3AIOA

R267k mutant of a hsl-like carboxylesterase from sulfolobus tokodaii
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
283
structure length
283
Chain Sequence
b'ASVEEIRSLFKQFSSLTPREEVGKIEDITIPGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDSAGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTREHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVKFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVFYGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 303aa long hypothetical esterase
molecule tags Hydrolase
source organism Sulfolobus tokodaii
publication title Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobustokodaii
pubmed doi rcsb
total genus 100
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2010-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aioA00
3QZUA 2HHAA 2VA9A 3L1HA 4BBZA 4O08A 4IQ4A 3V1LA 4UHHA 3VJLA 5D3KA 1ZIXA 2VF2A 3UMJA 5LIPA 2WHPA 5DYWA 1ZI6A 5JARA 3R3XA 4X91A 4OPMA 2PPLA 4IH1A 3OC0A 3A70A 1ODCA 1A88A 1XQVA 4OB6A 1N5RA 5DJ5A 2QXTA 2P8SA 3QVMA 4JH0A 3M81A 4DNOA 1R88A 3MUNA 3WK7A 1LLFA 1R3DA 4RE5A 1P0MA 4X85A 2ROQA 1DWOA 5AKYA 4KE7A 2E3JA 1J06A 4HS9A 1CUXA 2QJRA 3AJAA 4PSUA 4Y2RA 3RLIA 1H2WA 5CH8A 4J0HA 5LYYA 1GKLA 3V1KA 3O4IA 1BRTA 2VSQA 3O9VA 2WIFA 1WPXA 4J0JA 1GGVA 5EIHA 3V9AA 2Y2VA 1EH5A 4KYVA 4BCBA 2HIHA 2XDWA 2XQGA 4F5ZA 5HKAA 2WIKA 2WFLA 4U2BA 3R40A 4AZ0A 3V1MA 3WKCA 3UUFA 4DM7A 4DNQA 3FBWA 3GFFA 5ALSA 4C87A 2ZYHA 3F8SA 1YASA 1FFDA 4NVRA 1W52X 5AM3A 1G4HA 4LXHA 3T4UA 3FSGA 3FNBA 3OURA 1DWPA 1LBTA 3WQHA 5IH7A 1UXOA 1CUCA 3D2BA 2I03A 5DTJA 3WKEA 4PF1A 5JD4A 2OGZA 1E8MA 4X97A 3GUUA 5FUMA 1QFSA 2XUDA 4L9AA 3FCYA 4C01A 3K6KA 5AI9A 2Z3ZA 3Q0TA 2Z3WA 4CFSA 1EVEA 2QOEA 4B7ZA 2EDCA 3FOBA 5FOQA 5EHNA 3KXPA 1JI3A 3WZMA 3AIMA 4IO0A 5JZBA 1BN6A 4GHWA 5K3EA 1LZLA 3MVEA 2XMSA 5JZ9A 1F6WA 1DT3A 1GPKA 2FJ0A 2YYSA 2BCEA 2XUJA 2GZSA 2C5FA 3ESCA 1ZI8A 3H2JA 3WKBA 2VJDA 3R3VA 2XUAA 3WK8A 1JJFA 5T4HA 2C58A 4B80A 2I78A 3IVMA 5FP0A 4Y2PA 2FJPA 1QTRA 1XLUA 3F97A 3STXA 5A2GA 5FDFA 3PUHA 4YASA 3FSGD 2JGJA 1QGED 3DD5A 3AIOA 5AI0A 5EIAA 2Y6VA 1D07A 4YX9A 3WMRA 3E0XA 3AILA 2IIVA 1TCCA 2AJDA 2DCMA 4FOLA 3IB3A 1EB9A 5ALUA 4BC0A 1DTEA 3R3ZA 1K63A 3R41A 4K2AA 2Y1KA 1IVYA 5EHXA 1DQZA 3ESAA 2PSDA 2VQ6A 4C4YA 1UK7A 5F4ZA 3WWOA 1QIGA 1MX9A 3I2IA 3CN7A 1U4NA 2UZ0A 1CFJA 2V9ZA 3OOSA 2JIDA 2CUTA 5AM0A 3HRHA 2HL6A 4WY8A 5K3AA 4FFWA 3TJMA 1UKBA 3R0VA 5HQ3A 3PE6A 1CRLA 3DJYA 1MNAA 2WUGA 3BXPA 1UK6A 3HYSA 4AN0A 4UUQA 1YS1X 1JKMA 4LIPD 1C4XA 4J0DA 4H0CA 2G5TA 1CUDA 2B61A 4ZI5A 2VAVA 1E8NA 3FAKA 4X3CA 3WK6A 4INZA 1CUWA 4HXFB 4B83A 4QWMA 4C88A 1XFDA 4HXEB 4K6KA 4NMWA 4RNCA 1LBSA 1SCQA 1WCYA 2QUBA 1YSCA 1LGYA 1XLVA 3C6ZA 4Q05A 4QDXA 4G1FA 5HFAA 5BWCA 4U2GA 5ALVA 2H1IA 5EHQA 1BEEA 1J07A 4DSAA 4CIBA 2R8BA 3BE8A 3R3YA 1XZLA 2C7BA 3WWDA 5JASA 3PUIA 1Y7IA 3C70A 4AQDA 1VXOA 1X70A 2XQIA 4IH4A 1E89A 5SYNA 5LZ8A 4LYEA 2ZYIA 2IITA 1QO7A 4OYLA 5I7UA 4OSEA 2HDWA 2CB9A 3SK0A 4FTWA 3FLBA 3STYA 2XMRA 4U2DA 2RI6A 1VKHA 4RE6A 3WI7A 1FFCA 3C5VA 3DKKA 4W1PA 2RGUA 4TPKA 2XT0A 5JATA 1FFAA 4BAZA 2OCIA 3EF3A 4OCZA 1A8QA 2AJBA 4W9RA 1TRHA 4TGLA 4ZV7A 4BDTA 1Q83A 1XROA 2JBWA 4MQMA 4DLNA 5K5EA 5KWJA 3VVLA 1U2EA 1QONA 1MAAA 2B20A 3QPAA 4WY5A 1K8QA 3FYUA 3E3AA 5IKXA 3U1TA 3BDIA 2V97A 3NUZA 4U2EA 4Y2UA 4JEIA 1EHYA 2XMGA 3QITA 2XUKA 3Q8WA 2PU7A 5I8PA 3DL7A 3LLCA 4AO7A 3G9ZA 4EB0A 5HKBA 3I1YA 2QZPA 4UHCA 2JGFA 1QIJA 1AZWA 1MAHA 4P08A 1N8SA 2WILA 4UHBA 3B12A 3QM1A 2WIGA 4UFPA 2BUBA 5EFZA 1EDBA 4QEKA 3VVMA 4L3WA 5J3JA 5AIBA 5ALPA 3QPDA 2WIDA 4U2CA 3HJUA 2HM7A 2ZJ7A 1CUFA 3TRDA 4K6HA 2O2IA 1IZ7A 3NGMA 3H19A 4N5IX 1GXSA 4FFVA 4MYSA 4EY7A 1RP1A 2QTBA 4W1QA 3BL8A 4QWWA 1G66A 4KRXA 4XJVA 5FXMA 1W6RA 5JADA 1MTZA 2EEPA 2HA2A 4Q3KA 4QDTA 1HPLA 4M0FA 3DEAA 1KEZA 1PFQA 5C8XA 5I9IA 5CTAA 3WL7A 3HSSA 1VA5A 3DOHA 3EBLA 4ZGBA 4XIIA 5JANA 3TEJA 3FLEA 2PUJA 5CBKA 1L7AA 1XZJA 4UHDA 2QT9A 4BRSA 3AUKA 1CEXA 4LXIA 4MQLA 1OXMA 4OUKX 1IUOA 2DQZA 2Z8ZA 1GQSA 1DINA 3I1IA 2WTMA 3FVRA 4H7KA 5DNWA 4H7HA 1KU6A 2WUEA 3G9XA 4C4XA 2XUHA 4H35A 4HTAA 1T2NA 2OQIA 3C43A 3LS2A 4WFKA 1ODTC 1R50A 5JALA 4X6YA 1EA5A 3H04A 3U0VA 2I3DA 5LKAA 5AKZA 3C8HA 1ZD5A 4DYHA 3G02A 5A7FA 4X95A 5T4EA 5AI4A 2XI4A 4BP8A 1JJBA 2WLSA 2QUAA 1VZ2A 4Z49A 5CT4A 2PUHA 4BATA 3HXKA 5AKIA 3ESDA 1VE7A 2QM0A 5JIBA 4ZXFA 1IMJA 3IUNA 2IX9A 3P2MA 5BOVA 3C6BA 5LKRA 5IVIA 5AHXA 1RYYA 1TCAA 2JGKA 3KD2A 2HU8A 3DYVA 2BUAA 5AH0A 4UBOA 1EVQA 4CCYB 1CUEA 1WHSA 4H18A 3QPCA 4X00A 1XQWA 5ALHA 2JGEA 1CLEA 5ALXA 2WM2A 3F67A 5ALRA 2ACKA 3H18A 4G5XA 3GBSA 1GZ7A 2H7CA 4ARAA 4LKOA 3WKAA 3STTA 4DMFA 1SCIA 5HQ3B 4BB0A 2PM8A 4FMPA 4W1RA 4BE9A 4MEAA 2YXPX 2X8BA 4DSZA 4ITVA 1ZJ5A 2RONA 1MX1A 3AZQA 6YASA 1CQWA 3M82A 4QA9A 2BAGA 2QRUA 4QLAA 1Q84A 2D5LA 4IH9A 2XQKA 4ROTA 1M33A 3W05A 5HF8A 1TK3A 5CXUA 7YASA 2PBLA 4EY5A 3IUQA 3OPMA 3WA6A 2JEYA 2WG1A 3KOOA 4OU4A 3D59A 1QFMA 2O7VA 1CUSA 5AK5A 3SWWA 4XX1A 4AO8A 5FLKA 4MEBA 5ALLA 1H22A 1H2XA 3PF8A 2X76A 2ORYA 2GBFA 1XLWA 3WIBA 4DMHA 3BF7A 3CXUA 4QDOA 4FLEA 1XRPA 2EDAA 5JAOA 5SYMA 2YASA 4HZGA 3CCBA 4GWLA 4Y2VA 3IBTA 3AZOA 