3SXJA

Crystal structure of complex of bt_2972 and adomet, a methyltransferase from bacteroides thetaiotaomicron
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
245
structure length
245
Chain Sequence
FSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of complex of BT_2972 and AdoMet, a methyltransferase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 85
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3sxjA00
9MHTA 2FHPA 4U7TB 3PS9A 3UJAA 3KQVA 2YTZA 2BM9A 3ELDA 3NDJA 3OZTA 4YUWA 2HMYB 2P7HA 3R0QA 2PV0A 4QVKA 3X0DA 1AQIA 2FPOA 3EGVA 4E33A 4QPPA 1VE3A 2HV9A 5LQKA 2B3TA 5DRYA 3TM5A 3GRVA 5CM2Z 4QDKA 3FTCA 2ZBRA 4ER0A 1L1EA 5E1OA 5EMJA 5KQSA 2FCAA 2EFJA 2QYOA 3FYDA 4X60A 5HZMA 1MHTA 8MHTA 2NXEA 3TPZA 1JSXA 2G71A 2H11A 4R6WA 4PYJA 1H1DA 3K6RA 1NV8A 2B25A 2OKCA 1X1CA 3C6KA 5FHRA 5EHIA 2AN3A 3PTAA 2B9EA 5D1NA 1RJDA 4DMGA 2QRVB 2ERCA 3QOXA 4DA4A 4MHTA 4OA5A 4IWNA 3JWGA 1U2ZA 2BZGA 4HC4A 5FWDA 3OU2A 4MIKA 2XYQA 3IHTA 4GBED 3KQOA 4RTOA 5EEHA 2JHPA 5C1IA 1RJFA 1JG4A 5DT2A 4YUYA 2O0LA 2H1RA 3TOSA 3AXTA 4XUEA 5IKMA 1M0EA 2AOUB 1NW5A 2QY6A 4PYIA 3F4KA 4R8RA 3MAGA 4X63A 1XCJA 3CJRA 3KR1A 3MCTA 1JTFA 3ELWA 4ATNA 4O29A 3HVKA 3ERCA 3HCBA 4L7VA 5DXJA 4RTLA 3OFKA 5CVUA 3RODA 2ONZA 4RVGA 5HIJA 2G8NA 3FUTA 4AUKA 3NVKI 1N7JA 3KQMA 3A26A 1XDSA 3UA3A 1V39A 2PSSA 1RI5A 3UJDA 4YV2A 3HCEA 4RTRA 4XUDA 1EJ0A 4AZTA 3G2PA 3FYCA 3DXZA 3GRZA 5CUQA 4FSDA 4PCAA 4Y30A 3KQQA 2ZIFA 1WXXA 3S68A 3SSMA 1KXZA 4RTMA 3EVBA 4BLUA 2Z6UA 3CVOA 1B42A 4X1OA 1G60A 5DTQA 1WS6A 2ZSUA 1INLA 5LR6A 2WA2A 3LHDA 2P8JA 3OZRA 5CVJA 3UFBA 1WZNA 3OCJA 1I4WA 1EJ6A 5U4XA 3UJCA 4IKPA 5FHQA 1PJZA 4BY9E 3R9XB 5K09A 3LDFA 4P7JA 3PX2A 1NW3A 1L3BA 2NP6A 4FT4A 4CKBA 2KW5A 4E2WA 1X1DA 2LD4A 1FJXA 3LL7A 4GOOD 3P9KA 2CMHA 2C7OA 3O4FA 3T7SA 2PT6A 4PYKA 4EVIA 2FK7A 1EG2A 5LQAA 5E9JA 2YR0A 3EEOA 1RJGA 2JHAA 3KQTA 4ER7A 2BR4A 2P7IA 3KQSA 3CC8A 4AZWA 5K0JA 1M6YA 3HM2A 4ER3A 4HG2A 3I53A 4EKGA 3NVMB 4GC9A 1NV9A 2VDUE 4HGYA 2JH9A 5GP1A 3TKAA 3ELYA 3BKXA 3DULA 1ZKDA 5FUBA 3GXOA 3DTNA 3FPEA 4A6DA 2PXXA 2P35A 2AS0A 2PVCA 4OX9Y 3BGVA 2ADMA 4KDCA 5EG5A 1ZQ9A 5CIYA 3A25A 4CTJA 4KVZA 5HFJA 3UBTA 2YX1A 4BLWA 4QQNA 4QTTB 4F84A 3ER9A 1YFJA 5CVEA 3UJ8A 3JWJA 4ZTBA 3PVCA 4M37A 3MGGA 1IY9A 3DMFA 4OBXA 5E8RA 5K0CA 3BWYA 2EX4A 3NTVA 1VQ1A 3GJYA 3ORHA 3UJ7A 2JG3A 2ZCJA 3DLIA 4RV9A 5FULA 3G88A 2IDKA 4DKJA 3GCZA 2BR3A 2YXEA 3FRHA 4FR0A 5EZQA 1L9KA 5EMMA 1ZGAA 3ME5A 1SUSA 2XYRA 4EKIA 5FQOA 3SMQA 3ELUA 1WG8A 1BHJA 5EEGA 2AR0A 1QAQA 3CCFA 3Q87B 2G1PA 1EAMA 2PWYA 1YFLA 1NT2A 2N47A 3CJTA 3DLCA 5HIKA 2QRVA 3HVJA 1NKVA 3EMDA 1O9GA 2WA1A 3CBGA 3FRIA 3Q7EA 2VS1A 3QV2A 3THRA 2IP2A 4KIGA 3B7PA 3HNRA 2ZTHA 4WVLA 2AVDA 5K0BA 2AOUA 4LWOA 10MHA 4FS8A 5CVVA 3CKKA 5FWAA 5C9ZA 2YVLA 4YMHA 3MCZA 1Y8CA 2HNKA 4DF3A 3A4TA 3D2LA 4C4AA 5K0GA 3KPVA 3TKYA 4DM3A 3KQYA 5DTRA 4ER5A 3EVCA 1NBIA 5DSXA 4E2XA 5EOVA 5DX8A 3WSTA 4EMSA 2IH5A 4KW7A 1P91A 3P2KA 3P71T 5T64A 4R6XA 4RYLA 3KU1A 5EIFA 3FPGA 3FUWA 3GU3A 2DPMA 4GOMD 1R6AA 2OYRA 2ZLBA 2PX2A 4QTUB 1SQFA 3G8AA 3LDUA 5P8WA 5DRTA 2XBMA 1BC5A 1M6EX 2ZBQA 4U7PB 2I6GA 5LQRA 5KS2A 1YB2A 3PLAE 3CGGA 5FQNA 3A27A 5D1HA 1KP9A 3FTEA 3DUWA 2AOWA 3MB5A 4A6EA 4E70A 2B2CA 3E7PA 5HILA 1X1BA 5EMLA 3THSA 4LECA 1QAOA 4RVFA 4GOLD 2ZZNA 2NP7A 2GS9A 3E05A 3B3GA 2I62A 1JG2A 5EZSA 3UJ6A 1G8AA 3NDIA 3R3HA 2H00A 4CKEA 4DQ0A 5F2NA 4P7FA 2I7CA 2PXAA 3EMBA 3HA7A 5LQNA 3C6MA 2OO3A 2UYQA 4RTPA 1G6Q1 3LKDA 3M6WA 1KIAA 3BT7A 3G2OA 5E8JA 1DL5A 2YXLA 3FUXA 3EEYA 3BZBA 3OU7A 2P3QA 4FZVA 3UJ9A 1XVAA 1FP1D 3L8DA 3PX3A 4HSGA 3B5IA 3T7TA 1D2GA 3AY0A 4C08A 4EQZA 4YUZA 3E23A 3EGIA 4PGGA 3TR6A 1XCLA 4HH4A 4QDJA 5GWXA 2PXCA 1IM8A 4GF5A 3OFJA 4M38A 1D2HA 3P9CA 2NYUA 4FP9A 1R74A 3TRKA 4UOEA 1RI3A 3HP7A 1NW8A 1P1BA 1P39A 3M6XA 2R3SA 1NBHA 2Z6AA 3OE4A 3OPNA 5DXAA 1JG3A 4C07A 3DMHA 2EG5A 2ORED 3VC2A 4ER6A 1R18A 2VDVE 3MTIA 3DXXA 2YUIA 3TLJA 3UA4A 4C04A 2QM3A 5GM1A 2JH8A 3R24A 3SVZA 2AZTA 2IBSA 4YMGA 1KPGA 1YUBA 4E30A 2PLWA 4Y2HA 3LPMA 5IH3A 5CCBA 1YZHA 2VDWA 3KPYA 2JJQA 5GINE 2UYHA 2R6ZA 5T67A 3V97A 4M36A 5ICEA 3DMGA 3REOA 4IV8A 5E1MA 2XVAA 3HA5A 4RVDA 3IV6A 1XJ5A 4V0RA 3I64A 4F85A 4H0NA 5KVAA 1UWVA 1I1NA 2CKDA 5FA8A 5HEKA 4C06A 2YXDA 3A7DA 3LDGA 2IPXA 1OR8A 5K03A 2ZULA 1XDZA 1FBNA 3OU6A 5EMKA 4BLVA 1KPHA 2PKWA 4EK9A 1I9GA 3SX0A 3LCCA 5K0LA 3GIWA 4E2YA 5K0FA 5EQJB 