3SXJA

Crystal structure of complex of bt_2972 and adomet, a methyltransferase from bacteroides thetaiotaomicron
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
245
structure length
245
Chain Sequence
b'FSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
molecule tags Transferase
source organism Bacteroides thetaiotaomicron
publication title Crystal structure of complex of BT_2972 and AdoMet, a methyltransferase from Bacteroides thetaiotaomicron
rcsb
total genus 85
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3sxjA00
1IXKA 2CWWA 5LQRA 3BKWA 4YMHA 1RI5A 1XDSA 2AS0A 1TW3A 3A27A 4DA4A 2IGTA 2CKDA 2IFTA 3T0IA 1ZGAA 1R18A 3FPHA 5DT2A 4E70A 1Q0TA 1NW5A 3FYCA 4GOND 4U7TB 3PTAA 5GIPE 1NW8A 3HVKA 2WA1A 5HIIA 3TR6A 5KVAA 3GNLA 4GOMD 2AOXA 1I4WA 2VDVE 3CBGA 4RX1A 1QYRA 4PYMA 5E8JA 5K05A 3AWIA 4RVDA 4DM3A 4HRAA 5DX8A 3ID6C 3SR4A 1JG2A 4KRGA 3LKZA 3HCAA 2R3SA 1R8YA 2GLUA 4PYKA 5DLYA 1O9GA 3FTFA 2JH8A 5CCXA 5CVUA 5F2OA 4HG2A 5FA8A 1R6AA 4Z2YA 3EGVA 1UIRA 4DCGA 3GIWA 3OFJA 1INLA 5EG5A 4OX9Y 3MB5A 4OBWA 4Y30A 5FADA 4RSRA 1ZG3A 5EC8A 1WG8A 3DMHA 5JUWA 3UJCA 1RJFA 5FHQA 3ELUA 4QTUB 2EJUA 2IH2A 1N2XA 5FCDA 2FRXA 4YUVA 2AOVA 1NV9A 5FA5A 2CL5A 3R9XB 2ZFUA 2H00A 3EVFA 3HVJA 4QDJA 4FGZA 2V74B 4KWCA 2PX8A 5EHGA 5EOVA 2Y1XA 2QRVA 4QPNA 2IPXA 1SUIA 3KQYA 5FQNA 2B2CA 4BLUA 3B3JA 3X0DA 4R8SA 4FP9A 2HWKA 5GM1A 3G2QA 5K0JA 3EVEA 4RTLA 4YMGA 3OFKA 5FWDA 4RTMA 2CMHA 2YUIA 2GB4A 2ZWVA 5FUBA 4RTSA 3B7PA 3CKKA 4P7FA 10MHA 1L3IA 2GS9A 4MWZA 2JH9A 3DOUA 3MCTA 3QV2A 4RTQA 2ZBQA 3NW9A 3MTEA 3R24A 5CVEA 4LWOA 3LCUA 1JQ3A 4DCMA 1JQEA 3UA4A 3ERCA 1KIAA 3FPFA 2FHPA 4QVKA 3IHTA 3DUWA 3FYDA 1L3CA 4GQBA 4YV1A 3EVBA 5BW5A 3M4XA 3G5LA 1JG1A 2NXNA 3G2MA 3OZRA 1QAQA 4K6MA 2QY6A 3RIEA 3NDIA 7MHTA 3O31A 3IEIA 2P7IA 3GU3A 2XVMA 3TM4A 1SVUA 3HM2A 4H0NA 3CJTA 4GEKA 2YXDA 4PGGA 3PS9A 4YUYA 1QANA 2N47A 4P58A 3G89A 1RJGA 3DLCA 1JTEA 1AF7A 2QE6A 3P2IA 3B5IA 3O7WA 3DP7A 4GBED 3SMQA 4JXJA 1M0EA 3GRYA 5EPEA 3G8BA 2AZTA 1RJEA 3KR0A 3IV6A 3M6VA 4YUXA 4F85A 2XYVA 2P40A 1YFJA 2YTZA 2P35A 3HTXA 5DWQA 4CKCA 4X1OA 5FTWA 4AZVA 3LCVB 4QQKA 1H1DA 3Q87B 5E9JA 4AUKA 1P91A 2IIPA 2K4MA 3EEYA 4XCXA 5D1HA 5ICEA 2IH5A 2QRVB 3UA3A 1X1AA 4FSXA 3OE4A 2JHCA 4X60A 5CVVA 5F2KA 3EMBA 2B9EA 2JJQA 1SKMA 2EG5A 2PT9A 3KQSA 2P3QA 1O54A 3LDGA 4R8RA 1AQIA 1D2HA 3E05A 5DX0A 1F3LA 1R74A 3CJQA 4RYLA 2A14A 4X41A 1NT2A 3HCBA 3I53A 5EGSA 2C7QA 1JG3A 5HEKA 3R3HA 1VLMA 2GPYA 4MTLA 4ATNA 5IKMA 5CCBA 1YB2A 1VPTA 4IKPA 4ER5A 3BUSA 1FBNA 2GAFA 2V7EA 3B3FA 3PFGA 2ZW9A 1XXLA 2ONZA 3KR2A 5DM2A 3GO4A 3REOA 1X1CA 3VYWA 3P71T 4EKGA 3EVCA 1JTFA 4PNEA 5DXAA 5K8VA 5CD1A 1OR8A 3BXOA 2G71A 3LX6A 5DRTA 3OPNA 1KHHA 1ZQ9A 3UJDA 4P7KA 3A4TA 2ZSUA 5K01A 4EKIA 1M6EX 1X1DA 3L8DA 4GOLD 4CTJA 3P97A 5EZSA 3KQTA 3KQOA 3QOWA 3TKYA 3BGDA 1NW7A 3NJRA 4HGYA 2XYRA 1Z3CA 1KPGA 2VP3A 3ELDA 3NWEA 3PT9A 4C07A 4UOEA 3NTVA 1M6YA 1SG9A 2AOTA 2ZCJA 3TLJA 5LQNA 3BGVA 3PX2A 3EVGA 1HMYA 1ZGJA 5DTRA 3LKDA 2EJTA 3AY0A 5F2NA 2Z6QA 1QAOA 2I62A 5FHRA 5DRYA 3P2EA 4IWNA 5FULA 3DXYA 5CM2Z 1JR4A 4RTNA 5CVJA 4C03A 3MHTA 5EMJA 1NW6A 2HTEA 2FCAA 2PX5A 3I5UA 1EJ0A 3Q7EA 5EHIA 4ER3A 2VDUE 4PIMA 3R6TA 3JWJA 3RODA 3OCJA 3KPYA 5HIMA 2OB1A 3LCCA 4KIFA 2Q41A 2E5WA 1IY9A 3R0QA 2Z6UA 5K0CA 3JWHA 3EVDA 3MERA 5P8WA 3TMAA 3I58A 2JHAA 1KXZA 2UYQA 3MGGA 4U7PB 3AXSA 3HA5A 3OU6A 5ICCA 5KQSA 1MJFA 2ORED 4FSDA 3TM5A 3CCFA 1EG2A 4OA8A 2IDJA 5IH3A 2PSSA 2P7HA 3HA7A 3D2LA 4CKBA 9MHTA 1WY7A 3PX3A 3DULA 1B42A 1RI2A 3TRKA 1I9GA 2NXCA 2H1RA 2PWYA 4PYNA 4ER0A 3DXXA 3LDFA 1XJ5A 3MCZA 1NW3A 1RI1A 4HH4A 4HSGA 3G88A 4PYLA 2UYCA 1YF3A 2QYOA 3GRZA 2BR5A 1Y8CA 3FUVA 4NECA 1P1CA 1ORHA 2AVDA 1BOOA 3UBTA 5DM4A 5G02A 2HR1A 3FUWA 4V0RA 3P9NA 1VBFA 5C1IA 1AV6A 3FTEA 5E1MA 3C6KA 5LR6A 3HEMA 5LQJA 3KPVA 4PONA 5FQOA 1WXXA 1DL5A 4FZVA 2NP6A 1YZHA 3C0KA 3KPUA 3FUTA 3THSA 3VSEA 5E2AA 3EEOA 2KW5A 4LG1A 5EMKA 3ME5A 1MHTA 2AOUA 2NNWB 3FTCA 1RI4A 3GGDA 3LGAA 1KR5A 1BC5A 3BWCA 2BM8A 4LWPA 3SX0A 3TOSA 1XTPA 3KU1A 3HCDA 4A6DA 1NKVA 4RWZA 3GXOA 1RI3A 3P2KA 5HFJA 4DKJA 3E8SA 4AZTA 2XYQA 4WXHA 5EZQA 4E33A 2PXAA 5BXYA 1VIDA 5E8RA 3P9KA 2YX1A 1NE2A 4KDCA 5B1SA 3KQPA 3UJBA 4KVZA 3BWMA 2JHPA 1IM8A 3FZGA 4IV0A 2G72A 4EVIA 2AR0A 4KDRA 3ELWA 3I64A 4PIPA 5BW4A 3C3PA 1XCJA 2BM9A 4XUEA 3E23A 3UWPA 3V97A 3PFHA 4AX8A 2G70A 1FJXA 4GOOD 1KP9A 4C08A 1NV8A 3E7PA 4HTFA 5DSTA 2AVNA 2DPMA 3C3YA 1HNNA 5BP7A 3GDHA 2HNKA 3ER8A 2NP7A 2PT6A 1SQFA 3LDUA 3KR9A 5EKXA 1G60A 4X61A 3G7UA 5DPMA 5H02A 3NDJA 2XBMA 3CGGA 5HOQA 4ER6A 3NMUF 3FTDA 4PINA 4RV9A 5KYGA 2AOWA 1L9KA 1ZHFA 3BT7A 3MQ2A 5HZMA 1YFLA 2PXCA 3U81A 3EVAA 3FUUA 4HTFB 5JR3A 1DCTA 1QZZA 2EFJA 4DZRA 1D2GA 4MHTA 3UJ7A 3GRVA 2ZZMA 2XVAA 5K0NA 4EK9A 5E1DA 2CMGA 3TFWA 2I9KA 4EMSA 5HIKA 3P8ZA 3EGEA 4OQDA 3BZBA 2PVCA 4QVGA 2ZBPA 3A7EA 5EKUA 3P9IA 2DULA 5GP1A 4BLVA 3M6XA 1FP2A 3F4KA 2I6GA 1XDUA 3BGIA 4L7VA 1G6Q1 5T67A 4AZSA 3SSMA 2OY0A 2ZIEA 3C6MA 3FUXA 3GJYA 4YV2A 2OPBA 3THRA 5T6BA 4EQZA 2QM3A 2PKWA 5E1BA 4DQ0A 4ISCA 2PLWA 2ZZKA 5EQJB 1XVAA 4A6EA 4C05A 3LBFA 3HCFA 5EMLA 2PBFA 2IP2A 3AXTA 5DSXA 