 1VKOA 1XSEA 2YY7A 4E33A 4NI5A 4AJ2A 3JQFA 1C0KA 4DPKA 3O4RA 3I83A 4W7IA 4ZJUA 4RV9A 4ZICA 4CM4B 4YQYA 4YTEA 3VZRA 1A4UA 3C1AA 2A4KA 1YOVA 2VZ9A 3Q1LA 4WNCA 4BOYA 2NUAA 1U3UA 2PLAA 5COBA 5JFOA 5T8KA 3V8BA 1E1NA 1E77A 1UDBA 5LC1A 4PZCA 5LDHA 2X6TA 1HZJA 3DZBA 4QT0A 4CMIB 2HDHA 1SNYA 1UZMA 1WAMA 1DRUA 2O3QA 1NVMB 1W73A 4WNIA 1JTVA 1J5PA 3AY6A 3CINA 3TDKA 1E3EA 1NP3A 2PNFA 2V7PA 1UXKA 4J9UE 2QYSA 3NGLA 1YJ8A 3PGJA 1GTMA 4LISA 4NQZA 4BNYA 1ML3A 2AG5A 1RM4A 1F14A 1E3LA 3DMYA 5AXAA 3VVBA 5A9SA 3PPIA 4PRKA 1LRKA 2HMSA 3H7AA 4XR4A 4KWIA 3VAZA 3SC4A 1WPQA 4WEQA 2X1HA 1KVTA 3ZU4A 1T2AA 5IAAA 4HFJA 3A06A 1Z7BA 3WFIA 3AUUA 3C85A 3QWHA 5F1OA 1Y1PA 2YDYA 1U9JA 3NYWA 2GPTA 4J1NA 3PYMA 2I99A 1K3TA 2WJPA 1WW8A 2RH8A 1Y9AA 3DZJA 1CWUA 3O8QA 4JLWA 1T1SA 4JJIA 5GZ3A 2IEDA 3KSZO 3RJ9A 1A27A 2CDCA 2OBNA 4BNFA 2ZB3A 5G4KA 4MKZA 1JDJA 2AEFA 4OQYA 3GF4A 1V6AA 1PL7A 3BMOB 1HDOA 3M2PA 3HB5X 1IL0A 3BMQA 3H8VA 4J0EA 4MP3A 4LMPA 4NNJA 1VM6A 3Q9NA 1QLHA 1UR5A 1DHTA 4Z9FA 1GAEO 3AOGA 3GFBA 3JCZA 4OM8A 4CM3A 3Q11A 5CDSA 2J3IA 5T64A 2ZTLA 2B4RO 4F3YA 3L6OO 4DL9A 1F12A 1I3NA 3CUKA 4NJMB 1JU9A 3IOYA 1KIFA 4GGOA 3ASVA 1S7CA 1MG0A 4II3A 1KYQA 3VPSA 4BKOA 3B20A 4G65A 4ID9A 2H9IA 4XJSA 4I8XA 1GZ3A 1JLLA 1AGNA 1NPTO 1ONOA 1N5DA 4IIVA 2Y0CA 3FPLA 8LDHA 4IXTA 2E37A 2VWGA 2EWMA 4XA8A 4MKRA 3R6DA 4CLHA 4NDNE 2IZZA 4M86A 1GD1O 1JKJA 3FWNA 3CSDA 3NTQA 3O38A 4B4UA 4RF5A 3LYLA 3V5NA 4FFPA 5HTOA 1NQ5A 1KEWA 5ER9A 2Z1MA 3KZVA 4CM8A 3KRTA 1PWXA 5JDCA 1PJ3A 3RC2A 4B8WA 5MDHA 4DUPA 2XPCA 3DFUA 1ADBA 1GYQA 1ZEMA 3LT2A 4TRNA 4DGSA 1T2CA 1GCOA 1E1KA 1GUYA 2IZ1A 5GY7A 5BR7A 1LJ8A 1Q0HA 1S6YA 2VHYA 5B4UA 1R15A 5TNXA 1LSUA 4HXYA 3E9QA 1U2GA 5HS6A 2GN8A 4XX0A 1HE5A 1XA0A 4RVUA 2J3JA 4FOOA 2X58A 3O9ZA 4TMFA 3QVOA 1Z45A 3T4EA 1T24A 4INAA 4PLPA 1DJNA 3RBVA 2FN7A 5F5LA 3UN1A 1GY8A 3DZGA 4IGFA 3H9UA 1ADFA 3OJEA 3RFTA 3VH2A 3W4KA 2PZJA 2BRUA 4CR6A 2A9FA 1EQ2A 1W0CA 5GZ1A 3WQQA 2O7SA 3DBLB 4FJ0A 3K5PA 1DJQA 4Z0PA 3AU8A 3F1LA 3ETDA 3I9OA 5EQDA 1V8BA 4QECA 2FR0A 1LDEA 4MIOA 4YT5A 4U5QA 4CQMA 2P9GA 4GMGA 1QORA 3G49A 2JFHA 4DBVO 3UCEA 4J0FA 2YZ7A 2DBQA 1TT5B 2VHZA 2O3TA 3HN2A 4IDCA 3SEFA 4MKXA 5LCXA 1H9AA 4B8ZA 1E3JA 4FJ2A 3G79A 3JQAB 3RFVA 3MEQA 4FJ1A 1E6WA 3W1VA 1ORRA 1RYDA 4E31A 5HWSA 3RKUA 4IQGA 1PQPA 1Y81A 3ZHYA 4ZGWA 1UAYA 2EJWA 3V1UA 4KZPA 1V3TA 3VPXA 4PRLA 2G76A 1R4NB 5J23A 1VC2A 1Z73A 4WK6A 3I52A 2AQIA 1LDBA 3LC2O 4BNIA 3GZNA 3UVEA 4QQRA 1MXFA 1BXZA 3KBOA 1UDCA 2Q1SA 1RM5A 4NIMA 5EMHA 1M76A 1BXKA 3GVIA 2JFGA 4FS3A 1N8KA 2PK3A 2V65A 4BNXA 2UDPA 1E3WB 2CVQA 4DQUA 3ZWOA 2FWMX 5TX7A 1CEQA 4BIIA 3GLQA 2QZ9A 2Z5LA 4GX1A 1B8VA 1F17A 2I5PO 2AE2A 3PIIA 4Z9XA 2H5LA 2HKIA 3ITDA 2Y66A 3UGKA 4WKGA 4CM7A 3I4CA 3I9KA 5CFZA 4W9NA 4WGGA 2Q3EA 4CLDA 1B8PA 3N74A 1E7WA 1PJLA 4UEJA 1GYPA 1WMBA 3DOJA 1YH3A 5TJHA 3L4BA 4Y8VA 2HK9A 4R41A 3U0BA 4E12A 4ZRNA 1JA9A 3P2OA 1O89A 1B15A 4BNJA 1K6IA 1QSGA 4XGKA 2HK7A 1IHYA 4DQXA 5TLSA 1H6CA 4NK5A 3WICA 1EUZA 1M2WA 3OQ6A 3DOOA 2PKQP 1GUFA 3NAQA 3JD1A 4WPGA 4YRAA 2X0JA 1H2HA 1OC4A 4U0KA 2HAEA 3I5MA 1XWFA 1NPDA 1ZK1A 3COSA 5K0ZA 2WM3A 4A27A 4CJXA 1NFFA 2VHXA 4ZQEA 3OIDA 4YA6A 3KYCB 4BNHA 5KNLA 2VOJA 1I8TA 2B5WA 2X9VA 4AICA 3PDUA 3DAGA 5B12A 5JY6A 4DBZA 3KYDB 4WCFB 2E49A 3ZWMA 2NVUA 1HETA 3BA1A 1DBVO 1VJTA 3GRKA 4I9HA 4WLFA 4EBFA 2EV9A 2P4QA 1N9GA 1NQAO 1ZUD1 3ZWVA 4BGUA 5I8ZA 3NTOA 2FR8A 4O5OA 1ZH8A 3WOHA 3L07A 2X9GA 4LSMA 3F46A 4IINA 3MOGA 4FFMA 3U4CA 2AQKA 2IDZA 3ZNNA 4ND3A 5L53A 3I9NA 1QXSA 7ADHA 3NT5A 3ZWYA 4LSWA 1PZFA 5CDUA 1ONPA 4IGEA 4E5YA 1NM5A 2E48A 1U5AA 4LK3A 4ZQBA 4R01A 2IRWA 1ARZA 4AFNA 1J0XO 4JN6B 3GZ4A 9LDBA 3NT2A 3OJOA 4ILKA 2C59A 3WNVA 1IPEA 4IQ0A 4BNGA 5A9RA 1LDNA 1GQQA 5GMOA 2Y67A 4XYEA 3WTBA 1DRVA 1JQBA 2FMUA 