4PYQA 4RWZA 5DM1A 4DCMA 1G8SA 3G5LA 2BM8A 1D2CA 3GRYA 3NWEA 2GA9A 1O9HA 4HTFB 3FPHA 5LQUA 2JHCA 4AX8A 1JG1A 2VZ9A 4OQDA 2GPYA 1JTEA 2XYVA 3BKWA 4GC5A 4HGZA 5EHGA 3SR4A 5K0NA 4GUAA 1PRYA 1R00A 3VC1A 1TW3A 3G2QA 4RSRA 1UFKA 3C0KA 4OBWA 3M4XA 3UWPA 5E2BA 4BP1A 3P2EA 1JQDA 3M6UA 2AOVA 3LBFA 3NJRA 3RIEA 2B78A 3KPJA 4RX1A 2PX5A 4DZRA 1DCTA 3M33A 3I58A 3P9IA 4K6MA 1XDUA 5CCXA 5MHTA 2P3LA 4GOND 3SSOA 1T43A 2OPBA 3A7EA 2FK8A 3HCFA 2CL5A 3UZUA 2ESRA 2OB2A 2F8LA 3KR9A 4RTKA 1QANA 3HCDA 1VL5A 2P40A 3AXSA 2Y1XA 3FUVA 3GGDA 3HCCA 3KPUA 4X41A 1RI2A 3TMAA 5JUWA 5K8VA 2VP3A 5F2OA 2ZWVA 5DX1A 1EQAA 3RW9A 4PYOA 4V0QA 5CVDA 3KHKA 3BWBA 5K05A 2IDJA 2ZW9A 1HNNA 5DM2A 4X61A 5E2AA 2O07A 1ZGJA 3C3PA 1P1CA 3HEMA 5E9QA 3ANXA 3FPJA 3HVIA 4P7GA 5LSAA 4RTSA 3GNLA 3EVDA 4PIPA 3G8BA 5DLYA 2PGXA 4PYLA 5E9WA 1SKMA 4OA8A 4QVGA 3P9NA 1TW2A 2G72A 3EVEA 4YUVA 2CMGA 3M6VA 2P3OA 5K01A 2PT9A 3PFHA 1F3LA 1WY7A 2PX4A 4NECA 4FGZA 2IH4A 3B89A 1ORIA 1Q0SA 5DM4A 4RTNA 1AV6A 4P7KA 4E31A 4POOA 1O54A 5FTWA 2O06A 5EVJA 2NXNA 3EVGA 3MERA 1JR4A 2NXCA 3NWBA 2PY6A 4PYNA 3P2IA 5ICGA 2ZZMA 1YF3A 5EPEA 3FUUA 5HIIA 3T0IA 2IBTA 2OXTA 2DULA 4FSXA 5KYGA 4RTJA 3TM4A 5GIOE 2C7PA 3EGEA 1L3IA 5EIWA 4PWYA 3SGLA 5KQRA 1FP2A 2OY0A 2IFTA 1KYZA 3KPWA 5JR3A 3FTDA 3MHTA 1XTPA 2YQZA 2AN5A 4BP3A 2HR1A 1BKYA 4M7RA 2HWKA 2ZWAA 1NW6A 2XVMA 5HIMA 3KR2A 2EJUA 5F2KA 1FPQA 4MWZA 7MHTA 4YV1A 1QAMA 2WK1A 4DCGA 2GLUA 3DH0A 4E2ZA 3QOWA 3LCVB 1VPTA 4E32A 4PNEA 4PGHA 2E5WA 3LCUA 3FTFA 1ZHFA 3P8ZA 4OQEA 1UIRA 3EVFA 1N7IA 5H02A 3GO4A 3DOUA 2GB4A 3C3YA 4P58A 5BW5A 1X1AA 2EJTA 4WXHA 3V8VA 3VSEA 2P1DA 1F38A 1SG9A 1NE2A 4LG1A 1N2XA 4R05A 2PBFA 2FRXA 5GOZA 3IYLW 3SSNA 3SM3A 1RI4A 4CKCA 4HRAA 3PT9A 1QZZA 4Z2YA 1HMYA 1AF7A 3ID6C 5LQJA 4HTFA 3LSTA 3LKZA 3G2MA 3BWMA 3U81A 1ORHA 2ZFUA 2ZIEA 1SVUA 3B3FA 3TFWA 3DP7A 1KHHA 2OBFA 1VP9A 2ONYA 3GRUA 1RI1A 3ER8A 1NW7A 4QQKA 4B17A 1RJEA 1SQGA 4RVHA 3VYWA 4KWCA 1VP3A 2NNWB 1VIDA 1G55A 3I5UA 2Z6QA 1R8YA 5EC8A 5EGSA 3HA3A 4GQBA 5FA5A 5T6BA 3TQSA 4C05A 3M70A 1AQJA 1Z3CA 5E1DA 4JXJA 2UYOA 4CTKA 5CD1A 2C7RA 4IV0A 4YUXA 3KR0A 3NMUF 3R6TA 5LQCA 2Q41A 1R8XA 4KDRA 4ISCA 5E1BA 2O57A 3DR5A 4RTQA 5K0EA 1Q0TA 5HOQA 2BR5A 4LWPA 5BP7A 5EKUA 2GAFA 2GH1A 2Y1WA 3BGIA 3FZGA 4MQ4A 5BW4A 2AOTA 3KQWA 5DWQA 5DM0A 3AJDA 1XXLA 4F86A 2ZIGA 3P97A 3GRRA 2G70A 4PONA 5G02A 3T7RA 2IIPA 2K4MA 4PYMA 5BXYA 1G38A 1VBFA 1YZ3A 4GEKA 5DSTA 1MJFA 2AOXA 1BOOA 3LECA 4KIFA 5DX0A 3GWZA 3MTEA 1VLMA 2UYCA 2I9KA 4PINA 1ZG3A 2FYTA 3JWIA 4YV0A 2QE6A 2OZVA 5FCDA 2P41A 3AWIA 3B3JA 2IGTA 2PJDA 3K0BA 2CWWA 4QPNA 5M5BA 2O05A 4PCLA 2C7QA 1JSZA 2V7EA 2ZZKA 3OZSA 3EVZA 5C0OE 1QYRA 4R8SA 3KKZA 3FPFA 3SXJA 3NW9A 1EIZA 2A14A 3H2BA 5DPMA 1KR5A 3G5TA 3HVHA 4AZSA 3GDHA 3O7WA 3IEIA 5EKXA 3PFGA 5DTMA 1JQ3A 3BUSA 4MTLA 5B1SA 1WXWA 2AOTB 5ICFA 3BWCA 3PB3A 3EVAA 2IH2A 4XUCA 3OE5A 4AZVA 2NXJA 4C03A 2ZBPA 3G7UA 5ERGB 4CXMA 3E8SA 3CJQA 1X19A 5GM2A 3LX6A 2PX8A 3DXYA 3BXOA 3G89A 3KQPA 3LBYA 1JQEA 1KPIA 3MQ2A 4FT2A 4PIMA 4XCXA 3I9FA 4KRGA 2OB1A 3EPPA 1KYWA 3O31A 2UZ4A 3HTXA 1L3CA 2PWPA 2V74B 2HTEA 4G56A 2ZVJA 5FADA 5GIPE 2AVNA 3JWHA 1DUSA 1TPYA 3UJBA 4CWAA 3BGDA 1SUIA 3HCAA 2BH2A 5ICCA 3LGAA 2AN4A 1IXKA
chains in the Genus database with same CATH superfamily
3CVWA 2VT2A 2AJBA 4QAJA 1WVGA 4OXQA 5ECYA 3ELDA 3RBVA 5CH3A 4Q7EA 2QTTA 3VMFA 4HNVA 2C5HA 2C9MA 2QL6A 4RABA 4D9GA 4RIHA 2FPOA 1KFKB 4TQUS 4LV8B 3HVRA 1VRWA 5AT1A 2B92A 1WB9A 3PWTA 2YUTA 4G0YA 4HDKB 5DW0A 3L49A 3RV3A 1Y4AE 2XWSA 2UV8A 3NPAA 1FYVA 4Q7QA 2QYOA 2P6UA 2QL5A 1Y6GA 2R751 1D6SA 4JGGA 1NZDA 2RAFA 5JTTA 3OPMA 2PZJA 4NK4A 4EM6A 1PR0A 3A3YA 2QSYA 3RC1A 3C5HA 2PRKA 4HWKA 2XTJA 4AG3A 1IN1A 1B7GO 1K7XB 2VXCA 2FP3A 4PIVA 1OAAA 4A16A 1R3DA 1DKUA 4S12A 1PTKA 5CXQA 2ZI4A 3SPXA 3WXMA 5DNYB 1KZ1A 1G1MA 2ZRLA 4U2GA 5J3JA 5LU9A 3FTNA 3ZKAA 1D7OA 3D7NA 3PFWO 4FHFA 4R9SA 2J4FA 5HJ5A 1ZMXA 1WWKA 1HZZA 2PGJA 4C0AC 3PBKA 1UBTS 1JIKA 1QIFA 1W1IA 2J5KA 4KO1S 1RJFA 5EE9A 4AUMA 1A7KA 1J0AA 2XVYA 3H83A 3OLVA 5FTKA 3KEOA 2QUIA 4RQTA 2VHZA 5HYVA 4HZIA 2BKAA 1RKUA 2IUTA 3HB0A 3AEQA 1D4OA 3VUEA 2ID4A 4GSKA 1Y81A 4P82A 1C50A 3HZHA 1D8TA 2O2ZA 4ZHSA 4Q6BA 5DXJA 5KYVA 5FWNA 3RAFC 4B3JA 4FGKA 4ZYWA 3PQEA 3KHUA 4NLLA 2DWOA 3K8QA 3PRJA 1TTHA 4AZTA 2ZBEA 4EYGA 1KKUA 5K5EA 1BMTA 2C82A 1TM1E 1KSHA 2YS6A 4R40A 2IP4A 3QKSA 4ARUA 3LIIA 4J2HA 3INTA 3MS7A 4BTVA 4KQIA 