4QE3A 4EBBA 4H7EA 5ALIA 1TQHA 5AOAA 2ZSHA 3W04A 5E4JA 1N1MA 4GW3A 2G5PA 3QMVA 5C81A 2G4LA 5HK8A 5AKLA 4AN1A 2O2HA 5EGNA 1LNSA 3ZLTA 1ORVA 4J0IA 4OU5A 3S2ZA 4I4CA 1CR6A 2PX6A 3O0DA 2WHRA 2BKLA 4DNPA 1QIFA 2OLEA 5JAPA 2QS9A 1J1IA 2HA3A 4UFNA 4EY6A 4HRXA 1ZI9A 2FX5A 5CRIA 4UPDA 3G9TA 2WG2A 3ICWA 1G42A 1T4MA 3X3HA 2VATA 4PSCA 4F21A 4ETWA 3L1JA 4V2IA 3E1GA 4H7FA 1QE3A 3ED1A 4EUSA 1ORWA 3G0IA 1XRRA 3IUMA 1ZOIA 1I6WA 5JD6A 4J0KA 2OGTA 4HRYA 2WJ4A 4J03A 1YA4A 4B84A 5CXXA 3AFIA 1WB6A 1ISPA 4EY8A 1THGA 5AKHA 1TIBA 1NX9A 2W6CX 5ALTA 4QNNA 3WK5A 1VJ5A 3UUEA 2DSNA 1QTIA 4CCYA 2VJCA 3DKRA 4DMCA 3G0BA 4BVLA 1PV1A 5FKJA 5CH3A 1CQZA 3K2IA 5T4BA 3AINA 2HA5A 2VJAA 2DHDA 4FNGA 3VJMA 3I28A 2OAGA 3ZI7A 2CMFA 1AGYA 3B5EA 4AZ3A 4C6HA 2CKMA 1SCKA 3F9CA 2GBIA 3QYJA 4GBGA 4Y2YA 3O4HA 1VA4A 5ALKA 4BZZA 4X93A 4PNZA 2ZJFA 2OCLA 3QMWA 3ZLVA 4C4ZA 3H1AA 4GXNA 5ESRA 3F98A 2D0DA 4E46A 4CIAA 1AQLA 5T4FA 2ZYSA 1ZGCA 4Q34A 3C45A 3YASA 3C6YA 4BAUA 5K3BA 5AM1A 3RKSA 2J3QA 2WQZA 3WK9A 5CH5A 4P93A 1XZBA 3W2TA 3STVA 3O4JA 1HBJA 3VXKA 2XE4A 3C6XA 1P0PA 4KAFA 4KAJA 2CZQA 1XZEA 2NW6A 2OG1A 1B41A 1OCEA 4E15A 1DWQA 4LYDA 4ZREA 4KAAA 4H77A 5A62A 5JZSA 1XQXA 1L7QA 1EX9A 5A71A 5HF6A 3VKFA 3WWCA 4KJXA 1FFBA 1EB8A 1JMKC 2XUPA 2QJWA 3G7NA 4IHAA 4UBIA 5AM2A 1Z68A 4MWTA 3FVTA 2HFKA 1XRLA 1CUVA 3D2CA 3N2ZB 1IUPA 4ZV9A 5D3ZA 2QR5A 1EI9A 4H7JA 1FJ2A 1QIEA 1NU8A 1UZAA 1CUAA 3K9BA 4H7IA 4NS4A 1MX5A 1YAHA 3I6ZA 4UBLA 3DQZA 3PF9A 5ALNA 4X92A 1UOPA 1X2BA 5CMLA 3I6YA 3D0KA 2CEKA 2GYUA 4I3FA 2ACEA 3BIWA 2C5GA 1H23A 5YASA 4J0CA 3G0CA 2XUGA 3WA7A 5ALDA 2DR0A 1LPPA 2Z5GA 4B82A 1MNQA 4UBNA 5EIEA 1LPNA 1QJ4A 2VAXA 3E4DA 3FYUB 3PFBA 3IUJA 4L72A 5CT8A 2XMZA 1R4ZA 5ALFA 1YAJA 2PSJA 4OYYA 4BCDA 4RGYA 1LPOA 4G8DA 4E14A 1LPBB 4OB7A 3WL6A 4BRZA 1E3QA 4KEAA 2XLCA 1UK9A 1UK8A 3WYDA 4B81A 3R3WA 2ZYRA 5ALEA 4GECA 1MJ5A 2ONCA 3HEAA 4JUIA 4N8EA 2ZSIA 1J2EA 3D5EA 1EK2A 3D3NA 3JW8A 2XQFA 2PKYX 4NZZA 1E8DA 3C8DA 4B6GA 2O7RA 2B4KA 4UHFA 3NWOA 1ZD3A 4LXGA 4MXDA 3IURA 3WYNA 4W63A 1W4LA 5HK9A 5KBYA 5CT9A 2VT6A 1DU4A 1LPAB 1FFEA 4FWBA 3MUOA 1ZGBA 2WKWA 3ANTA 4FBMA 4PW0A 4FHZA 4N5HX 5D6OA 3VDXA 3H17A 4EHBA 5DWDA 1WB4A 4G9EA 4FNMA 1BCRA 2XUFA 1R1DA 1SC9A 2J3DA 2XUQA 2PL5A 4HVTA 3WWPA 3WZLA 2CJPA 2V98A 1XZCA 4Y2QA 4BTVA 2K2QB 4CCWA 3L1IA 4A16A 4J3JA 3JYHA 4MJ3A 1QIDA 1YS2X 5AK3A 2GBGA 4KRYA 2XMBA 4AMYA 2WFZA 3C87A 4X6UA 5ALQA 3STWA 1X2EA 1YB7A 3B3QA 3HABA 1DX6A 1CUHA 4XVCA 3BWXA 5ALMA 2OCKA 3SC2A 1TKRA 1UKAA 3ZLUA 4N8DA 5AI6A 5AKJA 2PVSA 3PICA 1WB5A 5CURA 3KWFA 4AX4A 1XZIA 2X5XA 1QIIA 1WPRA 3JWEA 3WJ2A 4AMZA 3LP5A 1YR2A 1EK1A 3I2FA 5AO9A 3DDUA 4M0MA 2R11A 2Q0XA 2Y6UA 2HU5A 3M83A 3STUA 3KWJA 3WK4A 1JFRA 3I2GA 2ECFA 4K5QA 5HF5A 1QIMA 1G5FA 1EDEA 3IDAA 3I6MA 3ILSA 4LHEA 4FBLA 1K6EA 1UOQA 2HADA 4B9EA 1CUZA 3QH4A 1XZGA 4B85A 5HFNA 3O9MA 3NOXA 4FKBA 4G9GA 2WJ6A 1AMNA 1K4YA 2H7YA 1AKNA 4GDMA 4P9NA 3AIKA 2VTVA 1DX4A 3PI6A 3N0TA 4FLFA 2XLBA 4HXGA 4MYDA 4Y2TA 5K3FB 3BDVA 4Q1VA 4DNFA 4QLOA 1XRNA 4DTCA 3PFCA 5IVKA 1XZMA 5AJHA 3FYTA 4DGQA 2HA6A 4BP9A 4D9JA 1Q0ZA 3DOIA 5E4TA 3G9UA 3D7RA 3BJRA 1PJAA 4PQEA 5AIAA 5H3HA 3SX4A 2QKYA 5E2IA 3DCNA 1QOZA 1MT3A 4DMKA 3DS8A 1SFRA 4B9AA 3WKDA 3DNMA 2H9YA 2WG0A 1U65A 1MPXA 4KR0A 5EI5A 2HU7A 4BAGA 1Q0RA 4Q82A 1N5MA 1AUOA 3IA2A 4RPCA 2GYVA 4PSDA 5A6VA 2W22A 4PV7A 3HACA 3VISA 1XKTA 1GPLA 5FPPA 5E4YA 4QDUA 1L7RA 1P0QA 1E5TA 4Y9SA 4UBMA 4XWGA 2WJ3A 1Y7HA 1XZFA 5K3FA 1ZICA 3W06A 1AURA 5KWIA 5C8ZA 1EDDA 5HZGA 3QMMA 1HQDA 1O6GA 1TCBA 3F96A 4P92A 2WUDA 1GT6A 1MU0A 5AI8A 3V48A 4GEGA 4Q3OA 1ODSA 1WM1A 4YPVA 1WHTA 2H7XA 1ACJA 3T52A 3DL4A 4B0PA 4K6GA 5D7BA 4ZWNA 5DYTA 1W1IA 3G0DA 2BFNA 1ZJ4A 1ZIYA 4F0JA 2QVBA 2XMCA 4J0GA 1HKHA 2OAEA 4C89A 1HL7A 1XKLA 3DLTA 4U2FA 2HRRA 5ALWA 1B6GA 1BE0A 1IUNA 2CBGA 5CT5A 4WFIA 2WSLA 1UT6A 4Y7DA 1BCSA 1CPYA 4UBKA 4G4IA 2PSEA 1AX9A 2G63A 2PSFA 1Y37A 5DLPA 1W76A 1CIJA 1CUBA 3BJMA 5CW2A 3FLAA 4JNCA 1O6FA 2RHTA 4CG3A 4EZIA 3W9UA 1CUGA 1U8EA 3ZV7A 1YA8A 1MO2A 5DNUA 1CVLA 2JF0A 2Z8XA 3IIIA 3WLAA 3AZPA 3ICVA 5K3DA 1CUUA 2XQJA 1QLWA 3O95A 2BUCA 4E11A 5A7HA 2BGNA 1XZKA 4Y2XA 2RIPA 1F8UA 3MGAA 2LIPA 3FYUC 2I3ZA 1CUIA 4KE9A 1BS9A 1XRMA 5LZ5A 3W9BA 2RHWA 1XZDA 4Y2JA 1F0PA 3CCCA 1XZAA 3KDAA 1HLGA 1AC5A 4ZRDA 4F60A 5ALJA 1BU8A 3BIXA 4FDMA 5FRDA 4GI1A 3H2HA 4TVKA 2OQVA 2PSHA 2GYWA 2J4FA 2ES4A 2WTNA 1ACLA 4BE4A 3ZWQA 4BVKA 4WCVA 3TGLA 4WJLA 5BV7A 1JT2A 1JU4A 2GZRA 2HA7A 3GA7A 1KU0A 2BJHA 1H2YA 1YB6A 3RK4A 3GZJA 5AOCA 2JEZA 3G8YA 4KE6A 1EINA 4OB8A 4B0OA 3OG9A 5CT6A 5HCUA 2AJLI 1LPMA 2QMQA 3A2MA 2DFPA 2XB6A 4J7AA 4WFJA 3LCRA 5ALYA 4X90A 1EXWA 2XMDA 3OTQA 2OCGA 5LP1A 2Y2UA 3HC7A 3BF8A 2AJ8A 1CV2A 3HLKA 1NU6A 5LZ7A 2HA4A 2DQYA 3WJ1A 3H1BA 3H2GA 5AICA 2BGRA 1VZ3A 2O2GA 3FWHA 5LZ9A 1DT5A 1DQYA 5LZ4A 2WFLB 3A2LA 2RAUA 5BWBA 5AKGA 4L0CA 5AP9A 4A5SA 1S8OA 2YH2A 4MWSA 2GBCA 3H2KA 1WOMA 4JYPA 3ZPXA 4G8BA 4M0EA 2HRQA 3DYIA 4X94A 3M3DA 3WWEA 5IVDA 3OM8A 5JAUA 3EIOA 4S0XA 3EQ8A 4CG1A 2C0PA 5AKEA 1XRQA 2XUOA 5AM4A 3D4LA 4BZWA 1JMYA 1USWA 1VOTA 2WHQA 2WUFA 5AK4A 3HI4A 3RM3A 1JU3A 1XQYA 4QZVA 4G4JA 4H7DA 2AJCA 5AKXA 4BYMA 5JAHA 2WFMA 3PDCA 