4IYRA

Crystal structure of full-length caspase-6 zymogen
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
261
structure length
248
Chain Sequence
FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSAGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVITNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
publication title The regulatory mechanism of the caspase 6 pro-domain revealed by crystal structure and biochemical assays
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 81
structure length 248
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iyrA00
1M72A 4LSZA 4D3YA 2QLFA 3R6GA 1NMQA 4JJ7A 4EHAA 1SC1A 3PCXA 4EHLA 3IBFA 4FDLA 5IBRA 5IBPA 1RWXA 3PD0A 4FEAA 4JJEA 2CDRA 1RHRA 2HBQA 1RWMA 3KJQA 3R7BA 4PS0A 1RWOA 2XZTA 5K20A 4QU0A 4JR0A 4D3XA 4IYRA 5LU8A 4PS1A 1RHKA 4NOLA 4N7MA 1I3OA 1RHMA 2NN3C 1NW9B 1JXQA 3BIJA 3R6LA 4QULA 1ICEA 3SIPA 1SHJA 4IEFB 4DCJA 1NMEA 2CNLA 3V55A 2XZDA 2XYHA 3D6MA 2XYGA 1RE1A 3IBCA 4AWAA 5IASA 4JR2A 2QL5A 1BMQA 2CNNA 2P2CA 4EJFA 3R5JA 4QUAA 4QUIA 5I9BA 4QTYA 4NBLA 5IAKA 1PYOA 3V6LA 4AWBA 2J31A 4ZVUA 1RHQA 4QU9A 3D6HA 3V6MA 2CJXA 3S8EA 4EHNA 1GQFA 1RWPA 2QL9A 2CNOA 1SC3A 3ITNA 1K86A 1PAUA 3EDRA 1I4OA 5H0IA 5IANA 3EDQA 3NKFA 3SIRA 2CJYA 2H4WA 3KJNA 1I51A 5LU9A 2H65A 5IAGA 5IBCA 4HQ0A 4M9RA 3KJFA 1KMCA 4PRYA 4N5DA 4QUEA 1QDUA 4ZVRA 1IBCA 3H11B 2QLJA 3QNWA 4JB8A 4ZVQA 4HVAA 4NOMA 1F1JA 1F9EA 4QUBA 2C2MA 2C1EA 3D6FA 2HBZA 4QU5A 3H0EA 4FGUA 4QUJA 2J32A 3OD5A 2Y0BA 4JQYA 2DKOA 3PD1A 2C2OA 4NOJA 5IABA 3DEJA 1NMSA 2HBRA 3H11A 4I1RA 4NBNA 4QU8A 3V3KA 4N7JA 3DEKA 4DCOA 3R5KA 4EHKA 4EHDA 3R7NA 4DCPA 5LUAA 4FXOA 4ZVPA 2WDPA 4EHFA 1CVRA 2K7ZA 4AW9A 2H48A 4QTXA 3E4CA 3GJRA 1GFWA 1RWWA 4N6OA 2C2KA 3GJSA 4JR1A 4ZVOA 1RWVA 2FQQA 3V4LA 1SC4A 1QTNA 2H4YA 5IAJA 2Y1LA 1SHLA 5LUBA 3NR2A 2XYPA 4ZVSA 3UO8B 2AR9A 4PRZA 3S70A 2FP3A 5IC6A 4D3ZA 4JJ8A 3K7EA 2H5IA 4ZVTA 3GJTA 3DEIA 4QUDA 1CP3A 2HBYA 3P45A 1K88A 2C2ZA 3P4UA 3RJMA 2CNKA 3DEHA 4QUGA 4EHHA 5IC4A 4N6NA 5IAEA 3H1PA 3H13A 1RHJA 1RWKA 2QLBA 5IARA 2J30A 2H5JA 1QX3A 4N6GA 5JFTA 2H54A 4JQZA 4HQRA 4NBKA 2H51A 3V4OA 3GJQA 1RHUA 1I4EB 3R7SA 4NOKA 3UOAB 4QUHA 4I1PA 1RWNA 3NS7A 2J33A 5I9TA 2QL7A 2FUNB
chains in the Genus database with same CATH superfamily
4L15A 1KYIA 1XELA 5ARDA 3QBVA 4B6PA 1BGWA 1WXXA 4JFRA 3HR4A 3I01A 4C06A 1GRNA 1DKPA 1HT2E 1RPAA 1U81A 3LDHA 4PFQA 3WYAA 4DCVA 2XJ4A 5FUMA 3F6SA 4DB4A 2WE7A 3ANXA 1J8YF 4NH0A 4EMBA 4M1SA 4MITA 4ID9A 3T5DA 2NAFA 4E15A 1NUQA 2GZRA 3RYFB 2FMHA 4D3XA 3BWVA 4KCGA 2CLOB 1I3NA 1KETA 4MZDA 4C76A 1Z0JA 1Z3CA 2QRJA 3C3WA 4DDHA 1GCIA 4OHWA 3OX1A 4D44A 4B0OA 4DV6B 4G5XA 2X86A 4FNMA 2JLWA 1GRQA 1Y5IA 4KBYA 5CGQB 5BYBA 3FYSA 3OWXA 2Q6KA 1UDAA 2I34A 2HIAA 3D6MA 2DBVO 2XYGA 4R2MA 1R12A 3RSLA 3UT5B 4AULA 4HVTA 3IB6A 4KQMA 2IX9A 2AYXA 4JLPA 3TLZA 4BNYA 5MFPA 1PQUA 1PFUA 2HIHA 4QQ8A 4CT0A 4P3YA 1EPUA 1OR8A 2OYRA 1MW8X 4KUEA 4TV9A 4IIFA 3O8OB 4V39A 4GP9A 4YRCA 5JXIA 2NPOA 2PUEA 3ZQUA 1ZW6A 1KJYA 2BDTA 4AUNA 5BXYA 2L42A 2IPLA 4OL9A 2YVQA 5D7NA 2PIDA 2M1ZA 3I37X 3WMWA 4C0XA 5DYTA 4ZTBA 1SU4A 2HD4A 4L08A 3AP3A 2MCFA 1EAMA 1JS1X 2P27A 2V3VA 2KW5A 2W2LA 4OM8A 5CFNA 4BX3A 1C9NA 5KVVA 2A0WA 4IPTA 1NVWQ 5C4GB 1IIRA 1VRCA 3SF0A 4EIWA 4CG2A 3HRIA 1MOQA 2C1EA 2J7KA 1CW2B 5L51A 1CFZA 1UDRA 3D4OA 2DWQA 4U2GA 4X5OA 4WK0B 3U3JA 3Q8KA 3KX2A 2OHFA 3THXB 1NOKA 3IUJA 4QEZA 1L1RA 1H4VB 3J7AC 2AC4A 4O1MA 3DHVA 2Q46A 3ZHRA 4DF3A 1IZYA 3UUWA 1RAAA 4YK7A 3OJCA 4DQKA 4MUXA 5LWQA 2UZ4A 3O4IA 1NL3A 1QNFA 2IY9A 4F04A 4OGLA 3WKDA 1BX1A 5HSGA 1YA4A 3EF0A 2VO1A 2FB9A 4JVSB 4MK4A 4WKOA 4ZDIA 4UC0A 2DMRA 4N0PA 3N75A 4RV4A 2OGZA 3EZ6A 1DKRA 3KU4A 5BYJA 3WOVA 1UPUA 4LF6B 3QVKA 4AYWA 4LCJA 2GZSA 2AD1A 5DSTA 1KXZA 4ZAXA 2IS4A 4DXAA 5CDFE 1PR2A 1SVSA 2Q3HA 3NAZA 3P9YA 5C7OO 4PSAA 3RHTA 3BD8A 1R0LA 4B09A 4HNGA 2H8KA 1DI0A 4G5OA 1OGJA 4DGSA 4Z3DA 3ZJ4A 3BXFA 8GPBA 2GD1O 2XNCA 2I03A 3IMCA 4GOOD 4LV5B 1Z17A 2ZSEA 2BM9A 1I10A 2W6IA 4B71A 3N70A 1XPOA 2CWWA 2PH3A 1ZVQA 2PZMA 4IY1A 4ILEA 4F7DA 4UEJA 4E3WA 4K9RA 3VYTB 5HOEA 4Y1EA 3HKEA 3PFWO 1YCHA 4ESEA 1ZOLA 2HLNA 1JQBA 3O3CA 3T34A 5I7SA 4C2UA 3SG0A 3LT4A 2ZIZA 2A0FA 2R00A 2BDEA 2W6ZA 1T6BY 2FPMA 4RA9A 5CAEB 2RFLA 3WL6A 3ABIA 1UBLS 2ZYSA 1WF3A 2G8LA 2A9JA 4D4HA 5GADl 3WDMA 4E31A 4JXXA 3I1JA 4J2OA 5T4BA 4ALIA 3SF8B 5I47A 2JFQA 4FHZA 3H2YA 3HCAA 4UTPA 5IXJA 1KJQA 3RJZA 5D3ZA 1FOEB 4XKJA 2VL7A 2ZWIA 1U7WA 1CS0A 2R1ZA 5SZJA 3WLFA 1NBME 1J00A 4RHXA 4RVOA 4KK3A 1FPQA 2EP8A 2GJ9A 2X4GA 3C5EA 3EGIA 4R98A 2P9CA 5FNZA 4N7MA 3CE6A 3U4QA 4QXRA 1H8EA 1RWBA 1EBBA 1UBOS 3A4VA 2DUUA 1Q22A 2B1JA 2G25A 3I6MA 5C46F 1TMKA 1ULBA 4JYMA 4QAJA 4Q4HA 2Z6VA 2W4MA 4J1QA 5ICCA 2FUCA 2J4DA 4OCZA 1AQYA 2PS3A 3QSYA 1TZJA 2C7BA 5CA0A 4BJHB 1QV7A 5DNWA 2HMUA 4IIVA 3I2IA 3FF1A 1JU4A 2BKVA 2MYPA 1JVSA 2SKEA 1N7GA 3WJAA 2B25A 1PIWA 4PLCA 4B9EA 4IF6A 2XT6A 1M54A 4RFSA 1BDIA 1E1QA 2DLCX 1IZ8A 3DAHA 1QP8A 3NGMA 2VAWA 5KQPA 1FJHA 2G07A 2IHBA 2LV8A 2NU7A 3GEHA 4BTLA 5FL7A 1G7CA 1PAUA 1W87A 5BW8A 1RI2A 1DEOA 1RKVA 2F48A 1UKBA 2FW7A 5BMVB 2HN9A 1V47A 2VSYA 3L5OA 4OTZA 