1N7IA 2WK1A 3FRIA 4BP1A 4POOA 4R05A 1KYWA 3ER9A 4BY9E 5E9WA 3GRRA 1G38A 1TPYA 4HC4A 5DTMA 3T7RA 5LQCA 5GM2A 2ZULA 1D2CA 4YUWA 5DM0A 3NVKI 1JQDA 1PJZA 2O07A 5K0FA 2HV9A 3ANXA 4Y2HA 4RVGA 5M5BA 2PX2A 2P1DA 3CVOA 1X19A 3JWIA 2P3OA 3FPJA 5GINE 3ORHA 5LSAA 3M33A 1JG4A 4QPPA 4V0QA 3TPZA 5T64A 4GC9A 3KQWA 3LHDA 3NWBA 3LECA 3G2OA 1KPIA 2BH2A 3DR5A 8MHTA 4M37A 1V39A 1VL5A 1VE3A 1RJDA 1NBIA 2OB2A 2P41A 4PYQA 4X63A 4YUZA 2C7PA 2VDWA 2OKCA 4GF5A 1JSXA 3P9CA 3UJ8A 3GRUA 3O4FA 3MAGA 4ER7A 5EVJA 1G55A 2PV0A 3G8AA 4KIGA 4M7RA 5DM1A 5EEGA 3KKZA 3OU7A 2O05A 3KQVA 5K0LA 5LQUA 1P39A 3ELYA 1EQAA 4DF3A 2O57A 4CKEA 3NVMB 4RTOA 5ICFA 4F84A 2IBSA 5DTQA 2P8JA 2VS1A 1VP3A 2ONYA 2FK8A 4E2YA 4OA5A 4RVFA 4E32A 3K6RA 5ICGA 1T43A 2AN4A 2YXEA 3BWBA 3HA3A 3V8VA 1DUSA 3KR1A 3OZSA 1JSZA 2PX4A 5C9ZA 2HMYB 2GH1A 4MQ4A 1X1BA 2ZWAA 3FRHA 3G2PA 3PVCA 4HGZA 3BWYA 4XUDA 1UFKA 2G8NA 2ZIGA 3S68A 3DH0A 4BLWA 3HCEA 2G1PA 5EIWA 4FR0A 1WZNA 3LL7A 2IDKA 1AQJA 2AN5A 1FP1D 2PWPA 3SGLA 2IH4A 3HP7A 2OXTA 3BKXA 5CUQA 2Y1WA 3GWZA 1U2ZA 4B17A 2ERCA 2B3TA 1TW2A 1I1NA 1VP9A 4AZWA 4WVLA 1KYZA 4DMGA 3I9FA 2PJDA 2Z6AA 4RVHA 2AN3A 3IYLW 1R8XA 3SXJA 4E2WA 4XUCA 3OZTA 3TQSA 2OO3A 5KQRA 2I7CA 4OQEA 1KPHA 3OU2A 2ZVJA 4PWYA 5HIJA 3VC2A 2JG3A 3M6UA 5E1OA 1SQGA 2ADMA 4P7JA 3UJ9A 2AOUB 3KQQA 4FT2A 4QTTB 3DMGA 5E9QA 3T7SA 2ESRA 4MIKA 3FPGA 4PYIA 3MTIA 3RW9A 4E30A 1ORIA 1L1EA 4PCAA 4M36A 4R6WA 2IBTA 3LPMA 1L3BA 3UJAA 4LECA 2UYOA 4CTKA 1YUBA 1WXWA 1N7JA 2OBFA 2YQZA 3QOXA 3T7TA 3M6WA 3AJDA 3EVZA 1QAMA 2NYUA 3DMFA 3HCCA 4CXMA 4G56A 5DX1A 4E2ZA 5GIOE 2FK7A 2BZGA 5CVDA 3TKAA 2ZIFA 3G5TA 3A7DA 2AOTB 1EIZA 3B89A 1EJ6A 4GUAA 2YXLA 3K0BA 4GC5A 5EIFA 3SVZA 5HILA 4C06A 2B78A 4O29A 4QQNA 4CWAA 3H2BA 4PYOA 2LD4A 1FPQA 4OBXA 4FS8A 4E2XA 3KHKA 1BKYA 3LBYA 5K03A 2ZTHA 3WSTA 4C4AA 1ZKDA 2B25A 5KS2A 5MHTA 2BR3A 3HNRA 2NXJA 1XCLA 1P1BA 2OYRA 2WA2A 5CIYA 3UJ6A 3KPJA 2ZLBA 3UZUA 3SM3A 5LQAA 3PLAE 3OE5A 3SSOA 2VZ9A 4E31A 4R6XA 3DLIA 3LSTA 4RTJA 2ZBRA 1PRYA 1F38A 1VQ1A 4PGHA 5DXJA 2ZZNA 2OZVA 3CC8A 5K0EA 3KQMA 3GCZA 4YV0A 1BHJA 3DXZA 3EPPA 4ZTBA 2BR4A 2EX4A 3UFBA 5GOZA 1G8AA 1SUSA 2F8LA 2R6ZA 2P3LA 3FPEA 5EEHA 1WS6A 4M38A 4FT4A 3PB3A 2C7RA 2YR0A 2O06A 2YVLA 4KW7A 1EAMA 4P7GA 3VC1A 1Q0SA 2UYHA 5K09A 2O0LA 3B3GA 5E2BA 4PCLA 2PXXA 4IV8A 3EMDA 4RTRA 2C7OA 5U4XA 2FPOA 2NXEA 3JWGA 3DTNA 3KPWA 4PYJA 2UZ4A 1G8SA 3A26A 3EGIA 3HVHA 4BP3A 5K0GA 1XDZA 4QDKA 1R00A 1YZ3A 3A25A 1O9HA 5C0OE 2PY6A 5LQKA 4RTPA 3SSNA 5FWAA 2FYTA 2H11A 2PGXA 4C04A 1NBHA 3HVIA 3CJRA 5K0BA 4RTKA 5GWXA 1UWVA 4F86A 5D1NA 3M70A 5ERGB 2GA9A 5EMMA
chains in the Genus database with same CATH superfamily
2O7VA 1J9GA 1TAHA 2ORWA 4MS1A 3F5SA 1LDBA 2XBLA 3BKWA 3F3KA 3T7KA 4BGDA 1JLMA 4FHZA 3NTRA 3GLVA 5K4AA 4QOFA 2WICA 3W8EA 2WDZA 1P31A 3M4YA 3T0IA 4ZOQI 2XNKA 2M1ZA 5CA0F 4QM7A 1DC3A 2WA1A 5KNCH 3U9LA 1XTSA 4J3FA 2CXPA 3GNLA 4FLFA 3RC1A 2C2XA 3ZJUA 3TI9A 3CWCA 5E8JA 1JFRA 1H69A 3KLNA 4Q02A 1E2PA 1P9WA 3Q6IA 4HRAA 3ZK8A 1ZKMA 2LZ0A 5TE9A 1OSNA 1TLTA 3AY3A 1XF1A 4HBGA 1ZCZA 4IYJA 4Q3DA 3ZDEA 2NZUG 5F7XA 2ZXEA 1QH8A 4CT4B 3L3BA 4Z2YA 3OQ1A 2AA3A 1OLSA 4BLTA 3FM9A 2PUBA 1GILA 1X92A 1G7RA 4NBSA 3L01A 3OPXA 1RXUA 3R3YA 5JSYA 4CMKA 2HA3A 4C4TA 2YRFA 4L5BA 1BS9A 4C30A 1LLQA 3HS3A 5AVQA 3K1ZA 2ZSKA 4OJQA 5CH8A 3ZD6A 3ELUA 4BRZA 3WA7A 1FQJA 4ZZ0A 4L76A 2EDCA 4EZEA 2AH5A 4MYSA 3Q3CA 3PUIA 3QVGA 1GCOA 4M1YA 1A69A 4L08A 5AKXA 3UOGA 1HTWA 5I7RA 4DIDA 3HKBB 1E2HA 2L17A 1NWHA 2YNMD 4WGGA 3FLMA 1J5EB 1DHRA 2D7CA 4KHPB 4Q9AA 1ULHA 1H5NA 1FVOA 3D4IA 3F4LA 5GM1A 5JPIA 4F72A 5ALVA 3LW8A 2BJWA 2O5VA 3AJ9A 4ARSA 3QY9A 3EPJA 4KR6A 1ZHHA 3NTUA 2YUIA 5DYYA 1OBCA 3UY4A 1X7WA 1B76A 1Z33A 2ZWVA 4B5KA 4FR5A 2ONKA 4U7FA 2XLBA 2VTKA 2I2AA 4PC7A 2C3PA 5LC1A 1MTZA 2WM3A 2QPAA 3GLIE 4B6OA 2HJRA 2XQJA 1YCGA 3FGPA 3CF0A 3GFPA 4TKUB 4BO1A 3JY6A 2HJWA 2VDLB 4X45A 2AUMA 2AXNA 5AJTA 3OETA 3FWHA 4XD7A 1NUUA 4RL6A 1MIOB 2A9QA 2VZLA 2QAGB 2EHJA 3IP8A 5CA0A 1ZK4A 3EEFA 5TQVA 3Q7QA 1QAQA 4BPRA 1DBIA 3ILHA 5JWRA 3IEUA 2JFHA 3O8NA 3E4DA 4M1QA 2YJGA 4L8GA 1QWOA 2VEDA 3LH5A 2H1WA 5B55A 3AVWA 3C3DA 2ES4A 1CKEA 2BBOA 2G63A 4CHGA 1JIUA 3G89A 4ZAWA 1U7PA 2PEZA 3EF1A 4OUDA 2HQSA 3DEJA 1RABA 3JQ9A 4FXPA 4ZO7A 5ELLA 1E7SA 5BV0A 2OHIA 2RGAA 1W2GA 1Q1BA 3M7IA 1C1DB 3GRYA 4W9NC 3BDVA 3GAMA 2B4AA 3K0AA 2AZMA 1P4RA 1UDBA 3R7WA 5KVSA 1I7NA 2YTZA 4N0MA 1TCBA 3USES 4QOSA 1B6GA 1CZOA 1S3SA 1NF9A 2IYWA 2J3QA 2QTLA 4PFQA 2PGNA 4X7RA 3ESAA 2C5LA 3WIVA 5D1HA 3VU9A 2X86A 1EBFA 4JJKA 1P80A 1YJAA 4JC8A 4UNIA 3VR0A 4YT4A 2BFBB 4S1WA 4HNQA 5LYJA 3RTCA 4IDQA 2VSFA 5COAA 4EYKA 4R3WA 1S1CA 3I62A 1CRZA 3KAKA 4JP5A 3AP2A 2P3QA 4WW0A 1Y5LA 3PE4A 4BJ6A 4ZXFA 4AY2A 4XQGA 5L3QB 5T8KC 2HU7A 2J9YB 4N0PA 1G17A 4WBNB 1F3LA 4N8EA 5CITA 4L28A 5FO1A 2JDID 4BATA 3HB1A 5LP6C 3ADCA 6YASA 3OCZA 3INTA 4GRDA 1BVYF 2AHOA 4X1KA 5HMMA 4CEIA 1WUYA 2HQOA 4AMBA 3JQGB 3GR6A 2ZW9A 3TE6A 3V7YA 3REOA 4DDMA 1JTFA 5JBQA 3PUYA 4H3KB 1XLUA 4J0QA 3L0YA 1O8CA 1OZ0A 5JFOA 4JL6A 1VLLA 1U9IC 2G9RA 1SU6A 1FRFS 2ZR8A 2A0UA 3RAFC 1GGHA 3A4TA 4QTXA 1N0WA 3U48A 3HVRA 5F9HA 2XVZA 1K75A 1GM5A 