3AIOA

R267k mutant of a hsl-like carboxylesterase from sulfolobus tokodaii
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
283
structure length
283
Chain Sequence
ASVEEIRSLFKQFSSLTPREEVGKIEDITIPGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDSAGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTREHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVKFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVFYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobustokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
molecule keywords 303aa long hypothetical esterase
total genus 100
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2010-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aioA00
2R11A 2XUOA 5FXMA 4K2AA 1E66A 4BRZA 4DMCA 2JBWA 4FFVA 5LZ4A 1CVLA 4FHZA 2JGMA 3I28A 4AZ3A 2HIHA 3C45A 1R50A 2OGZA 4WFIA 1HBJA 3OM8A 4EBBA 5ALSA 3H1BA 4AB1A 1DQYA 2QUBA 4X92A 2PVSA 4GI1A 1J07A 3NUZA 1B41A 4FTWA 1EVQA 1HPLA 5I7UA 2OCGA 5ESRA 2RHTA 1J06A 5JALA 3VVLA 1ZOIA 5AKKA 2XMSA 1GPLA 1TCAA 3WA6A 3Q0TA 3UUEA 5KWIA 4LXGA 2IX9A 5ALKA 1IUNA 2CEKA 1U65A 2VA9A 4U2EA 2XQKA 3V48A 4FLMA 3PDCA 1QE3A 2XB6A 3WQHA 4MEAA 3DLTA 2QRUA 3BIWA 1XQVA 5LZ5A 5KBYA 5JZ9A 4MYDA 4NS4A 1EH5A 4X93A 4Y2SA 4L72A 4HVTA 3PFCA 4KE8A 4WCVA 2HA5A 2G5PA 3OOSA 4I3FA 4EHBA 5EIEA 1ZI8A 1XFDA 2PM8A 2CBGA 1ZIXA 1DWQA 4OU4A 1UZAA 3V1MA 5DWDA 2ACKA 4UHHA 4UHBA 4FBLA 4BAZA 2WUFA 1OXMA 2B20A 3VJLA 2HU5A 4Q1VA 1ETHA 5AI9A 4G1FA 5ALXA 5KWJA 2GYUA 1YB6A 3RKSA 2LIPA 2VAVA 1UK6A 2QVBA 4Y9SA 3H2IA 4J0JA 1FFCA 2WHQA 1E3QA 3DEAA 6YASA 1G42A 3FCXA 1RWQA 5D3ZA 4UFPA 3T52A 1ZICA 3M83A 4KEAA 3R3WA 1YS1X 4XVCA 1G4HA 3A6ZA 5FP0A 5HQ3A 5LIPA 2HDWA 5CTAA 1ACJA 1QONA 4BB0A 1K63A 1CR6A 1EX9A 2I03A 3N2ZB 3WL8A 5AIAA 4G9EA 3IDAA 4JYPA 1QIKA 4EZIA 4BRSA 5A7HA 2AJ8A 1CUXA 4ZI5A 3WJ2A 2VSQA 2BAGA 4GEGA 3LS2A 5AK3A 1U8EA 5AKZA 3M82A 1YB7A 2OXEA 5KREA 1SOMA 1YA4A 5DTJA 5HKBA 3QVMA 3F97A 4CCYB 5CXUA 2XMZA 3QM1A 1F6WA 2B61A 1U2EA 1ODTC 3BJMA 2VJBA 1CQWA 1BE0A 3V9AA 4QWWA 4J0KA 3IUNA 3VKFA 2HA7A 2WM2A 4UPDA 1GPNA 4FNGA 3G0GA 1CIJA 2OGTA 2ZYRA 3AZOA 2VF2A 5CMLA 3I2HA 5CT6A 3STWA 3VXKA 1QIGA 5A71A 2BGNA 4HRXA 1BN6A 4Y2QA 5ALNA 5IKXA 3HABA 4DMFA 3GZJA 4B6GA 1GQSA 3K2IA 2WHRA 3CCCA 1CLEA 4W1RA 1ZIYA 2ONCA 1CUIA 1YS2X 4QDTA 2K2QB 4OYYA 3QMMA 2OAEA 2CMFA 4BDTA 3ESDA 5EI5A 1EHYA 2XI4A 4B83A 3B12A 1XZIA 1L7RA 1O6FA 4AMYA 4B82A 4KAFA 1PFQA 1ZI9A 3ZLUA 5AM5A 1UK7A 3GUUA 5JAHA 3DL7A 4MYSA 2JGJA 2PSJA 1XZKA 2Y1KA 3O4JA 2V9ZA 3OPMA 5AM3A 2XDWA 1ODSA 2OGSA 3C8HA 5D3KA 5IVHA 4B85A 1Z68A 4FLFA 4K6KA 1R9NA 5CT9A 4QE3A 4LXIA 3QITA 1F0PA 1UT6A 3I1IA 2HA3A 5FRDA 4DSZA 4ZGBA 4Q3LA 4WY5A 3GROA 3WYNA 2YASA 4OB8A 3F98A 5K3DA 2XLBA 4N5HX 5LZ8A 5YASA 1FFEA 1E8DA 4QEKA 4JEIA 2E3JA 3E3AA 4FNMA 2WSLA 2Z8XA 1QJ4A 2R8BA 5JIBA 2C0PA 3TEJA 3B5EA 4ARAA 4J0HA 4IHAA 3G9UA 1TAHA 1BCRA 2GZRA 3G9XA 1MX9A 4X00A 1XZHA 2OCIA 1I6WA 3H2JA 1N1MA 1MX1A 4BZWA 4QZVA 4EY4A 2HFJA 2O2HA 3WKAA 3D5EA 4H0CA 4ZV9A 3H2GA 4HAIA 3TRDA 1ZGBA 3FSGD 4CI9A 2FJPA 2FUKA 2VJDA 4X7BA 5A2GA 4QWMA 4X91A 4CCYA 1LZKA 2BJHA 3DYVA 3MUOA 2PUJA 1LPMA 2PU5A 3IUJA 4YX9A 2XUIA 5A7FA 4DNOA 4CIAA 2AJDA 1WB5A 2CUTA 2DQYA 4CIBA 3H2KA 2OQVA 1EB9A 3WK6A 2W22A 4DIUA 2XQGA 3G02A 4KJXA 1VXRA 4B84A 2ES4A 4PQEA 1CUGA 2OAGA 1D07A 3ILSA 2VT7A 3STVA 4MXDA 5IH7A 4CG3A 1NU8A 1E8NA 1EVEA 2PUHA 3GBSA 1MX5A 1CUBA 1UXOA 2HA0A 3R3ZA 1K6EA 1A8QA 1LPOA 3WMRA 5D7BA 4E14A 2XLCA 3F8SA 2WIKA 1JKMA 2J4FA 3I6YA 3S8YA 1ACLA 4ETWA 3C70A 4KAAA 4BDSA 5E4YA 3G9TA 1G5FA 2XQFA 5ALFA 2BCEA 2H7XA 2ZSIA 4OCZA 1YAJA 3WIOA 1K4YA 1MPXA 1W4LA 3IA2A 4JNCA 2WUGA 5T4BA 4A16A 4L0CA 4Q34A 1W52X 2QS9A 1LBTA 4P9NA 5ALLA 3WK7A 1BN7A 4B0OA 1ZD4A 3OTQA 3HXKA 1B6GA 2ZJFA 3BJRA 1WHTA 2PSEA 3F67A 3I2KA 4BBZA 4Q05A 1XROA 1SCKA 3B3QA 1JMYA 5ALDA 4DGQA 2JGKA 5LKRA 3QMWA 1A7UA 3WL7A 3E0XA 4LKOA 5CH5A 4BP9A 5ALPA 1H2YA 1UKAA 5BWCA 4LYDA 2WIFA 1QFSA 4A5SA 1XQWA 3DOIA 5A7GA 2H9YA 4FWBA 4PSUA 2RHWA 1LZLA 1ISPA 4Q3OA 5EIAA 3LIPA 4E46A 3WWDA 3R40A 2XT0A 5SYNA 4BCBA 4QDUA 3STYA 3R3XA 2VQ6A 3WA7A 4AO7A 2FX5A 4GHWA 2QM0A 4X6XA 1CUCA 2XUFA 3AIOA 4XJVA 4C89A 1YAHA 1VKHA 4KRYA 2Q0XA 1O6GA 3WKCA 5ALEA 3DJYA 1C7JA 4RE6A 4BAUA 2YXPX 2BFNA 1KEZA 5AM1A 1DX4A 1SFRA 3JWEA 2WIDA 4G8DA 5CT5A 4WFJA 1ZJ5A 2H1IA 2CJPA 3FYTA 5EHNA 2V97A 1CUSA 2O2IA 1XRLA 3WL6A 2XQIA 3OC0A 1E89A 5JATA 3PICA 2RAUA 1EDDA 3ESAA 4Y7DA 1Q0RA 1R3DA 5DJ5A 1AURA 3DKRA 2WJ6A 5H3HA 1JJIA 3ED1A 1TQHA 4C87A 3AZQA 1DINA 3G0DA 1K5PA 1XZBA 2WUDA 1UOOA 5HKAA 3P2MA 3KSRA 3WIBA 2Z5GA 1XZJA 1IUOA 2HM7A 2WFLB 3TGLA 5EHQA 2XUAA 3RK4A 2OQIA 2XMQA 4MEBA 3R0VA 1JJFA 5E4TA 3GELA 5FDFA 1XZMA 1AUOA 5LZ9A 4G9GA 1LPBB 2NW6A 2XMRA 5HCUA 3WWEA 5AKGA 4Y2XA 4X95A 2QZPA 4C01A 4HXFB 2DHEA 1CFJA 1PV1A 1SC9A 2HRRA 3PF9A 1C4XA 3STUA 5CRIA 5JAOA 2ZSHA 4QDXA 3E4DA 4LHEA 4F60A 4GWLA 3G0CA 2JGLA 1R1DA 2PPLA 2XUHA 2OPHA 3PUIA 1OILA 5C8ZA 4ARBA 1UK8A 4Y2JA 2HHAA 4ROTA 3DD5A 4WFKA 3I2IA 5LZ2A 1M33A 5CH3A 4G4GA 5DYYA 1WHSA 1YA8A 5CW2A 1U4NA 3IVMA 2WQZA 1YR2A 1UFOA 2WG0A 5EIHA 1W75A 4IH1A 5AI4A 1QLWA 1AZWA 5DTIA 4UBKA 4YPVA 