4BJ3A 2LKDA 1OFUX 4O5AA 2F3UA 5E7MA 1DHTA 5J63A 3LLSA 5CCDA 2VH2A 3ZWVA 3OHMA 3BIJA 1U7HA 2REXB 4R81A 2VA8A 5IVKA 4YUAA 2WI8A 3C3KA 4JC0A 3PX2A 5JY6A 4GDFA 5L3ZA 3GZNB 4B3MB 1U5BB 4FT4A 4X44A 2J9FB 1OTXA 2J8ZA 2LD4A 4EMTA 5B7NA 2QRZA 4JQOA 4NULA 3VSDA 3ZDFA 3GJ0A 1EG2A 1V26A 2RH8A 2REQB 1NJ2A 1YI0A 4MYCA 1HDGO 2UDPA 1KBOA 4UZSA 4U39A 1X7XA 4HDMB 2HAEA 1U8FO 1ZIYA 2ODAA 1QF6A 2ZOSA 3A14A 3NVMB 4G8DA 4G8JA 5GP1A 3WYFA 1QG0A 3Q2OA 4E2FA 5JAQA 4JL8A 1BVRA 4QQ8A 1GOTA 1ACJA 1SG6A 2ONJA 4D82A 3HRIA 3LVQE 3AUJB 4R8LA 5ILQA 3RS7A 4S04A 4BNLA 1G16A 5HFJA 3BSSA 1UFOA 3B9RA 3C3CA 3HR7A 4NCIA 3RQIA 2JLXA 3KYIB 4QQNA 5ALJA 4ZRNA 4CUJA 1AUXA 2VQDA 1TQ6A 4XVCA 2C9YA 4AZ3A 5C1OA 3GLTA 3OEHD 3N07A 2BLLA 2MMGA 4KZPA 2NQ8A 4QA9A 4ZHQB 4CV0A 4KQMA 4F8EA 4UTNA 2E87A 5AJUA 3NTVA 4RVNA 1CEYA 1RACA 4QG7A 3HCNA 4NAVA 1SRQA 1TYBE 2AG1A 3D02A 3U40A 1S3FA 1HYHA 2FPIB 1JI0A 1UEIA 1XQ1A 2D0DA 2DTXA 1H2WA 2FSVA 2GZHA 2ZJ0A 3GCXA 4GGOA 4NDZA 1UDRA 2QMUA 4OP1A 1RQRA 3DL2A 3WO1A 1YB6A 1WP4A 3L7DA 4ZVUA 3TCKA 4BKPA 2IIVA 2XYRA 3A6FA 3HLTA 4PX5A 5FQOA 3ORQA 2REOA 3M2PA 4YNBA 4N5HX 2H51A 4QE3A 2AXPA 1H5NA 4MIEA 1NW9B 1X13A 4YFVA 5E4YA 3VI3B 1JDVA 5FO0A 4B09A 2QRVA 1R4AA 4ZI7A 3Q8WA 1ITZA 1KSGA 3VXKA 1JHOA 1XG5A 3BG5A 2VRCD 4CI9A 1N6HA 2EFHB 1RJ9B 2GMWA 2R6DA 5JSZB 4BO9A 4AY5A 4EHLA 5I51A 1QH0A 3KALA 3A6DA 2PS1A 3QVXA 4NP6A 1QRSA 1S2IA 1EE2A 2PGIA 3CKKA 3WNZA 2YWCA 2YVLA 3VH1A 4EA6A 1JFFB 3HN2A 2FPMA 1V4NA 2Y1CA 3D2LA 2NUTA 3TQRA 4EW6A 1JA0A 4L28A 3UATA 2DFKB 5M3BA 3U7JA 5I7RA 1LF5A 1GILA 2CLSA 2V59A 1NSTA 5BYJA 3VKVA 4JXXA 1N25A 1H5QA 4DLPA 2ZYTX 4LKOA 1P91A 4OLFA 3WMFA 4CIXA 5IDWA 4RYLA 3VAYA 1KYTA 1VPEA 2D5IA 3Q11A 2Y1EA 4Y2PA 3FOAA 1QTQA 3OOYA 1Q17A 4IJKA 1R15A 2OYRA 5FBWB 3TVYA 2PX2A 3LDUA 3RM3A 1GTMA 1F4PA 3SBEA 1EVKA 3B13B 4DWJA 1B15A 5LC1A 2OFPA 2KBEA 3E5HA 1CZLA 1E18A 3IPRA 3FOBA 5HRCA 1CD5A 5D1HA 3OPYB 4PQYA 4M7OA 1U1DA 4X9XA 2XF2A 1GA4A 3QJYA 1TYDE 1EGVB 1M33A 1Q57A 1XFAA 4E70A 5MFZA 3LLVA 3WYGA 1JEQA 3AR5A 5DHRA 1RJWA 4ZKDA 3IJ5A 1ISMA 4Y9TA 1S4MA 2QQ0A 1BE6A 2WZCA 4GOLD 3E05A 1AMOA 4LI3X 1WZCA 2I62A 2JAUA 2QN1A 3N58A 2VPWA 3M82A 5D7NA 3SDSA 4ARZA 2JK0A 2HO4A 5KTNA 5F2NA 4KVGA 3MIIA 3VU8A 3ZWPA 4A2QA 4DXAA 2AFHB 5I7FA 4FGUA 3G1WA 1YU6A 4JGIA 4NATA 3PA6A 1BW9B 1GKKA 1M2OA 1Z88A 1UBSB 1YCGA 4Q03A 4WXRA 4WZBB 4GE3A 1K7FB 1LVHA 4Q01A 1KIAA 2DT5A 2GN0A 3PC7A 4YK7A 4RD0A 5L40A 1G20E 2CHEA 3VU9A 4FMDB 1AH2A 1XDDA 2JATA 2C88A 3I9V6 4XTCS 1ZRSA 3F9RA 4G5XA 4BIIA 1HFEL 1Q22A 2X5JO 2OQRA 3G0IA 3OQVA 4K6GA 4YI3A 4BFSA 1Z4NA 5IKEA 1XPRA 1EEHA 5CFPA 3QTLA 3IR6A 2ATEA 5H5JA 3ZGYA 1EHCA 3EUEA 3R3YA 1RTTA 2CVFA 3SOZA 3H17A 3LK6A 1R4ZA 1RI3A 1CZOA 4ICIA 4LC9A 3X1YA 4C4RA 1A9TA 4CLDA 2W6QA 4RM3A 2WM2A 3E18A 2J0VA 1T0UA 3UW1A 5BQFA 4FFPA 1OFIA 1K8RA 3CVYA 3QUBA 4C04A 1TC1A 2FN8A 1BJKA 4G5GA 1OC2A 3I32A 2X6RA 3O84A 4O2AB 3ZBPA 4KQEA 1I36A 1Q7EA 4B82A 1QE0A 4IFIA 3S6JA 1JLKA 3DAYA 4ZOLF 3FVTA 2O2IA 3SZUA 4IJ5A 1MJGA 2BMJA 1WMAA 1K2WA 3CKMA 2WSIA 3LSYA 3SS9X 2H1OA 2G9RA 1G4HA 3HA5A 1OXXK 4KIUA 3JTEA 2NZYA 1IY2A 4WCDA 5HXAA 2YXDA 5B58C 5LA6F 4D8UA 3FOZA 3GDGA 4JUBA 1KF0A 3BDIA 1YH3A 1FNNA 2BE7A 4LJLA 3GQBB 4OI4A 3VOBA 5DM60 3E15A 2E4ZA 2FETA 3K71B 1RZVA 3OZIA 4LYEA 2Y93A 4UU1A 1VSQA 5BRAA 5IUKC 4EF4A 1TDJA 2X8AA 4YAOA 3TZKA 1C8LA 2I3BA 2Q5EA 2JI7A 3IHLA 4XQ9A 3ROZA 5C4IA 4H7PA 3AVVA 3TF5A 1RRMA 4C4SA 3R7WB 1M34E 1VG0B 2W83A 4Y0VA 2EVWX 1R8QA 4GC5A 4PSKA 1JSCA 2ZPTX 2DXIA 1NXSA 3JYPA 3PC2A 1ZD2P 2OL4A 4F6CA 4A0SA 2DR0A 5K0TA 2OXEA 3GLKA 4Q1AA 2X1HA 3I6ZA 3W9SA 1L4FA 4NARA 3CXUA 3V4LA 2OP0A 4D0SA 4J0HA 4D9HA 1OLUA 4R1UA 4JKOA 1L7PA 3PTZA 4DQLA 5LP6A 2JB9A 3CXRA 3SSOA 3Q1LA 1EVZA 4YP0A 1Q2UA 1RKQA 1PK7A 2P40A 1O87A 3BRSA 3G1TA 2RC5A 3HCCA 3OURA 4G1UC 2CEAA 4LJ9A 3UV3A 3MLEA 1WZ2A 1DE0A 4N01A 3DOEA 5DMXA 2WILA 1NHWA 3ZDYB 2Z8YM 5CVDA 2FMXA 5B2EA 2BEVA 3V9PA 4PZAA 3HP1A 1B8OA 4C6TA 4I9NA 4LDJA 3GUCA 1HDEA 4YR9A 2K2WA 4K0RA 2H5JA 3JQAD 2B98A 4M8SA 2GA8A 1PS8A 4R4JA 3KKKA 4TTVA 3KZOA 1Z45A 4LGMA 2GBLC 3NHZA 2LBPA 3R5JA 3MJSA 5IAEA 4FHZA 3DMYA 2CMGA 3OI7A 2LE0A 3EN0A 3TTUA 1IMOA 1UMDA 1P0MA 3VC7A 5DN9A 4DVJA 1T4MA 3H1EA 5B7QA 1YSCA 3C70A 3PDIB 1E0DA 4OU4A 3LXMA 2UUOA 4GIBA 3TGWA 3IO3A 2HXGA 4LXHA 5FXMA 1VG1A 5DM4A 3HEBA 3T7EA 3WB0A 4BE7B 2QYTA 1DB3A 3HMQA 4DDHA 4Z4IA 2VQ3A 4POOA 2W6JA 1E7WA 1HSZA 1L7DA 1XMXA 1JSLA 5JHGB 