2NOAA 2RCYA 3T5MA 3VOAA 4MQ6A 2RHTA 4UUMA 1ZIDA 1P61B 4XOUA 4MP3A 4L72A 5FPPA 2X8AA 3UUWA 1H94A 1W96A 1Z4LA 4C07A 2P2NA 2QDXA 3PNVA 3QFTA 3CEHA 2ZYAA 5BURA 1CEXA 2NYAA 3V1KA 5F5XA 1SURA 5B1EA 2ZCJA 3SKXA 2J3IA 3TLJA 3KJZA 1O6BA 4PLPA 1Y8QB 1HRKA 4IF4A 5BOSA 4JBIA 2AX4A 4NHOA 4DGSA 2RSLA 1ZICA 1CFZA 4GS5A 1B6SA 2SCUB 3EPKA 3EIXA 3N6RA 4LXHA 4QELA 5EVCA 1PFGA 4YR7A 1N36B 4PZCA 2FCAA 3DVSX 1U2GC 1H1TA 5ADUS 2D7DA 1Z2AA 5CX4A 3KLPX 3MA0A 1QFJA 2Q41A 3P0EA 2A2ZA 4YT8A 1FZTA 2VK4A 5DGTA 3TEMA 2Q1SA 5EIBD 3HL0A 4ZVQA 2WWVD 2QP9X 2R8OA 3MERA 4G0OA 3WGOA 4R2KA 2X1MA 4JC4A 5JAMA 4AZ3A 1XA4A 4C0BA 2BEVB 2ORED 4EG5A 2KJQA 3GFRA 3LC7O 1RXIA 4P5DA 2PNJA 1F8FA 5CFLA 5ALFA 3IEVA 1EWVA 3UV6A 4LEIA 1EHIA 1OU0A 2IA5A 4CKBA 4JVNA 2WRZA 3Q8XB 4QEZA 2FPPB 3NKFA 4N12A 2XT9A 4ETNA 1FSSA 5I3CA 3HXOA 3A1CA 1JYEA 1WOMA 3NHLA 3IA7A 3G0HA 4C7OB 4R9NA 2OG2A 1SBIA 4L95C 1T35A 5ALWA 4XWOA 5BT8A 4ND8B 2YYZA 3N5CA 5BN1A 3R9WA 2ZJ5A 3PHLA 3WK5A 4AKEA 2X9GA 4V0RA 1HDOA 1ZMXA 2V7XA 4JXXA 3H1GA 5C32A 3GMIA 4DR5B 5E1MA 2W7TA 3S5JA 2IWRA 1CIJA 1XD2A 4ALKA 3GLIA 1FYDA 4RM3A 1JH8A 5BR1A 4KVAA 5DVZA 3THSA 4EATA 3X1WA 3UMMA 4LG1A 4MDYA 2OCYC 1S3GA 2ZAYA 1Y34E 3C3CA 4HWOA 4A4DA 3WFIA 3NUQA 3OQNA 4LDAA 1UQRA 2QZSA 1L8XA 1NU8A 2BM8A 3EHEA 3ISVA 4NK4A 1F8YA 4X1IB 5KEIA 4NQRA 4V0OA 1E4EB 2H9IA 2Z3VA 1NKVA 1A3CA 2JLBA 2WG0A 1M1YB 3ITDA 3VR4A 4D74A 3MM4A 5EZQA 4E33A 3DR3A 3ZIAA 3QSYA 4DKXA 1DRJA 2CVFA 5B1SA 1KSJA 1Z22A 3EOZA 1Q6ZA 1EE2A 3EDOA 4EVIA 1OGJA 1PHPA 2CUKA 3SHQA 1F0NA 3U3RA 2AMVA 3PNQA 3EIQA 1ACJA 3F3YA 4IBOA 4D8YA 3LUCA 3CB2A 2WZQA 3RLFA 3ZHQA 1ZR4A 4NCNA 1MVLA 2F8MA 3OMLA 2NTYC 2ZIXA 3PJGA 3V4OA 1YRYE 3NV7A 1V2HE 3DUFA 4R2LA 5BN5B 2QZ9A 1JILA 2GK6A 3W9SA 2K87A 3LUDA 2FRDC 1J97A 1XU4A 1M7HA 1HDIA 2COKA 3CWQA 3HJFA 3PNLA 2A0WA 3DFMA 3HEAA 4PANA 4XLLA 4PN3A 3IMFA 4IZ6A 3KSBC 1QS0B 2HRCA 4G5OA 2C04A 1K6MA 4X61A 4ESOA 2IU0A 4JKYA 1GXSA 1RHJA 2I66A 2CHFA 5AWFC 2AZ4A 3CW2A 1G20B 3N3AC 2D62A 1Z08A 2P2SA 5KDLA 3ZG6A 3PNPA 2D8AA 4KX5A 1N75A 3GGSA 2QVGA 3LA6A 4LJRA 1XKXA 2LRHA 4RSGA 3A4NA 2PUGA 4XYBA 2C58A 4RA6A 4DR6B 2C4TA 3OZGA 5KWVA 2EFJA 3UJ7A 2W6JD 2QZ4A 1WPXA 2ZZMA 1GQSA 3BFPA 4PU0A 4RKWA 2EJVA 4H31A 3DHYA 4WNIA 3L46A 1ODSA 3FZNA 2YWBA 1XDWA 1GTVA 3TL2A 4QYIA 4PX2A 3R3XA 4PAQA 4TVKA 4EF5A 4KLNA 3FTFA 1T9CA 4PR0A 4AZSA 5IAGA 2CB9A 1R6VA 2OY0A 3UAWA 4OHYA 1E2MA 1UOEA 1QNLA 3L6EA 5FOXA 2ST1A 3THRA 2IE0A 5FFNA 4JOSA 4IGIA 3STYA 4UMEA 2WMOB 1NLZA 2HSWA 1T0PA 2OBLA 4UNSA 3SM9A 1BA2A 1VBKA 1XVAA 4LGMA 1VMAA 3LBFA 3OX4A 2IGBA 2GPNA 4O2RA 1YULA 5G0WA 4TL7A 2VHWA 3TFOA 1H8EA 3AXTA 5DSXA 3LXMA 4GU5A 1NONA 2SICE 3PCRB 4P3OA 3GRRA 1L5HB 2Q5FA 4RACA 5DTMA 5BYKA 5GM2A 3B9BA 5IPFA 4MV4A 2X0DA 3W8DA 1CK4A 4KOEC 2PBRA 1RAFA 1N3YA 3VNVA 1E1MA 2OM6A 4IXWA 4LQLA 4UHCA 1QYIA 2ZYTX 4R1MA 3M33A 3WZMA 4DB2A 1SBYA 4V0QA 3M83A 3P2YA 2E4VA 4EDHA 3E70C 4DIUA 3CV3A 2P9ZA 1ULTA 3PYXA 1V39A 2REBA 5F51A 3R77A 3UTCA 1PL6A 2HK7A 4QFMA 2IOYA 2X23A 3ENKA 2PUJA 2WKPA 2WWFA 4GYKA 3ZJVA 4FGUA 2VPTA 3FPKA 4I55A 5G1OA 4G0MA 4KPUB 3SWWA 1WD5A 1JEDA 4TLBA 1ZVJA 2CUTA 4RH1A 1BO6A 2R11A 2D1RA 5CK5A 1A9SA 4I4LA 1L2TA 4UVEA 4W7IA 4EECA 1NM5A 1P39A 1PWZA 2EBHX 2VPIA 2HB6A 3OG9A 1WWKA 4C76A 1L4LA 5E9AA 3ZHXA 4YHHB 2H2WA 1VP3A 4IDGA 5CURA 5AI9A 3KQLA 3GCDA 1GWNA 3OJ0A 1BH6A 2R5WA 3R23A 3Q12A 2W8BB 2HXGA 3NAZA 1EG7A 1JQJC 5FV4A 1G18A 1NUAA 3BWBA 5CAEA 1KK3A 1D0SA 1UDWA 3T3DA 3H5OA 2VQEB 3W3AH 2BEUB 4KO4S 4UD6A 5AI6A 4C4PA 2VJDA 4EFDA 2B6NA 4ZWNA 3NS7A 3N2KB 4Q3KA 3T6KA 5EE1A 3D1LA 2KBFA 4L78A 5LMZA 1FNSA 2IZZA 2W6OA 2E18A 2IDKA 3IDFA 1QCCA 1LPMA 4IIVA 1OLUB 5JVDB 5IJZA 4DLWA 2PJRA 4M7OA 2VATA 3U3ZA 1L7DA 2G1AA 4LRUA 1W1IA 1NI3A 2CFTA 1G4HA 4ZANA 3ROFA 4A92A 2QMZA 2R66A 4NE9A 4REQB 4D41A 2PX6A 1ZBQA 4KUGA 2BUCA 3EGWA 3BSSA 1BSVA 4O4HA 1IUKA 3T52A 1IULA 1SCDA 3N28A 4BNIA 1PTJA 2D7JA 2FEWB 3KCNA 4XGQA 4EZBA 3ND7A 2OO3A 4CF3A 4I08A 3KZ1E 3AVPA 3NETA 8AT1A 3VC2A 5JLAA 2GD6A 1ELOA 3HU2A 4NMLA 3WDLA 3RI3A 2DBVO 2BJVA 2FR8C 1FPMA 4UQOA 4ERNA 2Q9BA 3H4IA 1L5YA 5L3SB 1ZM3A 1W9MA 4TYYA 3T7SA 1GPBA 2P2GA 4BUZA 3O92A 4FKBA 4MIKA 4PF1A 5K6RA 1Y8AA 2HK8A 2HHHB 4FFBB 5KHOC 1QP7A 4IIGA 5TT0A 4QGSA 5JPCA 4C4ZA 1A72A 3EZYA 3FKSD 3LUGA 2P0YA 4YP5A 3VTAA 3AY7A 3I12A 4G5SA 4RA9B 1U11A 4Y2QA 2XRZA 1LI7A 2XCLA 4YX9A 2X8WA 2VQDA 3HCCA 2G6BA 1CRPA 3KYBA 1EM6A 1QVWA 3LXUX 4OGFA 5F7OA 3GVIA 4IJWA 4KQIA 4RQTA 4X92A 3BX1A 1YZVA 4TN5A 1ZOSA 2KI5A 4YO7A 4IJ6A 3IAM1 2BD0A 1K63A 2O0HA 4AQYB 4O29A 1II8A 4RE6A 4RC9A 1OJLA 1U90A 3DTVB 3TD6A 2BUAA 3FVWA 3V46A 2E4AA 4X5OA 5H81A 2C5SA 2IYTA 1FE8A 2Z1DA 2A7QA 4BNXA 4EQ6B 2BR3A 4NQZA 3FZEA 5ITSA 3NQ41 4RAQA 1BKSB 4N65A 2WYOA 4KSBA 1T4BA 2GAAA 4GE3A 2OGUA 4O33A 4C78A 3MS2A 4UNQA 5FLKA 1KE1A 2OD2A 2RGRA 5FDFA 1PRYA 1GUBA 3JQBA 3FRJA 1CY1A 3CC8A 4GI2A 1OI7A 3FDXA 1PF7E 4FYXA 1KFKB 2NW6A 2ZDQA 1AA9A 2KQUA 2YHBA 1KEUA 3TSOA 2H48A 5C34B 3PLRA 2VJLA 2P3LA 1P75A 3MAJA 2F1OA 4Y18A 4M8LA 5B58C 3K5IA 3L7JA 1KAEA 2J59A 4HD8A 4IFIA 1LPNA 1OHHA 3P2JA 4OQ4A 1OH6A 2QUZA 3B13B 5GV8A 4RMGA 5K09A 3DE7X 1EA7A 4F6RA 5C1OA 3VO2A 4RTRA 