3SXJA

Crystal structure of complex of bt_2972 and adomet, a methyltransferase from bacteroides thetaiotaomicron
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
245
structure length
245
Chain Sequence
FSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative methyltransferase
publication title Crystal structure of complex of BT_2972 and AdoMet, a methyltransferase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
total genus 85
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3sxjA00
5E2BA 3SSMA 1KIAA 3NVMB 3GGDA 4YUXA 3TOSA 3MERA 1KPGA 1L1EA 2ZBPA 3B3FA 3G5TA 1SG9A 4PINA 4OBXA 5E9JA 1Q0TA 4ER7A 3SXJA 4RWZA 3HCFA 3QV2A 4EQZA 3PT9A 3GRRA 2H11A 5EMKA 1AQJA 2AN3A 4ATNA 5HOQA 2AOTA 2QM3A 2ERCA 2K4MA 1DUSA 4FP9A 2YXDA 2PVCA 1YB2A 2FK8A 3THSA 3P2EA 2PX5A 2CKDA 3KPUA 5E1MA 2BM8A 4M36A 2YX1A 3R9XB 2I6GA 2HTEA 3OFJA 1I4WA 4ER0A 4QVKA 2H1RA 1P91A 5IKMA 4HRAA 3G88A 4OA5A 3T0IA 4KWCA 3EVGA 3GXOA 3HNRA 4RVDA 5EGSA 4IWNA 3UJ9A 5EMJA 3CJTA 3KQQA 3NWBA 5K0JA 4F86A 3LCCA 1ORIA 3NWEA 1XDZA 2NXJA 4QPNA 1XTPA 5DX0A 4AUKA 1JG2A 4AZVA 2VDWA 2ZBRA 2P3OA 5K0NA 3SR4A 2DULA 4KIFA 3ERCA 2B9EA 3JWJA 5E1DA 1IM8A 1NT2A 3KHKA 3DP7A 2YTZA 1ZG3A 3B89A 2OO3A 3BGDA 3M70A 3G2PA 2B25A 4RVFA 4R8RA 4QVGA 5ERGB 1TW2A 1INLA 1VE3A 3FUXA 1R00A 3GRVA 5HFJA 3BWMA 2CMGA 1M6EX 2PSSA 2PWPA 2YXLA 5CUQA 4AZWA 5EMMA 4XUCA 4CXMA 2WK1A 3P9NA 2UYHA 3K0BA 3DMGA 4DZRA 3P2KA 5MHTA 3LBFA 4HTFB 2V7EA 1EIZA 3DLCA 3R0QA 5KVAA 3TFWA 4FT4A 2IBTA 3DXZA 4ER3A 3GIWA 5EQJB 4PNEA 5FTWA 1AQIA 3GCZA 3LDFA 2FHPA 3BWCA 4YV0A 2JHAA 4E2ZA 4PGGA 2P40A 5GINE 4HTFA 2QE6A 3EVCA 4GOND 4C08A 2BR5A 2O05A 3LECA 5DX1A 2P8JA 1KPHA 3JWHA 1NW6A 5E8RA 4OQEA 4DQ0A 2O06A 3FPHA 1VLMA 4QPPA 2CL5A 2ONZA 2G8NA 3TPZA 4JXJA 2NP7A 4FSXA 4BP1A 4EKGA 4M38A 3T7RA 3BZBA 3MCTA 4HC4A 2VZ9A 2ZSUA 1FBNA 4R6XA 5HEKA 5EG5A 5LSAA 1M0EA 5CD1A 4WXHA 4MQ4A 2O07A 5FWDA 3UA3A 4HGYA 3GRUA 1L3BA 3AJDA 3D2LA 3OE5A 5DRTA 3VC2A 1VQ1A 2NNWB 4RX1A 4YMGA 3NTVA 10MHA 3GDHA 2IH2A 3G8BA 1FP2A 5GM2A 2GB4A 2OPBA 2V74B 2IH5A 5K0BA 3FUWA 4H0NA 2Y1WA 4Y30A 5ICCA 4C4AA 2AOVA 5EHIA 5LQKA 2NXCA 2DPMA 2O0LA 3DMHA 3HA7A 4FZVA 2UYQA 4LWOA 3WSTA 2GS9A 3TLJA 5H02A 4DMGA 4POOA 4BY9E 2B78A 2P7HA 1I1NA 2I9KA 1D2CA 1Q0SA 2XYVA 2Z6AA 4WVLA 2HMYB 4A6DA 2OBFA 1Z3CA 3JWGA 4CTJA 3FYDA 5ICEA 5KYGA 4BP3A 3OU2A 5EPEA 1P39A 1NW7A 2ZZMA 3UJCA 2OB2A 2AN4A 1RJDA 5HIKA 2IBSA 1QZZA 3E8SA 2WA2A 2NXEA 4X60A 1RI2A 5EC8A 5DM1A 1ZKDA 5ICFA 1WXWA 4P7KA 3HCEA 1L3CA 5D1HA 2AOXA 5K09A 2H00A 2ZIFA 4PYNA 2IGTA 2ZTHA 3G5LA 4PONA 2JJQA 1OR8A 2AVDA 2BZGA 2PT6A 1L3IA 1KP9A 1RI4A 2CWWA 4KRGA 1QAQA 2PX4A 4XUDA 3KR0A 2ESRA 1VL5A 3KQYA 3PB3A 1KYWA 3SVZA 4E32A 5BP7A 3OZSA 1XDSA 4BLVA 2GA9A 3G2OA 4CKEA 5P8WA 1X1DA 4PWYA 5E9QA 4PIMA 5FADA 3REOA 1KXZA 4YUVA 4PGHA 5FULA 4P58A 5DXAA 2EJUA 3EMBA 3IHTA 3LCUA 2ZIGA 4OX9Y 2ZWVA 5IH3A 4PIPA 1RI3A 5DTQA 3M33A 1B42A 3OFKA 4PYOA 2PV0A 3M4XA 3V97A 2YVLA 2WA1A 1ZHFA 2HNKA 4LECA 1R8YA 1WG8A 3R24A 4RTOA 4F85A 3MQ2A 1KHHA 2VS1A 5FWAA 3I5UA 2AOUB 3GO4A 1R74A 1NKVA 1ZQ9A 3P9KA 3C6KA 2VDUE 3FTDA 1XJ5A 2ZFUA 2ZLBA 3ME5A 5C9ZA 4V0RA 2BH2A 5DSXA 3HA3A 1JG1A 4KDRA 3EVZA 3RW9A 4X1OA 1G6Q1 3DULA 4CKBA 5LQCA 2I7CA 5HILA 4YUYA 5K0EA 2FYTA 3OU6A 4L7VA 4MWZA 2Y1XA 3R3HA 5DTMA 4DKJA 2UZ4A 4PCAA 1VPTA 1ZGJA 2G70A 1VP9A 3C3PA 2R6ZA 1WZNA 5LQAA 3K6RA 1P1CA 1NV8A 2IDKA 4RTQA 2OY0A 3TM5A 3MTEA 1SKMA 3SMQA 3MHTA 1TW3A 1YZ3A 1F3LA 3ELWA 3OZRA 3SSNA 3DTNA 1VP3A 2N47A 3R6TA 4GBED 1RJGA 3KQWA 2HV9A 5CCBA 2ZCJA 3T7SA 1SQGA 3QOXA 3OPNA 3ER9A 3LKZA 2P3QA 4PYMA 2JHCA 5DXJA 5EZSA 1R8XA 4E31A 5M5BA 2G1PA 4EVIA 2G71A 4E70A 3BGVA 3QOWA 3LSTA 4K6MA 3KQTA 4PYKA 5BW5A 2AS0A 1G38A 5FA5A 2ZVJA 4O29A 5DWQA 5GWXA 1MJFA 5EEHA 4IKPA 3G2MA 3TR6A 2P7IA 2JH8A 3EVDA 2B2CA 5C0OE 4ER5A 3CCFA 2ZIEA 3FUTA 5EEGA 3O4FA 3B3JA 2NYUA 3KPYA 3L8DA 3HCBA 4Y2HA 4OQDA 2UYCA 4FR0A 3NDIA 5EIWA 2C7QA 3AY0A 1MHTA 3DH0A 5BW4A 1NBIA 4IV8A 5K05A 3FUVA 1BOOA 3EVFA 3OU7A 4M37A 5CVDA 2ZBQA 3HEMA 4R8SA 4U7PB 2HWKA 4CKCA 1UFKA 3DXYA 1I9GA 3M6VA 5KS2A 4RTRA 2E5WA 4P7GA 3BT7A 4GUAA 1RJFA 3MB5A 3KQPA 5GOZA 2IP2A 2Q41A 3ELDA 3EMDA 3HVJA 3EVAA 3KKZA 3KQMA 5E8JA 3VYWA 4UOEA 4PYQA 5DSTA 1D2GA 2PJDA 3M6WA 4GOLD 5EMLA 4CWAA 3ANXA 3ORHA 4YUZA 4NECA 4RTMA 3MTIA 3OE4A 5HZMA 1NW3A 4RTSA 4HGZA 3KR2A 4PYIA 4E30A 2AOWA 2BM9A 5LR6A 1SVUA 2ZULA 4QTTB 3V8VA 3I58A 3KPVA 5U4XA 4DM3A 3P2IA 5FQNA 2PY6A 1NE2A 3DOUA 1X1BA 1R6AA 3MAGA 3T7TA 3E05A 3UWPA 1JG4A 3B5IA 1JQ3A 3EGEA 3LKDA 4KVZA 4GOMD 2YR0A 2YXEA 3BKWA 1IY9A 2BR3A 3KR9A 3OCJA 5CM2Z 4M7RA 5LQRA 2XBMA 4ISCA 4PCLA 3UFBA 2EG5A 2P1DA 3M6XA 5D1NA 2IH4A 1NV9A 4AZTA 3SX0A 3NVKI 2PT9A 3P97A 3Q87B 4RTPA 7MHTA 3GU3A 2PLWA 2VDVE 1XXLA 1AV6A 1Y8CA 1TPYA 2LD4A 1G8AA 4GC5A 3PFGA 4X63A 1JSZA 2G72A 3CJQA 2F8LA 2IFTA 2ONYA 4A6EA 2PWYA 1ZGAA 4Z2YA 1BHJA 2YQZA 3CKKA 4PYLA 3RIEA 2PGXA 5K0GA 5G02A 5DPMA 3FPJA 4V0QA 4ER6A 4RYLA 4E33A 3GRYA 1R18A 1JG3A 3LDGA 5EIFA 2OZVA 3I9FA 4XUEA 3TMAA 1XCLA 5DX8A 1FJXA 2QRVB 2Z6QA 1X1AA 2PKWA 3EEYA 2ZZNA 4MTLA 3BXOA 1SUIA 3C3YA 3ELYA 5KQRA 2IIPA 2C7RA 2GLUA 3PS9A 3G7UA 