5LZ7A 1DT3A 4Z49A 4W63A 2GBIA 1GKLA 3SX4A 5ALVA 2VATA 1ORVA 1HDEA 5SYMA 1H22A 1VXOA 3G7NA 4OPMA 3WZLA 2PL5A 4YASA 1LLFA 3AFIA 2XMGA 2ACEA 4MQLA 4KR0A 3IIIA 3WWOA 4KAJA 1HL7A 3HJUA 5BWBA 4H7JA 4WDRA 5HQ3B 3O9MA 4J03A 1P0IA 2RI6A 3FLEA 1QO9A 4W9RA 2G5TA 4MWSA 1SCIA 1QTIA 3V1LA 4K5QA 1WB4A 3ZLTA 1P0MA 1MAAA 4Q3KA 4B0PA 1CQZA 5IVDA 2VJAA 5ALGA 4C88A 3GFFA 3JYHA 5F4ZA 4U2GA 1DU4A 3EQ7A 3VISA 3WWCA 2QJWA 2RGUA 1H2ZA 5AKEA 1VLQA 1XZAA 3STTA 4UFNA 1R88A 2PSDA 3KDAA 5K3FB 5AKYA 4QLAA 4DYHA 3WK8A 4HS9A 5LKAA 3HSSA 4J0CA 1AMNA 5D6OA 4BE4A 4BZZA 3WKBA 5AO9A 1R4ZA 4L3WA 1QIHA 1KU6A 4PV7A 3VDXA 1A8UA 1P0QA 1ORWA 4N5IX 1XQXA 4WDQA 3V1KA 3CXUA 1VE6A 4OB7A 4G4IA 5AI0A 4K6GA 1SCQA 3MUNA 2VEOA 5AKIA 5HK8A 4DNQA 2WTNA 1A8SA 2O7VA 2X5XA 2WIJA 5HF6A 1QO7A 2ZJ7A 1QIMA 5T4EA 4UUQA 3ZV7A 4ZREA 4ZXFA 3WLAA 2XUKA 2WHPA 4X6UA 5FLKA 5AJHA 3NGMA 3D2BA 3F96A 4JH0A 1EB8A 1J2EA 4PO3X 1WB6A 1J1IA 2H7CA 4F0JA 1XRNA 2C7BA 5DYWA 1QOZA 2VAXA 2WFMA 4EUSA 5BOVA 1IMJA 4AN1A 1AQLA 1CUHA 4B9EA 3ZPXA 1VE7A 5HFNA 2WG2A 3AZPA 4KE6A 4ZV7A 5A6VA 3WZMA 1EDBA 2WG1A 4GLBA 1GT6A 4OD0A 5ISMA 4A23A 1MNQA 3FCYA 1KU0A 4EB0A 5C81A 4FLEA 5LP1A 1QIJA 2WU4A 5CBKA 1YSCA 4OU5A 3G0IA 7YASA 5JYCA 3FVTA 5K3CA 1IUPA 2JGEA 1FFBA 3W9BA 3V1NA 4X85A 1DWOA 1Q0ZA 2WIGA 2WKWA 3G9ZA 1GGVA 1BS9A 4HXEB 4HTAA 3N0TA 5AKLA 1AKNA 5ALMA 3MGAA 1BCSA 5ALWA 4AMZA 2ZYSA 1RP1A 3SK0A 4ITVA 3STXA 1FSSA 4DMKA 2JGFA 4DNFA 3CN9A 4XX1A 5DNUA 1QIEA 5ALOA 2J4CA 2HRQA 3DS8A 4FMPA 2HU8A 3D7RA 4F21A 4Y2RA 5EHZA 4KE7A 3K9BA 2BUBA 4INZA 5AHXA 1VA4A 1XRMA 2C58A 1TCCA 4KRXA 5CH8A 4U2FA 3FVRA 3FWHA 4KACA 4H7FA 3DNMA 1CUWA 4QLOA 4BCCA 5AICA 1Y37A 3FAKA 3W05A 3W9UA 1AX9A 4X3CA 5HF9A 1MNAA 3S2ZA 4H18A 4YK7A 2DQZA 3LCRA 5J3JA 1L7QA 3BDIA 1TRHA 5E2IA 5HF8A 3KXPA 4CCWA 4HXGA 4UBMA 2VJCA 1VZ2A 2Z8ZA 4FBMA 2I3DA 1S8OA 1EI9A 3FYUB 2RIPA 1YASA 2XUGA 3X3HA 5ALIA 3RLIA 4UHFA 4C6HA 2V96A 1CUUA 5C8VA 3C5VA 3DL4A 2IITA 3WWPA 1WPXA 5AKJA 5AM0A 3NOXA 4Y2VA 3H04A 4X90A 1E8MA 1WM1A 4B9AA 2O7RA 3MVEA 1ODCA 1GPKA 3L1IA 5DNWA 1XZCA 2CKMA 3O0DA 4IH4A 3HEAA 4KYVA 4RPCA 1EK2A 4TGLA 1XKLA 3FSGA 2PSHA 5C8XA 2FJ0A 5AI5A 4MQMA 3DDUA 3DCNA 2WFZA 3C87A 3R41A 4UBNA 4AN0A 2WILA 1XZGA 3H2HA 5AKXA 1UKBA 3C6YA 3BE8A 4AXBA 2QOEA 1EXWA 1G66A 3BDVA 3AIKA 1UKCA 1AGYA 3I2FA 5AK6A 1W1IA 1XLWA 5JZBA 1X2EA 3I6ZA 4BATA 5AK4A 3VJKA 3IULA 5EFZA 3FYUC 4IO0A 4U2DA 2CB9A 5E4JA 4TVKA 3C43A 1WPRA 2G4LA 2YYSA 1BRTA 1C7IA 1THGA 5JD5A 2C5FA 1WCYA 3HC7A 1CUEA 3ZI7A 2ZYHA 2BKLA 2VTVA 4J3JA 3T4UA 5HK9A 3O9VA 3TJMA 1CRLA 1JMKC 2Z3ZA 3QZUA 4UBLA 4AX4A 1CPYA 1TK3A 3BWXA 5JD4A 2PSFA 1BEZA 4BVLA 3VJMA 4UFOA 2B9VA 2IIVA 4H7EA 3IUQA 3R3VA 4W1SA 4F5ZA 1XRRA 4EY8A 1LPAB 3BF7A 1EINA 1CUJA 4C4XA 5JANA 4FDMA 3EQ9A 3L1HA 2WLSA 5AOBA 4X94A 3HZOA 3PUHA 1JFRA 4FFWA 3LIIA 3I2GA 4RGYA 1TIBA 1WOMA 1CUVA 2X76A 5FV4A 5IVIA 5AH0A 3C5WP 4P08A 2WJ4A 4EY6A 4G8BA 1X2BA 4TPKA 2DSNA 5AKHA 2DCMA 3FYUA 4Y2PA 4XWGA 2GBGA 4FOLA 2C5GA 2DR0A 3KWJA 3U0VA 3WKEA 4J0GA 4AZ0A 2JGIA 4X71A 2BGRA 4H7IA 3VVMA 1BROA 1DX6A 3QPDA 2Z3WA 3EBLA 4V2IA 4KE9A 3BXPA 2Y2UA 4WY8A 3ICWA 5EGNA 2GYWA 3D59A 5ALTA 5ALHA 5HFAA 2QMQA 2OCLA 4XIIA 2P8SA 4GBGA 2JEZA 5CURA 2WU3A 2Y6VA 5T4FA 2QJRA 4U2BA 4RE5A 3RM3A 3OG9A 3LP5A 3DOHA 5K3EA 1DQZA 3A2NA 1T2NA 4C4ZA 2I3ZA 5A62A 5AIBA 4FKBA 2Y2VA 3ANSA 3HI4A 2XUDA 5ALRA 5C7YA 2DFPA 4H7DA 2QUAA 3D4LA 1T4MA 1F0NA 2WUEA 3C6XA 1EDEA 2PKYX 4D9JA 2XMDA 1FJ2A 2J3DA 1JI3A 2XUQA 2VT6A 3QPAA 2QR5A 1CUDA 4EY5A 3D2CA 5IVKA 1H2XA 1R9MA 4E15A 1LBSA 3YASA 2QXTA 5I9IA 3H18A 1QIIA 5JASA 3HRHA 5T4HA 1LPNA 1P0PA 5ALJA 3W04A 3QYJA 4M0FA 4M0MA 1FFDA 1E5TA 5JD6A 1UOQA 1IVYA 3HYSA 4GDMA 4X6YA 1Y7IA 4N8SA 3R3UA 4JUIA 1QIFA 4UHDA 4J0DA 3AINA 1W76A 3BL8A 4NVRA 3H1AA 3LLCA 5FUMA 2OCKA 3HLKA 1RYYA 1IZ7A 1HKHA 4GXNA 4H35A 5CXXA 5LLSA 1DT5A 2G63A 4L9AA 1MO2A 3F9CA 2Y6UA 3HACA 3WK5A 2XUPA 4N8EA 1XZEA 4BVJA 4BC1A 2JIDA 3E1GA 3WKDA 2JF0A 3I6MA 2ZJ6A 2B4KA 3ESCA 1W6RA 2EDAA 4UBJA 3EF3A 1CV2A 1QTRA 2HL6A 1JU4A 4WJLA 1N5MA 2QTBA 3H0CA 3D2AA 4AQDA 3IUMA 1MT3A 4G4JA 5LYYA 2OLEA 5JADA 4H7HA 3PF8A 1UOPA 1UK9A 4LIPD 3A70A 1TKRA 1ZD3A 4GECA 1EA5A 2J3QA 3EIOA 3C8DA 4J7AA 1LGYA 1FFAA 2DHCA 4B80A 2GBFA 1XZFA 1LPSA 4HZGA 4B81A 2BUAA 1LNSA 1XZLA 3FBWA 2HA4A 1H23A 3O4IA 2ECFA 1Q83A 2ORYA 2GZSA 5JAUA 3WYDA 1ZGCA 3AILA 3M3DA 2PU7A 3ICVA 1ZD5A 1NU6A 1JT2A 2OG1A 3KOOA 4OB6A 5K3FA 4IQ4A 3IURA 3O95A 4UHEA 3FLAA 4DMHA 3I1YA 4DSAA 2CZQA 1A88A 4CG1A 3WK4A 5FOQA 5BV7A 1ZI6A 1DTEA 4PW0A 1MTZA 1MN6A 4I19A 3SWWA 2HA6A 1HLGA 4OYLA 3QH4A 1N5RA 3DYIA 1GXSA 1UWCA 4UHCA 1TCBA 3I2JA 1IZ8A 4ZWNA 3RARA 5JARA 2UZ0A 3DQZA 3O4HA 5DYTA 2HADA 4P92A 4LYEA 5FKJA 1CUZA 4G5XA 4RNCA 2HA2A 1CEXA 3JW8A 5ALZA 3G8YA 4E11A 5DLPA 1JU3A 4OSEA 4NMWA 5AM4A 3FNBA 4PSDA 4PNZA 4BYMA 4MJ3A 2BUCA 3R3YA 1X70A 5AI6A 4DNPA 5AK5A 1BU8A 1QIDA 2XMBA 4AO6A 3WK9A 4AO8A 5FPPA 3IB3A 5EHXA 3KD2A 3WL5A 1NX9A 5AI8A 1XRQA 1VJ5A 1Y7HA 2DHDA 5AOCA 3IBTA 2PX6A 2D5LA 2YH2A 4QA9A 4N8DA 4BC0A 5HZGA 1MU0A 1QZ3A 2XQJA 3PE6A 4BTVA 1QGED 1QFMA 2XMCA 3U1TA 2ZVDA 1THTA 2D0DA 1YCDA 4X97A 3ANTA 3BIXA 5CT4A 2AXEA 1ZD2P 5AM2A 3ZWQA 2QT9A 4PF1A 2WTMA 