1XMJA 1TTPB 1CIPA 1NPDA 2WB4A 5AQEA 5HCUA 2MCFA 1PO7A 4DNQA 3ICOA 4G4GA 3VFDA 1WDMA 1AK9A 3KAPA 1FW6A 2OFFA 4K6HA 5FWAA 2GPWA 3HVIA 1VJ5A 1BVRA 2RHDA 4FOPA 2H1LA 4ZOLF 4BKPA 4YJFB 2JC3A 3CN9A 4CM9A 5HBGA 1Y8QA 2EKZA 2XYPA 2X6QA 1IDN1 3PGXA 4YMHA 2DHQA 2PZFA 1J5XA 3LKVA 3NH6A 4KYTA 3GLHB 4INPA 3N7UA 2QF7A 2CKDA 1Y7PA 1YE5A 1DDOA 4D9BA 5FAXA 3VHRA 3V2UA 4ZIRA 3J7TA 4F71A 1G7TA 3K72B 3R0VA 3PTAA 1T2AA 2XE8A 4U7TB 2B5VA 3ZWOA 3LHSA 4L07A 1VG9B 2JGAA 1TMGE 3PTLA 4GM4A 5HM8A 4OP3A 3TPFA 2OAEA 4QODA 1E1YA 2N42A 3MG9A 5KOHB 3H42B 4L7QA 2W6PA 1PJRA 2FMUA 3MOSA 5DM70 2PTHA 1VDMA 1MOZA 3R7FA 1NF2A 1Z36A 3K6JA 4HG2A 5FA8A 2C96A 4IXMA 3WK8A 2G09A 1HZZA 3LBHA 3NHAA 1E20A 1EM8A 3I76A 5B1IA 4MDEA 3E3OA 3D6UA 2ZIXB 3EFHA 3IMCA 1U28A 3ZY6A 4PPQA 2FDCA 1ZG3A 2O14A 2O0KA 5L4LA 3K0FB 4DUGA 1AT1A 3ZV6A 1RJFA 2G9VA 5EERA 4IHQA 2XCUA 4QXRA 4R84A 5LZ7A 4D5GA 5B3JA 3URKA 1XP8A 2AOVA 4M21A 2IEIA 5CPBA 5TJHA 5D7BA 1JJFA 1ID8A 3EEQA 2RHJA 2CVZA 1OTXA 3C70A 3VVLA 3TECE 1WPGA 2BFBA 2PZMA 5CW2A 1N4AA 1SUIA 2WSLA 3U4DA 5IM5A 4E14A 1M2VA 3E1SA 3IQWA 2C9CA 3I01A 4N1AA 3AP3A 5E7QA 5EUMA 4EY4A 4RTMA 1DX9A 3SEFA 3WS7A 5JYCA 1M5RA 10MHA 2ZETA 4TTSA 3V1MA 4F2GA 2VVTA 1LCIA 3C14C 3EZLA 4X1IA 2EC5A 2NZVG 4F8JA 2C4VA 1EXDA 2BLLA 2XQGA 4PG4A 4F5EA 1VB5A 3P9XA 2QOEA 3TTTA 4QQRA 4F7WA 4HNSA 1NWCA 4HGQA 2CL0X 2GZRA 3BSYA 3QMPA 3WLMA 3EG5A 4EA6A 1WSDA 2O2IA 4B6QA 2GARA 5CFOA 1Z7EA 1JG1A 1OFUX 2G06A 1D0VA 2GKSA 2YZ7A 3RRFA 2Y1EA 1T8YA 3CX7A 5C80A 3SX2A 3MINA 2EFDB 5I4BA 4D43A 1VKRA 4M9CA 4DA7A 2C97A 2IYYA 1N7HA 1SVUA 4WL0A 1OLXA 4EJMA 1E6WA 5LUBA 2BMJA 4PAOA 3C5VA 2DFVA 1QF6A 1PUXA 2AC7A 2YXPX 3ZOZA 3H8JA 3HKCB 1CUZA 3GYBA 2PMEA 3UHJA 2G77B 3BJEA 1SWWA 4YRIA 4RY0A 5DGCA 1UBJS 3K0HA 3P2IA 5IVHA 4FS3A 4IDHA 2ZIAA 4FDVA 3LGXA 4M99A 5FLYA 1M0EA 1CLEA 2ON6A 3EW7A 3IFSA 4JJ7A 1P18A 3QBEA 1FTSA 3H1BA 4HEA1 1PYDA 3ZI7A 2SNIE 4DY4A 2A86A 2QEQA 3DOIA 3RYCB 2XMCA 1E63A 2OAGA 3UJ3X 4BMCA 1I9CA 1OZFA 2GXSA 4CM6A 2NMVA 3GC6A 4K46A 1M1NB 3CZAA 3SC2B 5BUQA 4XCXA 1OQAA 5IXJA 2IWHA 2IH5A 3MTQA 4DT1B 2IRWA 3QNUA 3LE8A 2ZTLA 2MYUA 4V3CA 2CBGA 2V03A 2QA5A 1OPXA 1WEHA 2UUOA 3DT9A 4TL6A 5TARA 5AVYA 1M2FA 1T4GA 4FFDA 1UINA 1TQ6A 1UJ4A 4HDSB 1KZGB 4Q1DA 2W93A 3HCBA 5KJ6A 4HRXA 3GRAA 2NO1A 3E9DA 4OFBA 1VLMA 2J85A 3EASA 3Q88A 3E9RA 3I6ZA 4TWIA 4DDTA 3BUSA 1IZ0A 2NU7B 4LRWA 1UQUA 4FZJA 4LMBA 2G5GX 1RWNA 2I22A 4EKGA 4PNEA 5LP6B 5K8VA 3YASA 2EW2A 1X1RA 2FEPA 1XQXA 5JCPA 3T99A 1P77A 1E8DA 1PGJA 1QU3A 1DIGA 1QKIA 2ZBGA 4BWFB 3LLCA 1QH0A 3PUKA 4XVRA 3SHFA 3HYNA 5KREA 5H3CA 4EL5A 3L8DA 3GJRA 1ABEA 1SM4A 3TKYA 1EH5A 1GRCA 1X42A 1RE0A 2A30A 3KOXA 3BXGA 3UC9A 3VKGA 2OO5C 1QIFA 2C9DA 3L7NA 3NTLA 5AM5A 2JIBA 4UM5A 4DVJA 5AVUA 3PD1A 3PX2A 1UL1X 3HMQA 2DPGA 4JOQA 4OK3A 4UXJA 1HE1C 1KVRA 2DHCA 2WW8A 5TVGA 3T9CA 4ZYWA 3DLTA 2I62A 3CR8A 3KKNA 3OCUA 4HX5A 4UCXA 3ND8A 4BRUA 2NO4A 5IZCA 1T1JA 3LYLA 3DCIA 5IT0A 4XLZA 3RIGA 1QUFA 3IX7A 3L6UA 3OCJA 5HIMA 3NIWA 3E5HA 2PQ0A 3OC0A 3PC2A 1PG2A 4KIFA 4BNNA 3K0CC 4EHHA 5P21A 3IS3A 1UZMA 4Q4JA 2GZMA 4G4SO 5BOSB 4UUNA 2BEKA 3NNSA 4HGRA 3T3EA 1KXZA 3ZTTA 2QB5A 1V9LA 3AJ8A 3BERA 1MAVA 4CUZA 1CR2A 2OT3B 1X38A 3CEJA 3CCFA 4CKXA 5A4MS 5HXAA 1HX7A 2IPMA 1GITA 4Q24A 1ZEMA 1JKJB 2WTAA 3FTNA 3GBVA 1R6DA 1ZCFA 1RKBA 3A8TA 1LPBB 1BXRB 1GV1A 1QTRA 4N5NA 1FVXA 3CH6A 2QIPA 2ODWA 3E9EA 5KSOA 1A9QA 1PZEA 1U4NA 2CLOB 1QHEA 2JANA 2ZRJA 3UBTA 2B98A 1TJYA 3I3SR 3TGPA 2D0IA 3PITA 2IS2A 1YAHA 1QH9A 2EKBA 2ZJYA 2X9QA 3E4CA 4MVJH 1LPAB 4UPVA 3DZ8A 5ULLA 1U3VA 5AUPB 1X2BA 3S2ZA 1QQBA 1YBFA 3BRWD 3C1UA 2YFYA 1W59A 3R74A 4MMZB 2GHQA 5AVJA 4IDBA 3U3OA 2OC4A 5FLEX 4KN6A 4UU8A 4K0RA 3BWCA 1MO2A 5JNWA 3C45A 1IN6A 3AJRA 1C81A 2XGGA 1GFZA 3QTTA 3W9UA 4Y1RA 4J2TA 3CEPB 4QUHA 1CS4C 3IO3A 4MQ5A 3RTEA 3H9UA 2QKYA 3CB4A 3VI3B 4JT2A 1JU9A 4TMXA 5E8RA 3SYNA 3TL6A 4YA6A 3WFZA 3J81k 3PTZA 3VDRA 5KNDH 1WRBA 1Y1SA 4H18A 3QU9A 3QA3E 1R0BA 1SELA 2P6MA 2ZIZA 3KZOA 4TMTA 4X8HA 5K3FA 3AM3A 3PRHA 4OY3A 2C2KA 4WDRA 3RDPA 3TUJC 4BQSA 1C30B 2CLDX 2VQ3A 4CU5A 3NH9A 4NVRA 2ATVA 1JZSA 1SB9A 2CN1A 2BM9A 1B0PA 2NU6A 2P9QA 3C3PA 4NJMB 3A4IA 3AFMA 3H6GA 5FUXA 3O7MA 3SHWA 4DCPA 3I0MA 2R751 1U3FA 4P0QB 5BSKA 5JAPA 1OI4A 3VPCA 3MLBA 4EJ6A 5JS6A 4BRWA 1BYUA 5K4HA 1WV0A 4G5FA 2P27A 1FLNA 1TQ4A 1MOSA 4TRJA 1Z4MA 5G4KB 1U8XX 3AI3A 2YMLA 3CUKA 4L51A 5JYBA 1EUDA 1TYCA 3CGGA 3DONA 5JSFA 3FETA 4RV9A 4G0WA 2WKRA 4MVWA 2WLTA 1YRHA 3O4VA 1RRVA 3ACDA 3E03A 1O5OA 3U81A 2X0IA 1DCTA 1OV4A 4Q3LA 1Q3TA 4B7XA 2J5XA 1D2GA 1QX3A 3RQSA 5HZHA 2W00A 4RLSA 4WLVA 1HQDA 4EMSA 4LZLA 1XLWA 2Y1OA 3A4VA 2FQYA 3BXPA 5AW5A 1TIBA 4KC0A 4IV5A 3D2CA 1TKCA 1JAZA 1L7MA 4B1FA 4CKCB 4YV2A 3DDHA 3R75A 1D04A 2OPBA 2YXNA 4FFNA 4MW7A 2OENG 3KOWA 1JP7A 1UBKS 3AZOA 4PZPA 5D01A 4DDHA 5CD9A 3RV3A 3WLEA 1Z38A 3RC2A 3ZKWA 1M8PA 4ISCA 1QLWA 4Q4AA 4BB9A 4N8SA 1OB5A 1ESZA 1C4WA 3K2BA 1CUYA 2PM8A 3HCFA 4FGWA 4NCIA 2WFMA 2O3SA 4R98A 4ZQCB 4RULA 2NUPA 1R4ZA 2BELA 3FRIA 1Y98A 1F8XA 4JI5B 2H4YA 5AHRA 2NU9B 4YRAA 3V6LA 5KPDA 4Q16A 2VUUA 1GGKA 3B52X 3I9LA 3PI7A 3LI2A 1RMYA 4WUTA 1CSEE 3HJNA 2VYND 3UT5B 