1RTKA 2AX4A 1BWPA 1XD2A 3HB5X 3K0AB 3N0WA 3MS2A 4I55F 4JX9A 2DFDA 2GUGA 3NWBA 4W8OA 5F78A 2YY7A 1TF7A 3H1FA 3TZLA 3WL7A 3VR1A 4BTLA 2O8BA 4MWGA 1Y37A 5L3VA 2W6PA 2G9VA 3FUUA 2XWBF 4WKNA 3V8EA 1TXGA 4AY3A 2QV0A 2V5UA 4WD3A 3D6HA 3A04A 4ZC8A 1NBWB 2Q2NA 4IMIB 4JSYA 3T06B 4PWYA 5H16A 5IK2A 2P6RA 1UINA 1XZDA 3JARA 3U48A 9LDBA 2V7VA 2XRYA 3D7MA 4G25A 3L3BA 2IZ0A 4I1UA 2HBZA 1LQTA 1XTPA 3SVTA 2G40A 1KRHA 2H4XA 3H4VA 3OHSX 3W0LB 1EBBA 2FUEA 2QUBA 2QN2A 2VYVA 2A86A 3AO0B 3GGCA 3MAAC 3ND7A 4Z3DA 3RWOA 3ONDA 4EMBA 2BV3A 5B6JA 4I9FA 2WLSA 3QUQA 4GI7A 3FFBA 3R3ZA 1H2YA 4HAYA 2F9LA 4LSGA 2PAFA 2LCQA 1VJ0A 1QG4A 2O4UX 1E2FA 3LCVB 4YJGA 2X7JA 4N03A 2P79A 3O8QA 2IOFA 3B5JA 3TW0A 3P8ZA 1E89A 4IO1A 1F7VA 4URHA 1XMIA 1P2DA 4KN6A 1VL1A 1XTRA 1T6YA 5A2QA 4FHGA 3KQUA 4RAOA 4RF4A 3QU9A 1TUEA 4TTAA 3K15A 1Q0LA 2A5FA 3F3MA 4LQ4A 3LKZA 2AYXA 2ZIEA 1W4BA 4UUBA 1NHGA 2YV2A 1G8HA 2FCRA 3B3FA 3DBOB 5E6RA 3TFWA 4N54A 4XX0A 4UVEA 3MLBA 4AWBA 5KQLA 2BUAA 2GZ3A 2Z5VA 4AKIA 3BDAA 3T4PA 2YYZA 4IUDS 4BUZA 1SOUA 4TSFA 3GPIA 4DBZA 3W4IA 2BI4A 3PHGA 3OBBA 4W99A 2VZEA 5KNBD 3NWPA 3F46A 2E6UX 1X8KA 3BJZA 4K9MA 5KSPA 4QSHA 3VO1A 4YWJA 2B6NA 4LVOA 4RKQA 1VGQA 4DCNA 2IOHA 3UHFA 4Q1BA 4BYMA 4EBFA 1QGED 4WINA 3UKOA 4BEWA 5LQCA 1U1CA 1GPUA 2I8CA 3AF5A 3CURA 4I4IA 5DYWA 3AEQB 1XKXA 4YBRA 2GAFA 1G2PA 2FG7C 3L07A 5DGXA 3OEED 1KE2A 1U8UA 3OLCX 3FDIA 3F5DA 3EQZA 4N39A 5F12A 1HLPA 4PYMA 3UENA 1I7LA 3IERA 5AJHA 2Q5HA 2VT3A 4HGNA 2FEKA 3T5DA 4NFHA 4UHFA 3H5IA 3RUCA 4J1QA 4Z0NA 3M3DA 1X7DA 2Q1UA 4PZZA 2FYTA 2ZIUB 3LUHA 4CL8A 4GSYA 3QKSB 3ZV5A 2C3PA 1XALA 2Y71A 4KXXA 2XT0A 4AP9A 2B21A 2YASA 4X6UA 3IEMA 2FE4A 1H9CA 2NTNA 4GRIA 1Z7GA 4H59A 4TWBA 1EJBA 3KKZA 3FKQA 4KYIB 5FKJA 2RGCA 5LLTA 2WV7A 3BSFA 1KZ7B 3PPIA 5IJZA 4HB3A 1U90A 2A14A 2EU8A 3W1VA 2BFOA 5I47A 2EFEB 3WLNA 1CXZA 4LQDA 5D51S 3GDHA 1AN9A 1RLJA 2PRIA 1JQ3A 4HWTA 5T6MA 3WL8A 1ATIA 3QXGA 3CX7A 5G1OA 3RS8A 2IH2A 2VDRB 3OE5A 4QBIA 4W5QA 3DFZA 4QOEA 3U44A 4HUTA 3ZDAA 4X8HA 3ZQ6A 3SZOA 3L6DA 5B36A 1M2FA 5E3JA 1KDVA 2EERA 1ECJA 5K9ZA 2Z8YA 4MRSA 3R5KA 1X7XB 3RRBA 3AVQA 1NXOA 2I7VA 2ZYIA 3AR6A 1MEOA 3K70D 1R0XA 2V97A 1L3CA 3MJTA 4UZFA 2IYLD 1M2KA 4KHZA 4MEAA 3ZJYA 1D4AA 4YCAA 1RU3A 2XX3A 1U11A 5U1PA 1GPDG 4Q9LA 1IEQA 1ZX1A 1JQLB 1T15A 4DLNA 3A1TA 3GROA 1GGHA 5LZ8A 3VPGA 3E2IA 4BAZA 1CE8A 1CUWA 4L0QA 4AZ3B 1SA0A 2HMYB 1YTLA 1ZOLA 4DRXA 3JQEA 2J41A 4CMGA 1Y5IA 2BSQA 3IBFA 2HV9A 5J47A 1UPFA 4N0QA 1ZW1A 3GRVA 3H8SA 4BNJA 4L5IA 4C0HA 1FCJA 1JIQA 1BHO1 1DTSA 2R1TA 5EP2A 3TLAA 2R85A 4HS4A 4UEWA 4DJDC 4KMOA 4DQUA 5IZCA 4K2HA 5KQSA 5AVQA 4IJMA 1HG1A 1ACMA 4FILA 4X60A 4LFCB 4B8ZA 3NJ4A 3HB9A 3R3WA 5AO9A 4NDAA 2A5JA 4JU8A 4GWGA 3W2FA 3WRYA 4XFDA 2ERYA 2FZLA 1U0GA 5C32A 1SOMA 2JVIA 3ISJA 1CUZA 4LRYA 3A31A 3BYZA 1YUMA 2JIZD 4YRLA 4L4SA 1LZLA 1MO4A 1JFRA 3RHZA 4QTZA 1Q16A 3OVMA 1Z0FA 2QRVB 1K97A 2JZNA 1VZ3A 2Q2QA 2XJ4A 4IWNA 4N49A 4DHEA 3EWAA 4TV8F 4EYSA 3PTLA 4ZI7B 4RTOA 3PEFA 2JHPA 4LOKA 3VZDA 3L6EA 3EGXA 2DBYA 3HBAA 4NENA 2PLRA 5DT2A 3VR5D 1RXVA 1YI8A 3KVOA 4OO3A 3OZWA 1P9NA 4UKDA 4Q3LA 4GMHA 3ZN2A 2QY6A 2W4IA 4XI9A 2VR1A 4Z9YA 3RAGA 3P9YA 3ORRA 2BEWA 5BOSA 4AYWA 1XK7A 3FWYA 3KR1A 2NUTB 1D2AA 1FTGA 1O0SA 3IB6A 4DYVA 3PQDA 2WUEA 3ELWA 2I03A 4LYHA 4MARA 4PXYA 5ALKA 4V3CA 5SZHB 1AOXA 3ERCA 1YWGO 5TPZD 2KJQA 3RIGA 1ZIXA 3V4ZA 3MAJA 2X8WA 2BZ0A 3FUTA 3ZGXA 1N7JA 4MYSA 4NU0A 1RI5A 1EJ0A 1C7EA 3K9GA 4CMCA 5K8CA 3RLIA 4KR7A 5CITA 1G0OA 5GMOA 1ODSA 5AM2A 4C7BA 1DGQA 3L06A 4ZAWA 2K6GA 4KACA 5SY9A 4K1LA 2FOXA 1W76A 1KIMA 3LKBA 3QLTA 4QOIA 2HJHA 3GN2A 1KDTA 2VYFA 3GFGA 1PDWA 4K6CA 4P5EA 2PK3A 5JOQA 2P8JA 1JEQB 3MFYA 4JJAA 3AVPA 1I5RA 1WRBA 3NNDA 4PG8A 3KB8A 2BUCA 2GM4A 2BL4A 2OXIA 2R4UA 5HQ3A 1RABA 2CZGA 3O2JA 1FSZA 1TCUA 3N0RA 4PFSA 5JTUA 1N5MA 2HHCA 1U8CB 5BSEA 2IYYA 5CEEA 2ZRDA 1GUBA 1T1RA 4GOOD 2OAQ1 1M2OB 4HRXA 5I7OA 3T7SA 2YS7A 2J3EA 2I4TA 4EVIA 1B14A 1W0JD 1TI7A 3C3AA 2PT5A 3UWSA 2PQ2A 1TOAA 1ZN7A 2ASVA 5BV0A 4Z4HA 4QU8A 3UMRA 1CQJA 1E2MA 1G4UR 1GITA 1HLFA 3CW8X 5K0JA 4GYKA 1D7AA 2EHDA 3KWLA 2HIMA 4JI6B 1X9IA 3DHVA 3BKXA 3DULA 1ZKDA 3GGGA 3CW2A 3CX8A 1QF9A 2HF8A 1T1GA 4EHNA 2GO7A 2DLCX 1KXJA 2PHZA 4HAOA 2PVSA 2ZPUA 4JCOA 5F33A 1EU1A 1ZQ1A 4KVZA 1N3BA 4L5AA 2XUIA 4ZO6A 1M5RA 3I73A 4JT8A 1JDJA 4B3IA 3WGQA 3TBFA 5HMMA 4RESA 4FJ2A 3G02A 4UAGA 5KWSA 4P36A 2GFQA 2MSCB 4B0OA 4J6EA 4WFIA 