5AP9A 4IH9A 2X8BA 2HFKA 2JEYA 1XLUA 3W2TA 3EQ8A 4BVKA 4U2CA 3KWFA 4BCDA 2V98A 1L7AA 4Y2TA 1XLVA 2PBLA 3G0BA 3PI6A 4QDOA 3W06A 1K8QA 2XUJA 1LPPA 3A2LA 3WJ1A 3UMJA 1XZDA 4O08A 4W1QA 1VA5A 3AUKA 5HF5A 5FPQA 5JZSA 2C4HA 2AJBA 3O4GA 2ZYIA 4G8CA 4H77A 3CCBA 1VZ3A 1GZ7A 5K5EA 5K3BA 1DWPA 4ZRDA 1ZJ4A 1HQDA 4P93A 3D0KA 1CUYA 3D3NA 2HU7A 2XE4A 4DM7A 4DLNA 4J0IA 3ZLVA 4QNNA 4K6HA 3OURA 2EEPA 4BTLA 3C6ZA 2GBCA 1N8SA 3QBJA 3L1JA 4BP8A 4Y2YA 3FLBA 2GYVA 3AJAA 2EDCA 3SC2A 2WJ3A 1GKKA 4Q82A 3PFBA 4GW3A 4NZZA 2C0QA 1GQRA 3K6KA 1CUFA 5ALQA 1PJAA 3ESBA 5I8PA 1CUAA 1H2WA 4EA6A 4S0XA 4UBOA 4W1PA 3QPCA 1AC5A 3CN7A 5AOAA 4H7KA 1XRPA 2H7YA 5ALYA 2W6CX 4Y2UA 5K3AA 3H17A 1XQYA 1JJBA 5JAPA 5CT8A 2WHPB 4UBIA 2AJLI 3BF8A 3UUFA 1USWA 4I4CA 3M81A 4BAGA 4EY7A 2WFLA 3QMVA 4JYMA 2AJCA 2RONA 3H19A 5ALUA 1XKTA 3NWOA 3WI7A 3FOBA 3GA7A 4PSCA 2QXUA 4DTCA 3AIMA 1BEEA 3A2MA 2I78A 4LXHA 4M0EA 2QKYA 1OCEA 1EK1A 2ROQA 3DKKA 4MWTA 5DNVA 1MAHA 4CFSA 1Q84A 3C6BA 1VOTA 2O2GA 4BE9A 1MJ5A 4OUKX 4HRYA 4QDZA 4C4YA 4CG2A 4B7ZA 3Q8WA 1F8UA
chains in the Genus database with same CATH superfamily
1Z4PX 1ZM4A 3BSSA 4DLSA 1RC1A 2R1VA 1CJSA 2WD7B 2PTGA 1HZZC 1QCYA 2YXBA 1WXHA 3LG2A 1TQ4A 3M0EA 1E7SA 1FW8A 4JC0A 3RVPA 4K6OA 2I33A 1PGQA 3MLAA 4NS1A 3HBMA 2VPIA 5AVSA 1N3BA 3HA7A 5DISB 1RS0A 3RVBA 4KGZA 5LZ4A 2ZW9A 1UAGA 2HXGA 3DBLA 4GLLA 3R24A 1JALA 4CM8B 3HJTA 1Z47A 1UBOS 3W78A 2EWVA 3O73A 1VL5A 4EVQA 3F4KA 1ZK4A 2HIHA 3VYRB 1C7RA 5J2TA 1W0KD 3AUTA 3GDWA 5KYKA 2ZWAA 1FSGA 1P45A 2C4TA 5DFAA 3O8NA 3OWOA 4WFIA 1RKUA 1U04A 2BSAA 5UKDA 4ZZ2A 2FSSA 1WZUA 1TM3E 2AEFA 3CG0A 3E7XA 3KQLA 1HBJA 1GO2A 2QEQA 1DOHA 3HBNA 3UM9A 5ALSA 1RQGA 5EA2A 4MRSA 1G21B 4QQ8A 1L7DA 2C3UA 4X92A 3R6WA 2E1PA 1YACA 4RBNA 4ACBA 2XADA 1A69A 2I4TA 4OMUA 1KOJA 3RAPR 2XRYA 1J07A 3UUWA 1LDYA 2AYXA 4KR9A 3EAQA 5DGIA 3JQPA 1N8NA 4PY2A 3QF4B 1KE2A 4IDDA 1ECCA 2A5JA 1OFUX 3GJZA 3JU3A 4TKVB 3UNXA 3WGZA 4G0PA 2W8ZA 4LZJA 2IOQA 2ZSEA 4EFDA 3S4YA 3RO7A 5H9WA 1E9SA 3LA8A 1VHJA 3IAEA 2VN8A 3A4NA 2ZIXA 3VPCA 2GZMA 2P62A 2OCGA 2BM1A 5D86A 1T9CA 2FPPA 2X1LA 1IWBB 3UT0A 3CONA 1VG0B 3BL6A 2RHTA 1E7QA 1ZMOA 2J30A 3TRJA 3H87A 3ZEAA 4CLHA 2ZCJA 4LZLA 3VVLA 4KXNA 3RC8A 5HM8A 2XMSA 3E15A 3JWPA 4W5NA 4NBVA 3Q0TA 2B2NA 4ESHA 1JSZA 4LXGA 3WIVA 1PFUA 3MT9A 3DEYX 1RM0A 3NPMA 5CNKA 5GJVC 1TCUA 3ZI0A 5ALKA 2B8EA 3D8NA 1IUNA 2K7ZA 3I6QA 4ZO4A 3KB1A 4XOUA 5EE9A 1RHRA 1R6TA 1QMPA 4U2EA 1XD2B 1Z17A 1VKJA 3KPUA 3LO8A 4MCJA 1AGNA 1HTBA 3IT2A 4BX0A 1UWVA 3AP3A 2RH4A 3HP1A 1KEPA 4DV4B 3IMCA 3S81A 3S8MA 3WQHA 2WBLC 4AC9A 5FO0A 1Y6RA 2QRUA 1NSTA 1F5NA 1JIVA 2IT1A 3AHEA 4FS8A 4YJ3F 4ES6A 2B0CA 1XQVA 4JEUA 4MPPA 2F55A 4R81A 5DCUA 3I01A 3KZXA 1I5OA 1N8KA 2A9JA 3RK0A 4YV0A 3VNVA 3DAYA 3VR6H 1ZM2A 4NBUA 2K5UA 2QU8A 3CH6A 2XE7A 5HBGA 4HWRA 1EDZA 3DFZA 3NNNA 2DVMA 1K2WA 4JJGA 3KB2A 3Q3CA 2ZI5A 1ZH4A 1QR6A 3IPRA 4IKOA 4Z0TA 4Z2YA 4S1OA 3WY9A 4BNVA 3BCSA 4JP3A 4H2DA 4WCVA 3VV3A 5IDVA 3K8YA 1Z0IA 4PE5B 1A50B 4BIIA 3KT3A 1TL7C 1TJPB 3CF6R 3KKEA 1N6IA 5A1JA 2ZIGA 3EZYA 5EJFA 2ODBA 4G41A 3TH5A 1TKAA 3OEYA 2YZ7A 4WLVA 4D4MA 1ZIXA 3PR3A 4LZPA 1DWQA 1O6ZA 4DNXA 4OU4A 4DC9A 4NTZA 4D97A 5G53C 4JT8A 3HR7A 5BVGB 3NHZA 4IMRA 3UHFA 5DWDA 3UO8B 4EI7A 4QJ3A 2JIMA 1JDPA 3N76A 4F5EA 3PJRA 4NRDA 3A06A 1FBTA 1U9IC 1SRQA 2A7XA 4BAZA 2C78A 3VPBA 2H11A 4MUKA 2H29A 3PDIB 2QN7A 2YRWA 5EY5B 1J39A 1ETHA 3JD1A 4G1FA 1ENYA 1O95A 3RTBA 1OX6A 1QZXA 2W6ID 4RZHA 1HOTA 4YJ2F 3JYOA 2VAPA 4MK4A 3VHXA 3ZY2A 2GF9A 4GKVA 2VAVA 5L45A 1USUA 2D5CA 3DLHA 2KBEA 2RH5A 2G9RA 1IMOA 1J70A 1N4DA 2FZEA 2YY7A 5H1YA 4EB8A 4J0JA 4F5DA 3IMGA 2QNRA 2WHQA 1J1ZA 3DBRB 1E3QA 1UCFA 4HMPA 3RWMB 1KJJA 1ZN7A 3DT9A 3BOSA 2ID8A 3DEAA 4JGIA 5CYGA 2V1UA 5L8VA 2FEPA 3KRTA 2B4AA 1E2FA 1VI2A 1E1DA 3B78A 3FCXA 4IVRA 4O1IA 3K4HA 5DI9A 4UFPA 4DR5B 2EX1A 3T1NA 2C3YA 2J6IA 1NW6A 4MVWA 3AL3A 4ALJA 2PZBA 3C3MA 5JDIC 4NXNB 4QTTB 1AOXA 2VDPB 2AD1A 3BIJA 1KPGA 1YS1X 4K9OA 5D1NA 3EFBA 4XVCA 1G4HA 3A6ZA 3OSZA 4YNBA 5FP0A 2HDWA 3MJFA 1XWFA 1NV9A 5DSXA 5EIWA 1KEWA 3JQRA 5CTAA 2VDJA 4OI4A 1T3SA 4BB0A 3JSAA 5DHFA 1DOAA 4Q39A 4Q4CA 1MAVA 3TD9A 3N2ZB 3CX7A 2IZ1A 4IUYA 1GZ3A 2DG2A 4P5EA 4IIJB 4MIKA 4QATA 4EWLA 1XDSA 3K9NA 2A33A 3PT5A 4EG5A 3CUTA 2WUWE 4C22A 2J0UA 4YHHB 1QYRA 2OC9A 4A8JB 1Y1RA 4DR3B 5AK3A 1QQ6A 3PX7A 5CAEB 3D8BA 4MV0A 1OROA 2YWJA 3KZCA 2YN4A 3B6MA 3AV3A 2FEXA 2JG3A 3VQTA 3M82A 1SZPA 5LYJB 1M8KA 1MEOA 2X0IA 3DFKA 4RQBA 5A6SA 4Y6PA 2OXEA 3OCUA 3P9ZA 1L0BA 2FWRA 4YRAA 5KREA 1I1HA 1GITA 1BHJA 1M83A 2E5LB 2HNBA 1QRDA 3DTVB 4PZAA 5FR1A 4BUCA 2J59A 3QOXA 5JNSA 4N6OA 5ARBA 3HY6A 1NVEA 1ZMRA 1TVEA 2I6SA 5AW8A 1KFEB 3FCAA 2R751 3BS4A 3IV9A 2D06A 1F6WA 4B1FA 1PQWA 2NZ2A 1U2DC 3DWGA 4I9NA 4L3VA 1G2IA 3I5YA 3A9SA 1BMQA 5H70A 1OH8A 1KAMA 1WUJS 3ND9A 4RETA 2PT7A 5E6UB 1KWKA 3GRRA 4MA4A 3QI7A 2OV1A 3L02A 2I4OA 4DILA 4U7JA 3CW8X 5CA0B 2J6BA 1OBCA 4EI8A 3TG2A 2JAXA 2PL3A 4EG0A 2FOIA 4BQSA 4M21A 5C4MA 4CU2A 3K71B 3OFVA 3K0FA 3PPYA 3K30A 1R12A 3NI2A 1SEVA 3QU9A 4PLWA 3HEMA 4QWWA 5FFFA 3VU9B 1R0RE 3A1DA 3VMFA 3TNJA 2WM2A 1L5ZA 4L8LA 4QHTA 1NVXQ 3PVCA 3DMGA 2R66A 1R8XA 3U56A 4JC4A 