3QBJA 1QO9A 3EQ9A 4OD0A 2WHPB 3WL8A 1W75A 4BDSA 1A8SA 1THTA 1UOOA 5ISMA 3ESBA 4HAIA 3V1NA 2VT7A 4WDRA 3H2IA 5IVHA 3D2AA 5AK6A 1MN6A 1P0IA 1F0NA 1UFOA 3WIOA 5AM5A 4EA6A 1FSSA 2OPHA 1ETHA 1YCDA 2DHEA 3I2KA 1XZHA 1QZ3A 5A7GA 1QIHA 1BROA 3IULA 5JD5A 3CN9A 4BCCA 4UFOA 1IZ8A 2HFJA 4KACA 2B9VA 4Y2SA 1CUJA 3KSRA 4I19A 1VXRA 4X6XA 4BTLA 5DTIA 1CUYA 3EQ7A 2C0QA 1JJIA 3S8YA 4JYMA 5ALZA 2VJBA 1C7IA 2VEOA 2HA0A 2FUKA 3A2NA 3A6ZA 3O4GA 1R9NA 3RARA 5ALOA 1GPNA 4Q3LA 3LIIA 1GKKA 4X71A 5FV4A 4X7BA 5FPQA 5EHZA 5AKKA 4EY4A 2V96A 2WU4A 3ANSA 5HF9A 2WIJA 3WL5A 4UHEA 3R3UA 3C5WP 1VE6A 3FCXA 5C8VA 1LZKA 3I2HA 2J4CA 4AO6A 1ZD2P 2XMQA 4KE8A 3VJKA 2ZJ6A 2AXEA 5JYCA 3LIPA 4GLBA 5KREA 1OILA 2OXEA 4FLMA 5DYYA 1SOMA 3H0CA 1HDEA 5DNVA 2XUIA 4BVJA 4WDQA 3GELA 5AI5A 1VLQA 4CG2A 2JGLA 2DHCA 5ALGA 1QIKA 4G4GA 4A23A 1UKCA 4UBJA 3HZOA 1E66A 4YK7A 5LLSA 4BC1A 3G0GA 1BEZA 4PO3X 4CI9A 1UWCA 4QDZA 2C4HA 4AB1A 2QXUA 5AOBA 1R9MA 3GROA 5C7YA 5LZ2A 1A8UA 2JGIA 2PU5A 4G8CA 1TAHA 4N8SA 1ZD4A 1BN7A 4AXBA 1RWQA 1GQRA 4W1SA 3I2JA 4ARBA 1K5PA 1H2ZA 2WU3A 2JGMA 2OGSA 1A7UA 2ZVDA 5K3CA 1C7JA 4DIUA 1LPSA
chains in the Genus database with same CATH superfamily
2IS1A 1GNVA 3EK2A 5ICMA 2XWQA 1C1XB 3L1HA 4URHA 3V3KA 1UBKS 4TLCA 2B7BA 1QKJA 4QNRA 1CSEE 4Q3EA 3SLKA 5JV5A 3ZZMA 1NC3A 3BGOS 3NHUA 3O47A 4PZAA 4MMYB 4DCUA 4F5WA 5K3SA 3KTOA 2PJUA 3BULA 1CZNA 3J81A 2UDPA 4I8XA 1BDJA 4R1PA 1QB7A 3VR2D 5HQJA 1IONA 1EJ6A 1Y8CA 3N2YA 3N2IA 4R0VA 3EISA 4S24A 2C42A 3IV7A 4C03A 1EX7A 5K0TA 3H2SA 5DYWA 1DTWA 5JARA 3R3XA 2ZRIA 1V7ZA 4LISA 5FB3A 1OVMA 3A6KA 4YCCA 4LZOA 4W82A 4JJEA 4LGCA 4WKPA 2D1TA 4E70A 5EPUA 4H27A 3FF1A 3QWAA 2FPRA 2DC1A 2Z2KA 4IH1A 2AG8A 1QKKA 4ZQCB 1KHHA 3A70A 1D2GA 2WD8A 4OQQA 3BGVA 3LUBA 4G0MA 3KXIA 5ARDA 2A5JA 4YRPA 2V7WA 4RVNA 2RCYA 5JCJA 3SP1A 1JW9B 2DWOA 1A88A 2J6BA 1LBHA 1XQVA 4BWYA 3BBPA 1N5RA 2VSFA 1FNMA 4OB6A 4W7IA 1H93A 3UT0A 3WYGA 1NOIA 3A6FA 6GPBA 4Z4GA 3BKWA 2ONJA 3NCTA 3PENA 5IN4A 1K6MA 5KVVA 4V39A 1BVUA 4QUHA 2HR1A 2C29D 1J4AA 2O48X 2PD4A 1LLFA 1S3GA 3G5MA 1KY4A 3PQ8A 3NOOA 2HBQA 2VK4A 4GZ6A 3HBNA 3V8BA 4HFMA 3KDPA 2D8MA 3M6XA 4NHOA 5H4HA 5SICE 3ZHXA 2JKZA 1ZNWA 4KPFC 2E3JA 4K87A 4HS9A 3LP8A 3UENA 4XDGA 4A6XA 4JUDX 4V02A 5IAGA 2FZGA 3VR4A 4DLAA 3AJAA 4LJRA 3GBPA 1DJPA 3KAQA 2ERCA 2BKVA 5E6SA 4D0NA 3KJHA 4Q3NA 4MW9A 2NTEA 4OHFA 1Z7EA 3DAGA 5KC8A 4PICA 4URUR 4JODA 3VPSA 4YV0A 4PLPA 3MINB 2GCEA 1Z35A 2J6HA 2VSQA 1C2TA 2QRHA 3MXTA 3OPXA 5DN6A 2WIFA 3KKZA 4M9RA 2P9QA 1L0BA 4J0JA 3M3PA 3B13B 3UHAA 3NVDA 1ZUIA 3FROA 2JS7A 2Y2VA 1T4BA 5G4KB 2RAPA 1EH5A 5DHSA 4C7BA 3AKDA 2VNJA 1G20B 4R2HA 4EFKA 1FYFA 1T8PA 3I32A 2VIIA 4GLOA 3N0XA 4KYVA 2XDWA 4MROA 4JFAA 4JLUA 5A0FA 4F5ZA 1UWKA 2BZ0A 3ELBA 4PEVA 4DA9A 4YRIA 2JBAA 5DLDA 4US2R 4BBPA 4M8IA 4B73A 1VJRA 3VGPA 2YV1A 3ZIAD 3O4FA 4BX8A 1DELA 1IY1A 2BFAA 3BB3A 5DP1A 1CR0A 3WKCA 1XAGA 2VP6A 3TQTA 3LVQE 2IYOA 3IR5A 3C0KA 3NUQA 3BMNB 3W1WA 3IV9A 5KKAA 4HTFA 4AJPA 1FRVA 2UXDB 1GT91 4N9QA 3G49A 1KJZA 1EFVA 1EG2A 5KWEA 4R0MA 3ND6A 1DJNA 3F8SA 2ZVPX 4E94A 5E1MA 5CB4F 5JEEA 3HU5A 2H4YA 2JIOA 1JRLA 1P29A 1L4YA 2D3WA 1XCOA 1K8YB 1LK0A 4G5HA 1LDMA 2CZCA 3QVGB 3QVSA 4GEKA 4PZLA 3OZ7A 1YD7A 3PP8A 4MGEA 1FDTA 4TL7A 1XU7A 4X7MA 1QRAA 1NXWA 3OURA 1GILA 1HEYA 5IH7A 2N1BA 3HP7A 5TS2A 1HK7A 1CP3A 2WVAA 1H1LA 3O9ZA 3NYWA 1FY2A 4PF1A 3MRVA 3ABSB 3AI1A 1WDMA 4KGZA 3GUUA 2ZDHA 1F12A 1JG3A 1QFSA 2EP5A 1DKNA 2H4HA 2X1VA 5JJBA 1XD2B 2WKRA 3PUKA 5AI9A 1QAQA 3LOQA 3UFXA 1U3FA 1R4MA 5D8DA 2FA9A 4OKSA 4INOA 2Z3ZA 3CW9A 1TVKA 2OUKA 3BFKA 2IHNA 3HNRA 2IP1A 3Q0TA 3B1ZA 4XYMA 2YVQA 2IYPA 4RHEA 1EMDA 3ZHQA 4ZIRB 5HIKA 2WT4A 3AV3A 3F7OA 4IRUB 4IIJF 1W49A 3BD7A 2QOEA 3AG5A 4FFSA 4CLOB 1C7QA 1CLUA 1FSZA 2ATEA 3D8SA 3HFRA 5B1HA 3SX2A 1V16B 4KTVE 4WZ6A 4CLDA 1INLA 1HNWB 2CVHA 2HJRA 2W0SA 4KPUB 3M8KA 4JXKA 2ENWA 1ZK1A 5K03A 2OO5A 1F8YA 1K66A 4FW8A 4MVWA 1P9NA 3CNBA 4TMFA 1N2CA 2ZRNA 5C51B 1LZLA 2XWJI 4GI7A 2JBHA 3TKLA 3DEFA 3NWPA 1SXJE 3E9RA 4BO9A 2XMSA 1IN8A 1BFUA 4ZFNA 1F6WA 3TW8A 3PDJA 1CXZA 3ANMA 1OI7A 2YYSA 4CBVA 4O8CA 4DCOA 3QKWA 1E0KA 1VQ1A 3SG0A 3THOA 3D6HA 4PYLA 2FP4B 4WOPA 1G6KA 1SCUA 3HG7A 3SXPA 5KMGB 1DRKA 2KWIA 4ZVNA 3U7QB 3ZBPA 3E2PA 3GFRA 1UC9A 4RH0A 4A8JA 2HMUA 2J0SA 1M2OA 3K30A 3PQ3A 2XUAA 1P2DA 2XTJA 3WK8A 3KPWA 1JEAA 1I3LA 5ADHA 2H7VA 4DZTA 4TTPA 4OJMX 5LN1A 1IY9A 1ULZA 5DGTA 4UOEA 3AH8A 1XCBA 2YJ6A 5T4HA 3WMEA 4B80A 1ZRMA 1JUDA 1N1GA 3JQGB 5I4CA 4HLUA 2UZ3A 3KNZA 4Y2PA 5KVQA 2RK4A 4JT9A 3FTNA 3ZY2A 4NIMA 2G70A 4WKNA 3KR0A 4WECA 3VOSA 2V4ZA 2AVDA 3QX9A 3F97A 4E2YA 2F1IA 3KHTA 1KZHA 3MERA 4JBYA 3H5LA 2Z4RA 5LQDA 3VI4B 2HF8A 2HJ9A 1L4BA 3GGOA 1LSUA 1UPXA 2BD0A 3T34A 2VZLA 4ND5A 2KM1A 2BSQA 4XCVA 3UJBA 2GEUA 5BQOA 3BAFA 1AXEA 5AI0A 5T3UA 5DNCA 2NAPA 3A31A 4UASA 1NLUA 1ZGZA 4WVLA 3BMOA 2HOQA 3EIHA 3Q10A 1HZZC 1UFQA 3FN4A 1JHDA 5TEVA 3TXXA 4YX9A 2PXCA 2UUBB 2G76A 3E0XA 4F1JA 1EKXA 1FPMA 2C1EA 1IMOA 4K6CA 2GVNA 2DCMA 4FOLA 4MMXB 2HCRA 3ZW7A 4BQRA 5CIYA 1XKXA 4JI8B 3N39C 3WYAA 2XXBA 1GSAA 3N8NA 3VQTA 2X15A 5JQGF 3JQ8B 2ABWA 3ZHUA 1UT5A 1Y6QA 2FLVA 2QJTA 1DTEA 3GUCA 5HYVA 1O94D 5FQOA 2NSYA 2QD3A 