2CXOA 3B6KA 3HCNA 2D3WA 4IOLA 4KMRA 5GZ1A 5DWVA 1SCAA 3KV3O 1GT91 3I28A 5F77A 4A15A 1Z74A 4MS1B 5DTRA 2P78A 4A73A 1KKLA 1ECCA 2KX7A 2B2NA 1H9AA 3A4MA 3ESDA 1YFZA 2I29A 4NYJR 1GN8A 5EQFA 1SXJE 5EZYA 5HS6A 4RPLA 1ISHA 2VHZA 4AF6A 3HTXA 1HSZA 5C8YF 3MAGA 1UPFA 2I8CA 3GJ5A 2O23A 3LK7A 4HDNA 4QOFA 3RUPA 3NG1A 3QI2A 4HNQA 4HFJA 4DV0B 2BE9A 1KF0A 5L3SB 1TVMA 4IJ5A 5G0SA 2WDPA 1SKYB 4EG0A 2IUFA 2CLSA 2O5EA 1PDOA 2YV3A 5HIAA 1X1EA 1OZFA 5J4LA 2AC2A 4Y98A 3SHOA 1GFWA 2GJ8A 3E27A 4N5HX 3OZGA 10MHA 4INZA 4HZUB 1PGOA 4NS4A 4RO0A 3EISA 4ZQEA 4CRWB 3UO8B 4PY2A 3VGJA 2YFQA 3JQFA 3W05A 1NBOA 1VJDA 2JGDB 4OQQA 2ZB2A 3B7GA 4GC9A 1VM6A 4V0SA 5FPTA 3SFVA 3D31A 2V4MA 3ICQB 3B78A 1MV5A 3DUWA 4GWGA 2AFHA 2P41A 2I3BA 1YKFA 3KKQA 1OWOA 3EXFA 1Q7TA 2G83A 3MAJA 3VAYA 3RWBA 3TIFA 3ZJUA 4YJFB 3U09A 4UD6A 3PENA 3EIHA 4LMAA 4EX7A 5DBIA 1O5OA 3JTMA 4YC7A 4D25A 2QTMA 3ND8A 1T5DX 4RKWA 1YZTA 3FTEA 3GIDA 3C7DB 1T8PA 3NAGA 3QG1A 1ATZA 2QW8A 5IS2A 4E5UA 4PLFA 1NYTA 2FWRA 4PGHA 2P5TB 1LDEA 1KI6A 2P0YA 3P2KA 3ZV7A 1L2TA 2GTHA 2VDWB 4JL5A 3G5UA 4JLWA 2V1UA 4E7PA 3EK2A 1NOJA 2OHVA 3WTBA 5IAOA 3F6YA 3OZRA 2LD4A 4UMEA 2JI4A 3AFNA 1VE7A 1OYWA 3MWLA 4EGJA 1MR3F 5K8JB 3A1UA 4RKYA 3W3AA 3SJCA 5J23A 1KC3A 1US8B 4X60A 5IYZA 4ZI3A 4UMVA 3H1TA 2MJLA 3UMGA 2VIIA 1DJOA 4DBZA 3GNLA 5EHNA 3B5IA 3TLJA 4YGYA 2DXIA 4J76A 3NI2A 4WOBA 4KQEA 4P82A 4J4TA 1YS4A 4A2PA 1ZOOA 3WADA 5E95A 1BJTA 3PHGA 2J7PA 2JJYA 3G9XA 3EHDA 2X23A 3EWSA 4HK4A 1RRVA 4CV0A 4JR2A 3R3XA 3RYIA 4CLEA 4IR7A 3NPMA 5ALNA 3QKIA 4L1KA 2WSIA 1KMHB 4BO4A 4BVJA 2MMGA 3UJ8A 2PX4A 4N3NA 4QHSA 3G3EA 4B9AA 4M4SA 1T8SA 4PN3A 1A69A 2EBWA 5IZCC 2ILVA 4O4LB 3M6UA 3TL2A 4MRSA 4I8IA 2UYGA 4OK5A 4F2PA 1QGUA 3QV1A 4RIEA 3FCAA 2FMUA 4GW3A 1KK1A 4UASA 4CDMA 1CUAA 2UVQA 4EM6A 4IDQA 5L45A 3I58A 1F6BA 2YH2A 1NDQA 3L0BA 2BFCB 4YO8A 1CHDA 2FEWB 1FFBA 2PMFA 4IDEA 1V9LA 2A35A 4CKEB 1ZMTA 4MGZR 4B4WA 1QGZA 1XZNA 1ZI6A 2V7XA 3B48A 2XGMA 1QV9A 3GRPA 3ICOA 4FDTA 3GDHA 5TQ2B 4PG5A 3D3KA 4MWCA 2IUUA 1N3LA 4EFLA 4XJVA 1JR3E 3TTUA 1VHDA 2UVPB 1E2LA 3CXRA 4HCJA 1DKUA 1KRXA 4Q66C 4GI7A 4G65A 3R7NA 1XBTA 3A1SA 4RDXA 4FXOA 1RTKA 4PX9A 3TOVA 4JT2A 1EX6A 4PVCA 1E3WA 2Z5GA 5UKDA 3TN7A 3WZLA 5AW6A 2X6QA 2PRIA 3G2JA 1G8JA 2QG9A 4ZVNA 2P91A 5KWEA 2B6HA 2MYTA 3ZHUA 1HNWB 3NM6B 4KQJA 4XEUA 3DC2A 3SCZA 5J5VA 3DZJA 5DU2A 3HO1A 1BJKA 1VPDA 2O4CA 2WKRA 2IXGA 3SQMA 1DP4A 3WRYA 1CJSA 1MVOA 3O8CA 1CUGA 5FWYB 4FCTA 3R0IA 1P9LA 3EGCA 2ZIVB 1XQYA 4R9UC 1FFHA 4N82A 4RK7A 5I8WA 1QDEA 4XVHA 2ZAYA 1ZZGA 3G2PA 4MV7A 2M98A 1Z26A 3UXMA 1JDPA 4JQZA 1ABBA 3K0CA 3C48A 2GXQA 2GEFA 4IIDA 3RS3A 4C4YA 4BZQA 4CMCA 2HDWA 3ORFA 1DIAA 1ZJ6A 4OGKA 5H1YA 4DA0A 1D4AA 1XXLA 5TS3A 1IBSA 1M8JA 4BBPA 5F33A 1C1DB 4LXUA 3R3UA 3H19A 5FLYA 3H4MA 2X4IA 3U3DA 1PZXA 3FRHA 4ZN6A 3MTAA 1H42A 2Y92A 4Y2UA 2ZBDA 5DLEA 4DA6A 1LLFA 4Q0MA 1JDSA 1R6XA 3O94A 4LSMA 3NWJA 3CNOA 3STTA 2B6NA 3K20A 1Z7WA 1DZ3A 2RGDA 2QZZA 4KAAA 3RIMA 2W42A 4ZODA 5PNTA 1E2EA 2CMFA 2QJOA 2XWBF 5JNLA 1PK8A 3RGGA 5L95A 1M2WA 4M8KA 3QBTA 1P3JA 2QNRA 3LBIA 4YUXA 4YLEA 1MQSA 5KVAA 2XMCA 5JXGA 2XMGA 3H1AA 1ENPA 1F51E 3IULA 5EWJB 3SM3A 4FE3A 4IJKA 1FUUA 4WXRA 3IMGA 1P18A 4F72A 1ELOA 1VDMA 2OXRA 3BMNA 3EEQA 1OYOA 3HZRA 4CMKA 3GLFE 2H1SA 3AZPA 4FLFA 2QTZA 3G0IA 4MIOA 5F7JA 1W2WB 1NASA 2GVZC 3NXSA 1XTQA 3ZXIA 2PA3A 2BMJA 3IBYA 4CCAA 2PGNA 2PRZA 1GCAA 5FBKA 4RTMA 1CF2O 3ZBQA 3ZWXA 4CIXA 1OPRA 1ZH2A 4PXAA 1XRJA 1F5SA 1KDZA 1UL1X 1DV1A 2AB0A 4H7JA 5AW4A 1PT6A 3FI0A 1T8TA 2QUKA 2V7VA 3V1YA 2OSBA 3NNNA 2P9YA 2Q0XA 4NZNA 4D42A 2W37A 1LSOA 1WCXA 3ITNA 2H9AA 1QIGA 2QTRA 4DCTA 5IT4A 3AERA 3QFRA 2CN1A 3OZBA 1U0RA 4QBTA 2IUSA 3DNPA 2XQGA 3PZBA 1V9SA 4C2BA 5A62A 4BFZA 1J20A 4UBOA 1U7DA 1U0LA 1ZX1A 2O05A 4M1KA 5LLSA 3K1AB 4RSMA 3P9RA 5GM2A 4R9RA 1CQIB 5CK4A 1CR6A 1W76A 2EBUA 4FGUA 5BWOA 1BCSB 3MGAA 5IDXA 3FIUA 2BBSA 2MSNA 3ER6A 1UFQA 1YB2A 2NTEA 3UKJA 2H2AA 1UXKA 1UK9A 1M6YA 4JI8B 1FNCA 4YXWA 3UG6A 5AVSA 4C4TA 5JW6A 1PX2A 3GJRA 1TZBA 5FLKA 1RWWA 1MJFA 2A58A 4YRBA 1UEJA 1UMDA 4HY3A 2WAMA 2CDBA 4Q6BA 2WLSA 2EKBA 4PZAA 1MC5A 3QPCA 2I6FA 5AXDA 3DDOA 3ZE2B 4DV4B 4H27A 5BQOA 1ZUHA 5C3UA 1P2VA 3BX1A 4NU0A 1UXIA 1Y7LA 4KBFA 1N6RA 1WG8A 3E9EA 4LNUA 4Z8XA 1WEKA 1YO6A 4ZRMA 5I8ZA 4DQUA 2X13A 1SVWA 1BW9A 4QUGA 1F2TA 3SBXA 4OB7A 4F3YA 2B83A 3UJ3X 2GM4A 2VRBA 5DHQA 2WJ4A 1RXYA 4PC6A 4KITB 4L22A 5ADUS 1UWCA 4ZICA 1ZWKA 2QX7A 3QVOA 4UDOA 1DWPA 2PWBA 5FLEX 5LMCA 1TYEB 2PJRA 1GL9B 3AVXA 1PD1A 2Q1YA 2OBXA 1CJVC 3E81A 2Q41A 3IRVA 2RH5A 1NC1A 3EMDA 1R3DA 3N6XA 4KN6A 5DCLA 4KQGA 4WOCA 4KOEC 1RJ9A 2Q9CA 4MTLA 4AZ0A 5JJBA 1HDZA 3H16A 1SQ0A 2J07A 2NU6A 2O3SA 3QVGA 4HWSA 2NSJA 4XOUA 2VA9A 3WLSA 1MJ5A 3ZW9A 1DXOA 2JD0A 1DRKA 3D8HA 3PFBA 1R15A 3EXG2 1G8FA 4BQNA 4V3CA 5A3SA 1CSEE 1OTXA 1XEXA 2POQX 3T0IA 1FMJA 1TQ8A 2QRQA 3GT3A 3I0NA 1E1DA 2QPTA 1FNDA 4JU9A 2F1RA 1E5XA 3O8BA 1U7UA 3V7YA 3VAAA 3VR5D 4DMFA 4OXIA 4CMEA 1J39A 5MFZA 2E0IA 4FX2A 4CMIA 5LA6F 1VB3A 4BLTA 1PSWA 2AN3A 3CE9A 4FI3C 4IX1A 4R3WA 3F90A 3M6AA 4U7TB 4TRRA 2IBSA 1ZIPA 5ALLA 1NF8A 3MYYA 3HSSA 3QVWA 1JIKA 2NTNA 4REMA 1Y6JA 4KBGA 1GUAA 