1AKEA 2V7VA 3VV2A 2I87A 3NTOA 4NS1A 4FFRA 6AT1A 3V33A 2J3JA 1OF1A 2YIVX 5EJ8A 1EZZA 4HFMA 3W1VA 4MQMA 1WMAA 3I3OA 2OORC 4F8EA 3NWBA 1GAXA 1Z5ZA 1U8YA 4M0CA 4IM7A 3CNBA 2F64A 3SSAA 3FNRA 2J4DA 1CBUA 4WXRA 1A2QA 4YUZA 3NU1A 4MLCA 2PT7A 1JS1X 2VSQA 3W3ZB 3JPYA 2QRJA 2A6PA 1Q16A 2ZDHA 1E1QD 5DB4A 4AB1A 1V1RB 4ER7A 1FS6A 1GPLA 1XB2A 2PV0A 2V6JA 3UF0A 3LGSA 4MZXA 3S7TA 3H2ZA 4DF3A 5SZKB 3EQ9A 3RYIB 2YZNA 2V3WA 2P8JA 1S3IA 2R8EA 4EM6A 1U6IA 3UQZA 1OFGA 4CR7A 3PIRA 1I7QB 4OATA 1LNQA 3VPAA 2FK8A 2QRNA 4QNRA 1XCGB 1ZSNA 4OVKA 1A96A 3SF0A 1GCGA 3Q3VA 4UNRA 4YRNA 2YXEA 3BZWA 3M6IA 4HQNA 4PHHA 3NANA 3S3TA 4P33A 3VR2A 3AJAA 2VK8A 3BREA 1GFSA 1X8KA 1O95D 1OE0A 2Q5OA 3BQ9A 3OX3A 3U0BA 2F3UA 5GQSA 2F8TA 2JI8A 1U0BB 3S68A 4DQLA 4AJ9A 1KQPA 1UKBA 4QARA 5FEMA 3I2GA 4HFNA 3VNBA 3MBIA 4LY0A 3RIXA 3R7AA 3RUPA 4CW7A 4E5PA 1FJ2A 1GTJ1 1THGA 2BH9A 2BMVA 4RGYA 1ORVA 2C29D 2E85A 2YWXA 3GWZA 4YHBA 5A3VA 1H2XA 2ERCA 4ND8A 1VP9A 1E8NA 1D03A 3L82B 1KYZA 2IHJA 3IBTA 5JC8A 13PKA 4MRNA 1JSCA 1RM5A 4D6YA 1EVEA 3SXJA 3S2SA 3K53A 3ZDDA 1WKCA 3C8UA 5F78A 3TQHA 1JECA 5F1YA 4ZODA 2JLCA 3EBOA 4XQEA 1FF9A 4OHMA 3OAAD 2AB0A 2BFDA 5B12A 2JG3A 3TBKA 3VMMA 3CLKA 3C7AA 3DBHA 2ROQA 2AOUB 2O3RA 3FOBA 2P9CA 3ZHCA 5C8VA 1MHPA 1HETA 3FPBA 1XVVA 2FMKA 3IL2A 5BPHA 2HCFA 2GNAA 2HYDA 2O0JA 4KR3A 3NHRA 1OX4B 1W25A 3KV3O 4RMIA 4EH1A 1JWLA 2NO0A 4WK2B 2WZDA 4CTKA 4UBNA 5FNVF 1QQAA 4HP8A 2HSDA 1W44A 2I67A 1CQJA 4MA5A 3KALA 3HJRA 4EI7A 5BUCA 5H3LA 4CLXA 5FUVA 3FPCA 3NKLA 2NYUA 2ZJ3A 1HZZC 2HNBA 3GJZA 4DREA 1TD1A 4YAGA 4J0KA 2JARA 2P69A 3HYRA 3OHPA 3QEAZ 1MRSA 4ARVA 4Z1MD 2WQ6A 2JAUA 1SCIA 2ZUUA 1EIZA 1GRQA 2ETVA 3OM8A 4FPXA 4D9KA 4NZZA 1N2CE 2JAXA 2YYYA 3OIVA 1E6CA 2HHCA 4TTVA 2Z8ZA 2QLTA 4PYOA 3BJMA 4QSMA 2Q49A 4MW9A 4TM8A 3VZPA 2RGXA 4BL5A 1J09A 5L3RA 1AC5A 2J0UB 3N75A 1EKXA 4H6WA 1WMDA 5GV7A 3RTBA 5LQAA 4BFCA 3IUPA 2H1CA 3B6IA 1X80A 2IY7A 5DBHX 1E9BA 4EPYA 4L5JA 1CQIB 2XXAB 2IHTA 3CSDA 4ZT6A 3ROEA 1ESDA 1PLJA 1GD1O 1G4UR 1KSHA 1QOPB 1WDWB 3JD0A 3MGKA 4MUIA 1AJEA 5B53A 2POCA 4QPZA 3DNFA 4DLKA 1K98A 3FFTA 2W22A 2B35A 1X8LA 1SIWA 4OHXA 3IULA 4WASA 4WI1A 4B3DA 1DCKA 4MIEA 1Q0UA 3WKDA 4Y0NA 3GGOA 2PMWB 3DMRA 4OK6A 1HQCA 2CFRA 1QFXA 4DEVA 4ZDKA 1NATA 3ETEA 3HQ4O 3KT0A 3EH2A 4RD4A 1FNCA 3JQ7A 4FX2A 4XVQA 1Q3HA 5CJJA 3MCAA 3REQA 1LQ2A 3HO1A 3CNQS 1CYDA 1XRSB 3IRUA 4IPTA 1T4DA 2RG1A 3OWXA 3JPWA 3AO0B 5FNVA 5LLDA 4G23A 1FFGA 1SY7A 4UTXA 5IYZA 1YTUA 3QFFA 1M5UA 3CLRC 1UBHS 1V9CA 1JKIA 1RCFA 3E15A 1A5TA 3OLCX 2W2LD 4I50F 2JLAA 1HPLA 1I3MA 3RIYA 4YRJA 3VUEA 4D0SA 3C6XA 2V8OA 2W6NA 2ODEA 4BV8A 4FYYA 5LPNA 4BVHA 1PG0A 1Q0PA 2IGTA 4MJ3A 4Q7MB 3RASA 3BULA 3DQZA 4FQ8A 4ZDJA 1KVQA 1K86A 4Q1VA 5GIPE 1YC5A 3HVKA 3TZQA 2FQ1A 1QCDA 1TGVA 1A5ZA 3K1AB 2DTEA 4FK8A 1T36B 1QYRA 1T3LA 4X7MA 1XLTA 2H08A 2VAWA 3C7KA 3E7FA 1G42A 4JSRA 4DSZA 2ETXA 2Q29A 4MS1B 4MROA 4AXXA 5CFNA 3G9UA 5CM8B 3JW8A 1UBOS 4K9DA 3U4QB 3VPGA 2C2OA 2V3CC 4OB7A 1XPRA 2N75A 3QF4A 1FFSA 2HPZA 1A8PA 3MYYA 1UXOA 4DEYA 1LF5A 2OK7A 2HF7A 1WCV1 1MB0A 1SFRA 1DFIA 1P4GA 2IHBA 2J09A 2JEZA 1TO2E 1YASA 1ISJA 2B9VA 3DTVD 4TUYF 5AOBA 121PA 4FFOA 2Q1UA 5TIIA 3BH6A 2FSVC 3SNKA 4CT0A 4CQMB 2IEDA 4XTCS 1DJOA 1TZJA 4WAUA 5KAPA 2E6UX 1TL7C 2BHLA 4PC6A 3ZDAA 1FNNA 5COQA 1FXWF 1O03A 2FR8A 3NNNA 2WJHA 3ZHRA 2NQ2C 2RG7A 1YNOA 2H2DA 4ILEA 4QHSA 1J0XO 5C8ZA 4FP9A 2GD2A 4QQ8A 4P8RA 3SEQA 4DWWA 4O2LA 2E89A 1NVGA 1LF0A 5FWDA 3SYTA 1NXSA 3RK4A 4OHKA 4DHEA 4AF8A 3SQXA 1L1QA 3P4UA 5IYZF 4IH9A 5CDUA 1A9RA 2HPAA 2ZRGA 3QPDA 4LJLA 3R4CA 4L4XA 4M83A 4X91A 5FV7A 3ZWPA 2H4JA 5EJ9A 2VPPA 1QU2A 3BTUA 4CE6A 4ENQA 4MJ7A 5HDQA 3BF7A 2ZE8A 4LPKA 2O2DA 1NL3A 2AE2A 2C2GA 1PWYE 2FHPA 2WVHA 3CLTD 3GVHA 5JAQA 3RJTA 2V6MA 1DKNA 1NOKA 2FETA 4X9XA 3H9CA 3M4XA 1EK5A 3O1JC 3OZRA 5K3FB 5A0VA 3UMJA 3I72A 1EA5A 4K9PA 1I6WA 3ROTA 3H5RA 1DBQA 1TOAA 4FFSA 2UZ3A 5FWXA 4HVLA 4QLAA 2RIRA 3T5DA 5GJVC 3T4PA 2ZI5A 1WCIA 2M32A 3PGLA 5BYAA 4GMXA 3SXUA 1RKVA 3UICA 3LS2A 2O8VA 3KWFA 1T8RA 3KUKA 5F1OA 3SMQA 5IBQA 4B9AA 2R7KA 4ESEA 2HKIA 4NESA 3RBVA 2OMEA 4LQDA 5I9MA 3ZE1B 5CB4A 3IMEA 3SX4A 1H22A 1UJ5A 1VIAA 4LJ6A 1KEEA 1WQ1R 4ECAA 2J3HA 2FWBA 1NC1A 5IKOA 4HRVA 1ZEJA 3GOQA 1ILEA 2K4MA 4UCWA 4K28A 3W6UA 2I6FA 2CMFA 2D2VA 4FMDF 5ALGA 1I51A 3DBRA 1YD7A 3NNDA 4HO1X 3KTAB 2AEFA 3VZRA 4EHAA 2YJTD 2EG5A 2JKZA 3WA6A 3JVVA 1NX6A 2VYCA 4LOLA 3C3BA 1CZHA 1G21B 4UE6A 2PFKA 5DBFA 3W7VA 4RYLA 1U8FO 5CXSA 5IWAB 1DKUA 3BIOA 1HE5A 1RLTA 4BFTA 5KTOA 4ZO8A 1FSGA 1Y80A 1ZM9A 2Q1XA 3JQFA 3ZD9A 1B6RA 2AFRA 4HEA6 3D3QA 5LYJB 2CE2X 3ZDFA 1Q7BA 5JS2A 1MF7A 4TKUA 5D3QA 1ETHA 2DUNA 1SHZA 5AKJA 1OR8A 5EJ4A 4GLOA 3PE3A 1IHOA 1NZJA 5AOAA 2CNKA 3HPQA 4JP1A 4XVHA 3GUUA 1C0KA 1O95A 4NZMA 5FFFA 2FN4A 4EKIA 7MDHA 3CNHA 4BFUA 4CTJA 1Q1ZA 1X7YA 3DEYX 4B3CA 5EJMA 2QJWA 3ELDA 3P9QA 5KTTA 2MHCA 1WETA 4RANA 4Y8VA 1YBMA 3EJWA 1FDUA 2IHZA 3ZIDA 5HJ2A 3ILSA 2YBEA 5ANRB 2UVDA 2ODQA 5AVXA 3V42A 3PDIA 3ITNA 1FJGB 2HQRA 4HFJA 4IQGA 4BVEA 3E3MA 3GLHA 3AERA 1VLVA 2WILA 3F6EX 3IP7A 2I7XA 4CUJA 1CY4A 3MTDA 3D8NA 4X8MA 3QLUC 2FRDA 2O20A 4KZKA 3JWJA 5JI3E 3I32A 5AKGA 