2HLPA 3HVRA 1V25A 2Q1UA 3OWXA 4FE4A 4Y9UA 1B2LA 4NNPA 2Y1KA 4OLFA 5I7HA 3SXUB 5EHXA 2DBVO 2FZWA 2ZI6A 5CCDA 4N12A 2O3UA 1TVEA 1T0IA 2CJFA 3JYOA 1NNLA 3SI7A 4X7PA 1Q12A 4GBMA 2B4YA 4OQPA 5FTNA 2JJQA 3M9LA 5LMNB 1JECA 5LXTB 1TAQA 4FR2A 3ED5A 5F4ZA 1D3AA 2VA8A 1G8HA 1YR9A 1ZK4A 2AFHE 4M2LA 4YWJA 4R7TA 4QT4A 4F4CA 3AVUA 2WJGA 4FSXA 5EE3A 2ADOA 2IPMA 2Y27A 4O4IB 1U7PA 1THMA 4JL6A 5ITZB 1N5IA 5BSRA 1BFKA 4MVJG 1L4LA 3L7YA 1B8NA 5CUQA 3PNSA 2GCOB 4OOFA 1CFJA 2RJOA 2QN3A 2OYRA 4BMVA 3FWNA 3DT6A 2WWXA 2J9YB 2Z2XA 3MT8A 1W4RA 4HRAA 4LN1A 2AEFA 4W99A 1WQ3A 4RA6B 2JK0A 2RGBA 2ID7A 5EL0A 1S0UA 3WO0A 3HRHA 2C8VA 1OHHA 5G2OA 3U9SA 5K3AA 3PNMA 4O6VA 3VZSA 2N75A 2XOEA 2BV3A 2NQ8A 1UKBA 4R5HA 3PQ5A 5JY1A 3DDSA 1ZEJA 2DH6A 5C7IO 4EY3A 3GF4A 4WJKB 2ZYAA 2B92A 5CAEA 1C3LA 4TQGA 3U31A 2YIJA 1Z9BA 4XPIA 1U7XA 2LW7A 2C57A 1K6IA 4W5TA 1U02A 1R27A 3OWOA 2VR1A 3ZVMA 4DLVA 1E4YA 3GGJA 4Z7NB 3VPDA 3HXQA 1YS1X 2GO1A 1ZCAA 3GDFA 2CDRA 2QGZA 4W5QA 1TYAE 1VDMA 4RFSB 2J9FB 4MJ7A 4P6VF 4XVRA 2MINB 3GGGA 3U3RA 4D92A 4ENQA 2OAP1 1D0SA 2G5TA 4YY3B 1N0HA 1RM4A 2YL2A 3JZDA 1NW3A 1HQYE 1I13A 2FWRA 1DEHA 4ZI5A 4CFYA 3AM1A 1Z4PX 3IHLA 5E2BA 2P40A 5IMBA 5HZKA 2VAVA 1E8NA 3OQMA 4HGZA 1LY1A 3HCNA 3FSJX 2G0NA 1N9ZA 4ENTA 1DMRA 1H6DA 2IHYA 4Z3OA 2DUMA 1MZVA 1RE0A 4QWMA 1E59A 3H4TA 1V7QA 4JU8A 4P0QB 3CNLA 2QENA 2UYGA 4ZGWA 1PZGA 5ICCA 2Q1XA 3GJ4A 1LBSA 3CLKA 4U0JA 3EIEA 5BRAA 1E2JA 4AJHA 4UU1A 1WCYA 3ODPA 4HVCA 2FUG6 3D3EA 5FWYB 1SKQA 3IKTA 3Q7PA 1LV8A 3H9UA 1CZKA 1XLVA 3O2NA 3C6ZA 3FHCB 3O73A 1ZEMA 4HH1A 4TMKA 5CA1A 5HW0A 3OZTA 2CNKA 4CM9A 1P2SA 4LV6A 5AHKA 3RC9A 5HFAA 3GG9A 2OO3A 3AKEA 1XTTA 4U2GA 3UCXA 3KKEA 5ALVA 1PT9A 5EHQA 1BEEA 3ZTTA 2D4AA 2HBRA 2CLDX 3I61A 1D09A 4RD1A 1D1QA 4BJ3A 2R8BA 3RAEC 2F9MA 3M5WA 3WC4A 3BE8A 3BFPA 2IUYA 3VDMA 4G85A 1RC8A 1BRMA 2KSQA 1XXHA 1Y3AA 4PS1A 3WWDA 3R9WA 3FH0A 5KSZA 4FONA 1DIRA 4HN2A 4QYTA 2Q21A 4EP1A 2OTCA 2ZBVA 1RKVA 4WOJA 3V7WA 1EVJA 1Y7IA 4D98A 4KFRA 1U3CA 3A0RB 3C70A 3E3LA 3MWJA 2IEYA 1VXOA 4OMUA 1YRWA 4QVKA 3UUWA 5KTPA 3CH5A 4GSKA 3SICE 1NY5A 4NEGA 2O8CB 4DLUA 1E89A 4J16A 3MJSA 1E5DA 5PNTA 3IP8A 1H9CA 2ZYIA 4I5IA 1A8IA 3B1VA 3GCGA 5F51A 4DCGA 5DASA 2AXNA 4IWYA 1CB7A 3MTBA 4KTTE 4H08A 2R47A 3E53A 4RKEA 4RV5A 4AJLA 3B5IA 3JYNA 1K98A 3L8YA 4IMJB 4OYLA 4XCXA 2G77B 1M6YA 4IJKA 4DARA 5I7UA 1D4ZA 4HQFA 4UVHA 3ZE9A 4B4WA 2CB9A 4XVUA 3Q7TA 3PFHA 1KRXA 1P0CA 3U3KA 2J3IA 3ZR4B 2XWSA 1PHPA 2WT9A 1BXZA 1VCMA 4O2AA 1L4MA 1L8AA 2BEUA 4RSHA 2DQKA 5T7BA 3NOVA 4AC9A 2QLLA 1OFHA 2BCJQ 4TPKA 3SHOA 4DC0A 3I05A 4EWLA 4C4SA 4A0FA 4QGAA 3JASB 2WRZA 4J16C 3NFYA 4BAZA 1IWPB 2AJBA 4W9RA 2OBBA 4B3SB 4L5BA 1RC0A 4RYLA 4AYTA 4LF8B 4B71A 4XGQA 4R71A 4YRNA 2ZS8A 1AF7A 3EARA 5HMLA 5DI9A 1M8KA 4TQ9A 3CRMA 1QZZA 2KB0A 1RVDA 3BXEA 1G17A 3HXMA 2JBWA 3EC1A 3TLAA 1YOVA 2BBSA 1OB2A 1NMXA 4MQMA 2W7TA 3VX4A 4ZJPA 1W0JD 3WJAA 5KWJA 2RG7A 2GK6A 1U2EA 3V4VB 2ZK7A 5C8YF 1R6UA 5LQRA 4RK4A 1L8OA 2YMQA 2Z4TA 4MUXA 1FJHA 4OFZA 1Q0QA 4UU8A 5L4LA 5EJ2A 3OCVA 5C9ZA 5K6AC 2FX2A 3AF6A 2REQB 4IMPA 4EGCB 1CY2A 2H65A 3ANNA 3RANA 3VPCA 4D99A 3AJ9A 3QFSA 3JV7A 3IP7A 4AYXA 1XEWY 1ARZA 2NX2A 3U4HA 3V4SA 2DMRA 4GPD1 2MYNA 1W73A 4D9HA 5A3QA 4BN4A 4YAWA 1UXIA 3BDIA 5L7YA 2D5AA 3KJEA 4MS1B 1F9AA 1W88B 2V97A 3FTFA 4RULA 3AW8A 4U2EA 1U81A 4TL8A 1ZVQA 1EHYA 2XMGA 3DZDA 1EXVA 3QITA 3KSMA 1SHTX 4N5LA 4UXHA 1G5HA 1SHLA 4XYGA 2Y71A 5IBQA 1Z47A 4P7GA 4FPXA 1R15A 4RQBA 3Q8WA 4QU0A 2X8WA 1EUYA 2DB3A 4QX6A 1T5LA 3LLCA 1DUVG 3MMZA 5DOZA 5E3IA 3U81A 1DJQA 4ENVA 5DNEA 2GH1A 2G9RA 1P33A 1R4NA 2GFQA 3AU8A 3UAYA 4YT2A 1NFRA 3P94A 3F5DA 1E7YA 4PQRA 4MUIA 3OFVA 3NTQA 2W48A 1U2SA 3W5DA 5E7JA 3S2GA 2B34A 2DU8A 3OIUA 1F2UB 3ZTYA 2DJ5A 3MS7A 1P62B 3B12A 2CNLA 3HZHA 4OL0A 4ZVQA 3VU1A 2F67A 1PL0A 1E18A 2HQOA 5EFZA 4LY3A 4DWJA 4QEKA 4NEQA 5LB2A 1P91A 3VVMA 1F6BA 2HRBA 4A4DA 5J3JA 1BX1A 3COYA 4DOMA 13PKA 4YO8A 2I6FA 2OHFA 3QPDA 1FZTA 4GSYA 2E4UA 3LFTA 1VBMA 3R0ZA 2B2CA 2XBUA 1VPLA 2A0WA 2XA1A 3TDKA 4E12A 1IOLA 4PG5A 3U80A 4RWZA 3E3MA 5JU6A 2WNSA 4Q48A 3F6EX 2CWDA 4IKEA 3DA8A 4MRSA 4O2BA 3O92A 3LPCA 1QLJA 3LQ4A 3CX7A 4Q12A 2YVAA 3JU3A 3NHKA 1MA3A 2BKEA 2ENUA 1AGNA 3NGMA 5F4BA 3ZHTA 3MN1A 2QNBA 4UXJA 4N5IX 4RW0A 2JVJA 2V3VA 4ZQFA 4AN4A 4G0PA 4IVNA 4ENRA 1RTKA 3CUUA 1JG6A 4W8GA 2BFFB 5TVGA 4MYSA 2NVWA 4KXUA 3WZ2A 3ZDFA 3LK6A 3LV8A 1COZA 1H0HA 1X7YB 1YMUA 2AHOA 3UFBA 1GSOA 1M9NA 1V9CA 1FQKA 4KSBA 1MABB 4GP6A 1QH8B 2NG1A 2JLYA 4JDUA 5FXMA 1DWUA 1SG0A 1W6RA 2HF7A 2HA2A 3U19A 1GQQA 1HDYA 1KVQA 2A0FA 3K35A 4QDTA 3U4QA 3HK2A 5JZVA 3UWDA 3ONEA 1N0IA 1Z0IA 1T5IA 2GTIA 4JYZA 2GJAA 1VA5A 4PVDA 2GI4A 4KK3A 4A8PA 1KDYA 5HIAA 4TLDA 4HDSA 4ZGBA 4XIIA 5AHRA 1DBWA 4YJFA 4YCBA 5HS4A 5KPDA 4QPDA 2P8JA 3KQKA 3RKRA 2W2VA 1V41E 3BFXA 1T3LA 5EHGA 1I3KA 3LT1A 3UC9A 5DGXA 1EZZA 1TC1A 1YOVB 4MWOA 2BCGY 3S6JA 1R0SA 4DJDC 5LP6B 1CEXA 2FPUA 4LXIA 1H8HD 2XCTB 1GCUA 4FN5A 1GDHA 1GLNA 3CH4B 4L50A 3W4IA 2FOIA 4NU6A 1KKUA 1TQ6A 2JFZA 5IARA 2G8NA 3LXXA 3ROGA 4CL8A 1GQSA 4OJYA 4V2UA 4LRTB 1DINA 1P0FA 5JMTA 4L95C 4C2UA 4YCDA 2G4CA 5GM1A 3SY8A 2ZJZA 3FVRA 1MH1A 2CYAA 3DVAB 1LDGA 1SOVA 3BRWD 