3AIOA

R267k mutant of a hsl-like carboxylesterase from sulfolobus tokodaii
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
283
structure length
283
Chain Sequence
ASVEEIRSLFKQFSSLTPREEVGKIEDITIPGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDSAGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTREHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVKFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVFYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 303aa long hypothetical esterase
publication title Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobustokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 100
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2010-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aioA00
4Q3LA 2JEYA 3FYUA 3ILSA 4UFPA 4B0PA 1MNAA 4WY8A 3RM3A 4Y2QA 1ZI9A 5CRIA 1GPNA 4I4CA 2WUEA 3PI6A 4H0CA 3PF8A 2VJAA 1F6WA 5HF8A 1ZD5A 3AZOA 4OYLA 4J3JA 2XUJA 5CT8A 5HKBA 5AKYA 1C7IA 1W4LA 4K6HA 3ICWA 2ZSHA 3IURA 4UFOA 4X00A 3VXKA 3R3VA 2XUPA 1MN6A 1TAHA 3DLTA 5D3KA 2XMSA 3GFFA 5FV4A 1I6WA 1B6GA 5ALRA 4DGQA 2QUAA 4I19A 2PL5A 5ALEA 5ALMA 2C5GA 4IH9A 2WILA 2AJDA 3K9BA 2Y2VA 1QIMA 5HKAA 3VJLA 4OU4A 1R9NA 2ECFA 2PKYX 5A71A 1PFQA 5AK3A 5HQ3A 4N8SA 5ALTA 1JU3A 3QMMA 4C4XA 3R3WA 2WG2A 3SK0A 1YSCA 4LKOA 5E2IA 1UK6A 2DFPA 2Q0XA 1Y7HA 1J07A 5EGNA 4B82A 1RWQA 4N8EA 3M83A 1XROA 1DX6A 5E4YA 2P8SA 1VJ5A 1O6FA 5EHXA 1ZD4A 1ZJ4A 1THGA 3W06A 3CN7A 4G8DA 4QDXA 5AH0A 5AM2A 2QUBA 3L1HA 3B12A 3H2JA 2GYVA 2XQKA 2ROQA 3D7RA 1MO2A 4H7EA 2WLSA 4TGLA 3O9MA 2WIDA 5AK4A 3FLEA 4O08A 4WFIA 5ALXA 1XZAA 5K3DA 3EQ8A 1MAHA 3BJMA 4F21A 4LXHA 3QPAA 5ALKA 3AJAA 4MWSA 2XQFA 4C88A 4YASA 4XWGA 1XRQA 4C89A 3WIBA 1QIGA 2PM8A 2XUIA 1EINA 2B61A 4E15A 3BDIA 4H7DA 5AKGA 2DQYA 4Y2RA 5AOAA 1MAAA 4MYSA 3BJRA 3O95A 4BCDA 2WUDA 2CKMA 1GXSA 2HA5A 2RI6A 3D3NA 1U65A 3L1JA 2LIPA 5DNUA 4Y9SA 2Z8XA 2BUCA 4C4ZA 2OAGA 4JUIA 1XKLA 1UK8A 3NUZA 4OCZA 3DQZA 4HVTA 3WK8A 1WM1A 2CZQA 2BCEA 1DQYA 1VE7A 3STWA 4B85A 3G9XA 4V2IA 1QFSA 2XMGA 1J06A 3WK7A 1J1IA 1E8MA 1OILA 4EUSA 3H2HA 1PJAA 3W9UA 1EXWA 3C43A 2I03A 3A2NA 1QIDA 4X91A 4DMHA 3U1TA 1XZLA 4BAZA 5FP0A 1R88A 3HACA 3STTA 1CUSA 2R8BA 2DQZA 4UHCA 1YB7A 2VAVA 3G02A 4J0KA 2HA7A 3C6ZA 3I6ZA 3OM8A 2C5FA 5CT6A 1SCKA 5I9IA 1XRMA 3LCRA 3QZUA 5AKZA 1P0MA 3DYIA 2BFNA 5KWJA 3VKFA 4Y2UA 3ZLVA 3CCCA 1MU0A 3C8DA 3MGAA 5K3AA 3STXA 5D7BA 2WFMA 3MVEA 1C4XA 5FXMA 4RPCA 3DCNA 4XIIA 4OYYA 3DDUA 4DMCA 4YX9A 1QIKA 1J2EA 4FLEA 2XMBA 2XUQA 4Q3OA 5EHQA 3PDCA 4B6GA 4BDTA 2QR5A 4G9EA 2OCIA 3IVMA 2XUDA 3R3XA 5YASA 2PPLA 1L7AA 3R41A 3G9UA 5HK9A 5BV7A 3CXUA 1VXRA 3FSGD 3PE6A 5AHXA 1EDEA 1G4HA 1DU4A 1O6GA 2GZSA 5FOQA 1L7QA 5F4ZA 1WHTA 1EB9A 2GYWA 1IZ8A 2ZVDA 4W1PA 3OPMA 5E4TA 3NWOA 2XB6A 1BN7A 4LYDA 2VT6A 5E4JA 1XZGA 3N2ZB 3HRHA 2XMCA 2XMDA 1XZBA 2OXEA 5IVHA 1MTZA 3OG9A 3B5EA 4C87A 3E4DA 5CT9A 4KYVA 4UPDA 2K2QB 3I2HA 3KD2A 3LIIA 2OCGA 2WUFA 4AMYA 1TKRA 4ZWNA 3FYUC 2HRRA 3FCYA 4X93A 1B41A 1JT2A 4N5IX 4G8BA 1ZGCA 4NZZA 1VZ2A 3IUQA 4G1FA 2RIPA 5ALHA 4L3WA 5A7GA 4AZ0A 3MUOA 3WKEA 1GKLA 4WDQA 3H2KA 4B0OA 1GPLA 2WJ4A 5EIAA 4A16A 2WFLB 4ARBA 3C6YA 1XZEA 3BF7A 3WWPA 5K3FB 4GWLA 4NMWA 1Z68A 2NW6A 2AJCA 4UBKA 2OCKA 2YASA 1UFOA 5ALJA 3I1YA 4Y2TA 1FFAA 5ISMA 4Y2YA 4P9NA 3G7NA 1YA8A 2OGZA 4AO8A 3D2AA 3K6KA 4PSCA 3H2IA 4TVKA 2WHPA 3G9ZA 2V97A 3I28A 3WYNA 5HFNA 2QOEA 3O4IA 3STUA 1P0IA 1VKHA 1LPNA 5HF6A 2XUGA 3ANSA 2IIVA 2ACKA 5AIBA 1EVQA 4BP8A 2ES4A 4B9AA 2ZJ6A 5AI5A 1WPRA 4FLMA 1YB6A 2ZYRA 4QLAA 1N1MA 3BXPA 4E14A 4OU5A 1FSSA 4B9EA 2FUKA 1XZDA 3O4HA 5JAOA 4F60A 1G66A 1W52X 4J0DA 4N8DA 5K3EA 2HA0A 1IMJA 3WQHA 3EQ7A 2B4KA 5SYNA 1LPMA 4WJLA 4LYEA 3C87A 4GXNA 2FJPA 3C5VA 1NX9A 4UHEA 2DHEA 4B81A 4EB0A 2WJ6A 1A7UA 4HRYA 4BCCA 3H18A 1N5MA 2WU3A 4AN0A 4WFJA 1XKTA 1ODCA 1H2ZA 5DTJA 1DTEA 2JGKA 1JU4A 2Z8ZA 4MJ3A 3H17A 3VDXA 1XLUA 5CT4A 5LP1A 2X8BA 3FVTA 4BE4A 4BZZA 4QNNA 1ZOIA 1BCSA 3VVMA 4DMKA 4CIBA 3WL5A 4FHZA 3PFCA 2G5PA 2HFKA 2OPHA 2FX5A 3GBSA 3N0TA 4QWWA 2X5XA 2JGJA 2VAXA 3QMVA 4TPKA 3TGLA 5AI0A 4KJXA 1E8NA 5AKLA 4U2FA 1A88A 3QM1A 4J0GA 4N5HX 2G5TA 1E66A 3WWOA 3QMWA 1CPYA 1ACJA 2XE4A 2ZJFA 5ALWA 3ESAA 5IKXA 1CFJA 3T52A 2VQ6A 1T2NA 5JAPA 1A8QA 5ALYA 2XDWA 3I2FA 1IUPA 1W6RA 3G8YA 3PFBA 4X6YA 3WK6A 4KR0A 3C45A 3KWFA 1MT3A 4DNQA 2BUAA 4Q05A 4U2GA 2JF0A 2QXTA 2OG1A 4QDOA 1HL7A 5AI9A 4AZ3A 3IUNA 4RE5A 2WUGA 1M33A 1U2EA 2HA3A 3C8HA 1CUVA 5JZBA 1K5PA 3Q8WA 5CH8A 5DNWA 4BAUA 4WCVA 2PX6A 4ZXFA 4M0FA 1MPXA 1ZGBA 1CUXA 4J03A 4J0CA 4DLNA 1R9MA 5ESRA 4HRXA 1QIEA 2HIHA 1QZ3A 3D2CA 5LZ4A 2QKYA 1UWCA 3HXKA 3FWHA 4U2EA 4NVRA 4KE7A 5AP9A 3IULA 2OQIA 1IUOA 1UOPA 3C5WP 1K8QA 3AILA 3I2IA 4PW0A 3RK4A 1MNQA 1OCEA 5A7FA 3C6XA 1USWA 4ITVA 2C58A 3ZV7A 3ANTA 1E8DA 4QDZA 1ETHA 4RE6A 4PSDA 4BB0A 4I3FA 2GBGA 1XFDA 4C01A 4G8CA 3W9BA 3GZJA 4CG3A 4OB7A 5IVIA 4PNZA 1JMYA 3TRDA 1VA4A 2XLBA 1QO7A 2WG0A 2O2IA 2PSFA 2J4FA 4IHAA 1SFRA 4MEAA 3V1KA 4L9AA 1WB5A 4CG2A 5HFAA 5DYWA 1VA5A 4AMZA 1FFEA 5DYTA 1AZWA 2J4CA 4UBOA 2Y1KA 4OB6A 4HAIA 2I3ZA 3WL6A 1LPOA 3DL7A 4FTWA 3OTQA 1JKMA 2Z5GA 3VJMA 1X70A 4UBJA 1QIHA 