3GNSA 1B26A 4TRRA 4CV0A 2DFDA 2OZPA 4NH4A 2Y1OA 4CLXA 4WASA 5KJFA 4Q3DA 3BTOA 1C1XB 5EJ2A 2Q2WA 3CXRA 3DBVO 4N5NA 2GYYA 5I7SA 3FNGA 2W2KA 2H63A 3DBRB 4LRSB 5GZ6A 2PTGA 5ILOA 5F5NA 4E3ZA 1X7HA 5DCWA 4A10A 3I9JA 3PQFA 4KTTE 1L7DA 3ZI0A 1D1SA 5CDGA 3QLJA 1V9LA 3DTYA 5KVQA 4CQLA 3OA0A 5CPBA 1B0AA 2BFMA 2EP7A 1F0YA 1D7OA 2YJZA 3C7DB 1Q0LA 1E7QA 1ZSYA 3VTFA 3MTGA 4R1SA 4Z3KA 1YE3A 1BVUA 3NX4A 3INGA 2RAFA 2IXBA 3FWZA 3AM4A 3IP3A 1ZVMA 1ISMA 2R6JA 3BTVA 3RUEA 5JDIC 1H9BA 3B1KA 1YL7A 4J7XA 4R54A 5KJ1A 1MFPA 3U9LA 2YDXA 4MVJM 1BXGA 2B69A 4D0RA 3LT4A 4Q9NA 1LC0A 3S1LA 2D4AA 5U4QA 5A4DA 1X0VA 1P1RA 3HG7A 4DIBA 2CD9A 5TIIA 9LDTA 4NFHA 1Q7GA 3UXYA 1NWCA 1VRWA 2PD6A 1ZMTA 5IXYA 1U8XX 3JD0A 1C14A 3DZFA 5JNLA 1VL8A 4CM9A 5FF9A 1X7DA 1XEAA 4JQCA 5L4SA 4OYRA 4CM9D 2VYVD 3EHEA 4BO0A 4RVGA 1MUUA 1P1FA 2I6TA 2PH5A 4XR9A 1SZJG 3C24A 3PXXA 2Q46A 2VZ0A 3E03A 3IIEA 1H6AA 1R4MA 1TXGA 2AA3A 1NFQA 5DULA 4B7UA 5BSEA 2BI8A 3VDRA 5KVSA 4EYEA 1P77A 3ZU2A 4KDFA 4E2ZA 4YVFA 5TS3A 3SJ7A 3NDRA 3WTCA 1XU9A 4F46A 2LDXA 1L1FA 2D5CA 4YB8A 3VHRA 3OA2A 1C1DB 2ZTMA 2BHLA 2HMUA 3QRWA 2IYOA 4NR0A 1DFGA 3WQSB 2NNLD 3GR6A 1RJWA 1E5LA 4R3NA 4W99A 4R4JA 3TL2A 2I66A 4NU6A 2O2YA 2AHRA 4IJUA 3W6UA 2P68A 3UUWA 1PGNA 2V6FA 3I6IA 5C7OO 2B37A 3WMWA 1XDWA 3LU1A 4OHUA 3ZDFA 3D1LA 4CLOB 2XAAA 1F06A 3SLGA 3WYEA 3L4BC 2IYPA 1I2BA 3WBBA 4EDFA 4P4LA 4LRTB 3GFGA 4JX8A 1HTBA 1RM0A 1Q1NA 5AYVA 2WEKA 4HNHA 3PZRA 3OQBA 1HDGO 4JJFA 4GL4A 4IDFA 4FFOA 3Q6IA 1K6XA 1Q7BA 3GRPA 1EVIA 3K96A 2NV6A 4ZRMA 4D44A 3BMNA 4GVLA 1K89A 1KC3A 2X7HA 4ZQHA 3S2EA 3W4JA 4BO6A 4F45A 4AJEA 1SAYA 2CF5A 1M75A 1E7SA 4XJTA 3EC7A 1GADO 3MTJA 2A92A 1WDKA 2WE8A 3DXFA 1JVSA 3E9MA 3CIFA 3ORFA 3PQEA 5DCYA 3NDIA 2Q1UA 4OAQA 4ESOA 3LC1O 4HBGA 5JCJA 1PL6A 5FFFA 4DIOA 2POQX 4OQZA 4TSKA 3JQGA 2WYWA 2PGLA 4ND5A 1C0LA 1D1TA 2XOXA 3AFMA 1Y8RB 3L4SO 2QYTA 3MOIA 2DQ4A 1UZLA 4HFMA 1YDWA 2C29D 3HFSA 1Y7TA 4KDEA 1RM3A 5G0VA 1ZZEA 5A04A 5CEEA 4YJGA 4YJFB 1M66A 3WLFA 4RDIA 2Y1FA 3WGQA 4J2HA 1LX6A 1UXJA 1WLYA 3NUGA 3AM3A 4Z9YA 5I9MA 4Z3DA 3R3SA 3GK3A 2IE0A 1VJ1A 3E8XA 4PG8A 3PK0A 2Y68A 2YHIB 2ZJ1A 2FZWA 4L4SA 5CP8A 3RQSA 3TWOA 3EK2A 1BSVA 3OMLA 2JCXA 2EF1A 4YJDA 2PKQO 5ITVA 4MVJG 4XDZA 4WJZA 1HZZA 3DMTA 4R9RA 5KVCA 4O6VA 3PHIA 1LSOA 2ZCVA 4DMLA 2PFGA 1VI2A 4N7RA 2QRKA 3PGXA 4K6CA 3JQ7B 3E5RA 1EE9A 1MP0A 5BNIA 3WGZA 3V2UA 2CUKA 2PV7A 1OZAA 3E5MA 4YT4A 4ZHSA 4OXNA 2VT3A 3QQPA 3GAFA 1HDRA 4O0LA 3TOZA 4NFYA 1NXQA 1UUFA 3IL2A 4M54A 4M1QA 4BNTA 1JKIA 3PRJA 4PLCA 5JW6A 3QP9A 4HP8A 3ZHBA 4TRJA 4W7HA 1LBEA 1EVYA 1PTJA 2IEBA 5IDWA 3IMFA 1E7MA 2XXBA 3GVXA 2Z1NA 1FXSA 1LNQA 4CM6A 1ZJZA 2FOIA 1KEUA 5BNFA 5HBRA 1UXIA 4RF2A 3RUIA 1WVGA 1T2DA 3OM9A 4J4TA 4JBHA 4NK4A 4J3FA 3VKUA 4CLRA 1NAIA 2W8ZA 2CVZA 1PSDA 3B1FA 4Q3NA 1E1MA 5EIOA 3RVDA 4AJJA 1N1GA 2EKQA 4NBRA 3JQDA 4DYDA 1YQXA 1FDSA 1F8GA 1PQUA 3HDJA 3I4FA 4GVXA 3KLPX 3KO8A 2NACA 4S3MA 4PG7A 3WX0A 4DREA 5DDIP 3ONEA 2NU7A 3EZYA 1I33A 1TB4A 3SBOA 3D3EA 2W4QA 1PEDA 2X0NA 5U1PA 3CH6A 4B4OA 2HLPA 3KTDA 3K73O 2NVWA 1Y6JA 3QY9A 4CR8A 1C0PA 2HJRA 1I2ZA 5TQVA 1NFRA 4BVAA 2UYYA 4M87A 4CMEA 1V0JA 4XCVA 1IY8A 2DUWA 3HDHA 3QWFA 2EW8A 5EINA 1SOWA 4DMMA 3RUCA 4RQTA 3V2GA 4Y6PA 2IXAA 3A28A 1GEEA 2O3SA 3P2YA 4YT8A 4IDGA 4FOSA 4ND1A 3KYBA 4AVYA 1NVTA 4N5MA 1GDHA 2ET6A 4KUEA 4AJNA 4XRGA 1FDTA 1R0LA 2BKAA 2JD1A 3FBTA 3WIDA 1YOVB 4TKLA 4NBWA 1EVZA 2HK8A 1G0NA 3H5AA 3OQ1A 1ZSVA 3TSCA 1E3SA 1WDMA 4BKPA 2NWQA 1JWBB 4XYMA 3ONFA 4HKTA 5BNTA 3PQDA 2AQ8A 5G0SA 4ZN6A 1YB1A 4G2NA 2WTBA 4A0SA 4NBTA 4D3SA 1GCUA 4LN1A 3U4HA 1M6HA 1RWBA 1NHWA 4OSOA 1YQGA 3PHHA 4LVCA 3L9XA 3OF2A 4M8SA 1A7AA 3RJ5A 4GX0A 2D2IA 3A1NA 5A9SB 1K0UA 2C5EA 1F8FA 4P38A 5HA5A 1DC6A 3UF0A 3F3SA 1PGPA 3WWYA 4LW8A 1JAXA 1I2CA 1KVQA 