2QF7A 3L4BC 4GI3A 3ZCQA 4HPWA 1JF8A 4B5KA 5CW1A 5G0UA 2FAXA 4BNGA 4LI3X 1X74A 2CLIB 2ZIAA 4C4XA 1OZAA 3P20A 3KTAB 2KLBA 2FEWB 3RKUA 1T2NA 2JKYA 1Q22A 4WCFB 1SZDA 2OQIA 5BNFA 3SYTA 2XOKA 4QBKA 2EZ4A 3U5TA 3C43A 2XB2A 2GILA 4KO3S 3ZE8A 4QYIA 1P4HA 3U7GA 4MCAA 2J9XB 4RTPA 1NBOA 4QUIA 1NN1A 4RLFA 1NIJA 1PJBA 2ZSBA 4A15A 2B35A 1OBOA 4BO5A 1TM5E 1KYQA 5U4XA 2QN9A 4X6YA 2C4MA 2XECA 1CVIA 1SA0B 3WGUA 2JIMA 5HJ7A 3H04A 1YOBA 3GLHB 3WNBA 1MXHA 1JPNA 1VL6A 3R5SA 3DBOB 4YJGB 5KJFA 5AKZA 3PD1A 2G40A 3OOWA 5EWMA 2I7CA 3VAZA 1ZQ9A 4AG6A 4OK5A 3RQSA 4I8IA 1U9IA 4IG9A 4KQMA 1ZD5A 2V5VA 3PXXA 3DMTA 3G02A 5IWAB 1V45E 1P2FA 1I2AA 4F92B 4M1OA 3I37X 1LLQA 2G9VA 1B8PA 2MYTA 2GD1O 5I3CA 5T4EA 4BO4A 4ZQHA 2WYWA 4GYKA 3EJWA 1KI6B 1U8YA 2QUAA 1NG1A 2NU6A 5KNBD 2F8LA 1DE0A 3WGQA 1EK5A 1RFGE 2FZCA 2GTHA 4HDMA 1NZDA 2W4IA 4KFCA 5LJLA 3GMTA 1R64A 1SKAA 4G5RA 3R9KA 5ADVA 5LUAA 1LI7A 4V1CI 4JROA 5KNDD 4JKOA 4G4SO 3E27A 5K8LA 4BQOA 2ACWA 2RGGA 3IEIA 4ZXFA 5H5JA 4PC3A 2ZR8A 2RHOA 3AEKA 1IMJA 3B48A 4KNVA 4GX0A 3WTBA 3DO5A 4E08A 1E9CA 3LCMA 3C6BA 2BC9A 3I04M 5BOVA 5AVXA 5LKRA 2AEMA 4TSKA 3MG9A 4M36A 1RYYA 3DCIA 4RMNA 2Q5OA 2W2PA 4UPVA 3ZIDA 7MDHA 3L04A 2YNMA 1QAOA 5I9MA 3MWEB 5IRCD 4DIOA 2Q6LA 1A9SA 5JJ5A 3DZHA 1PUIA 1E9EA 1RHJA 4CLXA 1ZKDA 3B3FA 1A2OA 2RHHA 1QK5A 4UBOA 1OU0A 5AH0A 5HXAA 2EVWX 1TRKA 3G2NA 2ZT7A 4PLHA 1CUEA 1WHSA 2VJOA 4MQUA 3TFOA 1U0RA 3QPCA 3LUCA 1WY5A 3E9CA 4HP8A 3UYKA 4B6JA 2F90A 5KYWB 5CB4A 4DUPA 2YHBA 2NVUB 1ESCA 3O7MA 1YZ3A 3LRPA 4UPEA 4NJOA 3WQBA 5D2CA 1NF2A 2XY4A 1IJFA 3C4VA 1BS2A 2AD1A 1XVTA 2DE0X 2SICE 1PLLA 2WM3A 4BFSA 1ZZEA 5EMHA 4E5UA 3OLVA 3VR3A 5U9CA 1O5IA 1TNDA 4PTZA 2WYOA 4G5XA 5DK4A 1UFRA 1V8OA 1LW7A 3KTFA 4MR7A 2VDUE 4ND2A 1GZ7A 4OI2A 3A6EA 1HDIA 1PO7A 3ZY3A 2GX6A 1JA0A 2C2MA 2D0IA 1KFJB 1KAQA 2PMWB 3CBGA 4YMSA 1JLKA 2OA0A 2Q7OE 1DNPA 4DMFA 3NDRA 2P5YA 4KPGA 4CKWB 2ZJBA 4BB0A 2FUEA 1PGPA 4W1RA 4NZOA 2NYUA 2X8BA 1N1DA 4DSZA 4LQDA 2BTQB 5CNJA 4BNXA 3WBBA 1K3UB 4G9BA 3X1XA 4IXWA 3ICEA 3ZQ6A 3TTUA 1C9MA 1WDLA 1OYYA 2Y99A 3DL0A 3ZJYA 5FWNA 2JLAA 2PGAA 3FHTA 3NRJA 1CQWA 4K9SA 3M82A 3EPJA 4QA9A 2BAGA 5AFSA 5LM3A 1OSNA 5K0JA 2Y93A 3GNQA 2D5LA 4IH9A 4R1LA 4UNPA 4Q7QA 1II8B 1LRJA 4UE2A 1MLDA 4BKUA 1V11B 2QTZA 1GKYA 1TK3A 3UHPA 2G17A 2PBLA 3IUQA 4U6NA 2DPGA 3EZ9A 4NMXB 4DEXA 4F8JA 2R8EA 1HXHA 1TD9A 2ADFA 1JEJA 5LQMA 1LC0A 3H4MA 1Y5MA 3HB1A 5A1JA 5LD2B 2VHYA 4MPJA 3D59A 2WYIA 4ICIA 2K7FA 2AB0A 5JCOC 4CF5A 3QV2A 1LVUA 4L57A 4AO8A 4XWYA 4NOLA 5L4NA 3EVBA 4XWTA 4H6WA 4CDNA 2WSBA 3GJ6A 3PT5A 4L15A 3PF8A 1KEEB 4HMOA 3ZWNA 1C3OB 1TE2A 1YQGA 1D2RA 4RCYA 3SDBA 4EKIA 3KPJA 3WIBA 1OH8A 1SEPA 4F6CA 3BF7A 3CXUA 4M86A 3QW2A 3N87A 1EUZA 3GQVA 4JU9A 3IIKA 5EFOA 4O63O 2C2GA 4MKHA 4MI3A 2ILTA 2C82A 4X8OA 1H3EA 1I33A 5JAOA 2GZHA 2A0UA 3K6RA 3TX2A 2CFIA 2BGWA 3RUPA 3S2EA 4Y2VA 3LTEA 3LT0A 3MRTA 2VF7A 1FFHA 3BMOB 3IBTA 4EBBA 5C1PA 4PRYA 1JEOA 1Q7BA 2QMOA 3PL5A 2VWGA 4EB6A 3KE9A 2WEKA 3HWRA 1E2FA 4A0GA 1JHXA 2GK4A 1IBCA 4RTKA 3TZKA 3NHPA 2VPWA 5AOAA 2QAGA 3LPLA 1JR3E 3FR7A 4LZPA 4NBSA 3QLEA 2H2AA 2L0XA 3A27A 4ANFA 5JH7B 2J07A 1T9CA 3ABRB 4YGXB 3VSCA 1GRVA 4U3JB 3PDIA 5FPYA 2QSYA 2DLDA 1I9GA 1X3SA 1WNFA 1XA3A 2D59A 2OWDA 3QTTA 4L2IA 2NQTA 4OHKA 1EP9A 1HTBA 5A06A 1PTKA 4PR0A 4ER3A 5CVTA 5AVSA 1N78A 1G7SA 1NC1A 3BD8A 3H16A 1OFIA 4C6TA 2R2GA 1SD1A 1NJ8A 3ZWVA 5HK8A 3COWA 1QVAA 5JSYA 5C81A 1Z6TA 3EEQA 2DULA 2JAUA 4AN1A 1MD9A 4BO0A 1N5DA 2BBOA 4J3FA 2G07A 3TRHA 4Y1FA 4DB2A 2ZUFA 3K32A 1G21B 3D31A 3JVVA 5JFOA 1KHTA 3Q15C 4F7DA 5D3MA 1DC5A 3NYQA 1LNSA 5CCBA 1EA7A 1ESZA 5C1OA 1RZVA 1K7SN 2ZRPA 1NOKA 3C1TA 4CMGA 3S2ZA 1K4KA 5IC5A 2O7NA 1KC1A 4DXDA 4NYIR 4ZQBA 1VJ1A 4PU0A 2PX6A 3Q7IA 2HLDA 1S2OA 3PQ6A 4R9VA 2IYUA 4IXTA 5EINA 3TEFA 1W4AA 4CEJA 1FW6A 3FKSA 4ZQIA 1RCUA 3GLKA 2W2QA 3ZW8A 1EPUA 5BVGB 1ECFA 3CX8A 4MVJM 4RABA 4XFDA 3NIWA 4DMRA 3H5IA 1UUFA 2BM9A 2PQMA 4UCQA 4CI0B 4F4UA 2HWXA 2HYIC 2HHHB 2NXJA 4UFNA 4YRBA 1U2TA 4ZVTA 1AS0A 2W5UA 4QOFA 4PGAA 1ZI9A 2V7UA 2WD9A 1II8A 3AM5A 2Q3HA 3UPDA 2D6FA 2WK1A 4FYWA 1WR8A 1TJPB 1QP4A 1Y1TA 1DHRA 5CD9A 1F3LA 1XFAA 1YIAA 4JENA 3FETA 1J2RA 2C5HA 4C0BA 5A4IS 1RE1A 4PTYA 2VATA 4L4UA 5A4MS 3D7SA 4ETWA 1O6ZA 2XVMA 3L1JA 1FUUA 5K0EA 3OLCX 4CLRA 1AKMA 2JH9A 1QE3A 2PH5A 1B2RA 3NNNA 1CZOA 1EWTA 3G2MA 4DKJA 3IUMA 2MYPA 1H3FA 2M6KA 4JP1A 4V0MA 1JIJA 1VIVA 4RTMA 3IQFA 3T7SA 2AKEA 3DKIA 1HYEA 4V38A 1ZOIA 1H8EA 1I6WA 2E5WA 3AYZB 3F5MA 4FSHA 4NV0A 4ZT2A 1H1LB 3NEAA 3K15A 2A5FA 3KSDO 1O4VA 2BDTA 3PHJA 3L7MA 2NN3C 1GRNA 2HGSA 3VOAA 5CG2A 1GA4A 4MARA 4D0GA 3E8MA 2HUPA 3K3PA 3WIDA 2VQEB 3WHPA 1WB6A 2AI2A 2V7GA 4JLSA 3VM6A 5JCXA 3T1VA 2AEJA 4KZKA 4BKQA 2COUA 1FQWA 2J0VA 1TA4A 1XCJA 3JQDA 3RSCA 4QXQA 2XCIA 4M0DA 1HO3A 1T91A 2VDNB 3OPYA 1PFKA 3ELWA 5KYWA 3LL7A 3WK5A 1FMLA 1RPJA 1JH8A 4L07A 5JXJA 3CNHA 1UXJA 2BJVA 5DE3A 4M38A 4DPLA 1DXYA 2IELA 5DSTA 3AY0A 4LRWA 2VVTA 2YWGA 3VPFA 2H92A 3EAFA 1O0BA 3GP3A 3IPXA 3DKRA 4AZ0B 1E1RA 1QCYA 2PIAA 3I72A 4DMCA 1LQTA 4N7JA 1TYBE 3G7UA 1BIFA 3RR2A 4U8GA 4YMHA 3H8SA 3FYHA 2EKLA 1Z2NX 3GUYA 2FR0A 4TXLA 4AVYA 4DCVA 3USES 5FKJA 1E5VA 1OZ0A 3P45A 2PS1A 