3DJYA 4BDSA 4BC1A 3AFIA 1QIJA 3O0DA 1DINA 3LS2A 1ZIYA 4IQ4A 4IH1A 1CEXA 5ALQA 4FNMA 3A2LA 3M82A 1S8OA 3X3HA 1PV1A 1GT6A 3QITA 1R1DA 5AIAA 1LZKA 4DNPA 4X97A 4K6GA 3R3YA 2W22A 3AZQA 4RNCA 1WOMA 2WU4A 5FDFA 3V48A 4BRSA 4ZV7A 1XQWA 1UKBA 4E11A 5ALZA 4A23A 1H2WA 1XQVA 2B20A 5ALPA 2HM7A 2OCLA 5T4BA 4E46A 4DSZA 5EHZA 4QDTA 3I2KA 2I78A 1CUDA 3D2BA 5H3HA 2PBLA 2DHCA 2EDCA 3R0VA 1SC9A 1IVYA 3V1NA 4G4IA 5IH7A 5JARA 3WKDA 1CQWA 2VEOA 4F5ZA 4BATA 4DYHA 4CCYA 1AURA 4BRZA 3G0CA 1WHSA 3F98A 5ALLA 4UBLA 5EHNA 4J0HA 3WJ1A 3GROA 3AZPA 3HC7A 3A70A 5AM4A 1XRPA 4AX4A 1MX5A 3FBWA 4H7IA 2WQZA 4XVCA 2VTVA 3ZLTA 2ZYSA 3UUEA 4H7KA 5AKHA 4J0JA 1CUBA 1EB8A 4HXFB 1LPPA 4S0XA 1Q84A 3G0BA 1XRRA 5AM1A 3FYUB 5IVDA 2ZSIA 1XQXA 3D0KA 3OURA 2G63A 3IUMA 4KAJA 2VJBA 1P0QA 1LNSA 3BDVA 2YXPX 4KEAA 1UKAA 3O4GA 4EY8A 2GBFA 1CQZA 4MWTA 1ORWA 4BTVA 1Q0ZA 1K63A 2H9YA 3F8SA 1MJ5A 4AO6A 5HF5A 2OQVA 3DYVA 5LLSA 4UHBA 5EIEA 3QH4A 1YAHA 4Y2PA 4KE9A 4G5XA 1GQSA 3JYHA 2V96A 3SC2A 2RAUA 4B7ZA 3M3DA 5A6VA 3PF9A 1XZIA 1RYYA 1XLWA 2CMFA 5ALGA 1OXMA 2VA9A 2QT9A 2JGLA 1LPSA 4H7JA 3IBTA 5ALNA 1QLWA 4ZI5A 2XUOA 5FUMA 4AN1A 1TQHA 2CBGA 3I2GA 1FFCA 3D59A 1CUIA 3I6YA 2V98A 2V9ZA 1FJ2A 2FJ0A 2XUHA 3AINA 1QO9A 1SOMA 4HXEB 2HA6A 3NOXA 5HQ3B 5AI6A 4HS9A 4BC0A 2I3DA 1UT6A 1DT3A 4FBLA 3NGMA 5A62A 4BVLA 3YASA 5EFZA 4A5SA 4G4JA 3R40A 4JH0A 4G4GA 1BRTA 4KE6A 2JEZA 3RLIA 2BAGA 5JADA 4P08A 4J0IA 3FSGA 3G9TA 2ZYIA 1R4ZA 1P0PA 1IZ7A 4KAAA 4Q34A 4UUQA 5AKEA 1DWPA 5I8PA 4QZVA 3E1GA 2XQJA 4MYDA 4DMFA 2DSNA 1AX9A 5ALDA 3CN9A 2WKWA 3I2JA 5D3ZA 4QE3A 3HI4A 2O7RA 2OLEA 3IA2A 2GBCA 5JIBA 1QTIA 4X7BA 1BEZA 4UBIA 2YYSA 4DM7A 1A8UA 5AM0A 4JNCA 4X6UA 4K5QA 1UXOA 1NU6A 5CMLA 2E3JA 5DNVA 5AI8A 4C4YA 1A8SA 5T4HA 4GLBA 4ZV9A 3DOIA 1K6EA 4LXGA 5ALFA 4Q82A 1CR6A 2O2GA 2WFZA 1HLGA 2C4HA 4LHEA 3ESCA 5ALOA 3W05A 4PV7A 3E0XA 3QPDA 5CURA 4BBZA 1LPBB 3F9CA 5J3JA 1ZI6A 4FDMA 4D9JA 2X76A 1XZMA 4EY6A 5CH3A 1XLVA 2IITA 4F0JA 5JD4A 3H1BA 1QE3A 4HTAA 3D4LA 2XUKA 4X95A 1W1IA 2HL6A 2RGUA 4U2BA 4UHDA 3L1IA 5CXXA 2B9VA 2R11A 2GBIA 1Y7IA 4HZGA 2WIGA 3WL7A 1F0NA 3W2TA 1IUNA 1XRNA 1BS9A 2HU7A 5C8ZA 5DTIA 1E5TA 2OAEA 4FWBA 1QONA 3KXPA 4W1SA 5EIHA 3DKRA 2AJLI 4CIAA 3PUIA 4AQDA 1WB4A 4WDRA 3IB3A 1AKNA 2WHQA 2JGIA 2ZJ7A 1CUEA 3FYTA 5CBKA 1D07A 1JI3A 5K5EA 1HDEA 4Q1VA 1AC5A 5T4FA 1TCCA 1ZJ5A 2EDAA 3H2GA 5DYYA 5EI5A 3FLBA 4J7AA 4BE9A 3GA7A 2PSJA 4H7HA 2VSQA 3ZPXA 1YS2X 2GZRA 3ED1A 3JWEA 4CFSA 4P93A 4BP9A 1EK1A 4QLOA 1G5FA 4X6XA 2O7VA 1N5RA 2VT7A 2XMRA 1HKHA 3VISA 2W6CX 1K4YA 4Q3KA 1MX1A 3AIMA 1CUHA 2CEKA 1TK3A 1EI9A 3WKBA 1QIFA 1UK7A 5LZ2A 5JD6A 3V1MA 1LBSA 4CG1A 1THTA 4KAFA 1EX9A 3LIPA 4OB8A 1F8UA 4CI9A 3FAKA 4AB1A 5AM3A 4QDUA 3ESDA 3CCBA 2RHWA 3FOBA 5CXUA 5FRDA 4Y2XA 2HRQA 1BCRA 4LIPD 2DHDA 4QEKA 2QTBA 4H77A 3S8YA 3DNMA 1BN6A 4FKBA 4UHHA 5LIPA 2PU7A 2DR0A 5I7UA 1TRHA 2QM0A 5AOCA 4EHBA 1VLQA 3A2MA 3B3QA 2PUHA 4X90A 5LZ5A 6YASA 1FFBA 4C6HA 5D6OA 2JBWA 1YA4A 5AKKA 3DOHA 2BGRA 2HDWA 3Q0TA 1F0PA 1XQYA 2QMQA 3QYJA 3F96A 2PUJA 2HU8A 5FLKA 4BVKA 2H7CA 1EDBA 4WFKA 4RGYA 1AMNA 4EY4A 2XUAA 4FFWA 1RP1A 5BWCA 3LP5A 1KEZA 3O4JA 1YASA 2BJHA 5CT5A 1Y37A 1E3QA 2CUTA 4PO3X 2WHPB 2D5LA 1H2XA 1LBTA 1E89A 4MXDA 4DNOA 4ZGBA 1EK2A 5HCUA 3DEAA 4P92A 4GECA 4B84A 5CW2A 1FFDA 2WG1A 4FBMA 1BE0A 4GBGA 4FFVA 4Y2JA 2WFLA 4W9RA 4FNGA 3A6ZA 5FPPA 4CCWA 1UK9A 1YR2A 3T4UA 3EF3A 5K3FA 5A7HA 2VJCA 1H22A 1CVLA 3I6MA 3AIKA 1GGVA 4LXIA 5IVKA 2O2HA 1DX4A 4L0CA 1DWOA 3QVMA 4X3CA 5AK5A 4MQMA 3H04A 3V9AA 4EY7A 3HZOA 3BF8A 1ODSA 1LGYA 3F67A 3K2IA 4M0MA 3UMJA 5JAUA 4DSAA 1BEEA 3R3UA 4FLFA 2RHTA 4ROTA 4W63A 3WJ2A 4BTLA 1H2YA 3DS8A 5AJHA 5LZ8A 5AM5A 5HK8A 3PICA 2HHAA 4B83A 4GHWA 3QPCA 1CUAA 2AJBA 5CTAA 4PQEA 2J3QA 4AO7A 2QVBA 4L72A 1EHYA 2WTNA 5LKAA 2HADA 2WIKA 3UUFA 4BYMA 1R50A 4BCBA 3WZMA 1CUFA 1JJBA 5AKXA 1GPKA 4XJVA 3OOSA 1ORVA 3EIOA 3JW8A 1VXOA 3WI7A 2RONA 5CH5A 1ACLA 1CUYA 3G0DA 4B80A 5ALUA 3WWDA 1VZ3A 3RARA 4KRXA 1G42A 3SWWA 1XZFA 1TCAA 4GDMA 2HFJA 3ZLUA 1CUGA 3WWEA 3LLCA 3KWJA 5AKJA 3H19A 2CB9A 2QS9A 3OC0A 1QTRA 5C8VA 2H7YA 1LZLA 3ZI7A 5BOVA 5C81A 5ALIA 1HPLA 1Q83A 3I1IA 4M0EA 1XZHA 4K6KA 3RKSA 1ISPA 2Z3WA 2AJ8A 4U2CA 5A2GA 4KACA 4BZWA 3WK4A 2QRUA 2WIFA 1UOQA 1AQLA 2Y6VA 3HYSA 5BWBA 4FOLA 4EBBA 5LZ7A 4U2DA 1CIJA 2WHRA 3WK5A 3VJKA 1U8EA 1JFRA 2PU5A 1XZKA 4GI1A 4UBMA 2C7BA 4IO0A 5SYMA 4Z49A 1CUWA 2H7XA 3GELA 4PSUA 2GYUA 5LZ9A 3HSSA 1SCQA 2PSEA 4Y2SA 5FKJA 3DD5A 2BUBA 3WA6A 1H23A 1UOOA 4FMPA 2JGMA 3V1LA 1EH5A 1WB6A 5K3BA 1GZ7A 3H0CA 2WJ3A 3MUNA 1BU8A 5KBYA 1CV2A 4NS4A 1QJ4A 4ZRDA 5T4EA 4X94A 3DL4A 3WLAA 2XT0A 3C6BA 5AK6A 2G4LA 3IUJA 1MX9A 5K3CA 3KSRA 4EA6A 1LLFA 5AKIA 1GQRA 3AUKA 3WK9A 1YS1X 5JZ9A 2XQIA 3HABA 1T4MA 2Z3ZA 4OD0A 2CJPA 2D0DA 3TEJA 2JGFA 3BIWA 2UZ0A 1TIBA 2PVSA 4OUKX 3PUHA 3H1AA 1KU6A 2XLCA 4GEGA 1C7JA 1KU0A 3EQ9A 2J3DA 4KE8A 1EDDA 4DIUA 4YK7A 1L7RA 1BROA 2WSLA 2ONCA 3ESBA 1JJIA 4KRYA 4UFNA 4WY5A 3HJUA 3ICVA 5FPQA 1HQDA 4MQLA 1HBJA 3WA7A 3FNBA 1R3DA 1ZI8A 4JYPA 5JANA 2HU5A 1SCIA 5HF9A 4OPMA 3IDAA 2OGTA 3AIOA 1DWQA 3KDAA 3DKKA 5JYCA 5LYYA 4ZREA 5C8XA 3ZWQA 5LKRA 2YH2A 4BVJA 1WCYA 1XZJA 2QZPA 3W04A 3S2ZA 