4K9MA 3CU5A 4A6DA 5CLQA 1JL3A 2VF2A 4LK2A 1M0WA 3BHJA 4Y2GA 5CT6A 5DEIA 5IT4A 4BVFA 3RIHA 1CTQA 1X7GA 5A71A 1DAKA 2BGNA 4R2HA 4TOIA 3T7EA 4A8JC 2YX1A 3C8UA 4HRXA 4FEGA 1PE0A 2EZ8A 1V16B 4OF4A 3ZY3A 3OZAA 1U5BA 5ALNA 1QVAA 4BKQA 4XFDA 3MERA 4RCVA 2I9KA 4BNFA 1EQ2A 3RS0A 4A82A 1PVVA 4JT9A 4OL0A 4RMNA 3C3EA 3JTEA 3UW3A 1FE8A 3TUIC 1EUCA 3BQNB 1GA6A 1J5XA 4U1RA 5B7PA 2K4MA 3W5BA 4PQGA 4LX0A 2ZZNA 5LQRA 1P7YA 2X5NA 5TARA 1Z07A 4N6GA 3QF7A 3H5AA 2Y9MB 5TGTA 1E5XA 4QDTA 1XZPA 2V7WA 3MCWA 1JECA 4F96A 3BGDA 3PYLA 4MCAA 1Q11A 3M5WA 4OYYA 4KR6A 4QBKA 3IAUA 1TM7E 1ZN8A 2C5BA 2CMFA 1Q7GA 1SCBA 3MT8A 1OFGA 3PIRA 3LPNA 1YIAA 3P9CA 5DVZA 1ADYA 1CS4C 3OHPA 2YICA 2WKRA 1RXYA 4UEQA 2PXAA 5BN5B 4D6YA 3TE6A 3U4HA 4RXMA 4WV3A 2H06A 2A5GA 4QUIA 3EC7A 1JIJA 1XZIA 5TXGA 1QVRA 2PX8A 3OQIA 1VCIA 1ZI9A 4FN5A 4CQJA 1TJ4A 1HNNA 5GP1A 4E1AA 3MTQA 4X1YA 1V95A 2AOVA 2C84A 4XSVA 3E9ZA 3GUUA 4BNXA 2Z8YM 3PG5A 2RB4A 2G8NA 4I14A 3UHPA 3LLMA 3RVJA 4LYJA 3H5RA 5JAHA 3DDHA 2OHIA 2AWNA 2QYTA 3BMCB 3CNQS 3D6TB 1YI0A 4IWNA 3IHWA 4Q1EA 3RC2A 4BO9A 2Q5EA 1FFXA 1DCMA 2X9NA 2FUEA 4K86A 4U0KA 4GZ6A 3JQGB 3T54A 3ILHA 4NONA 4AY5A 2N0SA 4FEEA 3OPMA 1IOVA 3WTBA 2IP1A 1PHPA 2JFQA 4B35A 1CZHA 1KZ6A 1JKIA 3S2IA 1UBHS 3NT2A 1N78A 2ASVA 4AMGA 4AZ0B 1OTYA 3MBKA 4O4IF 1SUIA 1Z68A 4HTFA 4PO9A 3L0DA 1CZOA 4FLFA 3UPDA 2E21A 3TX6A 5CT9A 1AS0A 3O21A 4LXIA 5C7LO 1Q1EA 3BERA 1XSEA 5EXPA 1RHKA 3I1IA 1H66A 4GM1A 2XPCA 5BN3B 2QRMA 4JBWA 1OLOA 1M7BA 3R6GA 1A4IA 3ICPA 1MA3A 2AZ4A 3JALA 4R68A 1KC1A 4NICA 2QW0X 1ECBA 3AJDA 1A4UA 2AG5A 2B5VA 3WYNA 1E94E 4FKZA 3WJAA 6LDHA 5JZVA 2YS7A 4URWR 1SZJG 5BN1A 1BX1A 1LC0A 4OB8A 3F9IA 3GEBA 3V6LA 1VKRA 3EOAI 2OKCA 2ZAIA 1YC2A 4C0JA 3QEOA 1M8PA 1Y89A 5KMGB 4JKOA 4Z4FA 4QEKA 3OZGA 2D1RA 3S1AB 3Q8XB 2NO5A 2QU7A 2YMPA 4GSLA 1GZDA 5AOVA 3T5DA 1Z8HA 2OXFA 2P2NA 4D9FA 5KOJA 1AKYA 3NKVA 1E2DA 4FONA 2BH9A 2OP0A 4OQPA 4EHKA 3ZXSA 1DAEA 2J0SA 2UAGA 4MTLA 1SO8A 4IHAA 4NBSA 3PNSA 3O0TA 4QFCA 2H0AA 4XQGA 1Z16A 4WPGA 3AKEA 3UYKA 2QSYA 4BB6A 2P9QA 4QJBA 2AUNA 4UKDA 3FGPA 1U6IA 1UZLA 4B4OA 4B40A 4M1OA 4F4DA 3PGJA 2D7DA 3BH7A 3T3GA 3FGNA 2KJQA 1PFKA 1MKYA 2GKOA 1FSFA 4PO1A 5CA1B 3DZJA 1IJEA 1EFVA 1Y1QA 1E3SA 3H2JA 4M6WA 1DC3A 4QGHA 4GPAA 2ADOA 2Q5JA 5I5EA 1LW6E 4LAFA 4CBVA 1J7KA 1EVJA 3AEZA 5K01A 2I4RA 2I80A 2L82A 4W9NC 2D13A 2HFJA 4EGCB 3WKAA 1L5QA 3KUUA 3OFSA 5CM8B 2DLDA 1FTQA 4H0CA 4NX2A 4J16A 5LP6C 2WR8A 1E5VA 1PX2A 1XI2A 1ZCBA 2OB2A 3QEMA 3U4IA 3RD5A 5CVDA 4FWTA 4YJFA 1ZGBA 2X1HA 3N6VA 4G5QA 2NPIA 3MF4A 4FZ3A 4L5BA 5HCNA 4G63A 2WP0A 4CMBA 5EJGA 1A95A 4DE5A 3UY4A 2ZT8A 2FUKA 3O31A 4O3MA 3FNQA 1Y6JA 2IY9A 5DTRA 3UCEA 3GLIA 1WCWA 2Z3VA 2O48X 3OBIA 1Q22A 4XGRA 1VKNA 5IH3A 4ZOCA 3VHRA 1DTWA 3ZDEA 4JP2A 4D9CA 2BJHA 5LOVA 4P3YA 1IUKA 1EJ6A 1U8AA 2PUJA 3GAMA 4TVBA 4UAGA 3LRPA 3TNFA 3BM5A 3IUJA 4FMCF 1M2WA 1X80A 1CB7A 3DCIA 4OKIA 4MR7A 4OK5A 1X1TA 2QM7A 1CQIB 2W6PA 2XUIA 3LM8A 3CR7A 2WK1A 4L2IA 5A7FA 2IF2A 2GZAA 2M32A 4HQ6A 2AJDA 3I0ZA 1E6WA 1A9RA 1VJCA 1WB5A 2GTIA 3Q0IA 1OFVA 2IZ5A 4TWIA 4BY9E 1BHSA 1R3UA 2G5GX 4JXJA 3H2KA 3SNHA 2XUZA 4A6XA 4EJ6A 2WSBA 1KEEA 3AVXA 4A15A 3DXYA 2HMVA 4M7WA 1QHHB 4R2XA 3T3IA 3H83A 4DIUA 4C0HA 3PNLA 1RWKA 1EE9A 2NV2B 4P58A 3QA9A 4WKOA 4EMTA 3GZ4A 4B84A 5JTTA 4BO8A 3FNRA 5CB8A 1W8DA 1JNXX 4KH0A 3FPEA 4PQEA 2ATXA 4A8HA 1HLFA 1OXUA 2E4AA 2R6CA 2VA8A 3CUEF 4RVGA 2E4VA 1GCUA 1KYWA 5F7ZA 1E2QA 3KYBA 2PH3A 2X6RA 1NBIA 3ZHSA 5ESDA 4PQYA 2QAJA 5ERYA 2Y92A 5FQNA 3SAJA 4RTLA 1R0ZA 3M33A 1SC6A 2JARA 1UBKS 4GOXA 5BPFA 5HX7A 4DABA 2NYVA 2J07A 4HWOA 3PE3A 4TS1A 2CZGA 3GBSA 3NV7A 4ERNA 4RVDA 1DTSA 2FEMA 4MTCA 2P79A 2GD6A 3PLNA 3QMPA 5F2OA 2F3QA 3AXTA 4O0LA 5G3ZA 3ND8A 1G4UR 2XVMA 4EYEA 1NHWA 3GGJA 5JS2A 1CY1A 1TUGA 2QB5A 3WGJA 4I2VA 4L16A 2ZGVA 1DEOA 2QL9A 3TWOA 4Q9LA 1KO4A 1Y5NA 2BJWA 1MXHA 4A8TA 3TDMA 4CCAA 4QBIA 4NULA 1NMSA 2DFTA 2ZJ8A 2RJOA 4OA8A 5D7BA 3VYWA 3CUUA 3CGWA 3WV4A 3AR4A 4P2GA 3DEFA 1U81A 2P91A 1DC8A 1GGEA 2V6JA 3COPA 3ESRA 1PCXA 2CGEA 2GSWA 3PRKE 3LX6A 1YGYA 2ZOSA 4TVOA 5JMPA 2CJFA 1B76A 1UPXA 3S8YA 3KKMA 4ZOBA 1ACLA 2DXIA 3COWA 1RPAA 1VLJA 3LTEA 1J2UA 4BDSA 4RX1A 1QRRA 3AYXB 1EM6A 3AJEA 3CW2A 4D79A 1ZVVA 5TDHA 1XCPA 4AYXA 3TLGB 2TYSB 3FZGA 3WQSB 1LJUA 2P4EA 3KTFA 1K3TA 1T2EA 3L7OA 4EP1A 4OCZA 1RBZA 3WIOA 4BO6A 1H05A 1MPXA 2GJ4A 3TL2A 4DQVA 1W4LA 4GQIA 1O3YA 1WW2A 2O8NA 1FRVA 1U11A 2IHJA 2BSQA 5T4BA 2BTQB 4QD3A 1G6KA 1MIOB 3SDBA 3PJGA 4LUCA 2WB2A 4S3MA 2C7QA 1T6XA 3LSYA 2F8MA 6NULA 2FPXA 2FG7C 1YB2A 2ZIZA 2O1SA 2UZ4A 1P33A 3EZNA 1Z25A 5JJIA 3THOA 1XMXA 2PZMA 4WN9B 1ZGZA 4YY3B 2QS9A 1C7FA 1U28A 1U2SA 1SPBS 2A84A 2IIPA 2MJLA 1BN7A 3A05A 3DVLA 2IPLA 3PP8A 2CXNA 4FDAA 4WADA 4ZOAA 2CV2A 3PVSA 1A27A 1PG5A 3I09A 4AP5A 2REOA 4OX9Y 5DLYA 5F98A 1CNMA 2VPQA 3JVVA 3VKWA 4GKAA 4Q05A 3D7KA 3FDJA 3IP8A 3QBTA 3R9KA 4P2BA 4AKSA 4C43A 3O8CA 3IAAA 2ZCVA 4PRYA 5BXYA 2GBLA 1Q7BA 3VPFA 3DOUA 1O54A 3NC4A 3TLEA 5JNVA 2OHJA 1KDVA 3WL7A 4QPCA 4QNMA 3E0XA 2NSDA 1J99A 1QYVA 4BB5A 1C50A 1YD7A 2W83A 2GNOA 2ZE6A 5BN4A 3G8BA 3W5UA 5CH5A 2QPAA 4K0RA 3L7YA 1TUIA 1XZ8A 2JIPA 1M6VB 1QC5A 4DG8A 1XVIA 4CQMB 2C4VA 