4ZTBA 5CCXA 4HH4A 2QRVA 1L9KA 4RVGA 5EOVA 1IXKA 4EMSA 1JQEA 1XCJA 4YV2A 5LQNA 3ID6C 1F38A 5T64A 3B7PA 1SUSA 3B3GA 1P1BA 3H2BA 2OXTA 3TRKA 4MHTA 3PVCA 5E1OA 4C07A 4E2YA 3VSEA 4QDJA 3F4KA 1YUBA 4GF5A 4PYJA 1JQDA 1EG2A 4YMHA 3PLAE 3UJ6A 3TKAA 3NW9A 1RI1A 2AOUA 1FPQA 5T6BA 2JG3A 1UIRA 5K01A 3KPWA 4QTUB 4FSDA 2XYRA 5HIJA 4DF3A 1U2ZA 2GAFA 1EQAA 4RTJA 5ICGA 3GJYA 3O31A 2AOTB 5DM2A 1JR4A 4EK9A 3AXSA 3PX2A 3HCCA 2R3SA 1AF7A 4RVHA 1UWVA 5B1SA 5FUBA 4BLUA 4E2XA 1ORHA 5JR3A 5DT2A 1X1CA 3FPFA 5GP1A 5K8VA 4GEKA 1N7IA 4GOOD 4DCGA 2C7OA 4RTKA 3HA5A 1KR5A 2JHPA 5HIMA 3TM4A 2FPOA 4C04A 5K03A 1FP1D 2EJTA 5F2NA 2QY6A 1VBFA 2IPXA 5CVVA 3UJBA 5LQJA 5K0LA 5GM1A 4XCXA 3AWIA 2JH9A 1XDUA 4G56A 1DL5A 4YUWA 4RTLA 3C0KA 3KQSA 5K0FA 4MIKA 4X41A 5E2AA 5LQUA 3FTEA 3DXXA 2PX2A 4KW7A 5JUWA 4HG2A 4C06A 4E2WA 1O54A 1QAMA 3KQOA 3MGGA 4U7TB 5EKUA 2OYRA 2Z6UA 3UZUA 2B3TA 3FTFA 3RODA 1X19A 3DR5A 1NBHA 2XVMA 5EZQA 2PXCA 3HCAA 1BKYA 3A27A 3A26A 3HVHA 3Q7EA 1PRYA 4P7JA 5CIYA 1EJ0A 4QQNA 3OZTA 2GPYA 3TQSA 2VP3A 4RV9A 1RI5A 3ELUA 2O57A 3GNLA 1N7JA 4LWPA 4R6WA 3P9CA 3UBTA 2GH1A 4KDCA 3BWBA 2QYOA 4BLWA 3G8AA 4AZSA 3CJRA 4QQKA 5FHQA 2C7PA 3G2QA 3HTXA 9MHTA 1QANA 1YZHA 5HIIA 3HVKA 1T43A 4DCMA 3NMUF 4LG1A 5FQOA 5DLYA 4GQBA 2I62A 3PFHA 1PJZA 2XVAA 3LCVB 2UYOA 5CVEA 2BR4A 2P35A 3CGGA 1O9HA 3EGIA 3UJ7A 3E23A 2FCAA 3HP7A 2AN5A 1XVAA 5EVJA 3FRHA 1BC5A 3IYLW 2A14A 1YFJA 5E9WA 1EJ6A 4C05A 1DCTA 5DM4A 3KR1A 3CVOA 5GIOE 3VC1A 4FS8A 3A7EA 3P71T 4RSRA 4YV1A 4DA4A 3ER8A 2YUIA 2OB1A 3IV6A 3LPMA 3DUWA 3BGIA 1JTFA 3EGVA 5EHGA 1YF3A 2PBFA 5BXYA 3KPJA 2EX4A 3A7DA 3M6UA 5FA8A 1KPIA 3EVEA 3DLIA 2ADMA 3HCDA 3GWZA 3BUSA 3NJRA 3C6MA 1JSXA 3HVIA 5CVUA 3KU1A 3E7PA 2P41A 2PXXA 5E1BA 5KQSA 1WXXA 1N2XA 2OKCA 3FUUA 5GIPE 3LDUA 3CBGA 1V39A 2EFJA 1YFLA 2KW5A 4FT2A 3LGAA 1QAOA 1G60A 2XYQA 5F2KA 2HR1A 2CMHA 3FZGA 3GRZA 4RTNA 3LX6A 3I64A 2AZTA 3O7WA 3NDJA 5EKXA 3SSOA 3UJAA 4AX8A 1KYZA 1G8SA 1G55A 1HNNA 2AVNA 4QDKA 2ZZKA 2ORED 1NW8A 5C1IA 3FPEA 3LHDA 1HMYA 4IV0A 2PXAA 3P9IA 2NXNA 3U81A 3BWYA 3I53A 4R05A 3FTCA 5DM0A 4F84A 3UJ8A 3SGLA 1SQFA 5DRYA 3A25A 5F2OA 4OBWA 3A4TA 5CVJA 1NW5A 3KQVA 1VIDA 1D2HA 4EKIA 3PX3A 1QYRA 3TKYA 2NP6A 2FK7A 3FPGA 2ZW9A 2ZWAA 4CTKA 3EEOA 3CC8A 4KIGA 1O9GA 5K0CA 3S68A 8MHTA 4HSGA 1WS6A 5T67A 3UA4A 4B17A 4FGZA 3EVBA 3FRIA 3JWIA 1M6YA 1JTEA 2PX8A 3AXTA 3G89A 3P8ZA 3IEIA 3SM3A 1RJEA 3THRA 4C03A 2AR0A 4X61A 3MCZA 3HM2A 4P7FA 3BKXA 3DMFA 3LBYA 1EAMA 3LL7A 4GC9A 3X0DA 1WY7A 3EPPA 5FCDA 5FHRA 3PTAA 3UJDA 2FRXA 2IDJA 3FYCA 2P3LA 1H1DA 5DTRA 4OA8A
chains in the Genus database with same CATH superfamily
2PK3A 1W0KD 3NVMB 3VBCA 4TL9A 3UYKA 2QTLA 3GMSA 1B76A 4MARA 1U5CA 1N0IA 2VNKA 3LHSA 5E9JA 5EP1A 2FHSA 3N2KB 4KSYA 1CIJA 1EK2A 3QV2A 4RWZA 3TOCA 4BTLA 4FE3A 4HH3C 4ZT7A 5KDLA 4O2RA 2ARKA 2J6CA 1QV9A 2BI8A 5IN5A 4IG9A 1LPSA 2ZI3A 2F55A 3QTLA 1GSOA 1XRNA 5JLJA 5BR1A 4I1RA 3NPMA 3DVSX 3U9LA 4OBEA 2ZSEA 1TIPA 2DTXA 1CEXA 1QVWA 3T9AA 5IHXA 1ZSNA 2NO7A 4M36A 4R8LA 5CIQA 4EL5A 1XD8A 2AUMA 4S1NA 1AO3A 1PR9A 2Y1DA 4IFTA 4KITB 1XCOA 3DMTC 5JCXA 4R1LA 2DQKA 4RD4A 3LNTA 5IDYA 4QBGB 4TT3D 3MWYW 3ZI7A 2VTBB 3GUHA 3HJCA 3G5AA 2ZB4A 5KYWB 3GXOA 1N5RA 1K86A 1EK0A 1OQAA 1YQUA 3PDIA 5FL7A 4CHTA 3AKZA 2QQEA 5KTNA 2P4QA 3LFTA 4MUXA 4RSMA 5FIUA 4R2WA 4ECAA 3ZLUA 5K0NA 2EDAA 2OCKA 5HPYB 1I7LA 1YB6A 1A04A 2ID9A 3TPCA 4O4JB 5AOVA 1VDMA 2XMCA 1PHRA 3LWZA 1X15A 3PHHA 4L8GA 1HE8B 1FSPA 1AMUA 5IC5A 2I91A 1AKTA 3K9QO 5CUQA 5IBQA 4MV3A 4QQ8A 3ZD9A 2NXWA 2JVIA 4IMIB 2WK1A 4TTVA 4QXPA 2R8RA 1FYFA 2F1JA 5J2UF 3P0EA 5IUNC 5MF6A 3KSDO 3A9WA 3OURA 2XT9A 1K6IA 1T5HX 4JLMA 5SY9A 3TSCA 3TB4A 2D5LA 8AT1A 2A92A 3ISTA 1Z33A 4GXTA 4JYBA 4NU8X 3WO1A 4EG3A 1ZUHA 1LWOA 2IHUA 1C7EA 1PV1A 2JHAA 1K68A 4WK0B 4ZYUA 5A04A 1P77A 3T99A 3SLRA 5B6IA 1APBA 4OB7A 3BRWD 1KI3A 1SUAA 1NQAO 1PT9A 5JECA 1RKUA 3LFHA 4UM5A 1PWXA 2VPXA 1N5KA 4KUEA 3BA6A 4ZU1X 4YXWA 4ZCTA 3IP1A 5L7TA 3M4NA 2H4JA 4MR8B 3RSLA 1CSEE 2A8YA 2I76A 4BP1A 3ZCPA 1H9CA 4BX9A 4GOJA 3V2HA 1WZUA 1W2GA 2QTWB 3BZBA 3G79A 3SYRA 3WTCA 1J25A 2PGLA 4YJHA 4E5YA 1L7QA 3QYFA 3SEAA 2VSYA 3HZOA 1Z8DA 3W7BA 4N03A 2P67A 1JFTA 4KWHA 1FVXA 1FFYA 2NU8B 4KREA 1VQ1A 3Q3JB 4QYIA 4JLKA 4RX1A 4JC5A 3EXHB 2QP3A 1XF9A 1E1RA 3G8BA 1MC1A 2C03A 1TCAA 3HKEB 3Q7PA 3F9IA 4BU1A 1XFAA 2D1SA 3WBKA 3KTFA 1VL1A 5JDIA 2GD0A 4II7A 4RJTA 3CNNA 5C3UA 3PK0A 5LQKA 4XWAA 1SCUB 3MINA 2MSEB 5CNJA 3C7KA 3KUDA 3VNQA 3S81A 3BQMB 1R6XA 3OLQA 4HEA1 3SIXA 4BECA 1YZLA 2R68A 4PPGA 3MW8A 5F5XA 1GQSA 3STTA 1YMQA 1U1CA 4WVLA 4A6DA 2CVZA 3QE0A 5D51S 2XOXA 1ABEA 2QUZA 4PLVA 1X92A 5HYVA 5KYGA 3AF4A 3NRJA 3O9VA 1KHTA 4O0LA 3H2ZA 1L4KA 1AKVA 2BWJA 1ZLXA 2VWQA 3UJCA 4BB9A 1PK8A 2QRPA 5K8IA 1V5GA 5H8WA 4JR1A 2HIAA 2B4KA 3CF6R 5AVSA 1Q14A 3CWQA 1NW4A 5DM1A 3X44A 4JA2A 5CDGA 3FPLA 2I4MA 3DFKA 3IA2A 1POWA 3OJLA 4JI7B 1GUFA 4IH4A 2OAP1 3T7DA 2QN7A 3GLHA 1NVEA 3PWSA 4F8JA 1XCBA 1FSFA 3RUPA 5JDIC 4OSOA 1PK9A 2GKSA 4OQQA 1D6MA 2PVSA 4M1YA 5KOHA 3REOA 2YFKA 5EXEA 2I5PO 3VZBA 4ASUD 4FHDA 4GM0A 4XX0A 2J0QA 2HQSA 1EFRA 4ND3A 3UHAA 1RYBA 3RAJA 5C18A 3EMBA 1L6RA 