4MPPA 4PC6A 3DMFA 2NTVA 3GRKA 3CVVA 3IEVA 4FFMA 2Q5CA 4P4GA 4BFYA 3BWVA 4F5YA 3KETA 3DUFA 5F35A 1CETA 3KIPA 1OLSB 4Q5IA 4AJNA 3MILA 2P9JA 3I76A 3KFXA 4AIRA 2YVKA 3U3JA 1FNSA 5K99A 2JJYA 3MINA 4KYTA 2G28A 4L3VA 2R97A 1W5FA 3B1YA 1WZ2A 2CVOA 3ZY4A 3CEPB 1V1MA 2QNIA 3I28A 3K70D 1M8FA 3AIIA 4EGSA 3KQNA 1N5OX 1RWNA 2BEVA 2W90A 1L4FA 4AZ3A 4CCAA 2O6LA 4C6HA 2OILA 5IJ0A 4ZAFA 1SCKA 3EVTA 4C29A 3F9CA 3MUFA 1MTOA 1N6LA 2BLNA 2PA3A 1W48A 4UQLA 3FWYA 4C08A 1JR6A 2GASA 1FRZA 3PHIA 1VA4A 4QUAA 3W7AA 1NE2A 1BD3A 4BZZA 3LA6A 1J21A 1LSJA 3UV6A 2I9PA 1IH8A 4E88A 4C4PA 2GJSA 1KYXA 3AL2A 1MB2A 2DX7A 3H1AA 1IFXA 4JUAA 5LWHA 1Z75A 1QM5A 5JD3A 1J8DA 2WV9A 1NVVR 3WO1A 3NT2A 1UBSB 4E46A 2VUUA 4HH4A 4MR8B 1MEJA 3GDOA 2N0SA 1EWKA 3DGFC 3P27A 4BP1A 3SOPA 1GZDA 1Z7BA 2D2EA 4Y98A 4R9SA 2LZ0A 2WAAA 2ZIWB 4LFBB 4KWTA 1MRNA 3OCUA 3GOQA 4UQOA 3C6YA 4FHEA 3MRSA 4BLOA 4C3VA 2OV8A 1GN9A 2VJQA 4RIHA 4OL9A 5C8YA 2FKNA 3HI6A 3L0DA 4DF3A 4Z7QB 2BTEA 3D9QX 4QIHA 2C78A 3TGWA 5AM1A 4PX9A 2VCYA 1JXOA 3DEYX 1LLUA 4BV8A 1FYWA 3DVAA 3K8YA 4P93A 4BX9A 3O4JA 3CR3C 2PYDA 4JHXA 1NBWB 2J0UB 4JOSA 1RKQA 4XEUA 5EUCA 4OQMA 4D8UA 3CR7A 1LDNA 2CKDA 3EVCA 1B43A 3OT5A 3JPWA 4FCWA 2EWMA 4CF3A 5ABPA 3CO5A 6NULA 3C6XA 4KXYA 1OFTA 1P0PA 4EUNA 3NBAA 1II0A 1DIAA 2R1TB 2EX1A 1XZEA 4FK8A 5AWFC 3UW1A 2R7KA 1NG9A 1HGXA 3A7EA 3TZCA 2I3BA 1Z0FA 2PWAA 2FN3A 3BMQA 1B41A 3PVZA 2BF7A 1EGMB 2ISSD 2Y1FA 4PPNA 2GDJA 3ZV5A 3IDFA 2Y66A 1OGYA 4I6GA 3AGQA 3DBHB 1K3TA 3II6X 1XCPA 2M1ZA 4XD7D 1A95A 1MPTA 1U2DA 3W6PA 1A1VA 2B8NA 1ZAYA 1C41A 5J5VA 1E2EA 4TLBA 1RZUA 4FE3A 1JIUA 1WD7A 1DAOA 5GONF 5HF6A 4Y1GA 4L8FA 5G3ZA 1KDZA 3WDKA 2CY0A 3A3OA 2WM8A 5D1NA 3WWCA 3IP3A 4BLVA 4ZI2A 4KN9S 3RIYA 1EB8A 2W2OA 3C7AA 3KLBA 2NUTB 2P35A 2IDZA 3H6HA 1RJ9B 5A9TA 1ULTA 2CFTA 3PD7A 2QJWA 4O2BF 4OGFA 3DE3X 2ISCA 4KIWA 3SLGA 2VNKA 4ABTA 4MWTA 3O74A 2OV2A 4RXMA 4PYIA 8MHTA 2BGMA 4ZOAA 5KJEA 4QSHA 1KE2A 5C1DA 4UQPA 1KAOA 3TMKA 4QAQA 2XZOA 5B55A 3KT6A 1KDPA 2BFFA 2PT6A 3D2CA 3OTWA 1O9BA 4FM9A 1JGTA 3S2IA 3DCYA 4I1IA 4ZV9A 1YA6A 1KYIA 3DWFA 4LYYA 1EI9A 3L9XA 2QK4A 2WMNB 4FB5A 3ZU6A 3O84A 5G0VA 3ICCA 4HY3A 5ICFA 1CUAA 4JXXA 3KC2A 1DEAA 4EAQA 3C6MA 3VKVA 1O08A 1YAHA 2Z5VA 3ZWKA 2WUVA 3QXXA 3SGLA 5KNCH 3DLBA 5DNDA 1UC5B 4UBLA 3LLMA 5G1NA 5T8KA 5KSWB 3WGZA 3DQZA 1KDTA 4PY2A 3SOZA 1SNYA 2JVIA 3PF9A 4JBNA 1UOPA 5CMLA 2Y1LA 4G41A 4IIUA 1H2BA 3D6TB 3D0KA 1PS9A 4JJ4A 3T4XA 4D6XA 2CN1A 4TV8F 4I0WB 1NXXA 1A04A 3CRW1 1DPFA 4C5CA 3KYIB 1E94E 1WKVA 4TUYF 3HFSA 4FJ1A 4E4YA 4TMWA 1U99A 1A27A 2R7AA 3PGXA 1H23A 3LPNA 2WVHA 5FO0A 1YJQA 5YASA 4Y1EA 3K0HA 2GEBA 1IG3A 3PUVA 4FFBA 3WA7A 1NVMB 1EFPB 3C5HA 5A3JA 2RAVA 3F49S 2DR0A 1L8QA 3EXFB 3OKCA 2DH5A 3R6TA 1CZRA 2A5YB 4EYQA 4DAOA 1QZXA 1AO3A 3DB2A 2PO5A 3AHDA 4H1TA 3OP4A 1YFKA 1BKSB 1MNQA 3IAM1 1FYEA 4I50B 1COWA 3R7SA 5EIEA 4N49A 1JP7A 3IT1A 1LPNA 1ADYA 4DCPA 1RJFA 4G84A 1VSUA 1YTLA 3ESXA 2DZDA 4LMAA 1UFVA 1NSTA 1OGJA 2GPJA 1BG6A 1XHEA 2QVLA 3DV0A 4PLYA 1Y98A 3LGAA 4MI9A 2AYZA 3VR5D 3FYSA 4NU5A 1YKFA 3PKIA 5G0SA 3OE1A 3VOBA 3VTZA 4RTSA 2XMZA 4AZTA 2VPYA 2EFGA 2CL7X 2Z83A 1X7ZB 5L3SB 1MJGA 1KEKA 5HJ5A 1LW6E 1A97A 2ZBRA 4YMGA 3VFDA 5AVOA 1Z8HA 2WZBA 3U0BA 1DDGA 2R3SA 3I5MA 1H94A 3FWZA 2C3YA 2EZTA 3DP7A 3BA6A 5IG2A 3QTLA 5KOIA 4WGFA 4KRFA 3T3PB 4KIJA 1YJBA 4TWBA 1JBKA 3E81A 4XVQA 5KTRA 3WL6A 1PNOA 2J3LA 4PG4A 8AT1A 1QGYA 3ASUA 1RVV1 1UK9A 3FI0A 4B81A 5LYJB 3R3WA 1SXJC 4KX5A 4XR4A 1GNPA 1TEXA 2ZYRA 3JPYA 2VJKA 3OM1A 1ST2A 1TO2E 1YQ9A 4GECA 4MVJF 4BZXA 5IASA 3BH0A 4Q7MB 1OKKA 2QJFA 5LCXA 3GGCA 4EJFA 4YHHB 2MTBA 2ZSIA 2FW8A 2PN1A 3DBLB 1J2EA 4RD0A 4HQOA 4P35A 2ZAIA 3D5EA 5ERGB 2PZ8A 3K8QA 3JW8A 1L5HA 3S8MA 4ZZIA 2XB8A 4DDVA 2PBFA 4AM8A 4Q1DA 2PKYX 1JLHA 2ADMA 1TCVA 3LZCA 2H9IA 1G3QA 2ZZMA 3AKZA 4ZZ1A 2R4TA 4J8PA 1PJSA 1E1NA 2X7XA 4UHFA 3GVPA 1UXHA 1ZD3A 3NWOA 4GZMA 4JNKA 4O2RA 2PYZA 1GJRA 4TUYA 4UARA 1TTTA 2OFXA 4D8TA 1ZD9A 2ZGVA 1KVSA 2ZRQA 2VTKA 3LY9A 1SXJA 4TLMB 1CF4A 2EX0A 5FUYA 4FWIB 4CKCA 1ZP6A 2ZITA 5CJPA 4C43A 2GN0A 3O3CA 4U8HA 4O4IF 4X20B 1QQ7A 3SZUA 4KYIB 2O1EA 3T0FA 3WRXC 5KBYA 1E6UA 2OQ2A 3GPLA 2KPOA 3HJCA 2SBTA 1P8JA 4WMLA 5EIXA 4GPAA 1KYZA 1FFEA 4KAXA 4MQFB 4WK4B 1H2HA 3I09A 2NSDA 3HWX1 1TM3E 2EJBA 2AMYA 3MUOA 2GPTA 4FWBA 4EEZA 1HYQA 3H9JA 5IUJC 1WLYA 4KXXA 1SUWA 4PW0A 1LF0A 1UBHS 4LTNA 1SIUA 2BRUA 2JIPA 3NJ4A 4CDMA 3TMYA 3NHAA 4BNDB 3VDXA 1ZHFA 1G4AE 2C7QA 3EGWA 5HPYB 4OXIA 2BMEA 3GJRA 1ECPA 1H0RA 2R7MA 3SYLA 4JJFA 2QVCA 3L2OB 2GRJA 3WRXA 2AUNA 3N7TA 3TF5A 3DNFA 3WWPA 2ZWIA 3B60A 4P0PB 2ZIVB 3OEYA 4JC0A 4JVSB 3PTZA 1J0DA 2IIQA 4W5HA 3K96A 5HCIA 1I1NA 1IAQA 3E82A 1M2HA 1WUYA 2CJPA 2GNPA 1SVWA 3N8HA 1F2DA 3JRXA 2V98A 1JV2B 3GFTA 4Y2QA 1GXSB 1NT2A 1WULS 1PWXA 4WA8A 5F78A 4CCWA 7REQB 5K8IA 5KTMA 1HYBA 4ZU6X 1AKYA 2CNOA 5TQ0A 3NHLA 4RM2A 1M34A 1OTHA 2KYRA 3OFND 5ILQA 2H1HA 1YS2X 3NBXX 1H3NA 1POXA 3G9QA 3U26A 2GBGA 2Q0SA 2XMBA 2ZVQX 3HM2A 4HNRA 1BXKA 2C4WA 1M7BA 1WXFA 2FJUA 5IJ9A 3G2LA 4X6UA 5H80A 3KZOA 1KH3A 1Y9JA 4RPLA 3B3QA 3DHEA 821PA 3ADDA 1NJFA 2YDXA 1XYVA 3SC3A 2HWKA 4KNWA 2WF5A 521PA 1CUHA 3RYTC 1JPVA 4XVCA 3VAYA 3F5QA 1W46A 