4NXMB 2BJVA 1RXEA 1HYEA 1QFSA 3BWBA 4KXYA 4WZBE 1XQWA 3KYCB 5FX2A 2BGKA 4MVYA 1GEEA 2RHWA 1QKKA 1Y7LA 1LZLA 2CBXA 2HYDA 2IUSA 3DP7A 3I45A 3LPLA 1GTVA 4NU8X 4XTRA 5DHQA 2F3TA 2YWXA 3NTXA 3QYFA 2NUAB 4UM9B 5DU2A 2VK1A 5EIAA 3LIPA 5THXA 2ZRGA 2AUMA 3UT5A 5JCOA 3GARA 2ZVJA 4RLQA 3WWDA 2CXXA 4DBLE 3FI9A 3QBVA 3OUZA 1DIGA 3MB8A 1MAUA 1U1GA 3WHKA 5K3OA 5F1PA 2ZRMA 4RSRA 4XVHA 5BW8A 4FDTA 5LQSA 3GEDA 1N0WA 2GH1A 1EZZA 2FF7A 3ROGA 4JJFA 1VG9B 4GPBA 4CM8A 3BXOA 3WGVA 3WA7A 3TTSA 2XDAA 2FX5A 1IQRA 2G9NA 1M1NA 4JKIA 2B2CA 4J1QA 4LNUA 3SE0A 4B45A 4DR6B 1ZK2A 2WUVA 1RKVA 1MH1A 2IYOA 5F64A 1XN4A 5FWAA 5H9VA 2VT3A 4CKCA 2YN0A 3ZHXA 3A4YA 4RS3A 3IALA 4HYTA 4CKYA 5KTOA 1C41A 5K2OA 3ANNA 2B94A 4YP5A 4R05A 2FX2A 3LK6A 5DP2A 3T3MB 1JLLB 1N2IA 1U2GA 1E2JA 4UEJA 1IN1A 2C8LA 2D7JA 2AN5A 2QT1A 1DC6A 4JP8A 2O54A 2QYSA 1JHAA 3JQ8A 4BVEA 3UANA 3CR8A 4KQXA 4Q01A 1CJBA 4M0UA 4NI5A 4B2YA 1HM5A 1O6GA 1QU2A 5K8TA 2ZTMA 2GZ1A 2PGNA 3FMIA 2CDRA 2H2GA 3EGDB 2UZ1A 2FN9A 4UU7A 3HJGA 2CDNA 3PX2A 5I7FA 5F3RA 2GAFA 4RE6A 1TMOA 2DQ4A 1ZW1A 4QDJA 5A06A 1M75A 4CN8A 2H52A 5SV2A 4QECA 1PT8A 3URKA 3R5HA 3QVVA 1W0CA 1W36B 4G01B 3KSBC 2R60A 4MVJA 4IG4A 3KLNA 1MA0A 4R4JA 4YP0A 4CKEB 1DX4A 1GL7A 4J4BA 3VU9A 4LSMA 3NEAA 4EF4A 2H85A 1LTKA 5E3HA 1QLJA 3A25A 2WPDD 4FYMA 4II2A 4TTTS 1NRIA 4JYBA 4OLAA 4OQ4A 1GNTA 1XTVA 2F48A 2V97A 4EF6A 2HGZA 3RVQA 1ZGJA 3DZFA 1VKZA 1N2CB 4Q9AA 3O6VA 4XYGA 2CLFB 1C29B 4OJTA 3A1SA 1I13A 3SDSA 2Y4NA 4LGCA 3WL6A 4TTRA 4KO1S 5E1DA 3ZDCA 2XQIA 1NVGA 3CURA 1OVMA 1UMCA 4Z9AA 1SXJC 1IFXA 2C8KA 4RORA 2GBPA 1ZXXA 2MYTA 4KO4S 4PYQA 4QPDA 2ZPUA 4BV9A 3ESXA 4EY3A 1R66A 2FSGA 2XSZA 1AURA 3ND7A 1PGNA 1Z4QA 1YCHA 4AJNA 2R6DA 3FIJA 4J9VA 2WJ6A 3ASVA 2E82A 2R8YA 3HGQA 1OLXA 1X1RA 1GRRA 2NTVA 3WGHA 3NUGA 4NU0A 3ROMA 4D45A 4NFYA 3Q87B 4IXMA 1CYDA 4LRXA 1ML3A 4I6EA 3W2GA 2FI1A 4EI9A 1I10A 3ICOA 1GN8A 3AZQA 2WAOA 4U8HA 4W8GA 1VSQA 2X5KO 5JPCA 2ZWOA 4HD8A 3Q3VA 4F84A 1XZBA 2QZJA 3WMXA 4WOPA 1YBHA 4HDSA 1K86A 2C9CA 2GT1A 1AMUA 2P9EA 4E2ZA 4CEHB 3DGFC 2E9SA 1H1DA 1VIVA 3HGTA 3A9UA 3SF8B 3VR4D 5AVJA 1VHLA 3E82A 2BRUC 3K20A 3SEZA 1XZJA 1DKLA 3MOIA 1IUOA 2JHFA 2QT0A 2HM7A 2WJYA 3WHIA 3ORSA 3ZIAA 5DM60 3GEPA 4R01A 1AGRA 5EHQA 5KINB 4IEFB 3ONFA 1USKA 1MLDA 4JP1A 3RK4A 5BQPA 5KJFA 1Z6QA 1T3GA 1TF5A 4C6TB 4TTAA 3UOGA 3ZE7A 1PJQA 4JODA 3VZCA 2V1XA 3PENA 1FJGB 1BHQ1 4EPXA 3FMFA 2O2XA 4QXAA 2A8YA 4HLQB 2Q2OA 1AUOA 2VHXA 3W3AA 4OXKA 3OP4A 2AX4A 1PJ3A 4LC9A 4PBSA 4TQ9A 2NW6A 3E27A 2XMRA 3PTLA 5HCUA 4BJ3A 4RLHA 4EO4A 2C3MA 5F1KA 4EPWA 2WSMA 2HOQA 4Y2XA 4YMLA 2Q0HA 2XNDA 4C01A 3KUKA 4WZBB 2NXEA 3TW4A 2P6RA 4YJGA 2O4CA 3TD2A 5K09A 5LL6P 1VKOA 4RJTA 2QTMA 2B4QA 2DHEA 2VJNA 1XMVA 2XGGA 3AR5A 1CFJA 3I12A 4UHJA 4FEAA 3HDVA 2EEZA 1GP2A 1EBBA 1C4XA 3STUA 4E07A 5CRIA 4XWKA 2Q6TA 2REQA 3QU7A 3F73A 2ZSHA 5DK4A 3E4DA 5I8WA 3KZMA 1Y9AA 1E20A 3E5HA 1MJGA 3NHSA 3PEEA 4X7MA 3PXEA 3CYFA 1F7UA 3A3YA 5A9SB 2ODNA 1WMSA 3WNCA 5LN1A 1HFJA 1Z4JA 5JQGF 1CHNA 1HLDA 2ZQYA 5C8ZA 2C9YA 1GFWA 1UK8A 5AD1A 4WZ6A 1RLUA 5CVCA 2HX1A 1D2RA 1Z5GA 3WLLA 2HZBA 4ROTA 2G04A 1RD4A 1H6DA 3DD5A 4QUEA 4AUMA 4IIGA 1RZVA 3KQQA 4MPJA 1MT0A 1M6NA 1NFRA 1YA8A 1WL8A 3CKKA 4PS0A 4Q12A 5CBPB 3IVMA 1V1MA 3PYXA 4R2IA 1E6CA 1Z22A 4NMMA 3OZXA 4UJ5A 4RKEA 4M53A 4QGBA 1AXEA 3MJSA 3R9XB 4K6CA 2F3RA 2ZJYA 5BQOA 1DKQA 5SY4A 4EF5A 2QM8A 2JFHA 3BXXA 2Q46A 5LZ7A 1DT3A 4Z49A 4W63A 4DA9A 4BLUA 3MCAA 3SX4A 2NXJA 4GFDA 4NOMA 4XE5A 2X3FA 1RFGE 3EZ7A 5JXJA 3HXPA 5FPYA 3VBEA 3U0BA 1ORVA 1P6UA 1SC4A 4MYCA 5F2EA 5JNTA 5TMPA 1P1HA 4PNPA 3GH3A 1Y4DE 1YI1A 1M67A 2VSOA 2QL7A 4ZYWA 3OA2A 1VXOA 3DMFA 2XB9A 3DMPA 4G0NA 1CR4A 4YASA 4EQZA 4KR0A 4HG2A 3EMVA 2JFGA 4IJWA 4KX3A 3IIIA 3IQEA 1Q0LA 3WWOA 2N75A 4N0QA 3SZ3A 5DM4A 1CZKA 3I9NA 1SOWA 3ZWNA 1GARA 1KNQA 1RTTA 2ZTSA 3L7CA 1L7EA 3FLEA 4CM9A 3DBVO 3FCUB 2AEJA 4JV5B 4OJYA 1LWOA 1TK2A 2O3QA 1RRPA 1DI0A 1I3LA 3BE4A 1Q91A 1SCIA 2BKEA 1M0SA 3H9GA 2LD4A 3OQHA 8ABPA 3DDOA 1GPDG 2C9MA 4KHPB 2BZSA 3HP7A 4MQEA 1P0MA 5AHKA 3D3WA 1BDHA 4HNQA 4F71A 1G64A 1Y8QB 3NYRA 4A91A 3JQBC 1JLMA 4QJ4A 4RY9A 1PJSA 5FEUA 4LMAA 5F4ZA 4BKMA 1A9XA 4XB6B 1YQDA 2XEXA 1XZNA 1DU4A 1M6EX 1A8HA 2E5WA 1I2ZA 2QJWA 3FVWA 4NPCA 5HHTA 4QBFA 1AGPA 5KKCA 3CF4A 1H2ZA 3NBFA 4QOHA 4YUXA 3CVJA 4XPIA 2ZWVA 2G5CA 4S1VA 5FOSA 3STTA 3OETA 3JAWA 4ZC8A 3VKGA 1ZUD1 1YIOA 3FUTA 2PSDA 5T5QA 2VVTA 4IS2A 2XNJA 1KYIA 2WMOB 3CKYA 3WP0A 4CQLB 5HOQA 1W29A 4JU8A 3BXHA 2BGIA 3EDMA 4JUAA 4L50A 4QLAA 5JPIA 1VMEA 4M9SA 1TU4A 1X6VA 3SLKA 4UM9D 1C4KA 3HSSA 4J0CA 3TFWA 1DCTA 3N8IA 4MB0A 1WJGA 3E3NA 1EWKA 3OF2A 4BE4A 1MB0A 4XRRA 5BUQA 3WKBA 2E1RA 1XJ5A 5AO9A 3S3TA 3ZWCA 5LU8A 3BD8A 4E13A 2R25B 4BRUA 4M8NE 4IXWA 5IYZF 4JYAB 5KQPA 5T7BA 1P2FA 1QIHA 4YMGA 3CIOA 5ED0A 3VDXA 1WD7A 1MCZA 4BPRA 1A8UA 4PYMA 5DOVA 5J5CA 3SF8A 2JEOA 2ZROA 1WRBA 1E5QA 2YFQA 2HDNB 1AN9A 3A04A 3D6MA 3TO5A 4ER0A 2AZTA 2XDQB 3DTNA 4M0KA 3E48A 1I7NA 4W7HA 4E22A 7ADHA 3KAJA 4KUEA 5EHIA 3AKYA 1YWGO 4DREA 5BSVA 3UWMA 1Z5UA 4XM2A 4DLAA 4K6GA 1CIVA 1JPNA 1NVDA 4IL5A 4QRDA 1SCQA 1WE2A 2H3HA 2JGNA 2FCRA 1BEUB 3B20A 3ICCA 4M0CA 5KJCA 2EW8A 3II6X 