3LYUA 5LIPA 1WU8A 3WA7A 5H59A 1UM8A 5DTQA 4BUZA 3L8GA 1L4HA 3OFKA 4Q15A 3U09A 2WZQA 2YVLA 4KMRA 4L0MA 4C3OB 1OU4A 3U31A 1R8YA 1RXYA 2Y66A 1OI2A 3ZGNA 4ZKDA 4E11A 1AY0A 2OSVA 4NDNE 3VUEA 4YCSA 3DGEC 3I04M 3WFZA 4MUJA 2ZI9A 4KNVA 3NIFB 4RXMA 3OZDA 4NRDA 1BYIA 3C6KA 4X3CA 2WUEA 4QDTA 1PWEA 1MBZA 4H7HA 1WMDA 4B46A 3OQJA 2RHOA 5KKCA 2BBOA 1EBFA 5DSXA 4QL3A 4ZQEA 3UMVA 3VUFA 2Z2YA 1FLVA 4DJTA 1EP9A 3IEKA 4D25A 4C5AA 5FFMA 3EHDA 1DQSA 4UD6A 5AKYA 3ZDXB 2CY0A 2PO5A 5HE8A 4CM9A 5CBPA 1NI5A 4LK2A 3H17A 2QN8A 1QX4A 1ZS9A 2NQTA 4NMXB 3WYAA 1RAGA 1VPTA 1DWPA 2CL0X 2G70A 4I9FA 4OHVA 3AM4A 4OJNA 3HBMA 5JAUA 2QMEA 1KZ4A 4HQFA 1KWKA 3C8HA 1O5IA 4FMDB 4G0OA 1PZXA 1W87A 3FYTA 4GRIA 3RSHA 1S2MA 4R68A 2COEA 4IEIA 4QJBA 4TTSA 1VHDA 1E5TA 3ETDA 1WDKA 3LF1A 4G24A 3DLBA 5D5HA 4KIJA 1V1MA 3BXZA 1RJGA 3HY3A 3KQWA 1OTYA 2HV9A 5FRDA 4ON9A 3AUXA 5CCBA 3GBVA 3KQKA 1AURA 1X7XB 2FA9A 2I6TA 4S2UA 2BL4A 3EDOA 3ASYA 1ODSA 3HHPA 4G2NA 4PQFA 5D7BA 1KE2A 1HQYE 5KX5A 5ILOA 2VPZA 2XUZA 2PLFA 4CIAA 3O74A 5FI1B 3IPAA 1XO1A 2JVJA 3C3AA 4O29A 4RETA 4UZSA 4FWBA 5DWQA 4B2IA 2ID8A 3CW8X 3EIXA 3HGMA 5L6MB 4GI1A 3BBLA 3DDNA 4RM2A 2FEMA 3KL4A 1NVDA 5I9BA 3TL6A 4JZKA 4RHEA 1U90A 3B3JA 3BH7A 1T8YA 3G17A 2UYCA 3O2JA 1JDTA 2WG1A 4FUTA 1IQ0A 1J99A 2BLNA 2OCYC 2CL7X 4J7UA 5CNKA 4Q16A 3AYZB 1ZM9A 1JIJA 2XMDA 3FGPA 2VDMB 3CZ4A 4QG3A 4D0SA 1BOOA 2Q2WA 2EKLA 3SC4A 2O8VA 3LXRA 1N5IA 2HWKA 4PO9A 1R5JA 4G9EA 5AI5A 5JS1A 4K9MA 4RTRA 4U39A 2ZWMA 4DSOA 2WPDD 3EY9A 1KYTA 3RU9A 2WBLC 2GNOA 1Y3BE 2JI6A 1CB7A 4K9OA 5SZIA 5GZ3A 2Q41A 3ELDA 2QT9A 3EVAA 1V41E 4PYQA 3EXAA 4PHCA 1WDTA 4MYRA 4Y6SA 1XZLA 2FE4A 3O2SB 4I36A 1HGXA 4D9IA 3UV6A 3N1UA 1AT1A 3MTIA 2M9MA 2EDCA 3FOAA 2YIVX 3EFOA 3KR2A 3L1VA 4G1MB 4G86A 4OI4A 3RPEA 3ZDYB 3SBDA 2GEFA 3PC2A 4RL4A 4KLNA 1SCQA 1YBAA 3ISVA 2P2CA 3H9CA 4MQUA 4DMHA 1R5OA 3U44B 1BW9B 1FRZA 1NXPA 5DBEX 2ZDQA 2P6RA 2GSDA 1ZWKA 4OHKA 4Q9DA 1NXWA 1VMDA 2CDCA 1A2KC 3C87A 3WLTA 4CGYA 3O4JA 3GW8A 2OHXA 3MNFA 3A6FA 3UBMA 1QQ5A 5A0FA 4ISCA 4QSMA 1XNQB 1OFUA 4G36A 2ES4A 3C3CA 2WUGA 3KYIB 4OLHA 3WL5A 1KZYC 2HJWA 4GBGA 2EFGA 1FMLA 1R4NA 2CK3A 3WYEA 4F3NA 4DMFA 4RTPA 4N65A 2O8EA 2JFNA 2QRJA 1Z6QA 4H4DA 5J2TF 1Y80A 4K7JA 1OYYA 2E55A 3C5HA 3EOAI 1C1DA 2BJHA 4EX7A 3FBGA 2XOEA 1IN6A 4LZNA 1BHJA 3LK7A 3N2EA 5G2OA 1TYEB 4CDMA 3MS7A 4X7PA 3V7WA 3T54A 4Q7KA 1H2ZA 2YZNA 3BMQA 3DZKA 4QFBA 3L05A 4L8VA 3LPLA 4YV7A 1WXHA 1QJCA 1N1MA 3C4JA 4N6GA 5DBHX 3AT1A 3TVDA 3GGSA 5FR1A 1U2GA 4EMTA 3ZX4A 1YR7A 4JKIA 1YBVA 5GAJA 4B75A 1ODKA 3OPXA 1F8XA 4XYGA 1CPYA 1YJ8A 4XDGA 4JDPA 4BWYA 3NHWA 1PGPA 2HPHA 4AZ0B 4NEQA 2PZMA 1EFAA 2GTPA 3QQ5A 3WKAA 6NULA 2W6ZA 1HQDA 2ZSBA 1SZPA 1QHFA 1U0SY 4FMPA 4KXWA 4YHHB 2ZJ6A 4H4CA 3SDSA 4DZZA 3DD5A 1V45E 3PVCA 3N8GA 3NAGA 2JANA 1T0BA 4Q93A 1JQDA 2J6IA 3TKAA 1M2GA 4NENA 5JS6A 2ZBUA 4JP5A 3T3EA 3RSSA 2VA9A 3ZJYA 2PRIA 1FJHA 3MG9A 621PA 2A2ZA 3P96A 1DFGA 2HGZA 3R0ZA 5J2TB 2FEWB 2PKXA 1EWKA 1FRFS 1GL3A 1FMTA 1KQOA 2BMVA 1YR1A 2C1XA 2VEOA 2VJDA 4XGQA 4PU0A 5FUXA 1K7XB 2O8BA 5LB4A 3NTRA 2QPLA 4LA4A 1QRTA 2WQZA 1XZCA 4FZ5A 3KDPA 4UNRA 5B1SA 2Q1TA 4BLUA 1U2GC 1HTWA 2ZVPX 2ZSAA 5DNCA 2LKDA 2MSWA 4N18A 4ZMSA 2GXSA 5LMUB 2G0NA 4D1YA 2I1LA 1N7IA 3COPA 4QOJA 4KN6A 3L41A 1E8DA 2VUTA 2FU5C 4KMMA 4MP6A 2OBXA 1Y3IA 3D7RA 1ZAYA 3FF1A 4DLVA 2HLDD 1MN6A 3M9LA 1M1ZA 3FTEA 1P0FA 2VN8A 3FMIA 1LD3A 1LNQA 1T3LA 4AY4A 4EA8A 4ZK2A 4C01A 1TRHA 3GBPA 4IR7A 1GYQA 4FEAA 1POXA 1W94A 2HSJA 2IPLA 3IVGA 5F35A 2J5KA 3GJTA 2ZQ5A 1PEDA 1WNTA 2A9PA 3WRWA 2P78A 3EEIA 4W5NA 3S2EA 1SWVA 2DTEA 4ZI7B 4HX5A 1UJNA 4A1OA 4HOYA 3EQ8A 4GPIB 2C4UA 5IXSA 4K2AA 1Q0HA 3A3OA 4PLHA 4R2IA 4YRSA 3AX6A 4F93B 5BSVA 5CB8A 4DM7A 2IWHA 3G8AA 1NZDA 2I54A 1P80A 3OG9A 3FNEA 3KXLA 2BKLA 4MB2A 1FQOA 4X00A 4UHHA 4CLRA 3FYHA 1GO2A 1T2CA 2Z3VA 1Q7RA 3L7DA 4QPCA 1JKXA 4GQBA 4GPZA 1DT3A 3AI7A 4WADA 1IBRA 3NEPX 4NYIR 3PUXA 4PG6A 1JGTA 1YQGA 1UK7A 1Y9ZA 2H54A 3A05A 3F2IA 2V58A 2DH5A 3QVLA 2ZXEA 1Q83A 2WM9B 2FP4B 3LX5A 4MS1B 3X1ZA 4Y2QA 2Q3DA 2X8LA 3TDKA 1JZQA 2A0FA 1UFVA 2DF8A 2JHGA 3N2ZB 1BDMA 2QMYA 3K1AA 4B6OA 1EXWA 2AFIB 1KI8A 2ASEA 2VBCA 4LQ4A 4RSRA 3ZHVA 6CHYA 5IT5A 1QKKA 1OGJA 3GLGE 4AY2A 2ET6A 3ZWBA 3TK1A 4JXZA 5ALUA 1R0SA 1M1YA 3RRYA 4BFTA 3B1ZA 3OI7A 3C6MA 1SULA 4BCCA 1EA5A 2X4LA 3UUGA 1WXFA 1ZCBA 4IF4A 3TI9A 1TZJA 4ZCRA 1G0OA 2XAUA 3OD5A 1ES9A 4MR7B 2XI4A 4YREA 5BSUA 4W9NA 2CXOA 2WY2D 2OCAA 4B6GA 1C3OA 3FPBA 1ZVQA 3NEAA 5E6SB 4HD8A 4BB6A 1L1FA 1U8YA 2II6A 3O7WA 4OHBA 2VWGA 1UKCA 1P29A 3ZQKA 1I1QB 3BXEA 3ETHA 3AOEC 3C85A 1QFZA 1QC5A 3BQNB 5DU2A 2ZUTA 4AY5A 5FWNA 1VPEA 1WBDA 4G0MA 3MC1A 2FPIB 3R8XA 5FH9A 2BZSA 2X77A 3IR5A 1CQIB 1XJWA 2I2XB 1NRWA 4WKCA 4B31A 3L02A 5IANA 2AW5A 1ACJA 1S4MA 3MEQA 2E2WA 2ECFA 4FR5A 4W8GA 1N0VC 4X1KA 5DRYA 3WS7A 3DBHB 5AVTA 5IVPA 1ULZA 1SB9A 3LA8A 2FNAA 5FI0B 4X6LA 1EWTA 1WXIA 2DQYA 3TXXA 2XGJA 3AFIA 4P0PB 4Q1EA 4TWAA 1QGUA 4B17A 3BD9A 1S0UA 2VYNA 2QM0A 1JTEA 1XTIA 3DM9B 4KEAA 4W9NC 4FFLA 5BRNA 4PYRA 4BX3A 2F90A 1E4EB 2YNMC 3TIXB 3TLGA 3T5TA 3VYVA 2DBZA 2GAOA 3LBYA 1BE0A 3LL7A 3NAQA 4GR9A 2TECE 1YH3A 3U13A 2CYCA 