4C22A 1VQ1A 1E2IA 3ORHA 2RKWA 3PNYA 3AETB 3AL2A 4UNNA 621PA 3DOHA 2PNFA 3K9QO 3NHWA 3F47A 1U0HC 4QDUA 4V1CA 3DM9B 4AFNA 5JVDA 2V4ZA 2O8NA 1ZBQA 4TTSA 3KSMA 3Q1KA 1JWBB 4XYGA 3RUFA 1ZXBA 3ME5A 4GHWA 2WIAA 3QKTA 4DBVO 4EKIA 4LKRA 4BV2A 4F4DA 3DYVA 4ZI2A 2R6FA 3KXIA 4DJEC 2P0AA 4EVRA 2WFZA 2XADA 3DW1X 2CK3D 4OQ4A 1NT2A 1PFQA 1YMUA 2FA9A 3CJTA 4FOTA 4HK4A 4RVSA 2AXEA 3GW8A 3MN1A 4P0PB 3MTAA 3OCCA 3O0DA 2P2CA 1OJLA 3FOFC 3MMPA 4Z0TA 4C7OA 1MD9A 1XIVA 4D74A 1X1EA 3QV2A 3UAZA 4E5MA 3GAMA 3SN6A 2P4EA 2FTKE 2PQMA 5FF9A 3QFTA 4R83A 4XWGA 3G5UA 1KI7A 1OBHA 3KHTA 4DZZA 3KB1A 2WJGA 2WD7A 4LWOA 4EJSA 2W2PA 2HMAA 4FOPA 2HPHA 4YMHA 4UPVA 1Q3KA 2EQBA 7ABPA 3AX6A 3L0DA 2FSGA 1GRVA 2CLDX 2R2AA 3PQCA 4R9UC 1M2JA 4DA6A 1OLUB 3LFUA 5MFPA 3GVCA 5LP6B 3U0VA 5IMBA 3HFRA 4EMSA 4KN9S 4KW7A 2QMOA 2RJNA 1L1RA 4U2CA 1SU4A 1L5VA 4V0LA 3ZD8A 4F4HA 4POAA 4DNFA 1ZR2A 1JR3D 2F9FA 4GOMD 4QYIA 1SHTX 1T3LA 4X54A 4E5SA 1ULHA 4RK6A 2OHFA 2EHJA 2ZJAA 4K5QA 2Y0EA 2OLJA 1DV2A 1NC3A 3G6WA 1QVAA 5TDHA 2BEVB 1DJPA 1S2LA 1Z5PA 3L7NA 4ZV9A 3IQIX 4C6TB 1RC0A 4LE2A 4GVXA 2J45A 3G0OA 1XP5A 4FWIB 1YDFA 2Y67A 3T3MB 1EP2B 2B1RA 4RIFA 5JWRA 3W5VA 2AOWA 1NJ1A 4ZZ1A 3E3OA 3IEUA 5ALTA 3ZEIA 1RQXA 3MMXA 1M66A 1QGYA 3THSA 2B1IA 1UMDB 3QIVA 1KH2A 2FQQA 2NTVA 3SJCA 3RTGA 4DV0B 2DPXA 1PR1A 4UDNA 3MA0A 5AMXA 2OO3A 1DRKA 4I3FA 2RH4A 2PXHA 3DAOA 4JJ8A 5CEFA 4DSAA 4CG2A 3R20A 3PITA 4GXRA 4RY9A 3L0YA 1S1MA 4CHTA 4DEXA 3UJ9A 1PTJA 3DFKA 2QKYA 1RRKA 2BFPA 2O8BB 1UP4A 2JJYA 3AY0A 4P32A 4EQZA 3BEDA 4PGGA 1JU9A 2AB0A 3TR6A 3I1FA 1XCLA 3EEQA 3UICA 3W1EA 3DE7X 4D25A 2IZOA 1GZVA 1HZJA 1KYVA 1P1BA 1Z18A 2Q49A 2ZJ4A 5D86A 2OG1A 4EGQA 4F9TA 4KV9A 1T2AA 3OE4A 2ORED 2QJFA 1R18A 4TKLA 2BCJQ 8OHMA 4K81B 2HMSA 3L9WA 2YUIA 2CMKA 3WIVA 4FFWA 5JMPA 1ISFA 2Q46A 1IWPB 3L01A 2IBSA 3MUOA 7ADHA 1VRVA 2PRZA 4TVBA 2EKZA 1LW6E 2O6HA 4ITUA 5BVGA 2P5YA 4D0GA 4CQNA 3TIIA 4S1VA 3ANLA 4GKVA 1SXJE 3UQYS 2GT1A 3EODA 2JGRA 4J1TC 4YJGB 3GBSA 2GKOA 2JCBA 3O8QB 1DEOA 4HXEB 1XEFA 3D8UA 5FJJA 2XNKA 1C7JA 1K68A 4RHCA 1IXSB 1NLYA 2X4LA 1BS1A 5K03A 4D44A 2OAGA 1XDWA 3EEIA 4XCQA 3LE8A 2RGEA 2X9LA 3HUDA 3JR7A 4HDNA 1FRFS 4HH3C 3DVRX 1RXCA 1GGNA 3F1LA 1BE8A 4A15A 3KJNA 1PGJA 1T25A 4DR4B 1IZ8A 2QGFA 1F2UA 4N82A 1QGDA 1XWFA 3F90A 5AJVB 2OCKA 1MLDA 4ZOLA 1GNLA 2H0AA 3MILA 3Q3VA 3GCGA 5E6RB 2PX3A 4ME6A 3IH5A 4XX0B 3SR4A 3DDSA 4A36A 2QUKA 4UE3S 4LOJA 5C5DA 1O4VA 1UFKA 2R2GA 3AHCA 2H1IA 3AL0C 2HX1A 1XMSA 2F17A 3KE8A 3HKCA 4DZRA 5JCOA 1Y1PA 3M33A 5F7OA 1SAYA 1X3LA 3BMNB 3BL5A 4GZ6A 2F1KA 4BNTA 1T43A 2P11A 1GG8A 2IYWA 1E61A 1O5IA 1EUCA 3CPJB 4HXFB 2OB2A 3VZBA 2A92A 2OM6A 4PQFA 4WEOA 4X41A 5JUWA 4TN1A 1RRFA 3RAEC 3CSDA 4D97A 1L4UA 1RQLA 3PDJA 1GJRA 3TWOA 3ZZNA 2CN1A 2R6GA 4G5HA 3LHIA 4LW8A 5TMDA 1FDOA 2Q2WA 3MWKA 5IDYA 5E9QA 4OLJA 5BR1A 4BOYA 1PG5A 5F1PA 2HI0A 4B0PA 4B6JA 5JNUA 2NUAA 4HX9A 1GRRA 1LBQA 4AY6A 1XN4A 5K4AA 1J99A 1T1EA 1P1JA 4QBTA 1U6KA 4CKCB 3MRXA 2O3SA 4GNRA 4TV9F 3V1MA 2BFWA 1A2QA 2FVYA 2XOEA 2XTZA 2JJMA 4PLWA 4XASA 5IM4F 1MH1A 2RI6A 1XQXA 4K6KA 4MO9A 1E8MA 1TAGA 3IUQA 4WL0A 1NWCA 2PX4A 5IXJA 3B89A 3OM1A 2VG8A 2WIFA 4YAGA 3ETLA 2BHLA 1QTRA 1UK9A 2A9PA 3G17A 1DWQA 3JQRA 4N8SA 1W48A 3FZEA 2OD7A 4EPVA 4KXLA 4EYKA 3JY6A 5CHYA 5ALDA 3AVTA 2O06A 2B4AA 4ES6A 2W2LD 3W77A 1Z62A 4WLUA 5TARA 4CM9D 4DCPA 4NY1A 2C3UA 3H04A 5ICGA 3LVFO 1OH6A 2XA9A 3SHVA 4D5GA 3F2VA 2J0UA 1Y8QA 3K20A 4YCBA 4Z0HO 3U44B 3LU1A 4YQEA 2IZ6A 1NVEA 5JECA 1V4BA 1DAFA 4OGGA 2IWHA 2MSKA 1ZVJA 4XQCA 1Y8RA 3EFHA 3KEGA 1SC9A 1YQ9A 4DR2B 1S89A 3DMTC 4C7KA 1L0BA 2J30A 1XOIA 1SHLA 1JHVA 1ZJ4A 1KYZA 3VVLA 2YN2A 4EY3A 1WSAA 3FWZA 3U61B 1YHYA 3PHBE 4MYDA 4JJGA 3W04A 4XVUA 1W6RA 2W2OA 3R74A 4EH1A 5DVZA 5F2KA 1QK5A 3RVOA 3TJRA 4CL3A 7MHTA 2NG1A 1NXVA 4RQAA 4AQ7A 1K08A 1AZSC 1HLDA 2ZB3A 1UBHS 3L0IB 3PHIA 3Q0EA 3ZCTA 3FDJA 4DQDA 1NNSA 4EO4A 2ZUTA 2DSNA 1CE8B 2WFAA 3GHYA 4FMCB 1CSEE 1V37A 1GRCA 1SA0B 3UN1A 1E79A 3ILVA 4GNKA 1SK8A 3LH5A 3M5PA 1WU7A 3IB3A 4L4XA 4M2LA 4YAUA 2HZBA 3A1UA 4JJFA 4Q4HA 5EJ9A 2WHXA 3C8UA 2R1TB 1G21A 2E4VA 4DAEA 5DHQA 4CMIA 4P53A 1QZZA 4QBKA 3KKEA 1GCIA 4Z2YA 3QVTA 5BRNA 2QRKA 3WYBA 2DQZA 1JAXA 4GGMX 1GWNA 3X2FA 4EY6A 2R8EA 1E7YA 4EY5A 4B84A 3DE0X 4CQJA 5JMOA 1HT0A 1K5DA 1NP7A 1SZCA 3ZIDA 2AKYA 4NVRA 1KEKA 1DLIA 2NNWB 2QGNA 2VEOA 3E1SA 2VFAA 4Q39A 1G66A 4PZDA 4EW3A 1AKWA 2VKQA 5K8LA 2GPTA 3MBIA 2FMTA 