4IYRA

Crystal structure of full-length caspase-6 zymogen
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
261
structure length
248
Chain Sequence
FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSAGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVITNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The regulatory mechanism of the caspase 6 pro-domain revealed by crystal structure and biochemical assays
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-6
total genus 81
structure length 248
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iyrA00
4EHDA 3OD5A 5JFTA 2QLBA 1GQFA 3ITNA 2CNNA 1K86A 1I4OA 3PCXA 4HQ0A 2H51A 3H11A 4N5DA 4NOJA 2J30A 4M9RA 4FEAA 4QUAA 5IBRA 3EDRA 4QULA 5IABA 3R7SA 4FXOA 4AWAA 1RHMA 3NS7A 4JR0A 3V6MA 5IC6A 1PYOA 3PD1A 4DCPA 4FGUA 1QX3A 1F9EA 1RHQA 3GJTA 1SC4A 2C2MA 4NOLA 2DKOA 5H0IA 2CNOA 4QUDA 2Y0BA 3GJSA 4QU5A 1I51A 2H5IA 5I9BA 2XYPA 4ZVUA 2QLFA 3H0EA 4HVAA 3DEJA 5LUAA 2C2KA 4D3XA 1F1JA 4N6NA 4NOMA 1QTNA 1SC1A 3DEIA 3K7EA 5LU8A 4QUHA 4QUIA 1RWPA 2XYHA 4AW9A 2NN3C 2XZDA 3H13A 4N7MA 4QU9A 4QTYA 2HBYA 2J31A 1RWVA 4ZVTA 3GJQA 4ZVQA 2WDPA 1SHLA 2H5JA 4PRZA 3DEHA 3NKFA 4I1PA 3V4OA 4QU0A 2J33A 3R6GA 2HBZA 2CJYA 1RWMA 5LUBA 4NBKA 5IARA 2AR9A 5IBCA 4QUBA 3NR2A 1SHJA 3P45A 3EDQA 3KJFA 3DEKA 2H54A 4JJEA 1SC3A 3SIRA 5IANA 4ZVSA 5K20A 2H4YA 4PS0A 5IAEA 4DCOA 4QUJA 5IC4A 3V55A 3E4CA 4QTXA 1RHKA 4EHKA 2QL5A 5IAJA 4DCJA 2XYGA 3D6FA 3KJNA 4NOKA 5I9TA 4ZVRA 1RE1A 1RHRA 3D6MA 3H11B 3UOAB 4N7JA 4EHHA 3UO8B 4EHLA 4JJ8A 1RWOA 4EHAA 2FUNB 3GJRA 2H65A 4D3YA 4PRYA 3IBCA 1RWXA 4QU8A 3SIPA 4QUEA 2C2ZA 4NBNA 3R7NA 4IEFB 2C2OA 3KJQA 3S70A 1QDUA 3BIJA 2QL7A 1CP3A 3R5JA 2FP3A 2CDRA 3R7BA 4JB8A 4LSZA 3IBFA 1PAUA 4JR1A 2HBQA 1GFWA 1KMCA 2FQQA 3V3KA 1RWKA 4JJ7A 3D6HA 4IYRA 1RWWA 1CVRA 1BMQA 1I4EB 2QL9A 2H48A 5IAKA 4EJFA 1IBCA 2CNLA 2H4WA 2CJXA 2HBRA 4NBLA 1RHJA 1NMQA 4JQYA 1NMSA 1K88A 2XZTA 3R6LA 4PS1A 3QNWA 1RWNA 2C1EA 4QUGA 4EHNA 2CNKA 4N6GA 4ZVOA 5IBPA 4D3ZA 3RJMA 1NW9B 2K7ZA 2P2CA 1NMEA 5IASA 3PD0A 3R5KA 4ZVPA 3S8EA 4JQZA 4AWBA 3V6LA 4N6OA 1JXQA 3V4LA 4FDLA 1RHUA 3P4UA 2J32A 2QLJA 4HQRA 4I1RA 1M72A 2Y1LA 5LU9A 1ICEA 3H1PA 1I3OA 4EHFA 5IAGA 4JR2A
chains in the Genus database with same CATH superfamily
1NQVA 2C7BA 1FNMA 1A4UA 1XCOA 1XZ8A 3VOSA 2Q5FA 4EZBA 2AMFA 4I0WB 4NAHA 2UZ0A 5JALA 5L4LA 2GGSA 5JAOA 3G5AA 4EY4A 3DD5A 2BHRA 4G5FA 1R0YA 2C2BA 2XKBA 3KU1A 3CURA 4U2GA 3RYFA 3W2FA 3WLLA 2EFJA 3HYNA 5E4FA 1UAGA 1R74A 2DX7A 5JNVA 2G17A 3R3YA 2QVXX 3DCNA 5CVVA 1SKQA 4ARCA 1UXJA 3C3AA 2C84A 3LPMA 2NTEA 4GOXA 4JEHA 4DWWA 3BFKA 1V11A 2MMGA 4EVIA 4J4TA 1Z5OA 1DXHA 1KH1A 2Y0BA 3MAJA 1L9XA 4ZC1A 4RD2A 1I51A 2BBOA 3VZDA 3WGIA 3AEQB 4G5HA 1XZHA 1X7XB 4ARAA 3IT3A 4HDRA 3UQYS 5JNRA 4AKSA 3KUUA 5HRCA 1S3IA 1EP3B 4F2HA 2O6LA 3D1VA 3VYSB 2VPXA 1Z2AA 2VSQA 4LN1A 3ZE1B 2EKPA 5JJ5A 3L84A 3BWBA 2QN7A 1AMNA 1YS9A 3EPPA 4ZVTA 4C4SA 2XUQA 2YQ5A 1SHLA 3DEAA 3EG9A 4H7IA 3NC1C 4NBSA 4OGLA 1GV0A 3PNSA 3FVRA 4OK6A 4RSMA 1AF4A 1ODIA 2ODEA 3BMNA 1OBOA 5EGSA 1CXZA 4W5TA 4BXOB 4FYYA 3QHPA 3RS8A 4S35A 1KIMA 2ISQA 1U5BB 3IJ5A 1JB9A 4HB2A 1U9IA 2IYQA 3DPSA 2D2FA 3KZKA 5DCLA 3QBTA 2IBSA 3H4MA 2ZUFA 2OZLB 1UADA 1P80A 1I0LA 4GOOD 3ZY2A 4K6FA 3TE6A 5A5EA 3C8MA 4JAVC 4PAWA 5JO9A 4V0SA 4JI1B 2B8TA 1HNXB 4NFHA 2J08A 3QKIA 4CIYA 1G6Q1 4YUXA 4BWFB 5GGXA 2YQZA 4KXUA 3O93A 4CLEA 2AEJA 4FIDA 4X3OA 3LRXA 4U7FA 5ECDA 3G8CA 4INAA 3CE6A 5BOSB 3U7IA 4LA4A 3B5JA 1EP2B 2BM0A 4G0QA 4D3YA 5KWJA 1ZH8A 3ODGA 1P2DA 3EZXA 2EKZA 1TE2A 4RNDB 4PQRA 4DBLC 1KIFA 1KU6A 1NKVA 2JASA 3NWBA 1CUHA 1SOUA 3HYCA 5JSZB 3UW3A 1MOZA 1IXRC 1C1DB 2C94A 3GOHA 3OHPA 4QL3A 3PDIB 4HPWA 2G9UA 1GVNB 3K9GA 2NO9A 1K66A 2OUIA 2PZJA 1JDPA 4DYVA 5FYQA 3CRZA 2F8MA 3EVBA 1FFEA 3EF3A 3MJFA 5C46F 3FOWA 1DT3A 1O97C 4OB6A 1EDDA 4Y9TA 2WQZA 2E18A 1D4ZA 4O8CA 2BFCB 2ZYRA 4W9NC 2QD2A 3B1FA 2O8NA 1ONSA 4YP6A 4MWGA 3INGA 3H4VA 3DBOB 5IZ4A 4M9CA 3CRQA 2BRUC 2BTQA 4KE7A 3OWHA 3HDGA 2IHVA 3AHGA 4D4JA 5JCOC 2XQVA 5JHHB 2VDPB 1GA1A 5JFGA 4UCWA 2FEKA 1AS0A 1L5RA 4QAQA 2CVQA 3GA0A 3O9VA 3OOSA 4G89A 3MIIA 1I2BA 2WF7A 3DYBA 5HUQA 1PFUA 1Y3HA 3SYTA 1XDBA 1ZITA 1U6IA 2CZQA 1QP4A 2CV1A 4FIZA 4MK4A 4DVGA 1D2GA 3LYAA 3Q7IA 2EEZA 3UPDA 1EP9A 4YWJA 5CEFA 5J4LA 4HBGA 1O77A 3VHXA 1T5SA 1E5LA 2OILA 1JHVA 3I6BA 4OSOA 5H70A 5KNBH 1L4LA 1XAGA 4ZPXA 1UK9A 1J9ZA 4MXDA 2ZAOA 3H11A 3EQ8A 4ITVA 4OQ4A 4RZHA 5AUQA 2WWIA 3A9CA 4ZOLF 4DWVA 3DW3X 5DHQA 4A8TA 3AERB 1SXHA 1M6HA 1DAFA 2Z57A 1V45E 1O0BA 1CNEA 3PXBA 4Q9KA 2QXTA 2HQ1A 3WMXA 4P38A 5ICFA 4JJFA 3I28A 4HS9A 5JISA 1K68A 3OOHA 4W9RA 3QOFA 5CT4A 4LFCB 3ZWDA 2GBFA 2YFQA 3LX4A 3PKIA 3WSTA 3UJHA 2PSSA 3T7AA 3SDSA 5E2BA 1LBEA 4FWIB 2GK4A 3C98A 3NM4A 4RD3A 3RR2A 3VI4B 2A7XA 2XKKA 2EKDA 1QUEA 2WC1A 3K7EA 3ZGOA 3OX3A 4JOCA 2BLNA 2I7CA 3CRMA 3OOWA 5JYCA 1NUAA 4FDAA 2Y2UA 4X91A 3PC8C 1D1SA 1Q7RA 4M8IA 4B8ZA 3LXMA 5JD5A 5IM4A 1OLSB 1XXHB 2YHIB 3EZYA 4GI2A 4QSMA 4QSHA 4YRDA 2PTHA 5JZ9A 1PJTA 2I4RA 2GCPA 2PMKA 3FX2A 2QNBA 5HF5A 4DR2B 1CUZA 1VQ1A 1USGA 3VH2A 1GHTA 3A36A 4WBNB 1VCMA 4U39A 3M6XA 4ZZIA 4MEJA 