1EVEA 5DJ5A 4EZIA 1YCDA 2C0PA 3QBJA 1QFMA 3U0VA 4GW3A 4Y7DA 3BWXA 3TJMA 2XUFA 1Q0RA 2HA2A 4DTCA 3G0IA 4EY5A 2AXEA 4ETWA 1W75A 3HLKA 1DQZA 4QWMA 4XX1A 4H18A 4QA9A 1UKCA 3R3ZA 2BGNA 4H7FA 3FVRA 3WWCA 4JYMA 2JGEA 3SX4A 3WL8A 3BE8A 4BAGA 2OGSA 3M81A 4YPVA 3IIIA 5KREA 4JEIA 2ACEA 1X2EA 5ALVA 5JAHA 4AXBA 5JD5A 5AICA 3FLAA 1XRLA 1WPXA 5DLPA 4IH4A 5JALA 1VE6A 5AO9A 2HA4A 2QJRA 3STYA 3D5EA 3EBLA 1XZCA 3BL8A 2PSHA 2QJWA 2H1IA 4UBNA 4DNFA 3WYDA 4W1RA 2DCMA 4X71A 5KWIA 3STVA 2WTMA 1UZAA 7YASA 3WKAA 2XMZA 4INZA 3FCXA 4CCYB 1CRLA 2XQGA 1DT5A 1CLEA 2Y2UA 1CUUA 1VOTA 3P2MA 1JJFA 4HXGA 1ZIXA 1ZICA 2Y6UA 1W76A 3G0GA 2ZYHA 2VF2A 1AGYA 3VVLA 1GKKA 3GUUA 1QGED 3WZLA 4K2AA 1LPAB 5JZSA 2QXUA 2EEPA 4OSEA 1CUJA 5JATA 1JMKC 4Y2VA 1CUCA 1QOZA 4ARAA 5DWDA 1AUOA 2JIDA 2XMQA 4MEBA 5JASA 4H35A 1NU8A 5ALSA 2PSDA 3C70A 1U4NA 2ORYA 3KOOA 1X2BA 1QIIA 2WIJA 3BIXA 1CUZA 1YAJA 4PF1A 1N8SA 3WIOA 4X92A 3F97A 2C0QA 5HZGA 1ZD2P 3HEAA 2IX9A 5AI4A 3E3AA 2XI4A 2BKLA 2VATA 5C7YA 4UHFA 1TCBA 1EA5A 4G9GA 4X85A 3WKCA 4W1QA 2WM2A 1ODTC 3O9VA 2VJDA 5AOBA 3WMRA 1ZD3A
chains in the Genus database with same CATH superfamily
3UAXA 2QMZA 5F33A 1TUGA 2IQ5A 2R6ZA 1Z5NA 3GUZA 1JXOA 2V7PA 3JQPA 1A50B 5JZVA 4W5OA 4WY8A 1G0NA 1Y5NA 3RM3A 3OLCX 4YUXA 4JI2B 4Y2QA 4LDPA 1Q0SA 2Q45A 2RGXA 2X19A 4BVHA 1NDHA 2Q4EA 3BC1A 3A6JA 1YKGA 1JLHA 3O92A 4IHJB 4AN4A 1QK5A 1NXOA 1NHWA 3GUCA 2NO9A 1ADCA 3SZGA 1J0AA 1DBQA 1MC1A 1T26A 5LDDC 4HJRA 1C30A 3RBVA 4IVRA 2Y9MB 2BKVA 1ZD5A 1EFUA 3EWIA 1KPHA 4MRMA 3C3DA 2IV7A 5EJ5A 5IAJA 2JPDA 2NUPA 5CDFE 1V6AA 3TZCA 1TM3E 4KXWA 4QUBA 4D9GA 2AWNA 2RHDA 1F38A 5BR8B 1EWVA 1C7IA 1N6KA 2H92A 1W9HA 3MHPA 2YYYA 3O9ZA 4U00A 2HRZA 3U3ZA 2VQEB 3WLMA 2OSBA 1IOLA 4A15A 1VYHA 1U1EA 3L77A 3COJA 4ZO4A 4QO8A 3VXKA 1EVKA 2IH4A 3Q6MA 4HH3C 1YHYA 1XEXA 1BJKA 2H8GA 4Q15A 3EGWA 4FN5A 4HH1A 1YDEA 2H00A 2ILVA 4U8HA 1T0HB 1R0CA 5EE9A 3SXPA 4DZZA 1ZXLA 1DAEA 3FVVA 4TXLA 5DP1A 1VKRA 2PS3A 2XMSA 1SM4A 1M6HA 5FV4A 4BBJA 1YQXA 3LBIA 4I19A 2PL5A 4C4RA 4ER0A 3FHOA 3OQHA 4EECA 1YQEA 2FMUA 5DU2A 5ULLA 4NYJR 3PFNA 2BEVA 4UNRA 5D87A 3E7DA 4C03A 4HJXA 3GJ3A 4NBRA 4JOQA 4O6VA 3DBVO 4IH9A 4FMDF 3V8BA 1X3LA 2RB4A 4TSKA 1Y8CA 1ZNQO 3C3JA 2WWGA 2AJDA 4B43A 2PWYA 1N6OA 4RNDB 4AJOA 3THOA 2C9OA 3PHGA 2GLUA 4OQ4A 2NVWA 5DHSA 3JAMA 3ICQB 4K7JA 1OR8A 1YVPA 3THWB 2BBWA 5E8JA 3AF2A 3ZWYA 1R9NA 3ER6A 4XCVA 2PKYX 2I4NA 4KWTA 4J91A 4XTCS 1B0PA 3RIEA 4ERXA 1J2TA 1BVHA 4GH5A 2A14A 5AK3A 1O94A 4KX3A 1BE6A 1M1NA 3AONB 5HQ3A 1HA3A 4EM6A 5THXA 1PG0A 1IC6A 2F17A 2QUJA 4WKNA 1W19A 1GG2A 1VHDA 3R3WA 4WQMA 2FQWA 2QVGA 4UEJA 5EXEA 2JCSA 2WG2A 4FE7A 1HDCA 1AIPA 4Z1OA 1KWGA 3SK0A 3KEQA 2FPIB 3U7RA 1NZFA 1PP4A 4DB2A 1JDZA 5AVZA 3GVHA 1UK6A 2DFPA 3R5FA 4YCDA 2NTJA 4I5GA 3UAOA 2AGVA 4GI2A 2OBFA 1PDOA 4G0PA 2QT0A 4MMZB 2XDAA 2TMDA 1ECJA 1NFQA 1HG1A 1FOEB 3R5TA 5EGNA 4B76A 3IEUA 3OEEA 3X1DA 4IMJB 4N8EA 2JLRA 1XTZA 4L0DA 3LT1A 3G5TA 2QF7A 3FZGA 1R8YA 5K8JB 5EZSA 1O6FA 1KI6A 2V7UA 4NPAA 1LBQA 4DQLA 2EV9A 4I36A 1ZJ4A 4L9WA 4Y6RA 4YMGA 1WL8A 5HQTA 4B8WA 2EKZA 3LV8A 4AJEA 2HCFA 2QUBA 4UOZA 2DWCA 1EQUA 2QTNA 1QP0A 1NI3A 3AC0A 1HEUA 1U04A 5HKKD 2XQKA 1VE3A 1TAGA 2NGRA 2ROQA 5JNTA 3LTNC 2BKXA 3E22A 3JSAA 3DHVA 4DV6B 1JKJB 5DNAA 4H7EA 3VPDA 5BURA 2FWNA 4RK4A 5C1DA 1M8JA 5GIOE 3TX6A 5DSZA 2O2ZA 1IZ0A 2WIDA 1VL5A 4QOSA 5JAIA 4NOJA 1U28A 1X15A 1QYIA 5IKPA 2XF2A 2B34A 5I4CA 3CZPA 4YONB 2Q3MA 2XYGA 4JDUA 4ALJA 3EA4A 5AUQA 5IARA 2IHVA 4JLBA 4MNTA 1TE2A 4QQRA 1XZAA 3NHWA 4O4JF 4KYUA 5G1PA 5ICSA 1JIUA 1T9HA 4F9EA 1CETA 2CF6A 2NZVG 4KBFA 4DGSA 4F4CA 3SFVA 1VMKA 1XTSA 1M72A 1PWXA 1UPFA 2R9VA 2Q4DA 2IDMA 1XRQA 5LD2B 1BMTA 3ABSB 2PM8A 3WIBA 5A5DA 4C0QC 5FHQA 2OWDA 3RS0A 4CIWA 3B70A 2ZIAA 5DT9A 3FDXA 5F9HA 2DQYA 2P3OA 4FZ3A 5I5EA 4MVJM 2WEKA 5JAMA 2C4UA 3ZGZA 3CONA 4UATA 2XRFA 4PY2A 5HRCA 1DC8A 2BM9A 3HHPA 2I0FA 1C80A 3DB2A 3INTA 1EK6A 4M7WA 1FRZA 1VPEA 3S44A 3O95A 4P3YA 3QJGA 4UMFA 4BCDA 3W90A 4D8UA 3RYIA 3UN1A 4F5WA 2D8MA 2QRVB 4QGSA 2FZLA 3IEMA 2BBOA 3K6JA 4DCVA 2ZATA 4EPWA 3D3NA 2QAJA 4Q00A 3OETA 1WXFA 3I9FA 3GNLA 3AI2A 2BTQA 3B6EA 3JQCA 1TM1E 4HWOA 1ELOA 1UPCA 3DL2A 4MUBA 1FQOA 1VRWA 1Y5MA 3FZNA 2O8FB 3PPIA 5DNUA 4Y9SA 1UJ2A 1U2ZA 1SNYA 2BUCA 2D13A 2Z8XA 2OV6A 3BZUA 2OAGA 2PX3A 3CMCO 4GZMA 4X60A 3GA0A 2FW8A 4JHXA 4U3JB 1F0KA 4DQVA 5C5DA 2A1UA 1CQIB 1UJ6A 1XKLA 1QB7A 3S2SA 3VZPA 3HM9A 2PUDA 3TK1A 3SYTA 2H2HA 4PR0A 2VO1A 3ZTTA 1T8PA 5HYVA 1DQYA 2HMSA 1JYSA 3OUUA 4V2IA 1JPUA 2W4MA 1PR1A 1QFSA 4EYEA 1GGMA 2CNNA 1NRWA 3BQMB 3D3WA 1FYDA 3HBAA 2X14A 3LPDA 3PNMA 2G8NA 3WK7A 3ESZA 2Y92A 5F12A 3KJZA 5JCJD 2JD2A 4Q93A 4AU1A 3GYGA 4TKZA 4GBED 4LQDA 1TVKB 3DXZA 3ICEA 2BFFA 1NQAO 4AURA 4PC2A 5FUWA 3C43A 5L7WA 2I03A 3M3HA 2Y4NA 1W7AA 5TT1A 4NZ9A 1F3OA 4LY0A 3HJTA 4JBWA 3H5OA 5JRZA 1H3NA 1HE4A 2AL7A 1TF5A 1K2VN 4ZOEA 2ODPA 3FPBA 1HH4A 1R66A 3FWNA 3OZAA 2OHHA 1CUSA 4RFVA 3STTA 4PG8A 2DQZA 4GOOD 5ES4B 3F73A 1CKEA 1YB7A 3G02A 2IY7A 2G04A 2OD7A 3EZFA 4J0KA 4US2R 2YKGA 3IFSA 1IXYA 1THMA 4H2DA 5DBOA 4E5KA 4B6RA 4IJQA 1PJ3A 3B20A 4LTMA 3TTUA 4B3RB 1QM5A 1P61B 3V55A 4IGKA 4FD2A 3AR5A 3TUIC 1SQ5A 