4C2UA 4ND7A 3IPCA 1MORA 2AJTA 3ZU3A 5KOHA 1RPJA 1JW9B 2OBMA 2YJ6A 3IX7A 1ONPA 3DBLA 3JXEA 4OM7A 4D42A 2HLNA 2OESA 3L8HA 4XIJA 5KO2A 4FDLA 3MEQA 4H17A 4KJXA 1Z22A 3JPWA 4L0DA 4KDRA 1R8XA 4U9UA 4C4ZA 5IC5A 2VPXA 5I01A 5K0EA 1Q0TA 3OX1A 2BEWB 2GPSA 2GBPA 4MGYR 3ZDBA 1GZ7A 2B3DA 2BPOA 2QN7A 5EUQB 1FFAA 1Z2NX 5AXCA 3KTFA 1BCRB 5C8YF 2QT9A 4IF4A 5FBHA 4KOEC 2OK8A 2AH5A 1U3TA 2H3EA 4MW9A 4R0NA 1V9SA 3NRJA 1XQWA 3GZTB 3O3CA 2RK6A 2C8VA 4LYDA 1QSGA 1V11A 2X5OA 3DF9A 2WBLC 4YC7A 5DX0A 4FB5A 2O5CA 2I4OA 4LAFA 1NQVA 4ZIRA 2B7BA 2G80A 4FW9A 4RMNA 4KMRA 1ZIPA 5FCDA 5T8KC 1DT3A 1GQ2A 3KAJA 3WKAA 4KHPB 1CZRA 4IZHA 3IUJA 3R5HA 1MR3F 1NBAA 3T38A 1BU5A 1VCMA 4BP9A 3OZSA 4XW2A 1U9ZA 3L7LA 3K70C 1U7XA 5C0OE 4R8SA 2ZG6A 2K5UA 1ODKA 1PT5A 2EZTA 2UVQA 3C6ZA 4WFKA 1SVSA 3Q6IA 4RJIA 3LYAA 1J2TA 4QPZA 1W94A 1U0TA 5EPOA 1Y89A 4TXJA 4Z4QA 2CVZA 5HQ3B 4FSHA 4BL5A 2C77A 3KD2A 1DC7A 3IAAA 4XJTA 1W7AA 3QHAA 2CUTA 5BWBA 4E5YA 1P2BA 2QJWA 2Z5FA 8LDHA 3MGAA 5B2ZA 3UWKA 2ZEJA 2YOGA 1TO2E 3ZZUA 1E1RA 3TUJC 4YT8A 3GP3A 3WKBA 1TTPB 5LNK6 1OC4A 3OZCA 1GTG1 1KO1A 1FQJA 1YZFA 4QBHA 1CQJB 3TSAA 2NO9A 2BGUA 2I1WA 3V7YA 1KYWA 4ML3A 3PPVA 4K1XA 4YPFA 4R0MA 4HVTA 4XXHA 3RS4A 3H2YA 2WLTA 4U2DA 3NT5A 4KUEA 1VL0A 3UQZA 3B7WA 4NMXB 4F8JA 1THZA 3O93A 5ICCA 4WXMA 1IXKA 3EOAI 3I62A 4QYTA 4S05A 1TFUA 2J3HA 1CJMA 2PN1A 1G2IA 3DPIA 5DBEX 2A1UA 3UJAA 1WTAA 2GBIA 3NDJA 5BNTA 1IE3A 2ODPA 8AT1A 4CGZA 2XDQA 4F5WA 1LPPA 3AEUA 4INAA 3PIIA 3VGPA 4BGEA 2FNAA 3IAM6 1AK9A 4FN4A 1AIPA 1HDRA 1PHPA 2G5GX 3TG2A 4ZVQA 4H08A 2ZBRA 4DGSA 3O75A 4LI0A 1B8VA 1E2JA 5CH8A 2AZXA 1D2EA 1PNOA 4V1CB 1ULZA 5JVDB 5FTNA 1KYXA 1MZPA 3BERA 3UHOA 1JHRA 1HYBA 3P9PA 4BASA 1J4AA 3AF2A 3K4QA 3TL2A 4EJMA 2IHVA 2JEYA 4I8IA 1T1SA 2ZE8A 4L73A 3F2IA 3RK0A 1SVIA 3AKCA 3UJ3X 3E5RA 2V98A 2WAMA 5D1NA 3VSBA 4ZYUA 3KSZO 3TUZC 2A7XA 5I7AA 3U6KA 3X1WA 1ZXXA 1M74A 3AR2A 1U2ZA 3AEKA 3ZI0A 1TTQB 2OCAA 4MIKA 2B36A 3FCSB 4C7OB 1BFUA 4R7GA 6NULA 5CDSA 5AK5A 2VHQA 2QN8A 1B8PA 3W5HA 1T5BA 4OF4A 2C2OA 5B5SA 1NW5A 5E6UA 5JS7A 4EJSB 4H60A 4X63A 8ATCA 5JXJA 5HP4A 4O1MA 3GFPA 1QO9A 3LT1A 4Z6KA 4H7HA 5J4VA 5AW5A 3A32A 4MUAA 1YQEA 2L17A 3NVKI 4C0QC 2QR2A 3HDHA 5CK5A 4N47A 3UCFA 3PNMA 2J08A 3RT9A 3GRZA 4QYIB 2C1EA 2QSZA 2ARKA 5AM4A 1KZYC 4LXXA 1VIVA 2W0MA 4HF7A 2C3YA 3KSDO 2KS6A 3URMA 1EEXB 1YXMA 3GVHA 2KQUA 4MVJH 3WMWA 2C5EA 3KSAC 3IAFA 4JK3A 1TYZA 5JQGF 4B34A 5A0FA 2RBGA 5DW3A 1KI9A 2XOKA 2WA2A 3EQ6A 5HX7A 3ESQA 1IUPA 1PJZA 2LXNA 3H2HA 4EG8A 4GEGA 4L02A 2PS9A 2XZOA 5ADWA 2NVOA 2OR3A 2PZLA 3JQ8A 4QBFA 5DBOA 3WP0A 1L4LA 4LJYA 1JX6A 3EXAA 3KOYA 2QF7A 3L6CA 1HV8A 2JLZA 1N3IA 2FEAA 2JCYA 4RQUA 3SY8A 2C7OA 1PFVA 2YR0A 1QBGA 4BB5A 2QMEA 3U7HB 2FXIA 2RHLA 4U7HA 3UT5A 4QYMA 1GQYA 2C4VA 3ECAA 4ER7A 4HNGA 3TKLA 3OLXA 1MX9A 3T6KA 3I53A 3AY3A 1EVJA 2NW6A 3KOOA 4MQLA 1E3QA 2VF7A 3B9PA 3EOZA 4JLBA 1XCOA 5L4SA 3AFOA 4BIMA 2V9ZA 4JN6B 3V8BA 2O0JA 2B30A 2AI3A 2VF2A 2WKPA 5CLFA 2JFGA 5AI0A 4U00A 4GUDA 4M0PA 1QHGA 3VQTA 2NVBA 3L6BA 3H8WA 1T9GR 4DPKA 3DOJA 4V24A 4UM7A 5THQA 4CPDA 3AB3A 4EGCB 1ZR4A 5AVTA 2IF2A 5BVGB 1ZD5A 2EX4A 3OX3A 4FQ7A 5MN6A 5BMOA 3OKFA 1NG1A 4G01B 1I6WA 4C78A 2PSHA 5KPJA 3GLGA 3K6KA 2QSJA 4I08A 3MPUA 4IEFB 1EIWA 3WLKX 3PUJA 1WBBA 4Z2AA 3I2YX 2V5VA 5EE3A 3VJKA 3E3LA 4D43A 4IRUB 5EMMA 1I2MA 4W8GA 4OXXA 1COWD 4DDWA 1PWZA 1UJ6A 2MU1A 5CLHA 1ODIA 2OHXA 3NHBA 5HFAA 4ON9A 4HDNB 5IF9A 3T3PB 1I30A 2FLVA 2XE7A 2XTMA 4CYMA 1QXSA 3ONEA 3UC5A 2FW7A 3WTBA 3WLQA 1ADGA 4BE9A 4D79A 4OJKA 3R3SA 1MG0A 1F2UB 1G291 2H1WA 3CBGA 2CL0X 1JR2A 4ZOLB 2C04A 2KI5A 1Q7RA 3W5SA 2C4WA 1FQKA 4YLYA 2QZJA 3QE2A 4JJ4A 4P84A 3PZRA 1YK1A 4K40A 1GQOA 3L1IA 2AOUA 4QX6A 1YZVA 2IRWA 1QIJA 3PRHA 4AICA 1QRTA 3ITEA 1GCAA 3EXEA 4H1VA 2OV4A 2HNKA 4JYBA 4X91A 1ADBA 3LVRE 3HKCB 5BN3A 3KPVA 3RRMA 1DKMA 4UXHA 4AJHA 2D8MA 3U39A 3U4DA 1L5RA 4P1ZA 4IIVA 4PPYA 521PA 4UBJA 5EJ6A 4RZ3A 1EUCB 1UKVY 4G89A 2FQXA 5ESWA 1JYSA 2AG8A 3FFWA 1G5QA 1Z0JA 3X2SA 4XD7D 3VNBA 5HDBB 4MK4A 2XQIA 5C34B 3NX4A 2FQ1A 1T35A 4UPEA 4CI0B 1BXKA 4Z8YA 5FL7D 5A6SA 2I6GA 3VPCA 5KS2A 1KAEA 2CXXA 2VK4A 3T0FA 5DULA 3SZ3A 1VSBA 1ZMTA 4HKTA 4QELA 5BYKA 3DCNA 5JCZA 2PZGA 4EW1A 3QMMA 1XJQA 4NI5A 4YP5A 2VPZA 4J16C 4RKYA 2NUAB 5JE8A 1TC2A 1WQ3A 2VN8A 2XDYA 3F6EX 1QKJA 3C8DA 1H1LA 2B61A 4P5PA 1QYWA 3A9UA 1CRZA 4GYYA 5AK4A 2E82A 1R6DA 4FEYA 3VBEA 2NO6A 1P4SA 4C05A 5KWIA 