3WGVA 3G2NA 3L7JA 3UVEA 2PZAA 4B85A 5FPKA 5JQWA 1GGHA 4I9FA 4A2WA 4ND7A 1Z13A 5DI9A 4B3CA 4BMSA 1Z5NA 2XMDA 4UQOA 5FV4A 3RS2A 4GL2A 4XCQA 1QIHA 3PUHA 4V0OA 3INTA 4CKXA 3T3PB 3OIDA 3CLUD 1K8RA 2E3JA 1EQUA 2V3VA 4QECA 1T36B 3HKEB 3BE6A 3QEMA 5DOVA 5CXQA 5I6DA 2UAGA 3KOMA 1DT5A 2XRFA 3E0XA 3KB1A 1OC2A 3RBVA 1G63A 5HGXA 4RK7A 4WT7A 4K03A 2COUA 4AUMA 1AKWA 3KTAA 5J4YA 4FR2A 4JU8A 5EE1A 5K3CA 3C5HA 4C4RA 4XYLA 1RWXA 1DRWA 1YQDA 1WHTA 2BF4A 3FMFA 3UHAA 1HBJA 1EUCB 1FU4A 3DZCA 3R7NA 4IIJB 2ZJ3A 3ISTA 4E30A 1KSJA 1IMJA 3TIXB 5TS2A 3GAZA 1ULTA 1CDEA 1NI4A 3BD7A 4BRSA 1NDHA 4MVJG 3C3MA 2AV6A 3WGUA 4FFSA 4NJEA 4LXTA 2XLCA 1TD9A 121PA 4NMWA 2EDAA 1OGJA 1MFZA 3GFSA 3K0HA 3L1IA 4U3JA 4UHFA 1ES9A 3ZI0A 1JTVA 4KUGA 3AP2A 4NFLA 2YNMA 4BQEA 2OHIA 5EWMB 4X7PA 2OHHA 5JRJA 3AF4A 4DLYA 4F9GA 3WB1A 4YAIA 1RQ7A 5AK5A 1ZIXA 4AJ4A 4ZCPA 3UFXA 4M9XA 3A2KA 1FXUA 5B58T 3MMPA 3FSGA 2IUUA 4CM4B 2GH1A 3FSEA 2JD1A 3OD1A 2QP4A 2ZW9A 4Q9LA 3LGXA 1OX5A 3DBRB 1KYQA 1AQYA 1H2HA 1IDOA 2WNIA 3LECA 1XUOA 2PKWA 2GJSA 1JA9A 2X22A 3IKTA 3N2EA 1ZMBA 1VPWA 1A2QA 4ZQGA 4LQLA 3WG9A 4HD8A 1VCOA 2YBEA 3TLZA 3N05A 4AJJA 5K6AA 2XNSA 5F5XA 5ED4A 4MITA 2OD9A 1GPYA 1MNQA 4HX5A 1HT3A 3ENVA 5AM0A 1UQRA 3NJ8A 1HURA 2I0FA 3KHTA 4X1IA 4U6NA 4EA9A 1V95A 1PJRA 5JEDA 4KLZA 2HWXA 4YAJA 4RAQA 1C7EA 4DQKA 4M0CA 4HRYA 3LIIA 3SSNA 4F4HA 1QIDA 2QUIA 4JA2A 2QF7A 2IBTA 3ZD7A 4PWYA 4B71A 4X71A 2QZJA 4CMBA 3WGYA 1DKNA 3KPUA 4FYIA 2DERA 3M5CA 4WN3A 1QGED 4URVR 3VR3D 3I83A 5JO0A 3ZN2A 1KMHA 4LHSA 1D2RA 7GPBA 1Y8ZA 5AQ1A 4QQRA 5JAHA 2QW0X 1EX9A 1U8ZA 3O4VA 4OJKA 2JGNA 2NV0A 2PUBA 2GCOB 4MWTA 3T52A 1M6YA 1VIDA 5C7YA 5HYVA 3ZS8A 2WVAA 4QDXA 3WNZA 3SR3A 1ZD9A 4UNRA 3H8JA 2Y0DA 2EX4A 3K0CC 1LH0A 5IYZF 3WK8A 2GRAA 3ROXA 3AB7A 4W82A 1XZNA 5CLIA 1GPH1 5FOUA 1CIJA 2A0WA 2H52A 2PKXA 3A6KA 1OB5A 1G3UA 1E3JA 1U5CA 2I1WA 1R9GA 3GBSA 3KQVA 2FQXA 2B7BA 3FCSB 4MQUA 3LUPA 1DHRA 4NK5A 3K9CA 3LHDA 3PR2B 2C4TA 5KYKA 3K0BA 1KRHA 3JARA 5TQ0A 4R1TA 1RBQA 2CL0X 3NEJA 4M99A 3B82A 4Y9RA 4MI6A 3HDJA 1MIHA 4JQSA 1VJGA 3FM9A 4CT0A 3RADC 1PFKA 1BC5A 1T4DA 2FPPB 2E55A 2FOIA 1H2ZA 4JENA 1U7ZA 4KYVA 1Q15A 4IPTA 4UE2A 1ACJA 4ZVRA 4ZYTA 3QU4A 2J48A 4FSXA 3WJAA 2XCLA 1G64A 4WOPA 2BLLA 3CKLA 1TVKB 2QEQA 3EFEA 4EHAA 4ZI2A 3LA8A 3RTCA 4QU8A 3G0HA 1T9GR 3QG1A 4H16A 4EO4A 1FJ2A 1ANKA 3BSSA 2RGRA 2JFUA 2OXCA 3EE6A 4A15A 2J07A 3I52A 1N92A 3N7AA 3FDFA 4XXHA 3VM6A 4D96A 1ZVVA 4OUKX 3SEFA 4S2EA 1H42A 1XZFA 4KQIA 2Z56A 4ZU6X 3HABA 1KSGA 1M3SA 3QENA 1DIAA 4E4TA 2QX9A 4EHIA 3DZHA 3VYUB 1PX2A 1QKIA 4B48A 2X86A 4LVCA 5B2ZA 1E8DA 1GIAA 4WY5A 4R9NA 3RLIA 5KINB 3EZ2A 1AZWA 1MDFA 1YR8A 4Q03A 2HQSA 4UAVA 1YJBA 2Q1XA 3UFXB 1HR0B 3THWB 2RHOA 4FONA 4DDUA 1QFXA 4C3UA 3D64A 4GBGA 4XR9A 1USVA 5KYVA 1I1HA 3W1WA 1JFFB 2IUFA 1OC4A 2ESRA 5BV2P 4GPD1 3ZWAA 1E3WA 3SSOA 4EVRA 4KLCA 2E4UA 5L9AA 3IP5A 4H1HA 3DFMA 3JSXA 4NMMA 2BUBA 1UINA 3BRSA 3G6KA 3TFQA 1MEJA 1M1XB 2YN2A 2J5XA 2CDAA 3I9NA 1LDEA 2C8JA 5H4HA 5THKA 5LU9A 4PHFA 3WGTA 3UCEA 1GXSA 3A1TA 4YAUA 1NY5A 4RF5A 3ZWYA 1WSDA 4X65B 3C6XA 5D84A 2M1ZA 2NSJA 4HAYA 2FKNA 4QLOA 5TMBA 2R8ZA 2GA9A 1I4TD 4EAQA 4PRKA 1Y9DA 1EG7A 2VP2A 1P77A 1Q3HA 4YRGA 5AI9A 2DFPA 5TQJA 2Q2QA 3G0BA 2GUWA 3SFVA 1O6FA 4MV5A 1KSHA 1N8SA 5AVVA 1WLSA 3FWKA 5I7SA 2Z5LA 2HOQA 2JZNA 3W9SA 3S81A 2XUIA 4NENA 4B33A 4BKMA 4FGUA 4YI5A 5LZ7A 2H1FA 2O7VA 4OU4A 2QT1A 3AK4A 3WYGA 3I6ZA 2XBUA 3MCUA 3UWMA 5A5FA 2E4AA 2DCUA 1LW7A 4PHTA 2WLTA 3SKXA 1KI2A 4IVQA 4XJSA 2RJOA 1P45A 4XB2A 1Z4KA 2GZ2A 2VK1A 2ZDQA 3EB9A 1LUAA 4MVJA 4ARZA 5KU1A 2VXBA 1DJOA 3W3AA 2DLCX 1T9DA 1XVVA 3ONEA 1OAAA 4B6JA 4JI4B 5EJMA 3GDHA 2C57A 1BYUA 1G8JA 3H2HA 3REOA 4F56A 4YQZA 4OJTA 4YRJA 5K09A 4Z4QA 3DFZA 3WGMA 4CR6A 1SZDA 2PPVA 3EOBI 1E79D 3I04M 4B7ZA 3SS8A 5IXJA 5T8KC 2J33A 2Y4OA 4WL0A 3KZVA 1RRPA 4Y1EA 3LY9A 3KSDO 4O63O 2DBYA 5EXTA 5FXMA 2IPLA 1CE8A 3Q6IA 1R6DA 2V7WA 1D09A 2Q1SA 3QWIA 5FNZA 2YWEA 2XXAB 3IJRA 1S96A 2R6DA 3HJBA 1FYDA 2ID8A 3RVNA 1JB1A 2GJ8A 3JQ7B 1KI1A 2ZBUA 3VZBA 1J20A 1GQYA 4DCJA 1VC2A 3M5WA 4FUQA 4O1MA 1KGDA 2V98A 4K3VA 5HHTA 2YYYA 3AP3A 5FD8A 2RAVA 4NDAA 5KSYA 5FOXA 5CR9A 4LNUB 5EKTA 2PZGA 3L0BA 3BB3A 3MFYA 3ZU5A 2VVTA 4LXYA 3LBIA 4RANA 1Z08A 4B17A 2Q8QA 4HZIA 5U1PA 4MAAA 3LGSA 3KXLA 1Q1AA 4NYMR 4OXIA 4BO0A 5CXSA 4LHXA 1YQXA 3AFIA 1Z34A 4RU1A 1Z5ZA 1CU1A 2I4TA 1G5QA 1IHXA 4XDZA 4CCAA 1SKUA 1CD5A 1XKXA 3PL5A 2BGIA 1CDOA 4RZSA 3LM8A 4AFNA 4OQDA 3IUJA 1ISIA 1VMDA 4AKHA 3R7FA 3FNFA 1VMIA 3QEAZ 3AXSA 3NT5A 3L1KA 3PDHA 4D2IA 2QSZA 1CRZA 1K2WA 1Y6RA 4D79A 3VH1A 1ZUD1 1ZYUA 3TD2A 4CT4B 2QD1A 3I64A 2O14A 3N6XA 3R8XA 2VDJA 1VI6A 3QJ5A 1Q7GA 3JVEA 3P0RA 4CLRA 1QR6A 1UBEA 1TF5A 4E03A 1NBMA 3N76A 1V39A 4C05A 1ZXLA 2HK9A 4TMXA 3VPGA 3RFXA 1MFPA 1JTEA 1SU4A 1E1YA 3EGDB 2PFGA 3GFRA 3PQEA 1C1DA 5I8ZA 5IHPA 3L79A 4LJLA 4PY2A 1NL3A 2XE7A 3AINA 3S2EA 3G49A 1ZD3A 4C78A 1I80A 2GCGA 3CN9A 3DBLB 1O89A 3M6FA 1FC0A 3D6TB 4CM7A 4X7MA 1R5NA 3UMVA 3LY7A 2I7DA 2QN8A 2VSNA 2XYQA 1N3LA 4QYIB 5FUYA 1EQAA 4INZA 5CEEA 2GRUA 2BTOA 1DNPA 3MJ4A 5FIUA 2R6AA 4QULA 3GWZA 3LW8A 2COKA 3SZMA 1ECBA 4FLEA 2NUAB 4BNWA 1PQPA 