2CSUA 3GGPA 5G0WA 1HYHA 3AOEA 2GN9A 1WNTA 1I36A 4IDAA 4K28A 4CUJA 4BKQA 1LTHR 1AXGA 3HADA 2R00C 1EUCA 3U4DA 1Z6ZA 4Y67A 3PI7A 5THKA 4UVDA 2GZ2A 4XGIA 2G82A 4URFA 4II2A 4DIFA 3GDFA 4GH5A 4R5MA 2C2XA 1B3BA 5KIAA 3HDYA 2HQ1A 4OXYA 4C7JA 1XG5A 3RI3A 4TRMA 3W4IA 1P45A 5G0UA 4Z0TA 4JP3A 1NBOA 1WWKA 1CERA 5G4KB 4XDYA 3RU9A 2QQ5A 4D45A 1C3VA 3D7LA 4DXHA 2E82A 1DPGA 1W4ZA 2EHDA 5AVOA 5JBIA 4I08A 3EVNA 3KOUA 3MJCA 1DC4A 2HO5A 3ADPA 3BMQB 3GN2A 1MFZA 4FSHA 2OP0A 4BO4A 1DC5A 1LSJA 3VC7A 2DLDA 4AJOA 3LF1A 1ISJA 3GG9A 1KEVA 2GSDA 2UUOA 4J1TA 2I76A 1ISGA 2DT5A 4YJHA 5FEUA 3H2SA 2GASA 4FQ8A 4NJOA 3TL3A 2V6GA 3D4PA 3DAPA 2DTEA 3DMTC 3JD2A 1B3RA 4IPTA 1Q2XA 2CNBA 2Y1CA 3AJRA 3G3EA 5DP1A 4BUCA 5JXWA 2NU6A 2GO1A 1VSUA 2VWHA 4JGBA 1HL3A 1ISFA 1P31A 5DNAA 3F5QA 3HNPA 4CM1A 4PLZA 4WUVA 3WG9A 3ZWXA 4I5DA 3FF4A 1QYWA 1EMDA 1H0KA 4U6SA 3TN7A 2FY8A 1NHGA 4JBIA 2F1KA 3FNHA 2C2YA 2W98A 4R3WA 4XB1A 1HDYA 3NEPX 1QYXA 3H2ZA 5EL0A 3OBBA 1Y5RA 1YO6A 2DU8A 1ZK4A 2O4CA 1Y8QA 2X23A 1YBMA 3AU9A 5ER6A 4DWVA 3E6AA 3BYZA 1XU7A 4OIMA 3SJUA 5BSFA 1ENZA 2WWRA 1LLQA 4N18A 3S2FA 2P91A 4CM8B 1U3WA 3DZKA 3MJSA 1MG5A 3Q0EA 1PGJA 3ZWCA 3HB4X 2ZIZA 3V1YA 1DSSG 3GUYA 1ZK3A 1TI7A 4PN3A 1ENPA 1XGKA 2YV3A 4FIZA 4BNNA 1T26A 3WMXA 1ZBQA 3EUWA 3JQ8A 3F9IA 4ALNA 3QIVA 1NNUA 3EDMA 1KC1A 2PGDA 1I0ZA 4EI2A 2OHXA 5JC8A 2P9EA 2ZYGA 2Q1WA 1HE4A 4OJNA 3PHLA 3RD5A 5IZCA 1RPNA 5K6AA 3NTRA 3WB9A 1JN0A 2JD0A 4RORA 2AW5A 2ZQZA 4UUPA 1MX3A 1GPDG 1PR3A 3F47A 1O9BA 3TRIA 4KWHA 3SLKA 1XCBA 5JO0A 5CG1A 3UH1A 1IHXA 2PZLA 4BO8A 4MJLA 5IZ4A 4DLLA 2O4UX 2FRDA 3VH1A 2HCTA 1NPYA 2BFPA 4JJGA 1OOEA 1UDAA 3KEOA 3JD3A 3GNQA 4CQMD 2QHXA 4CQMB 4TVBA 4FR5A 1OI7A 4E2WA 3JQFC 3NKLA 1GR0A 2VTDA 4M49A 1OMOA 2GERA 2GUGA 2R2GA 4D43A 1QLJA 3D3WA 3R3JA 1VJ0A 1EQUA 2DPHA 4OMUA 4HWKA 5G2OA 5T8KC 5KOIA 3H9JA 3DO5A 1LDGA 4ALJA 4EEXA 5F21A 2C82A 4R1NA 3JQAA 1D4FA 3QVSA 1QMGA 3BTSA 2OXIA 5I9NA 3CMMA 3MJVA 3KETA 4DC1A 4PZEA 2ZB7A 2C7VA 3GZNB 1UXHA 3QVXA 2G17A 3IJPA 3K30A 2EKLA 2WD7B 1JWAB 2WE7A 3WSVA 1KVUA 3GC6A 4ROSA 4RCVA 3LT0A 4PCVA 1W6UA 2CY0A 3JV7A 4BNLA 5JSFA 1UP6A 3PJDA 4FFRA 1JAYA 4GX2A 4XQEA 3RU7A 2ZCUA 4TWRA 3O26A 4JBGA 1YGYA 4IUYA 4I5FA 3PZBA 1T1RA 3NDJA 1NAHA 5L9AA 2W2LA 3PHJA 1FJHA 1SC6A 4UVHA 3AOEC 1YDEA 5EN4A 5JMPA 2O50A 2GN6A 4FGSA 4YAIA 5IG2A 2DBVO 2JHFA 1EBFA 4IS2A 4D3DA 4I5GA 2EP5A 3P5SA 1YS4A 1X7GA 4J16A 4MVJE 2JCYA 3ZWWA 1BHSA 4JK3A 3DL2A 1LC3A 4Q3EA 1WMAA 2EG9A 2B0JA 5JYEA 1R66A 1FF9A 4B7CA 4K6FA 3C7AA 3RCBA 2JHGA 1AHHA 5I7EA 1P9LA 1U7TA 1A9ZA 3Q2KA 2CF6A 4N5LA 3LQFA 1OBFO 3E82A 2QX7A 2Q4EA 4B4VA 5JAIA 1DEHA 1U3VA 3TJRA 4CR7A 5C37A 1QR6A 2V6MA 5DP2A 2GLXA 5I9LA 1YWGO 1ZNQO 1ZO8A 2QRJA 3GDOA 3VDQA 3X2FA 2CFCA 4PG6A 3KSDO 1E7RA 3CMCO 4KTVE 1EK6A 2YFQA 2Z95A 3PWSA 2C54A 3VOSA 1DIAA 3IS3A 3K8ZA 3N58A 1PJTA 3PJFA 5ICMA 4MDHA 3MCVA 3QVWA 1HWYA 4KQWA 4YXFA 1Z75A 3JQBA 5C7LO 1MB4A 3WS7A 1R0KA 1HLPA 4PVCA 4IDDA 3ZV3A 4J43A 2UAGA 4WEOA 4OOFA 1N9GB 1XYGA 2ZB8A 3CTMA 1SO8A 4WCFA 4WLOA 4BGVA 4J91A 5DBIA 2HJSA 1OFGA 1ZMOA 4RVSA 1ZIDA 4EJ6A 1U7HA 3DEYX 3ZHXA 3AK4A 5BSGA 1X14A 3CE6A 1LUAA 4QUKA 1ZK0A 1A72A 4ZU3A 4WOJA 2WYVA 3F1KA 4B3IA 1CRWG 3QWIA 2VNSA 2LDBA 4HY3A 2GCGA
chains in the Genus database with same CATH superfamily