1JQBA 3RREA 1L6IA 3AR8A 2W6NA 4LJ6A 4QL3A 1G4AE 4B73A 2EX0A 1KI8A 1U80A 3EXG1 3HRKA 3HDTA 4IQ0A 3ITNA 4IQ8A 4O4JA 5CRIA 3SK0A 4FK8A 4D46A 1CZKA 3P96A 4LUCA 1IULA 3RC7A 4D6PA 4MHSA 1VKHA 4RF5A 2R8RA 2OWEA 3T5MA 3L8DA 4KO8A 3HZOA 3TNJA 3NC4A 1KZ9A 1V5WA 3B5IA 5A71A 3RJ5A 3V2HA 1H3NA 1SRRA 3CN7A 3HYNA 4ROTA 3U6BA 1FVFA 1TZKA 2FGKA 2J0UB 1Y8QB 3CLKA 4BVEA 2H2DA 2EXXA 3TOXA 1KJJA 2Z83A 1Y8RB 1ABBA 1HR0B 1IY8A 1LLFA 3NANA 3OPNA 1T5HX 4MZXA 1K7CA 2VDVE 1O6FA 3EIXA 4KG7A 1MJ5A 2VZ0A 4BZXA 1B8UA 3H3FA 4YMGA 4JBXA 2C83A 2H0QA 2WJAA 2F8MA 3PEYA 2VDWA 1XZQA 4KR9A 1CUGA 1Z0UA 1T2FA 2ECQA 2XMCA 3M6AA 2HQRA 5BRJA 4I5FA 3FPAA 5LD2B 1D9XA 1PU2A 1BGWA 4ZVKA 1RZ3A 2XVAA 1R9JA 4NRDA 4A0QA 5JPCA 2ZRCA 3N8NA 4AS3A 4QO8A 5EJGA 2OK7A 2IPXA 3N0TA 4CN8A 3LOPA 4U7GA 4HDAA 1NF9A 3LC1O 4BLVA 1U9IA 1DG1G 3BXGA 3GEHA 3ETCA 4Q4HB 2D7DA 2M6RA 2A9KA 1EESA 2I4RA 2QS9A 4RWZA 4CMIB 4D9FA 3OD1A 4Q3DA 5IZ4A 3IOMA 3FNFA 3GRYA 3VDNB 2FWJA 1T3SA 1OT3A 3QPDA 5ARBA 3HU3A 3P32A 1Z8HA 3DZ8A 5IFLA 4WBXC 1UANA 2C96A 2YCLA 4EAQA 5G4KA 2GPYA 3BKWA 5BQXA 1DX6A 1XA0A 4P4SA 4YAJA 5TS2A 3ZLBA 4QJ3A 3GJ8A 3MBKA 4JIGA 4P4GA 5DXFA 4LF6B 3AVWA 1Q91A 3SU8A 1IUKA 5IKOA 1NOIA 1SWVA 1UBCA 4MVJG 4RX1A 2K7ZA 3V80A 4P3XA 3PNKA 4M86A 5KOHB 2NSYA 1EUZA 3IJPA 3AZOA 3FJYA 4QHTA 3DBLB 4TSKA 5CCXA 3ZUPA 3UZUA 4BNNA 3OTGA 4Q00A 5D5QA 1P2SA 5L7YA 4B47A 5HCUA 5K8VA 3FFXA 1RI2A 1E64A 1M72A 4NBWA 2C5GA 2IEZA 4MA5A 1NXQA 2QQGA 4V0QA 1E9FA 4ND3A 4BQPA 3N86A 3IRUA 2IDJA 3GA5A 1KGSA 2NU6A 2EJVA 4IMRA 4OJYA 5TQVA 3C3PA 3NUQA 3OLWA 4TKVA 5GOTA 3PXCX 5A5FA 4WTOA 3RANA 1RLTA 5HCIA 3RAJA 1USKA 3EVDA 5K4GA 2EG9A 1V11B 2ZIXA 3ETDA 4RZ2A 3TMKA 2FJUA 1QZTA 5G0VA 3SMVA 1J2UA 1ODFA 1T3HA 3DXFA 4EI7A 4ZIRB 5LYYA 1B6RA 4MR7A 5TVKA 1MFPA 1TF5A 1B4DA 1YIAA 4TTRA 1FMJA 2ZSJA 1P31A 5CIQA 4FGZA 2BDTA 1YE5A 3R0ZA 5FFMA 3NH6A 3O5AA 2WTUA 2EFGA 1DKOA 2YY6A 4FYVA 2EATA 2LPMA 1QDUA 2JGKA 3GVPA 1SCDA 2QTGA 3NR2A 3Q7SA 4O33A 5FTWA 2J3KA 4BYGA 4YT4A 1UDWA 2FEPA 1B6GA 1OZHA 2RSLA 3FMGA 1MC4A 4C7VA 1QYVA 1AGNA 3P2IA 3U3ZA 1I6MA 2QNBA 2P6NA 4UD6A 2XLCA 3MYYA 3WGIA 5F5XA 4JBNA 3QVUA 1LW7A 1D4FA 1AN0A 1JG6A 3ONVA 3SJAA 1SQ5A 2WICA 4FZ5A 2VJQA 5HOEA 4E5KA 1DKNA 2GZRA 4TV9A 2OE2A 4WADA 3TLEA 4BNYA 5IM4A 1NRIA 4KXQA 4IQ4A 3V46A 2KM1A 4G9EA 4Q47A 1G41A 4CKXA 2IX9A 4F0JA 3BXEA 4JGBA 3F6RA 3DV9A 2H17A 2YOHA 1NX9A 4X45A 4EHDA 2YQZA 1LQUA 1Z5ZA 4TMWA 1QO7A 2PWBA 5KHOC 1UZAA 2ZXFA 2PUHA 2ZYVX 3BHMA 4YREA 2XHZA 4X85A 1JHXA 3STWA 1RBQA 3AU8A 1M0TA 4IYRA 4EHFA 3ZWXA 2WJPA 3RWBA 4REMA 2WPDD 1BKDR 3N05A 5I9IA 2JIZA 1U9CA 1B0UA 1UUFA 2UVDA 1Y48E 2A1UB 2CLKB 3O8BA 3VPSA 1Y6QA 3IP1A 4WFJA 4S0ZA 2AX3A 4PAMA 5I48A 4I81A 1M76A 3U60B 2XDQB 4DXDA 1OXMA 5FLEX 4ABYA 4Z54A 1JEYA 1XNQB 3KKPA 1OTYA 2X13A 3IEKA 3UMFA 3WDKA 4L27A 4RD4A 2PE5A 5JAMA 2HJRA 2ISCA 4HAVA 2II6A 4MW6A 5GAJA 1KJ9A 1J24A 1SUWA 4RJJA 1FDWA 4WA7A 1PR2A 3PT9A 1R6VA 3A2NA 1G5PA 3U3MA 3HYSA 4F4IA 3MMSA 3S3TA 1HEIA 3JQ9C 4HMOA 1L8QA 5SY6A 1EVQA 4NOLA 1CLEA 3P0HA 3DSRA 2JA2A 4NHOA 2G1KA 3QE0A 5EGNA 2AJDA 5B4UA 1J9GA 1G2OA 1C7FA 3VYWA 4RU1A 2AUMA 2FMFA 4CMBA 1AUOA 4I1IA 1X8LA 1G55A 3FIUA 3GMIA 4XOIA 2O0KA 3JWEA 2ZSBA 3ASVA 5FA5A 1TJNA 1U4SA 3UAYA 2CE2X 2GN1A 2XNDD 4M9UA 4RHUA 1I7PA 1I7DA 1I13A 1I1OA 4R1MA 5ITWA 1JLRA 5AVSA 1TAHA 1N36B 3Q3HA 5E6UB 1NNI1 1XRJA 3WGJA 4A91A 2Z08A 3LY9A 3ZS8A 1MAAA 4Y2QA 1E2DA 2QE7A 1OFVA 2ICAA 5FAKA 4YRJA 1MW8X 1Q77A 1KP3A 4GW3A 3P97A 2PGLA 3KHSA 1FDIA 4YCLA 1DWPA 1KI6A 1H0RA 4WPGA 1E32A 2H1HA 4FW8A 4CIBA 4DUYB 1UBLS 1ZU4A 3GR6A 1PUIA 1ZGGA 2DWUA 2UZ1B 1R0RE 1D5WA 1V45E 3K1ZA 4FZJA 5AI5A 1VIYA 1LRLA 4NHEA 3RS5A 3GWZA 5TMPA 1WQ1R 3MMNA 1E1DA 4GR5A 4I19A 1ZESA 1U7PA 4FFRA 4KNYA 2QIOA 4KVAA 1JDTA 3AR4A 1VTKA 1KS9A 5SZKB 3TRIA 3U31A 5LQMA 2PZ8A 4LDRA 4ZCPA 3COVA 1NNLA 2VDKB 5ALWA 1E8DA 2XD4A 1UBGA 1U2RA 3SHOA 4BJ5A 4ZK2A 4PHFA 4RMIA 1NVGA 2BI8A 2FLKA 3GARA 2UYGA 3ENVA 2YZMA 3L7IA 3NBAA 1P61B 3RKRA 1LVUA 2W2MA 1J20A 3EPKA 3HVHA 5C8YA 4KRXA 2R8OA 1EGHA 1FUUA 3KD3A 3JQ8B 1DFIA 2GRUA 2WWRA 1P60A 4E6EA 4JDPA 3KCNA 5EE5B 4ETIA 2YL2A 1OHHD 5BSRA 1R37A 2NXJA 3ABOB 3MJVA 1LZKA 2VDPB 1T4GA 1UL1X 2DAPA 3LLCA 3EZLA 3ND9A 3R3JA 4N3NA 4UUAA 5DHUA 1EZ4A 1YCHA 1R27A 4D1YA 2JW5A 1Q0QA 1Y82A 3LX6A 1V5IA 2G9UA 4FT2A 4JEUA 2IV2X 4BZZA 1S3SA 2ZUWA 4NXMB 3WBBA 5KYNA 3O31A 4WUVA 5F9MA 3VSCA 4IS2A 1GAWA 2CC2A 4N5LA 4II2A 1DOHA 3B53X 