1UXIA 4BN5A 3HPRA 1OXVA 1L7AA 3E23A 3TXAA 2H3EA 4U02A 2XCOA 3TRKA 2EATA 4YBZA 3JQ8A 4C20A 1RAFA 2YX1A 4R68A 1PS9A 2H59A 3P9SA 1JHDA 3OT1B 5DV9A 1XZPA 4BMCA 1IBKB 5IW8A 1B23P 5AVTA 1RPTA 4MPJA 3IBGA 1SOMA 1YBVA 2RD2A 3R4VA 1B93A 4OATA 1RJEA 3N5KA 4YV1A 5HBRA 2GAAA 1GZDA 3BG5A 3NEPX 4LXIA 5DNEA 1Y6ZA 4TTSA 4BVLA 1JILA 1OH8A 2IUEA 3T4EA 3E3LA 3H8SA 2Z5VA 2VJOA 1PR3A 3IESA 1XZGA 3IAS1 4Z9YA 1QQ5A 3DBVO 2V5UA 4HH3C 1X42A 5H9VA 1FNBA 4B4VA 4MAMA 5AHXA 5ECWA 1ILWA 2UXBB 1E58A 1AZSC 2VYND 4DRXB 2IYFA 3MCVA 3D81A 3TR0A 3TLMA 3AEQA 1YHNA 4UTVA 4MVXA 1Y5MA 2BGJA 2HUNA 2OO7A 4DHWA 4UTZA 2EWMA 4KVAA 3VV2A 2E4XA 1UBRS 1L1QA 3ILHA 3TOSA 3U49A 1IVNA 1MKYA 2KMLA 2R4UA 2CXPA 3CTPA 1FDVA 1QG4A 1ID8A 2B1IA 1E2PA 3F6SA 2Y0CA 1TZKA 5K2OA 1Y5NA 1F2VA 1RP1A 3FMPB 1GRQA 1ZEMA 4R0MA 2VJKA 1AHPA 4XYGA 4BNUA 4C0HA 4B3IA 1O95C 2ZDGA 1JLSA 1RQPA 3KSRA 1B8NA 4NOKA 3PNBA 4V0RA 3AFOA 2JLBA 3HUTA 3CE9A 2M6RA 3OP4A 3CBGA 2BIFA 2CFSA 1N34B 1XA0A 4XQEA 1S89A 3IX7A 1HWYA 3U31A 2XB8A 4L72A 4R9VA 3PQFA 4LBVA 1DHTA 1OI4A 1P5ZB 2KLBA 1D6NA 4RA9A 5DX1A 1H4TA 2VF7A 1WV1A 4MUBA 1NGSA 1P39A 4RJTA 1XZAA 2GYVA 4HRVA 4B81A 2JAOA 4TLLB 1KU0A 2UYOA 1KR5A 3RAFC 4LF5B 4AUKA 3UB4A 4DL9A 2YV4A 3EXIB 4MS1A 4PU0A 4AY5A 2B6NA 3MK31 4YALA 1M1YA 1XP8A 1G5RA 2DM6A 2EV9A 5CYFA 5HPYB 4F6RA 4X6LA 1U0RA 3OLYA 3L7MA 2CSUA 4RE6A 2XMRA 5DYGA 2PUCA 2ZANA 1DU4A 1N6OA 2YZMA 4HPJB 3UMGA 2J6IA 1EFRD 3BJMA 1TZCA 2E5LB 3RFUA 2ODTX 3C6KA 2ORYA 4V0KA 1D2AA 1S2LA 2HO5A 3PEVA 2LDXA 4Y7CA 1Z68A 3EUEA 5G1OA 4B2LA 1J1UA 2Y1EA 4RIIA 2J7PA 3O1HB 1P62B 2HO4A 4K1LA 1I7LA 2P9YA 3EMKA 1BE0A 1R50A 4BVJA 2OYRA 1BXZA 4AVYA 4COKA 5TMEA 4ECEA 5A9TA 1JFSA 1Z2NX 5JDCA 1AUVA 3HJFA 1BKSB 1L7EA 2BJHA 3PUXA 3ACBA 4K9KA 1YZFA 4RD0A 1WL8A 4PSUA 4Y1FA 1E2MA 1I4OA 3VC1A 2J41A 4B35A 4C7JA 3BTVA 2EIXA 1ZW1A 2QMEA 3E35A 4YONB 2FN3A 2O2SA 3VV3A 4MTCA 1DQSA 4XOUA 3X1JA 2ZRAA 4WXYB 1SG9A 2WF6A 4RHXA 1CDDA 4PSAA 3KDSE 3W05A 1HGXA 3FUWA 2PKQO 3B3FA 3MCAA 1P2VA 4FDTA 4C7OB 3KDAA 1JEOA 1SG6A 3WDSA 1KTVA 3V7NA 4HJRA 4A8PA 2DEUA 3F6RA 1SOAA 1QO0D 3G23A 1II8B 4XIFA 5B1SA 5SZJA 3WKEA 1KWKA 3U39A 2O4CA 1ZU5A 3ZU4A 4CGZA 1USUA 1QMPA 3RRMA 1ZRSA 4EKGA 2YV1A 5EHXA 3MD0A 5ENDA 2EJVA 4B9AA 4N41A 2QW8A 2NO1A 3GELA 3C3PA 4DVJA 1NQWA 3ZI4A 2IQ5A 1YHYA 4K6KA 5EHQA 3W5CA 3AVVA 5F1OA 3VKHA 1CIVA 5CBPB 3Q7SA 1T2VA 4WN9A 1XTZA 1YS6A 4HZUB 5F33A 5TGTA 5AICA 5LD2C 3E82A 4TQUS 5LQCA 1T5IA 2AN1A 4O2AB 3HHPA 3LKBA 3A6HA 3NKFA 1E0AA 2JCBA 1QPZA 4MDEA 4ER0A 3T5CA 4BIIA 4NXNB 4W4TA 5M3BA 1DKUA 3PJDA 2IZOA 4MYCA 4LY3A 4FDUA 5JVDA 4HEA6 4UMEA 5EP4A 3EZLA 2XCSB 2FG5A 4N0EA 4I19A 4TV9B 3UG6A 2IS6A 4ZKEA 5JSHA 2J4DA 3Q3HA 3U17A 2JH3A 3I32A 5IM5A 3HB7A 3G68A 4TWIA 3OJXA 3KE9A 4I5FA 1NBAA 4P31A 4K0KB 4LZZA 4ZOLB 5GGYA 4CMKA 1A8PA 1I2ZA 1YQGA 3C6MA 2ZUDA 2HK8A 5KOHA 5IRCD 1OQAA 3L77A 3KR1A 3QFTA 1YAHA 2G67A 2QM0A 3E3AA 4QQKA 5DTEA 3SXUA 4W1PA 5HM8A 1QK4A 1JFTA 2JI7A 1OBHA 3R5KA 4MUMA 3KL2A 4TL8A 3N0RA 3LT2A 2IYNA 2EBWA 4J1TC 3HJRA 3WBKA 4YCDA 1KJIA 1ZZGA 2C2OA 4TRRA 4ZV4A 4GGMX 4XVHA 3HO1A 3EVDA 4XI9A 3GFTA 2WYVA 1EFKA 5ALPA 1IRIA 3ZS9A 3A26A 1M54A 4KGVA 1QIMA 4AMUA 1NF3A 4ZZ1A 4G84A 5LA6F 1X15A 2J9ZB 5CDUA 4R71A 2V6MA 1QTQA 2Q4EA 4FZRA 1U9CA 1ZUWA 3PSAA 1TJ4A 1I10A 3HCNA 3F90A 1KMIY 1PQWA 3IHWA 4YA6A 1PWXA 2WKPA 4JASB 1AURA 2HSGA 1T2UA 3JYOA 3E61A 1U8YA 3KK0A 3R7AA 4DMLA 2VHZA 4OX9B 2AH5A 3F5DA 5HF8A 2JDIA 3KFVA 1EP1B 4EHNA 4Z4GA 2REQB 2OB2A 4JC0A 4U6QA 4TMFA 2H1RA 3C3EA 3DQPA 2ZSKA 3OQ1A 5BRAA 1PG0A 2BUCA 3CUKA 1F12A 1GZ5A 4G1EB 4HAIA 4MJXA 4PLWA 1PT5A 3TZQA 1M1NA 2HU5A 3DUFB 1DKRA 2J3LA 4ZQIA 2NWQA 2XDAA 4QM6A 2A6PA 2PX2A 3L0SA 5TEWA 3GQBB 1J97A 3CUEF 1SRRA 4DANA 2IFTA 2VJQA 3HCBA 5IBRA 3KWFA 1GA4A 2CK3A 4A6DA 1R3UA 4DF3A 1A9XA 1N2ZA 1N3BA 1W44A 2PY6A 4LHYA 3FSRA 4NRDA 1NTRA 1Y5IA 2O2IA 4IIJA 4UDYX 3OCJA 4QXAA 4E11A 4JJKA 2PVPA 5I3ZA 1JLKA 1J70A 4IWYA 3UF0A 5JZMA 1B73A 1QRRA 1XFAA 3MPOA 1OSNA 4BLOA 3G9QA 3G9XA 3QOYA 4HAUA 3JYLA 2PEYA 5BRJA 4AKIA 1RPNA 1R9JA 4HADA 1ZK4A 3LBNA 1FVXA 3QWHA 5G3ZA 2QTMA 4GMDA 3TTWA 2OXRA 2OQIA 1JR3E 5HZGA 4RXTA 1L1FA 2IEAA 5FWXA 3DXFA 6REQA 3Q87B 2Q8NA 4D9JA 5JAIA 4RFSA 3AUAA 4H0FA 5K5EA 4ZN6A 5KEIA 4ML3A 3NNNA 1N5MA 3GJXC 4JCOA 1TVKA 4F7DA 4PPFA 5COAA 1K4YA 5TV2A 5FJJA 3SC3A 1RR6A 1AGYA 1OFIA 2OL4A 1VYUA 1YJQA 4H7HA 4X20B 4BLWA 4CETA 2G76A 3MS2A 4XUGB 2PL3A 2Y1XA 2OFXA 1ZM7A 3H17A 4I4NA 5ETJA 1IWPB 2XMSA 3DV0A 1SQ5A 1TYAE 3GUZA 1Y3BE 4B79A 2G9QA 1XRSB 5B64A 1EWRA 1DWPA 2ZU6A 4MUKA 4A1OA 2WT4A 3BE8A 1CY2A 3BQMB 4K8RB 4UC0A 1X7YB 1AA9A 1F5SA 1U2GC 3PJEA 4PTZA 1WMDA 4RD1A 4DQVA 5J58A 5JUWA 1WQ3A 4V1CB 5CA0A 2ODAA 3DAGA 3LHIA 4J7XA 5K1ZA 2P6PA 2O7QA 3LU1A 3FFTA 3PDJA 2IY8A 4C22A 1UFOA 1FK8A 1VECA 1WNFA 2CXQA 1HMYA 2G09A 3TQOA 4G36A 5CX1B 4R2MA 1SKYE 3FOAA 3HXKA 1I3KA 5CCBA 4KLNA 1GKKA 4D7AA 3DE1X 3UK1A 3ICOA 5B1EA 4OHMA 1Z7BA 4KWIA 3D8HA 2R8PA 4BNFA 1KJQA 1KE1A 5TQVA 2X2OA 5AKGA 4OY3A 1Z6YA 4HEA1 3OLCX 4B09A 2Q2VA 3O7WA 1PJZA 3LUFA 1JA0A 1C4XA 2ET6A 3LP6A 1ETUA 4OHCA 2QXYA 4MQFB 5KTKA 3DUWA 3PVCA 1WVIA 1RJGA 3G2KA 1JEAA 2QD3A 4J2HA 4YJGA 4G5XA 