2YJ5A 4LJ6A 4EBFA 2VNAA 1Z08A 2EKPA 1ZUNB 4MVJD 4OOFA 5B58T 4IKPA 4LVNA 4MVJI 3HR8A 1UZUA 3KOMA 4Y2UA 1HI9A 2NMVA 3RVPA 4YUWA 3MGAA 3NRJA 3NVDA 1T13A 2F2TA 5D7BA 2VYQA 3MVEA 2I1QA 2ERCA 1WUIS 2VDNB 3VDMA 4Q1CA 4WBNB 3PNVA 1KSHA 4D8YA 2O5EA 1C0PA 3EXAA 4IIDA 1G5RA 3DCNA 1D2CA 1Z26A 1QZZA 4XIIA 3I0ZA 3V8VA 2PA0A 4DMCA 3ZWBA 1FTSA 1B15A 4S12A 5MHTA 4FCWA 2JHPA 3PXAA 1PSDA 3DMYA 3QELA 2CJXA 5K4HA 4CMGA 1J2EA 4FLEA 4AS2A 2XMBA 4ENTA 3NI2A 3ROPA 1L7XA 1FP4B 1WR8A 2ATVA 2AXQA 2ZS8A 3GHHA 4BDTA 4V03A 1ID8A 1RBZA 2J30A 1RJ9A 1I0ZA 1A9RA 4URYR 3MWJA 1XSEA 3NT5A 2XUDA 4O5OA 2VRWA 4KR6A 3LM8A 2ZQ5A 1KAMA 1PYGA 4IBOA 2H1SA 5CLLA 3UB4A 4WZAB 4P31A 2G07A 1KMNA 2CF5A 3M9LA 1EM8B 1CZUA 1NI5A 3E58A 3DBLA 4JLKA 2FAXA 5AHXA 4ND2A 2GN9A 2O6LA 1EDEA 2OG2A 3FFBA 4PX9A 5D01A 1DU4A 3N7AA 4IV5A 4IVPA 4Z4FA 3LWZA 4E30A 1MENA 4JT8A 1O6GA 4GPEA 4J76A 3FGOA 5FOQA 4WZAE 2O8DA 3GOQA 2JBHA 4BY9E 3BGIA 1WHTA 1E1NA 1DKLA 1HMPA 3BXOA 1XEWX 4XEUA 3SHWA 4MR9A 1L4HA 2ZVDA 3KE9A 4P35A 4QPCA 4KQMA 4CMAA 2EERA 4NLLA 1N92A 1YOBA 3BTUA 1BN7A 1GQ2A 2BHNA 4H31A 2ZBGA 4TYYA 3KQPA 4LYAA 4XKJA 5FNVA 2YFYA 3N39C 1X7WB 2XZTA 3RSSA 4G09A 3WO1A 4A8JA 1BH6A 2VZ8A 1KDPA 2WR8A 2J7KA 3ONDA 3HCOA 2D7JA 2GMWA 3FGZA 3LT5A 4YDSA 3AHIA 2V6BA 5JUWA 1QGAA 3OG9A 1QVZA 3IDFA 5IVHA 4AMGA 3CX3A 4J4BA 3TLXA 5EOVA 5KCZA 3E4DA 2O2XA 4DUGD 4QOFA 4KYVA 1X0VA 1LS6A 1ISIA 1FQWA 1RWOA 1XTQA 2RC5A 2FPRA 3KKNA 3TL6A 4C43A 2GUWA 2VWGA 4KV7A 1TAQA 5M2QA 2ID8A 4TTSA 4E6EA 1JZTA 3O1JC 4BNIA 2HLHA 3NEJA 3RFXA 5BW5A 2F8MA 4NJMB 4IPTA 4OBEA 3SEAA 1IQRA 2FVXA 2ZS9A 3NEAA 5JTTA 5CXSA 2QTRA 2HRRA 3C16C 5KDOA 5D51S 1ZKMA 3LQKA 1Q7GA 1T6BY 4IXDA 2AD1A 2XXBA 2ZUBA 3RASA 5C5CA 2FY8A 1JT2A 4V24A 4QUEA 4CQLA 3ZU2A 3UGTA 3W6UA 3U7GA 1TKBA 1XNHA 4G8BA 5CB0A 1YZTA 3LHSA 5KVQA 2VH5R 2VBIA 1P29A 4PLPA 4WZBA 4ZMBA 1ONBA 4HX2A 1T4GA 2W6MA 2I55A 3P1JA 4NZZA 4B3DA 5JPCA 4MVJF 2B7BA 1NYLA 4D0SA 1I2ZA 1YRLA 2RFLA 5FBQB 3TQOA 5EJ9A 3IUQA 3IH5A 4G1FA 3B51X 3ASVA 1MOSA 5ALHA 4EY3A 1OW3B 4BIIA 3LDUA 3MUOA 4DA7A 1Z29A 2NTVA 3IKVA 3F0TA 1A9XA 3UXYA 4CM4B 3WLIA 2PMWB 2VHYA 3WNDA 4N41A 2WJ4A 4NBTA 3WBJA 4ENUA 4A16A 4YRMA 4EARA 2HIGA 4JI5B 1X74A 2WFLB 4BO8A 4UTNA 4ARBA 3M5PA 2PYZA 1DC6A 3K30A 2Z6QA 4OX9B 2VFAA 4QYMA 1BMDA 4QUJA 1GUYA 1CZNA 2E5FA 4QOJA 2V7TA 1ZGJA 2H11A 1FFYA 1XZEA 4AVYA 3N05A 4YCAA 1UIMA 3FNEA 1V11A 3LKDA 1CVIA 1A4UA 3ZHSA 3IQIX 1D0SA 1SCAA 2XWSA 4P3NA 1DSSG 1NMEA 1ULBA 3ZHZA 2FUG6 3TCNA 3MIZA 1NVKA 5JNLA 3OLZA 5HOQA 1JKFA 3K8YA 1IJFA 1Q91A 2VK8A 3KS9A 4GMGA 3NW9A 5CX1B 4DF3A 5B1YA 5CG2A 4HB2A 2FWPA 1QRTA 2NW6A 4GXTA 4WV3A 5FTNA 1DKPA 5EJAA 4HAUA 2K2WA 5CYOA 5DCWA 4QTXA 1M1XB 4TLDA 3NDBB 3SZMA 1ZM9A 2ORED 3ROXA 3NC0C 2O0HA 4M0CA 2CBXA 4F04A 4QNRA 3V8RA 3BSYA 5H83A 2OCKA 3RS9A 1E3TA 1KZYC 1UFOA 1OROA 1ZNZA 3RAPR 5FWNA 2Q8PA 3SMVA 4QYWA 2J85A 1CRWG 4ZU6X 1KTIA 1C2TA 3H3JA 5IC6A 3CU5A 2Z2ZA 2VYVD 4BNNA 1E1YA 2H07A 4XVRA 3UG6A 1XTUA 3K8OE 3H5LA 3FPSA 3KTAA 1WF3A 5L3ZA 3NNSA 1KI4A 3OEHA 1QC5A 2GJAA 4Q39A 3RYTC 1GSHA 2OGZA 4B4KA 4CIVA 4Z51A 5F76A 3VNRA 3B6ZA 5K99A 3T3HA 3QY0A 1F12A 2OT3B 4OJQA 3CRW1 5FOTA 2BCGY 5IKEA 2WHPA 1TFRA 3I28A 1GNQA 5J4YA 5H80A 1S2NA 2V6MA 2QENA 1YQQA 4ID3A 4LAFA 4NIMA 4EKDA 5LQKA 4X1OA 3OE1A 5HFNA 3STUA 4BNGA 3DEIA 1EFDN 1MQ9A 1E3JA 2DBQA 2H65A 3MSXA 1VKHA 5HF6A 3THSA 2VPXA 1Y3FE 6AT1A 5AIBA 2Q6KA 1N3IA 3E1KA 3WP1B 2ZITA 5E6SA 2NO6A 3BH0A 3SLGA 3ICPA 1SY7A 4ZXPA 5IC4A 1N2CA 2ZJ6A 3EZ9A 3PIRA 5IXJA 1HNWB 4MPJA 2JASA 1KMQA 3U3JA 1PZFA 1C7RA 1EFKA 4WSOA 4JLSA 4FLMA 3KT3A 4BV8A 4WGFA 1JECA 1G19A 5F1PA 1YB6A 2ZYRA 3BOSA 3I39X 4IZIA 4KFUA 3SKXA 4JI7B 1XA4A 1Q12A 3HXOA 4X9XA 3V7WA 2ZI3A 1X1TA 3BXPA 3ISJA 3LQRA 1BO6A 2HLDA 2B99A 3OUZA 5EIOA 4E14A 4Q3DA 3VPFA 2GPYA 4DG9A 2OR3A 4B9EA 2J41A 1U2GC 3CSUA 5HJ7A 2R0QC 1I13A 1WXHA 2RSLA 2HI0A 3I01A 4XYBA 1SBCA 4XQ9A 4Y6GB 2VTKA 2PZAA 5JISA 4KP7A 4C0KA 5JAOA 5K0LA 1TVEA 1GRNA 1SOAA 5F3WB 1QGOA 1Y3BE 1L5HB 3B1WA 2PWZA 5EKXA 1DXOA 1L5QA 4N0EA 4CLOB 2VT3A 2CCJA 1E7MA 1HURA 3UAZA 5K3EA 3U6KA 4YMHA 1X1BA 3MCAA 3EQ7A 3SLRA 1RE1A 4LZOA 4GL2A 4Z8YA 5E6RB 1LA2A 5BVGB 2EFGA 1EGQA 1UMDA 4GXNA 4K9MA 3SSNA 1V9LA 2BFPA 2NG1A 3LUCA 2DHEA 2H5IA 2QTHA 4ZO6A 4EB0A 1TT5B 2UZ4A 4QTUB 5ENDA 1XTRA 3ZVMA 4DREA 2B92A 4I66A 1B2LA 1IN7A 3IEPA 4H7PA 4BCCA 2XNSA 2DSTA 5A4AA 4TYWA 1ZW6A 2FOIA 1QFYA 1GZHB 3IERA 2Z83A 4OXQA 1XKTA 5FTMA 4J1QA 1ESCA 4PZ9A 1BZYA 3V8MA 3ZW7A 1JU4A 3I6IA 1GAJA 4S04A 3VX3A 2Z8ZA 5FOXA 4FOSA 1WB9A 3GFSA 4NH0A 1WMBA 1SHTX 4BUZA 3F6EX 4GI7A 1KMCA 3JS5A 3RNLA 1SHLA 2R2AA 4BJ3A 4TL6A 4AAYA 3N8IA 3L8DA 3BB1A 3VDXA 3ZGLA 4F6RA 4KXLA 3JD3A 1OX4B 4HQFA 5CT4A 3ZOKA 2X8BA 4EB6B 1Y42X 4F6CA 4Z6KA 3LYAA 2BZ1A 3ZDQA 4AX8A 2EW2A 1ICIA 2JJ1A 1CQXA 3DCJA 1AQIA 2DT8A 2WIBA 1X7HA 3COZA 1C0EA 1DTSA 3JD4A 2R6HA 4BZZA 1KFJB 5LN1A 1M6WA 4QQFA 4R4JA 5LBTA 1PLKA 2ZDHA 1Y1TA 4TSFD 2ZGVA 3PP8A 3H4TA 3W77A 13PKA 1UFKA 2ISSD 3TSOA 2G9ZA 2GSWA 5AW4A 4WFQA 1H3EA 2OPBA 2O9JA 2C2KA 2IPAB 4QWWA 1MO6A 2MSDB 1L3IA 1FF9A 1B0UA 4NNJA 3K5HA 3NM5A 3VHQA 2XB9A 1LD3A 1Z0DA 1WV0A 4R84A 4KVFA 4H6VA 1FUIA 2VF4X 5A5FA 2PUEA 3QKUA 1Y98A 4MCAA 4TPKA 