1ECPA 5AUNB 4CEJB 1RTKA 2E4UA 1NJ5A 1NG1A 2MINA 3GEPA 4X24A 2FRXA 2A35A 3AV3A 3T7AA 1PHPA 2J9YB 3ECAA 5AM2A 3GEIA 4YWJA 1CB0A 1N2OA 4ABTA 3IPCA 2I34A 2XXJA 3FYSA 3K0FA 1Q7BA 1FP4A 1RCFA 2H0RA 1H8HA 1L1EA 2ZETA 3U7HB 4E46A 2I29A 4GLFA 2WKWA 1Q0TA 4U4AA 2FSUA 5LDHA 4N6NA 1RZ3A 1XMQB 3A4LA 13PKA 4V0SA 3WQRA 3QSYA 3PT9A 5B58C 4E51A 2I1VB 5KTYA 1ZI6A 3GZNB 4UBOA 5EWJB 4G0ZA 5F7ZA 4J0EA 1GUYA 1L5VA 1NP6A 1KJNA 2ZUSA 3U80A 2LIVA 5COBA 4HVCA 5FWYA 1I7QB 2HI0A 1E77A 1NSYA 2RB5A 4LWQA 4YRBA 3OQNA 4UZFA 2Q3HA 1M2JA 1RBZA 5EE5B 2E4YA 1OFTA 4EZEA 4XR9A 1RC1A 4DMRA 1I4WA 5DCUA 1XCGB 2I4LA 5T4FA 1F48A 1Y7LA 4KWCA 1MOPA 4LIPD 5JROA 4MRMA 4F11A 4HXGA 2ID7A 4YCCA 1VIMA 1M7GA 1GQYA 2CVHA 5JMWA 3WGIA 2FWIA 4DMMA 4ENSA 3U56A 2EP5A 5I7VA 2JLZA 5H3HA 1U0FA 4IJ5A 1L7VC 2EFEB 4J29A 2ZBRA 1HSOA 4LSWA 4WLVA 4F45A 4RK1A 3N53A 2D1YA 1GQFA 4OXQA 5BQXA 3RVDA 1CY6A 1R3UA 4E4RA 2IZ6A 3WGLA 3ABQB 1AS2A 1L4BA 2M1ZA 1T2EA 2PKYX 1R16A 3LGXA 2XCTB 4JI2B 3MUEA 1AO0A 3UB3A 1QG6A 3R9WA 2PU7A 1YRAA 2XE6A 3H5VA 5I47A 3U4QB 1I3CA 3IT3A 2QTVA 4JU8A 3P2KA 3V42A 4BGIA 4BE4A 5I3ZA 4JWTA 1K2VN 3ZBQA 1BVHA 3R0QA 3DLCA 3D02A 2Q3FA 5H83A 1XXHA 4CUKA 3LBNA 3ANTA 4DAOA 2LZ0A 2FPMA 2QHXA 3QXSA 1N2HA 3VGJA 3PXUA 1NTOA 5KNCA 4BZQA 1DQRA 1EH5A 2QTMA 2QZJA 1X7WB 1BMFA 2YY5A 3NEJA 4MW2A 2QSYA 3C3XA 1QG0A 2X3UA 4XIJA 5HMLA 5THQA 1V16B 1Y4AE 4YC7A 1O2DA 2PGNA 3X1JA 4DG5A 2QN2A 1QZ3A 1PVDA 4O3FA 1B26A 1EUDB 1I13A 4QULA 1VL8A 4YTEA 4M21A 4HB2A 1J5PA 5KNDH 3GJ5A 3R8FA 2EWWA 3E22B 3LI2A 4CM7A 4UXIA 4LBWA 1E7WA 4FHEA 1O58A 2JGAA 5EA2A 3W5DA 1DHTA 4TX1A 3PIDA 5DHSA 2V3CC 3AI1A 5L4SA 3NTVA 2JIRA 3IQEA 1W0CA 2Y71A 3C3WA 3NV7A 3QG1A 1FP2A 7ABPA 3HZHA 1KEWA 1SELA 5FP0A 2BTQA 5K0BA 5DK6A 2DB3A 3ZCXA 4RD6A 3DMHA 4FQ5A 3V80A 4RXTA 4WKBA 3NFRA 3EPJA 3M9WA 1QYVA 4OL9A 2RH5A 1DG3A 1WHSB 2RHTA 3JYNA 4UBMA 4DMGA 5AW6A 2DPXA 1TMYA 3RJMA 1U80A 2ACWA 2DR2A 4BVFA 4FKZA 3OO1A 2YHSA 2XDWA 1COWD 3R5KA 4LY6A 4MW5A 2VJLA 2HMYB 2Z6AA 5EUMA 3FSRA 4WAUA 1QHHB 1QNFA 3HFRA 3GP8A 4LJ6A 5I7EA 4N76A 2EC5A 2PS0A 4DXHA 2CCJA 5CAEB 3A1VA 1FX0B 4IIXA 2DX7A 4CMJA 2ZZMA 3TGWA 5TNXA 1BS9A 4C2UA 2W4IA 4CG0A 1KFJB 4GI7A 4O4IF 5ICFA 1RRPA 1W47A 3FLMA 4OB6A 1VMKA 3LRTA 4BO5A 4IIJB 4H3HB 3VM6A 4BIMA 4TROA 3V2UA 1L3IA 1KP9A 1HE4A 2CUTA 2NO6A 2WSLA 3M4YA 2AXQA 4WJLA 1J8QA 1I10A 1XDSA 2HRBA 1XEXA 2NSJA 4PWYA 4RVOA 1KMMA 3L0ZA 1O8CA 1QG2A 5FULA 4P58A 4R98A 2ZRNA 3LDHA 2EJUA 1I7PA 2CJXA 1GZ6A 3HJAA 3QKWA 1FXWA 1XNGA 4IRXA 4MVWA 1XZBA 4N12A 4PIPA 4WXMA 1SAYA 4Q4AA 3CR7A 4PXSA 2V97A 2CHVA 2Z1DA 3EVTA 4I8DA 4NPAA 3PVZA 5T41A 4BFWA 5HKKA 2JA1A 3BMXA 1RNLA 1SD5A 4J07A 3DOIA 4ZVKA 2WUVA 3AH8A 1JNXX 2ZWPA 4I55F 8OHMA 1FW8A 2HF7A 5D85A 4IQGA 1T9AA 3WB9A 2WSBA 1KI7A 1YR8A 2FEPA 3L82B 2EKDA 1OVMA 1JRLA 2NIPA 5EXPA 4MS3A 4CIVA 3HE3A 1YJAA 2R1VA 3DDHA 4BZWA 4HQRA 2WT8A 5JWHA 3BA1A 1VB5A 3PWTA 4IZ6A 4X1OA 3WKBA 3H8VA 2FF7A 3PYXA 4TV9F 4C6HA 3NH9A 4O4IB 1JMVA 5HJEA 3IX7A 3LZ6A 2FYTA 5K0EA 1GEEA 2JIZD 2W2MA 1ZUD1 2YZGA 3BTVA 5DLQC 1BMDA 1E5VA 1RWKA 1PI3A 1AE1A 4JGGA 2R6ZA 1SUDA 1VG0B 5BSHA 5JYBA 3JV7A 2XIJA 1QGDA 4F4JA 4DNOA 1ZU5A 2PH7A 3HO6A 4AMYA 4BTEA 4I08A 4JUBA 1LI7A 2Q5EA 3K6SB 1NM5A 3GQBB 3W2EA 5DI3B 4UAGA 5BSGA 3GIDA 3C3EA 3I05A 1JHPA 1KDTA 4DWVA 2G08A 3BX1A 5DNAA 3GMIA 3QY9A 1VJDA 1Z0IA 1WXEA 1RT9A 2GZMA 3R3WA 4I1VA 3SD7A 2KLBA 4EG0A 2CNKA 3LIPA 3ETGA 2AYZA 1IPFA 1GKYA 5KYKA 4POAA 3OMLA 3VR0A 4BFYA 1DAFA 2ZR8A 1KKUA 2V7PA 2PMDA 4IKPA 3G2MA 3HN7A 5DYNA 2B6NA 4CM4A 2HRDA 3E4CA 1AKUA 2QRUA 4P3YA 5B2ZA 3T61A 3NIGB 2QRHA 4ZN6A 1RFLA 1S3FA 2ZJFA 4QO8A 5CDYA 5I6DA 5JT1A 1OTHA 1NVXQ 5BW4A 1U99A 3QM1A 3PEYA 4UD2A 1T1EA 4GPAA 3MA0A 4YJFA 1NM5C 4OMUA 3ZE7A 4CKCA 5HJ2A 1XPOA 3BXGA 4TS9A 1IB6A 4GGMX 4TYYA 2FZVA 5KQGA 1DGQA 2V03A 3DMDA 4AJHA 5FTNA 3T1QA 2WIJA 2VATA 5BN4A 4PTLA 5AHWA 4FILA 3D2CA 1F8FA 3LU1A 4YRZA 3QE9Y 1QYCA 1GKIA 3VPFA 3OIUA 2HREA 3X1KA 3NP7A 3VNUA 1W48A 4Y6RA 1BFKA 2AJCA 3VR2A 5KI6A 5KO2A 1V2HE 2C8VA 2YWFA 1YD7A 2C5LA 2DQSA 3PPWA 1E3DA 2CJPA 4U9HS 3DKPA 4NECA 2WKSA 3OE4A 3WWCA 4ALMA 4HGZA 3K9WA 3U7GA 3DP9A 3UV3A 1ZJWA 1SVUA 1ORTA 1SIWA 3RF6A 3RS3A 4KQKA 3I58A 5LB2A 2F1HA 3I37X 1JBQA 1NVAA 4A6PA 2NPFA 1TQ6A 1X1BA 2HJHA 3W3AD 5JHHB 5JYCA 4R41A 2B5OA 1PS0A 1RYHA 4MA5A 5J1SB 1L8AA 1I14A 2RGNA 2AF3C 3QE4A 4DWJA 4A8JA 1B1CA 4EGFA 4PIVA 4Q18A 4R1TA 2BEUA 2XXAA 4M9RA 4XPZA 5CU7A 5BSEA 4S0XA 3CZPA 2TMYA 4OQ4A 1BRTA 1D04A 3IUSA 1TF5A 5EJ7A 1Y7IA 1JSZA 2H18A 1UZLA 3LO5A 1QCDA 2R8PA 3IE2A 1LSSA 3RBVA 2VZLA 2B99A 1UOEA 3AC0A 3NHFA 1TK3A 2H06A 5EFZA 1N1GA 4GMDA 3AM5A 1RXEA 5F52A 5AFSA 2BFDB 1UQUA 1A8PA 1JAIA 2CNNA 1A4UA 3ZUGA 2RB4A 3KYBA 5FPKA 2Y9PB 1L4UA 2IUSA 5LLTA 5LLSA 4QDXA 3NHLA 4HN9A 1T4BA 3ZHUA 5FFFA 1UQRA 1JEJA 1N2JA 1W1UA 3JY6A 4MYCA 1IC6A 1Z29A 3ELYA 3OIFA 1CDZA 3Q3EA 3TIFA 1NXTA 3KB2A 3H2JA 4KLAA 4L6CA 3ZYZA 5J23A 3D6UA 4F5YA 2RGNC 5JQGB 3PFNA 2IHTA 4JEUA 3TRHA 1L9KA 3WQBA 4A8JC 4DSUA 2PZ8A 1WXGA 2G04A 2Y99A 4MV5A 4QUJA 1C4OA 3NHRA 4OCZA 4D9BA 1PAUA 4LJLA 5JEDA 3KSZO 4IQ0A 1EFPA 1YTUA 2QTHA 2X0EA 1YUBA 4TV8F 1YHNA 2A0YA 2WTBA 2XJ4A 2AOUA 