1MPTA 3QE0A 4UZFA 3KJHA 4G9BA 3K9FC 4CNBA 5JD3A 5D5QA 4TM8A 3DWIA 3G1TA 5HWSA 1WB9A 2EYUA 4MRAA 1N8SA 3O4FA 2HCRA 1O6FA 1L7MA 2VXCA 1KJWA 1AQ6A 3OY2A 4IQ4A 1Y34E 4XIYA 1IVNA 1RJDA 5ALDA 1A4UA 2VDMB 1GNTA 4NULA 4WCFA 1S02A 5EXEA 1U7ZA 1YJQA 5A5VA 1JDVA 2ZT7A 3B9RA 4X61A 3UVEA 4QWWA 2H16A 1T8UA 2QZ9A 2POCA 2WG1A 1UM9A 4XVQA 3A1CA 4W1PA 4Q9LA 4IKEA 3TTTA 5E4JA 1DC3A 4PLHA 2CNOA 3R4VA 4EVQA 2EYQA 3AHEA 4HEHA 2PGDA 2IHKA 3PDJA 1G8HA 3DFMA 1TVKA 3TQIA 4IJMA 3UWPA 3GLHE 3BFJA 4JDPA 2NP6A 1WCIB 2BLLA 5E1MA 2ECFA 1HZZC 5BW5A 1GQOA 4LXXA 3RQIA 2QIPA 1UC9A 3FDZB 4CU2A 3DBHA 3B38A 1JPUA 4XWWA 3ZVMA 3WV5A 2C2MA 4I9HA 2GYYA 2ZIXA 4MMYB 2NWQA 2QDKA 1E2FA 3BTSA 3HNOA 1O6ZA 1UFVA 2A14A 2F1OA 3G2HA 3NWOA 4DANA 3V3KA 3PE4A 2VP9A 4PIMA 1FP4A 1VXOA 2QR5A 1ZKMA 2XXJA 4OKNA 3ZWCA 3DMTC 3PC7A 1L7RA 3EIEA 4F1WA 3UA3A 3KZ1E 4TL7A 3K92A 1V71A 1YE5A 1GZSA 3C7KA 3ZUPA 4GEKA 1PK9A 4UFPA 4NDNE 1OLOA 2Z43A 2AFIA 4B2PA 4LYDA 4DEXA 2RHRA 3H6GA 3G68A 1QTNA 1LV7A 3AKEA 4GH5A 3TGPA 1GM5A 4RMNA 1OAOA 2YCLA 4QATA 2AQ8A 2WI8A 3EQ2A 1AZTA 4JJKA 2C59A 4TTVA 4JJFA 4N12A 1KS9A 3DB1A 4HLDA 2VJKA 4DLWA 3ZDBA 3GCGA 2O8EA 1WHTB 4DVGA 2VKTA 4G84A 2J3MA 1Y6GA 2A8YA 5FBQB 1F12A 2C96A 3S2FA 2Z4SA 3ESAA 1JT2A 1FFGA 4IVQA 3FGZA 3DQPA 1U2SA 1WU7A 2Q3MA 1PEKE 4G01B 3KDPA 4H4EA 4H7KA 4CLOB 2J59A 1X7DA 1G1AA 2J5BA 5DSZA 2FPWA 1D6MA 2VVTA 2XD4A 4GR4A 1MC4A 2I2XB 5D3MB 3VKWA 3QJ5A 4GL2A 4UDNA 4UCFA 5FEUA 2HL6A 1VYHA 4LOHA 5LXTF 3AJEA 2NU9B 1B26A 1E8NA 1TXGA 2LNDA 3EB9A 5JWRA 3W9UA 3K70D 2IC5A 2FJPA 2F90A 4OQLA 5LR6A 5CBKA 2KQUA 3ZGZA 3PA6A 4RQAA 3RWOA 4KAXA 2PAAA 5BQ5A 1L5HB 4KG7A 3PUJA 4RDIA 1V25A 1N6KA 4OGFA 3CY6A 4R2XA 4OU5A 4BKUA 5B36A 2B37A 1V96A 3BHIA 3ZVNA 3SZLA 2XUQA 3THRA 1P17A 4EY3A 1I4DD 5E0OA 1SC9A 1QAOA 1T0HB 1OQAA 1SPBS 4A0HA 3WAGA 3TW0A 1OILA 4RQBA 3X1JA 2G5PA 4MVJG 4Z99A 3I3OA 3ANSA 1TUGA 3MBIA 3PDHA 3K53A 2NO7A 5BSWA 4HQNA 3DV2A 2AOUA 2Q62A 3P9ZA 4NF2A 3EWNA 2HPHA 2JGRA 2MINB 1VL2A 5KOYA 3W7BA 2BTQA 1QDLB 1ZIDA 2VTKA 4R4JA 2YL2A 1N1DA 4PHGA 4Q4JA 2FRXA 2P68A 4RCZA 1S3FA 3H6KA 4O5OA 3TKAA 4LOAA 3U4MA 3DDUA 1GGEA 2GEKA 4X41A 4ZU1X 3K0AB 3U26A 1ADCA 1K7SN 1U9IC 3IHTA 1OFUA 1XCGB 1XTZA 4UOQA 2WTBA 1NSFA 2R97A 4NK4A 3RWMB 5CB4F 521PA 2ZSBA 3WIVA 4AB1A 4URFA 4AKEA 1ECGA 5AD1A 1YFLA 3KE8A 1RACA 2FNAA 4FFMA 4XJSA 3CPHA 3L4EA 2FW8A 2BR3A 1KFKB 2O2IA 2W8BA 3ONNA 4DWWA 6ABPA 2DFPA 3OO0A 2QEQA 1D04A 3NBUA 4US2R 5IEBA 3JQCA 4MWSA 2NNLD 1P4GA 2GBLC 2WQ7A 4N7RA 2J32A 3N9IA 1E66A 1AZSC 5ALQA 1XL0A 5BQXA 1E3MA 1XYYA 3D0OA 3H9QA 4DR5B 5JEDA 2AHOA 2I1WA 4W8GA 4DCGA 1PE0A 3N8GA 3TFWA 2Z3ZA 4OPMA 4UM5A 3UMVA 4D9BA 4HEA6 1MG0A 3ZCSA 1NF9A 1QMGA 2WSSD 1U2DA 3GFOA 2C78A 1TKRA 1G4AE 4DSAA 1GIAA 4ERNA 3PUZA 2B21A 3GZNA 1EP3B 2K2QB 2C8JA 3TG2A 4DIKA 1C4XA 3VPCA 4KRXA 1E1KA 1P33A 5FV4A 3CMMA 4E30A 1HOTA 3I2JA 4YUYA 3HCRA 1LXCA 1YK1A 4L7QA 3WSVA 5FI1B 3UHAA 5JQGF 3EN0A 3GHYA 5AKGA 5KJ1A 3ZYCA 1UC4B 1NLZA 1GR0A 4ZJUA 3T3MB 5AI6A 2QD5A 5SYMA 2CXUA 2IF2A 3ND6A 4PBRA 1SQ5A 2Q3CA 3AEYA 1B42A 3KEMA 1T6YA 4BVAA 3EXIB 1WPRA 1QVAA 2JRLA 3N3AC 3HXLA 4TMVA 4HBZA 1EUDA 4IIEA 3AVOA 2XB9A 4KE7A 1I1OA 3CLKA 4GWKA 4L5CA 4C0SA 4HTAA 3U40A 1FBNA 3EWAA 4YDHB 1WZIA 3AR9A 2JIQA 3DF7A 1FRZA 4DADA 4OD0A 3W5HA 2DUWA 3C8DA 5CBPB 2J5KA 3SXUB 2QAGC 4RVDA 3WY9A 3MINB 4KPFC 1M72A 1DLJA 4OFZA 5E9AA 2CE7A 3I0MA 3GNTA 1Z8HA 1SC1A 4HUJA 2CD7A 1DT5A 4MWTA 2C03A 4MW6A 3GLIA 1HV8A 4DDWA 3KLBA 4JCCA 3RCBA 1RSZA 1OI4A 1KVRA 3A27A 3I8SA 4I50F 1QR2A 3TRHA 2RGYA 4CWAA 2BP7A 2O07A 1II0A 3UAWA 1BE6A 1C8VB 4FN5A 4JGIA 4UNIA 1TCBA 2ENWA 3IBTA 2C7GA 2IYXA 2X8WA 3LMKA 4HTFB 4M9UA 3T1QA 3UA4A 1LRJA 1KJ9A 2XAUA 2VYCA 3H6HA 3DE5X 3DT8A 2R4UA 3WXBA 3KBBA 1WF6A 3RSSA 2XBMA 2CJFA 2HV8A 3KSMA 2AD5A 4IDOA 4MYDA 1C8LA 5DV9A 3ZWVA 4S1PA 3PYMA 2VHCA 1LK0A 1BHSA 1TEVA 2G5CA 1YR3A 1TVCA 5KWIA 2RGNC 1B8VA 3R5XA 1FF9A 1JQ5A 2Q5HA 4JY7A 3OEED 4DCCA 3S2EA 4GPTA 2RI1A 4I50B 4JXKA 1REQA 2I1VB 4IIHA 4U0JA 1K06A 4W4TA 1MUUA 4M83A 5L7YA 3CZAA 4BAUA 3GOQA 1LA2A 1BVYF 1U0EA 2JIOA 2X58A 2YN4A 5FBLB 4KV7A 3KXIA 4JITA 4KLCA 3STUA 1SKMA 4KLAA 2VF7A 1QU3A 4HADA 3D0KA 3LX5A 4D2IA 1W581 4KRYA 3WYNA 1H3NA 1TEXA 3C1UA 3ORQA 4NFYA 6AT1A 3K35A 2GSWA 1N9GA 2ZB8A 3AI7A 2G04A 3CW9A 3KT0A 5E6RA 4YP7A 5JG7A 3ZGLA 3ZNQA 4C2AA 3VKUA 1X94A 1C0PA 3CO0S 4CKWB 4KK4A 2X42A 3ZOZA 1BC5A 4MIYA 4B8WA 2HUPA 2OCYC 3G2IA 4P32A 4BU1A 4JB8A 5TRTA 1O0BA 2DPXA 3G0OA 2BKUA 2EW2A 5CK5A 2PX8A 1O0SA 5DYIA 5CD9A 4BN4A 1A1SA 3ELYA 2YW9A 2YOFA 1QG6A 3HKBA 1HX7A 1K5GA 1BXRA 1EFHA 2VSXA 1SPXA 1F0YA 1T0JB 2ZROA 5CNMA 4PBTA 2YXLA 3QOXA 4RF2A 1VKNA 3QVTA 3C8UA 3JTEA 4M7RA 2HNKA 1YULA 4MVXA 4RJTA 5EJ9A 5K3FB 5J4HA 5KYWB 4GVXA 2ES4A 5KVQA 1KOGA 1AG9A 2DHRA 4BP8A 3FE2A 1PZNA 1PW7A 2G0TA 3GA5A 3P0HA 5JDCC 2O7QA 5JMOA 2G9QA 3IE2A 2XUDA 3BSSA 4F4JA 2RGXA 2PGLA 2DQ4A 1WDWB 1ORTA 1C9MA 2HA5A 4ND4A 3ZDRA 2QTGA 3VYVA 1IB6A 1M66A 1S8AA 3F1LA 4V3BA 4I1VA 5BN3B 2WUGA 4FKMA 4N9QA 3P2IA 1H1LB 1RCTE 4UMDA 1Z12A 1SULA 5DHFA 4AKGA 2P69A 3P5BA 1H4SA 4GGPA 2VHWA 4X71A 4EUKA 4ZCRA 1UBJS 4O4IF 1CIVA 4GPEA 4FFBA 2ZXFA 2H18A 4X92A 4QPZA 3ROFA 