4I50B 4NBLA 1Q11A 5DM0A 5F7JA 3VUFA 3W4IA 4EKYA 2MSDB 4JXJA 4L9SA 4CGYA 3QJGA 3V1TC 3PTLA 1RIFA 3E1KA 5AXBA 3DYIA 3WMGA 2TMYA 1O4WA 3THYA 1QV7A 1QIKA 3O75A 3EXAA 2Q0HA 1MQ9A 2IYPA 2VS1A 3FYUB 1KFKB 1VPVA 1EA5A 1MX5A 2AJCA 3BRCA 3GROA 3HA5A 3L6EA 4QOIA 3FMOB 4MW6A 4EJSB 3GG2A 2XRZA 1L7MA 3HKDB 4QJIA 1R4NB 1ZUIA 2AR7A 5LYYA 3UJ3X 4XGIA 4ZQEA 3LL4A 3C7KA 2G71A 3JPWA 2O1SA 2CXNA 3ZVRA 4N7BA 3BT7A 3R9WA 3LPLA 2YMLA 1ICEA 4K1XA 3UK2A 3BFXA 4C43A 2AXQA 2ZRJA 3D6AA 4WJZA 3E53A 5B4UA 2Q5CA 5LIRA 3BMCA 2OWEA 5C1BA 4V1CA 4XJXA 3HJHA 3KL4A 1DRJA 2AZXA 4MX8A 4OSEA 4UVEA 1MN6A 1YRLA 1C3XA 1H94A 4NCHA 4PZYA 1JEYB 3L0IB 3IPXA 3R7SA 3ZV3A 1DMRA 5CLGA 3VNBA 4DC9A 1KEVA 5BWBA 4OJNA 1RHMA 2ZTVA 3KC2A 2IZ0A 1Q0RA 4YMSA 1T5OA 2I4NA 4NX2A 4LSMA 3TZLA 1QX3A 2HREA 3D3WA 3V2GA 1T0PA 3BXZA 1JLLB 2W4IA 2HJGA 4YMLA 3RARA 4DJTA 5A4JA 1DFHA 5GTDA 2Q7OE 4TLCA 4PR3A 1EFCA 5DDIP 3A4NA 4X90A 521PA 3LHKA 1Y5RA 2J3JA 5BUQA 4AN0A 4KQKA 3S40A 2K6GA 4D26A 3MINB 2OZLA 5AJTA 3T5TA 4UOEA 2QU7A 1H3EA 2XY4A 3NHFA 2EQBA 2OEPA 4D6XA 1P7YA 4RHCA 2V8BA 1Y37A 4FHGA 5BSMA 2PE5A 1G8MA 4HEHA 4YYZA 2BEVA 4N0PA 1BXGB 1D8AA 1Z47A 1F38A 3N9IA 3RIEA 4OV6B 2YV3A 1JR2A 4BV9A 4POOA 4UOZA 1TF7A 3ZE6A 3HXQA 3DKPA 2FXVA 4LPSA 4O1IA 4EVQA 3O1IC 2PIAA 4NZYA 5L6LB 3NTVA 3RSCA 3CLTD 3A27A 1GNLA 3NH6A 1NLZA 5D3MB 1ZAYA 1H1LA 3CH7A 3H1AA 5CYGA 1U8XX 3L8MA 1E9AA 3NASA 3CX3A 1BQEA 3KZ1E 3T7RA 1B14A 4REQA 2Y67A 1Y5LA 4HUJA 5F4BA 2QTWB 4X1KA 3H9JA 4QAJA 2P67A 3G0IA 3CXUA 4MINA 1CERA 4PRYA 1QTIA 4ZT5A 1E2GA 1XTRA 1CVIA 2I6UA 5IVPA 1ZQ1A 1IH8A 2FGKA 2NVOA 4J91A 4F1JA 5JSFA 4PLYA 1V7CA 5C7LO 4MIEA 5DHTA 5HKAA 3UT0A 3RS3A 1W6RA 1BNCA 2QJRA 1M2JA 1EFLA 4RJKA 3S7TA 3SPXA 4YO8A 1EFRA 5G02A 3S2SA 1XNJA 5LDGA 2FAXA 1Q7CA 3AUKA 3E22B 3L9XA 3DE5X 3QE3A 2D4HA 4CTJA 4AZ0A 1U3TA 1NQAO 1ZO8A 2XUZA 1SCUA 4J6EA 2J7PD 5DT9A 5JZOA 4V03A 1HZZA 3T5GA 3QVWA 3AR7A 3EIFA 1JHQA 1X14A 4OI1A 4AURA 1AIPA 1SO8A 2C9ZA 4RE5A 2WWTA 3HZHA 4U9UA 1ORRA 3VA7A 2ICAA 3RBZA 1IJFA 3ZDFA 1AXEA 2CNWA 4RAOA 2HPAA 3MMSA 4P36A 5DNAA 3WQQA 5MFPA 5BYBA 3NORA 2E6UX 4KIWA 1KEEA 3NV7A 1JBEA 2A9KA 2BAGA 2JGKA 2ZYHA 4NHOA 5CURA 4YMWA 3WO0A 4MUGA 3V4LA 1F06A 5GOZA 2XUJA 3CC8A 3T7SA 4YJDA 5E95A 2VWGA 5BV8A 1KZGB 4EVSA 4YLYA 3K70D 2AJ8A 3GLFE 2A2ZA 4YMGA 4GKBA 2LD4A 1AGPA 2XD4A 1C14A 2YRXA 1KJ9A 3DNMA 2MCFA 3P96A 1TCCA 4RBNA 3BFPA 2HB6A 1K86A 1W0JA 2O3UA 2OE2A 3QKRA 1XN4A 4I8XA 4MR8A 4C4YA 1ZUHA 4QODA 1Y82A 1UDXA 3WLIA 1ZJ4A 5AM5A 2Z4SA 2WWRA 5EJEA 1C8VB 4BVBA 1B6RA 1DRKA 1PEAA 1X1RA 3HDTA 3FHJA 4M9UA 2PN1A 4MV3A 4BZWA 1UMBA 2BJWA 3V4FA 5FLXA 4IZIA 4M1MA 2WU0A 2E5FA 3HEBA 3Q15C 4KO4S 4AKGA 3DE7X 5B6IA 5KTTA 1BD3A 4RD6A 2C2MA 3EWIA 3GNSA 1E4VA 2QL6A 3HR7A 4FYVA 4UFNA 4E0BA 4KPEC 1NPTO 3KOYA 2CNOA 3SMVA 1EEXB 2POCA 2XRYA 1FNSA 1J24A 1U4OA 2W93A 3LBFA 4GXRA 4KE6A 2IY7A 4WESA 4TROA 3RVKA 1U80A 2IT1A 2QTVB 3QKUA 1SC1A 1U2PA 2IDMA 5TPWB 1RBZA 3FE2A 2VK8A 3FHOA 4H2DA 4PWZA 3EEYA 1TQ8A 4CDGA 4LZLA 2VF5X 3S1LA 4X8HA 1U8TA 1E6WA 4DSAA 2PKRA 1ZN8A 4WJKB 4EFMA 2CLSA 2GRJA 2WWXA 4FC6A 1VHWA 4MEAA 4NATA 1RW4A 2WU1A 3IQDB 3I5YA 4L5AA 5EUQB 1G98A 1XELA 2C4HA 3ZV6A 1Y8AA 4TZTA 4TLEA 4OU5A 3V4OA 3H86A 2QRLA 3IEXA 2XW6A 4UHHA 1R0ZA 2O4UX 2AX4A 2Y9MB 4YQEA 4ASUD 4NCBA 1MCZA 3PC2A 1ZBDA 1O8CA 2IDKA 4HLDA 2ZJ1A 3AESA 1J56A 3KLMX 5IMBA 2FP4A 4BLQA 5IG2A 3ZK9A 2QTCA 4GZMA 3VZPA 1XEXA 4FFBB 2AF4C 3KYCA 2O2YA 2HAEA 3T5BA 4EUHA 3ZE0B 2OCAA 1VLVA 2X4GA 2AKYA 2B4YA 2G08A 2XUHA 3IHLA 1YR7A 2KB0A 5ILQA 1L4UA 3TIIA 4EENA 3UMRA 1RC0A 1TZJA 2GXUA 1W5EA 3VPDA 2A78A 4QXMA 4BKPA 4ZGBA 2AK3A 3IV9A 2JH8A 4TN1A 1SHTX 1XMJA 3SYKA 1TKBA 3KT0A 1NG9A 1K6JA 4IAOA 1D6MA 4UPVA 3LQ1A 2BMJA 1Z4NA 2PFSA 1UAAA 1MC1A 2EF0A 3AU9A 3P52A 4R3UC 5C8YA 1P4RA 2VWPA 1ZD4A 4ZGWA 2N1MA 4E5SA 5AW4A 4WZBB 1IY0A 4C6RA 1PJCA 4BLTA 4B2YA 2HMWA 4EAAA 4ENPA 1DXYA 4QPCA 5LDDC 4YBRA 2ZIWB 4D45A 4RTMA 3GL9A 4DB4A 5FEUA 3ANTA 5TT1A 1QDEA 3RF7A 1SKAA 3IUNA 1PKXA 5GVRA 2J3MA 4DSOA 4C14A 2HXYA 2B20A 2H1WA 4NFYA 1YA8A 5ELXA 2GAJA 2MYTA 3EVEA 1PFVA 1XTTA 2FSUA 1ZKDA 4IHJA 4JC4A 4US0R 5E2AA 4EG3A 1O54A 1AKRA 3FYSA 3MTQA 2GDZA 1UKZA 2FSPA 4H0NA 1EFAA 5FBHA 4Q01A 4P58A 3NTLA 5D3ZA 1L7BA 1U8EA 3OLVA 5GV8A 4QJ3A 1CJBA 3AHIA 3WVNA 5K2MA 4KR7A 1CE8B 1JE0A 2CVPA 1I7PA 3IQWA 2JVIA 1C3VA 3KYJB 3RHFA 1VGVA 3KR0A 1J1IA 5EGNA 4F9EA 4R2JA 4RUKA 4TLAA 2MINA 4HLUC 1V8BA 1RT9A 1PZNA 1LV8A 5EWJA 5KHOC 4P0PB 2CMDA 4PINA 4HWKA 2GSWA 4HX2A 4N8SA 7MDHA 3JTEA 2PKQP 4D42A 3NKLA 1WHSB 4XUEA 3Q7EA 4YJKA 4Z8XA 4EQ6B 5JFOA 3KUCA 4RULA 3CLSD 4UBIA 4CL3A 4LGCA 1XCGB 5DM2A 5BWMA 5H0IA 1DV1A 2DQKA 4IW3B 1B0PA 5FV7A 2GJ4A 4EPYA 1RXYA 3BCUA 3F3SA 2G7MC 2JF0A 4AG6A 3WNVA 2IBMA 5KTSA 1QIGA 5KYUB 1EX6A 3CPSA 3EC7A 3UICA 3WWEA 1TC1A 4X5OA 5JS7A 4LDJA 2VPWA 5CT8A 4FNOA 5HILA 5IZCA 3QELB 4UZSA 4ID3A 1E89A 1YOVB 2QN9A 4R2HA 4AX8A 1WCYA 5CT5A 4B46A 4OMUA 1NI3A 6YASA 2HRCA 2A9QA 4JT2A 3EOZA 4AM8A 1ADYA 1H3NA 3C3DA 3N8HA 2C0QA 3B2QA 4QT4A 4ZYVA 5GZ1A 4WFJA 4JI5B 5JLJA 2QMOA 4HVLA 4PR0A 4P0QB 1JSLA 3SLGA 1A2OA 2QAGB 3B2NA 3MOIA 1VL0A 3SNHA 4A6XA 2AJBA 3L1VA 3BX1A 1CYEA 3CQ9A 1FUIA 