1U2EA 4RSHA 1XE3A 3VV3A 3GN1A 1E5LA 3PNVA 1AGXA 4QTUB 3QWIA 4Q9KA 5CIWA 3QFFA 3VH1A 4GSKA 4V1CB 3BD8A 1ZOPA 2QVCA 3BICA 4LZJA 2OHJA 4TSFD 4X54A 1XTSA 3UHPA 2I87A 3VHXA 3CUSA 3CNBA 4J1NA 4X93A 4LYDA 1A27A 1LDMA 2J46A 1SIOA 4E1AA 3OMXA 2XQGA 3VKFA 4YR9A 1CBUA 1B3RA 3AVTA 5LYJB 1QU3A 2XDYA 2AMJA 2B4RO 3ICWA 2OEPA 4I1SA 3B9BA 3CNLA 4IUBS 3HY6A 4DCGA 4NXMB 4URXR 3FPCA 1KR5A 2AZXA 1FYDA 4YMIA 3KUXA 5JSUA 2ERYA 1VBFA 4WNAA 4AYWA 2HRCA 4MITA 4QQRA 1HLFA 1Q12A 1XA3A 3RIMA 1BCRA 3L7LA 3QVJA 2NGRA 5JBNA 2WTMA 2BFCA 3ZZMA 1QUFA 3T4EA 5AHXA 2UAGA 4Q24A 1QH0A 5ES4B 2IZ5A 3K4QA 2IL1A 3JYPA 4ZHQA 5JZSA 4HG2A 1E6CA 3STWA 1RWNA 3QQPA 4MJXA 5AUPB 3IQGX 1ODFA 1WHTB 5ECYA 3W0LB 1PT7A 4FKBA 4OOEA 4WI1A 3ZI0A 3Q7EA 4R2HA 4Y6GB 5LU8A 1LX6A 1J5XA 1QB7A 2V0CA 3HSSA 2NAPA 4KKXB 1I3KA 2HA0A 2EG9A 3ONFA 3VNRA 4XFDA 1VYUA 2C5HA 4LNAA 4AJIA 1W35A 3PT5A 3JTMA 4MQEB 2HZ7A 4E03A 1PD0A 1M7HA 1SCJA 5EZYB 2VJNA 3QWHA 4KDCA 1YR2A 1Q3HA 3IHKA 4YLYA 1YS1X 1I6LA 1RBQA 2YQ5A 4O4LA 2G76A 3D3JA 2IW3A 3HXKA 4WOJA 2Q7DA 3VVMA 2JARA 3RHFA 5BWLA 5MDHA 5CFQA 2JGEA 3FAKA 3HVKA 4A27A 1WKCA 4LG1A 5FQOA 3DVAB 1FFWA 3E5RA 2H1VA 4ZO4A 3VR6A 4EYEA 5LBUA 2EP8A 2O8CA 2H59A 4AF7A 4UC0A 4C0HA 4HDRA 4ZP1A 2A0UA 2EF0A 2JEZA 2W83A 5LNK6 3MJTA 3VR3D 4AJ4A 1NJGA 2D1RA 2XPCA 4XEHA 2NADA 3BG5A 3T3NA 3W1VA 3ICQB 1KDYA 3H1TA 1EJ6A 4RMGA 2R7KA 3RJ5A 3AHEA 4S0ZA 5DM4A 5GIOE 1LDNA 3CYFA 3MB8A 2WV7A 3TNDA 1M83A 4TLDA 3BIWA 3QYPA 5EWMA 4NG4A 2DLCX 3BDIA 2PWZA 3O1HB 2JBAA 5CLJA 2CFOA 5BXYA 3RRZA 2MIIA 1A97A 2IYSA 4UVEA 3V7FA 4JJAA 1JHXA 2ORVA 2ADMA 4OU4A 4QTYA 1N57A 2B1JA 2GETA 3BUSA 3C5WP 3IIEA 1Q0ZA 1YE8A 3DE2X 4HDKB 1R1DA 4OJYA 5BQ5A 4GKKB 5BSRA 4JVMA 3B48A 1V6CA 1LDYA 1KEPA 5CLFA 3O8CA 2N42A 4H0CA 221PA 4CE6A 4W6ZA 4GPTA 2M6KA 5IAEA 2CMHA 4Y2VA 3RYIA 1W6UA 1GXSB 3HR7A 4AX8A 1KDOA 3JD4A 2P90A 4IHAA 2ZE5A 3UK0A 3RCBA 3C41J 3EC7A 2ORED 2VYQA 4HWSA 3TL3A 2ENUA 3SQWA 1YC5A 3NH6A 1GARA 4PZUA 3IOMA 2VT7A 2W2KB 3QXHA 4BFCA 2VHEA 5AVKA 4XD2A 2G77B 2VP5A 3SYMA 1QJ4A 3MMPA 4B6JA 3BRCA 1PFVA 3HYRA 5K3FA 4YGYA 2RI6A 3P19A 3CQ9A 2P8SA 1NW5A 5CP8A 4HAYA 2QR3A 3ST7A 5B58T 2JGFA 1NONA 1OXXK 3PX3A 4Y3UA 4WBNA 5CB4B 1R4MA 2SCUA 1FK8A 5CGZA 5L95A 4Z4QA 3ZIUA 2ZCVA 3QSGA 3QNUA 3AVXA 4RHUA 2RGGA 3UA4A 2BGIA 1SBCA 3FGOA 2B30A 3JWIA 2PX8A 3NOVA 3G89A 4N40A 1E98A 1FRNA 1AHNA 4K26A 1C9NA 2JB9A 3I8XA 5F33A 4AG5A 2O8FA 1EAMA 2FWAA 3M81A 4JJIA 2CV2A 2VEDA 1FFXB 1WD5A 1U8XX 1E5DA 3RK1A 3UJDA 1SKUA 3T95A 1G42A 4M6WA 2LDBA 3V9PA 2Q50A 1JEQA 2JJ2D 4Q39A 1KPGA 2I8CA 3B3FA 5EHXA 1SOAA 2E6KA 4HYEA 5AVQA 1GNTA 1Y6FA 2X2FA 3KALA 1ZONA 4UBNA 2PLRA 3WB2A 4LYGA 3ZU6A 1LPAB 2BGLA 1KC3A 1J0CA 1MDFA 1R9JA 4I5GA 2J3KA 2F1RA 4U2EA 3RSOA 4EHLA 4TVSA 3PDWA 4OH1A 2GN6A 5CDFE 1UZNA 2WQ7A 2FK8A 1GPJA 5KAMA 1JIXA 3ZJ5A 5JCJA 1Y4UA 3T5CA 4FYPA 4DT1B 3HDGA 2JLQA 1JPNA 2GEVA 1YCDA 4NOJA 1YQXA 3GJ7A 1L8LA 5EGSA 1BMQA 3HFJA 4JP8A 3FJYA 4KO8A 4TS3A 3NWBA 3O94A 1WSAA 4U2CA 5D86A 1LZKA 1HOXA 1OX5A 4X7RA 4LQDA 4LJAA 1IY2A 2GHIA 5K0SA 2PGOA 1QMGA 2E4ZA 4IDQA 3NYRA 1I33A 1Q7TA 1D09A 2C3UA 1EDEA 1ONNA 2OK7A 1M2NA 4WCDA 5CJJA 1KSFX 2F1OA 5E7QA 1NT2A 4XGIA 3VZSA 5KVSA 3C5VA 3G2PA 5GZ6A 1AK2A 1SC6A 4HCJA 4BRUA 1LQTA 2IU4A 5C5IA 4DMLA 4F4CA 3FUXA 2HQRA 5E7IA 3WNQA 1OLOA 1QDUA 1U8UA 4PZCA 1RHKA 2EKPA 5AKXA 5JH7B 1PJLA 4ND4A 2UYGA 4JSRA 4RD3A 2C20A 2J45A 3LUJA 4AX4A 5LA6A 5AJYA 3Q3IA 1PJSA 1T3TA 2GMWA 5CX4A 1Z0DA 3IOBA 4CTOA 3FPKA 3T1NA 3MMXA 4D74A 2YJNA 3LG2A 4ER3A 4HDSA 1JDVA 5EQJB 3U26A 1AQIA 1NVKA 1ZVKA 3FGZA 5D87A 4ZYVA 3VR5A 4Q48A 1RLUA 3CRW1 2A33A 1ESMA 2DFNA 2C7VA 2G67A 1SXJD 2BR5A 1BX0A 2G8LA 3E3MA 3KB6A 4BJ6A 2GN0A 4B3XA 4EUSA 3C8MA 4NH0A 3ABOB 3JWHA 2QR2A 4J2OA 4BJ3A 4ZXPA 4HI0E 1PZNA 2BSXA 2A5FA 4PAGA 4QREA 4N9WA 4TQAA 4V0NA 1M1XB 3V8EA 1VIYA 2DLNA 1I4OA 1OYOA 2QRQA 1QV7A 3I1FA 1W25A 4EFMA 2M1XA 1YVEI 2QE7D 4NOLA 3C3DA 3I73A 1DAPA 3V00A 1MJNA 3QU2A 1DOAA 3NALA 1NQWA 4RFSA 1GN9A 4WXHA 4LDRA 3UF0A 3VNAA 2O59A 2AMFA 3ZWWA 4GYJA 5HQTA 2X0FA 4RELA 5FWXA 2VT2A 1D1QA 1JLLA 1LS6A 2X14A 4PX2A 1YZTA 1YKGA 1Z6TA 5B37A 1MPXA 3UQYS 3X1MA 2NU7A 3GF4A 1Y7HA 3GLQA 2R5FA 1YFKA 1NR5A 1Y37A 1W7AA 1EMDA 2KWIA 2NXCA 1U0RA 1H4QA 3OWXA 4FYMA 3GX1A 4RIEA 3ZGYA 4BY9E 4POOA 1MC5A 1T2VA 2V7XA 2D0PB 2J9GA 2HDHA 4JBLA 3RBAA 2QN1A 4CTNA 5KWEA 1PX2A 2YYYA 3C8ZA 1TT5A 1JXQA 2PX0A 3ZK8A 4CTJA 1DV2A 2H1LA 2IEIA 4MTCA 3HXTA 3ZHYA 1PW5A 1KAQA 1GTJ1 2B2NA 1DRVA 2N1MA 1O96A 3NBMA 5CT6A 1OWMA 1NATA 2H07A 2ZTVA 4TKLA 4Q03A 4Y2XA 1ZJ4A 4MA4A 3A9SA 4NJEA 3E8SA 1BXRA 4E88A 2A6PA 5G41A 4PTZA 4EFNA 4X60A 2VJMB 4B35A 5BN5A 5IDWA 4JBHA 2GCGA 1NN0A 3DUFB 4X6YA 5C80A 4B74A 2B82A 3R6LA 4ILKA 3VVCA 1UJ6A 5CFNA 5HM6A 1VMIA 4FQ8A 4LRXA 3V55A 1BSVA 1NLFA 1IHXA 3CLSC 3R20A 4L9RA 4C3UA 1Q84A 4PIMA 5AIAA 5B3LA 2JGKA 2OV1A 1TI7A 3LQQA 3CW9A 3FDIA 3MS4A 1PKEA 1B8UA 1M75A 3IHTA 4IGFA 4YAFA 4ZWNA 4P36A 1QIMA 4B81A 2AC7A 1H2FA 2FXVA 4KR2A 4PYOA 2YFQA 1QE5A 3QMWA 1BMTA 1CUAA 3AJ9A 4WK2B 3CLUD 1JV2B 2D1FA 2F62A 3DS8A 2DCUA 1N92A 1VFPA 1DRJA 1CERA 3LP5A 1Q15A 4L6IA 4DOMA 5IMSA 1EHIA 3GVHA 2QT0A 5LMZA 4QGFA 1PNTA 2DKNA 