5LOVB 3WLMA 2L18A 3ORQA 5FWXA 1TLTA 2FW9A 1ULSA 4ILEA 3SC2A 2IYZA 5K8CA 2P5SA 2O07A 2IGBA 3MA0A 5EXSA 2XT6A 3VHLB 1KDOA 2OLJA 4TSFD 3IQGX 2JAPA 3VA7A 2Q49A 3ELDA 4UMEA 3GHYA 5CURA 2DLNA 3UJ9A 4BNWA 4X64B 4B76A 1LJ8A 2PKCA 3N7AA 2WJIA 2X5XA 3GJYA 3N74A 3O75A 3E9EA 4NE7A 4AF8A 2OUIA 4K7JA 4C2AA 4CUZA 2C3PA 4U6SA 4IIDA 4Y1RB 4KGVA 4AMZA 3IX7A 1NASA 1X9HA 1WW8A 4K3VA 2I0FA 3MT7A 3THYB 4DBLC 5AO9A 3NFRA 4X61A 2CXPA 2HPVA 1GR1A 4I5EA 5FOTA 3D7LA 1R10A 4YH1A 5CVVA 1JHYA 1HKUA 4ZCTA 3B6IA 3TNJA 1ESDA 2Y6UA 2QX4A 5ERYA 3STUA 2H5EA 2VHJA 3QVVA 3HN7A 3PE4A 2FPGB 2GCOA 2TMYA 4MHOA 2GEJA 3DGEC 3OAAD 4BFCA 4K8OA 1JFRA 3P2EA 5A3VA 1J33A 4C07A 1QPZA 1ZKMA 4FYXA 1MG5A 3SNKA 5HF5A 3W5VA 1QIMA 4JXZA 1G5FA 1E62A 4XTRA 2P9FA 3D5TA 2J09A 5L3ZA 2YY5A 2JFHA 1WPGA 2X1LA 3D6NB 1CJCA 2L2QA 4LHEA 4XW2A 2GD0A 4FBLA 5A9SB 4JT4A 4IEFB 5TS3A 1UOQA 4L1KA 2XNHA 1VMDA 4QJIA 3TCNA 4Q24A 1O97D 1SCNE 3OX3A 4JUBA 1RBMA 4YNBA 4LHWA 1E1QD 1GTZA 1J00A 1TJYA 2LTAA 3U56A 2P1RA 3HEBA 4E4TA 1AMNA 1K4YA 3PVSA 4TQAA 3SXJA 4E2WA 5KZMB 3ZD6A 4E30A 1KIAA 2X2OA 5C2JB 2IZZA 4RGVA 4LRYA 1YUBA 4O5OA 2NM0A 1FXWA 1UL1X 1E3WB 1U28A 2BZ1A 2P0EA 1WTCA 4YDSA 4WFQA 1GUFA 1ZW6A 2I55A 3VYVA 4CMAA 4CTNA 2PX4A 1BNCA 1LBEA 1FOEB 4FLFA 1JJAA 1N8NA 2XLBA 5F9HA 1CE8B 4QGSA 2F00A 3JWGA 2YUTA 7AT1A 1JQAA 3OZSA 2VPZA 3LYHA 3L8GA 1F5NA 2RIRA 3AEQB 5A3SA 2PL9A 4NI5A 4QLOA 4QECA 3WDMA 3VHXB 2UYCA 4BO6A 1L5FA 3INRA 3O8OA 2PUVA 4LWPA 4RZ3A 1FDUA 2WSMA 5EJAA 3E70C 2CLFB 4V0OA 1K97A 2DRIA 2D5IA 3I73A 4QUKA 2E4ZA 3PI7A 1ZSVA 3VC1A 1XPRA 5C0OE 3SIWA 2D54A 2YNMC 4QUDA 1A2QA 1X7HA 4D9JA 1TT7A 1XR3A 1X8KA 4YR9A 3DOIA 5E4TA 4ZHSA 1NF8A 3G9UA 1NQWA 4J1TA 4F4FA 1QSGA 3VU9B 2XKJE 4IZIA 3BCUA 1PJAA 2C3MA 4MUNA 4PQEA 3DXYA 5AIAA 1VSBA 1KJQA 3GLQA 1PT5A 5JNLA 2QKYA 2FXIA 4IZ6A 1R6XA 1QOZA 5CITA 1XXHE 4Q4HA 4RHXA 5AYVA 4F6RB 1DG3A 1R0ZA 3DS8A 4Q39A 1M1YB 1U3UA 3S1AA 1UJMA 3KV1A 2JEOA 1CRPA 4JI7B 2CXOA 2GHIA 4YMLA 1IEXA 3IMFA 4GBED 3BZWA 4L08A 4XLZA 4I4TB 3EFEA 1U65A 4HG2A 4M7RA 5EI5A 2OB1A 4BAGA 3OQBA 1SVIA 1P73A 2IGTA 4DEYA 2Q3DA 1N2BA 4DQVA 4Q82A 1EUDB 2WP0A 2QX6A 3T15A 5A5FA 5HP4A 3CCFA 3EAGA 3NUGA 4AY5A 3TW8B 1J5EB 4RTRA 3CM0A 3OHSX 4MRAA 3MOIA 3EXIB 3DONA 4EABA 3RIEA 1IC6A 5F21A 3W4KA 3OE7D 3ZWMA 1DJOA 1NKVA 4TRMA 1RD4A 1UJCA 3CZCA 1VYVA 3I6BA 4M21A 5E4YA 2WAMA 2A1UB 1N33B 1L7RA 3D6UA 1DC4A 1R6AA 4KPUA 3O03A 5FD8A 1SUSA 1XA4A 3TB4A 4XWGA 3DDHA 1MV8A 2WJ3A 1Y7HA 2VP9A 3KOWA 4ZOBA 3GJTA 3RASA 1NYRA 4CLOA 3PE3A 3WGLA 2J08A 3WV4A 4LKRA 2H2WA 3NDIA 4M6WA 3K0CA 3LW8A 1TF5A 1B4DA 2B3TA 1SZPA 5TV2A 1EBFA 5E95A 2C2HA 1OAOA 2WAYA 5C8ZA 5HZGA 3EUFA 1U5CA 1V43A 3BBLA 4ZCQA 3Q85A 1XD2A 1XMSA 3NKLA 3HN2A 4DZZA 3QXSA 4IDFA 1FUYB 2V7VA 4LBZA 3GRUA 3HCCA 3NEPX 1L2TA 3SEQA 2I76A 1GT6A 3CGWA 1NZFA 1T0PA 2CCGA 2HRDA 3C74A 3QIVA 2FPPB 5AI8A 3MHTA 2HSZA 2ZYVX 3V48A 3EBPA 2G09A 1RCFA 4XDZA 3T41A 1EZ4A 1WHTA 2FPKA 2PCLA 3NEJA 1JAHA 4PBTA 3DE5X 3U7EB 2VRCD 3FMVA 3T52A 1W1UA 3ZE2B 2W2LA 5CB6A 1HZJA 5TVKA 3B6EA 4G0YA 4PNEA 4PGFA 4Q3DA 2BDEA 3JVEA 5D7BA 3K0CC 2A5DA 3I0NA 2QT0A 3C3CA 3F4KA 4HGRA 1H2AS 1HDRA 1Z07A 1ZMXA 4LRQA 3UQZA 3M6UA 1XVLA 2AH5A 2C4NA 4QPZA 1NJ1A 4R8VA 4S3MA 5TARA 1GV1A 4ZDKA 4E03A 2A9JA 3WBJA 2NOAA 1EFVB 4ZARA 3UOGA 5KYTA 3GGPA 4DGSA 1W4BA 3SBDA 421PA 4F0JA 5SZKB 3QVKA 3H8WA 5D87A 3ZBQA 1KEUA 3DP9A 5IPFA 3QE0A 4IG4A 5FORA 1E77A 3INGA 4HNTA 1GTMA 2HXYA 1Y81A 3EPKA 3FOAA 1QQAA 1I1OA 4FFDA 2O2EA 1FZQA 4B34A 3E05A 4LS3A 1CJTC 4C20A 1OTYA 1K5HA 1Y4AE 3BD6A 4HYEA 2DOKA 3PJFA 1L9KA 3DFZA 5T67A 4D8VA 3EZ7A 2HSDA 1OI4A 2C61A 3DWEX 3EVDA 4Y18A 5FJIA 3ETDA 1J39A 4ZT4A 1EBUA 2CBGA 3FJYA 4WFIA 4O59O 3EOBI 4JUFA 4WBNA 1ODKA 3RLFA 2WSLA 5MN6A 1AA6A 4BVGA 1UT6A 2QMHA 1U4SA 2A9FA 4ZDIA 2Z1DA 3BORA 1WNTA 4B7CA 2ZI3A 4NMHA 4UBKA 5EC8A 2VCEA 1TGVA 1M1YE 4YQFA 1FTWA 2PSFA 2VHVA 1YUMA 5FBQB 3VR6D 2HEIA 3JQBC 4JNCA 1QR2A 1B8OA 5ECYA 1WU8A 3SJZA 3SZMA 4D3DA 4HXYA 3DOJA 5HJEA 3BL5A 3LT4A 3NDJA 2FU5C 1D4OA 3GLHE 1CNFA 4MS3A 1C3XA 1M2FA 4NYMR 5DGHA 3PA6A 3T3OA 1RSZA 3DT8A 1VCHA 4KQWA 1CVLA 2VZ9A 2V45A 1PRYA 2VJNA 5FNVB 2OHIA 3TTTA 3VC3A 4D41A 3EF1A 4EW2A 1DXHA 3WLAA 3AZPA 4RDXA 3G8CA 2FE4A 3KYBA 3ZCXA 3A6DA 2NQ2C 4MKGA 4DA7A 4XSHA 5IDVA 1OI3A 2OCPA 1NFFA 4AMBA 1KGDA 2GJ9A 5A6VA 1C3EA 1YQDA 2YOGA 2W2TA 4MCIA 4QQNA 3AEZA 1J23A 4F3YA 1R2QA 2I4MA 5COBA 1NUHA 5F7OA 4NATA 4OSPA 3T7AA 5DI3A 5TMEA 1E3TA 3I92A 2D74A 4GRDA 4EGJA 5EJ5A 3P9IA 1TVCA 4KE9A 3RW9A 2ZYUX 2QMYA 1BS9A 4R6WA 5LZ5A 2RHWA 2QN7A 1UIRA 2HTEA 1GG5A 3EDOA 1UKVY 1V37A 1RW4A 4E31A 1HNZB 3TJRA 3H2BA 4GR9A 5KDOA 2Q8QA 5BW5A 1CF2O 2R7LA 4ZQEA 4RNDB 3ME5A 4DFDA 1BU8A 4FDMA 4HJRA 4R2LA 2H2IA 4RZHA 3MZ0A 4CM1A 1YR7A 4YMVA 1NN5A 4KK4A 5ER9A 1DCMA 1GY8A 2PZMA 4DREA 1AXRA 2GYWA 3AI3A 2VI5A 4RA9B 4TXJA 3SZLA 4HX9A 2ES4A 2WTNA 4WOBA 3RREA 1EVKA 2NIPA 1E2MA 2KI5A 1E4EA 3TGLA 3MWDB 2R60A 3ER6A 4OJNA 1Q2XA 3ZYCA 5FH9A 1ULHA 4MCHA 2Q7XA 4IMRA 2GZRA 2ZT8A 1RQLA 2FSHA 1KMCA 3BXFA 3E22B 4JB0A 2HA7A 5JSZB 3QPVA 1FNNA 1KU0A 4BMXA 2P1DA 4IBOA 3WB9A 3KUXA 4QTXA 4IDAA 3EE6A 2IHVA 4HT3B 5BRNA 1YZGA 3LC7O 3G23A 2Y0CA 3GCDA 3QHAA 2XNSA 1M7GA 1P5JA 3EXEA 