1YIOA 5JDCC 1V1RA 2W2PA 1TEZA 2A94A 3HCWA 4L4XA 4LVNA 3ZZ1A 1X1AA 4LC9A 1PJ4A 3O4FA 4JJ8A 2VCEA 3CX6A 2OOKA 5ENDA 1O0CA 3QF4A 1EI9A 1B6SA 4E4TA 1BMFD 1X3SA 1C0EA 4FUTA 1GGFA 3DDNA 4B0PA 2EZ9A 1T0JB 2MR5A 5JAMA 4XIJA 4XYGA 2H1LA 3FUTA 5KJEA 4EUFA 4IDOA 1XJWA 3E7FA 5FADA 1QGZA 1V8FA 4MR9A 4ZALA 5KNBH 1NI5A 4RPJA 1P1JA 4HDOB 1U4OA 5IXJA 3NIDB 3TK1A 3FZNA 1JNXX 5I7WA 4B7ZA 5IJ0B 1QRTA 4IUBS 4AK9A 5F98A 4KO3S 4KIFA 4UE3S 3QWBA 4Q05A 5LUAA 2W2KB 5EIAA 1OU0A 3R8CA 1QU2A 1ZEJA 4FLMA 4HRAA 3MFQA 4JIGA 3WGGA 2FEWB 3FYCA 1N32B 2P9ZA 3L0YA 1ZJJA 1ZXLA 2ILTA 3DWFA 1Q0UA 3NOXA 3IODA 3S2IA 3EUFA 4CV2A 1T5SA 2IIBA 2HRZA 3HDGA 2PZGA 4NMMA 1VFPA 4QSMA 3ZC3A 4PSCA 5JCXA 1Z6PA 1ODIA 4YRQA 4FDTA 3TIXB 4S0ZA 1XTPA 5AJUA 4QSHA 3M8KA 1GPWB 3ZN2A 3RC8A 5A0FA 3IBGA 1R8YA 2E9SA 2TMKA 3MJ4A 2FMXA 2PH3A 2PWAA 3CUEF 1NF9A 1Q1EA 1G19A 2PBZA 2Q9AA 2ZDGA 4TTQA 2XDWA 3QG1A 4XTRA 5EAIA 1TK2A 2FFJA 1RMQA 2FPXA 5LDDC 4DPMA 3OUTA 3EGCA 3DNPA 1IZ0A 3SQXA 1NIJA 3O4VA 1P5ZB 1PJCA 2OBBA 4UQPA 3DXZA 1R10A 3LT5A 3DDHA 4IX9A 2VDRB 3VR4H 3I2GA 1HT0A 2A1IA 1W59A 4UUMA 1IAQA 4CWAA 5LWHA 3ADDA 5HFAA 5L3QB 2O2JA 3FMVA 3LVFO 2XBUA 2C9YA 1ZOPA 2GPSA 3EH1A 4G26A 3OJXA 3SQNA 1SCUA 2W6PA 2E4UA 2HCJB 3ADBA 4ZHQB 4ZVVA 5HIIA 3IV6A 1SD2A 3WO1A 1YJBA 3IT3A 1ESNA 4V0MA 4N03A 4PN7A 4EVQA 5CNIA 4MI6A 2GXUA 2IHNA 1TYDE 3E81A 1J56A 2QU8A 3OF5A 3STYA 4CETA 1T9DA 2R8ZA 4UU0A 1CRPA 2QOEA 3VR3D 1LQTA 5IC5A 3AUAA 3VR6H 1RWWA 1BQ3A 4JXKA 4EO9A 2XRYA 2C77A 3PP8A 3TAUA 3UJBA 4AUMA 4H4CA 4TZ6A 4DF3A 2WU0A 5DSXA 3Q8KA 1DIGA 4FMCF 2IYTA 4BQOA 4XB2A 4HOYA 1R4MB 2PZAA 2IZ6A 4YK7A 3PDJA 2F00A 1W0JD 5DHQA 5I3CA 1XA3A 1KBZA 1W87A 3S1AA 5BP7A 1WO8A 2AD1A 4DV1B 2JARA 3IT2A 3T9BA 3MRXA 5B2FA 4OCZA 1CIJA 1VKHA 2SECE 2Q6OA 4RUKA 3OEHD 4U2DA 2PWZA 1ZITA 4I19A 2ATVA 1MH1A 2WG1A 3E22B 1MENA 3SMQA 3VYSB 3STHA 5E95A 1IZ8A 2BF7A 1OTYA 2GTPA 1IEXA 1OASA 3KS9A 3TXXA 4WDQA 3U1BA 4YH1A 2PL1A 1TJ5A 1AUVA 1ZN8A 2WHEA 5EESA 3ZIAD 1HFEL 4FYPA 3PI6A 5FI3A 4YPOA 5EIWA 4FYIA 2AOUB 3BMXA 4HQRA 1WZEA 3FYTA 1EE2A 3AERB 5BSVA 5KJ6A 1M2GA 1VL6A 2QZPA 5SV2A 3WL6A 2OYSA 1KXZA 2P1RA 4OBEA 3V9PA 3L6UA 4F6RA 2DC1A 3PC3A 1JV2B 1XZQA 2XVMA 1NTOA 4KYTA 4UDYX 1FSSA 2AZMA 3DHNA 1IN6A 1V1MB 2QLFA 4XQ9A 4EJMA 2WILA 1TX4B 2ONZA 3GPBA 5DRTA 4B87A 1E2UA 1T1EA 2WHYA 2ZBQA 4JC0A 3QTBA 2X8WA 4CG2A 2CD7A 4L8VA 1IHPA 1R0XA 3BDAA 2I71A 3WGYA 1Z82A 4EA6A 1KWKA 1WXQA 1YKFA 3PLNA 2F1JA 4HTFB 4YCBA 2OV2A 1JBQA 3OI7A 1UJNA 4OG2A 1L7XA 4V24A 1AO0A 3IYLW 5JO9A 3TR5A 4NCNA 1IY2A 4LZJA 2WVHA 4HXGA 1YS1X 3A6KA 4X61A 5E1BA 4ZANA 4A26A 3QHAA 5JXIA 4TQGA 2LRHA 2A0XA 2WHPB 1U4NA 4URXR 3X1XA 5EQFA 1OX4B 3ACCA 3OLXA 1X0XA 2AUMA 1C8BA 1SRQA 4N40A 4DIEA 4NCXA 5BMVA 4GU5A 3RVLA 1XMQB 2AYXA 1IQRA 2C03A 3HKEB 5AOAA 1OFHA 2NZJA 3J7TA 2FR8C 1UT6A 1ORVA 3GGOA 2H1RA 3W6PA 3BRSA 4F85A 3U5TA 4A2CA 3VI3B 4RV4A 2EXXA 2XNDA 4IGKA 1IXKA 4IFIA 1RPAA 3E7WA 2C9OA 1Z2EA 1XZFA 4H4DA 4JHLA 4PPNA 4Q3AA 1U8CB 5FUYA 3THXB 1TJ3A 3B1XA 1QLWA 2JRCA 3EXIB 3DDOA 4DTIA 4FFDA 4E4YA 4JYAB 5CPFA 1V6CA 4Z8YA 5BT9A 4HSGA 3ANLA 5MGBA 1R0ZA 2Y1GA 1BQ4A 2DUNA 3NYIA 3SM3A 2ZUSA 4QODA 5T4HA 1TE2A 1HR0B 3CBQA 3ZUPA 1X1TA 3PHBE 3ZNPA 2OL4A 3A4MA 2PR2A 1QIFA 1ZCZA 2EZTA 2Q5IA 2QKYA 3QX7A 3OOJA 4GNKA 1EXDA 1YSCA 2EKPA 2FZCA 5GOZA 4G36A 3OOEA 3TRDA 3FB1A 4B4WA 1Y5MA 4BO7A 4HLCA 1ZKMA 2X2EA 4BV8A 5CEFA 3K1AA 1XUOA 2P4HX 4QOHA 1DX9A 2P4UA 2PA3A 3JARA 1K27A 4J03A 5E6SA 1SQ5A 4HADA 5HUJA 2WZBA 1TQ2A 3WP0A 2ZWAA 1XK6A 13PKA 2RI1A 4BN5A 5AVZA 3L1KA 4YR9A 1H6BA 3GT0A 4DM7A 4FYWA 2CXNA 3LZ6A 2FP3A 4U0JA 1FK8A 3CRQA 3LDFA 3PGA1 4FE4A 3OJFA 1AKUA 3SVLA 1P7WA 1IATA 4GXQA 3K1ZA 1J5EB 1BD3A 1UEXC 5I47A 5FI5A 3RVJA 5IF3A 5K0SA 4QXQA 2PSDA 3BXPA 4QPNA 4KQXA 2G5PA 2VRCA 4QXMA 4ZP1A 1VCOA 3REQA 3AG5A 4XSHA 4Z6KA 2NQ2C 1CR0A 4ZO9A 4RKQA 5E8RA 4Q3CA 5T6MA 1FJ2A 3A10A 3L82B 3UMSA 2ST1A 2ZQYA 3G9UA 5AIAA 4NXNB 3P4UA 4D41A 1XD8A 4HDMA 4FE3A 3RYHB 4K9DA 3KLOA 4JB3A 4Q7MB 2ZR7A 3BJEA 4U2KA 1E4EA 3R7AA 1JEQA 2XGMA 3CPHA 5TS2A 1GNTA 2BSXA 3VO2A 2J07A 3REOA 1LBHA 2VTEA 1QH8A 3HEMA 1P2VA 4YV2A 5J3JA 1EXMA 4CLRB 3IUPA 4FQ7A 2PU7A 4ZZ1A 3IPLA 5BWLA 1HI9A 5IKXA 2Q3HA 5M04A 2DULA 3DO8A 2VF2A 1RC1A 4MGHA 4BX0A 3F6YA 4C07A 4AQDA 4GQAA 4Y9RA 5DCUA 2X0EA 1E0DA 