2JAUA 3IT2A 1R0BA 1ECFA 4B76A 3AB7A 1L5YA 3R5SA 1HM5A 4UNIA 2GCOB 5AVJA 3OKFA 3R41A 2CWDA 5KC9A 5L3SB 4QD3A 3H1BA 2RC6A 1KJJA 4DEYA 4OGFA 2VDLB 3V8QA 2Q2QA 1H4SA 4GI5A 3RABA 4CF6A 2G9QA 4MWZA 4ECEA 3U61B 3JQDA 4BN4A 3PJFA 1XCMA 4ZO6A 2WYHA 3AVQA 5A5FA 1WZNA 3CXUA 3RNOA 2NO4A 2IDKA 5ALDA 3AFMA 3TXYA 1P9NA 1NMYA 5HKOA 4DDMA 3LBAA 5LZ7A 3UC9A 5EUBA 1YZ3A 1F3LA 4QGBA 3K0HA 4NXNB 5G4KA 1VP3A 1AIPA 4NZPA 1LDBA 3FVVA 5A2QA 3QKTA 2RG1A 3BF8A 1JKMA 2QRGA 2WR8A 3ISJA 2I4OA 5I7AA 2JDID 2O0JA 2UVPB 3DO8A 5D5QA 1W4LA 5GONF 4HQOA 4JYAB 3I6BA 2PZLA 1E6MA 1K9SA 1IQRA 2A0XA 4Z4FA 1AS0A 3G2KA 1KU6A 4QWWA 5FI5A 3LSTA 1E9BA 4JASB 4S1OA 2BFPA 5DE3A 4A0HA 3GNQA 1RQRA 4B09A 4GM4A 1JKJB 3O83A 3T3MB 2A9JA 2X42A 4J6EA 2C61A 4LKOA 3WGGA 3E3LA 1P0MA 5FPPA 5L45A 2O0KA 1FSGA 4DXDA 2QD1A 1BAPA 4EHDA 2ZJ8A 4I2NA 2HW8A 2NYUA 3PQ7A 3RLFA 3HCBA 4CJXA 2XUIA 2ZATA 3OLWA 4EUKA 1MCZA 1NBMD 1U8TA 1IN4A 2GD6A 2WYVA 2HB6A 5JWOA 1HURA 1U2TA 2R6GA 3KDAA 3FUVA 4Y1RA 5GZ1A 1XZAA 5T3UA 3U7QB 2IQ5A 5JOQA 5JNLA 4JFAA 4E6PA 4WFIA 1C8VB 2BEWA 3NIBA 2EU8A 4JR0A 3KZVA 4DBLE 1D2EA 1I30A 4RCVA 1F5NA 1ECBA 1H0HA 2WMOB 3CH6A 3ECCA 3MB5A 3ADBA 2CFIA 1UPFA 3HVJA 5IVKA 1LUAA 1PVOA 2LRHA 1WDLA 1UBEA 4G67A 2BI4A 4HYYA 3A6JA 3FUCA 3QY0A 5IDXA 3WO0A 1XHFA 2Q6LA 3PJEA 2GILA 1LGYA 1NW3A 1W9HA 1P2BA 5ARCA 5HZMA 2E4VA 4N49A 3ORFA 1RCTE 4MGZR 4CLOB 5FBRB 4BVAA 4WKPA 2REOA 4YEDA 4ACAA 4BLTA 3GT4A 4I3GA 3ZE8A 1VPWA 4G0WA 3FNFA 2OK8A 1WDWB 2O6LA 2PX6A 3Q7SA 4J3JA 4TMXA 4LYEA 2GHRA 1W1WA 3D64A 1FUEA 3BDVA 3OCJA 5JC1A 2EGGA 1UXGA 2H1CA 1OI3A 3WAGA 3Q5GA 1N3BA 2HIGA 2PKCA 4V02A 4ZYTA 5JJCA 2WU0A 1NV9A 2X7XA 3FKQA 2HC9A 3NVKI 4FYJA 2HQBA 7MHTA 1Q92A 3NYQA 2PLWA 2ZYTX 2ZI4A 3ZDDA 4K3VA 2CVPA 4G84A 3GLGA 1DQNA 2IEBA 3QUAA 2NO1A 4YCAA 3AUKA 2BHRA 2F48A 1C8KA 1ZGAA 2QPOA 4LOJA 1N4DA 4KO2S 2PBRA 1QFYA 1ZEMA 2OVBA 1MJHA 2R44A 2ZRQA 5K0GA 5LOVF 2C83A 2X9VA 4ER6A 3ZDZB 4BFUA 3B8HA 2OZVA 1LJLA 1O77A 3TR5A 2QX9A 4E5DA 5BYJA 1FTNA 3NKFA 1KAMA 3OZEA 4L2IA 4NV0A 2EX1A 4QAJA 2PBLA 1I0LA 4I46A 3GPBA 4RESA 3GNSA 1NG9A 3SSAA 1GL9B 1E1YA 1A5BB 3TUIC 4UHCA 5CD9A 3ENKA 4JYZA 1Y5LA 1XRSB 4YBRA 3G7UA 1I1OA 5EJMA 5JPDA 4KHPB 1GZUA 3G1UA 1DX6A 2CZGA 2W6IA 3HV0A 4XCQA 4EMSA 3OTOB 1VC2A 2ZROA 3DHVA 3QVXA 1G66A 3B7PA 4FBMA 4HNUA 5AVZA 2HBZA 1PQYA 2QZ4A 3PPVA 3VPAA 4C07A 4BQPA 5C52B 2XWJI 5JW6A 5DN9A 3HMKA 4L4ZA 4B3GA 5JISA 3KSUA 4WA7A 2ORWA 4NEGA 1I80A 4AAYA 1RXWA 1P6QA 1E18A 3NW9A 4BP8A 1T1IA 2QP4A 2W58A 3I4FA 3KKPA 2B1QA 3JYHA 2H2AA 4RANA 2BFFB 3DYIA 1IN8A 4KB5A 1KJZA 4M3NA 3U4IA 4JX8A 4D4HA 1LU9A 5JNUA 4NQRA 3T7CA 4TLLB 2J08A 2HEIA 4IVNA 4I6JA 1O89A 1V6AA 2WE8A 5DM2A 4AW9A 1Y5MA 1WW2A 3QWFA 2GCEA 3F3YA 6REQA 4PRLA 1OB2A 4LYAA 4LOLA 3FLAA 4K8RB 1QQ7A 1EE1A 1KVTA 1OLXA 1XZJA 2VI5A 4FFMA 2OBNA 4DM4A 3QPCA 1P0CA 3B38A 4QT4A 2GJ8A 2D59A 1IEQA 4MQFB 4IXMA 1U2DA 5IK2A 3QBEA 3PQ3A 4MDFA 4GI3A 4BAGA 1ZW6A 4BZZA 1JQBA 2OGTA 1WWKA 1FMJA 1Z0AA 4CQMB 2JGIA 3VV2A 2IYLD 3HP1A 4O08A 3IBSA 1KP3A 2CNBA 5EHQA 4A26A 2PUEA 4P0QB 2FUG6 1BGXT 5FPYA 1G5PA 2XADA 4X66B 4QC2A 1T3HA 4BAZA 1JA9A 2IOHA 2O1SA 4UHEA 3ZHRA 1GNQA 1XF1A 1MFZA 2VDNB 1L8XA 1W5FA 3EXG2 3MPUA 3PNOA 2VNHA 4I9NA 4Q3DA 2NQ2C 5DYYA 1X19A 3DR5A 3SN6A 2WWFA 2JD2A 4RK0A 3HCAA 3BORA 1VKZA 4PSVA 3SKVA 3L07A 4RHCA 3HVUA 1IBLB 3S2GA 1JILA 1ZBDA 4B80A 1A0OA 2PZGA 1GKLA 4DC1A 4YP7A 4I8XA 3BHMA 3L1HA 4AM8A 4IM7A 4YHBA 4A8TA 3RVRA 1VBMA 4BLWA 3TNLA 4GL4A 4MVXA 1Q5PA 2EKQA 3EWNA 1SGWA 4WGFA 4D3DA 4YMVA 5LQDA 1MHPA 5DMHA 2A4MA 2WI8A 2V65A 3OC0A 1TM7E 4UHBA 1U2DC 1MLDA 2NUAB 1EFLA 3THXA 1ZVVA 1SUEA 1VLJA 1TVMA 3FCOA 3IB3A 1D4FA 3NM6B 3Q6NA 4LBYA 3ED1A 2ALJA 1Q16A 1IZ9A 1ZRHA 2CYBA 2YJTD 3JQAA 2XE8A 3NG1A 1M66A 3EXIA 4WEQA 5TQVA 1NJ8A 3V46A 2O6HA 5I7RA 4G0VA 3OQBA 4W1QA 5JJBA 5HP4A 3ITDA 4M1EA 521PA 1JJ7A 3WLSA 3CRVA 3CVVA 4MDYA 4ZI3A 4AJ9A 5GVSA 1N77A 2JLXA 2K2WA 3IYLW 2WJIA 1HYQA 2W6QA 4YT4A 3AF1A 3T3OA 2QL6A 3IE0A 3V6MA 3QVMA 3EOZA 1QRUA 4FJ0A 3BXFA 4YJ2A 2AHOA 2VZ8A 3JPWA 3P45A 4Z54A 1MORA 4KR3A 5EAIA 2JNWA 3F78A 4HAIA 2X8BA 3RYTC 3T52A 3M6UA 4IAOA 5K6RA 3PDJA 2Q5QA 4N7BA 1XQ1A 3IVMA 2I3DA 1I8TA 1JSXA 1AKWA 3AZPA 2F8MA 2P79A 1TGVA 1EVEA 3EGOA 2O48X 3OIDA 4M1ZA 3AUTA 4LVCA 4ZCSA 4E22A 3EIQA 3FTPA 5FEMA 1NWHA 2AT1A 2BAGA 1E0JA 1E94E 5DGHA 5HS4A 5I5EA 3SZGA 3LJKA 1SHJA 2BMAA 4LEIA 3I9OA 1WW8A 3H87A 3I64A 1QK3A 1SC9A 2C78A 4RGYA 4HDMB 2V6FA 4DBZA 4BB0A 4Q34A 1N0WA 3PG5A 2IYOA 2GYWA 3QEJA 4P3OA 2X9NA 3RC8A 1EZ4A 5TPZD 1FDVA 1F4VA 1HMYA 3HUFA 3G82C 3OLVA 4UEQA 5KDOA 1A50B 1RRKA 3T34A 3TG8A 1NLYA 2FFAA 2EHDA 1PQWA 1XK6A 1W5BA 2GRAA 1OY1A 2C9BA 2HRZA 4XJXA 5CG1A 1TEZA 4I8IA 1ZESA 5D3MA 1ZD4A 5A2GA 1HSZA 2AG6A 3CN9A 3WIDA 4CMCA 2QTAA 2Q0QA 3LVQE 2CNWA 1X7ZB 5KJ6A 3JZDA 2FW9A 2WIDA 1KVRA 4PHTA 1EPUA 4AF8A 4DCCA 5FLXA 4OFBA 3FPGA 3JVEA 3EPKA 2C2ZA 5U9CA 2VPTA 1GGJA 3AG5A 4HSGA 1SBZA 5BSTA 3N6VA 4FCTA 1ZK4A 1W5AA 1TC1A 3D3QA 4OJTA 2BFMA 3TQQA 2BFBA 4I9UA 4LXYA 2JFVA 2FPUA 4Y8VA 4P92A 2BCGY 4HQNA 3E5NA 1SU8A 3N74A 3GARA 4FWTA 4L74A 2W2LA 1RPTA 5BUCA 3RYHA 4IGAA 2J4FA 2JIPA 4QYXA 5DHPA 1HF3A 3W77A 3A1CA 