1E66A 3KWLA 3ZU3A 1NQOA 2AJCA 2BL4A 2O2XA 3EGCA 3T5BA 5K0CA 2Z5VA 4BDTA 1DEXA 3O91A 5IUNC 1P0IA 2X2PA 1EINA 4Q4CA 3AL3A 1BE8A 1RAGA 5G0SA 2UYQA 2F3RA 3MUOA 3PD0A 1UJBA 5BSVA 1PUJA 3BE6A 9ABPA 3HA2A 1SK8A 1ZC3A 3D59A 3H4VA 3MWEB 1F12A 3NC4A 4R2HA 4CR6A 4YMUA 3FWNA 1YQXA 2QRZA 3D6NB 3P94A 1Y8ZA 2YZ2A 1LWNA 1U3GA 1YHNA 621PA 1CRQA 2JBHA 2H1RA 2HLDD 2J1LA 4RHYA 2O4UX 4YFVA 3DXXA 1RIIA 1O58A 1YT5A 3UXHA 3O8OB 3G88A 2VSYA 1VSQA 1CS0A 2BVNA 1E3MA 4ZT4A 3QELB 1J07A 3NYWA 4FD3A 1AZLA 2F67A 3WYAA 3PENA 4HYEA 4EEKA 4ESHA 1KWGA 1AV6A 4LOIA 2ZI4A 3ST7A 2IZ1A 1GGJA 2Q9CA 1NZFA 2HDWA 2X4IA 2RGBA 2YHSA 3E5NA 1CQIA 1N2IA 3PDHA 1EUYA 4DIBA 4B09A 4BAGA 5IJWA 3C24A 1L7RA 3FSEA 3DLAA 4C7OA 2BGUA 4HR7A 2DHRA 4HJRA 1PZXA 1GR0A 2NNWB 1VZ3A 4AKGA 3NP9A 3OOJA 3TD9A 1ECBA 4KOAA 1U4OA 1W6RA 3KSRA 3K0SA 1EVJA 4DR2B 1IHXA 4F91B 4KAXA 3LOQA 3E8SA 5I9BA 3WJ7A 4NCKA 1C3OA 1KJJA 1VIDA 3GDWA 4ERXA 3C7DB 3OIYA 3JZMA 1BE6A 4QLOA 1X15A 4QO8A 3D8SA 4H3VA 1H8HD 1HDRA 2JHPA 2REXB 1G3UA 1PWEA 2PLAA 1Y82A 3H8SA 3Q3GE 5E6SB 2V0CA 4YREA 2SCUA 4GDFA 1U3WA 4FDUA 2ZI3A 4B81A 2JATA 1EUDB 2OLKA 4Z4CA 2XR1A 4Z4EA 1XRJA 2Q1YA 5FLXA 1HORA 1QO7A 2AN1A 5LZ8A 3AUUA 1ZOLA 3DBVO 3WQRA 3HKDA 4M9SA 2VLBA 4WLEA 4QC2A 2NO5A 3PPVA 3LNTA 4TMFA 1NDHA 3DHWC 1J20A 2HNKA 4EF6A 2V6IA 1SGWA 2JAOA 2EERA 4HB2A 2VA8A 4AQDA 1QHYA 3GHHA 1SUBA 3M4JA 4PTYA 1PGOA 2F4NA 3K05A 5KYYB 2E1PA 5C2JB 4CHTA 5KQGA 3B6EA 4H6XA 2YIDA 3DSRA 4MO9A 2NTEA 5EE3A 4E13A 1Y1TA 4CF6A 4Z1OA 3EVAA 3PX7A 1TDJA 1JJ7A 1QZZA 3U4IA 4XIJA 4DZRA 3WXBA 4V0LA 4JGIA 1YQGA 4PZLA 1FTYA 2LCFA 4F96A 3PGKA 3V1UA 3C3XA 5K8CA 3REFA 2O8DB 5HIKA 3PR3A 5I8PA 1JLLA 1FRQA 2Z5LA 2JGIA 3DWEX 4DNXA 2WWYA 2SKCA 5AKYA 3RJ9A 5JNSA 3JARA 1XA0A 2TYSB 3I83A 3PKIA 4A0SA 2ZIEA 4MPDA 2FFRA 3LC0A 2CMKA 3VR2D 3G2JA 1EFDN 3V7WA 5CFPA 4ARCA 4P92A 1OAKA 3JCZA 1BEEA 2C1EA 1PL0A 2NUBA 4AYTA 4PO1A 1K9VF 1NY6A 5FPHA 3SI7A 2ECKA 1XNQB 3B1XA 5HKLA 1QDUA 1OFVA 4HSEA 3X44A 2EGUA 3I92A 1T1EA 1P6QA 2WK1A 1K7SN 3KAQA 2XZOA 3OCCA 2NQ8A 1IVSA 1YKGA 1KDYA 1NNEA 1K3TA 1KK2A 1WCIB 2VZ0A 3I6QA 2O07A 2UV8A 4AO8A 3U17A 3VPHA 3HZRA 3QYJA 5AYVA 4IF6A 2HFKA 3LKBA 4EKDA 4F3NA 1HFEL 4E15A 4O1IA 3W6NA 2PPLA 3S40A 3ZE9A 3K0AB 1Y1RA 5FR1A 4MPPA 3AKZA 1DSSG 1P1RA 1Y1PA 3AR5A 3ETLA 4YS6A 5M34A 4QXAA 3GJXC 3TJMA 1L5QA 4GF5A 1U7XA 2QYTA 4AO6A 5A4FS 4Z8YA 4HH1A 1QF9A 3PPIA 4GLBA 2ZT6A 5FI3A 5NULA 3HBFA 2ZSBA 2OGTA 2BMWA 1EQAA 5DEIA 5I9NA 5H4GA 1AUOA 4ZOAA 1Q0RA 4FC7A 4OSPA 4PRKA 5TMEA 3TNFA 2ZROA 2XE6A 5AHXA 3X1MA 4ACAA 1BN6A 3EODA 4G1BA 3VPBA 4DJEC 2O19A 2RGEA 3RS3A 4DCJA 5BN3A 2A7XA 2YMQA 3N07A 4OHPA 1CZNA 4YV1A 3RAEC 1W8DA 2JCVA 3GRPA 4P81A 3T4EA 1N34B 3BH0A 4Z7OB 4UBJA 1NYLA 4RADA 1Z6QA 4EHNA 3ESXA 2CW5A 4OI0A 1E5LA 4DRXB 2Q21A 3VTZA 5D86A 1JSZA 4FNMA 3D3WA 1ULAA 5J9FA 2FZWA 1X80B 3AILA 2NUTA 1M3SA 3LAWA 1TK2A 3FB4A 1ZU5A 1KF0A 1VPDA 2WR8A 2Z5FA 5AVRA 1XX6A 1XZJA 3RCBA 4RLFA 2XCRB 5G2OA 3X1YA 3DG9A 4YC7A 2BZ0A 2UZIR 2KBEA 4IG9A 4MYDA 5CBKA 1IWPB 3R9KA 2ZTSA 1X7ZA 3A3NA 4HNHA 4UTZA 4ZI7A 1HR0B 3LO8A 3I9FA 1CNMA 2Z6AA 2BEUA 1R8XA 4BZWA 4DG9A 4YDSA 5L8VA 2ODBA 3OZDA 4FNGA 1ODFA 2HYIC 2J0EA 5TC4A 1QRSA 4PWYA 2HV8A 4B73A 2FMIA 1DHTA 1DKLA 1F4VA 3AKYA 4WA7A 5E1OA 5E6UB 2OLJA 5THXA 2W58A 1LW7A 3V80A 5JSZB 3NO4A 4AI6A 4TTIA 4CMHA 3PQ2A 4WLFA 1M33A 2PDAA 1Y37A 5A4DA 1Y81A 4GI3A 4IAOA 3VU3A 2WBLC 1H0KA 4X6UA 3UJAA 1NF8A 2DRIA 4HCJA 4LECA 2Z2XA 2ZG6A 4JXZA 1A8QA 3JRWA 1QDLB 1YA6A 2FFHA 2GYUA 2ZU6A 1G2QA 3K0CA 1QAMA 4CM7A 3OUUA 5AKZA 5M04A 1CT9A 1B8PA 2DU8A 5GIOE 1GNVA 1SXJB 1J7JA 1OW3B 1GPYA 3PRYA 2AW3A 2KMLA 3DAYA 4K9NA 1DEOA 5T4EA 2PUDA 1U63A 4MKZA 3VAZA 4OYYA 1C2TA 1SZDA 1B00A 2G5TA 4LFBB 2YMPA 5CVTA 2P9TA 3BBPA 4IDDA 4LF5B 4Z3KA 4UATA 2HNAA 1Y5NA 3AY6A 3IT3A 3O8QA 3D5TA 3K73O 1II9A 3O95A 3ORFA 1JLKA 1JX6A 5AI5A 5C1PA 3DHEA 1VPWA 2PGIA 4Y9UA 1NVMB 1OBHA 1WXEA 2AHRA 1CY2A 3OC6A 4YRDA 3GJQA 2VH2A 3OE5A 3OIWA 4JVSB 1E6EA 3TUIC 4C0XA 3KBBA 1AMOA 1AN0A 4G0QA 4HF7A 1WULS 4UXHA 3QHPA 1KJ9A 1E2GA 3L8HA 3OZEA 4DJJA 3W5VA 1JBQA 1XZAA 2O3UA 4ENUA 3TGWA 4BLQA 1OXVA 2BR4A 1XZNA 2J9FA 4ZTBA 3UFBA 5HJ5A 2X0FA 4D25A 7AT1A 2QLLA 1I4OA 4PW0A 4B7ZA 3MFQA 4FZ3A 1APBA 2GCPA 1SXIA 1WZUA 4QOHA 3P9RA 2C9MA 2ZRNA 4JQOA 3WBJA 1BE1A 5KVCA 4MPRA 3SVTA 3T7JA 3PC8C 3SLKA 1XD9A 3VHLB 5A5FA 3JWGA 4M49A 3L43A 4H4CA 2UDPA 1WF6A 3ODPA 1SD5A 1Y7HA 4CQLB 3K2IA 4F2DA 2DB3A 1IG3A 4KIWA 3KXIA 4UAUA 4HZUA 4IX9A 2DXIA 1N6NA 2TMDA 3E2PA 2WYVA 4KPFC 1Y4AE 1GKIA 3QWHA 2CBXA 4HDRA 1UMBA 821PA 4YPFA 5H9WA 4EHKA 3TF5A 3RFFA 1NBMA 1DP4A 1QWSA 2GA9A 2DM6A 4EHIA 2ADOA 1F6WA 4JL8A 3UBMA 1T9HA 2CWWA 1LI4A 2BBTA 1UQTA 1WP4A 3DZBA 4HT3B 3U3XA 5C7LO 1JKXA 1G16A 1TW3A 4R7GA 4HX9A 3ONVA 1RBQA 4JBNA 3KJQA 4QTYA 1V8DA 3OM1A 3KZMA 3TDKA 3U56A 3U61B 3KYIB 1K5PA 2B5WA 2IC5A 3HGTA 1YBVA 4R1LA 3G13A 1NULA 3ZKAA 4NCAA 1TAQA 1W30A 3BHMA 4G5HA 3AWIA 4RVDA 4XW2A 5JEEA 1CEYA 3LT4A 4CG2A 4AKTA 3NC0C 1KDTA 1P1HA 4RF4A 5TPWA 2HJGA 4PYKA 3TPCA 4ZAXA 3RUHA 3LRXA 5CCXA 4L74A 4MQLA 4X54A 1ZL0A 4CG3A 1PR3A 3HG7A 5TF4A 1SHLA 3WNVA 4D4LA 2J45A 3STWA 1C7IA 4M60A 4BN4A 4Y30A 1IY2A 