2VP2A 3CH4B 3IVCA 3EQ2A 1GNPA 1PFKA 4DQVA 2OUIA 3PUZA 3BXZA 3NTLA 1OXUA 2Q4RA 1L7QA 3MSXA 4EHDA 2HPAA 4WXEA 2OHJA 1E3QA 1V25A 1NV9A 2H59A 3C98A 2ZCJA 2AVDA 5IVHA 3O95A 1SPXA 1MLDA 1XZBA 3OCCA 4J9VA 4QX6A 4X9XA 4EO4A 2ODEA 2P2SA 3E2PA 3M4YA 5IBQA 3IQDB 1W94A 3MJRA 3QXJA 4HDKB 2WWGA 4L0QA 5E7IA 1WSDA 3IQXA 1OFIA 5ELMA 4F97A 2N75A 1RXSA 1RCTE 3N8GA 3GFVA 1YNOA 2XCRB 1ZP6A 2JI7A 2R79A 1E2IA 1QC5A 1HDZA 2BHNA 1WXXA 4LNUB 4KN9S 4UNPA 3GGSA 1CUVA 1VA4A 5FBZA 1W0KA 3N2GA 1SB8A 1RRFA 2QRVA 2V6BA 2YJ4A 5DHPA 2R44A 1TU3A 3F4KA 1XB2A 1MBZA 4NBUA 4GP6A 4G0VA 5SYNA 4BX2A 2R62A 2OBYA 3A9VA 2WINI 4JGGA 4XD2A 4B3XA 4I9GA 2PM8A 1L5RA 3EEQA 1HLGA 2P9CA 5AJWA 4CM5A 2YWHA 1H4SA 3TLAA 4AF6A 3DE6X 4UXHA 2Q3FA 2R8EA 3JAMA 3UAGA 3UWOA 1O97D 2FPRA 3I04A 1TU4A 3LY9A 4PZ0A 2Q5CA 3ED5A 2IIPA 3U17A 3T3OA 5CYFA 2J9RA 2C2ZA 2YWJA 4X1YA 1FDOA 3FY4A 1NV8A 1UT5A 1Z37A 3N2NA 4LDJA 2CKDA 2BBTA 2EYQA 3JSAA 1HA3A 1RQPA 4MJXA 1D2RA 3ZCRA 1NE2A 3DB2A 1P3Y1 4L74A 1F2UA 3EXEB 3AVUA 1NI3A 1NVBA 1ID8A 5A6SA 2AFHA 3EF3A 3OIWA 1E2NA 5CVUA 1I5RA 4R1UA 2XUGA 4PLHA 3V7YA 5FPSA 4JCOA 4W8HA 5TJ9A 1VE9A 4YUAA 2G4LA 2O3UA 4RTMA 1RVDA 5SICE 4CL3A 3ACBA 4FDAA 2FMTA 3UENA 3GD5A 1XRQA 1G20A 1K5DA 4EG8A 2XA1A 1QFZA 3CRZA 2DUUA 2Y99A 5EFZA 1UPFA 1FNMA 3RIHA 3DLCA 1OI4A 4GGPA 4LJRA 5JSHA 1H5QA 4DA7A 1JHRA 3RRJA 3FBGA 3ST7A 5IT0A 5DU2A 3K92A 3ASYA 3NATA 10MHA 3F2IA 2XZDA 4GLLA 1WR8A 2Q4DA 4KO1S 4TKVB 4F06A 3ICEA 5TEVA 2DF8A 3Q0TA 4MB2A 1OI3A 4TQUS 4M0DA 1HT3A 4E0BA 5M3BA 1A9QA 2NO4A 3ELBA 1TZBA 4C1BA 2QTVB 2YHUA 2ZUTA 1TM7E 3CY6A 3L5OA 3MZ0A 4UC0A 3LCCA 3WLEA 2ZAIA 4FXPA 4DG9A 3CVYA 1T6XA 3PFFA 2J0QA 2ZK7A 2JPDA 5ARCA 4KP7A 4ZOAA 4X90A 5H82A 4H7HA 2CDBA 4YCMA 2PX5A 3CUSA 1LFAA 3VNQA 4EITA 4OBBA 4BUJA 2V9ZA 1P4JA 3JQ9C 1XALA 5CG2A 1NMEA 3EXG2 4LMAA 4PW0A 1Z56C 2PPLA 3N5CA 1AGPA 3HWX1 1LPNA 2FRXA 1QHXA 1EK5A 1OC2A 4GLOA 3NGXA 4KMRA 2GCNA 2WIBA 3PA8A 1Y3HA 1S0UA 3EW7A 4D98A 4PGAA 5I9IA 1CXZA 2HRBA 3A1UA 1P5HA 4RF3A 1Q2UA 1SBIA 3I3SR 2IYNA 3OIYA 3D5TA 4UMFA 4YALA 4ZK2A 3Q8LA 1RLTA 1FEZA 1DAHA 1NA5A 1ZRSA 4JBWA 4MQBA 1RQXA 5DASA 1O5IA 1EFKA 3G1UA 2WU8A 4Z0HO 3RRXA 2K7FA 2XUFA 3INRA 1TVEA 3F97A 4DZRA 1PTKA 2EU8A 2H52A 7GPBA 2W0SA 3NV9A 4MUKA 3DB1A 4YP9A 2UYGA 2O1XA 4OF4A 2OCXA 2ZWVA 5DM60 2D0IA 1XEXB 3BCUA 3DBOB 3FW1A 2BR3A 3SLRA 3U7JA 3A9CA 1TUGA 1R8XA 1TO1E 3L0IB 4IFTA 4IIDA 2ZE6A 4QPJC 1AT1A 3RFUA 4S05A 1KI6B 2DR3A 3B9QA 4AMZA 3N7UA 5TQ2B 3F9RA 4EY6A 4O4HF 1KY4A 4Q82A 1KI8A 4AZ3A 4IRXA 2DY0A 2HREA 2ZIFA 1A9RA 3VH3A 2BV3A 1LK5A 1JKJB 4XARA 5H4HA 2HF2A 5KTKA 2GAJA 5FWXB 3UK1A 3VV2A 2IYSA 4WE3A 2XUPA 1KFJB 1X15A 3BXXA 1BOFA 3FZYA 1R5JA 2QX9A 4LXYA 2GF0A 5J4VA 3TSZA 3MWKA 2ZAGA 5CH8A 4FCTA 1I3OA 4IZ6A 4QO7A 4BMVA 1MVNA 1GN8A 1Y0BA 1LLDA 2C3PA 2Q2VA 2J7PA 3GV0A 1DO8A 5EQJB 3TFOA 3ANTA 1GZ7A 1XCGB 5ETJA 4FYJA 5D5PA 4DAEA 4G2TA 4GKVA 5E4JA 3J81A 4EJSA 4YNBA 4GAEA 1GYRA 1KDTA 1W5EA 2ZB4A 1TQ8A 1SBTA 1U28A 4RVOA 1E2PA 1BWQA 2CNKA 3T95A 4A03A 6YASA 2QTBA 4J49A 2W93A 1MPTA 8MHTA 4FCVA 3U4AA 5FWYB 5J2UF 3NYQA 2R1ZA 1OWLA 4RHTA 4S1VA 2HWUA 2IODA 1CUHA 3WGIA 1Y8CA 2JHCA 1KJ9A 3AEQB 1KMIY 4E5UA 2XV1A 4B1FA 3UPTA 1G8GA 2ZATA 1WXFA 3FHJA 2GA8A 3ESCA 3LLSA 4EZBA 4LY0A 4UVGA 5CDTA 3BD7A 4IM7A 3LWZA 1FUYB 4QJ5A 4TXNA 5T4BA 1L8QA 2BFFB 3R40A 5LMUB 1KEPA 1XTVA 4IDNA 4RKYA 2IELA 4LJ6A 4D7AA 3I8XA 4JP5A 5LXTA 4Q9KA 2GCEA 3ROKA 3ZJVA 2ACKA 1E92A 1LA2A 2LPMA 3HYCA 4UNNA 3SBEA 4ER0A 4EW6A 4X65B 1WBDA 4F9TA 2QAJA 2P62A 3HCOA 1C9NA 3ROMA 2CFIA 3EIHA 3HR8A 3BJMA 1P4RA 3THOA 2C92A 2PSJA 3HY6A 1G8JA 3AO0B 1M0TA 3PWZA 3OM8A 4H7KA 2YHBA 1F51E 5EERA 5TVGA 1L7MA 1TQDA 2PUEA 3LQ2A 4DCVA 4RHUA 1PNRA 3GEMA 2GKOA 1LVHA 3FOWA 3JR3A 4IEFB 1M2VA 3C5EA 3ZWPA 2JI9A 4LY9A 2DYKA 2YICA 4RH3A 2VAXA 