3K8ZA 3H13A 2Q8QA 1T2EA 4I8XA 1J24A 3QKSB 3BORA 2JD2A 3GFFA 4GI5A 5EXPA 3R44A 4MNTA 4F91B 2QRNA 3RH0A 3KKNA 4AQYB 3GGJA 2PYIA 2DETA 4Q02A 1N5MA 2E21A 3OTOB 3UAZA 1A5AB 1GADO 2FZ4A 1ZNZA 3LW8A 1CJCA 4I5FA 4YJHA 3WLJA 3C6ZA 1XNHA 5GZ6A 4P8RA 3E03A 3DAPA 1EGMB 4QM7A 2EJVA 2QTVB 1QAMA 1IMJA 2VHXA 2QLFA 1LPBB 4KZKA 4CVNA 3OLVA 4JJ7A 2QVGA 1QF7A 4O4IB 1N0HA 1USVA 1T8RA 1ZGCA 3L05A 1PT7A 4PIVA 5DHTA 3L7LA 2DFNA 3MJEA 2D1SA 4GAEA 4JOCA 5FLXA 1SQFA 3JSXA 5LCXA 5I6DA 2K87A 5HQ3B 4K3UA 3U44B 3PXGA 1M1YE 4E4TA 2PAFA 2VSQA 1HUQA 4DQXA 2J9FA 1MZVA 2GRUA 3ETLA 5AM1A 4QYIB 3GMIA 4G85A 3UGKA 4EP1A 4MUHA 4ZK6A 2GN0A 2J0QA 1Q95A 1QH1B 2VJQA 1Y7HA 2DQYA 4BYMA 1L6RA 1TMYA 2PVSA 3AEUA 4UDXX 5FTKA 1UPTA 2R85A 3TMYA 4FHDA 4ZI7B 1HTTA 3R5FA 2M6RA 1UXJA 3HV0A 1W8IA 3P4YA 4J94A 1CPYA 5EHXA 1L4YA 1E3LA 1WUYA 4QDOA 4E51A 3W4KA 1CJKC 1KNXA 3P5SA 3E3NA 1HZJA 4H4DA 5AIBA 1P4HA 3BB1A 5JAHA 4HRVA 1L7EA 1RKBA 2ZWOA 3VZRA 2X9NA 3M6FA 4GP6A 2GXSA 2UAGA 4Z1MA 1R27A 4PSCA 3CV3A 2NTYC 1M6WA 4MW5A 1PV2A 2QGFA 5L3RA 3QG5A 3WWPA 2TECE 4I55B 1EG2A 3CX8A 2HXSA 3D4IA 1PO7A 2DERA 3KNZA 2YN2A 4F5ZA 4MVYA 1WB6A 1UFOA 4PXYA 4BYGA 1Z16A 4ENQA 4Z4GA 3NYQA 1B15A 4C4XA 3U7HB 1G2PA 1D2RA 2JGMA 4WL0A 2R6AA 3DVRX 2HF8A 4Y2YA 1J2EA 2D5CA 4OFXA 3SR4A 4K0KB 1BVHA 3H11B 1S8NA 5IT0A 3QH4A 4V24A 3CWCA 5BSTA 4J16A 2W8ZA 4MKIA 1IY0A 1IUKA 4GNRA 4RHTA 4TZTA 5DNVA 3WNZA 2EEPA 1UDXA 2VTBA 4ZXFA 1E7RA 1W9MA 2ZSJA 1B14A 3RT7A 1NQTA 2VPZA 3PD1A 4R83A 1VJTA 2QMUA 1LQUA 1UJ4A 1JQAA 1L8XA 2NVBA 1Y81A 4J1TC 5JT1A 2FKNA 1ZSNA 2YY5A 2X1VA 4JA0A 2FPPA 4AVYA 2CMGA 1VCOA 1L1EA 2IQIA 2ZPAA 4LVCA 5CMLA 4UU8A 1SXPA 1YTLA 4MR7B 4ARAA 5G0VA 4CM9A 1EDEA 3DMDA 1N34B 3HR7A 5BSKA 4IIJA 3EXG1 4IFIA 3JR7A 1CUHA 3HL0A 4ALMA 5CVEA 4REOA 3K6RA 3WGKA 1K4MA 1FSPA 2BEWA 3CSDA 3NO4A 4D96A 5A06A 1ID1A 2EDCA 3N2ZB 4WGFA 4UAUA 1HDCA 1LGYA 2PY6A 3B52X 3FAKA 4GC5A 1UT8A 3RVNA 4A7PA 3NJ4A 3EFBA 4US1R 5ED4A 4FFLA 1J09A 4PYOA 1UOQA 3AMVA 3EZ9A 3WHIA 3WGHA 1S8FA 3F6PA 5AJXA 2RCYA 5GOZA 2DFKB 4EPVA 2B9EA 1W7AA 1QIDA 3HWWA 4FIDA 5D85A 3L93A 3V1MA 5BQ3A 3LXXA 4JSYA 1Y4ZA 4YI3A 3U0VA 3VR5A 5DOZA 2XR1A 3BGVA 3HB4X 2GM9A 1S4QA 4RPGA 2J9GA 5BWCA 3LF2A 4ZOLA 1O87A 2BFBB 3BXHA 3L0ZA 4Q3BA 4BLUA 2IXFA 1QF9A 1YB4A 3KPWA 2B4YA 3FAZA 2F8SA 4HGOA 2XQIA 5LXTB 5HNKA 3MMPA 4IVRA 2P9TA 3ASVA 3I6BA 4TLDA 3SR3A 2HCTA 2P2NA 1CUXA 2PUTA 2X2PA 3FVRA 3OY7A 2V9PA 3RFUA 2OV1A 3N39C 4YRNA 1ZD9A 3C24A 3KQQA 3KUUA 3NHMA 1SOAA 1C14A 3PNMA 1F3LA 4HZIA 2WF8A 2ZUWA 1JSXA 4MHSA 2Q5JA 4XDZA 3RS8A 1WX1A 4G0PA 5KC9A 3LU1A 3OLWA 2YWBA 2B34A 3BN3A 1Z7BA 4IJUA 2E5FA 2SKDA 2DVMA 3K1YA 2GBIA 5ELMA 5DM60 3WO0A 4BUCA 5BSEA 4PZDA 3JZFA 1KPHA 1R64A 3DL0A 4I3GA 3TTXA 1WHSB 3JD4A 3M9LA 4IKOA 3K09A 2B5OA 3ZIAD 3HN7A 5E7IA 2GESA 1TQ2A 3ROKA 3TE6A 1XMXA 1TT5B 1I01A 1ZESA 2JLCA 3A6ZA 1ZK0A 1TMOA 4LPKA 4Q01A 5K1ZA 2IHJA 4DCJA 3B1ZA 1N6OA 1EVLA 3QIVA 3ENWA 2XI4A 4WEQA 3UQZA 4R8MA 4MI1A 3LSTA 3ODGA 1WOMA 1DJNA 1U04A 2DC1A 3B12A 3K1ZA 4JNCA 1FL9A 3OE7D 4QQKA 3RAGA 3NFYA 3ZDQA 4BE7B 4MQUA 2ZT5A 5K3EA 4B3SB 3UFBA 4TV9F 4I5IA 3HJBA 3GGOA 1VGVA 1O08A 3QLVC 4KH1A 4UEQA 2FWNA 4ARIA 1YDMA 4LDPA 4BJ5A 1HNZB 2WF9A 2XOKD 2HU7A 4RKEA 9GPBA 4L5YA 1G9XA 4LRXA 1N5RA 1KJZA 1XZDA 1LNQA 2NZVG 3Q85A 4JUIA 4ZTZB 3U4GA 2DPLA 5EIFA 4DW8A 1IG0A 3SMVA 4R1NA 2XE7A 3P2OA 3DMRA 1NJ2A 2AOTA 2BW0A 2HX1A 3M89A 4XQEA 3KQHA 2P65A 2XKAA 2AK3A 4W6QA 5JJLA 4RKQA 3E22B 3A1NA 4K9DA 5L6LB 3GB9A 4ERXA 3QW2A 4C87A 3TXAA 1ZUWA 2J1LA 2QXUA 1H5UA 1VJ0A 1ZXLA 1OBHA 2VT2A 2YV5A 3ETNA 3KTDA 1UMBB 3UGTA 3FMFA 5ALJA 5KNLA 2H63A 2OXFA 3OLYA 1VPLA 5CT4A 1ECLA 2KM1A 2KYRA 1D6SA 2A5DA 1L4KA 3K6KA 4IIYA 3NZEA 2YINC 1R00A 4LWQA 4QPJC 3TI9A 1JECA 3ZZUA 1U2TA 3G7UA 2H08A 4L9RA 1L5RA 3QBDA 5CLIA 4B3JA 2VQFB 2BKEA 3WZ2A 1CVIA 2D2EA 4JWKA 4FWTA 4LV6A 2W90A 4HYTA 2X40A 3C6QA 1M6NA 1Y5LA 3Q7SA 4KR6A 4DSZA 4ZFNA 5B1HA 2FEAA 1MCZA 1RTTA 3G6KA 821PA 1TJNA 5HKLA 3NOOA 3SFZA 2QYHA 4HGQA 2ID4A 2UZ3A 1E1RD 3NWPA 5C7YA 4EW2A 5CT8A 3AC0A 1XZLA 2PN1A 3O8RA 3AKZA 1JEAA 2IZ7A 3LXRA 1HDGO 1N9ZA 2V9ZA 5FHQA 2IH5A 5CFPA 3KCQA 1Y8RB 2IZ5A 2ECKA 3Q0TA 4OHBA 3PHJA 5IM4F 3MHTA 4IAOA 5LQUA 4XVCA 1MPXA 2ZE6A 4MLZA 3T12A 4EK9A 4JI4B 2HDOA 4N6GA 4EJMA 3OCUA 1TL7C 2HRDA 2HSWA 2V65A 4DARA 1LWNA 3QF4B 3KVOA 4WACA 4BUZA 3H8SA 2V7BA 2PNFA 2HK8A 3DHWC 5EL0A 1CX9B 1JB1A 4L6IA 3GZTB 3VBCA 1K8XB 1IY1A 3HU3A 2O8FB 2IYWA 1KI9A 5H3LA 3ROQA 1PZFA 1E3SA 2GK3A 5AYVA 5TPWB 3RR2A 3MMNA 1LLDA 2L2QA 2BAGA 1S9DA 2I1LA 3L7KA 3UJ6A 4B33A 2WWRA 3EQ9A 1JHXA 2AMVA 4Q93A 1EM8A 3KYDA 5C1DA 3OZCA 2WHPB 4RZSA 3P9CA 1XAIA 5IN5A 4BDTA 4RIFA 4MA4A 1EIZA 2IDZA 3VI4B 1E9CA 3GVPA 3NDIA 3VYWA 3OOHA 1FU4A 4KR2A 4FINA 2FFJA 2OECA 5A7FA 2OEPA 2BDUA 2RD2A 1UMCA 3B2QA 2WE8A 3EEIA 3LPAA 5A05A 1F8FA 1X9IA 3D0QA 4ZAZA 5FUBA 3AXTA 3OSUA 2Q1WA 3A6FA 4UHDA 4RLQA 2OZLB 4EB0A 5AKKA 3QPBA 5AJUA 5CA0F 3FKJA 3LHSA 3A1DA 4FE7A 1G21B 3Q2KA 3SXJA 3DMYA 5ITZB 3FUXA 1Q19A 1MXHA 2FOIA 4EFDA 3CNQS 1AB6A 2O7RA 4GLJA 3RK1A 2W22A 1GL6A 4WNIA 2Y68A 3D8BA 4NBLA 3WKAA 4ARBA 3EASA 2CGEA 3B3QA 1VQ1A 4D8UA 2GOYA 3FYTA 4L95C 1XYGA 1N0WA 1ZN9A 