2R00A 4L3VA 3A4LA 2FG7C 2QVBA 4MMZB 4JVLA 2HA2A 4CQMD 4XSHA 2F1HA 1DBRA 1EINA 1KDTA 1ABBA 2FZCA 1Q50A 1UZLA 3ER8A 1H1TA 3FJYA 2FSSA 1I1QB 4XWGA 2ZJFA 3JS5A 3SZRA 1PRYA 2C96A 5AKKA 2HQBA 4P5EA 5F21A 1QORA 5I4IA 2XVYA 3C1OA 2A9FA 3QVLA 4MUNA 4V0LA 3U60B 2IP2A 1QK3A 2JLVA 1AD2A 1RM3A 3W04A 2PSJA 2CBZA 2X14A 4AX4A 2P68A 2PGJA 1UP6A 4DIKA 3GDOA 1UXKA 4OIFA 3W8FA 3HG7A 1FTYA 2GVZC 4DJ5X 5K7SA 1N8NA 1OU0A 2ACWA 2G70A 3P5BA 1U8FO 3L7LA 5DVZA 4BRUA 1YC2A 3WLJA 4PO1A 3IBTA 1ZD5A 3T1YB 1U7TA 1Y8QA 2OD2A 3LUHA 4OXRA 4ZOBA 3WV4A 5K8UA 4LV8B 2YASA 1GTVA 3PXCX 3GLQA 1D7OA 3LOQA 2W2XA 2R79A 3FTPA 5DNCA 2HMAA 2HIMA 3JD4A 4F38A 3PZRA 1XPRA 4R1UA 5EHNA 2NTNA 3PT9A 5DB4A 2ZM5A 1BMFD 2CNKA 2OC4A 1O3YA 4EP1A 3A6ZA 3TEMA 4LRQA 4HWGA 3FOCA 5FL7A 1W2WB 3NETA 4C4XA 1T8RA 2PZMA 4L5CA 3I2YX 1SC6A 3TVTA 4LZOA 4UHCA 2O3TA 3COVA 4OAQA 4BE7B 1ZOLA 5K3OA 2RBEA 1X9HA 3JQQA 3DDNA 3FI9A 3P9RA 3JQDA 2X1HA 2KPOA 3Q9UA 3JD3A 2XSZD 3SHWA 1E79A 4U0KA 4C76A 4ZHQB 4MWZA 5LLDA 1V0JA 1N0WA 2XKJE 4G4GA 1JIXA 3VR3A 3ZLJA 3N2KB 1XRJA 4MRMA 3U3KA 1RMQA 3HY3A 2KM1A 5AKIA 4BFXA 1WB5A 1FSFA 2PFKA 2R6CA 4WI1A 2ZGVA 3P94A 3TXXA 5LMCA 2QRJA 2IOFA 3FYUA 3RT1A 2OP1A 4XGRA 1QUFA 3HU2A 4D5EA 2ZSDA 5CNJA 3G7UA 4NZ9A 1XJWA 2YR0A 3O9MA 1WDMA 1HRDA 1OGYA 1X87A 2GK7A 4NEHB 1GL3A 5IULC 4S05A 1PGNA 3CISA 3E0QA 3HSYA 3QEOA 4QQFA 4ONEA 5DGTA 3ZZTA 2V4UA 4N3NA 3EH1A 3N2GB 1NQTA 4OHWA 3IB3A 4G63A 4ALMA 1WU7A 4K9OA 4DLAA 4ZO4A 5FI5A 5EJ6A 3U44A 1KOJA 4Z9XA 2HDNB 4FFRA 1QIJA 1XHEA 4MQMA 2A9OA 4JQCA 4HLQB 1MO6A 3R5SA 1P1JA 1L4BA 5JVDB 3TD9A 1T8PA 4W5OA 3FWHA 4RH1A 3NHPA 1XTBA 2PGAA 1NONA 4IDPA 1LTKA 2IUYA 3EQ9A 1A9YA 2NXJA 4J0DA 2JHFA 4PZPA 3AHCA 2HMSA 4FNAA 2AKAB 4EX7A 1OILA 1T1RA 1U1IA 4I55B 2ZWPA 4YPFA 2VBCA 4QXQA 4B2PA 5LQKA 2C1ZA 4ZI7A 1K6XA 2Y6VA 2PH1A 1M2OB 5A4DA 1DAIA 1Z29A 4IFBA 4TV9F 4QTXA 4PN7A 3EFHA 1RHKA 3WY9A 4M0FA 2B5VA 4Y2HA 3DTVD 1U2RA 3H2IA 4WRRA 2CLFB 1GXSB 3L46A 2Z1NA 1PR9A 2C42A 2NP7A 3AL0C 4M1KA 4RMHA 2WTEA 4O2AF 1CY8A 1ZESA 2M2IA 2OFWA 5ALQA 1NT4A 3AI1A 3G0CA 3U62A 4E09A 4Z7NB 4QGBA 1GQ2A 1SBQA 1H1LB 3LCMA 4QOEA 4QO7A 4YREA 1L5QA 1XSEA 2IF0A 2IZ6A 2GHTA 1UFVA 1NI4B 2OLEA 2X6QA 4BL5A 1GPLA 1Z6PA 4EL5A 5AUOB 1O6CA 2ZB4A 1OIVA 1KDRA 3DUFA 4WJLA 4AZ3A 2X0JA 4CEJB 5F9FA 1JFVA 2XCIA 3BXGA 1UJCA 2X13A 4ZT6A 2ZSEA 2FB9A 1WRBA 2FFBA 3B1JA 2C4KA 3LW7A 4LTMA 5GONB 1DZ3A 3T1QA 4B9EA 1E63A 3SBDA 3HP4A 4R5HA 4ZI5A 3K30A 1V6CA 3TNYA 3WLPA 4EGFA 3EXEB 3TSCA 3A7DA 1ST3A 4N3AA 4WE3A 4KOEC 1XYVA 1QZZA 1OAOC 2GPYA 3BM5A 3QVMA 1HDIA 4INPA 3QPAA 5DSZA 2C9DA 5CT9A 1VDZA 3O26A 1WOYA 3PC3A 4OI2A 4Q37A 4AF8A 1V3TA 2VDNB 3EIXA 4D56A 1JG1A 2C98A 1G21B 3I4CA 4IF4A 2JGLA 3M2TA 4EG8A 3OEHA 1O2DA 1M34E 2VPZA 2WM2A 2VAWA 4Q12A 1AS2A 5FFFA 5TB5A 2VJBA 2IEYA 2ZRMA 1JLLA 8GPBA 5FQOA 5IUJC 2GEBA 5DNWA 4ILKA 5EZ5A 3VX4A 3YASA 2IH2A 2NO5A 1XTSA 4X93A 1FSSA 5EVJA 4BQFA 2V7PA 4LBYA 4YECA 2B1RA 2V45A 3HXTA 3JQ6A 1RNLA 5F4ZA 5A71A 4WZBE 2ZITA 1NMZA 4HDOB 4HQ0A 3ADBA 3ZBPA 3QF4B 4Q4LA 3RVBA 1MENA 3RS9A 2WINI 4PYJA 4F5WA 1V16B 1S7CA 1SQGA 4Z0HO 4PBSA 3OM0A 4B76A 3PEFA 2BFEB 3DLHA 4N48A 1XZMA 2WPNA 3HUFA 1WXFA 2FEPA 4RHEA 3UUGA 1KMMA 4OHVA 1MQ8B 1PTJC 3DWEX 1YJ5A 4FJ1A 3ELYA 4XTRA 5BN3B 4I6EA 4O3FA 3I5XA 1VG8A 2D0IA 4O4JA 4REMA 1POXA 4AJPA 1CEEA 5KYXB 5JSKA 3CSDA 1N7HA 2Z6VA 4XX0A 4KX5A 1KK0A 3QBVA 4QDKA 2J0UB 4R5MA 3RPEA 4NJMB 5GPBA 2C2KA 4L2IA 5BOVA 1OA0A 3JQAA 3DAYA 3IPRA 1EFTA 2I2XB 5GZ6A 3IILA 4JX8A 3LOUA 1OV6A 2XF2A 4OQPA 1KJZA 2GHIA 2R25B 2V55B 4FP9A 2O48X 4IVRA 2B2XA 4WFQA 5H5JA 1PLKA 3VYWA 3W5VA 4AULA 2B1QA 4FKMA 2OAEA 2GSDA 3EBLA 2IZ7A 2WUEA 3QZUA 3IUBA 3GXBA 4YRLA 3TL3A 4CDNA 4JC8A 4E1BA 2W2LD 2ZIXA 3C70A 3GDFA 4MIOA 1NVDA 4LRUA 4O0LA 2PX3A 4YRMA 2UXCB 1BWSA 1V1MA 2R7AA 3N7TA 3KDPA 3NOXA 1L5LA 3RODA 4ZO6A 4D0RA 4QXPA 4RDHA 4YJ2A 1N33B 1Q84A 3ZBTA 3FPHA 2BVNA 1Z88A 4GUAA 4LHWA 1K8QA 4MMXB 4UCFA 4GMXA 1R6XA 1RTTA 2NUTA 3V2HA 1LPBB 2BZ1A 4MGEA 1KA9H 3OFND 4D4HA 5CA1F 1KXZA 1QZ3A 1FNDA 1YQQA 2AFIB 2DHRA 3NOVA 4JVOA 1WY5A 3ZJYA 3L6UA 5KTOA 1HDOA 1V5EA 2OVBA 1GG8A 5E7MA 3G2JA 4MVCA 3ZWWA 5EJ5A 3S1SA 4LDNA 1M6EX 2DFLA 3GEDA 1PL0A 1U5AA 3C39A 4KK3A 5CDTA 5C8DA 1EWQA 5FHQA 2QGZA 3V42A 1E94E 2VCHA 4EZEA 1NUSA 1UBKS 3OG9A 1PT6A 1UJNA 1N1MA 2ZP1A 1H8ED 1LEHA 5DLYA 2J8ZA 5BV1A 3SVTA 1RJFA 2AC4A 2EGHA 1UJMA 1XL0A 4R1LA 3OKCA 4ZREA 3O74A 4UAUA 4PSKA 1OBCA 2RGEA 1R9NA 2FPXA 2VYFA 3QF4A 5ANRB 1QH8B 3IAM1 4NBWA 3KPYA 4BMXA 2RARA 3FLMA 5DXAA 1QHHA 2R1ZA 3IAXA 1TEHA 5ICSA 5JBNA 1LWNA 3QXHA 1BCSA 3RCBA 1SC9A 3VR1A 1FJXA 3RGGA 3E03A 1V4VA 3EF0A 3OPQA 5D5HA 4RTJA 4JV5B 2GEUA 4JQYA 4RJIA 5TMPA 4C07A 4PC7A 2DTDA 1L0BA 2F62A 4M88A 4MWDA 1ETHA 2MJLA 2QVCA 3L6BA 4UEOA 5J43A 4MUIA 1VJ0A 4WGFA 1ZNXA 3IOBA 2PDAA 5KKCA 5FA5A 3MWGA 4P4UA 1IPFA 1BJRE 3IMGA 4DNOA 5BURA 2PNFA 5TJHA 5DPMA 4Y6RA 1M72A 2RJ3A 2IXDA 2R6R1 2QN2A 2VUHB 3OI7A 3AI2A 5ESXA 5G41A 3VPFA 4BLRA 5HKBA 2IGTA 4CIBA 1HX7A 2HQRA 4F60A 4P92A 4Q7EA 4ZGGA 3V34A 2Q99A 1N1DA 3K2EA 4P6VF 2RGDA 2DB3A 2WJZB 3SJZA 1RJ9B 1YOBA 2JIZA 3DM5A 3D8UA 3TE7A 5HFJA 2I8AA 2J9RA 2H5EA 5FO0A 5HKKD 1JW9B 1RFLA 