1Z7YA 4WCDA 5E0KB 5A02A 2CFSA 4IZIA 5ARBA 3IXMA 5IDYA 2JGKA 4OYLA 4PPYA 2BGNA 1HXHA 5HDBB 4ZVUA 3ZV6A 3JVIA 4ZAVA 2RCYA 2QLNA 1DTEA 1UKBA 3D3WB 1MOPA 4OHWA 5D6NA 5FTJA 3VA7A 1N0HA 1MB9A 1GVHA 3PRHA 3PFWO 1IXRC 3U0VA 2OCBA 2IWRA 1USVA 1D2NA 2YZKA 3S7ZA 3ZVNA 3LBNA 5IDXA 2V3CC 4HMQA 1TNDA 2VF7A 4Q9AA 2VDNB 4V2IA 4WK4B 3SXUB 4UTRA 3LVQE 5FNVF 2PD4A 1C1YA 1P44A 2PZMA 1ID1A 2PQMA 4L2IB 5BN3B 3WK9A 3BD8A 5JCOC 1N2GA 3OPYB 3K9HA 1PR5A 2CLDX 3WSWA 5ULLA 5DN6D 5HKAA 2PMFA 3DP9A 4OLJA 3MTBA 4QDKA 3P7MA 5FUVA 4BKMA 3OETA 4XWKA 5I45A 1A7UA 1NR5A 5LZ5A 1KY2A 4LZAA 1CY8A 1OLOA 1U0FA 2IOYA 4RD0A 1E3WA 4RL6A 3QSGA 1YFLA 4LBZA 1NJ1A 4Q7EA 3C3PA 4P3KA 4XD7D 4YC7A 3TLGB 2PWYA 2WD7A 4C0AC 5ISMA 1IQPA 2I1LA 3C6QA 3MGKA 5AM3A 1PGOA 1EVEA 1E2BA 2JAHA 4IXDA 2CVOA 1T36B 2HA5A 1PD0A 3EGOA 3BREA 2YQ4A 5B3LA 2VSQA 4C2BA 1YV9A 3L1UA 3MUNA 2HFJA 2I3AA 4OJKA 1KVRA 2PX2A 5A4MS 3OQMA 1YB6A 3EWNA 3R74A 3HB7A 3S2ZA 3V4FA 2VFAA 2ZSJA 3ZWKA 3FI0A 3RVMA 3CW8X 2C4KA 3P1JA 2HWWA 2R5FA 3LP6A 4EUEA 1EGMB 4E5VA 1X7ZB 2H06A 2H07A 3WE7A 3EPKA 4Q01A 4BATA 3T5BA 3CH5A 4JLMA 2QD2A 1DWOA 1OJ7A 1THGA 2YYYA 3H2KA 3QU7A 4NBLA 4RIEA 4P4NA 3R7SA 2FEXA 1G8YA 2IEZA 1FX1A 4RDHA 2RSLA 3GJXC 1A5ZA 3OHSX 2BHRA 2WWFA 3KJNA 2VP6A 5H9VA 1J42A 1G6Q1 4PX3A 3H2IA 1DLJA 3W3AD 3BSFA 2F9LA 3DCIA 1ISIA 2R25B 2EIHA 2CHEA 4ZREA 1VRVA 5JARA 4JNKA 4KKVA 1CW2B 1G6OA 4QQNA 2OCIA 2BGIA 2VK8A 3KCQA 1H1DA 1NN5A 3ZLVA 2FN9A 3BCRA 1SOVA 1JI3A 1JHUA 2XNCA 3IHLA 4H3VA 5FP0A 5AK6A 1HDCA 2QIOA 3HJCA 3O74A 5KNDA 1WULS 2E5WA 1WW3A 1Y3CE 1LWOA 1P1HA 3GVCA 1CR4A 1BYUA 1QHFA 1ZH4A 2B5VA 1UK6A 3MW8A 4NS4A 4CL0A 2DAPA 1E2GA 2NU8A 3VPFA 5B5SA 1Z5OA 4M99A 1UJBA 3HZZA 3A26A 2C7GA 3G2JA 2NVUB 5AHWA 3TIGA 1A8IA 1E2KA 4G9BA 3WIVA 3OZCA 1I7NA 3O90A 1N36B 5B1IA 2E6UX 2Q0QA 4YJ2A 2A7XA 2P35A 3ICPA 4IYJA 5KOJA 5L3ZA 1LBTA 3QLTA 5ALIA 1FUIA 1T6ZA 4IFBA 4XI9A 1OH6A 1UJMA 1V11B 4D3ZA 5A7FA 3KSUA 1KBOA 2VO1A 3DWGA 4W5RA 4KX5A 2ID8A 3PCTA 4LJ9A 4EGJA 1EVQA 1ADYA 5KAMA 2NZ2A 2XI4A 1EGHA 4WFJA 1HQDA 4MV7A 4L9SA 2ODAA 4OQEA 4XOIA 4YMUA 2BFDB 4AZTA 1IBLB 3MWYW 3OCJA 2GBCA 5AQ1A 3FMPB 4CDMA 4JQOA 3VH4A 1EB9A 3QKSA 3WMGA 3H4MA 3E9RA 3TQCA 2II6A 1ENYA 4OU4A 2YOHA 3G8BA 3B2EA 3ZGXA 4TYNA 2VSYA 1P1CA 1ZC4A 4RTOA 1V1RB 3B70A 3VDXA 1UJ2A 5KSYA 4ICIA 3UMRA 3EGXA 5FKJA 3WFJA 1R74A 4W8GA 4XEHA 3V8MA 2YMQA 2XB8A 2GNAA 1NW9B 2GK3A 1UBOS 3QF4B 4AXXA 4RTKA 1CJCA 3N2EA 2ZVJA 4PZDA 4QAQA 2EP8A 2I2DA 4ZHQF 1JIIA 3M2TA 3A58B 1XRNA 5EYPA 3T7CA 3JVVA 2J09A 4DCUA 4MR9B 1W2WB 3PXEA 3IOEA 4XUCA 3RRYA 3UOGA 4OSEA 4BPRA 3AL3A 3RSHA 1JG6A 4EM6A 2QUBA 2VAVA 3SCZA 4R8MA 4LCJA 2GZRA 2FW1A 2OCPA 2YL2A 4HYYA 4YCDA 5EJGA 4RK4A 5C1BA 3X43A 5IT5A 1M72A 4I8DA 5DW0A 5LYJA 1PDWA 1FUKA 2GD1O 1PNOA 4FP9A 2D59A 4JSRA 5HMLA 4E12A 5ICSA 1M6YA 2HT1A 5BUZA 3ZGYA 1YCHA 4B47A 2IT1A 3PGVA 3HK2A 4AJ1A 1N3IA 1T5LA 3SC2B 4M55A 1EXVA 1P0CA 2F55A 3EQZA 1ZGZA 3BERA 1WDLA 2FRDC 2HK6A 5CIWA 2XHZA 2VVTA 3IPYA 1UBKS 3WIUA 4AL4A 4G0UA 2WPNA 4JI3B 4L73A 2X9NA 4OHRA 3NT4A 2WAOA 5FL3A 3ENVA 1A71A 5HF9A 1JPNA 4RENA 1N2CA 1RWXA 1FVFA 1Y4SA 2QUIA 4ND6A 3UKOA 4LQ4A 1B14A 2OECA 1ZRMA 4WVLA 2JLVA 2OXFA 2V8OA 4BGIA 1SZCA 3I01A 1VHWA 2BFEB 2MYPA 3L5KA 3HCEA 4ZVLA 1N1EA 1NSFA 5FB3A 2JJQA 4ZZ2A 4A23A 2HWKA 2G40A 2WJGA 4U6QA 3RU3A 1P60A 4DV6B 5I8WA 2ZBRA 4HWRA 1WSWA 4NMXB 1A8PA 3ASZA 1LI4A 2QPAA 4A8TA 3F3KA 3IAXA 2PPVA 4BCBA 4FZVA 1Z29A 3G0HA 3GFOA 3ZCQA 3CCCA 5KNCA 1SCUB 3SF8A 2YWXA 1RC0A 2ZULA 1U2DA 3L1HA 3ZY6A 3AYXB 3DPIA 2DT8A 1W30A 5I6DA 2NAFA 1I32A 2GH1A 3GO4A 1CZKA 5BUQA 3ZHZA 1BMDA 4G5QA 1XZGA 3BDVA 3EGIA 3UAZA 4AJHA 1ZIXA 2CL5A 3PRKE 4K88A 2YOFA 2IBSA 3I32A 1H4TA 2X9QA 3W2EA 2CMDA 3C3MA 4P4TA 4KHPB 2VRWA 3H5RA 3QKUA 4N3BA 5C18A 2WM8A 2FB9A 5ITWA 3N28A 