3F8TA 1TKAA 1W34A 5SZIA 3R75A 2BGKA 1TU3A 2HLHA 2JFPA 3PHBE 3AB7A 2BFPA 4BXOB 2V7UA 2VHYA 4AS3A 2ZIFA 3E7WA 5JH7B 1TZCA 1XLUA 3K32A 4P0QB 2NO0A 4D9HA 4L3WA 3C43A 1H4TA 2A7QA 1V1RB 2FN4A 3GEDA 4E1VA 2EJUA 4Q3AA 5CA0B 5KQLA 3C15C 3I9JA 1I51A 3HJGA 3MG9A 4PFJA 5FV7A 4V0QA 3WLQA 1J1ZA 4CIVA 2CT8A 3CLRC 1ATIA 2A2ZA 2GHTA 2JCGA 2PUWA 2WSSA 2GN1A 3ORRA 4XWAA 2YOGA 4Q3LA 5FORA 4GKJB 2O8BB 3DA8A 1NVGA 1OTYA 4JUBA 4GGOA 5BO5A 1VCHA 5TB5A 3FPHA 5EZYF 1AOXA 3H7AA 3QUTA 5KNBD 5BVHB 3BK2A 1XDSA 1EXDA 2ZIAA 2OAGA 1UZMA 1DWUA 2Y93A 2G0NA 3BF8A 4S1VA 5CXXA 1CY2A 2B8JA 2GK7A 1JU3A 2SBTA 3KOZA 2N0SA 3UW1A 5JTTA 3EPLA 5ADVA 1RMYA 4BKRA 2BH2A 1R8XA 4KYVA 1TD1A 2EJCA 2OO3A 2O2GA 2K7ZA 3O7WA 4B48A 2GCEA 4XGQA 2XVXA 2NYRA 3VO2A 3WLHA 4BNHA 2Q5EA 3V97A 6LDHA 2C2GA 1H5QA 3PHIA 16PKA 1DVRA 2VYFA 5HUJA 2Q45A 2W0SA 5LUBA 4A16A 4B17A 4D3YA 1UZAA 5FBRB 2XAAA 4DLUA 4CM4B 5IVDA 3IR6A 1VLZA 2R00C 4CDNA 2DBRA 3WL3A 2O2DA 5JZOA 4J03A 2W6MA 4UBLA 4KXVA 4A10A 1SOMA 3TD2A 1XRSB 2GAAA 1MDFA 2ZSDA 4EHHA 1PTJA 5G1NA 3ZWDA 4CQJA 3F71A 3GLTA 3NYWA 4ME6A 4XCQA 2DR2A 1FFYA 1CY6A 1Z07A 4YJ3A 5AHKA 5B6PA 3U3XA 4E6PA 4LF7B 1JFVA 2GLTA 1NDUA 3G2NA 4XGRA 5KTMA 1YJAA 1I2ZA 3LGSA 2A6PA 1E1CA 1Q91A 3D4BA 4JYBA 4QG7A 5EIEA 4Z7NB 3N2KA 4MI9A 2IBMA 4Q37A 2YRWA 4QO7A 3NKLA 3KTAB 1P7VA 3JD1A 4JL8A 5B1DA 3V33A 2P4QA 3NHAA 4A92A 4NFLA 1UH5A 5BXQC 2Q4DA 5KMGB 1RW4A 4KHZA 2IPOA 2VDKB 1E60A 1O9GA 1ZY2A 3HRHA 2WD7B 4Y7CA 4KRFA 1JLSA 2WU1A 3GVCA 1GZDA 3AKDA 4YR9A 1NJFA 1P19A 5IYZF 3AM4A 3L0YA 5JNRA 1D1PA 1EUQA 4N48A 2R8PA 4J0JA 1L5VA 5CNKA 5JS6A 2XB4A 5K51A 1LI5A 2ZAMA 4KQ2A 3OEEA 1DIOB 4QE3A 4JR0A 4OAOA 2ZUEA 4ZKDA 4FJ0A 1E64A 2FWPA 2XDYA 3CEPB 3D1VA 4BC1A 1KBZA 3QWBA 1V16A 4YROA 1C1HA 2B82A 3KT8A 1YOVA 4RACA 5D51S 5B2ZA 4YRKA 1FU7A 2GD0A 2GEUA 1Z22A 3LVBA 3SVTA 3P4XA 4C03A 5KNCD 1YCFA 3NRJA 3TQSA 5D6OA 1XHLA 5EQDA 1QB7A 3TFQA 3HUEA 2H7YA 3EVTA 3KFLA 5EMKA 1GTSA 3PEEA 2ZJAA 1NONA 1CKEA 3X43A 4MQBA 2R6ZA 1YBHA 2D13A 4DMUB 4UE3S 4DUGD 5E3IA 4CM8B 1FSZA 4WD3A 1AKRA 3SQDA 5BVGA 4RMJA 1NP7A 4N39A 1I30A 2OPBA 1NPTO 1RYFA 2XMPA 3SSNA 3X1ZA 2GPYA 2IS1A 1IUNA 2IP2A 4GI2A 1KOFA 1LBHA 4TMKA 4F4UA 1CP2A 1WMFA 2HMTA 1LK7A 3ABZA 3CM0A 4W7SA 2FRDA 3PZRA 4YFYA 2Q27A 3LPMA 5JROA 3E5NA 2WSYB 4Z1OA 2PLWA 1Y6FA 2C29D 121PA 2P7HA 4UU0A 4MW0A 3EZNA 3JQFC 2I76A 3NXKA 2XQFA 2JJQA 2XPCA 4K9LA 3R7LA 1C1XB 4YRFA 5C0OE 4X7BA 4MCIA 1E9EA 5FTNA 1Y8AA 1SIWA 1RU3A 4KPUA 2CEAA 1ULHA 5DEOA 1GRVA 4E21A 4WA8A 3OHMA 3PDIA 3UJPA 2HBRA 1ZW1A 4M9XA 2R751 1HKHA 4J0QA 4CE6A 1O95A 3TGLA 4XOIA 1HKUA 1JX6A 3GRRA 1SK9A 3INTA 1XTUA 4AKSA 4B6EA 5JRDS 2QMYA 1X1RA 2Q50A 2XNKA 3EGDB 4X1OA 5E9JA 2P67A 3T5TA 1DAIA 3C0KA 3GYBA 4V2IA 1WJGA 2NG1A 4WBNF 3MAAC 2I66A 4HNUA 3TE7A 1AA6A 3KOOA 4QICA 1XZAA 1N2ZA 1RD4A 2P40A 3OD1A 4DSTA 2H31A 1RPJA 2OP0A 2OSVA 3FTNA 4CJXA 2BGWA 1G3QA 4OOEA 4K8RB 3W0LB 1A9XB 3OOSA 2EKZA 3NX4A 1PL0A 1V6CA 2XQKA 1NN0A 3QELA 4M76B 1RLOA 2L0XA 4D81A 3I04M 4U7HA 4YWJA 4DKJA 3SZUA 1NBHA 3E0XA 4GOKA 3BULA 1OZ0A 3CVYA 1G0OA 4ROSA 2ID8A 1Q3TA 3ZLVA 4P7BA 3IJ5A 1GR1A 3TAUA 2WIFA 2PS1A 2GEBA 1XTVA 1P1IA 3QBJA 1EVZA 5L4NA 3H5IA 3L40A 3MERA 4IGEA 4FZJA 4DG8A 4EG3A 1E0SA 4KVZA 3TIIA 4WBNB 3NC4A 2AF4C 1KK2A 1ORRA 3M9XA 5REQA 4JYZA 4EKYA 4LRQA 4AAYA 1HF3A 3R6GA 2R7NA 4JDUA 4UBMA 3L92A 4EHAA 4UE2A 4LYEA 3HLKA 2OVFA 4B7ZA 1A8PA 1G2IA 2CFTA 1U3DA 4DJEC 4E88A 2QPAA 3C7AA 3T1VA 1ZK2A 2FQYA 3GBPA 1FRVA 4AJPA 1XRRA 4YV7A 2F9LA 1Z6TA 3T8YA 4BB0A 4K6CA 1RHRA 3X0DA 4ENRA 4INOA 5B7NA 4Q3NA 4CKZA 3AEKB 3S81A 1H0SA 3B20A 3TTVA 2PWYA 2EHJA 5I4IA 4E33A 3RU2A 2O5CA 1PS8A 3FRIA 4F4DA 2CXTA 3JWPA 4AKIA 5TY0A 4QRDA 1Q7BA 1E79A 2IOQA 3HSKA 3LKBA 5GM1A 1A8IA 1P7PA 3UK2A 1JQEA 2RMKA 3I53A 4IXNA 1C1YA 4LDNA 1JBKA 3GEGA 3NIWA 3QBEA 3PTAA 3W8FA 4C05A 2Z8YA 1GGNA 3KM0A 3GRCA 3CBQA 1E6LA 3KVYA 2C3PA 3SBDA 2ZZMA 4BO5A 2NVUA 4OH1A 1IM5A 2I3DA 2PT5A 6REQB 2QTCA 1K7CA 1TO1E 4R2JA 1IM8A 1F1BA 2IYPA 5DN6A 5EWMA 5KVSA 3HA5A 3Q98A 1PUJA 2XCLA 4UBNA 4UDYX 2I4RA 2C5SA 4XDHA 5K0LA 4N76A 4IMPA 2GD6A 3H4IA 4YACA 3OO1A 4EHNA 2YFKA 1BEZA 4GI1A 2EZUA 5JXHA 4J0KA 1RZRD 3QEKA 4CODB 1R4MB 5LN1A 1E4EA 3GC6A 2Q2QA 1JQLB 1KZ1A 1L4GA 5G0TA 3H3FA 3ZW7A 3I5AA 1U0GA 3DAGA 5IMBA 3TW8A 4JBIA 3HLTA 4ZV7A 4GM0A 4B81A 1TAHA 1T43A 3OX2A 5A71A 3K6JA 2HHLA 5JXWA 5IBQA 4D43A 1OSNA 1S0UA 3BHNA 1TJ4A 2I2AA 4QPCA 4HWOA 1OXBB 3D4PA 5DO9A 4NXMB 4PGAA 2R6DA 3QKUA 2DWCA 2X4LA 4DIFA 4IQGA 3VR0A 3CLSD 2MYUA 4YRRA 4AWXA 4C7OA 1JEDA 5JD4A 1L5WA 4K6HA 4MQEB 2XHZA 4U7JA 4BV9A 1R5NA 3BWDD 1JE1A 1N8TA 2BJHA 4YJDA 4RTJA 3HXKA 2ACVA 2HHAA 5FBWB 2IV7A 5HZHA 3K0CC 3KQTA 5TQ0A 2UZIR 1A97A 3GRZA 4C0WA 4YMTA 5ERYA 2FR1A 1ZU5A 2HPZA 5KYVA 7ABPA 1QG0A 2D2IA 2Y66A 1ZLXA 3MNFA 4QHTA 1MGPA 1VBMA 1O1YA 4MICA 1G7SA 1VHWA 1I7LA 4JJGA 2NUAA 2Y1LA 4LXHA 4UREA 4WY5A 3HVIA 4ZV9A 3RSZA 2A1TS 3ABSB 3DM5A 4JC5A 1UUFA 3BMXA 4HLNA 5IMSA 1XTIA 1YS9A 4N3AA 2JJ1A 4RA6A 2R0QC 1F7UA 2I7VA 5DGHA 1QS0A 3QA3E 1SXIA 2JH8A 3HCPA 5BSVA 4U7GA 4GXQA 3PF8A 1T1SA 1OVMA 3BD9A 3IRUA 2W2OA 1GPUA 2YNMD 1Q1QA 2IOFK 4KIFA 1ZJZA 3RTDA 3ASZA 3D4NA 3E18A 3U5TA 