2Z1DA 4E08A 1BG6A 3EDOA 5DI9A 4I1PA 2P77A 4KJXA 1E8NA 4HKTA 2QE7D 2N1BA 5CLHA 1HTBA 1RADA 1UEIA 2IE8A 2W48A 4PSAA 4BB6A 2XHEA 1QYRA 3LPCA 4LOHA 4TT3A 4N5HX 3PX7A 1ZCAA 2ONJA 4QU8A 4BLPA 1Y5LA 2XEXA 3PC8C 1N8TA 2WF7A 3IBCA 4TTPA 4G1BA 1PEDA 3L6RA 4DILA 4B40A 5EXXA 4FDLA 3F2VA 4RJKA 4PGMA 1OBFO 1DWUA 1OWLA 1DIGA 2SCUA 4Q4DA 5TGDA 4DA9A 5JRDS 3SHQA 2WJPA 1I7QB 3OT1B 1B1AA 2QLFA 2A9JA 2OBNA 4HDSA 5ALWA 3DV0A 2Z8YA 3KOYA 4RX1A 3MMZA 2DUWA 2FG7C 2I2DA 4E5MA 2BISA 4JP5A 5C1BA 5T6MA 1UMCB 3TBHA 3CQ9A 3KQKA 4IGFA 1Q3KA 3E7WA 4G5GA 4JWTA 2WAYA 2AE2A 3O8QB 3RRZA 4RHUA 2VJMB 2BFDA 1QSGA 1U2SA 4QVIA 5DLYA 1KYYA 3GAMA 5ESDA 1F9EA 5I9MA 3NTRA 2B0JA 3MJEA 1KFBB 4QOEA 5AJTA 1WD5A 3I2FA 3RHSA 1N33B 3D4OA 3QVKA 4BEVA 1CY6A 1ZZEA 3RB8A 1FFGA 4J75A 4BX0A 3G8YA 4CMIB 2RAPA 3G49A 2WVJA 1Y0BA 1EAYA 1DKQA 1OV4A 1Y4DE 2YIDA 3FOZA 4J43A 4K9OA 1SQ0A 5U9CA 5IFKA 2RKOA 1I4DD 2PQ6A 4JJIA 5BVHB 1MT3A 2OOKA 3ORHA 1IN8A 1PBNA 2BUAA 2ZRNA 4PINA 2ZAYA 4HAVA 2FPSA 2V54A 5SZKB 1LI5A 2XCQA 3MEQA 4Q05A 4U2GA 3HK2A 3KFLA 521PA 2PT6A 3RAFC 1TPZA 1VJ0A 4ZYLA 1H6CA 1E0SA 2QXTA 3KEFA 5EY5B 2QN3A 3TQHA 2YL2A 3L41A 2AG5A 2VXBA 3CCFA 2ZBQA 3D4IA 3P0HA 5FWXB 4W5TA 2NUTB 5B30A 2Z98A 4AZ3A 1U1GA 1COZA 4NV1A 3E9DA 3JQRA 4M1SA 5M29A 1QYCA 3BKWA 2I6SA 4YIKA 4QSHA 5EWLB 2RKWA 3DE7X 2WUGA 3EOZA 4N5DA 4RE5A 3NZEA 2HA3A 3DTYA 4X61A 4MO2A 3SZLA 1RSZA 3ZW9A 3BMQA 2WJAA 1U02A 3KB2A 2NZ8A 4HGNA 1EGHA 4CEJA 4QQ8A 1K5PA 3VR2A 4ZVMA 4DCJA 2VHJA 4I50B 2Z5LA 4G01B 4WCVA 2PX6A 2RGYA 3E48A 3F1LA 1OU4A 3A1CA 4FEGA 3Q0IA 4LYHA 5FTJA 4KREA 5EWMA 2J9GA 1MPXA 1ZGBA 1RM0A 2WV7A 3QLUA 3C6KA 4JXJA 3X1JA 1JHZA 4UOEA 2YOGA 3HCWA 721PA 1P5JA 4EHIA 1WBBA 5H5JA 3ZDFA 3MGBA 1KKLA 4QULA 5KYUA 2ZANA 1AT1A 2PKQP 2DXIA 3VH2A 3D6JA 2PIAA 3KZCA 1NPDA 1R9MA 2G9RA 3PL5A 3ZWAA 1H4QA 4KFRA 3LQ2A 5E7QA 4V0QA 4MPPA 3KBBA 4HRXA 1Z8NA 4A4DA 3B1YA 5H4HA 5KJCA 2HGSA 3BWYA 4OQMA 5BSEA 2GVDC 4N82A 2W11A 4JP2A 4UARA 4XYEA 3D2CA 3P5SA 2O3RA 5G1NA 2D0OB 3K05A 3ZNQA 3U3KA 2D8AA 2ANBA 3B9RA 3GP5A 3CR3C 1G0OA 4WOBA 4EI2A 1T9KA 2B35A 3E7FA 3FKSD 5HX7A 4MWCA 1CZHA 4BN5A 2B6HA 1IM5A 4A6EA 3BGWA 4YO7A 2VAMA 4PW0A 1K8QA 4KPGA 3I2IA 3RK4A 3DE6X 3P2IA 5D5HA 3RFFA 1MNQA 2PRSA 3HADA 5A7FA 3SF0A 3S28A 1PU2A 3ANTA 1EX6A 4CZ2A 2F1OA 1G8PA 3E8MA 1Z7BA 4YJHB 4TVOA 3DLCA 3SBDA 3OA0A 1SZCA 3HB0A 4E3WA 4QTTB 1C7FA 4K9DA 4PSDA 2R8OA 4NJEB 3UM9A 3X1ZA 1X7ZB 3QF4B 3BILA 3T7TA 3X2EA 3FXAA 3QA3E 3ZK8A 4H3KB 4IIBA 2A5GA 2GBGA 5G4KB 2EF0A 1P5HA 1V41E 3DOUA 4L8VA 4OQLA 4E2YA 5IU6A 2G08A 3FROA 4LXXA 3OLWA 2JAUA 1JHMA 1VJGA 2B21A 3EXG1 2B98A 1NE7A 1PD1A 2C2GA 2FPPB 4FJ0A 2WKPA 4D3YA 1ZWLA 4G84A 5IK2A 3FTNA 3JASA 4BEWA 1DZIA 2AKAB 4N0DA 3DEHA 5TS3A 4YLYA 1JGTA 3DPUA 3KQLA 4PZZA 5KC9A 5BWNA 4YT5A 2O8EA 5A3RA 3DDSA 5BN5A 5IT5A 1NZJA 3EXHC 3LSYA 2X23A 4HBZA 1FY2A 3ZC3A 3DCIA 2WWIA 4WLOA 1OY1A 2WG0A 3BQNB 3KZKA 3JSXA 4ENVA 1V8BA 1EUZA 4P53A 4FOOA 1P74A 4OGGA 2DLDA 3K6SA 4K86A 4M8KA 1M7GA 3DUFB 4A2CA 4BLQA 2EFEB 2R5NA 4D99A 3A58B 3ITKA 5K20A 3FFTA 1WXEA 4M7RA 5TGTA 4OHOA 5IJ0A 2R96A 1XX6A 2I7VA 3DZKA 1W0JD 3A36A 4QU5A 2IEZA 4PIMA 5DYTA 3UC9A 4AY3A 1UFRA 4YP5A 4YI5A 4UBOA 1V8PA 3SM9A 2R8PA 4NG4A 5K51A 2HRBA 2C92A 3K3PA 1LPOA 3TRIA 2WSIA 3OTQA 3ZVRA 5CCEA 4ZYTA 3ZKAA 2JBAB 1W88B 3P2EA 5IJ9B 1H2BA 3TL2A 2X9VA 5IYZA 2W6ID 3DVSX 4L16A 1BKYA 1YR1A 3F71A 3G13A 4H0FA 4HCJA 3RD5A 5JXWA 1G38A 1W85B 1XTBA 1QIHA 2DEUA 1ZDMA 5DI3B 4EX7A 4MTLA 3Q88A 3DJYA 1AQJA 1A76A 4BC1A 1YRWA 4G97A 2PRJA 4HNRA 2GH1A 3UKDA 4B34A 4IQ4A 4IH1A 4JFAA 2PS9A 4CNBA 1PR4A 3ETJA 5ALQA 3F5QA 4FNMA 1U2PA 3I9V6 5C53B 1DIOB 3M82A 1QF7A 4I1IA 4JLMA 3PNOA 1S8OA 2I1VB 3DLIA 3ETDA 1N7JA 1P2TA 1AOXA 1P4AA 2ZUSA 2J5KA 3H84A 4IIHA 5CNMA 1UBTS 1KZGB 3A27A 4POAA 1JHOA 3ACDA 1ZK2A 5JR3A 2AOTA 2PVPA 3CUSA 3QITA 2VEDA 1V6SA 2R5WA 5AIAA 1FL9A 3I45A 2V7GA 3M6VA 4ER6A 1GLVA 5B53A 3UK1A 2G72A 5EJFA 5KJ1A 3TZHA 4RHFA 4LGVA 4EG3A 4X45A 5LQUA 2J6BA 2Z2KA 4I9GA 1PWHA 3MYYA 2BV3A 4FEYA 4EHFA 1RHQA 4GRDA 1ZG3A 3LVRE 1HWYA 1B23P 3L5OA 2TSYB 3A9VA 1VGRA 1WOMA 2ZU0C 3SHOA 4IZHA 1AV6A 3OM9A 2H9AA 5FDFA 1XQ1A 1T3SA 2J3IA 4LQCA 3ZV3A 5H59A 4A9AA 1P1RA 1VM6A 2WMDA 1YULA 1UKBA 2QDKA 4ZI3A 4E11A 2GEJA 2C2YA 1U9YA 4A23A 3DPSA 1YVRA 1EFVB 3DVRX 4P5EA 1H2WA 4GQAA 2FSHA 2XB8A 2B20A 3H9BA 3K1AA 3R4CA 3PFHA 4UVEA 1SMKA 5T4BA 3V8EA 2E4ZA 2ZYVX 3S68A 1IJBA 5ABPA 2XCTB 1V1MA 1UWLA 3EODA 1F2VA 1SKBA 2I78A 3I2KA 2GPWA 1KEEA 4JI8B 4OLAA 3KR9A 4DE5A 4XASA 4YAFA 2CNLA 4AKGA 1FLAA 2EIXA 4B47A 1T35A 1SUDA 1WKVA 2DHCA 4O3FA 3R0VA 5AVKA 4ZGWA 2VHWA 1GEGA 1W46A 1W5TA 3EXFA 1SC9A 2DG2A 4MEJA 4NU8X 5DNDA 3W4JA 1AO3A 1DOHA 5LWQA 3UV6A 1TEHA 2PRIA 1ZM4A 2ISQA 3GDFA 3R3JA 3PQ5A 4DLSA 2O50A 2Y3IA 1UP4A 2SHKA 3I8XA 3UQZA 4ZIRA 2VQFB 2BFMA 4FYJA 1GCAA 2PWBA 1Q5PA 1RAAA 2OXRA 3PRJA 2IEBA 4HNSA 4P38A 1U94A 2BR3A 4LFBB 1IMOA 1KJYA 4UC0A 4MRAA 3S2FA 1DIRA 4ZOQI 1W0KA 3IP1A 3E35A 3KOXA 4WJKB 3AV0B 5EMKA 4AROA 1U8UA 3RU9A 3BT7A 2CHFA 4HH0A 4PLYA 3ODPA 3S3TA 1AURA 1J8QA 4HWTA 4BRZA 1SPXA 1WHSA 4HUTA 2GM9A 1L1EA 5DIZA 4B3XA 2IKSA 2QP9X 3ZU3A 1AKQA 4GMKA 2JL1A 4A6XA 3X1XA 1GDHA 1N0UA 1IXKA 5TY0A 