3X0DA 2GZ3A 1YI8A 3Q5DA 1TF2A 4IMPA 4UTXA 4L9SA 2P27A 3S28A 3ANLA 5B7NA 5HDBB 1O57A 1VLQA 3SQXA 2BGRA 2Y1EA 4LY9A 4P2GA 5KMGB 3ZH9B 5C5CA 1PEAA 1Z9BA 4YJ3B 2BHSA 3EGXB 3IP7A 1A98A 1IBCA 4PO3X 4XTCS 3ZNQA 1FDWA 2FG7C 4D8WA 5KTRA 4HH0A 4FFBA 1R88A 3L06A 1EX9A 2XX3A 2V54A 1L7NA 3OA0A 4IS3A 4JUAA 4YJKA 3E8XA 3MWEA 1DUSA 4GPEA 3VH3A 2NV0A 2XMSA 1NL3A 4MI3A 1YB2A 3JD0A 4MSUA 3CSSA 1DEXA 1GUZA 2BHLA 4O2BF 5IJAA 2NOAA 3RT7A 3VU3A 3DNMA 4QVKA 2Q28A 4CQMD 1P73A 3P52A 1ZA1A 1YU6A 1P1RA 4FFPA 5IKMA 3ESXA 3FOCA 1LLFA 2J5RA 2G9VA 3RS9A 1LCIA 2I1WA 3OM1A 1VCOA 1O4WA 3FKJA 3L49A 4P3PA 4EJ6A 4KPEC 4MH0R 4EELA 4G8BA 4Z5XA 4N5MA 1DC3A 1Y7TA 5J43A 4R54A 3D8BA 1G6OA 4RZSA 1SIBE 4M53A 3JWJA 4GLOA 4HNAB 3M70A 3DP7A 1XA0A 2FLKA 4UMFA 4PG4A 1PU2A 3X3HA 2D7JA 2FUKA 1G7CA 3PUIA 1DXYA 1UWCA 1G291 2YXLA 1IXZA 2AD5A 1F9AA 4O5OA 4XM1A 4CXMA 4A82A 3LY9A 3VU9B 4EUNA 4XPIA 3EGDA 1JLMA 1G16A 1O9BA 1S1MA 1DZIA 2LP4Y 2QD2A 4MLDA 2X6QA 3FD8A 4HTFB 3ZNOA 4AI6A 1K75A 4FT4A 3G2JA 5JU6A 4BKOA 1BOFA 2ODNA 2OOSA 3HHEA 2HWYA 3OICA 2MR6A 3WQSB 1QWOA 2AJBA 4F6CA 5GV7A 1BE1A 1QK5A 4D9GA 1TU4A 3KJXA 1A1SA 2E85A 2NU6B 4DJAA 3STXA 2P8JA 4FCWA 1EG7A 3OESA 4ZIRB 1OAOC 4EKYA 1FFBA 2JAPA 3QNWA 4UAVA 1KBZA 4JI0B 4PCVA 1RRMA 3WOHA 2WD7B 5BQOA 4CKWB 4MV6A 2CXSA 2FY8A 3WBFA 1KEEA 7AT1A 2HMSA 2H16A 4D97A 4HWRA 2RKWA 3Q72A 1LVGA 2EZ8A 2WIKA 4BNMA 2CLDX 5ELXA 4MR9B 4MQ4A 5YASA 4OI0A 3OZIA 3D8NA 4YVFA 4HNTA 3HXPA 3VC2A 4MQMA 5CHEA 1FQJA 1QHSA 2WZBA 1UZAA 3FCAA 5HBGA 3GDHA 1E9EA 3HB1A 4QUBA 5EJAA 1BXKA 1UMCB 5TMDA 3UFXB 1ZYUA 1OH6A 5A4AA 2W4QA 4ZC8A 1X77A 4KNYA 1UP6A 1JPJA 3X43A 3ZWMA 2A9RA 1Q20A 2IS2A 2VXBA 2BCJQ 2L42A 2ZAOA 3AW8A 3HRHA 3WSTA 1S8AA 1ULSA 1HBJA 2P11A 3GZ4A 4KO4S 5TY0A 4AKSA 1THMA 1I1NA 4U8HA 3HB0A 1KSJA 1L6IA 4GVXA 3PR2B 4PFKA 3C5EA 5A7FA 1F2UA 2R84A 3ACCA 2C9CA 2XSZA 1YVDA 4MEAA 5KYYA 4ZYWA 1WUIS 5E0OA 1T4DA 4DEVA 1LDEA 4NR0A 3UPDA 4OM7A 2C9MA 2R87A 5JNWA 2WMYA 1IUOA 4EA7A 5HCNA 1VSUA 1M1NB 3BE6A 4MVJP 5F9MA 1L3CA 3TW8B 2AOXA 4UQOA 2H00A 1XKTA 3MZ0A 5ADHA 1B8NA 3DT6A 1FE8A 2JFQA 1QOQB 2AVDA 1XVVA 2B61A 2BZGA 1RI4A 2PT6A 4L78A 4JYPA 3RTGA 4LOHA 3PB3A 4KL8S 4RJ2A 1W2WB 1HDCA 2HN9A 2QM8A 2W5UA 3MTQA 1CKEA 1OC4A 2TS1A 3MJEA 3PXGA 5DNVA 3BMCB 3U4CA 3V1MA 3VPCA 1XMOB 1KXZA 1X2BA 2J6BA 1ZN9A 1BH2A 2ODTX 2QLTA 4IDGA 3W3AH 2YC4C 1WKVA 1ZK2A 3FOBA 2CXRA 1V7QA 3H8JA 3I5AA 3L0YA 4EJFA 5KB3A 1SHUX 4EH1A 2PE5A 4EGSA 1EDDA 4GU5A 3B6JA 4PFQA 1AC5A 1GHTA 4CYMA 4CI9A 3ZBTA 3BK1A 3BEOA 3IDQA 4L4SA 3Q9NA 5K8VA 5FWAA 2R8YA 4LRWA 5FNZA 3CMMA 5HRCA 4IEEA 2X2OA 4C4XA 2H08A 2EQAA 5A9RA 3A0UA 2ZJYA 1TUEA 4RJJA 2PTHA 2WSMA 2W8BA 3B60A 2WIGA 1RWOA 4V0RA 3MOGA 2OMEA 2UZ1B 2AE2A 5IP5A 3L3BA 3TX2A 5TGTA 1B43A 4FN5A 1IHUA 4W9MC 3GLKA 4EATA 4ZAWA 2Z2JA 5TDHA 1V5EA 2MDTA 3DULA 3F7TA 3HNPA 4I19A 4KQ6A 4NCKA 4OTZA 3GV0A 4Y2JA 2OG2A 4PG8A 4B71A 4Q9AA 3D81A 1L4MA 3FDXA 4ZKEA 3SJZA 2R65A 3KOOA 1VA5A 2DH6A 3MWJA 4DR2B 1T4CB 1F17A 3LM8A 4U6SA 4IXWA 4QRHA 4Y6LA 1F6WA 4WVFA 1NVFA 2VTDA 4FOSA 2QI9F 3F6RA 2EGHA 1TW3A 3ELWA 3SJUA 1U7DA 2DPLA 4DEXA 1I4EB 1UJCA 5HKBA 3PXBA 2RKOA 1E9VA 1SQGA 1U5BA 2XRFA 1IRXA 3OZWA 3LKZA 4FDTA 4NCNA 4YP1A 5KNDA 1OGYA 3KZ1E 4E31A 5JRJA 3H4TA 1R8QA 4GSYA 4QBTA 1LLQA 1Q0PA 1YO6A 1XWFA 1GQQA 4ZOLA 5IPFA 4UJ5A 4NDAA 1E6KA 3GFSA 2ZVJA 2IU3A 1ZJJA 1DC6A 4DDWA 3P7MA 1H2HA 3OECA 3K2QA 4JUCA 5CYGA 5JY6A 2IS4A 4FX5A 4GKJB 1D3AA 2B2CA 1NVMB 3DA8A 1DKUA 2AFIE 2G88A 2OFOA 2Z2KA 3KFLA 4MUIA 4MB0A 1EZ1A 3N2NA 2Q1SA 3EUWA 1Y4DE 5JPIA 3WXBA 2QX6A 4C87A 4TV8A 4CL3A 4K9SA 5BMVF 4IHJF 4ZVMA 4MUFA 4IHQA 5MFPA 3PF8A 5BVHA 1KAGA 1D9XA 4Q4JA 3TSYA 3WB1A 1D4OA 1JA0A 2X58A 3HEMA 4U7PB 3WKEA 3ZV5A 4HVLA 5GTDA 2GASA 3DXYA 3ZIDA 1I9GA 3OF5A 1L5HA 3I23A 4Q3NA 2Y0PA 1W76A 3ZHQA 5ER9A 1B1AA 3CLTC 4RA6A 4YP9A 4ALLA 5JI3E 3MCUA 3Q7RA 4JWKA 1A96A 3KQMA 3NP9A 4CR6A 3VSCA 2PZKA 5B64A 2B4QA 1JP7A 1BDJA 1DTWA 2GFIA 5CR9A 1WOMA 3ZLJA 2IP4A 2HLHA 3NYWA 2NSLA 3PEUA 5K9ZA 4QDZA 1Y89A 1UBJS 1NNSA 3V8PA 1XNRB 5LR6A 5REQA 4URVR 3KKQA 2AG1A 3ZOZA 1F8YA 5IG2A 3MN1A 1WCYA 2ZJOA 2M2IA 3RR2A 3R7WB 3OZAA 1CJCA 1DIAA 3GDOA 4NBKA 5HZKA 4I6GA 4DUPA 1TD1A 1AGYA 2QRLA 5IJ0A 2UDPA 2YR0A 3L0CA 2IC5A 1IY9A 2PYIA 1P3JA 4LRSB 3H84A 5LQRA 1O6CA 4RMNA 5A4FS 2P9FA 4BKMA 2QAJA 2EG5A 1ENOA 1Z88A 3DEKA 3ZXSA 4OK5A 4RLSA 1YDEA 2O2IA 4NJMA 1WZIA 3LCMA 3R7SA 4IWXA 5BMVB 4U3JA 5LP6A 4N6OA 1S2IA 3AESB 1W34A 4FD2A 2YS7A 4B3FX 3OT5A 1C3EA 1SZCA 3E0XA 1NNLA 1QRRA 4JC0A 3RJTA 4EWLA 1PFUA 1E6UA 4IDAA 2CLIB 4HLNA 5DOZA 4CR7A 1BDIA 3UK1A 4CCSA 2D7DA 2BPOA 1TUBB 1L4FA 2VNSA 4OXYA 4BFLA 1PBTA 5K0ZA 1NQ5A 3OJCA 1DIGA 1OXBB 3UM9A 5DPMA 1DEKA 1RJ9B 2EEZA 3NGMA 3L8ZA 4U1RA 1GNLA 4GEGA 3CZRA 4C0JA 3LDGA 4F9EA 2OHVA 3HACA 3CG0A 3S2UA 4D3YA 5JVDB 1FJXA 5D8DA 2I7VA 1A7JA 4MTLA 4EFKA 4P4SA 4GX2A 1R6DA 1JLHA 1EP3B 3BXOA 4AJ1A 2NZ8A 3KOYA 1QH9A 3GMTA 5EWLB 5CA1F 2OCLA 4J4BA 2AKYA 2X2PA 3DV2A 4J0CA 1MJGM 5FB3A 2I9PA 4IQFA 2KSQA 1X9IA 4BO8A 4YV2A 5K99A 1JIVA 3R5FA 4NZZA 1F38A 2ZIXB 4DC0A 1CDOA 1TUIA 3B3GA 4TQ9A 2YXBA 1ZJ6A 1KTVA 2F9FA 3AUYA 3HFSA 2V7VA 4X1IA 5LP6C 1KEZA 1UFOA 