1MO5A 3DQZA 3M3PA 3MEQA 1J90A 3QKWA 5HIMA 3AHIA 2P9FA 2LZ0A 2IK8A 4Z7JA 1QWOA 2P4SA 4YP0A 1V1MA 3MRXA 1CVLA 3T95A 2YYZA 3OE4A 3PDUA 3SHVA 2JJ8A 4ZTUB 4LNUB 4G0YA 1EESA 5U1PA 5LKAA 4LDAA 2JAQA 4X7PA 4ZYUA 2DJ5A 1RBMA 5C4IA 2ERYA 3SD7A 3FUTA 1FUYB 1GQ2A 2VFAA 1JIVA 1I3MA 3BEOA 4D79A 4IDPA 3I62A 1XB2A 3UXHA 4CUZA 5I9LA 4RAOA 1TUBA 4WZBA 2BGGA 4BOYA 2YC2C 1MJHA 5TLSA 1QHNA 4EDHA 1F2VA 4RABA 4ECAA 1CNMA 4LJ5A 2ZRCA 2Z98A 1CR0A 1L7AA 1NW9B 1S2MA 5SV2A 3VH3A 1UKYA 2PYDA 2VZ9A 5E6SA 3KUXA 1Z0DA 1MBZA 2HSGA 4GBED 5CJ2A 5EZ6B 4ZEOA 3V4VB 4Y1FA 3ZWWA 2RHOA 2I7CA 1NVTA 3E9QA 3L3BA 4KAFA 1GLNA 2C20A 2XA9A 1EGQA 4KXLA 3VC1A 1SKAA 3DUFA 1DPFA 4PAOA 1AHPA 2F8TA 2CZGA 2GF2A 3P0EA 1R3UA 1ZISA 3STVA 4RPIA 3LY8A 4LC0A 3N76A 4MUYA 4NATA 3QLJA 4FLMA 4W1RA 3F98A 4IZ6A 3VHXA 4GX2A 4O4HF 2Q8NA 4HAOA 5EUQB 5CDHA 1QJ4A 3CA8A 1NVEA 3IP3A 3IUEA 5EI5A 4HQKA 4FSHA 4ZVUA 2QF7A 3D6HA 1RYEA 1XDUA 1E32A 1MORA 2VLIA 4ZO6A 4DE5A 5C3MA 1HO3A 4WIAA 5K0JA 4MVJP 2FCAA 2OFOA 5ADWA 4UJ3A 2BOVA 1ORHA 2VQEB 1S2OA 1IG3A 4DXHA 2Z5FA 2JARA 3STWA 5H0IA 3WLPA 1EVQA 2DRIA 4M3NA 3SIRA 3I6YA 3FWPA 1R0RE 3HKCA 1NP3A 3NU1A 1CERA 1XWIA 4LS3A 4R16A 4B3GA 1JG1A 2CBZA 3QLEA 1AH2A 5CLHA 2H2IA 4NBUA 3VV3A 3ZCQA 4BY9E 2XMZA 4O4HB 5JOQA 1FA9A 2XOEA 2PSDA 1KY3A 3ZZNA 4PG4A 2HU5A 1LLCA 4BCBA 4I6JA 4D82A 4YT8A 5EPUA 4F12A 3G5TA 1E1RA 5H9WA 2H4HA 1FLAA 1DMRA 3QU4A 2C7PA 4OLJA 1Y5MA 1T9DA 2ID9A 5MF6A 4LW8A 1RYHA 2ZBFA 5HA5A 1ODSA 3DTVD 4QG3A 4FD3A 5JAQA 4DSNA 2GILA 1Y3AA 3EGWA 3CYFA 4J0EA 2Q1UA 1E63A 3IHKA 2EOAA 4FEGA 4NJMB 3T38A 3NOXA 2JI6A 5I7VA 1CUEA 4B43A 5DT2A 3SHTA 1NJ5A 2ZIXB 1O4WA 1JZQA 2O3RA 4JC4A 4ZO7A 5HFAA 4NE7A 2NSYA 4IFBA 4FLEA 5GJCA 4YCSA 4B3BA 4G1CA 2FLVA 4O4JA 1A9RA 1LPNA 1W49A 3WISA 3EPJA 4NBRA 1KIFA 4LZLA 1YR1A 2YWXA 5BQFA 2WT4A 2VJMB 4Q3CA 2QKYA 3A2NA 4O2RA 4N8EA 3ONFA 2RIRA 2DFDA 1K98A 5SYAA 5JAPA 2XLBA 4TZ6A 4CMEC 2HM7A 3OOJA 2AN9A 2QVXX 5JIBA 1R8SA 4M1MA 3O31A 3NOVA 3O21A 3QXSA 2IYFA 4EY8A 2VTDA 4ZMSA 2WY2D 4Z4QA 2YX1A 1HNNA 3BOSA 2Y3IA 1HMYA 4PYNA 4RWEA 4Y67A 2IV3A 2FK8A 4CM5A 4D9JA 3CIFA 1R18A 3H2KA 4R31A 1JDUA 1HL7A 1NWHA 1Y3CE 2LE0A 4D97A 4EQ6B 2UUBB 3HZHA 4GU5A 2ZWAA 1TIPA 3EVDA 1HFWA 4E5NA 3OH8A 3GGGA 2ODWA 4D3DA 3NS7A 3OJ0A 4FYPA 4FQ7A 1S2NA 1AS3A 3FTDA 1V2GA 2BD0A 3GRVA 4JP3A 4OV6B 4P3XA 3RJTA 3ANLA 1QJCA 2B2XA 4C4PA 2G82A 5TXGA 1G8SA 1JEQA 3FCOA 1GWNA 4US0R 3PPXA 5L8VA 1KQFA 3DOIA 5MGNA 2X0DA 2ZIUB 2II6A 2ZJ0A 4FGLA 5ILQA 3A0RB 1JPNA 3GAMA 4NS1A 1DCMA 5BV8A 2BM1A 3BMQB 2AXQA 4WCFC 4N0QA 1G8YA 2CDRA 5JZSA 3E9CA 1WUTA 2IEYA 5A9TA 1PP4A 4C0BA 4UEOA 5C37A 1P61B 3TLGB 4EG7A 2IU3A 3HC7A 4NOLA 4FBLA 5IWAB 3OQOA 1TLFA 3GFVA 3KHTA 1RI5A 3H5AA 3RC7A 4F7WA 1XEFA 3J81k 3ADBA 3BIJA 2ZZKA 1JA9A 5HXAA 1SHJA 5I9SA 1QRAA 1QONA 4IEFB 4CL2A 5LIPA 2DYKA 4E5YA 3N2LA 4HX9A 2HA4A 3TB6A 2MSKA 3MUNA 5E2IA 3OAAD 2OLKA 3DV9A 4GG1A 4DIUA 1G8AA 3OF2A 1OWPA 3RRJA 2PWPA 4FWIB 1T0UA 2NIPA 4MRNA 3RVPA 3T61A 5B4UA 3D2CA 4DKXA 2WLTA 1CZLA 1TJ3A 2CUNA 1UBRS 1QYIA 2C82A 13PKA 2P8SA 2QX9A 3G1WA 3OZTA 4HDMB 4NWIA 3DV0A 1GD1O 4NCKA 1RRGA 3JYQA 2CYAA 1RWPA 4AMBA 3PGMA 4UXJA 1UXOA 3OU7A 2EVWX 4N47A 4B2IA 2O8NA 4U1RA 3O4JA 1URPA 4BB6A 2YJ6A 3VPDA 1NLMA 4CZ2A 4ZANA 4S3MA 1OYYA 3C3KA 3L7IA 3QXHA 5DM2A 3U61B 4N5NA 1MB0A 1EKXA 2JNWA 3OU2A 4XVRA 4TUYB 4LGCA 1N2CB 3JYNA 2IW1A 4QOEA 2QLJA 3OPNA 2XNJA 1U0NA 1OAOC 1X70A 4OAQA 1U0FA 4RE6A 2A92A 5C4MA 1ZH4A 3UQYS 1Z39A 5EE1A 3R40A 2HR1A 2X8JA 1K7YA 1T3HA 1FNSA 1XV5A 3MB8A 3PB3A 3AJAA 3I52A 4G8CA 4KIUA 4XW2A 1ODTC 4C4OA 1QH9A 2GHRA 3WL5A 2WJIA 2DWOA 3GVIA 5F7XA 1OH6A 2WJPA 1X1DA 1BQ4A 3GAFA 2FP4B 3O1LA 1PZGA 1TFRA 3OZVA 2W8BB 4OI1A 3DKVA 4CCYA 1BVUA 1QFYA 2P2LA 4HAYA 1HDEA 2SCUA 4KC0A 2ZJ2A 2XA2A 3QFSA 4EKEA 2HTFA 2VQSA 2IHYA 3DDNA 1E5DA 1PX0A 3C4VA 4G9EA 2ZUVA 5FD8A 1PQWA 1QH0A 2X22A 3FWHA 4OKIA 4W1QA 3FSGD 2GT1A 1NBMD 2FZWA 3P9QA 4CM7A 3JZMA 1VMAA 4RDHA 2DFLA 4OSPA 1TRKA 2WP0A 5J63A 1PFQA 3E5MA 3IO5A 2C2ZA 4BEBA 1E0KA 5HK9A 2D0PB 4FS3A 1GGHA 2M6LA 2IHNA 4KQFA 1CD5A 3PDCA 1V8DA 2ZUBA 3GZNB 4IUDS 2NYVA 5FUQA 3DZBA 1JFFA 1KI4A 1GQRA 4IHJB 4O2AA 1H22A 5H3HA 2H51A 5B1EA 5ICMA 3R3SA 2ERXA 3ESQA 3I61A 5ALKA 3MTBA 4AJEA 3EEOA 5JLAA 5KB3A 1ESCA 5GIPE 4JIGA 1EGAA 1T3LA 3C1OA 5H5JA 4CUJA 4Z4EA 4YMLA 3S2ZA 1FMLA 1Q1GA 2HXYA 2OCPA 4XFJA 1FZQA 3KVVA 1I3CA 1Z4MA 1VHQA 4L4UA 1DV2A 3ETEA 5FO0A 2ZP1A 4BIMA 1RMQA 4FZRA 4Y6OA 1W36B 3LYHA 3DP7A 1OASA 3Q8WA 3B82A 1JJ7A 1KVTA 2J5RA 3IALA 4JA2A 4QGAA 5I4KA 3DQQA 1LPPA 3P9IA 3W2HA 1CDEA 1EUDB 1E2JA 3K0HA 1BMTA 2YZGA 2BBTA 4DC9A 4JJ4A 5AIAA 2EFCB 2QQ5A 2M6KA 3G8CA 3GQVA 1IQPA 4X1KA 3RTGA 4CU5A 5KOJA 2PGXA 3KUDA 1MB4A 4OAPA 4C20A 4O29A 5A6SB 3PLAE 4CQNA 4DAEA 1YONA 3UZUA 1DJLA 2IFTA 3BA6A 2ISSD 5A3RA 3OMWA 3VOTA 1LPMA 1DEKA 2BFEB 3EDOA 1H2EA 3AG5A 2FSFA 2CVPA 1SXJD 5FI3A 4BNZA 3R8FA 3A9UA 3DNMA 2PSJA 1CUWA 5DN9A 5G4KB 4UHCA 3RUEA 1SKYE 3D02A 3ZOKA 7MDHA 2Q6IA 1MX9A 4G41A 4KXQA 3B5JA 5KTKA 3TO5A 3H9CA 1IHOA 3OQVA 3C5WP 4GRDA 1XLVA 4NABA 3VC2A 5GY7A 1M0SA 2C42A 2P3QA 3UG7A 4EGCB 3AQ4A 2ZSAA 3DLTA 3U4IA 2OV2A 4BO1A 2VPPA 4XYLA 3BL5A 2V59A 3S68A 4AY3A 