4ZD6A 1P7CA 1UP4A 1UFOA 1KO8A 1W7AA 3MJEA 1HBJA 3DAOA 2FHSA 2VJPA 1ZICA 2ZRGA 4O29A 1PR2A 3CISA 2HSWA 3V8NA 3S7TA 3ZIDA 4MRMA 1T0UA 1L4YA 4TKMA 3LXXA 5JLAA 1GLNA 2XLBA 3S1AB 1SBCA 3UK0A 3H5IA 2NXJA 3CURA 1U3CA 1EDOA 3Q87B 3GMSA 3QPBA 1CK4A 1XVVA 1MZVA 4MVJP 1D1PA 3C6MA 4JBNA 4NFSA 4NPCA 3STUA 4C04A 1L4NA 4HXEB 1C1DA 4LJAA 3Q3IA 2B21A 1FYFA 3WL4A 1VHQA 3LV8A 3CZMA 5EP4A 3RG8A 2AX3A 2IUEA 1LKZA 5BR1A 3R9XA 4YDSA 1M6VA 2X8JA 2J6IA 3PWTA 4CMBA 4NMHA 4JS0A 4KL8S 1WHTB 2F67A 3KWMA 4JLDA 2IW1A 3QV1A 4F6RB 3RABA 4BVBA 2C5AA 2WNSA 4IRUB 1CBUA 2CDAA 3GWZA 3DZ8A 1V47A 2ZRMA 3PFKA 3QE0A 4RHEA 4Y2PA 5HMMA 5JR3A 1UH5A 2RKBA 4QHTA 1GZ6A 5ES4B 3VHQA 4O3FA 2GYVA 1A4XA 3FTCA 4CIVA 4IY1A 1YRYE 1OLXA 1D2MA 1JA1A 2E4WA 1N5OX 2O1EA 3ET5A 1TQ4A 4N82A 3TQHA 5AM0A 3AF5A 2R8YA 3SPXA 2C4VA 1XRJA 4MYTA 5DMHA 3EEFA 1E1CB 4BB6A 2XWJI 1B0PA 1O77A 4C5CA 4MW2A 4RZHA 2NPFA 4A1FA 4A91A 1C4WA 1YDFA 2NUPA 3ACDA 3NYRA 2HMVA 4AJ4A 3NM4A 3NBKA 3Q85A 3VPCA 3RYIA 3U61B 1R4ZA 3V2HA 2YXLA 3AM5A 3AHCA 5IM5A 1RXUA 1Z4KA 2BCEA 4D96A 1I01A 3UGJA 1I3KA 4HX5A 5C5IA 4FX2A 5EHIA 1DOHA 3QKRA 4WLNA 1EWYA 2A59A 3O3MB 2EW2A 2B8TA 4UTNA 2C4TA 4OP2A 4MI3A 2VNAA 2C9CA 3N5KA 4INZA 1CV2A 2W2VA 1CZNA 3UPUA 2R1TA 5FV4A 2Q27A 5K2OA 2PE5A 4U2GA 2OTCA 3BXHA 2D2VA 3VKHA 5JADA 1R64A 3R23A 4KSBA 4HV4A 3HUUA 3M4ZA 1MHTA 3RTDA 1JYSA 1ZGGA 2QPLA 1J97A 3FZEA 1M0WA 1O9HA 1ZM4A 1M8FA 3OX3A 1QQTA 3A37A 4WH0A 4XRRA 4ZQFA 3G8AA 4B33A 1V7ZA 2CCJA 1IN5A 1T6YA 2GZ1A 2Z09A 3F3MA 3Q9LA 2ZRAA 4G3XA 4DR1B 4G0WA 2JRLA 4RJIA 2QZZA 4GI2A 1NRWA 1J39A 5K3CA 2QAIA 3HDQA 3T94A 5IFLA 2JFQA 3HN6A 4UBLA 1CQJA 5JAZA 1H8HD 1ECCA 3E5NA 1PLJA 2WSLA 4R69A 2GNOA 3N3BC 1XKTA 3GXOA 3HEBA 3KAQA 1SHUX 2V5VA 3HA5A 3LDHA 4HK4A 4OAPA 4MYRA 5E6SB 3E1KA 2DG2A 2FSGA 4XLZA 3VBEA 4Z1MD 5HKBA 1MQ9A 3KQWA 4D5GA 3KEQA 5KHLB 1KZ9A 3JAWA 2FMIA 5IEJA 1SCNE 3O91A 2XD4A 3G5MA 1R1DA 2H2WA 4D57A 2NVBA 3PKIA 5D3ZA 5K3FA 3PNLA 3CKKA 4S1TA 5KSWB 3EIUA 4TVOA 3R6LA 3I72A 5H1YA 3OZRA 4Z0NA 2H2DA 5LZ9A 5ED0A 1D2EA 1AA9A 1SBNE 5BYAA 1DKLA 1NR7A 3ILYA 3UOWA 3D2AA 3JAKA 5HQ3A 5L4NA 4CV3A 3D6JA 1E6LA 3REQB 1YCDA 2J48A 1F2VA 2QM8A 3LPDA 4X6LA 1EZZA 1XMSA 2H08A 3LO8A 4WQMA 4F5EA 4Q4CA 5AVJA 1Z6XA 2YHAA 3KXPA 4ZV7A 4U02A 2G0TA 2JIDA 5IVDA 1JQJC 1QCZA 3G0OA 3C16C 4HDMB 8GPBA 3UANA 1ENOA 3KQKA 3TW0A 3WISA 3OURA 2V4ZA 2O8CA 3FCOA 1E4EB 3IDZA 3RC9A 2EAUA 1JEQB 5BQOA 4CIDA 4OX9Y 2A86A 3TB4A 4MIYA 1LDMA 3UMFA 1AKVA 3DL7A 4PS1A 4LOJA 1JVNA 3B6KA 4KRXA 4A82A 1IK6A 1JSZA 1KRHA 1OYOA 3KB6A 4FDMA 3VZBA 1KAOA 1D6JA 4Q3OA 5I7RA 2OM2A 3EQ8A 3IBTA 2D1YA 2IYQA 4BC0A 2WJJA 4P98A 3ROPA 4G1EB 1D6MA 2FWAA 3GEGA 4HRXA 4WINA 3T3PB 4FW9A 3W34A 3QIAA 3WGNA 1XT6A 3I28A 4C6RA 5FBVB 3A1CA 4K3VA 4MMZB 4NDZA 4B6SA 1CDZA 3DFIA 4P33A 4KLZA 3AY7A 2YUIA 1SQGA 4N41A 4FC6A 1SOAA 2PS9A 4RD6A 2H1SA 4ALLA 2L18A 5TRTA 4ALIA 2CSXA 1GGNA 1FX0B 4KYVA 4AIIA 5F4ZA 5A6VA 1PWZA 3BAZA 3JRNA 2O8DB 1K6MA 3GWGA 5DISB 3GH1A 3MMPA 3TLMA 1BN7A 4N9QA 3GRCA 3IDAA 4L75A 4TM7A 3EFEA 4JL6A 3SYTA 3CJRA 5K3DA 2QTCA 3H42B 2Q7OE 3I6ZA 4AMVA 3WHLA 3L2OB 3UJCA 3UC9A 5C34B 1QC5B 2OFPA 2V0CA 3DKPA 2CFRA 2OLEA 5TSDA 1IE3A 2Q3MA 1YS6A 3LH5A 4HSEA 3R2JA 4NU0A 1C0IA 3QKIA 3JZMA 5FUMA 2YY7A 2ZE8A 4M1EA 2OV3A 2DOKA 2R6R1 2G5GX 1TIPA 4AJ2A 3VOBA 3WYAA 1KSHA 2HX1A 4GMKA 3FUUA 4RV9A 4JKOA 4DIDA 2XNSA 4YTEA 2OHVA 4X92A 1A4UA 4XW2A 1XDZA 2OGWA 5IH7A 4WNCA 1HFJA 3FPEA 3NTXA 3Q1LA 5K01A 3T5PA 2Y6VA 5C8YA 1KAMA 4YP1A 5C31A 5COBA 4C3VA 5DM1A 1KI9A 3MCWA 3OCYA 4US0R 4LX8A 1WA5A 1XTIA 2XWPA 5F12A 4AULA 1RZVA 2XOKD 4BFLA 1T91A 1HZJA 1W76A 2X6TA 3DZBA 3G23A 5DWQA 1FTNA 5HTKA 3TI9A 1JTVA 1J5PA 3AY6A 4I4CA 3WO0A 1A2KC 1QGDA 2JAQA 2O5EA 3P8ZA 2YXBA 5KWJA 2HOQA 3DNMA 4Q00A 3OD1A 2PX4A 4K03A 4RK0A 1QK4A 4XCQA 