5FADA 1OJ7A 4QYIB 2JA1A 4B4VA 2W8ZA 3B9QA 3ESBA 4CZ2A 4CDRA 3AKDA 3ESZA 3L6RA 3L8FA 2ZYUX 1MO6A 3A58B 1CP2A 2A3NA 1TM1E 3AETB 1O0SA 4C0JA 2XWQA 3E7XA 3QE9Y 4OYRA 2W8BA 2EF0A 3SK0A 3CF6R 4HNVA 4Q4LA 3WGQA 3GRCA 1DO0A 1FTGA 2YS6A 3ICPA 2CNWD 4X0EA 4KQCA 3ZS8A 4JI0B 1L5LA 1G5QA 1QQ6A 3B3JA 2FX2A 4WWHA 2OHVA 3ZV7A 3ECSA 4GHWA 3MYRA 4AWAA 5B30A 3I0ZA 1LA2A 4KRFA 2FWJA 4BJ5A 5TS3A 2WJJA 1ZONA 1R9MA 1Q1EA 3ETDA 4Y6QA 1UWCA 1ZRSA 5CYFA 3EDMA 1D6SA 1A9TA 2ZBVA 3A05A 4REQA 3IKTA 4KP7A 5EPUA 5FO0A 2BHNA 3KLBA 5E4YA 2AG8A 4GBMA 2Z08A 2AMFA 3CLSC 3FWPA 3ERCA 2HADA 4BU0A 2QJFA 3GVCA 4EF4A 4P1ZA 4L73A 2VHXA 1L3CA 4GQBA 3KQUA 1ZA1A 3NHKA 1HE8B 3G5LA 1XMXA 2E2WA 1GAEO 3L6BA 5JAUA 4TXMA 5DNEA 2HIGA 3BPSA 3QWFA 1XMOB 2D1YA 2G5CA 4LNHA 3TSWA 1J7KA 2Q0QA 3V1LA 3T1OA 2QE7D 2FLKA 1GZ6A 3NRJA 5JADA 1ZXXA 4NX2A 3RUFA 3D2BA 2HMSA 2Q5HA 4Q66C 3QU2A 2XZDA 4TVOA 2VWGA 3M3DA 2XEXA 4YUYA 3ZWWA 5KDDA 3EIUA 2BF7A 1XRRA 3FHCB 1H1LB 3O75A 1HT0A 4KQ2A 2GF9A 3NYRA 4B79A 4BLSA 4P54A 2JA2A 4MUJA 3LOUA 2SBTA 2HCBA 3MT0A 1R0YA 2CHEA 4S0XA 2VUSA 4A16A 2F4VB 3K70B 3ZH2A 1GU0A 2LWIA 3M5DA 3CVUA 1H0RA 3QJYA 3T3PB 1LDGA 1RJEA 2HU2A 4UU7A 1G8KA 3QUCA 4YCBA 2YXBA 1HFKA 2ZSEA 3PPYA 4QDXA 4F85A 2G25A 4DR4B 1Y5MA 4YUAA 1RAHA 1Y9JA 4P4GA 4NEQA 2BI7A 4M0DA 5EIBC 3TWOA 3D4PA 3L1IA 3EEYA 4O4IA 1QPBA 1GKUB 1W1UA 1DQNA 3F3MA 5EMNA 4ARAA 2HXYA 2VDMB 3QA9A 5H4HA 1HOTA 5TQ0B 3TQFA 3UA3A 5K6TA 5KTPA 3KLMX 3QWIA 3R7NA 2C03A 1JFTA 1VI5A 2FCRA 5F73A 3KQSA 1DARA 1M34E 1X3LA 3K92A 5EWLA 5ARCA 3RD5A 1NQXA 4LHYA 3R3WA 3SOPA 1AQIA 3G0GA 1X6VA 1R74A 3GH1A 2EWWA 1DAGA 2Y68A 3GRKA 1GPWB 3IB6A 1J9ZA 1LRLA 3IEXA 4N0EA 3BQMB 4U7HA 1M1NA 3SC2A 1JG3A 1KARA 4YAFA 3K6SA 4ATNA 3LHFA 3SJ7A 4AY5A 4BEWA 3AYZB 1LDYA 1UJNA 2EF1A 3H5AA 4OHVA 4XYMA 1XXLA 1L5GB 5FRDA 2OOKA 1MT0A 2RH5A 1Q1AA 1NBME 2FF5A 3N2KA 2P9FA 4IGFA 2FOLA 1QVRA 1GL9B 4RZQA 4CCWA 1I6MA 1OLUA 3EX7C 1JI0A 4Z0NA 3BGSA 3KXPA 4ZHSA 4FCCA 4E07A 2HOQA 3QF7A 1YCFA 2F48A 4ZOLA 2QI9C 3AERB 1JT2A 5C8DA 1YDWA 5T64A 3CIOA 3NJRA 2XYRA 4WCFA 1WNTA 3FVVA 4RKEA 2Q8NA 4EAQA 1E4EA 3I9KA 3RFXA 3PPWA 1D5CA 1SG9A 4G9GA 1TIPA 2AKYA 4E4YA 2PUEA 3PFCA 2YRXA 4UEWA 5IM4A 2JI6A 1UCFA 4R0VA 3THOA 2C5FA 3SQWA 3EA0A 3AGPA 3IHWA 4G67A 1JR4A 1T13A 3H9JA 2D5AA 5EMJA 1UC4B 3GYGA 4HXYA 2GPBA 3K1TA 4O25A 3RS7A 3BHIA 4CM9D 4DLVA 5B7QA 1R10A 3DE3X 4D9HA 2AFVA 4A8JB 2OB1A 5E3HA 3MSXA 1GPDG 4EW1A 1M34B 1V1MB 5E3IA 3N05A 3JWHA 4WIAA 2H16A 3ZI4A 5KQPA 3AI2A 5P8WA 3RH0A 4CLOA 2F7SA 1QP4A 4LIPD 2YDYA 4OMFG 2R1UA 2R1TB 4QO7A 5EWJA 1UOOA 3CT6A 3X2FA 1KI6B 3RFTA 4DJFC 4AL4A 2VNKA 5FPQA 1YQWA 1SC3A 5D2CA 2NXCA 4KFCA 3R5HA 2VJMB 1IN1A 5FBZA 2M6RA 4JB0A 3UUEA 1NJ6A 3NDPA 4BWGA 1O5TA 1VE1A 2K6GA 4P4LA 5TMDA 1PJBA 1Y6QA 1YZLA 2G9UA 5JSHA 1UUFA 3WK4A 5JFTA 1ORHA 2AEMA 3FUWA 2PV7A 5SZJA 1HQKA 4PC3A 4C0QC 2BTQA 5EINA 4IEFB 1F20A 3CY6A 1MQ9A 2W4QA 4U6QA 1JDZA 4KIUA 5ADHA 1FX0B 4HDMB 4IMRA 4QATA 3C3KA 3DYBA 1XAHA 1DS6A 4R1TA 3ZLTA 1DEAA 4CM8A 4QRDA 1PSDA 3BB1A 2HU5A 1ODIA 1OXBB 4XOIA 3WL6A 1YQEA 2OV2A 2Q3JA 1NLUA 1E92A 4N5HX 1RNLA 4GPD1 2X1LA 4ZIRB 3KL2A 1I2BA 2B3DA 4DC9A 4A6DA 5LYJF 4LF8B 2FG6C 4GZMA 3V8NA 1MT3A 1BWQA 1RI3A 2A59A 2CXTA 4GNRA 3ROXA 2A0YA 2NN3C 1U9ZA 4KDCA 4MJLA 2RK4A 3UJBA 1PKEA 1H0SA 1WU8A 3UHOA 4AURA 4ZICA 1VXOA 1WE2A 1RWPA 4MVJA 5K3AA 2VDRB 5KCMA 1AKNA 1NX9A 2I8CA 3F1LA 1MJNA 1HQYE 4RJKA 2PH7A 1V0JA 5AW7A 5IX8A 2Q8PA 1R0SA 3PQ4A 1MB3A 2OQVA 3PRJA 1ONSA 2IKQA 2J31A 3IIEA 4C08A 5IXYA 4LS3A 3U4QA 1YMVA 4I1RA 1VCMA 4J7CA 3ZWVA 2ZJ8A 2H3HA 5KTYA 3GMTA 4M0EA 4HQ0A 4KE7A 4TYPA 5TRTA 1A2KC 4RQUA 4IJUA 1YTLA 2JFFA 3G7UA 2GJ9A 5DPMA 3AW8A 3NDJA 1BNCA 1QMGA 1VJDA 2Z5GA 3JU3A 3M5CA 4GIBA 1CZKA 4XPZA 4RW0A 1AMUA 3AK4A 5HCIA 4XCQA 1UP7A 4LMRA 5HG0A 1Z68A 3DB2A 1EEHA 3AR9A 4B3TB 1CE8A 2RAFA 3OQJA 1RIFA 1XFAA 2GN0A 1XJ0A 3IC5A 1PNVA 3DAPA 4ZRMA 1RQGA 1XJQA 2QGZA 5FTKA 4TLDA 3TB4A 421PA 1TEXA 2VJPA 3B1ZA 2QLMA 3P9IA 1G7SA 1AQUA 1MC8A 1SBCA 1TKBA 2PU5A 3F71A 4N40A 3WRXA 4YYZA 1JHRA 1IQUA 1YGPA 1UKCA 1O6CA 4MR8A 2CLMB 4ZEXA 3ANMA 3UCXA 3W05A 2GBFA 4CIWA 2QAGC 3V8EA 2E1RA 3W5BA 4CL0A 5KNLA 3UPDA 1NW4A 1SNYA 2QM3A 3CLHA 1MZPA 2IT1A 3F46A 2QV0A 1XF9A 4DA9A 5JH7B 1ZVMA 5A3SA 1FX1A 2NV0A 1SUFA 2WJZB 1T5BA 2IZOA 3ANLA 4G3XA 4JCCA 4DMMA 4BJ1A 4OU5A 4JLSA 4M9XA 3WIDA 1B74A 3CH5A 4P4UA 1OLXB 3VVBA 4YYEA 4BFSA 4HDQB 5JCJD 4Q7KA 4HC4A 2FSHA 3FMVA 1SHJA 4AU1A 2QW1A 4IXNA 2A4KA 2H65A 1H2ZA 1OU4A 1HYGA 1ISFA 1MQAA 2QV7A 1YUMA 2IITA 1OWOA 3DOJA 3L7YA 3IBSA 4I6GA 2O5EA 2FQQA 5LSAA 2YFHA 3OZIA 4JJ8A 4HLUC 1OIWA 1X7YB 3CTPA 1E98A 2IKSA 4WZBB 1X0VA 4U9IS 2I55A 1KZ9A 5IKPA 3N3BC 1NVUQ 2ZE5A 4YRFA 2JHGA 4A8HA 4ZHQB 1PGNA 4C7JA 2W2TA 1VSTA 2X1VA 4J4TA 4DILA 2C7PA 3SDSA 2RONA 3GP3A 1QFMA 4YT2A 2DWQA 4DWJA 3KYJB 2GZAA 2PRKA 3LQFA 1L4GA 4IWYA 3ZDYB 2VK2A 4CT5A 2JLSA 1QBKC 4XAQA 5IULC 1RU3A 4KYIB 2M6LA 1R15A 4LYYA 3E22A 4GI1A 5CT9A 3PC6A 5LQUA 4Q3OA 1BHO1 1QZ3A 4EOGA 4MUGA 4NK5A 5ICFA 1Z17A 1GL7A 1L5FA 1Q6YA 1WHSA 1PNOA 2J4CA 1FDOA 1E2LA 2ZAMA 3H3XA 4X20A 1D2RA 3KOZA 1KO5A 1F51E 2PKYX 3MMXA 3SU8A 2ZXUA 3GH3A 4PLZA 1ZD3A 3H9BA 1KIMA 