3HYSA 4MV4A 2QRHA 2Q9UA 4PSUA 3W4IA 1Q7RA 3IAM6 1CDDA 5CB0A 1PZMA 5FOVA 4IEIA 2I6UA 1GQFA 3IXLA 1P1BA 3OP4A 2FYTA 1U2DC 1LDGA 2HEGA 3T9CA 3RHZA 2A9RA 1S8OA 2QU8A 2RK3A 1X13A 3BFVA 3UJHA 1X7XA 4B3HA 1IOLA 2PT6A 4GXRA 3V80A 3RKRA 4KMOA 2ZK7A 1UKAA 1QNLA 1UQUA 4L72A 4Z0TA 5J5AA 1T0PA 3A1EA 3BSYA 1FB5A 3JCZA 3K5WA 1G8PA 4CTMA 2GEVA 3CEHA 1XEAA 5EE3A 2HB6A 4LTMA 1GQQA 4MDFA 1EQUA 4X24A 2H7CA 1E61A 3ZXXA 3IJEB 3PVCA 2HO4A 2IY7A 2KLBA 4U8HA 3FUVA 2VHJA 3DDHA 2A5YB 4MVJD 3NBXX 1ISGA 5DGIA 2Z6AA 4UUAA 4EZEA 1USUA 2IPNA 3BQMB 4HDKA 2RJOA 5JI2E 4PYLA 4PF1A 1KIMA 3N1UA 4EX6A 2LCIA 1O8CA 2WEKA 1BKDR 3FCUB 1CZNA 3NGLA 4H2DA 3QWAA 1EP2B 1EMDA 2C4VA 1LVGA 1MP0A 3IPRA 5JJCA 4J4HA 1OWNA 3TF5A 2KE5A 3IP9A 1SU7A 2JASA 5TIIA 3RUCA 4ND1A 1QKIA 1T5SA 2CVHA 2GA9A 3QFTA 4FKBA 4XI9A 3RJMA 3CF4G 3ZS9A 1FSSA 4OX9Y 1HH4A 4QLBA 3I5UA 4EGFA 2PUHA 4PBSA 1I13A 1HBJA 1IXZA 2CVZA 3OZUA 4YVFA 4DLZA 4OBBA 5LB4A 1WY7A 1QZZA 2WQZA 1YUNA 3F5QA 3R7SA 3GAZA 1I4LD 4BLRA 3DLHA 3CSUA 2DOKA 4R5MA 3PUIA 1K7XB 3URKA 3OM0A 3IHWA 3Q7RA 3B7PA 2D2FA 1KDVA 1E2UA 2V6MA 3TKYA 3CZ5A 4Q1AA 4OL0A 3DBRA 4DC1A 3HDTA 3I01M 1AK9A 5D6NA 2VRNA 3FPLA 4B6GA 5A9SB 1XP8A 5JPDA 4O33A 3AV3A 5TGDA 1JG7A 1CY1A 3D7SA 1JAHA 1SVMA 4MWOA 2PFKA 2OO5A 2VAMA 4EVSA 1BXGA 2NO9A 4TYYA 1V41E 1KMMA 1TC2A 1XCOA 1AKMA 3PL5A 3QUSA 4O2BA 4X85A 4MRVA 3H4VA 3TSCA 2XUHA 2AH5A 4JYAB 3LIPA 5I5EA 5JCOA 3GLUA 1K9SA 5ALMA 3CWQA 3S28A 2C5HA 1Y42X 3B13B 3EMKA 4OIFA 1L5SA 2VXYA 1C0IA 2AEEA 3RHSA 2XCTB 5LQSA 1FNBA 1VFNA 2YHBA 5JTUA 3MS4A 1YRQA 2EL7A 2Z3VA 4KFRA 4AX4A 5F9HA 2J3IA 4AZ3A 2ZI9A 3N3BC 2NU8B 1F20A 1Z35A 3NB0A 3MCVA 4E2WA 3IAS6 1GPYA 3PFFA 4WDRA 3D8SA 4I1YA 1HG1A 2AEMA 3FSRA 3IJPA 3GGCA 3G6WA 1PGJA 3W2IA 5FWXB 3ZDDA 1ABEA 4RH0A 5ALIA 1A2OA 3V8RA 1N8NA 5BN5A 3DKIA 1CLUA 1TKCA 1ZVVA 1W52X 4NU8X 5A5DA 3LOUA 4FR0A 3CB2A 3DZDA 1BOFA 3NNSA 3Q9UA 3QP9A 4NARA 1YQEA 3V6MA 4PTLA 1MZPA 3KQPA 2ZI3A 2WZCA 4FM9A 3H17A 1NI5A 2LRHA 1AURA 2OD2A 1ZCJA 3D2AA 1IPEA 2ZXEA 2GR9A 4Q24A 3WGZA 4A2WA 1EI9A 2V45A 4N8SA 2H4WA 2ACWA 3H5VA 4B7CA 4MP3A 3WL4A 1AS2A 2X1LA 3CGWA 3FPAA 4ER5A 4GQBA 1E9RA 3AYZB 5A2QA 1IOVA 2Q5FA 1PNQA 2CDAA 1Z5PA 3CKMA 3T1YB 4NOMA 5T67A 3N2EA 1HLPA 3S2UA 2B98A 5L3VA 1AXGA 1ZK4A 1XU9A 5CW2A 2FPIB 4QU8A 1Z0SA 2PXHA 1UFKA 5KZMB 2OM2A 4MLDA 5ISMA 3AETB 4FGSA 4ESOA 2Q2WA 3O92A 4IIJF 1F0PA 4TL8A 5FFFA 5B3JA 4EHFA 4GLBA 3T3PB 4ZQFA 3MGGA 2RC5A 4GIBA 3LXUX 4IV0A 4ZAYA 2XB2A 3ZQKA 3ESXA 2YNMA 4Q19A 1ZOIA 3PL1A 1G9SA 4YFVA 1VKOA 3FOEC 4M55A 2I7DA 1CJMA 3DEZA 2D2VA 4JSRA 1HY3A 2D4AA 3OZAA 1ZMXA 4JD5A 2RC6A 4BWGA 1L7VC 2WTUA 2ST1A 1K88A 1VIMA 1AVTA 1G20A 1Y82A 4OHKA 3M1AA 3OIVA 1ZAKA 5EP4A 1YK0A 4FYIA 4RZQA 2IH2A 4Z4FA 1O97D 4ZOLF 2VJYA 2QN2A 3O74A 1RXCA 3NBQA 4D8YA 5AW9A 2OB2A 1RHUA 3AHCA 4KGZA 3UB2A 4E07A 1OIXA 2GCIA 3GUYA 4XQ9A 2OVBA 3I2HA 4G5HA 2VBIA 2N75A 5K9ZA 2H1OA 3PGLA 4DLNA 4F97A 1FVXA 4WOPA 5ALTA 4ER6A 5AHOA 1ZJ4A 3GBSA 3RIXA 4RIGA 1PD0A 2GNOA 3KFXA 3ROMA 2PX2A 3MCUA 2IYEA 3Q11A 1V11A 1IRXA 1QHIA 1W5FA 3SNHA 3EJ6A 5LP1A 2BBOA 5EYPB 4IDHA 4IKPA 1QTQA 3THWA 3KC2A 1KJIA 4S1NA 2FG6C 1J2YA 5CR9A 5EKSA 4F9EA 4Q6WA 3VOBA 2AG8A 4F9TA 2W48A 5JAOA 3O0DA 4PLZA 1AZWA 2OCLA 1DWQA 2W2VA 1D9ZA 2VQDA 3Q7QA 1CUBA 4JJIA 4UAGA 1QRRA 3JY6A 2XLCA 1U2QA 4LKOA 5FPSA 1JAIA 3NRCA 421PA 3I30X 1A3CA 2DHCA 1THMA 4OQYA 5ARCA 3TTSA 2ZUUA 3N5CA 4LC9A 1Q7EA 1NMEA 1Q0HA 4DLLA 3TCNA 2I55A 3O3OB 4AT1A 2ECPA 2WJHA 5DISB 3USCS 1ZM9A 3L0DA 4XH9B 4WK6A 4J16C 4KO8A 4AUKA 3GDOA 3AUXA 1ZMOA 3G2OA 4KO1S 4NCHA 4X95A 5KYNA 2IEAA 4QYXA 2PLNA 1JWAB 1MN6A 2W6PA 4MO9A 4PLPA 2FPOA 3FOCA 5GOTA 1SOWA 4G67A 3O95A 3BGIA 3Q0EA 4U3JA 2J5XA 3AHHA 1QRUA 3OECA 1KNQA 3JAWA 5FA5A 3AK4A 4ZT5A 2HQ1A 3AIMA 4A23A 2I3AA 4HH3C 3QFHA 3WJ2A 5ARBA 4B3IA 4S2EA 3A36A 3HB0A 1UJMA 4TMTA 1WD5A 3ZQJA 4D26A 1ZCZA 2QJRA 3H04A 4LRTB 3WSWA 3BDVA 4L0CA 5BV7A 5L53A 1NVBA 4EF5A 2H00A 1OV6A 3C7TA 1E94E 2XBUA 1AT1A 4TKUB 3E9ZA 3UAVA 4HUQB 4C4ZA 1M3SA 1ZEMA 1IPHA 5DXAA 2VHUA 3U4CA 3W78A 4C88A 1POWA 4PC7A 1JNXX 4CIWA 4NECA 1J9ZA 4KH0A 4GT1A 4RZIA 1HEIA 1R9MA 3V8NA 1XQ1A 2RG7A 4GX0A 1L5NA 1GEGA 1IBMB 3RIGA 4I9NA 4ZVLA 3EFEA 4C01A 3F1KA 1GCUA 1E1MA 1GZ3A 1P31A 3DOOA 3PGA1 5FFNA 2BJWA 3AVTA 1Q7CA 2ZBPA 3AVUA 3ON5A 3ORSA 4E5PA 4Q7QA 4RTNA 5MN4A 1VG1A 3T7DA 2FSGA 3A1TA 4EO4A 3DBLB 5EIBD 3W6UA 2ODTX 4BQOA 5EJ6A 5J2TA 4MW9A 3OLQA 1EFVA 1S5PA 5K0FA 1YXMA 3G1UA 3CVXA 5C8XA 4C0AC 3BMOA 1YIAA 4KODA 1L8QA 4OK6A 4DREA 3SICE 3ND5A 1VLMA 4M0LA 4I5GA 1B0ZA 4D9IA 4BFTA 1M76A 1ESNA 3P45A 3UBMA 3DP9A 3C3JA 4TPKA 1YRAA 2AJLI 2BCGY 5JLJA 1NXSA 2MYNA 4UE6A 3N0WA 4F2GA 3EXAA 2OG1A 3OPYA 4OMUA 3SJ7A 4QO8A 5LD2C 3HU5A 1D1TA 4HFMA 1WVIA 1G6OA 1WXEA 4UOEA 2QWXA 1NW6A 5G0UA 1YZ3A 4PPNA 2XQVA 3V4PB 2NZUG 3F67A 4J49A 3EA4A 3MMSA 1Z5VA 2QLMA 4UXIA 1RMTA 1DG3A 1ZD3A 5I9TA 4KE8A 3TH5A 4L73A 3K9NA 1NNLA 1RAHA 1MAUA 4HLCA 5ESXA 4AO6A 1W25A 1UXHA 3DF9A 4LN1A 2OHIA 3NC1C 1I7SB 1L5LA 5JS8A 3ZIUA 4X1IB 2FXVA 1X8LA 2ZBQA 4D3FA 3H86A 2Q3FA 2B3TA 2O6LA 3C97A 3ESYA 2ZRDA 1ZRNA 1IL0A 2R25B 3OAAA 3AEZA 4GYYA 2EARA 4LQLA 1QR6A 5CXQA 3K71B 2UKDA 3DL2A 1D7OA 