3O6VA 5IKXA 5TNXA 5JARA 1Z4QA 3JWJA 4BQRA 1TU4A 1XRRA 2HU2A 4MZDA 5G1PA 2VHUA 2C9YA 4HNSA 1KJJA 3I76A 4EQ6A 4UUOA 5BWLA 2Z2ZA 2Z6QA 5GJBA 2PAFA 2PJDA 5KO2A 1M1NB 3HC7A 3EIUA 2YMQA 3QYFA 4OB8A 4AAYA 1IZ0A 1BQ3A 4HGYA 4DCGA 4EITA 3NHLA 1GILA 1Z62A 4PC1A 3IXMA 3O83A 4WEOA 5JQGB 4GMFA 5LU8A 1K3TA 2AX3A 3LDFA 1NBME 1OI2A 2IV2X 3VKUA 5LYJA 1NIPA 4JN6B 4IJ5A 2H4ZA 2QV7A 4HWOA 3DEHA 5JCJD 1EVLA 5LWQA 2JAHA 4F91B 4H15A 3E5MA 1GRCA 1V5GA 4NV1A 2BKVA 1S1CA 3KYDA 5AJVB 5IWCA 2QDXA 4DQUA 1P61B 1Q3KA 2QP3A 2X6TA 3PGVA 4G4JA 3X2EA 1H93A 3I5UA 3FPGA 2DUJA 2Z43A 3DZ8A 4IDFA 4IUYA 4NPCA 5L3SB 5DI3B 3VR4A 1OPXA 3NYRA 2MMCA 4OQFA 1DAHA 1E2KA 4AUNA 1POWA 5EJGA 3AHJA 4QG7A 2QUJA 2WIDA 4OH7A 1RI5A 3LH5A 3TLJA 3DOFA 2PA3A 1LLUA 2VP5A 3IVGA 4I6GA 2QORA 2Z3VA 1MABA 4YUWA 4MYDA 1ATIA 5AJUA 1KEPA 1GKIA 4PIPA 5NLLA 3UO8B 3HGQA 2ATXA 4KNVA 4P81A 2VYQA 5BQ3A 1LF5A 1PWEA 5AUPB 1O9HA 1M1ZA 4M1WA 2V0NA 4G9EA 1ZGBA 1R0CA 2J4FA 2F8TA 5CLHA 1VSUA 3D54D 4H77A 1P18A 5K0TA 1YZHA 1F48A 3KS9A 4YP9A 5BV7A 4IBOA 4KG7A 3WMWA 3UXHA 2EG9A 1BEUB 3BQ9A 2GPWA 3A31A 3KQQA 2EJCA 2W6PA 1GU1A 1Y1LA 2WNHA 2QL9A 4GPIB 5AVWA 1WQ1R 1N2SA 3KJEA 1TQ2A 1QZXA 5FO1A 3F6BX 4I5GA 3MQFA 4XIGS 1NMSA 3IVRA 1XEXB 2ADMA 1LFAA 2Y71A 1F2TB 3RK1A 4QPJC 5GIOE 1ZGHA 2Z0MA 2ZPUA 2GEVA 1KI3A 1RLJA 2GEJA 2QR5A 2RFLA 1E6KA 3D7LA 3AVUA 1ZNYA 1K4MA 1RM4A 2CL7X 2QMZA 4BJ5A 4E4YA 3H2BA 1SUBA 4QOHA 4RSGA 3ETEA 3VU8A 5C3MA 1ZNQO 1KDYA 1UC9A 2AOXA 4F5DA 5ESDA 1LPAB 2D7CA 3QW4B 5EPOA 4NC9A 4XPIB 1IN5A 1ZP6A 5ENVA 3UGJA 1Y9ZA 3CLRD 2WKQA 3C87A 3LA6A 5HEKA 4B84A 4AZWA 1QO0A 2H1HA 4X97A 3LUDA 2PSDA 1XMVA 1XKLA 1HT2E 4OQNA 1JG7A 1KK3A 1A8SA 4R51A 4MYTA 5C5DA 2VDWB 3SEZA 4AJLA 5F7XA 1D2CA 2G1AA 3PEWA 2ACKA 1IEQA 3F7TA 4ROTA 5A7HA 4DE5A 1RMTA 2RKBA 3UHFA 4ZCRA 2XGMA 1IZ9A 5A2GA 1FIUA 2GKGA 2CJWB 3OT5A 4FYHA 4PRLA 2IZ1A 1LDNA 4ALNA 1ZOOA 4EY7A 4R4JA 2R0QC 1Z75A 4TM8A 1Z0SA 4JP5A 4ZRNA 4DCUA 5DX8A 2LKCA 2GDJA 4DBVO 4WKNA 5AQEA 1E2FA 2W6NA 4QA9A 2XTNA 2WG2A 4QICA 3OBBA 4TMYA 5BVGB 4NCXA 4HNAB 3LUCA 3ROKA 4C21A 1YTUA 4AJIA 3L2OB 2VHCA 4YCNA 2XE4A 1IHUA 5TR9A 3RRXA 1QU3A 5K3DA 4BNKA 1JDVA 2P9FA 4TOIA 1QVZA 3DPUA 4QTYA 4EEZA 1VPDA 3BEOA 4H7DA 3W06A 3VVBA 4WNAB 2OV4A 5KPJA 1G7SA 5JH7F 1M1YB 2H08A 3G8AA 4ZQCB 1NP7A 1V9LA 2CLCX 2IYXA 2AE2A 2XB6A 4KI0A 3UV3A 3PHLA 1DC6A 1AX9A 5CNKA 3G1WA 4BGDA 4DFDA 4NU5A 3FFXA 3OZUA 1V37A 1AXRA 2IZ5A 4HNQA 4QTZA 3W79A 5KX5B 3BGIA 1C4KA 1DOHA 1NWHA 3AOEA 3MAGA 2B4QA 1X7WA 3MMZA 5BXQC 3RF6A 2AFIE 4RKFA 4UVDA 5EKXA 5KSPA 3KZNA 3W6OA 1M67A 4IICA 5JJLA 1A82A 5GONF 3SU8A 2JBAB 2YXBA 1Q0QA 5IKMA 4AZSA 4MYUA 4DC0A 2D5AA 2EBUA 3HN6A 5FWNA 1GLGA 4BP3A 2E1PA 3EGOA 4D98A 4H3SA 3FUCA 5IBQA 4BWVA 1HNZB 3DEFA 2YDYA 1Z18A 1VSQA 1NXTA 3CF4A 4LXGA 2O0HA 4MP3A 2P2DA 4O4LB 1NP6A 5FTJA 4DLVA 2COEA 3M8KA 1WXGA 3I5MA 3ZWCA 4CFSA 2YY6A 4KPYA 1W35A 2BGMA 4DN6A 4XWKA 2B37A 1GUZA 1PFQA 2A1IA 3UGTA 1LVUA 4IDOA 2BSAA 5DTJA 4BMZA 1S2GA 4QNRA 1E1NA 1W5TA 2ODBA 2H31A 1X2EA 1OZ0A 2PZEA 4KXXA 1G8SA 1T5TA 3FKQA 1I2AA 5LQAA 3BWVA 3SZOA 3F74A 2BM8A 1B8UA 3QXJA 1L5HA 4U5XA 4I36A 4LGYA 1NJ8A 2F3QA 3WJ2A 4OYYA 3QLVC 4J3JA 2WHRA 1HE1C 3KVNA 4F6LA 1KYIA 1RZVA 3H4IA 1HNNA 2Q3CA 2W8BB 1SY7A 3NRJA 3TR6A 5CB4A 3VDRA 4MCHA 2DLDA 5BWOA 2FZKA 3A9WA 1PEYA 2P2CA 3CT6A 4FSDA 1ORTA 5F51A 5DGCA 5ICEA 4D99A 2JKZA 4AC9A 1NOKA 3L7BA 3ES9A 5DT2A 2XT9A 2DT8A 3W4KA 4JROA 5KX5A 2V1XA 4ZD6A 3ZHOA 2EP7A 5HQTA 1JR4A 1MTZA 2DQ4A 3H9GA 3VQTA 4WCDA 1QLHA 1QHYA 1XLUA 2FPKA 3EQ2A 1YU9A 3OZSA 3P9IA 4I1YA 1OF1A 4RGYA 1QVWA 5JDCC 3E9YA 4I46A 1Z12A 3HY6A 1PKEA 3KP1A 4F2WA 3GVIA 2RGXA 4ZZ0A 2ZI6A 4WKCA 2H7VA 4U9HS 2H51A 4R7GA 2YFKA 3FR8A 1NX6A 2NQTA 2BFOA 2Y6UA 3A9TA 3FBGA 4TPKA 5E7JA 3TMAA 3UHOA 3VU9B 1GKUB 4TTTS 4CKEA 3F0TA 5CG1A 3RBAA 3STUA 4B3TB 1ULZA 2C04A 3BGSA 3L8YA 3MILA 4MB6A 3VO9A 3WWCA 4WXEA 3HI6A 4E7PA 1MO4A 4GE3A 5A5VA 1RD4A 1C2TA 1SKBA 1OJ7A 1GPKA 2WSSA 1PJ4A 3H7AA 3FPBA 3SVZA 3W6ZA 4AJOA 5DWDA 4DMGA 1KEWA 1UWCA 3LWBA 5F1KA 2P9CA 3K73O 4FMCB 5HIJA 1IC6A 4B4OA 3E8XA 1A98A 2G88A 4RX1A 2J9FB 1UZMA 2V7BA 2V0CA 2RKWA 3ZWVA 3BRWD 4Z4HA 2IS2A 4AMZA 3SSMA 2O8DA 5DASA 3VR4D 1DS6A 4CTOA 4ETNA 2GZ1A 3UGQA 1B16A 3FKSA 3VTAA 5C7IO 3E9QA 4EG4A 1P5JA 3B52X 3H2YA 2FKAA 2QMQA 1KI8A 3QRWA 5AM3A 3L4BA 3UWPA 1IBMB 2CE7A 2Y8EA 3T12A 1QQBA 3UY4A 2AOUB 1Y1SA 1C8LA 5E6SB 3L1UA 3V4PB 1BSVA 1MXHA 4Q7LA 1REQB 3ZGYA 3KXDA 2II6A 4V2IA 4EMTA 2GK6A 1M34B 1N1EA 4M38A 4JLDA 3NR2A 1ONPA 2FPPA 2Q07A 3T0IA 4DLZA 1CJVC 5J2TA 1E69A 4YRZA 5CAEA 2BFPA 3SR0A 2VP3A 4HXEB 4DXDA 5K3FA 2J6CA 2AZTA 3CUVA 4UUAA 2HFJA 2Y05A 3AM4A 1JPVA 3NIBA 4MWOA 1BVUA 4MCIA 4J1QA 2XVMA 5K3SA 4CEHA 1V8DA 5EYPA 5IJ0B 1X1AA 4CEIA 1BMTA 2XJ9A 4KSYA 4BX2A 3BWEA 3T34A 4P35A 3G17A 2BP7A 3NDIA 1VTKA 1HLDA 1CUBA 1JEEA 1R5OA 4LZPA 1P0PA 4P93A 4Y2UA 1GAJA 3CPJB 3K4QA 5I5GA 4FWBA 1Z6TA 1ZLXA 4QFBA 5HK9A 1YV9A 4C0WA 2CT8A 4RDXA 3FCEA 1H9AA 1X92A 4KGDA 4CFYA 2YZ7A 3HS3A 3QHAA 4FOOA 4I4TA 1J2EA 2ON6A 1ADBA 4XEHA 3T1OA 1KMCA 3KT3A 1J90A 2NU6A 1OE0A 3PQ2A 1G8GA 3Q9SA 2A5FA 3NBYC 2PRSA 1RWWA 3ZQ6A 2AQHA 2ODPA 4DKJA 3DEZA 2WVGA 4DDWA 