4NDZA 4BB9A 2ZRMA 4H59A 4Y6RA 4TUYB 4BMPB 1MQSA 1GZ5A 3QVWA 2Y1GA 1PDOA 3B1XA 3OZFA 4S05A 4OB8A 4Y8VA 2C95A 1NXQA 4DLYA 3E7DA 4HB0A 4WERA 2MHCA 5HCUA 1X3LA 2JPDA 2IOHA 2AJLI 1UQUA 5EMNA 4AUMA 1LPMA 3CWZA 4BFLA 4DBVO 2EIHA 5IX8A 2YFQA 1Z6QA 2XB6A 4RPJA 2O5VA 1MP0A 1DADA 3HY4A 5KI6A 4EG0A 4EEXA 3ROFA 4DL9A 4DLWA 5MFPA 3FG9A 5K6TA 2C8LA 3CTPA 4WQMA 3OPVA 4KMMA 3FAZA 3GZNA 1PUJA 4ZJZA 1MAVA 2VH1A 3WS7A 4X90A 2XMDA 4WXRA 1O89A 4RD6A 3FSRA 3L8ZA 4RESA 1O6CA 4XEHA 5LP1A 1KSGA 1JZQA 1IYZA 1HEUA 2CLEB 3HC7A 3I04A 4ZC8A 2C9MA 1J5PA 4FHGA 4G4SP 2PWZA 4PNHA 5ESWA 1G7TA 4Q9JA 1JXMA 4GC5A 3KSBC 1RM3A 4LY0A 3X2SA 2QU8A 2CT8A 2HA4A 4R3WA 1ZWLA 1P7CA 1K75A 2R62A 2APJA 3WJ1A 3OCYA 4EFDA 1QU3A 1JDNA 1QG6A 1T2UA 1X7ZA 3GEHA 4NCXA 2JLSA 2AQIA 2X2FA 4JKIA 3W5IA 4H1VA 5GJBA 1U11A 1E9DA 3B2QA 4D4IA 2A88A 4ZO7A 4E1VA 1NDQA 1JIKA 2O2GA 3SYKA 1JDZA 3W2IA 3R6WA 1FF9A 4HOYA 1K2WA 4KBYA 5EE1A 4BFTA 3ND8A 1BYIA 3K92A 2J7PA 3BERA 3Q2IA 3PPYA 4R83A 2R6AA 1BSVA 2VDMB 4NQZA 4EUFA 3WB1A 3H9BA 1YO6A 3A2LA 3L7KA 4HNAB 5EWJB 4BMDA 2NPOA 4N0MA 3OEHA 1NM5C 1V4VA 1L7VC 2JZOA 4L0CA 4WKBA 1UBCA 4IRXA 2YH2A 3OI7A 3HH8A 3TSAA 2GBCA 4Q7EA 3PWTA 5CB0A 3L0OA 5E1OA 4JYPA 3ETHA 3IA7A 2DR2A 2QG6A 4BVBA 3W3ZB 4XGNA 5JC8A 5F3DA 5JPDA 4WXMA 4EZEA 3E35A 3CPEA 1N6OA 1L5RA 2BI7A 1D8TA 3ZH9B 2R84A 1MOZA 4QXMA 1XTBA 2P2GA 4N6NA 2R7NA 1A71A 4S0XA 2OHVA 1BVRA 2EJTA 3IO5A 4LY6A 3RU9A 3COVA 3W34A 4BVFA 3PFIA 5FTLA 2P6PA 5J2TF 5EP4A 5TPWB 4UEQA 5AM4A 3ZI0A 4P8RA 1SN7A 3W2GA 3UICA 1EQ2A 5J4VA 4LF4B 1Z0JA 3F5FA 1P5FA 2EERA 4JQZA 5DVZA 2NUAB 1KOGA 3RJ9A 5GJWC 2FEMA 1M66A 3IMEA 3VKHA 3LY5A 1TXGA 1HEIA 1NM5A 4RVFA 3KHSA 3E84A 1E6KA 1USWA 3V7NA 3CXRA 3Q3CA 4XB2A 3WRVA 1T9ZA 4JT8A 2FLKA 1C5KA 2HN9A 1QF9A 2Q1SA 4OP1A 5JJLA 4RENA 4RS3A 4EVRA 3C7DB 3G1UA 5EJFA 8ATCA 1C9DB 2DM6A 2JZNA 4KQ9A 4ARZA 2QL5A 4NCKA 1DQSA 3I9V6 2VPXA 4ME6A 3GCXA 4TYWA 2QGFA 2B5WA 3OZCA 2Y1CA 1UR5A 4ZVLA 2VPPA 3WLIA 3PNKA 4YCLA 1AHHA 3LOUA 5IFLA 1FA9A 1GRRA 3R7WA 2UVPA 3O3MB 2V0GA 1TFRA 1HUQA 4M53A 1PF7E 1Q1GA 5GJCA 1J8MF 3A14A 4I3GA 4MWDA 1UBJS 5DU2A 1G8YA 3AVPA 3K8OE 4NE2A 4YXWA 2PUAA 3CJRA 1SK8A 4RKWA 4QQRA 3ITNA 1C2YA 2BISA 4S04A 2GFHA 4CQJA 1AHNA 2ZIZA 2YRWA 4OD0A 2WHPB 3AI7A 1OIXA 5TMBA 2QQ5A 3RSLA 5H4GA 1W75A 4BBAA 1PW5A 1J1ZA 1A8SA 1UOOA 4MA0A 3J80A 5GMOA 3UB2A 3V1NA 2VT7A 3RYIB 3OJFA 2FFAA 2RK6A 4TYQA 4Z1OA 4MB6A 2UUCB 1VFNA 3FJOA 1J2JA 2EW8A 4R84A 5LU8A 4R2WA 5IVHA 1ZQ1A 3OC6A 1O03A 1QV6A 3QLTA 3SZ3A 3TOZA 4HDNB 4AJJA 1P0IA 1F0NA 1NUSA 1UFOA 2G5GX 3EXG1 3MIIA 2H4JA 3JWJA 5CHYA 3WIOA 1DAMA 4AI6A 5JZMA 3ULKA 4ACBA 3VKGA 1L5OA 1N5KA 1ZLYA 2DHEA 3M89A 5KX5A 4R1MA 3M4JA 1QZ3A 1GGFA 1KL7A 2X8AA 2YWHA 3QHQA 4QYXA 1UP6A 4J1QA 2F3PA 1JA9A 4FXPA 2GKGA 3L79A 3UXHA 2HCFA 3INTA 3CU5A 4O4HB 3D6JA 4V1CB 4YCAA 3IOEA 1Q95A 5JD5A 4FDLA 3V00A 1OD6A 3RO7A 3FNRA 5CIQA 3KK0A 5DLQC 1R0CA 4JLPA 4WIAA 3JYLA 2CYCA 2BIFA 2WZDA 3WHKA 3K0SA 3KJFA 1H05A 1QPBA 4TTRA 5I48A 1RQPA 1KI9A 2IZOA 2V3WA 1IZ8A 3R0JA 3FDFA 1DRJA 1T13A 4B6FA 1R0BA 4KACA 3BB1A 4Y2SA 1CUJA 4DS3A 5DNYB 1NVTA 2GN9A 2H8KA 3HA5A 3LQ1A 2EBHX 5FUWA 1RAEA 1IN7A 3W3AD 2Q1TA 1F2TB 4HDKA 4IIXA 2CDCA 2FZKA 2P9GA 4UCFA 2A0YA 3HXOA 2C0QA 3EGVA 1EFTA 1JJIA 5E8RA 3M1YA 5BUSA 4D25A 3IQZA 5FBVB 3GEGA 4M0KA 3K8ZA 3P9RA 1E1KA 4OIFA 2HA0A 3LWBA 4YLYA 1PGJA 1VM6A 4ZOLB 5AVQA 1LK7A 1U3WA 1ZBDA 2AZDA 4P3YA 4RY8A 5ALOA 3L1UA 2YFYA 4EQ6B 2OXTA 4Z99A 3BGDA 3RT7A 5JS1A 3MWGA 4Z4CA 1ZW1A 3FMIA 1GKKA 1TI7A 3ETEA 3LIIA 4X71A 5FPQA 1JIQA 4NYJR 5BNWA 3VU3A 5BUQA 1PQYA 4HADA 4REMA 5J2TB 3A4NA 3FMFA 5A6SB 3UWOA 1GNRA 2QVZX 3L4KA 1MJNA 4NYMQ 3L5KA 1UBRS 1FRQA 4KBGA 4UUNA 2WE8A 3T5TA 2PLAA 3ZD7A 3ZV4A 1Z4MA 4K1LA 2ANCA 2BEVB 2OXCA 3GXBA 3ZU3A 4YAGA 4NBLA 4PPQA 2F59A 4S2EA 4BQEA 2ZR0A 4XLLA 3FCXA 3F1KA 5C8VA 4HAYA 3P4UA 3ZV7A 1VPDA 1Q44A 4QODA 3BRCA 5B7PA 2BY4A 2J41A 4PLVA 1KO7A 3VPAA 2NP6A 2XRMA 2NO9A 5EJIA 4LHZA 5IKEA 2CV0A 1JVSA 5DBGA 2XVAA 2ZJ5A 3NR2A 2ZJ6A 2ORIA 3EMVA 4ZCSA 4Q6BA 3FCOA 1JPJA 1KK1A 3GD7A 5IT9A 5DM4A 1Q0LA 5BNZA 2B5OA 3QYFA 3P96A 4Z86A 2PKXA 1U7DA 1YE5A 2V6FA 3DBRB 3NTVA 3UHJA 3IH5A 1K5GA 2H18A 4GLBA 2R8YA 1JKJB 4K03A 3X1ZA 5CXQA 2CXUA 3IE1A 1J8FA 2CL0X 2BGUA 2E85A 2ZOSA 1IZYA 2FI1A 3HYLA 3IDSA 4MEJA 5DYYA 1L7EA 1TUEA 1SOMA 1W96A 4MTCA 1LVHA 1RADA 1L5MA 1UADA 1G20E 2H1CA 3CPHA 3RHTA 4KO4S 1JKXA 3P0FA 1E69A 1R6VA 5DNVA 3UGTA 2HQ1A 5HS6A 3GELA 2JJ1D 1FDSA 1C9NA 3AUJB 4CG2A 1AK1A 2JGLA 2DHCA 4J9UE 4PCAA 3U13A 3LGXA 3U7JA 2G36A 4MYRA 4FCVA 5IXYA 1E1YA 4Z4HA 2ORWA 1V5FA 2E5FA 3OQOA 4WEOA 1Q3TA 5ALGA 1H0SA 1SJ9A 3KZXA 4LCEA 5TPZD 3EGIA 4C7XA 2HREA 1N25A 5JTTA 2X5JO 4KHPB 4XA8A 2J9RA 4R1NA 4BJ5A 4LJ7A 3TM4A 3HZOA 4PC7A 3KZCA 1JWBB 1X14A 2DAPA 4YK7A 3OZVA 5FOSA 2GPSA 3G0GA 1OF1A 4I5GA 1GEEA 3MBIA 1A5BB 2IH5A 2IIPA 1UWCA 1VG9B 1VRWA 2MIIA 2A35A 3DNPA 2XSZA 4PC2A 3UMSA 5ES4B 4QO7A 4AB1A 1VL8A 4EQ6A 2NO0A 3JARB 4HLUC 1YVDA 1D2EA 3HJAA 4MUBA 3PZBA 3TZEA 3UVEA 2GEDA 3M7IA 1R9MA 1TU3A 3EYWA 3GROA 3IAAA 4PLCA 4MUJA 4DCTA 3PPVA 1XEXA 4PGGA 4F3RA 5L51A 3UT6A 2JRCA 4JYCA 5JMOA 1IXKA 3D5QA 3ICQB 2Q6OA 1AB6A 2H59A 3VNVA 2O0KA 2EZ9A 4NWIA 4R3NA