2Q8PA 3ADKA 5K0TA 5T3YA 2GPTA 3DLIA 1HTBA 4URXR 4NE2A 5FPPA 1S7GA 2PMDA 2PGOA 5BSHA 1YMUA 3WLKX 1E2HA 3RTCA 4J3FA 4A82A 2AXPA 2P2ZA 1E4VA 1NFRA 4R01A 4F6RB 4YJGA 5C5DA 3U7RA 1KZ4A 4BVGA 1MT0A 2MR6A 3GFTA 3JQGA 3FDFA 4I99A 4P4TA 5IASA 4BVFA 1XF1A 2OBBA 2PZJA 2QTFA 2ZJFA 1QH8B 1R0BA 3O1JC 3OKFA 4KEAA 3GUCA 4FQ8A 4LKRA 2VPWA 3FM9A 4PO9A 2CSUA 4DJJA 4QT4A 1OU4A 2F55A 1L3IA 1SKQA 2JH3A 1MOSA 2H0AA 2ZYAA 1RLJA 3M3DA 1YUBA 1VL8A 1G0NA 3HO6A 2VUTA 2QTAA 3WLAA 1G8GA 5F1KA 1N2IA 2BF7A 3UH0A 4DA7A 5KAPA 2XZOA 2BFAA 3W5VA 1JN0A 5CVCA 1Z47A 1OMOA 3OT1B 2XKJE 3H0KA 3IAUA 4ISCA 4UCQA 3ZCPA 2DUJA 4OUKX 2C31A 4NK5A 3AVVA 2B7LA 3MOGA 3AFHA 4LHXA 5A7GA 3UICA 2Q9AA 4XTRA 3C4JA 1DAMA 4DS3A 2Q1XA 1UBCA 1WLSA 4HHEA 3EAFA 1QC5A 4OP3A 1YA6A 2C88A 1QRSA 1UAGA 1NUAA 3B5EA 4GPZA 2GCPA 3E9NA 2FUG6 1A96A 3KEOA 3PC4A 4NBVA 1WZEA 4BGEA 1XTSA 3DONA 3G0DA 4UMFA 2GZAA 4MDEA 1UOPA 1MOZA 4KPEC 1YGYA 2XWPA 2C2WA 3IMFA 2RCNA 4MYHA 1H8HD 1H69A 2Z9DA 4C2TA 5TT1A 2G08A 2QI9C 3UJNA 3I83A 3M6XA 1GV1A 1MABA 2D1RA 3PWTA 4QDTA 5F35A 5LDGA 2PSFA 4JQCA 2WD8A 4YJ3F 4C30A 2ZRNA 3LC2O 2X0FA 5FAXA 1HQCA 2COUA 3CRMA 1B6SA 2WIBA 3ZNNA 3DLBA 2VNKA 3KYCA 3MJ4A 1IEQA 1V8PA 5I7WA 1ZM4A 1YQDA 1SIBE 2YVKA 4NENA 3HFRA 1ADYA 4C7BA 2XKBA 5IEJA 4WI1A 1BDJA 2HREA 1T5LA 1ECPA 3SKYA 3SX0A 4AYTA 3FD8A 4LWPA 2VPXA 4OGWA 1I0ZA 3DDZX 4AY6A 2ZYUX 4MI3A 2PD3A 3H2SA 3C1AA 1DWOA 3QVUA 4I19A 2E37A 4RKFA 4X8LA 3LBHA 3LC7O 4JBNA 4R1OA 1W2HA 2OK7A 1KFCB 3AJRA 3CNLA 3GJ6A 4MYUA 5BV0A 1FYEA 3P9SA 4IIGA 3MW8A 3PYLA 3FNRA 4RE5A 4W6ZA 5IH3A 5P21A 1A9OA 3STYA 1VL5A 2V5UA 4NBSA 3LPCA 4IP0A 5KSPA 1N6PA 1SXJA 2N47A 2FOLA 3TBKA 3V7NA 4E5VA 1U6KA 1Y9ZA 4DCSA 2ATCA 2E6UX 5HMLA 5BPHA 2OLEA 3FGPA 5FF9A 4ZT6A 4IHAA 1Z25A 1Z8DA 4H0FA 4AF8A 4YRAA 2A57A 3FNQA 2X4DA 2QJTA 1KI2A 1ZJYA 5KINB 5EXDA 3BVPA 4ID3A 5LP6B 3N86A 3VR1A 1IVSA 2EGGA 3RSCA 5LZ2A 3OQIA 1Z6XA 3L8GA 2AJBA 4PX5A 3PVZA 4TKVA 3JVUA 5KWVA 5CLQA 3IPXA 3MCTA 4CF7A 1T6ZA 3ZJTA 3NYIA 1RAEA 4G0MA 3PS9A 2LR0A 2ZE7A 2BZSA 1KZ7B 2CF5A 4E70A 1R7RA 3I4CA 2MU1A 1X15A 5AXCA 3VPBA 2Z4TA 5IAKA 4D4MA 2BUCA 4OO3A 3PFIA 3U31A 4WKPA 2IOFA 5BYKA 1Z75A 1ESDA 1BFKA 4BMCA 2ONCA 3UHOA 3UPDA 2VUHB 2WTXA 3RYCB 3R3WA 4G4IA 4DHEA 2XIQA 2B4AA 3QA9A 4OLFA 2FZGA 3GJ0A 2F43A 3A9RA 3LVFO 3ZV3A 1DFHA 5E6UB 2O2JA 3QE4A 1R2QA 2BYTA 3PRYA 1JVBA 4Q39A 5AR1A 4GKKB 4C9BA 4AQ7A 1B3RA 1PJRA 3L0SA 1T3SA 4PNHA 2AJDA 3U6KA 1KVSA 1R0YA 4KPGA 1YKSA 1SIOA 4TWRA 3L7AA 1HFKA 3WDSA 2GZ3A 2ZJ5A 2ZI4A 2VEDA 2REQB 2Y0EA 3K0KA 3KR9A 3CZRA 1MX5A 1COWA 2EQBA 3OE5A 1PTJC 3CVOA 2JLQA 3RC8A 1X39A 2XUJA 4JVMA 1LVHA 2ZRQA 3UY4A 3RYHB 3INRA 4HYYA 4G5GA 2ATXA 2WJVA 1JE0A 1TUIA 2XUAA 1TU0A 3KPJA 3NV7A 3PQ7A 1FFAA 1AHNA 4F3TA 4MQ6A 4JP5A 5DHPA 2Y1DA 5HMMA 4Z49A 2EFGA 3DOJA 4LZOA 3VKGA 2O3JA 3TLEA 2PQMA 4F92B 4N6OA 4IO0A 2ZGVA 1E99A 3LDAA 4ND3A 4UZSA 3IEMA 3DDWA 2Q6LA 1XA4A 4KPUB 2BEVB 1NC3A 4C07A 1S4MA 4BRSA 4MIEA 3JZAA 5KOHA 2B8EA 4BTEA 1I24A 3AVPA 1SM4A 3I8XA 4EY6A 1M7BA 2PZ8A 2RSLA 1FMCA 3TSZA 1B93A 3I32A 3ZH2A 3E61A 4K26A 1C0LA 1NSTA 3O4VA 4H9GA 3LL7A 1A27A 4L3OA 4ND2A 3HVRA 1OE0A 1KAQA 2NP7A 2WU8A 3T15A 4BV8A 5CW1A 3BE5A 3GZ4A 4BE4A 4ZOCA 5AW8A 1AUQA 1N6NA 1VFPA 4J7CA 3O4HA 4W63A 1J5PA 1GSAA 2P7IA 4H6XA 4Y6LA 1P1HA 2CFIA 4DBVO 5BNIA 1GKYA 1ANKA 4N0EA 3O9ZA 3VQTA 2WWYA 4AY2A 1XNJA 1Q0SA 1WE2A 4Y7DA 1D0SA 1NZFA 1GN9A 1R8QA 4HRAA 4S24A 1JR3A 3PJGA 3MC1A 3GRKA 3OX4A 4FZVA 1ADGA 3IIMA 4GMGA 2AZDA 1FDVA 5GP1A 4ZCSA 4ZCTA 3BFXA 3FFTA 3ACBA 1IDOA 3A3KA 1JXOA 2LWIA 2ZVJA 3FYUA 3LP8A 4TTAA 5CHYA 5J40A 4F11A 4ZYWA 3EC2A 1RHKA 2R4TA 5E1OA 5BNTA 5HTOA 3AB8A 3NP7A 1EM6A 5REQB 5FTMA 4BRUA 1VDZA 3WGIA 2HNAA 3QJGA 5CJPA 1W0KA 2FRDC 3QWFA 4MQFA 1U8AA 4EGSA 3E3LA 2HJHA 3M6MD 1OT5A 2IZZA 2XYHA 4P6VF 4ACBA 1V4NA 2C4TA 3WMEA 2VJOA 2X7JA 5C8VA 1DDGA 3FJYA 4GMDA 3OFKA 2A5GA 2OZKA 3R5JA 1DG9A 3A4YA 4L16A 2QR2A 1PL7A 2ZS9A 1EEXB 2H5EA 1O89A 4PHHA 3NQ41 1GQYA 1N9KA 3A4IA 4TMFA 5CYPA 3W8EA 2WKWA 1Z4NA 1CUUA 4B5LA 1IIBA 4EI8A 2JCXA 3E5RA 3OJLA 2NQTA 3P27A 1ECJA 2V4ZA 3PXUA 1G9TA 4ARZA 5LFAA 2QT9A 2VRWA 4DLYA 1M2VA 1DKMA 4UQPA 1TTHA 3KKKA 2CW5A 3L8DA 3N2NA 4HS9A 5EFZA 4KACA 1HYQA 5EPOA 3LDUA 4UM7A 3K5IA 2K4MA 1IEVA 3AI2A 1J8FA 3PT9A 4C4RA 3NVMB 2DEUA 3HK2A 1K89A 1VC2A 1B7GO 2A5FA 1TA0A 3VC7A 2VP5A 2Z2XA 3GWZA 4K28A 5C7LO 4NBTA 3BTUA 3E2PA 1XD9A 2QUZA 2W2MA 2YHIA 3GF4A 1T4CB 1Z62A 3D3WB 3GFBA 4I0WB 1RC0A 4PPGA 4RV9A 2J09A 2R96A 1BNCA 4V0LA 1VJCA 1KQPA 4J90A 1BX3A 3U7JA 1AX9A 2X5NA 2G72A 1RXIA 1WS6A 2BGUA 1K92A 3LS2A 5FPQA 3BJEA 2L82A 4HDQB 3UW3A 1U1FA 2IGBA 3GUZA 4F45A 5KUTA 1Q17A 2QN7A 2WIAA 2X7XA 4H6VA 1YDGA 7GPBA 2WYVA 3RHFA 3HDHA 3TW8B 3FMOB 5CPFA 3HY6A 1XQWA 2C7VA 2QRKA 1U6JA 4A8JC 4BO8A 3KWFA 4OYHA 1Z4LA 4GPIB 4MGIR 3EAGA 3ZDYB 4C3VA 3Q87B 1KO5A 2AN5A 5BWLA 4GRAA 2C5GA 3CCCA 1EXWA 3CS3A 4QBFA 4RH1A 3W2TA 5KTYA 1WETA 3EYWA 3PD7A 1O3YA 4C7JA 3SGLA 2XQJA 5AHWA 3R5HA 1PVDA 4EGAA 5IC5A 4B32A 5K0BA 2Q5LA 3ID6C 1XDZA 3E82A 5DTMA 4DXDA 1ZICA 4PQYA 4HDSA 4Y0VA 2LW7A 1CEXA 4HG2A 2HAEA 2WIGA 3H1PA 3K0FB 1PR9A 1RHJA 1RWKA 2Z6QA 4LMBA 3UEOA 1SZDA 4LHWA 4C78A 4ZI5