2XQKA 1UWLA 2VT2A 4Q1FA 5C0OE 3K9BA 1YNSA 1G291 4G24A 5AI4A 3QA9A 5IU6A 1W75A 1YSCA 2YRFA 3R6LA 1LQUA 4KE8A 2F17A 1P9WA 3AKCA 4TQAA 3QX7A 2WIKA 3TTSA 4BAZA 3TIFA 3UHPA 3H5IA 4NV3A 4MVJD 5BN5A 1CUWA 1RI3A 5D3QA 3WWDA 4XWYA 1GOTA 4L8LA 4ARZB 1U2SA 3PTAA 4M9QA 5MN6A 4B6PA 4ICIA 1V71A 1SRQA 5JH7A 5KHAA 1ZJJA 1XKQA 3PE3A 3VR2A 3ZBUA 2WSLA 3A1WA 4IV8A 3ABZA 3WNQA 1YA4A 2YRWA 4E3ZA 2F3TA 3DO8A 5ALUA 1VG1A 3O4RA 4C03A 4DIMA 3WGNA 1FFYA 1QCYA 1UPCA 3NWOA 3EDRA 3NBXX 2WOJA 3OLQA 3WIVA 4ZK2A 3TLEA 5A4MS 1FRZA 1U3GA 5JMWA 5AVZA 1KQOA 3DNFA 3WHKA 2BFBA 1Z0IA 4G0OA 6GPBA 2CXSA 2VAXA 4JHLA 3VGJA 4R8SA 2FWJA 2ZTSA 2B8NA 2CVZA 2JVKA 2PQ6A 5JAZA 1T36A 3HKEA 3M2PA 3V5NA 1FQOA 1XJ0A 5T6BA 4DMCA 1UBHS 5EHGA 5I9BA 3O21A 2ENUA 3IUQA 4ITRC 2SKEA 2N1BA 3D3KA 3H0EA 1CT9A 4FE4A 1RRFA 5IJWA 3ZKWA 1WXXA 5D00A 2G4VA 3VR5H 421PA 3HACA 1NQUA 1VRCA 1JHZA 4YJ3B 5E6RB 1N7JA 1TJ3A 2H2FA 3PYMA 4NJEB 1WTCA 4R0VA 4URWR 1EXDA 2VA9A 4C5AA 5D3MA 5MN5A 1CUVA 5ALKA 3GPLA 1L7XA 1NVWQ 3NRBA 2NO4A 1PQ4A 4Q3LA 1J06A 5KNCA 5LXTF 2ZSJA 4QXRA 1H2XA 5ADUS 1R6AA 2WQ7A 2N3ZA 3KLNA 1HT0A 1H2BA 4LRSB 1XDGA 4LCEA 4IO1A 4IX1A 4YDQA 2VH2A 3GLRA 4CHGA 1NN5A 3PGMA 5T4HA 3PG5A 2W42A 1DJLA 2F64A 1CUDA 3SHOA 1E2DA 3G89A 3AXTA 1Z56C 4TUYA 4U8HA 2G40A 3KU4A 2ODQA 5CIQA 5B53A 5UKDA 4BZPA 4DCSA 5CB6A 1YRWA 2QRHA 3HWSA 4A03A 3ZHSA 2ZM6B 1B0ZA 4JEUA 1MMFB 1AKYA 3FPAA 3F5QA 4TRMA 4E6EA 5HZHA 1CQPA 1YBFA 2B9VA 2X0KA 1Y34E 1MR3F 1E6MA 1NUHA 3DKRA 3G88A 3HKCB 2C5BA 4YMIA 1EFVB 3M81A 4AN4A 4DIDA 3ELUA 1NVKA 3F3MA 3HO6A 4KXMA 2O50A 3JW8A 3WRWA 3PTZA 4EGQA 2P5YA 1PV1A 1S9HA 2NV2B 4K9SA 4ODIA 1NYRA 3RVLA 1FTQA 1BO6A 1TOAA 2C2HA 1TQ6A 2HBQA 2J3IA 3AF0A 3RI3A 5CTAA 4Z4IA 5BNTA 2WD9A 4ZOAA 4JDPA 4X6UA 1DIOB 3V8BA 4RIGA 821PA 1VA4A 2VQEB 2GZHA 1F0KA 4EJFA 4YCCA 1FW6A 4Z3OA 5LDHA 4WMLA 1Y80A 1D1QA 2V5AA 1RQXA 4IZOA 1NYQA 2WAOA 4HVTA 4NCAA 1FP2A 5KTMA 2PLWA 4JYPA 3BILA 2H4HA 3OTIA 2DMRA 2GXQA 3GLIB 2GM3A 2C5FA 3H1PA 4R8MA 2P0YA 4HYYA 4J16C 5B7PA 2OORC 3W3AD 3PPIA 2RH8A 4OP1A 3UK6A 3AVWA 1YR1A 4LE0A 1N8KA 2CXXA 4HKTA 4ZU3A 3RTAA 3KKNA 4RSRA 4TYWA 3P0HA 4DIUA 3SHQA 4NJOA 4H1WA 1U1FA 1TA0A 3BPSA 4PPQA 3NNSA 2DPMA 5G0TA 1XCLA 2GN6A 3DQQA 3O0DA 4BVGA 2FE4A 1FLNA 4HZUA 2FFAA 3V46A 1Q20A 3GUYA 3PE4A 2QUHA 2AI3A 1KY3A 3A6DA 3HCAA 4XFJA 4DNQA 1P91A 1YT5A 4XDHA 2ECQA 5B1HA 3ODPA 4EHBA 3GMSA 3EGCA 1N2IA 4ARUA 5A9SB 2OBLA 2QYSA 1MHTA 1R64A 2ZZMA 2E49A 3IAUA 3OMLA 3K71B 4RCZA 4GBJA 4Q4HA 1MO2A 2CBGA 3K20A 4PC2A 4M1EA 5TPZA 1ESNA 2FZGA 4EMBA 3C48A 4NCJA 3TW4A 1E66A 1JIVA 2JBWA 2BY4A 1GUYA 3DOOA 4J1TA 2PMWB 4N7RA 5ALYA 2OKCA 1HDCA 1R16A 5EKUA 5IEBA 1DBVO 3PLNA 1SEVA 4TGLA 4DILA 4E2FA 4LZNA 4LDPA 4PQEA 3VZRA 3C6YA 1IUKA 1F6WA 2FN9A 3EZGA 2G3YA 3TQCA 5JECA 3EF1A 5KJCA 1J0XO 1GNTA 1HDYA 4O29A 4NU6A 4DWOA 1V16A 3IALA 1JSCA 4JBXA 5FUVA 4O4HB 5C8YB 2JGAA 4KN6A 4PRZA 1KI7A 5K8TA 3IL2A 1KS2A 5C35A 1C0IA 1ZL0A 3SF0A 2RGBA 3V1LA 1N3YA 4YUZA 2JHPA 1NNSA 3WZLA 2YINC 4FEGA 2PZFA 5HFNA 1LJUA 1OLXA 1IK6A 1T3ZA 1YHZA 3HLKA 1RBMA 1OI7A 3NHUA 2NU9B 1MC8A 2XMCA 1P7PA 2PRYA 2VHQA 4TTQA 1N5DA 4LOIA 3TI9A 2PWAA 1B3BA 1V3QE 4WA7A 3OH8A 3ZY5A 3CU5A 5TX7A 2KW5A 4IIXA 1N2CB 1XOIA 3EXIA 3D6FA 4M1QA 2ZXEA 4MS1B 4V02A 5BQOA 3FTNA 1DAKA 3AG6A 3FHLA 3K32A 2VYVD 4TS1A 2KHZA 3WDKA 4EPWA 2ZB7A 1Y9EA 3T5AA 2HF8A 5FH9A 1MH1A 3N39C 4G9BA 2QRGA 1KJ8A 1OX4A 3OCYA 5TEVA 1BGXT 3IE2A 1KFBB 3KAPA 3NGMA 1X38A 4GPTA 4EKDA 1NJ5A 1J8DA 2W71A 4BUZA 4RKRA 1YFJA 4WZZA 1V6AA 2A0UA 3QTLA 1CJSA 1V2GA 3ZE7A 5F1PA 4C6TA 3GLHE 2X0NA 1JDBC 2CD9A 2D1FA 1WKCA 1J8MF 5HP4A 3C1TA 3GRPA 3WQBA 3PPVA 1MD9A 3TGPA 1ZA1A 8LDHA 3ZKWB 5FOWA 3QLVA 3KOOA 5JD6A 5IJXA 1J49A 3GMTA 1B2RA 1JI0A 2WNSA 3R09A 1GVHA 2WTUA 4OKIA 3OZBA 4CLHA 1DDGA 2PJZA 3C3JA 1EE1A 2YOGA 3PJRA 4O59O 1CB0A 1MO5A 2FDXA 1NOIA 2XTMA 4N6GA 5CITA 4X84A 5KDLA 4MUXA 3TUZC 3QVJA 4J29A 3H5NA 4OLFA 3MYRA 4F4CA 5L3QB 5IJAA 3AUTA 1DFGA 2F3RA 3MJEA 5CGQB 2B4KA 5E6UB 2ZVPX 1BDMA 4M1YA 4DTIA 2PT6A 3G6WA 1PT8A 3H3FA 1U3DA 4HMOA 3L4JA 4E2YA 1Z7GA 1GAQA 2CVOA 3M9WA 1F8YA 1KNQA 4A91A 2WSSD 3K5IA 1GPJA 3F2VA 3NAZA 3Q2OA 3OFKA 3NHZA 2QN3A 1GSHA 1LS1A 2BW0A 3CYFA 3E5RA 5FUWA 2IK8A 3I8XA 2XJ4A 5TQ2B 4QELA 3BSWA 4TXNA 1VLQA 1S02A 1AUXA 4JVSB 3HZOA 4Q7MB 3LQRA 2R7LA 1X1SA 2PCLA 4M0EA 4B4DA 1GITA 3CR3C 3JSAA 1YB1A 2Q1YA 4A16A 1ECPA 2GM9A 3TUIC 1F3LA 1DAPA 1IU9A 1NV8A 2BONA 3ND5A 5BW8A 5E3JA 2XWJI 4QUDA 4E5PA 6CHYA 1LI7A 5HA5A 3FUXA 3A10A 5AI5A 2RAUA 3KB6A 2V54A 1PL8A 1XDZA 4HVAA 5AO9A 5EXXA 1G7TA 3H04A 1CR4A 4P9NA 4QPDA 3DEIA 1HSZA 1PIWA 2D5IA 2F6RA 2VAPA 1H5QA 3NTOA 4IWNA 4QYIA 4RL6A 3MWJA 3WZ2A 1DRUA 4DLXA 1ZN9A 5TVGA 5FUMA 1QGUA 4G5SA 3T3OA 1YJ8A 2FSFA 2QJTA 4EUSA 4I3HA 1EGVB 5BT8A 4YRTA 1G5PA 3AY7A 1ZZEA 4GPEA 1G2QA 5FTNA 2F4VB 4EPXA 4FTWA 3CMMA 5T3UA 4RHTA 3ASUA 4ND3A 2G36A 1A77A 1LS6A 1URPA 3FRIA 1ZGJA 3EBPA 3IIMA 2CK3D 4YJFA 5I7RA 2WW8A 2I91A 1RI4A 2CJWA 3BJEA 4NH0A 4OM7A 4NZMA 4Q66C 4RK5A 5ALSA 3AESB 3NU1A 2ZRNA 4D8VA 4DG5A 16PKA 1QXSA 5CBPA 4R8VA 1HOTA 4GYKA 3TZ6A 1Q0HA 2IIPA 4YGYA 1YRHA 3L7AA 4M22A 4BECA 1CRWG 1W25A 1RYBA 2QRKA 2AXEA 5IHXA 1RXUA 