2OQ2A 2OZLA 1Q1AA 3R6DA 4HDKA 1U3DA 4HH0A 2EATA 1KVRA 5AKIA 1A8SA 4KSCA 2Q4BA 3VHLB 4KMRA 4DWOA 5BRJA 2O7VA 3GT4A 2HPHA 4PHCA 4OATA 4RH1A 1GDDA 1WXXA 2WIJA 1IQPA 1JLRA 1O94A 5IJ9A 3VR6A 1F12A 2IXBA 2E85A 2JFZA 3HBAA 3LT1A 5B3LA 5T4EA 4CQLA 4UUQA 3RUFA 5FDFA 3UMMA 3OLVA 3ZV7A 4HH4A 4AWXA 1DUSA 1SD2A 3L0CA 4NE2A 5KHOC 3BHNA 5KWVA 4XWTA 4O4HB 1ADFA 4ZREA 4ZJPA 2I4NA 1SBQA 1VL2A 2BFOA 2FY8A 4OHVA 1C4OA 1UL1X 2VNHA 2YQ5A 4PHTA 1JTFA 3V2GA 1O4VA 2RHMA 5JQGB 3JASA 4RL4A 3RSFA 3RTDA 3WLAA 4D0GA 4CDMA 2OXCA 3F71A 3S2FA 3KQHA 2QNBA 5CDSA 1T5OA 2SCUB 3FZYA 2H2FA 1B0PA 4CN9A 1I8TA 2CF6A 2DHRA 1PUJA 3D2BA 3IOCA 4ZOQI 2BEUA 1CDZA 3F74A 4R7GA 1ORRA 1AXGA 1ZZGA 3AC0A 1EB8A 3KYCA 5JZOA 4IUBS 2P4SA 3FDZB 5JE8A 3X2EA 1X77A 3L6BA 4UTRA 1IXKA 3CSUA 1J1IA 2A4MA 2H7CA 1OX4B 3I3OA 4LJKA 2C7BA 2NADA 2X4GA 4MRVA 3M4JA 3QELA 5EGSA 4F3NA 2EW2A 4JC5A 3KX2A 3CINA 5TS2A 4CMIA 3FUWA 3TL3A 4ER5A 1MDBA 3BZUA 3KKPA 2BSXA 2VAXA 2BTQA 1JXMA 3NKLA 3OY7A 4JGBA 5EE5B 4CPDA 1QKJA 3QFFA 3HJFA 4IJ5A 4IG9A 1VMIA 2PFGA 3GUYA 1VE7A 1AS3A 3CE6A 1KDYA 1IVSA 5EJ9A 4G0WA 4P4LA 2I6GA 4EAQA 1VPTA 1ULZA 2WG2A 3NC0C 3DPSA 2P9CA 2QRHA 3R77A 4FOPA 4G3XA 4LXTA 1FC0A 1FA9A 5DBIA 3WLEA 3EY4A 1KERA 4YQYA 5I6DA 5KOHA 1A4XA 4PZUA 3ZUPA 3TYXA 3AI2A 2BGLA 3A1FA 3FPJA 1GT6A 1HRDA 2GO7A 4D8WA 1RC8A 5DYIA 5JCXA 3ZH9B 1V37A 2NSHA 3PHLA 3FMOB 4DY6A 5ISMA 4NCHA 4EB0A 1KU0A 4IS3A 1NF2A 4EHHA 5C81A 1LY1A 1OHHD 3CVVA 1QIJA 1O97D 3FR7A 2JB9A 4U9HS 2BGJA 1VGRA 3QFTA 2O57A 4I8XA 4QTZA 1YSCA 3OJFA 2PVPA 4M8SA 1P4AA 1KDTA 4OU5A 4QO7A 5IUJC 3U40A 4ND6A 3IO3A 2ZZKA 2RDMA 1IUPA 3CT4A 3QFSA 2JGEA 4KJZA 2YV1A 4Q3CA 3GYBA 2OO5A 2IU4A 3RVRA 5A4AA 3NO4A 4PYLA 3AUXA 2ODPA 2WM9B 3ML1A 1OE0A 2QLNA 2HGSA 5HGXA 1A9SA 3IE2A 3QTLA 5A9TA 3VOAA 1BDBA 4R54A 3F6EX 1AQUA 3HUDA 4PG5A 4H1VA 3ZWAA 5T3YA 1YQUA 2AXNA 3ZXIA 4EAAA 1XDDA 2V4MA 3A10A 4B3HA 4EUHA 5J2UA 3E81A 3MMPA 4PCAA 1U31A 5SY6A 4YRKA 1Y9ZA 13PKA 4ZT2A 5FCDA 4FHFA 5K8LA 1AKNA 3WFZA 3WSVA 1XGKA 3SFZA 3PFHA 3PGVA 4MO2A 2X0DA 5T64A 4MGHA 1O94D 3L6EA 2EG5A 3ZWXA 1D1SA 4BVAA 3PQ2A 4D42A 4ZO9A 3SM3A 1RP1A 4MROA 4GKJB 3QXXA 3KVOA 4HGRA 4X1OA 2VTDA 4ITVA 1E18A 2FVXA 1FSSA 1GUFA 1PJ8A 2GPJA 2IE0A 3VOSA 4CKCB 3CUYA 5TEVA 1E96A 1E6EA 4C7KA 4XX1A 1KQPA 3GJQA 4DNFA 5DNUA 2WJIA 3KR1A 5DRTA 5J9FA 3UMVA 1QU3A 2CHUA 3AEQB 4KLZA 1NF8A 2J31A 4OAOA 1CWUA 1GSOA 2GAJA 1KZGB 3C41J 3GD5A 4GVLA 1QYCA 4L8FA 4PC2A 5COBA 3OQOA 2FN3A 2HLPA 4QLBA 1WXWA 2HRQA 3DS8A 3EWIA 3JWIA 4OHCA 1T5LA 1YCGA 2AE2A 4ZKDA 2HU8A 1VYTA 4LW8A 3CHYA 3CISA 2GCPA 3VH3A 2IYSA 4TMVA 3MJEA 3K9BA 4INZA 3TQHA 5AHXA 4X8LA 3X2SA 4GPIB 4BLOA 3U4AA 2I8CA 1LU9A 4R2LA 1D2GA 1SY7A 5JC1A 4H27A 1Q50A 4MVJP 4LRWA 1IBSA 2F8TA 1N2GA 2WF6A 2ID7A 3K5IA 3NAMA 4YGYA 1VSVA 5DGCA 2CHQA 2NO7A 2XTAA 4MUAA 5CK4A 1KKUA 1OR8A 2V7XA 1P5HA 3DNMA 1E77A 4B3BA 4YCMA 2I3AA 3L5KA 1SBTA 1Y37A 5KX5B 3HRIA 3R3SA 1JDNA 4PC7A 4C7XA 2NXCA 4UXHA 4HEQA 1AX9A 2EOAA 2ADFA 3HWWA 1B0UA 4ZYVA 3EH2A 4QICA 4D82A 2W2LA 3IDFA 4BFYA 4O2AA 3VTFA 1L7QA 1XAGA 2PGAA 1N0UA 3FI0A 5CXSA 1R4NB 1H3NA 3K5HA 4P38A 5TGDA 3SZLA 4YAWA 3F5DA 5TIIA 2C3PA 3HCPA 5AVOA 2JLUA 4I5IA 1X1BA 4NYMR 4UREA 1PP4A 2FYTA 4HXGA 2VJYA 3OJOA 4AD8A 3A3KA 4MA0A 1VZ2A 2Z8ZA 3JWHA 2AHRA 4PVDA 4Q6BA 4CLEA 1DAMA 1EI9A 4WBNB 2DE0X 3GEHA 1KI3A 1B1AA 3WE7A 3C48A 1E1LA 1Y34E 2JCGA 4HWSA 5ALIA 3K9FC 1RZUA 1QYWA 1N0HA 3N6RA 1W4ZA 2F6RA 3ANXA 3ESZA 3L7LA 3ZJ5A 1X0VA 4JHXA 5FAXA 1KORA 1FU4A 3IILA 3MHTA 1Z2DA 1GUYA 1CUUA 1OI2A 1OXKB 2QR2A 2EGGA 3ABRB 4TZ6A 3O9ZA 4ANFA 5FFNA 3PNPA 5BUSA 1T35A 2FQ1A 2ZM6B 1ZXBA 5AVYA 4N7BA 3IEXA 5AKJA 1T8UA 1J0EA 2ARKA 3NHWA 4GM4A 4Y2VA 1NIPA 3IMFA 4AYTA 5EXTA 2DGDA 4W5QA 1GSAA 1GQFA 2MINA 2ZTUA 1WD5A 4WXMA 1E8MA 5JS7A 1WM1A 3L6RA 3DPIA 3DTYA 2C1ZA 5K0LA 1FVFA 1FX0B 1HT1E 1PU2A 2C00A 4GYJA 4JZYA 4MRRA 5BYBA 5MGBA 1XHEA 2QTZA 1BOOA 4HWKA 2R8ZA 1E9CA 3MVEA 4J6FA 5E6SA 4J7CA 4JVSB 5ILGA 1AK2A 1ODJA 3DUWA 1FYWA 1HYGA 3HU2A 3ETHA 4RKQA 1PNOA 3RHZA 3VI4B 1QFZA 4MR7B 3VPHA 4YR7A 5IDQA 1LS6A 1WHTB 4MX8A 4F12A 2GLXA 1ECPA 1SM4A 5FUWA 1TVMA 2XTNA 4HGOA 4JLNA 1D5CA 3IBSA 5FBKA 4TRJA 3GLHA 5DNWA 3KT0A 4E2YA 4S05A 2EQAA 4JJIA 2DP4E 1MHTA 5CB4F 3T7JA 3DPUA 4RK0A 4LDRA 4GD3Q 4RPCA 3RNLA 1EK2A 4X1KB 1WS6A 2QRNA 3OH8A 4F9EA 1P2GA 5DSZA 4RADA 4RD3A 4BMOB 2ONJA 5B1YA 4ZZIA 1UMKA 2GN2A 4RENA 1W30A 5A4MS 2ZXFA 3EARA 4GQAA 5K2MA 3PCXA 4EUEA 3RCBA 3NHLA 4BIMA 2C59A 5DM2A 3WGUA 3BHMA 4IDOA 3KALA 2FPWA 3NBKA 4V0ME 4WH0A 3RFCA 4E5DA 2Q1UA 2VOEA 1O6CA 2DOKA 3INGA 1UKBA 4G09A 2WWVD 1CERA 2XZPA 3O74A 3BE8A 4FN4A 1G2QA 4DSOA 1H5NA 3GN2A 1P2BA 1Z6GA 1N4AA 4ZJUA 2RC6A 2ZJOA 5AW7A 1G66A 5FTLA 6ABPA 4HNSA 3BJIC 1CVIA 4YRFA 4Z4CA 5JFOA 1KAQA 2XE8A 3TL6A 3AIKA 5K0CA 2ZYGA 4WA7A 2JZOA 1TQ2A 2W42A 3ICQB 5AK6A 3WXMA 1N34B 2PNJA 3CEJA 1XLWA 3DAFA 5JZBA 3LT2A 2R6JA 2C20A 5CHEA 1WW8A 3I6ZA 3P2JA 1TYBE 4BATA 5KJ6A 2VPYA 4GR9A 4JLUA 1M73E 3TOVA 3FYUC 4F06A 2CWWA 3JWJA 2FMIA 3TG8A 3M9WA 3ZWPA 3VR5A 3AFHA 2A5DA 4RF5A 5CNJA 5FPTA 1JQLB 4Y1GA 1OU0A 3C7CB 4D3FA 4U63A 1P1FA 1SZDA 2PR7A 2NU8B 4GMDA 2QD5A 3KT8A 1V6SA 4LY6A 1RLOA 4B2IA 4MUJA 3ZKWB 3TXYA 2F8SA 