3PGJA 1GTMA 4LISA 3SIXA 4NQZA 2LCQA 1RM4A 1E3LA 1G20B 1U0OC 5AXAA 1WOYA 5A9SA 1W1IA 4N7MA 2HO4A 2IK8A 4QTXA 3GA7A 1PT6A 2HMSA 1HNNA 2AGVA 2ZRDA 3C4JA 4RIIA 3SQLA 4BVJA 1Q22A 4LRXA 4KWIA 1CJSA 3VAZA 3R09A 4ODIA 1QOZA 4KU4A 4MITA 4WEQA 3H5WA 1MABA 5HZKA 5IAAA 1J0EA 4RQBA 4HFJA 4V38A 4PC1A 4RH1A 1JFFA 3GLHE 1Z7BA 3SYRA 5CJPA 2ORED 1RI4A 4RU1A 2VDMB 3C85A 4RZSA 3ZVMA 3GL9A 2ADFA 1KZ6A 2VDUE 1BE6A 3NM6B 1UFVA 3NYWA 4J1NA 3FRHA 3TQRA 4BCDA 3SZ3A 2AFRA 4PFQA 2WJPA 3RIEA 1WW8A 2OA0A 2QXUA 2JIRA 1CWUA 3DZJA 4LY6A 4DLKA 3HTXA 3AGPA 4H17A 1NYLA 3ED1A 1N33B 2IZOA 4CGZA 2IEDA 3KSZO 2CXUA 4MR8A 4A2QA 1A27A 1IEQA 1XN1A 2OBNA 4TYQA 1JT9A 1Q3KA 5C4MA 5LP1A 2DETA 4D4KA 4QVGA 4BNFA 2OK8A 3GLFB 2QW1A 3ECAA 4MKZA 1CY1A 2NW6A 4KX3A 1MV5A 2C2OA 1PL7A 2QUZA 4CKCB 3QPVA 1EWVA 3DM5A 5DNUA 5YASA 3BMQA 3H8VA 4J0EA 3Q8WA 1R3DA 4NNJA 4LMPA 4CDNA 1YVUA 3G82C 1N6KA 1E99A 1QLHA 1SVIA 1TO6A 4MW7A 3VSEA 4YIHA 3DCYA 4CM3A 4GR4A 3F9CA 1GJRA 5EEGA 5CDSA 3N0RA 4W5OA 4OI2A 3EEOA 2ZTLA 1KOGA 4U6NA 1AUOA 2AIRA 3IIJA 3MGCA 4I4LA 3K15A 2ZBUA 3LLCA 4ER6A 3A9SA 4HZIA 4YREA 4JI4B 4LZOA 1AHNA 1BHQ1 2AFIA 2VC2B 2Z3ZA 2IE8A 3ENQA 4O8ZA 1R0CA 4I9FA 4BKOA 3OPVA 4MYUA 4G65A 2XF2A 1BX1A 4RZ3A 3RS5A 2H17A 4BGDA 1AB6A 4AZ3B 1JLLA 4RSGA 3O0DA 4EGSA 3NANA 3OP1A 1YMUA 1T3TA 4YV1A 4FI3F 8LDHA 3D8HA 3GJZA 3X1MA 1IBCA 3HC7A 4NDNE 1EXNA 3C97A 5CLQA 1WXGA 1TFUA 1GD1O 4TXMA 1K3UB 3CSDA 4O0MA 4YRCA 1Y98A 3A3YA 1H3EA 1E59A 2EW1A 1KK0A 2VHUA 3AW8A 4KVFA 4XWTA 5FFMA 3V5NA 4V0SA 1GP2A 1KEWA 2FZKA 4RC9A 4EF6A 4KFTA 4RTPA 1RQ2A 4Y7CA 4CM8A 1NMSA 3EXG1 1DCMA 1OGIA 1PJ3A 3L93A 3RC2A 2VDQB 5JWRA 3EFHA 3DFUA 1XKLA 2I33A 3FG9A 4EJSB 2E0IA 3LT2A 4DCPA 1UADA 4MR7A 4H6XA 2DKOA 1E1YA 3EVZA 3V00A 1G5RA 4ZAXA 2JJMA 2ARKA 2PCJA 1EFRA 4QLOA 3IE1A 1LJ8A 1Q0HA 1EK0A 1G5HA 1R50A 2P2CA 1TM4E 1VG9B 4P5PA 4UE2A 5TARA 3DEIA 4HXYA 3WLSA 2Z6UA 2ACVA 2V7BA 4H3SA 1M0SA 1OWNA 1BFUA 4DQ0A 5EZSA 1OX5A 2X58A 3O9ZA 2PEZA 1RRGA 3WIOA 2JAUA 4TMFA 1J70A 5HIKA 1C30A 4V2UA 2G6BA 2GM4A 5F5LA 2VP0A 1RPJA 3UN1A 1GY8A 4JVMA 3H9UA 4HQNA 5H3CA 4CTOA 3RFTA 1VJGA 4YXWD 1SU6A 4MRVA 2BRUA 5LXTB 2JFXA 1ZW6A 1QCDA 4ZJZA 3WQQA 4CFSA 4FJ0A 4P35A 2EZUA 1DJQA 4Q19A 2YZMA 3N2KB 3BSWA 1OPRA 2QY9A 3NB0A 3PXCX 4JLPA 3RLFA 2QL7A 2LTAA 2REOA 1C2YA 1X1QA 2EL9A 2X3UA 3F1LA 4E1VA 4ERNA 3CRW1 4HAVA 4I1VA 5EQDA 2Y4OA 4NH0A 3RR2A 2HZBA 1BAPA 1CDDA 1JIJA 2Q0XA 4WY5A 1LDEA 2P9GA 2CE7A 2HL6A 4GPBA 4U39A 4UHDA 5KDLA 3K4HA 5JS2A 1MX9A 2WPDD 3UCEA 1SQFA 1N9ZA 2CHUA 2XDQA 4INPA 2N1MA 2YZ7A 4J0FA 5KTTA 1U7ZA 2JVKA 1LW7A 2ERXA 4GC9A 4KNVA 5M2QA 1XVUA 1RWQA 5TPWA 3AG6A 5CLFA 1E9DA 3CR8A 1DEKA 4FJ2A 2FZGA 9MHTA 5JANA 3G79A 1TKBA 1IM2A 3MPOA 3RFVA 1U9ZA 4BVHA 3KFLA 3RE1A 4BLVA 1MOSA 3EVDA 3FWPA 3TTSA 4B83A 1PQPA 1Y81A 3ZHYA 7MHTA 4TN5A 2WTEA 1UAYA 3R44A 2EJWA 4ZGWA 7REQA 3KKOA 3V8QA 4UHJA 4KZPA 2HJVA 2JLUA 3OC6A 4XXHA 3IDOA 4CF7A 3DMFA 3VZDA 1TRHA 1CVIA 1OVGA 1VC2A 1Z73A 4WK6A 4Q7LA 5C35A 3I52A 4G0MA 3ZQ4A 2B2NA 3PVSA 1NJ8A 3GZNA 2QF7A 1V43A 1MXFA 4HB2A 3THRA 1N3YA 4ZOCA 4OUKX 1Y3BE 1MX1A 2AOWA 1G2OA 1QVWA 1VB3A 4BNXA 3B3QA 1E3WB 2PJDA 3CWQA 3O75A 3ZWOA 1CY4A 2ZZKA 1MPXA 1ILWA 1BNCA 1O95D 1Y1RA 1ZR4A 1U9IA 3LRPA 3GLQA 1CJUC 2QZ9A 1FYVA 5DT2A 1H22A 1A69A 2EJTA 5AVRA 3DPSA 1WVIA 2BM8A 3MAJA 1F17A 3I5UA 5EHXA 1BS1A 1H66A 1H0HA 3OFKA 4RCZA 4XASA 2HKIA 1QDLB 3IEKA 3RHFA 1E9EA 1U0SY 4E15A 2F2TA 2PRSA 5GV8A 1DNPA 5GINE 4ALMA 4GMDA 3WAKA 1ZGJA 1NE7A 5C4IA 3PTAA 4CLDA 3N74A 2B6HA 5HKLA 1PJLA 1M74A 1Z18A 3NH6A 4MV9A 3D6MA 4F5WA 4JDPA 2SNIE 1WMBA 1J25A 1N0VC 1TMOA 2WMNB 3DOJA 4V0ME 1DG3A 3CQ9A 4PYIA 1AA6A 5TJHA 2H1CA 1TM1E 2RHGB 3RUPA 3O4HA 2MMGA 3K35A 3U0BA 3GPCA 1E96A 1H2WA 2PL5A 3SYMA 1K6IA 1XOIA 4GPAA 4D8WA 4XGKA 1M9NA 4DV3B 1IHYA 3WXMA