1X1SA 3VPCA 4M38A 4O4IA 3F98A 3GLRA 3RVRA 1T8WA 5EHNA 1DTWB 2IY8A 4J0HA 4EVQA 3WJ1A 4JXZA 2QLBA 4RLHA 5MF6A 2HHCA 3GROA 3X1MA 1K5GA 1XRPA 2VF7A 4S24A 3SPXA 3UJDA 3KPJA 3CNQS 3O91A 2BEUA 3KD3A 2Z57A 2JFVA 3J81A 3T3OA 4OIMA 1I2BA 2C84A 2NU9A 3EEQA 4HC4A 1XD8A 4C2TA 2DPHA 3EDYA 1JLLB 2Y68A 4H7KA 4TZTA 3RR2A 1JH9A 4EUEA 1FTYA 2NZXA 1PG2A 1R5NA 1WXWA 2B25A 2IEDA 4Q7JB 3EPPA 4S0XA 3MBKA 1YTLA 1QP4A 4UASA 3I1FA 1E3EA 3FFAA 5JMPA 4YAIA 1JPNA 1XRRA 2H4JA 5CB8A 5AM1A 3RVBA 1ZVMA 4Q12A 5IVDA 1ZN8A 3VNSA 2Q9AA 2EAUA 2UV8A 5JQWA 2Y1DA 1XQXA 1VC2A 5IT4A 3OURA 1RWVA 1J97A 1I0LA 2ZE8A 4PPFA 4QYSA 3ZH9B 1QRDA 1SC4A 1V25A 2WJHA 2ZRIA 4P33A 4U5XA 3ZBQA 4UUPA 2NPFA 5P21A 5CFQA 3EQ2A 4Q3CA 3WLPA 4OATA 3O31A 1POWA 2HPZA 1C30B 2B2XA 3GOHA 1PJLA 2C57A 2D6FA 3JYPA 3KQVA 1LSJA 3PQ4A 4P58A 1M9NA 2W7TA 4MRMB 5H0IA 2AOWA 2NUPB 2CXSA 3F8SA 3ZX4A 4IDQA 2I1WA 4DUYB 3DEJA 1FMCA 1JN0A 3TDNA 2UYCA 2GTIA 3IR7A 3VZBA 1VPTA 3VYUB 2IGBA 4MVJG 4UKDA 5CA0A 2X13A 3L79A 3QH4A 5EKTA 4WESA 1YAHA 1GQFA 3IIEA 3OPNA 1DXYA 5MFPA 2W6QA 3OHPA 3STHA 1FUKA 1KC1A 2Y0CA 1F48A 2W2NA 4L9SA 1XEXB 4NF2A 4MHSA 2JFOA 3AXSA 3EGDA 4MRRA 2NNLD 1MXHA 3HRIA 3L0YA 3M3DA 1EDZA 1MBZA 1KARA 4HI0E 4PLHA 1CG6A 3L5KA 3V1TC 3VPBA 1RAGA 3ESRA 1XJ5A 2XKKA 1XLWA 2CMFA 3QKTA 5KWVA 5E1BA 1RAIA 3FPCA 1OXMA 3O3MB 3ES9A 1Q3HA 3PRYA 5EP1A 2QVYX 2VK4A 1JDBB 3C4JA 1E4EA 2JGLA 3FD8A 1M74A 2M6RA 4H7JA 4I08A 4Y6SA 2BEVB 5BNFA 821PA 2HK9A 4JD5A 2I87A 5CCDA 3KVVA 3CHYA 4OKSA 2D2FA 2ZTMA 2XUOA 1YJQA 2FZGA 1VTKA 2IYOA 1H2RS 2ECPA 4K3VA 4NK4A 3TTSA 2HKIA 3V8QA 3I0MA 1GTSA 1TQHA 3T5GA 3G2HA 1U7TA 3GJ8A 3H9JA 2V9ZA 5FBVB 1KEPA 2XUHA 3PGA1 3E18A 3I04A 3Q9NA 2AW5A 5KOIA 4LF4B 2PBRA 1JHDA 2IVZA 2WJJA 3EUWA 2HA6A 3NOXA 2Y0DA 4MV0A 5D5PA 3JVIA 4DYVA 5HQ3B 1M1NB 1RWXA 1ZCJA 2PXCA 2A5JA 2OFXA 2ZB4A 5AI6A 4R68A 4K2HA 3V2IA 2H1LA 3RIYA 3UWOA 3NYRA 4KDFA 5LBIA 2AQKA 4L74A 2ZUTA 2E2WA 2IEIA 4H1WA 1E5VA 2PRYA 4NCIA 4LWPA 3NGMA 4HNAA 1K3UB 2ERXA 2OFOA 3PQ7A 2QMYA 3RUAA 1CHDA 4JBHA 4BMXA 2HZBA 1AQ6A 3GYBA 3J81k 2YMPA 1JG6A 1C50A 2LGJA 4QL3A 4LRQA 3NWPA 3VNAA 2N9UA 4C4SA 5AVWA 5KJ6A 3YASA 3IURA 1OB5A 1FMJA 2I67A 5CEJA 3R40A 1KI6B 3PDIA 3KLOA 4J8PA 2CFOA 3N8HA 4Q6BA 4V0KA 3W6NA 4M1MA 1DFHA 2XNHA 2NVBA 1UBEA 5LYJF 2QWXA 1CZRA 1ZU5A 3RLIA 3ORSA 4DCSA 2XYQA 4LXUA 1Z0SA 3E22B 1K3FA 4OGFA 5JCXA 1ZR4A 3CMMA 3QFCA 4GMFA 2I9KA 1HLPA 1L5MA 1P3Y1 2JFXA 3JZFA 4FINA 3FSGA 4L4UA 2UZ3A 4ESHA 2ERYA 2J9YB 1QH9A 1WXXA 3AR6A 5EUBA 2BH2A 3GGSA 3CUWA 5KYYA 5JXJA 1QV6A 5HR5A 4JITA 3KLMX 4JJGA 1PSWA 1ABEA 2Y76A 4UUQA 3PPWA 1CY0A 3SOZA 1NW7A 1NA5A 2G3YA 3CPJB 3F9IA 3E1GA 3G82C 421PA 1DRVA 4MYDA 3KETA 4X62B 2FHPA 4MITA 3OA2A 1T0PA 2QQ5A 2WKWA 3CN9A 5DX0A 2FDRA 3TSCA 1SIWA 4BV3A 5LQMA 1NHGA 3RODA 2JB9A 1RPZA 2O7RA 2QJOA 2FLWA 2PDAA 3ADDA 3WYFA 3T1YB 5JIBA 3B52X 1QTIA 3GCDA 3L6BA 2YS6A 4EI8A 3UMCA 1FRVA 1YJ8A 1I7PA 2J7PD 2JJ8A 2SNIE 1XTJA 2W90A 3CISA 2YYSA 3FRIA 4NEHB 3SQNA 3Q8LA 4DM7A 1Q20A 3CA8A 1QVVA 3E7XA 2IL1A 4YAWA 4AS1A 2KQUA 2VP2A 2XBLA 1WQ4A 4BQFA 3H8WA 2QUIA 1L6IA 1Q1AA 4X6UA 3VMMA 1OBVA 4LDJA 2L82A 2P6NA 4DMMA 2QG4A 5CFPA 4K5QA 4QEZA 1QOQB 1VCHA 3OWHA 1NURA 1WTCA 1OGJA 3GRUA 2R6AA 3QRWA 5SZIA 2BHSA 2GPTA 3K32A 2Z2IA 3O7WA 3TFQA 1A8SA 2DMRA 3ONFA 4RH1A 2Z6AA 5JAQA 3RYIB 1EU1A 4GLBA 1GU7A 3DOIA 1MV8A 1FS6A 2G0TA 2H4XA 1XJCA 2P4EA 2ZPAA 4JFRA 4UD2A 3RIGA 3UT6A 3UXHA 4UVIA 1Q0HA 1T2UA 4P4UA 4U4AA 2BTQB 1WZEA 5AUOB 1IU9A 1V96A 4LJSA 2C4HA 4B3MB 2AIRA 1P60A 2GPAA 2WMYA 2V74B 3OC6A 4D4GA 1TMOA 3LK7A 1LLQA 1SHKA 2A1UB 3C7AA 2A5LA 3ESCA 4FFSA 1D2MA 1X13A 1RR6A 1T2VA 2MYNA 3IV7A 4PV7A 4G67A 4TWJA 5IAGA 4CE6A 5TPZD 5BWOA 2XE7A 5JI3E 3QPDA 5ER6A 2JFYA 5KSYA 3RKRA 3O3OB 5A3VA 4RSGA 1ISJA 1XDGA 1E4VA 4A8HA 4DB4A 3F9CA 2NSYA 2UU9B 1T4CA 4AG6A 5FEUA 2D0PB 3NYQA 3I4CA 1XZMA 3X43A 1ZISA 3CFYA 3CT4A 1IOZA 3D3WB 1MO5A 3FGPA 4FSXA 5BXYA 3MRVA 4RL4A 3RTBA 3TNYA 1S96A 5LU8A 2RKBA 1WTAA 2HT1A 3BB3A 5K7SA 2WM8A 4M99A 1NLYA 2IITA 2P9QA 4X7PA 2D1SA 3PTZA 1K7SN 3O83A 4AP6A 5JD4A 1KERA 2O48X 2BFFB 3G7UA 4JR1A 3H1BA 1FVFA 4JWKA 3VH4A 4BMPB 4CUKA 5AVUA 3DQQA 3H99A 4JU9A 5A5EA 1P91A 4FYHA 4ARSA 1PGQA 1R4MA 4QFCA 1W1IA 3RT9A 4QQNA 2NXEA 4YDHB 3A9CA 1KJ8A 3CUVA 3N2LA 4IX1A 4IGIA 2HL6A 2MSEB 3L7JA 5BOSA 4UHDA 2IZ6A 3LA6A 4TWIA 1X6VA 4FGSA 5CXXA 4Q9KA 2IDKA 4PAGA 4EUKA 2FN4A 1EWRA 4CV3A 3D8NA 1V39A 4IXWA 2GX6A 4G2TA 2OXCA 3WL7A 4YUAA 4QUHA 3KSDO 5AK0A 2ZI6A 4RU1A 4DC9A 1IUNA 3HXTA 3PYMA 4PGAA 4EGFA 1SHJA 1M2KA 2GPNA 2QN6A 3IOMA 3OQ6A 1M2FA 4Y6LA 1X94A 5DTIA 5C8ZA 1MABA 2DRIA 3QOYA 5CVJA 2J0SA 4RVUA 2H2GA 3ZIAD 1LK5A 3H42B 4MI6A 5FF9A 4CM9A 3REGA 1A4RA 4XAQA 4A0SA 1RPNA 3K2QA 2PFSA 1EFRD 4LZJA 5HNKA 3UVEA 5IDVA 5FLYA 4OYHA 3HLTA 5EQFA 1AS0A 1Q6YA 3QBVA 1P77A 2FEMA 2AMJA 3SXJA 4BNHA 4DBLE 2P2NA 4GLJA 1CU1A 1ADGA 5IPFA 1C4WA 2ZJ7A 4RPJA 3EFEA 3QELB 2YWEA 2GN8A 2WZBA 4FHCA 4FONA 4Q4JA 1V95A 1XDUA 4ZVOA 4NQZA 1DAIA 2ZJ0A 5C46F 5F23A 5FR1A 5HEKA 1JBEA 2V0GA 2Q5FA 1W4CA 4O2LA 5EN4A 5KJEA 1RJ9B 1Z07A 2OLJA 3AHJA 3TTYA 1A5AB 1MAWA 2RK6A 3IL2A 1KJ9A 3BREA 5DEOA 4RKRA 4X24A 4UMVA 1NNUA 1G4UR 3B9BA 2GSDA 5G40A 5F5NA 2D00A 