2XGOA 1XTTA 3SMVA 4XFJA 3UM9A 1HE2A 3V8VA 1W75A 3S99A 2AW5A 1U81A 1SRQA 3M8KA 2QAIA 2P11A 1BD3A 3LTNC 2WM9B 5C9ZA 1TUIA 4RHFA 5LZ2A 2BSXA 2ZIGA 4CR8A 5ALYA 2UYGA 4DBZA 3TYXA 3HJCA 4UM9D 3RPEA 4ZHQF 3HP7A 3AF4A 3B7GA 4W82A 5DGXA 4BCBA 1J49A 3IUJA 2W6JA 3FOAA 2CB0A 1FNBA 5JCJA 1TW2A 1FEZA 4GPIB 3A9CA 5MN6A 3EIHA 5KJCA 4R8VA 3PQ7A 2UVPB 4UU0A 1YH3A 2J07A 2LGJA 3EQ6A 1V5WA 2PQ6A 1N2EA 2RAPA 3QE4A 4FFMA 4WZAA 1QHNA 2I7CA 3BL8A 3ZWCA 4D9IA 4E5VA 3E2IA 3A14A 3ENNA 4RZIA 3C3WA 3L4BA 5HIJA 5K8JB 3WNDA 4M8KA 6REQB 5C4MA 3RVQA 4P7JA 4FT2A 3QH4A 2Z3WA 4MS4B 4BNTA 4Y2SA 5KNBA 4JSTA 2SECE 1XYVA 3B1FA 5A4AA 2RJNA 1X8XA 3DEHA 2OHFA 3HSSA 2JGMA 1PYOA 1AF4A 1RPTA 1TC2A 2C9OA 2UYOA 1QHXA 3FCUB 4RDXA 5ILGA 1R8SA 1GT6A 3G85A 3AKEA 2W6QA 3FNFA 1MO3A 1U7TA 3FI0A 3LZCA 4OUDB 2YJ3A 3EVZA 4FE7A 1XE3A 3FJYA 2EHDA 3I05A 3Q2IA 5E6SA 1CHDA 4XRRA 3ZCTA 5HTOA 1UAAA 4DA6A 4G56A 2ZRQA 1CZUA 2Z8XA 4V2UA 3CEMA 4ABYA 2QTNA 2W2KB 4HMQA 4HWGA 4P3NA 4BFVA 3O3CA 3G2KA 2ID8A 1FZQA 4PSDA 1OAAA 4Q15A 4D97A 4ZCIA 1AHPA 1EJ6A 1MFZA 2EZ8A 3K0BA 3FYTA 3WGUA 2Z6UA 1HBJA 5HILA 3DHNA 4N03A 3VZCA 3FHTA 2NT4A 3CWZA 2H1FA 2C57A 3F67A 2GDZA 5HFNA 1X13A 2DAPA 5BQOA 5HF8A 5B5SA 3R6DA 2EX0A 4CKZA 1CX9B 2OZLA 3GLSA 4N0QA 2OYRA 1QO0A 4RESA 2VHZA 2WA2A 4HPXB 3CSUA 4Z9FA 2GEVA 1I13A 2QN6A 3RG8A 4JC0A 5ESXA 3UZUA 2ZS8A 3TW0A 4XD7D 2DQZA 1WP9A 2IODA 4NYIR 1Z0JA 2IP4A 2QLBA 2R7LA 4O4JF 1DTWB 3LSTA 4FEGA 4WZ6A 4OI1A 4OQQA 2ZJ7A 4C3ZA 3GARA 3G2IA 1XRNA 1B7GO 1UT6A 5DN6D 1OZHA 3IR5A 1R27A 2MOKA 4GXTA 3OQHA 1KU6A 1ES9A 3AR8A 4UDYX 4A8TA 2W48A 4FT4A 5ENZA 2NIPA 2B36A 2Q6LA 2XKAA 2YVLA 1NFQA 2JI4A 2BFEA 1M10A 1T0IA 1UMBB 3ZWBA 3K8ZA 2CNOA 1ADFA 2MSWA 4FILA 4NU8X 1ZISA 4PCLA 1CB0A 3BIJA 3SFTA 3UANA 3F9CA 3ET5A 4F9FA 4GPTA 1GNTA 4PYJA 1CDDA 1V71A 1UKEA 1L5OA 3EGIA 3E3AA 3B48A 4JB3A 5HNKA 5CDFE 1RACA 3BFJA 1E69A 2PRJA 4TRNA 1IPFA 1D4ZA 3WSWA 4L4YA 5FP0A 4RTPA 1EWKA 2YJ4A 4GYWA 4XM1A 3HLYA 4QICA 2BSAA 4GYYA 3CA8A 1JEYB 1XOIA 4HWTA 2DUUA 4RU1A 3RBAA 4WESB 2PS0A 2QQFA 5CEFA 5D6NA 1VJTA 4HAUA 2OWDA 4Q6BA 3VR1A 4EJSC 1NSYA 3L7MA 2IW1A 4C1BA 3LWBA 4DAOA 2IYOA 1URPA 5FF9A 4XIYA 4QUBA 1RMQA 3K32A 4F9EA 1STOA 2H0QA 4MQUA 3MINB 3DVLA 2A5LA 1SBZA 4FONA 2X4LA 4W9NA 3L4KA 4GOMD 2ZAOA 2QUKA 4DM3A 2IS1A 5DX8A 3IQXA 4C5CA 5AW6A 2YIJA 1CQXA 1E6KA 4E11A 2YJZA 1R8YA 4G36A 2RMKA 4LXYA 4NICA 3NORA 5CT6A 3RUEA 4W5NA 1KMCA 2Y1GA 1R0CA 1QGZA 2VXBA 3GX1A 1WB4A 4DL9A 3HCPA 2W37A 5AHWA 1KO1A 1R6AA 2IEBA 3Q15C 3CURA 4QUDA 1W76A 2EWVA 1JFVA 4WINA 4YAJA 3TB6A 3WQQA 1JLHA 1ZJYA 3NATA 4MO2A 3L6DA 5DI3B 5LCXA 3QLVA 4YJ3A 4DEXA 1GL6A 3WIOA 4AUEA 2PIDA 4JYCA 2A57A 1I33A 2XUKA 4LDZA 1NJSA 3LQRA 3BCUA 2IV3A 1YU9A 4G0PA 2WF9A 5SY6A 2IEZA 3EN0A 2QN2A 4NDNE 2VTBB 2V74B 4KWCA 1TVMA 3K4PA 4MR7A 5EHGA 3C43A 4OXKA 4KV7A 3QLEA 1CUGA 2BEWB 3V4PB 4DT1A 1IU9A 5J3JA 4HEQA 3RVPA 1IXYA 2J41A 3PHCA 4R8SA 4KPEC 2V9ZA 3G2QA 4B4WA 4KPYA 2GPJA 1N5KA 3K4QA 3LHKA 2XUOA 1TQDA 3THXB 4GZ3A 4KGXA 1PJCA 4I3HA 1EUQA 3FTQA 5G3YA 5CDFA 1RZUA 4AF7A 5L45A 1J1UA 1ECLA 1U8EA 4G1FA 5CVEA 5LBUA 3BA1A 1FXWA 4RNCA 3EMKA 4OFWA 1LZLA 4W1RA 3E8XA 3FPFA 2R1VB 1E7YA 1KYXA 1RXSA 4QGAA 1EVQA 3PGJA 4P6VF 2WAXA 1Z5GA 1T2UA 5D3MA 3JQ6A 3B5JA 5A1TA 2DERA 3A6JA 2WJ3A 1T8WA 4N5MA 1R0XA 4FHCA 4E5YA 9LDTA 5LUAA 4GGOA 3BIFA 4Y1EA 4N4AA 4CVNA 1MC5A 4DCOA 1GIAA 5ICMA 2J48A 2X3YA 3BBLA 3PFIA 4HQRA 2OLEA 1UADA 1IZ7A 2FEKA 4QIHA 2CVOA 1RJGA 5T5QA 1B8OA 2PCJA 2G0NA 3B60A 3ISJA 4FGLA 1GTL1 2GK7A 3KYCA 3QLJA 3T1VA 4BAUA 4E2FA 3SE7A 2G1PA 4S1OA 2W2NA 3MJDA 1U0OC 1U31A 2BRUC 1S89A 2MR6A 4LNUB 2XH8A 1W73A 4AO7A 1JDUA 4NIMA 3PNMA 5CM9C 3VZQA 1C1XB 3NT2A 2AZTA 4EG1A 4OQLA 1WTAA 2O1WA 2TSYB 2FPKA 4E3WA 1LS6A 4BQEA 4H7FA 2VYVA 4TSFA 3DYIA 5KJFA 2WFLA 1VFNA 5FTNA 3LCVB 4KXNA 3A1TA 5TEVA 1H1DA 4FE3A 1RVDA 4CL8A 3B6MA 2I80A 2ZUTA 1RHRA 2V5VA 1JRLA 4HQFA 5KTSA 5HP4A 3FAZA 2MYNA 1KHTA 3FMPB 1FTNA 1YFZA 4PCUA 4FSXA 4DE5A 4H4DA 4F4UA 2EZUA 1KI6A 2HI0A 1IZZA 4TRMA 4WOPA 3UKDA 3H87A 3ZZ0A 4C2BA 4MWOA 2YWDA 3FB1A 1LGYA 1QG2A 1ZD4A 1RCTE 2XTAA 4YP9A 4M6WA 3OH8A 3GLKA 2Z43A 3ROKA 3N0WA 1CERA 4A1FA 3WGLA 3FNQA 3AEUB 4IMIB 4C4SA 1QRDA 1YB2A 1GZ5A 4WKGA 3G23A 1VJRA 2Z4SA 4ENSA 5JARA 3RGGA 2AMJA 4Y6SA 1UWKA 4GMKA 5DM2A 3NZEA 3R5JA 2BI8A 1ONBA 3ZX5A 3AZPA 4WXYB 4G8DA 5GADl 1TB4A 1Y9DA 1E3JA 5DBEX 1GY8A 1M6VB 3OLWA 4IEIA 3QFCA 3KSUA 4NJEA 5JWHA 1VGRA 5DHTA 2V7UA 3QG1A 1AZTA 1KDRA 1T6NA 4AQ7A 1ZYUA 3D54D 2JL1A 3BD6A 3PT9A 3LTEA 4KJXA 4AJLA 4HDAA 2BKUA 4KQKA 1OREA 4O8CA 5JS7A 3DB1A 1NJFA 3QXXA 2QW0X 4IRMA 4X94A 2KLHA 3K15A 5CG1A 1C9JA 1MO4A 4NH0A 1RHMA 3CRVA 4RELA 2Y1LA 3DOHA 1HT1E 1E2JA 2HBZA 3AY0A 5JFGA 5KJ1A 3GIDA 1TZKA 3BJIC 4GR9A 4IRXA 4RTNA 3DXYA 5CVJA 1N3BA 1E1DA 2Q3HA 4KCGA 2DWCA 4S1VA 3T1HB 2XF2A 4BGVA 4AAYA 4YXFA 5CT5A 5BPFA 4B43A 1ODLA 2NU6B 3PPXA 4PBSA 1ZH2A 3GVPA 3R6TA 3THWB 2BBSA 3KPYA 1Y8RB 4GM1A 1EXMA 2E5WA 1MRNA 3I8OA 4U2DA 5DYIA 3KQHA 1W4CA 2FMTA 3IKLA 1E9RA 3QTBA 4YRTA 1B16A 3MGGA 4DSTA 4YIHA 3U60B 4IFBA 2KWIA 5CU7A 4BNFA 1JBEA 4MUBA 2N0SA 2H63A 5CA1F 1Q12A 4KQHA 5AJUA 2P7HA 3VJKA 3HR7A 1LX6A 2VRWA 4E5KA