3TINA 2GQ0A 2QAIA 2QPTA 4DIOA 3SR4A 4MRAA 4L4XA 4MSUA 1JXOA 4H15A 2QRLA 1U0RA 1H4VB 2CF5A 3MM4A 5JVDB 4PYRA 2C2XA 2HCJB 4OHXA 2ZIXB 4TXLA 4C30A 5ICSA 3HN6A 3ZI7A 4F3RA 1JJ7A 1WMAA 2ZRJA 1MRSA 2GK6A 3C7TA 3K5PA 1U2DA 1T9GR 4TXMA 4ABYA 3CPHA 1L7OA 4J3JA 3T4UA 3IC5A 1JTVA 3V4RA 3O9VA 1KH1A 1CY6A 4OQZA 3OQPA 1JMKC 2O6LA 2ZATA 4RTMA 2P68A 3GCWA 4JJ6A 4B73A 4NF2A 1TK3A 2OCYC 2Z2JA 3VSCA 1MFPA 2QUHA 2IS1A 3TDNA 4QG3A 4M49A 4IZ6A 1BEZA 1L5SA 2AK2A 2OCXA 5EWLA 3PZBA 3Q88A 4MLDA 4X63A 3VJMA 1P5RA 2VDUE 3OJLA 3PFGA 7GPBA 4J76A 2G08A 4KQWA 5KVVA 1NR7A 1Y4AE 3O47A 5KKAA 1BDIA 2AT1A 1ZONA 4CGZA 1B8NA 3R3VA 1KI2A 3AKCA 1P9RA 4ILKA 5DX0A 2ZIVB 4F5ZA 2QW8A 4MQEB 4RXTA 4WLUA 3S2GA 1LPAB 4RK7A 3PPVA 1L4FA 3SM9A 3W5VA 1GCIA 1Q1BA 2AQIA 3FDFA 3LVBA 4ZO8A 3U3OA 4DJDC 3SJUA 4IXDA 4YMUA 1YZKA 4ESOA 1YDMA 3L1HA 3GP5A 3GLQA 3H2BA 3H65A 1A4RA 1EEXB 3ZVNA 2I7CA 3BZBA 3HZOA 2YHAA 3PUHA 4CM4A 5A5EA 3UJCA 2AQ8A 5ES4B 2JI7A 2ONZA 2IHVA 2YNMD 5AW9A 4HHEA 5K0JA 4TKMA 1YDGA 5IVIA 1N32B 5CEJA 2B98A 3JRWA 1VRCA 2F17A 5LMCA 1QBGA 1BWPA 1ZIDA 3A4IA 4P08A 5KWEA 1OI3A 3MJCA 3C3AA 2WJ4A 4EY6A 3TKLA 5ARCA 1X2BA 2FOLA 3ENWA 2DSNA 5AKHA 3D1VA 2FX3A 5GWXA 1W0JD 2PS9A 2C7PA 2NYUA 3FHCB 2IOHA 4NYJQ 5BSUA 3D8TA 4FFMA 4DUGA 1N33B 3W34A 1LLCA 1PR6A 1XUOA 2DKNA 2E55A 2PX2A 3UTCA 1GZHB 1IHXA 4EA7A 5CVUA 2DR0A 1G0NA 1SHZA 3U0VA 1WUTA 3WKEA 3TGWA 5L3QA 2ZXEA 2HSJA 3TPFA 4DWVA 2JGIA 4QBGB 4Q7EA 2GARA 4KQ2A 4X71A 2BGRA 2PN1A 3VVMA 5CFOA 4HGYA 1VE9A 2VAWA 3HXOA 4Z7JA 1R5BA 4ZCTA 2Z3WA 4AJEA 3ZZ1A 5LMZA 4RPHA 3EBLA 2WWFA 4PZZA 4HP8A 1OAOC 4A2CA 1XCJA 3IEVA 3B9QA 4V2IA 4WK2B 3KEFA 3FDZA 4KE9A 5FL3A 4A0SA 5FBZA 4BNHA 4W5WA 2W4QA 1LWNA 2Y2UA 4U9IS 1IDOA 4WFQA 3B6ZA 3RAFC 1X1DA 3NHPA 1P7PA 1ZAKA 4ZI2A 1I2DA 2XXAB 4ECAA 2D1SA 2HQSA 1K5DA 3MTJA 1V96A 3W7BA 4FD2A 4Q3DA 2GYWA 1YKSA 1LQUA 2BFDB 4F8EA 1B6SA 1ENPA 2AN9A 2NO4A 5HFAA 4ETMA 4XIIA 4YLGA 3FYDA 3GEIA 5LQJA 1GXSB 1JDBB 4CNBA 4UCFA 5GOZA 5CURA 3S2EA 2RFLA 2IDMA 1BNCA 2WJVA 3OQNA 1NKVA 3NLLA 1RADA 2VBIA 3MCTA 4HGQA 3T95A 1JAIA 4RE5A 3TVTA 1OBOA 4DQ0A 2VTBA 3RM3A 4B3TB 5HDQA 3WOHA 5EP4A 4RNDB 5C35A 2Q4TA 4ALIA 1XCBA 4M89A 2ZVQX 4G89A 4S1TA 2C8VA 1N36B 3BMQB 2OCAA 2KS6A 3B5IA 5F73A 5K3EA 3N28A 4C4ZA 2KX7A 1K0UA 2NZUG 5AIBA 1J8YF 2PS0A 4LZAA 3W79A 3HI4A 1EM8B 1AA9A 4ZAGA 3CZPA 3DZ8A 4YRCA 2HJWA 1R0YA 1FP1D 3OOEA 3SHWA 1RI2A 5DNEA 2A4KA 3SG0A 5KVCA 2C0CA 1UXHA 2DFPA 4H7DA 3F46A 4D0NA 4MGZR 1MORA 1F0NA 2LPMA 5IAAA 2H4WA 3D3WB 2Q62A 3PTZA 3G13A 2GCNA 2AN4A 1Z13A 2X22A 2HN9A 2XMDA 3B1JA 1KRWA 1PQUA 3ETLA 4K3VA 1JI3A 3RNOA 3CMMA 3WTCA 1Z0UA 4I50F 4RZ2A 3C3XA 4CTKA 3RK1A 4PO8A 2VTEA 5BN5A 1P81A 2CXPA 2IZZA 1M2JA 2MYUA 3B53X 1IOZA 1L5RA 4IIJF 5F9MA 2Q7DA 4BEVA 3RSOA 2GCOB 3BKWA 3T38A 2ZYTX 3PQCA 4YA6A 1ZESA 1LK5A 3ZCSA 3B51X 2OHOA 2Q1YA 3GGGA 4KGDA 5LNK6 1BC5A 1CDEA 2ZRHA 4BKUA 3A9TA 3PGXA 1EVLA 2H5JA 4RKRA 1DTWB 1HE1C 2IIBA 1ZBQA 3E8XA 3NBXX 4KLAA 3YASA 3SZOA 3T6KA 1LPNA 1P0PA 3GAAA 3ZYCA 3PXDA 3RC1A 3SOPA 3EQZA 3KLMX 5EPOA 1W93A 1KJ9A 1AM4D 4JROA 1WWKA 1N2ZA 1R7RA 4BMPB 4UTNA 5JJLA 5BV0A 3QYJA 2BCGY 3FKJA 4M0MA 2VNSA 5I4KA 4EDHA 2CMGA 3JRNA 2ZBEA 4JVNA 4P3OA 1I4WA 1V3TA 4DV0B 1WW3A 3JXEA 1O9BA 3OO1A 2Q3LA 4XASA 1JA1A 3UV3A 2OR3A 3R3UA 1A9TA 2CSUA 1QIFA 5GONA 721PA 4GYKA 3IT1A 4RVUA 3MINB 3F3MA 4YQEA 1Y3FE 3GAZA 4JT4A 3QP9A 4R1OA 4B8YA 2JFFA 1N6HA 3QG5A 2Z43A 2CYCA 1QQ7A 1W76A 3BL8A 4ED9A 3O2NA 4WNIA 1E4YA 2WYIA 3TOXA 2BP7A 4NVRA 4E1VA 1E0SA 1V8BA 3GH1A 3LLCA 3MFQA 5FAKA 5I7VA 2NP6A 5FUMA 2PMKA 1GZVA 3AL0C 3K6SA 1R0WA 4I66A 1XBTA 2OCKA 2Y1CA 4WZBA 4NOJA 2B21A 1CNEA 4FZRA 5ELMA 2D74A 4J29A 1VLLA 2A88A 3ZHOA 5IHXA 2IH2A 1IZ7A 4QXRA 1DWUA 5H02A 2X9GA 4TWZA 1T4CA 3GGPA 5B2ZA 1DHTA 4DWJA 4NG4A 4OTZA 1ISRA 1EFAA 5CXXA 4M9UA 1X42A 4P5PA 4CEIA 4QYMA 1XU4A 2RC5A 1V0JA 3AJ8A 1P1KA 2G63A 2BGWA 2J32A 2V8BA 2X13A 4DCSA 3F9CA 4CFZA 1P9OA 3QX7A 5TEWA 4PYOA 2XUPA 1DXOA 3ASUA 3DM9B 3FKSD 4KDRA 1XZEA 4R1MA 3ENZA 3CRW1 4Y6RA 3BEOA 3E1GA 5HA5A 1T10A 1C9NA 4EQ6A 2R5FA 3COYA 4Q4JA 4YR9A 2CD7A 5IKPA 5A0TA 2YMMA 2B2XA 5DPMA 1ZJWA 4PSVA 4UAJA 2YN2A 3V4ZA 1ATIA 3NBAA 5CA1A 2OD9A 2HR1A 2O9JA 3KHTA 1U5AA 2B8TA 2PLNA 2JJ8A 3K15A 1LNQA 1GGFA 4AQYB 3OJEA 2GDZA 1LDNA 2C1XA 3LKBA 3QUCA 4FOOA 4LJAA 3QYAA 4ENPA 2WTXA 1U7WA 4GWKA 2W11A 1CV2A 1K27A 3EZ2A 3THYB 1QTRA 5DP1A 4CG0A 1CDOA 2HL6A 1E2LA 3H6HA 3JZDA 5JISA 3FVQA 4OG2A 5JYDA 4FYJA 1DBWA 2YBEA 1EFDN 2JAOA 2HTEA 2C7RA 4E2WA 5IYZA 3VZDA 1RYBA 1VJDA 1Y80A 5EWMB 4RTJA 2HQ1A 1RI3A 1QV9A 1XDBA 4J7UA 1ISHA 3L7AA 3RROA 1E9DA 4ZZ0A 3UAZA 1SD5A 4LVOA 2ILTA 2W6MA 3U7GA 3QLEA 1OSNA 1H65A 1DELA 1FK8A 1Z2AA 2OLEA 2VOJA 3K8QA 4HSGA 4MYRA 4ZT6A 1U2PA 1N5LA 1W88A 1MV8A 2ZRFA 3JVIA 4OHRA 4OBBA 3U6KA 4QPZA 5A03A 1O6BA 4OK3A 2V3VA 4XB2A 5EWMA 3UKOA 4Q4LA 4OK6A 1NSYA 1IB0A 4AJLA 1FRQA 1Z0KA 2HQRA 4BNDA 1PW5A 1X1EA 3SYTA 3UJBA 3LCCA 2PGIA 2IEBA 3HCWA 4BNZA 1FFAA 3K4QA 2DHCA 3ZJ4A 5LLDA 2CVPA 3RSZA 4ABTA 4IDPA 3DKPA 3TSCA 3G1TA 3TJRA 5TVGA 1PZNA 1QH8B 2DBYA 4HZGA 4B81A 2FKNA 2YUIA 4HLUA 2IUTA 4RZIA 3WS7A 1Z36A 4I4NA 4IDAA 4PLCA 2HA4A 1H23A 2PH7A 4BBAA 4BNGA 1MQ8B 2H16A 