3FLBA 3RC1A 4YT2A 3GA7A 3H1TA 2ECOA 1ZRNA 4FT4A 2R47A 3DBLB 1LFAA 2IJGX 2P9ZA 1XK7A 3OQ1A 2GZRA 3AEYA 1RBMA 3ED1A 3ASUA 1B42A 3SJBA 1FNDA 1E2JA 1SO8A 4R7ZA 2F9LA 1PSZA 3DBOB 4R6XA 4CFSA 4BP9A 5MN4A 1DX9A 3CRVA 1YBAA 3PXXA 1HL3A 4P8RA 4JY7A 3L02A 2O8DB 1JEJA 1G5FA 2A9VA 2EX4A 1WHTB 1RCUA 2O7VA 5DW3A 2AG1A 4IVQA 3RGWS 4MR9B 5DFAA 4LOAA 3TAUA 2R87A 2XMRA 1U7OA 3UJHA 3VISA 5I4IA 2G1JA 1K4YA 1TLFA 1C9NA 1W94A 2CC2A 3UKOA 4I2NA 3AIMA 4IZ6A 4DUZB 4R41A 5FNVB 3VZCA 4A8JB 4M87A 5JCPA 1KBQA 1N7GA 2WWRA 4JQYA 1AO0A 1C4KA 2OK8A 3V97A 4OA8A 4XB6B 2C1ZA 4DSOA 1XPJA 3BCHA 3OLXA 4R98A 1U7XA 5JDCC 5KMGA 1QIFA 4PZPA 3DFZA 2C3PA 3AKYA 2VUTA 3B6IA 3OZDA 1Z5WA 4ECAA 5JD6A 5LZ2A 1XAGA 1N7IA 2OECA 3FNFA 5J2UF 1QQAA 3FMVA 4GEKA 4YI3A 3WFZA 2RD2A 3EPRA 2IPMA 2PH5A 4K9KA 1THTA 4TVBA 3DGFC 3F8WA 2FZKA 4NBVA 1U7ZA 4MMXB 1E79A 4UVGA 5DH9A 5ESXA 1OQAA 1DEXA 3S2GA 3R74A 3OT5A 3T4XA 2Q07A 4CDNA 2L2QA 1OI3A 2XF8A 2QBYA 1LRKA 1NFRA 1U11A 2DUMA 3LYLA 1EHIA 1XU4A 3CEPB 3FAKA 3L0OA 4TTIA 4AB1A 1PCXA 3DWIA 4HPJB 1K08A 4CQLB 1UPUA 2XJ4A 3O2SB 2PFKA 2D2IA 4E5NA 1A7KA 5EXSA 1MD9A 4J2HA 3DVLA 3FOBA 4O4HA 1KSGA 5HHTA 3K53A 4PX2A 3AG5A 3E70C 3DE5X 3H0KA 4WZBB 4DQUA 2HRQA 1DUVG 3USES 1APBA 3TM4A 1O58A 3ESXA 2VPWA 1ZBDA 1T1SA 4GG1A 2JLAA 2JC3A 5DLDA 2OEPA 4JBLA 3VZDA 2P2ZA 4TN1A 2DH6A 5FWYA 4HFNA 2QHXA 2ZWMA 1DV1A 4KQJA 1GKUB 3HMQA 5ELLA 4CLXA 1CS4C 3RVSA 4ZICA 3ZVNA 1BN6A 1BC5A 4FKBA 4RK7A 1KJWA 2V7QD 4Q24A 4UHHA 4K0KB 2QYHA 3QY9A 1PT9A 4CQMD 1A9XB 2BD0A 4Q18A 4R40A 4DLZA 5LIPA 1BFUA 4US0R 1F5SA 2XRMA 4UAJA 5I4BA 1UC5B 1P44A 2W6PA 3H2YA 4R8MA 4C0AC 5C8DA 4YXFA 3E9MA 3GRKA 4W5RA 1W4BA 4EHBA 4UREA 2HHLA 4HNVA 3PDHA 3UMYA 2OZVA 4F46A 1QQ6A 3AVQA 3VO9A 2HPAA 4IP0A 2O23A 2CNWA 2GTPA 2YTZA 2DWPA 2P3QA 2X5KO 2QW1A 2QU8A 4X90A 3K70C 1V11B 4IJMA 5DASA 1KMHA 1ECGA 2HY7A 4KRGA 3IIKA 3P26A 4I1UA 4LHZA 3VBCA 1SUBA 3BH6A 3H1FA 1NQVA 4XR9A 3WP0A 4IXNA 4LECA 2OV3A 1DJPA 2IDJA 4PFJA 5F2EA 4IIJF 1NI4A 3TSZA 4NYIQ 1ZVQA 2C59A 2D74A 4BNMA 5H9VA 2FPMA 2FMHA 1P1BA 4RK1A 3TRKA 2VHXA 1XQYA 4KUGA 1CXZA 2KE5A 4JUBA 3QYJA 1W59A 3F96A 4HO1X 1P6QA 2IIPA 3I92A 2M9MA 3HV0A 2A92A 2NTYC 3P9XA 3V1UA 3Q7IA 5L8VA 2J1LA 3CW9A 5CDYA 1DMSA 1XG5A 1FUUA 1YCHA 5D3MA 4JI6B 4LJYA 2QLMA 2WSSA 4C4TA 1B1CA 3T0IA 3RFVA 2M98A 2YN2A 3EIHA 3JD1A 3KTAB 2XUAA 4F06A 3MM4A 1QC5B 1XEAA 1HYGA 2NUAA 2ZWAA 1KEZA 2Q29A 1M5UA 3NAMA 4H0NA 4MV6A 2HV8A 3T3PB 1OBOA 1YASA 4RS4A 5CLQA 1YR9A 2FRDA 1QYXA 1M6NA 3Q15C 5CW1A 4ZP1A 1Y37A 1E3QA 1ODJA 4PO3X 2WHPB 1Z6ZA 1CDOA 4KYIB 1P9RA 2D5LA 2IPNA 2O0JA 4B5KA 5TB5A 4CL3A 1H1LA 1C7QA 1OI7A 3EDMA 3IB6A 3KR0A 1ZUWA 3QWAA 4YH1A 5A6SA 3T0GA 3V4SA 3WXMA 1CDZA 4KQHA 1C3XA 3P9CA 6Q21A 3FCOA 3O3CA 4DDWA 1SULA 2UZIR 1OD6A 5E6SB 1ZMTA 3DEAA 2NSDA 5I9SA 3IHWA 3GPDG 3EE6A 4X3PA 1UC9A 5AJZA 5CW2A 1N2CB 1S8FA 3S1SA 1E6UA 5CGQB 1GGHA 1E9VA 4JX8A 1RQGA 1NVTA 2FFHA 4Z2AA 1LBIA 2ZBVA 2E9SA 2GXSA 2NXJA 5WRFA 4OSPA 3WHIA 4BTEA 4CCWA 3K1JA 1UK9A 2GESA 4O2AA 4TUYF 2IHJA 3G79A 2CK3D 1ANKA 1N2CE 1QG0A 4BRUA 5FADA 3NHZA 1Y7PA 3GFBA 4GKAA 3SLKA 4HYYA 3EF3A 2KLHA 2PQMA 3MLAA 5FLXA 4O33A 1P4SA 2VJCA 3H9CA 4NYMQ 1H22A 3FMPB 2P75A 2RHOA 3JQ9C 3JZIA 4QPNA 4EF6A 4ME6A 3PL1A 4F3YA 3J7AC 2B8EA 4HGZA 4FZ5A 1R2QA 4LXIA 3ZGNA 3PC7A 3F46A 3BWBA 3L3BA 3HP4A 4AQDA 3U4QA 3D7SA 3HEMA 3KOUA 4YRGA 1U0BB 4S1NA 4K05A 3DCYA 4O25A 4MP6A 4MV7A 2I66A 4S1PA 4YT8A 2D2XA 1G7TA 3KV3O 3NGXA 4X3CA 3PEWA 2X0JA 1HX7A 2GRUA 2TMYA 3JR7A 3H04A 2RJNA 4EY7A 3HZOA 2OO5C 4MGHA 4KO4S 3TZBA 3ZDRA 2BMFA 1UMDB 2OB2A 3PC3A 5A9SB 1LGYA 1TXGA 3B3AA 1TQ8A 3I1JA 4DSAA 1R6BX 3TW0A 4TTQA 3OECA 3V7YA 2ZRLA 4RTLA 4WZ6A 3R3UA 1Z06A 2GK3A 4L73A 3B13B 2RHGB 5LOVA 2KX7A 3ADOA 4BTLA 3HY6A 1H2YA 3DS8A 4M9UA 4ON9A 3RAGA 5LZ8A 1ADYA 2BIFA 1SVSA 1J23A 1GYPA 1BHQ1 5HK8A 1P62B 1RAEA 1R8JA 1JR3D 3PICA 4NU6A 1MC4A 2HHAA 4G65A 3HU2A 4P1ZA 5CBPA 3QPCA 3TQQA 3EFHA 3AFMA 2P27A 3DZCA 4K9LA 4WXMA 2UKDA 4AO7A 5JSKA 2LVBA 2A30A 3E53A 1H4TA 1WSWA 4Z4HA 1GUAA 2OESA 4LG1A 4LYJA 1SUEA 4DCGA 2QTCA 4F6RB 1AKUA 1FNNA 4RZXA 3LT2A 2YV3A 3UANA 4ZOLF 2QZ4A 4RPHA 4TZKA 1EUCA 1TGVA 4U5QA 3R7AA 1TECE 4AF7A 4BCBA 3G88A 1DI0A 2PMDA 5NULA 4M86A 4NBUA 3U44A 4RHEA 3WZMA 1CUFA 2GR9A 3GAZA 2PMBA 4A5OA 1Z4LA 1NOIA 2XCOA 5AKXA 4BWVA 2PO5A 4XJVA 2YFQA 3SXUA 3VYVA 3OOSA 1V5WA 2GXQA 2YJNA 5FO1A 2Y93A 2QN9A 1U9IA 1RIIA 2NAFA 1MJFA 1JUDA 1AF4A 2VR1A 2ZBUA 3EMBA 1OT3A 3EIOA 4C2AA 4Z1MD 2C42A 5GOZA 5IAOA 1IEQA 3NCTA 1DBIA 1E2GA 3I9MA 1Y6ZA 4KN8A 3O2JA 3RS7A 4RV9A 4I3HA 1POXA 1OXXK 2CNKA 2PH7A 1E60A 3CBGA 5DK4A 4WKOA 1LQ2A 1ZCBA 4GOMD 2XSZD 3F4LA 3U09A 3WGKA 4WN9A 5LLTA 4PWZA 3D0QA 2I22A 1FRFS 1OFTA 4AWBA 4EMSA 1XEWY 3TIIA 4B80A 3LKVA 2HO4A 3WWDA 4DXAA 1CP3A 1CZLA 2GEUA 2I3GA 3WAKA 2DBYA 3RARA 3NM4A 4C4PA 1EWQA 2FK8A 2VYFA 3HFRA 4FCTA 2M6SA 1XZFA 3SWWA 3WDLA 2HFJA 2GZDA 2ZUVA 1ABFA 2Q1WA 4N39A 3FNGA 2V6JA 2C2OA 3SS8A 3BBPA 3IPXA 5BN1A 3N2EA 1VMDA 1I7NA 2QRMA 4J16A 5AKJA 2SCUB 3PT9A 1QH8A 4DUPA 1E96A 1QYDA 2X7HA 1CY2A 3GDOA 3QW2A 4P84A 1S5PA 4HDSB 4J6FA 3L2OB 1MDFA 3WBBA 2H7YA 1LZLA 1OXSC 3AQ4A 3DV0B 3QGMA 4MK4A 3ZI7A 5C81A 5LQNA 1FZTA 1GPDG 4PLZA 1BGXT 