4WZBB 1QHGA 3WIUA 2VCEA 5M7EA 3CSUA 3TWOA 1PQ4A 4QOGA 1EVJA 3AZQA 3M8KA 4JOSA 5DEOA 3FHJA 4ZRMA 4NF2A 4LGVA 2FPGA 1GYPA 3DBOB 5K01A 2GD2A 5KYUB 2AG5A 1VMAA 2I3GA 2H3EA 3B13B 4RTJA 1CX9B 2JK1A 4RNCA 5ENZA 3ZQ6A 3NRCA 3AXSA 4CIWA 4CMAA 4KWEA 3C97A 4YLGA 1ZH6A 4MPRA 1R2QA 1WAMA 3D6TB 2X5NA 3U49A 1M2HA 2ATCA 4E2XA 4H3VA 1ELOA 1GA1A 1VLLA 1XN4A 2E1RA 1I5OA 3WC4A 5LXTF 5SY6A 2ANBA 2M6SA 1T6YA 1QWSA 5AUOB 2C5FA 2YHUA 2CLSA 4QODA 5HIMA 3H0CA 2FPOA 1DQZA 4LXUA 2H1HA 5TQ2B 1GSHA 1WQ4A 3DEJA 1B00A 3ZXUB 5CH8A 1OC2A 4EUFA 1CUBA 1UMDA 3C0KA 5BSMA 3V3KA 3CZ5A 1XKLA 1TD9A 3H18A 1EE2A 4FEYA 1YVUA 4U7TB 3MGGA 1EXMA 2EIXA 3ZBPA 4MUKA 4UHKA 1KOFA 4HUQA 4XI9A 4D0RA 2Z3WA 3MBIA 4F2GA 5C51B 3A27A 1YTLA 3Q98A 1JSRA 1PRYA 2GEKA 2JLSA 2OBMA 4M83A 1NDUA 4I4LA 4DV2B 4E2FA 4ZCLA 2AK2A 1WB4A 2RARA 2W2PA 2Z57A 4RV9A 2P9JA 1N7JA 3SZMA 4LRUA 2O2SA 1GTZA 2QYOA 2JFXA 4L9WA 2IITA 4NEHB 4AZSA 1U7HA 4FKMA 1F20A 1MV5A 2JH3A 3RVKA 1E1LA 2O5VA 1D7OA 1UIMA 3ZCUA 1KK1A 1D0IA 1E2LA 4X91A 1U9ZA 5KVVA 2V7TA 3PJRA 1C0KA 4HV4A 1IHOA 3MBOA 2L18A 3O3OB 3GLFE 4R3NA 2GO7A 4L02A 4Y2GA 3HP7A 3N75A 1A5SB 2VSQA 3BM5A 3CWCA 4KXNA 4NBTA 3H1EA 3FFTA 2W22A 2WVGA 1BU5A 3CZCA 1RIFA 4JCCA 1WCIB 4NV1A 4C05A 4D4KA 1VSQA 5F77A 3KQNA 4FS8A 2FGKA 5FPHA 1UQTA 3PUJA 2XT6A 3ACDA 2QJOA 1EFVB 3IKMB 4BWVA 3H13A 1TZMA 1SUCA 5SZJA 1OD6A 4MI9A 2OZLA 2FF5A 3AYXB 3A1TA 4DNFA 3HCDA 1JSLA 2JJ1A 1JEOA 1JAZA 3A6EA 2YHBA 2ZBEA 3N9IA 1TCBA 3HL0A 4ALJA 5ICSA 3F5SA 1OXSC 5KKAA 3KG2A 4UHFA 4OAPA 2EFJA 4C4TA 2PUGA 2BUAA 1RACA 2YY6A 1MEEA 3EQ7A 4KQMA 5FLYA 1G41A 2KI5A 2POQX 4CT4B 3NDRA 4DYDA 5KQLA 2QVXX 2FW7A 2YWBA 3OEED 5IJ9A 3GN2A 4LVNA 3MJDA 3ZWYA 4KRYA 4PC1A 1G55A 2VYCA 1E89A 2P9TA 5I9NA 3N2GA 3OMWA 2JZCA 3R7NA 2VL7A 1XVUA 2FCRA 4K1XA 3PFKA 3SOZA 3WGYA 5A3QA 2P2YA 3AJRA 1K4KA 4KX3A 3S55A 4KXVA 4Q7QA 5LZ5A 4BGEA 2XNHA 2YFHA 4Z7OB 2PDAA 2YWDA 1ILEA 4YT5A 2XNJA 4AMVA 3OF3A 1KY4A 5F73A 5F2OA 3IAHA 1NFRA 1TK9A 2IQIA 2Q2VA 1ATIA 3A4TA 3FR7A 5D3ZA 2AXNA 3RVMA 2QK4A 2E21A 2NSHA 1V8PA 1QNLA 1Z4MA 2ZW9A 3GG2A 3UB4A 3N87A 1JG7A 3DCJA 1I3LA 2PSDA 3S68A 5EY5B 2GYYA 2PSHA 2XB9A 4FGZA 1CYEA 4C9BA 1XDDA 4IOMA 3B1JA 3O8QA 1I6KA 1JVSA 2WJHA 1T3SA 5EJEA 1RJEA 2WRZA 4BE9A 3KKNA 4DCSA 1KS9A 2IK8A 2RBEA 3S2YA 3S1SA 1J0AA 2BMJA 2WZCA 3DV0B 2Y77A 4H31A 4RS4A 1COZA 1RMYA 4HNQA 3TOXA 3EUAA 1D9ZA 3TE7A 1HE3A 2H6EA 2YJ4A 1FDIA 1MO4A 1XYYA 3DHYA 3VZDA 2VRWA 1IUPA 9LDBA 4UQPA 3ELBA 1N3IA 3T15A 1XN1A 3FCEA 3W34A 1WCWA 3DLHA 4TKZA 2CV0A 5I5GA 4PSDA 3UMGA 3QWAA 3G5TA 4MDHA 4NICA 2FTKE 3MAAC 2R6AA 4FYYA 3EF0A 1W0KA 3USCS 4DV7B 2B8JA 2NM0A 2XCOA 2VHXA 3ES9A 2BC9A 3ESDA 4K9NA 4RY8A 1T35A 4YDHB 4QXMA 3AVYA 2A9VA 1JKFA 4EPYA 3M4ZA 3GJXC 2XNSA 3Q15C 3KSBC 5E1MA 1FSZA 1Q3KA 2P9YA 1T0IA 2QUIA 2VJPA 4FX2A 4PNPA 2Z8ZA 2CDAA 2HTEA 5KOIA 2AQ8A 5BN3A 4B82A 1YL7A 2FQYA 2H1RA 3RC1A 1S3IA 1H1LB 2OV3A 4PSAA 2ZM6B 3G88A 4U63A 1OH5A 2Z5VA 1ANKA 2OHFA 1UAGA 2GRUA 5K1ZA 3IXMA 4GX5A 2H2GA 5DX0A 4CN9A 5K45A 2X8JB 2NXJA 3OQMA 1CZHA 2UYYA 3KAQA 4Q05A 2Y0EA 2FW1A 1UMKA 3HKBB 5DDIP 3CB2A 4KIFA 1XPJA 5WRFA 2XDQB 3MJVA 1T2FA 4OA5A 4PG7A 3WK5A 2YTZA 4B6PA 4MVJD 4EYQA 1QYWA 4XIFA 4HAXA 4QVGA 4WRRA 3ZC3A 4F2WA 3R1IA 3NORA 2ZT5A 1R0YA 4D9FA 3KQLA 1GV1A 3PJDA 1UC8A 4WLNA 3VYTB 2HT1A 2A4KA 1TKBA 5AYVA 2ZQZA 1LBSA 2IHJA 3QX7A 4RORA 2OQVA 2FKAA 3ZV6A 3ZIAD 4AUMA 4LJYA 1MQSA 2YJ3A 2VAVA 3EXEB 3HB7A 3IJ5A 2GX6A 4Q6WA 4E13A 5KVAA 3G13A 4BWGA 5UKDA 3W5JA 3GJRA 5TPWA 2BE9A 3NEYA 1OMOA 2OFPA 1LPOA 4JMPA 4YQZA 4N0EA 2I22A 1NVVQ 2JJYA 3JR7A 1O5TA 3I6ZA 5DASA 5FO1A 1FP7A 5D2CA 2QAGA 2O23A 2O05A 5IFLA 1NU8A 5T5QA 4JDUA 2KHZA 3C6YA 1QV6A 1NW6A 5DGDA 3BRWA 3W6OA 1CIPA 2ZT6A 2MTBA 2C77A 4QPPA 3UYLA 1QP7A 2AXPA 2G8NA 1HL3A 2GLTA 2WAYA 3KXIA 4QPJC 5DK4A 4M0DA 1DC4A 2JIOA 2AFHA 4A2PA 1EFKA 3ACBA 1AMNA 4KC0A 1NVWQ 4MQ6A 5EG5A 5CD1A 3QFHA 5KSWB 2C5BA 4UVGA 3DL2A 3I4LA 4BUCA 1TVKA 3IAS1 3OT1B 1GPAA 4WUTA 4HGYA 3RLIA 3TJZA 3M4JA 1JU4A 4DPKA 1AKQA 4N54A 10MHA 4ARIA 1Y4ZA 3NYIA 2GB4A 1E9FA 3DMYA 1FUKA 2GAIA 2BELA 4Q01A 2HMWA 2ZYGA 3IO5A 4Q37A 1Z45A 4G1BA 3H5IA 4MWBA 2CBXA 5A6SB 5EGNA 2QAGC 2GLXA 3Q4GA 4B8YA 1NFQA 2F8TA 3PQ4A 1QS0B 2OD7A 4BRWA 1A8IA 4J75A 3R74A 1Y8ZA 2ACKA 4YDRA 2G5GX 3QF4A 4C7OA 2NACA 3LT1A 1IN7A 1B73A 1OLSA 1XRMA 3ZH2A 1E2DA 1XQ6A 2RAVA 4C7VA 3OPVA 1P39A 2ZJAA 1XOIA 5DLEA 4H1TA 3RAEC 2E5LB 4JB2A 1ST2A 4Z86A 1OZGA 1QP8A 1ZQ1A 2NXEA 2QTFA 2YCLA 3IVRA 4RLHA 3VO1A 3ZHCA 1O0BA 1QFMA 4HMOA 3SK0A 3HCEA 2NU9B 4PS1A 4REQB 3ETNA 1T0UA 3G5LA 4G26A 1JXMA 1MAHA 4ENPA 1BO6A 3Q7TA 2ESRA 3H5RA 1UZMA 3GBSA 4OQPA 4E21A 5E3HA 2CN1A 2X6RA 4HNRA 1TB4A 1EB9A 3WGTA 2PGAA 3LUDA 4EJSA 1HG0A 1SVLA 2VT6A 3DM5A 4PGHA 5EPUA 4TM7A 3RIXA 4DXAA 1A9SA 1QGAA 4PPNA 2R1UA 2ZYDA 3V4ZA 1RI3A 4ASUA 1BCSB 3IERA 3QW2A 1N75A 3RI3A 4K87A 2CNLA 3W1EA 4L15A 3OQ1A 3ZHXA 3V97A 4DMCA 5I8WA 1EHYA 4TKUA 1JPVA 3DMNA 1EP1B 3GRAA 3KT8A 4D02A 2JFPA 2VDRB 1US8A 4XFKA 4GQIA 4EUEA 3NI2A 3LY5A 2NV6A 1YV9A 4R40A 5DULA 2P2LA 2OZEA 2QS9A 3MOSA 4CKXA 1UT6A 2VQFB 4BFVA 4KQIA 2VG8A 4I66A 3AR8A 2JFFA 3OF2A 5C9ZA 4QOIA 4LF6B 3N2KA 2YINC 1WBJB 4RQTA