1VHJA 4MA4A 2A5JA 2R47A 4RXMA 3E9NA 4BB0A 3AKEA 1CWUA 2ASVA 1W36D 4JUIA 3IELA 5AHWA 1LQ2A 1JJ7A 1DLJA 3BIWA 3HU1A 4W8HA 4Q9JA 3SE0A 2WYIA 5TE9A 2OHXA 4PAOA 1Z3CA 4ZZ2A 4TL9A 4UM5A 2QB5A 5KWIA 3KG2A 3OZFA 1RVDA 1UJ6A 2NPIA 1XD9A 4A7PA 4TUYF 1R4AA 5F3DA 1DDIA 1EBUA 5K0SA 3WAJA 2DG2A 5CDHA 2QTNA 5EQFA 2XEDA 4ZVKA 1GTJ1 4N0DA 4M0PA 5CDSA 3B1XA 1ESEA 2H4WA 1CSEE 2WZCA 3E3OA 2XHEA 3KVRA 1TL7C 4MGZR 3ROFA 3IDQA 2QAIA 4FZ3A 4WWHA 4HV4A 8MHTA 3VR2D 1QONA 2Q4RA 1P9LA 3LUGA 3PIRA 4IIDA 3OO0A 3SX4A 1QSGA 5IDXA 1W9HA 2X5XA 1E6UA 2QDKA 3O7MA 3SZGA 3ZHBA 5CVTA 4TSFA 1Y98A 2AFVA 3LUBA 1NMEA 1YB5A 3EXG1 3VNVA 2HCBA 2IHJA 1S3FA 3JWEA 1OI3A 3MCWA 3N8DA 4RC9A 1H1DA 4TRJA 1JTFA 2Z04A 2WQ6A 2QJFA 4R98A 2G07A 3VSAA 3LT1A 1XPUA 4JSRA 1DEKA 4NARA 1GY8A 1JVNA 2P2NA 5G2OA 1CPYA 1PUIA 1S8AA 2NSYA 1O5OA 3HYLA 1DE0A 5EZQA 2W2LA 3L6DA 1XHLA 2D1YA 2J0EA 4HNTA 3I4FA 2VXYA 3AKZA 4RL4A 3EUAA 2NU8A 3USCS 3SZ3A 9ABPA 1Q0TA 1NXOA 5JCZA 3TQRA 2IHKA 2V97A 3C4QA 2QXUA 3GUVA 5LYJF 1FVOA 4AZVA 5KKNB 4F4DA 3Q6NA 2ZI9A 4JBWA 2ORIA 3QE0A 1UBFA 1W1WA 3BERA 2RMKA 2EOAA 1N2XA 1GTZA 1VG9B 3DCIA 1ICIA 3HJCA 3M4JA 3OE7A 3OTHA 3QNUA 2O0MA 3F1LA 4IS2A 1Z07A 4G09A 3VOTA 1AH2A 1U0JA 1ECGA 5KNCD 4DKXA 3BL5A 4Z3DA 1DC4A 1GNRA 5E6UA 3CLRC 2ONCA 4ZTUB 2NYUA 4MR9A 5KUTA 3BMQB 4X60A 1BXRA 1I4LD 1LI4A 5KSZA 5ADVA 1MA0A 4CQLA 1G8PA 3MTDA 2I29A 1RWPA 1CY6A 4XRGA 4BE4A 4AN1A 3S8MA 5E8JA 1H6CA 2IP4A 4HRAA 3UTDA 1OWNA 2X8JA 1B41A 2WT8A 4HCJA 3AR4A 3K1JA 2BHSA 1JQEA 1XU9A 3MW8A 4WBSA 4ON9A 5AD1A 2BKLA 4CG2A 4K8OA 2I87A 2AG0A 1R9MA 5LR6A 1FU8A 4ETWA 3V4RA 1SHKA 4K6GA 1RM5A 3QX9A 4GNRA 1A8QA 1HQYE 5IFKA 2VYVA 3ESAA 4GT1A 5DK4A 3RSSA 2C00A 4IXMA 3I2HA 2WK1A 1ISHA 1NE2A 1FP1D 4KNWA 1FTSA 1II9A 3VH4A 3WWPA 3G0OA 1V7ZA 4E5DA 5HNKA 3D6UA 4ILEA 1P0CA 3K9QO 2OV2A 5IKOA 2FSHA 1JIIA 2W6JD 2WHYA 3ROEA 3UJ7A 3DLBA 1EXWA 1QGOA 2VPPA 3GIDA 3FVVA 5ALZA 1FQJA 2NU8B 1PUJA 4XVUA 3EMBA 1C1XA 4CTMA 4D8YA 4H4DA 3R3WA 4TMZA 2RHBA 1PWHA 2IYEA 3GGCA 3W4JA 3X1MA 1L8QA 2V7QD 3RG2A 4FBLA 1EXNA 1SG0A 2FI1A 2GTHA 4GPBA 2JGJA 4QTTB 4WNAA 4YAOA 3CCFA 2JLUA 2JW5A 1JJVA 2FW8A 3UAXA 1DMSA 1ZG3A 2X15A 4RH0A 3ZYZA 4MKZA 4PPNA 1FUEA 3E4DA 1G3MA 2ZCUA 2PH5A 1BCSB 2B9EA 3QFSA 3T06B 3H75A 4LXXA 3GRYA 1NRIA 1SPBS 1UXGA 2XXBA 5KYTA 3L0PA 3N86A 3ZHQA 4BNDB 4WOJA 4N5HX 4O3MA 1KVTA 3E7PA 1KI6B 4ZZ3A 4OHZA 4A2CA 2DC1A 2Q2OA 1JBKA 1K08A 2OORA 3A4IA 3AJDA 3NIWA 4IHJF 5K3BA 3RWOA 4MRSA 4YFYA 3AVYA 3VPHA 1YU6A 1Q5PA 3PD7A 1T0JB 4KN5A 4YJFB 2VDOB 2ZUWA 5F73A 1L5KA 3TX6A 3RUIA 4AT1A 1XEWX 4NV0A 2SNIE 4J07A 2J32A 3FG9A 3MWDA 4PPYA 3OLZA 4WZAE 5ALFA 2EFEB 2WIGA 3TPCA 1TADA 1SK8A 3DB1A 4TKMA 5TARA 3WJ7A 4C3OB 1LJ8A 2DWUA 3ZE8A 1YULA 3RVDA 1W0KA 2XCUA 5M34A 2W6CX 1MV5A 3OZ7A 4I99A 3UA4A 4B31A 1DC5A 3PKZA 2FLWA 5A9SA 4M60A 1LC3A 3HBJA 5M7EA 2Q0SA 2F43B 5EJAA 4QFDA 3KOUA 4HEQA 4I5DA 4ENSA 4EUNA 1PG5A 5SV2A 1Z35A 2HLDA 1RS0A 3G8DA 4EYGA 2W0SA 3F7MA 3CS3A 4C4PA 4K2AA 3RK0A 2EGUA 4CN8A 5EAIA 2ZE6A 4OGFA 3R7WB 5C4IA 5I7EA 3FZNA 5EL0A 3NBAA 5L95A 2QX8A 1SULA 4MVJM 5DLQC 5KSWB 4F3CA 3PNMA 4P34A 4G9GA 4K87A 3GZ4A 3QP9A 2X40A 1E60A 2ETVA 1I6WA 3D31A 1Q7EA 3NRCA 4L4UA 4N9WA 4OKSA 2PS9A 4XCVA 1TMYA 4Q3AA 4E5MA 3BJIC 1WAMA 2WMNB 3SMQA 3D3EA 3GLFA 4ESHA 1XL1A 2O5RA 2OTCA 5ERXA 4YN3A 1T0IA 4P83A 2BEWB 5ITZB 4J9UE 1I6KA 3A28A 4HNRA 5ERYA 5L3RA 4ZCTA 3U16A 4B44A 3MBKA 3B20A 2WBLC 3KTDA 1XCBA 2JJ8A 4NR0A 1LLFA 2VTVA 3FJOA 4L57A 3F6CA 2NXCA 4YVFA 4BJHB 3CW9A 3LCCA 4BFVA 3DBRA 1MPTA 2FWRA 3HKBA 2GN9A 4HLNA 4LF6B 3TRIA 4UAGA 5H02A 3ROMA 1E61A 1QJCA 4JSYA 3OPYI 4RVSA 3U09A 3ROQA 1SFRA 3W78A 3RM3A 1ZSNA 2NG1A 4WOBA 4G0UA 5DYNA 1T5DX 2CXUA 1P5HA 2GB4A 3VZSA 1PR2A 4QBKA 3DV0B 2A5DA 3H6GA 4MP8A 1EM8A 3HLTA 3AZPA 3NCHA 4KE9A 5A0VA 2VKQA 3B6JA 5A05A 5LQMA 1KDZA 1XD2B 4F06A 4GZ5A 4LTNA 1HDGO 1L5YA 3OU7A 1K3UB 5B30A 1TLLA 2P41A 4BPBA 3H19A 5FWYA 4GOMD 2P9QA 2Y1GA 4HDNB 3MTIA 3ROGA 1ADCA 3MSXA 2PUJA 1E0SA 4RLSA 4HVCA 1BFDA 4LKOA 4HN9A 4TUYB 4UBLA 1B0UA 1DSSG 3M4XA 4UVGA 1DC7A 1U0HC 3HN7A 3NDJA 4KTVE 5ECGC 4NONA 3SI7A 2EVWX 2JIQA 4YFVA 1XMOB 5LXTA 4S2UA 2V59A 2XOEA 4HYQA 2O2XA 4YCJA 1V3UA 5FORA 2Q5LA 1MVLA 4PYMA 1EU1A 3SWWA 5DX0A 2I3ZA 5FBLB 2YDXA 4UUMA 4JUFA 2GYYA 4PX2A 5I7WA 3CUTA 3IHKA 2IW3A 4J8PA 4FWTA 4PS1A 2HHCA 1IRXA 4IJQA 2VDLB 3TINA 2V7UA 4RACA 1ZONA 1JYSA 2V6GA 1JJAA 3DCJA 4KIFA 4R8KA 2C07A 1ESZA 1NW9B 4MUFA 2FCRA 4OL0A 1RCUA 4E32A 2ZXUA 4TXMA 5JATA 4WBNA 1KSFX 4OHYA 1Y6QA 1T6XA 4YJHA 1PZGA 5DHPA 1X86B 1Z0DA 4BUCA 2VP4A 3A70A 4PCUA 5KYGA 1JHYA 2FR8C 2AOVA 5BSUA 4H6XA 5IAGA 3RREA 1IN7A 1CR6A 3CRNA 2OXFA 2FPLA 1KETA 3A4TA 3HU5A 5A7GA 1VJ1A 5JFTA 1FEZA 2WJ6A 2YMMA 5EHIA 4B47A 1HKHA 1UBOS 2ZBEA 1ECLA 2QLLA 4LJYA 1AM4D 4P7FA 4UEWA 4H7KA 4RMIA 2X2FA 4RFVA 1RTKA 4HG2A 1B1AA 2ZSFA 1U28C 2VRNA 4CKBB 3SFTA 1RZRA 3V6MA 3RAJA 1W4ZA 1NKSA 2P7IA 3HA7A 3PP8A 4KVZA 3RT9A 4HNVA 4P86A 2GASA 2QRMA 1W30A 3D43A 1XTQA 1A7AA 2QR3A 3Q11A 2M98A 4HAVA 4WLNA 3RAPR 4DG8A 1I3LA 1GUFA 2EFDB 5AOVA 3P26A 3JZMA 4TL7A 4C01A 4HQFA 1F0NA 1MAAA 3ZGLA 3QE9Y 1ONNA 3I23A 3ZQKA 5K01A 5LQNA 4EI7A 3VKFA 1OAOA 4QBGB 5ALLA