2ZRAA 2O4UX 1KJNA 3UMVA 1YQGA 2WYOA 2PZBA 3NT4A 1ZIDA 4Q16A 4XWYA 1G2QA 3VC2A 1PQYA 5LJIA 2XT6A 2O2DA 3OQPA 5EUCA 2BFDB 5LDGA 2I4TA 4M0EA 3N3BC 2CLEB 3HSYA 3TD9A 4MX8A 2CVOA 3GFTA 2YINC 4D25A 4RAQA 5JDIC 2AA3A 2EFJA 1U2RA 5DT2A 1T3ZA 3MS7A 1COWD 1TUBA 4YJFA 5EP3A 3RUDA 4CM7A 1KP2A 2VSYA 2Z3WA 4CBVA 4QC2A 2C82A 5LIRA 3ET4A 5G0SA 3PHLA 1ORRA 2BGLA 4RCVA 5HTKA 1JJVA 1NJ8A 1E3DA 2ORVA 5FAXA 4KACA 3AX6A 4I4TF 2VP5A 3OSZA 2CFIA 1X7YA 2ZT6A 3A6EA 2OV1A 3C6QA 5EMLA 3QVTA 1Z2EA 3V4PB 4CKXA 3WAJA 2GB4A 1MO3A 4HFRA 2WAAA 5DP2A 4DIOA 3R76A 1L4GA 4CIXA 4YV0A 4N76A 1T3HA 2CXOA 4V0OA 5LZ7A 1I4WA 3THRA 1CIJA 1F8YA 2DR2A 1LLUA 1U0OC 2I62A 3Q3VA 5LC1A 1H66A 4O4LF 4D02A 5IJZA 3WK5A 4U7GA 1U8EA 2A78A 4AZ3B 1U63A 1JFRA 3G2NA 1KI2A 2P9CA 2ZAIA 3HYNA 4OI4A 3EG5A 4GI1A 2ZOSA 4NPCA 1DOZA 1WZIA 4UBMA 4EGQA 3UGJA 3O8NA 1U8YA 4YHHB 3KQHA 1V26A 4FW9A 2C7BA 2XECA 3C8ZA 4I7EA 4IO0A 3WYAA 3BMQB 2G83A 3VHXA 4ZQHA 3X1WA 4WD3A 1IBCA 4YAJA 5SYMA 4BX8A 4CEJB 3BXZA 3CURA 3E84A 2H7XA 2P2LA 3HDYA 3GELA 1RM4A 4MO9A 4EK9A 5JECA 4PSUA 5EWMB 2JVIA 1C7ZA 2GYUA 2PSEA 1N0VC 3JZDA 4K8RB 4Y2SA 5FKJA 4BMCA 2QGNA 1UOOA 3Q6IA 3RS2A 1KZ7B 1PYDA 4L8LA 3INGA 1KYZA 1QR2A 4ZVRA 3ORFA 4WIAA 3SHTA 4WA8A 5KYUB 3I58A 1WB6A 1ETUA 3KZVA 4H4CA 4OHRA 5FHRA 3UICA 3GEMA 3W5CA 2Q8NA 1PQUA 4BNUA 2EP5A 4NG5A 5KZMB 1GZ7A 3KQUA 2WWXA 2FW9A 2WJ3A 1F8GA 2NU7A 3F5SA 5AOVA 5KBYA 1QG4A 4IILA 4CW7A 5IS2A 4C06A 2E21A 2YDXA 1M8KA 3MK31 3R6TA 4LYFA 1EESA 1KK3A 2VPTA 1N78A 5JLAA 1GAQA 4ZRDA 4URWR 3PJEA 5ICGA 3K94A 3R3SA 4CM1A 1PRYA 3WMEA 1MZVA 3WDSA 5JHHB 3O5AA 2HC9A 3UGQA 5I47A 3QKIA 2GAFA 3JVVA 4K6MA 3CUYA 1K7FB 5IF9A 4UTPA 4W5JA 3GFPA 2DWUA 1T9GS 4LJ7A 3IUJA 3NU1A 5JQGA 1OSNA 3W5AA 3EY4A 2EHJA 2KWIA 3G2PA 1AVTA 3MJCA 1XA0A 4QDJA 1FZQA 2JFZA 2ZR0A 5H82A 1A9ZA 1A5ZA 1GNSA 3IVCA 4LWOA 4M36A 1LLFA 2NM0A 2QSUA 2WYWA 3AI7A 4MVJA 5THKA 3TPCA 3K4PA 3AUKA 3WK9A 1YS1X 2VA8A 3HABA 3NHLA 1JG3A 1VPLA 4TZ0A 1A7AA 1W5BA 3RTCA 2XB2A 4OD0A 2CJPA 4R2MA 4BKMA 1XYVA 3TEJA 4PICA 3LPMA 2VDRB 4D80A 1TDJA 3F9RA 4UM8B 5B57C 4MIKA 1UXKA 1GTVA 2YJTD 1IOWA 1J8MF 5BPHA 2RHMA 3BMNA 2VBGA 2QSJA 3QPWA 4ZU3A 1U4SA 3ROGA 2X2FA 3ACCA 3P0JA 2WHYA 1J9EA 1KO8A 3I4LA 3G2JA 5CX4A 4DKXA 5AFSA 1ZA1A 3I42A 4UNNA 4UEKA 4P5DA 3C3YA 3EQ9A 3A06A 1XMQB 1K88A 1AA9A 3U39A 1U2TA 4MHOA 3K9WA 4FGUA 3JASB 4AJ2A 4EWLA 1DBWA 4L5AA 4HLCA 4JLPA 4J0EA 4PZYA 3T7CA 2WPDD 1D0IA 1VLMA 3U7JA 1BROA 4OHWA 3A7DA 5A03A 1LY1A 5JSZA 5BN5B 5B3KA 2O8EB 3LX6A 3B89A 4F8YA 1BS2A 1JJIA 2C9ZA 3FE2A 4WY5A 2FKNA 3ZTYA 4U7DA 2PKXA 1HQDA 2WE8A 1Q15A 3ZW8A 3IJ5A 4AW9A 4V0LA 3K6SB 4ND8A 3FNBA 1J56A 1QS0A 1XCMA 2ODQA 3LK6A 1R3DA 3PIIA 4RXTA 3CC8A 4JYPA 5EMMA 5JANA 2XOXA 1K89A 1Q0UA 1SCIA 2AWOA 1Y7LA 4ZQGA 1RJFA 4D6PA 5IJ0B 2RAFA 2P79A 1ADBA 2HF8A 3BULA 1Y8RA 1Z56C 3H1PA 5HM6A 4OPMA 4YQEA 3IDAA 1VG0B 4BBAA 3KDAA 1OYWA 1D5WA 1WCIA 2E0IA 1Q21A 5JYCA 4IDEA 3S8EA 3HCFA 4ZREA 5EGSA 4ND4A 3RJTA 1AD2A 4EKEA 3CRNA 5B3LA 4M53A 2XTNA 2YH2A 3TLZA 1G4AE 1KAEA 3NPMA 5IYZB 3CEHA 4B46A 1WCYA 3G68A 1N0WA 1UDAA 2VKQA 1WZNA 3IPCA 3QIAA 3BHMA 4PSVA 1DLJA 5AHWA 3W04A 2Q0HA 2SECE 5L6MB 5TV2A 1EVEA 2HLPA 4LRSB 1PNOA 2C0PA 1AUVA 4DIMA 1IIBA 5IT9A 1QFMA 4V0RA 3MW8A 3K0KA 1NQTA 1C8KA 3PKJA 1OLOA 4DUGA 3A6HA 4WEQA 3TJMA 1KY2A 2XUFA 4EFKA 3EDQA 2QVZX 3ICCA 4Z4EA 3G0IA 5DGIA 1MH9A 4FYKA 2WINI 3P4YA 3GJ5A 3AM3A 3RC2A 4XR4A 3HLKA 1P6XA 1KSFX 1DQZA 5EQTA 5EP4A 2AOTB 1VBKA 1D2EA 1Z18A 2R8EA 5J4LA 3N5CA 1NOKA 1GZ5A 2PRZA 2QD4A 4RV5A 1JQ3A 1INLA 4MIOA 2FSUA 3WWCA 1RRPA 1Y4AE 2JGDA 1M1UA 2REXB 1TQDA 2H2WA 3O90A 4X63A 4ZO9A 2D1QA 4KIUA 4OHKA 4TXNA 4ZC8A 5A05A 2V1UA 4GD3Q 2H85A 2H9IA 4NI5A 4N47A 2Y1XA 3BAZA 2FXVA 1J24A 4QM6A 1SD5A 4PCVA 3D31A 2WFAA 3IIIA 5DX8A 5IEBA 1DEKA 2AOUA 2PA3A 4CXMA 3RS8A 2HSJA 4BVFA 2MINA 1DKOA 1E6LA 2ACEA 1Q1QA 2H2FA 2JARA 3OZFA 1X2EA 2PJDA 2H3EA 3NDPA 5JD5A 1FTNA 1YR7A 2ZSBA 1VE9A 1HTTA 1WSBA 1V1RA 4PHFA 2A3NA 3AESA 3K1AB 5JS2A 4DZRA 1P1JA 1M2JA 5AESA 5KOJA 5JALA 3KFVA 1VE6A 2IS4A 2ZZMA 1UDRA 1Z6YA 1V1MB 1ZH6A 2F3QA 1UBSB 2IE0A 1MRZA 1KEEB 5JSQA 3ROQA 3KXKA 1W5FA 4YJ3F 1NRJB 2QJRA 1XCPA 4R9UC 3I5AA 1L5YA 2C5BA 1W2GA 3D5EA 3A1FA 4XUCA 3EXFB 1E32A 3NEPX 3BL8A 3DLAA 2PO7A 2QJWA 2BSQA 2EWMA 1AXGA 2W8BA 4RAOA 1YHZA 4EJ0A 4I9HA 3QHAA 3GWZA 3HU3A 4AECA 4ASUA 4KIWA 4LYGA 4ZIRB 3GFRA 2DCMA 4DDHA 3PHBE 5H1YA 3OTIA 3TLMA 1P5RA 3I8SA 3RRMA 1C9MA 2WZCA 3QK7A 1IONA 1IG3A 1QHIA 1D1SA 1LEHA 5GP1A 2XMZA 3WKAA 2HWXA 4EJ6A 1OWNA 3DFKA 2BGJA 1Z6QA 3LVFO 2MWMA 4JMPA 2O7NA 3USCS 4YRSA 2ODNA 4BGEA 1WHSB 3VR4A 5KNLA 4IDBA 4YRCA 3U7QA 4B3TB 1A5SB 1SB8A 2XQGA 3NBKA 4O4IB 3JD2A 5C9ZA 3TN7A 3GEPA 2QW8A 2VYVA 2G80A 3GVIA 4YRDA 3JQ7A 2JLZA 4BFSA 2D4HA 3CLTC 1NR5A 2B8NA 4AKEA 1XIVA 2WK1A 2C2WA 2XE6A 4ZI7F 5KTSA 2X2OA 1B8UA 2OHJA 1W36C 2CHQA 1JJFA 2BEUB 3U49A 4MIYA 4RTKA 1ZICA 4O8ZA 2Q1SA 2Y6UA 1E5QA 2NU9B 1ZR2A 2ZIUB 3G0GA 4PAMA 2PSSA 5DYIA 2R7LA 1HE5A 4ER5A 3NVAA 2VF2A 4QXQA 4Z86A 2ZJ3A 2E49A 4M0LA 3T3DA 2VNSA 2E6UX 5IMBA 5A4KA 4E3ZA 2YHBA 4LYYA 4HDKA 4ZHSA 5C18A 2O8CA 4MWOA 1YNOA 4RSRA 3L0IB 4Y9TA 5TXGA 5KU7A 3X1YA 3MG9A 3H2SA 1XHFA 3U4MA 1NF8A 1ULSA