2NVWA 2W6JA 3O4IA 3QFCA 4UUNA 5AK0A 4R0VA 2I3BA 4AM8A 5B2EA 4KFRA 3OC6A 2JKZA 8OHMA 5HUHA 5C8YA 4BBPA 4XGNA 2DFVA 3KSDO 3M4XA 4R5MA 2OFOA 1OPXA 2B25A 4PLFA 5HG0A 3T4EA 3WYDA 3QEAZ 1L4MA 2B78A 4YDQA 3FTEA 3KIPA 2RK4A 1RAGA 4KH1A 2Q5CA 1CRWG 1ZGCA 5EFOA 2J3KA 1GNRA 1VPDA 4XJXA 2XNHA 3ORYA 5REQB 3M3DA 3TZKA 2QBYA 4MR8A 5AWFC 5IJXA 4XPIB 3DLBA 9ABPA 4MQ5A 4PINA 4UVGA 3ZK9A 3L6DA 4D3YA 1ZD5A 1SXPA 1WAMA 2YS6A 3PNVA 1JT2A 3RTEA 4OB6A 1OWPA 5K3FA 2AFVA 4CE6A 2GTPA 4F9GA 5IHPA 5JMOA 2JCYA 2X23A 3L0IB 1S2OA 5IKOA 5IUNC 1G291 2X4DA 2ZRPA 3O95A 4M7PA 4NV0A 4UHEA 2AZXA 3HHPA 3D9QX 1NAIA 1Y6QA 1OB5A 5F1OA 3DMYA 3Q85A 3FCCA 5FI5A 4A2PA 2GWRA 3I9LA 2IPXA 5IFKA 4I6GA 4ZHQB 2BWJA 1J2TA 1NMXA 1FLNA 5DHUA 5K8CA 2JRLA 4NOKA 5JDCC 1J0BA 1YQXA 2CZQA 1A88A 2AC4A 3HQ4O 4J3NA 3UWDA 4C05A 3F3YA 3WK4A 1B43A 4CG1A 2AMJA 1ZI6A 1UF9A 2VWGA 4WD3A 1DTEA 3UB4A 4KNVA 2QTHA 1Q0TA 4I2NA 4O4JF 3VNAA 4DLPA 4XM0A 4UPEA 3U5TA 2HA6A 1AUQA 1TTQB 3CRNA 4BKPA 2B1GA 3HKEA 3AEQA 5H68A 2ZS8A 1Y33E 1FDOA 2RH9B 2ZTVA 4AX8A 1NLYA 1N5RA 2GKGA 1OV6A 1D2AA 1TQ6A 1G6OA 2D6FA 1FDWA 3RSLA 3MXOA 3FF1A 1IL0A 1DKRA 2WMDA 3LPMA 4HWGA 3CB2A 4IHJF 1R2QA 3RARA 3MRVA 2H8KA 1R37A 4TKLA 3IQDB 2UZ0A 4KWHA 1EE2A 1I4EB 2NAPA 3Q98A 4TV9B 5DYTA 1D09A 2HADA 5CVVA 1D6NA 1BXRB 2QAGB 4O5OA 1L9KA 3EZXA 1IY9A 4LYEA 5BVHB 3LYAA 4LSGA 3MWYW 4QU0A 2RG7A 3F7TA 4G5XA 1KEVA 5BNFA 5FHRA 4BFSA 2ZRDA 3HVIA 1WKCA 4YIHA 5I01A 4QUHA 1XKXA 3FRHA 2ZANA 2CLKB 4IV5A 1N2XA 4DZTA 5MN4A 4IRUB 5ALZA 4W99A 5FJJA 4AUKA 3NANA 4BV8A 3LC2O 4CR7A 4OSEA 4GRDA 4NMWA 1D9ZA 4MDEA 1Y4ZA 1H0KA 4RV9A 1HDCA 4DUYB 2XYRA 1N7HA 3DTTA 1OPRA 2QY6A 5LUAA 2W2LD 3RFVA 2JLSA 2AFIB 5HMLA 4MJ3A 2PJUA 1GVNB 1HY3A 3FCSB 3LT4A 3IXLA 3R3YA 1FFXB 4Q9NA 4RD1A 4FW9A 1LSOA 4MGKR 3LXRA 2V0CA 1HFWA 3RC3A 1RJGA 2NAFA 3PXXA 5CVTA 4JJEA 1ISGA 4UD6A 3AEUA 1I6MA 5DBHX 3HK2A 2XMBA 3DZIA 2J9RA 3PL5A 1PX0A 1SEPA 5FEMA 2AYZA 1G3QA 4YUWA 5AR1A 2FWMX 2C5LA 2PMBA 4XUEA 4ZEOA 1BHO1 1P4SA 3KLPX 3LU1A 3M1YA 4QTYA 4WN3A 3DD1A 5AW2A 3KD2A 4RKYA 4C21A 3TJZA 1YHZA 1E2KA 1WNFA 4ZAFA 4LV6A 5FOTA 5L3VA 2ZREA 4MS3A 3CNBA 3OEWA 5KNCH 3BWEA 2PWPA 3Q6IA 5CCBA 3T0GA 3U09A 4N0EA 2CUNA 1CQJA 4LXYA 2FDXA 3T9BA 1GJRA 4FYIA 4DYDA 1F8GA 4D9MA 3EQ6A 2Z6UA 3DEHA 3DXFA 5E6RA 4Q15A 1P5ZB 4G1CA 4DUPA 3EVNA 4IDCA 4X54A 3V2UA 1U1IA 1YR9A 2TS1A 3P71T 4QA9A 5LCXA 1FX0A 4O2BF 3VR3A 4C7BA 2L2QA 1V7CA 5I9NA 3U4QA 1HZJA 1QZ3A 1V5IA 2PH5A 3QE0A 3VH4A 1QGED 4BTVA 2YIJA 3K0EA 5IVPA 2P2GA 5IM4A 2RAPA 1FL9A 4XR4A 1SKMA 1TA9A 4GPTA 1FX1A 4HLCA 2X8JB 2J9FB 4FE7A 4MV7A 2G36A 4QTUB 3SR3A 1DBVO 4CF4A 3ZU5A 4B3MB 1YZVA 1UJBA 4D44A 1ZWKA 3E4CA 4JLAA 4Y1RB 3DBIA 3GPCA 4WTOA 5D5PA 5L4LA 2WTMA 4HAUA 4GRIA 1UBUS 5F4BA 2HHCA 3VPDA 1ZNQO 3EUAA 2HFKA 4IILA 3OCVA 3DMDA 3Q7RA 2ZJ2A 3Q2KA 4FSHA 3VMMA 3WXBA 1XLUA 5JH7F 1RRVA 4Y67A 1VP3A 4GMKA 3FPKA 1KSHA 3D3QA 1DDIA 3SHQA 3FJYA 2O05A 2NO6A 2WPNA 4MS1B 3QA3E 2O8CB 1Z6ZA 2ADMA 3P20A 2FUG6 4G6ZA 5CLLA 4ETNA 1NL3A 4I55F 1MJFA 5CLGA 2OZVA 3RREA 1CETA 1Y8AA 2PKXA 1UFVA 5KTYA 2X40A 3DVQX 1PNRA 1GUDA 1ZD9A 4KN5A 4WLNA 1Z26A 3IS3A 4ZCRA 2CVZA 2O8VA 1TU0A 2ICAA 1GV1A 1XLVA 2ATCA 2PBLA 2XXJA 2PZEA 3G0BA 3MC1A 1R0LA 5H59A 3SYKA 2C9OA 2HV9A 3M6AA 3PI6A 4ND4A 4D57A 5F7OA 3PR1A 4HOYA 3H9CA 3T7AA 2IA5A 3ORQA 2BFFB 4FXPA 2XUJA 5A3VA 1LPPA 1U80A 1YV9A 3HFGA 4N12A 1KPHA 3O4FA 1MEJA 1HR0B 1YNSA 3UMJA 2OWDA 1E1NA 4MVJF 3EG9B 5BURA 3BWVA 4NP6A 2Q1TA 5AT1A 4ZU3A 1PL6A 1Z0FA 4QYIA 4UASA 4AT1A 4B4DA 4DADA 1Z39A 1YFJA 4OHYA 2H1FA 3LUHA 2BFBB 2LV8A 1ZPDA 4RY2A 2GZ2A 1ECLA 4BX9A 3DCYA 4UTVA 1ZHFA 4FX2A 1BWQA 3AUKA 2P9ZA 3HSKA 4HNGA 4C3OB 3ADCA 4DJJA 3R7WB 3CWQA 1VIDA 3FOWA 3GO4A 5HF5A 3B1VA 1S02A 3PA8A 1BE6A 1T1SA 3DUFA 3MBOA 3WNDA 3O4GA 4AJOA 5IDXA 3V7YA 4H77A 5A4FS 2LKCA 4QU5A 4QXMA 1NG9A 2YWHA 1VZ3A 3JWGA 3O8BA 4LV8B 4G0YA 1TRKA 1YNOA 4KBGA 1R5OA 2VK8A 3WSTA 5BSHA 5K8UA 1T3TA 1D2MA 4RHEA 4PZDA 4MUYA 4ZRDA 1X7ZB 2VH5R 4P93A 1QZZA 4KPYA 2Q6IA 1UMBA 1ZEMA 4WACA 4XDZA 4M37A 1UPCA 4Q5IA 2AC2A 4UZSA 4TYQA 3RS9A 4OX9B 4OYRA 1BXRA 3ZCQA 1OKKD 2BMEA 1T3HA 1DG3A 5WRFA 1NRJB 2NSJA 4MW5A 1UQRA 4CKBA 1JILA 3N3BC 1QO0A 1RR6A 2IOFA 1X7DA 2M9MA 2FXIA 3OURA 5DSTA 4CI0B 4RPKA 4GGOA 2Q7OE 3A9WA 1LLUA 2V8OA 4WNAB 1CQPA 1UFKA 3SIWA 2VTBB 2D5IA 3VR4A 3G3EA 3ENKA 1KDZA 4BJHB 2ACVA 2GHRA 2WT9A 2VHCA 4FR2A 1XWIA 3DO5A 4RDXA 3UXHA 4PG4A 4BQEA 2HRBA 4LHSA 4QQFA 1KIMA 1KI6A 3UGQA 5KDLA 3SC2A 3VYVA 4BLPA 4ATNA 3W5CA 4Q82A 3PFBA 4GW3A 3BULA 1G8GA 3L0OA 1PUIA 5IS2A 3JQ7B 1NA5A 1RAHA 4QFBA 4PPYA 2A5FA 1GQRA 4X6LA 4J90A 3SY8A 1Y8QA 3I6IA 1KAEA 2DEUA 4BQPA 2BI4A 3EX7C 1PJAA 2FN7A 4I99A 3TVYA 4I4IA 4ODIA 1TTHA 4V0OA 3VR1A 5HIKA 1JDSA 2VDRB 3KYJB 2LVBA 2XYVA 4WW0A 1H2WA 4JA2A 1AKMA 3DH0A 1N1EA 1B0ZA 1SVKA 2J0VA 3GHYA 1MGOA 4LOHA 4U00A 5L4SA 2EFJA 3GNQA 3ACCA 4S0XA 4UBOA 5TT0A 4EA6A 2ZJZA 2R7LA 3GT0A 5JRDS 1IVNA 4E70A 4YC7A 4DQXA 5AOAA 3JQAD 2H2HA 4WKNA 5CB0A 5JECA 1E0DA 1JP7A 3O82A 1XRPA 2H7YA 1KI4A 2WZCA 5ALYA 4M86A 2BFEA 1BXGB 1T43A 1U3CA 2OBFA 3ODGA 1XCOA 5FH9A 4K40A 3GMSA 4W5HA 4HAYA 3UT5B 4UPVA 3F2VA 2Y68A 5JJCA 4MPTA 2SBTA 3RVKA 1QH9A 4DR2B 5JAPA 2ISSD