2V74B 2DBQA 5JRJA 2D5AA 1CETA 1HKHA 1YDGA 1X7ZA 2HDNB 2R5WA 3RHTA 3H2IA 1RDFA 1ZZEA 2VJMA 1MMFB 2R4QA 2AN4A 1C3OA 3PUIA 4S2EA 4ED9A 5FUMA 4MDFA 1O0BA 4D98A 1W4CA 2APJA 4BAGA 2CK3A 2I1VB 1ID8A 4YN3A 4RJKA 3KM0A 4ZOEA 1VLHA 2WTNA 2FZWA 2VBIA 4WWHA 4ZQIA 4N6NA 1F8YA 5J4YA 5HTKA 2P68A 4RY2A 4EX7A 4DC9A 1NFQA 2CBZA 3NWJA 4H6VA 1T34A 1PKEA 1SU7A 3NKVA 3VU3A 5CB4F 4MWOA 1X39A 3WLFA 5JI2E 4FYHA 4QXPA 5LFAA 3PNVA 1ANKA 2Z4TA 1IBSA 1PVDA 4QWWA 1ADCA 1M8JA 2H1FA 4TZKA 1P17A 1CERA 2PWAA 4OB8A 3U09A 4GXTA 3AONB 1KQNA 3TPZA 4RGVA 2Y0BA 2ZRJA 2YFYA 1G5RA 5KJ6A 1QM5A 4C0WA 3EUWA 2AG0A 1UBJS 1P4RA 1JJ7A 5F1OA 4WLNA 1C29B 3IOBA 2C07A 5FHRA 4MIYA 3PC8C 3QIAA 5JPDA 2J9RA 1OWLA 2HNAA 3CUWA 3H9QA 4RKEA 1JR3A 5JIBA 4EBBA 2HW8A 1FB5A 2G83A 2WSLA 3DAHA 4YXWA 2XNHA 2MTBA 5KTYA 5JXWA 1EWRA 2HCJB 2L19A 1G5FA 2WHEA 4AF7A 3GELA 1UMBA 3G2HA 4OHBA 1PUJA 1W4LA 5DEIA 2IUUA 2AOUB 2C9DA 2N46A 4N0DA 4BO0A 3DQQA 1Z0IA 3M2TA 3MAGA 3O03A 2QL9A 3EXEB 3QVMA 4JBGA 5AKZA 3ZU4A 3AI2A 3ORFA 5BN3B 1SULA 1XTIA 3MS4A 4KH1A 1Y3HA 1QJ4A 1YASA 2V7QA 3KUXA 4O29A 4ZK6A 3R3UA 3LQFA 4MYUA 3CRVA 1UQUA 4L8VA 5HIJA 2YVQA 5TV2A 1V6SA 2P5SA 4Z49A 1ONSA 1HT3A 4X3OA 1KO8A 2CLHB 3OTIA 4GX0A 1NI4A 4DLXA 4PC6A 3OJXA 4OK5A 3DB1A 1Z2PX 1KOFA 1RWKA 5CUQA 2HHHB 1VIMA 1AHPA 2I67A 3TSYA 4K9KA 3HUEA 4ZZ0A 5A6SB 2QV7A 2GAIA 3E8XA 3L4JA 4IJVA 3U3JA 2QQ5A 2HYIC 1YR2A 4I9HA 1ZM9A 3OFVA 5EKDA 2VXBA 5ENZA 2WJHA 3O2QB 1G60A 1UXKA 1WS6A 1SHZA 3QKRA 3LHDA 2HUPA 1E1NA 2FFRA 5MGNA 3EDQA 4HWPA 1HE4A 3DM5A 1LDEA 4P3PA 1IK6A 3NB0A 1H1LB 4JBIA 1FXSA 1V1JA 2P9TA 1NW3A 3N2KA 1GGMA 1WXQA 4W4TA 1P0PA 3NYRA 1IBLB 2ZVQX 1NM5C 5LDDC 4K2AA 5JG7A 4O4JB 4DPLA 3QPWA 3A1DA 3ZWNA 2YWJA 4D3ZA 1WXGA 3QGMA 5EYPA 4L50A 3RBXA 4GI3A 4BVFA 1CF9A 2BR4A 4LHXA 2YIDA 1IPHA 1LS1A 3QPCA 3HM2A 4Q9DA 2AXNA 5F21A 2OFFA 5JQGA 2GTPA 2Y6UA 1VM6A 4ZT4A 1IY0A 3BQMB 3CF4G 1EA5A 4B6GA 2H6EA 1OY1A 4BX8A 2OKGA 4H0FA 5CJJA 3IPAA 4KSCA 1W35A 3HV2A 4UVGA 4XB2A 1I9CA 1UBEA 2Q8QA 2OYCA 4YFYA 1MO2A 1P1RA 2BKXA 5IJ9A 4DSTA 4NZNA 3LC2O 4ZXFA 1AS2A 1PP4A 1SZJG 3WWEA 3IE1A 5JH7F 4HFNA 2ZSFA 2GARA 5E8RA 1NZFA 4GMKA 4J43A 2VDWB 1SKYB 5JS6A 1JVBA 3P9SA 2AC7A 2HMUA 3C7KA 4Z4CA 1SIUA 1YB5A 2ODEA 4UNQA 3UVEA 1XVVA 2W5UA 5HBRA 1C0KA 2OHGA 3QJGA 1J07A 4QJ4A 3FAKA 3S40A 2EW2A 3TTSA 1E1QD 4UBMA 4Q1FA 3QUSA 4FC7A 3UV6A 1TJ5A 1VJ1A 2OFWA 3IIIA 5CH5A 4MINA 5P21A 4FYPA 2OCDA 2GJ4A 4LDNA 1D6MA 4NEGA 4CTNA 5EEGA 1E66A 1HRDA 2IHBA 4H3HB 3SKVA 2A9VA 1JT2A 3CH6A 3K4HA 1YOBA 3HVJA 1NKVA 4MSUA 2CBXA 5KDLA 4W9MC 2JHFA 3GRCA 3WHLA 4BKRA 1VCIA 2RI1A 2JKVA 2YYAA 2FP4A 2ID9A 4MB6A 4MPDA 4R2JA 5G4KB 3G8CA 2BGWA 4IGIA 4P4SB 1R12A 2JRLA 5IHXA 4WHMA 10MHA 2EF0A 5CVVA 4LMAA 3I01M 1PZMA 2PA0A 1CNMA 3V1LA 1UZMA 4WNAA 4NZ9A 4LYJA 5ARDA 1QHIA 5NLLA 4C4AA 3FPKA 2IZ7A 4DM3A 5IEJA 1QP0A 3T1OA 1KEEA 1QHHA 4KOAA 1GKUB 2R68A 1KI3A 4MUHA 1L7XA 1Q5PA 1WD7A 3V3TA 4NBSA 4RL6A 3P2KA 4BX9A 4NCKA 2QZ9A 1A97A 2EKBA 1SBZA 3FUWA 2VP9A 5TS3A 1RMQA 4RYDA 3TLGA 2WNHA 1R6AA 5JD3A 4OMUA 4HI0E 2E89A 1UK6A 3GEMA 3LCJA 3BRQA 2C8LA 4XR9A 3KJZA 1M6EX 4JUAA 1JZQA 2QAGA 4PCVA 1Z2EA 1H4SA 4N7MA 4MUBA 2W2LA 1OZFA 2NU6B 1ZMRA 4TKVB 4ZEVA 2VBCA 2ZSAA 3OT5A 4H7DA 2OOSA 2IYFA 5KEIA 2WFMA 3EVNA 1KU0A 3MM4A 3CPSA 3PHJA 2YHAA 4C1NA 2VPYA 2ZIXB 3NDBB 2H7VA 4GG1A 3NBFA 4HLNA 3FNIA 3AKYA 4QLBA 3F7MA 2PSDA 4GOXA 2ADOA 5AHWA 1ZH8A 2H65A 3NH9A 1V5GA 4HFJA 4CKEA 4EW2A 3LV8A 3OIGA 3D5QA 4P7FA 4I6EA 4D3YA 2AC4A 2X3FA 1VFNA 1PX0A 1IBCA 4EVSA 1NTOA 2I22A 1O95C 2VO1A 5FUYA 3D3QA 3EWSA 2IUSA 3FUXA 4OYRA 3WBJA 2FR0A 1FLNA 4OIMA 5EVCA 1GG5A 4DB4A 1CIPA 1PZNA 2X8BA 2GHRA 3LHKA 1RZRA 1H3EA 2WWGA 3CX3A 1EGAA 1K7SN 1D2GA 4JNCA 4B2PA 1BFKA 1O97D 1VJTA 2O2EA 1T9DA 1FJHA 3CH4B 3H5LA 5DTIA 1EXVA 4C4PA 1OF1A 4GF5A 4H7JA 2WUGA 2ODBA 3O47A 4WEQA 4ZGWA 3ROTA 4TV9B 3UXYA 1S5PA 4CCSA 3C39A 2ECPA 3T9AA 5DIZA 1ZUHA 1XA3A 3AJEA 5DXAA 1HRKA 2G4LA 3L4BC 1R7RA 1ZU5A 4LDQA 5GZ3A 1GDHA 4K9RA 4FQ5A 1E5LA 1MX3A 2JLBA 1GGJA 1L1QA 3I8OA 2GZSA 4B8YA 2G3YA 5DP2A 1H1TA 3F78A 1BVYF 4WLOA 3QSYA 2Y0PA 4ZCMA 2YDYA 5ESDA 1LFDB 4TN5A 3FGNA 4I1YA 3U4AA 2ISSD 3IUPA 4Q3KA 2JFXA 1LDNA 4PTZA 5F3DA 3EQ8A 3STYA 4A0GA 4EFKA 3AOGA 4PN3A 1YIOA 2PGDA 5BV1A 3VR3A 1QR2A 3QVWA 3LDGA 1JEYB 2RGDA 3D8TA 4PQGA 1H8HD 1BMDA 5KTMA 1DDGA 4QUEA 5K0LA 3JZIA 4JYCA 3BAZA 4E08A 3A3OA 1HE3A 4PYQA 5AK3A 3VVCA 2PUGA 2PUVA 4MW0A 1PQWA 4TQ9A 2NLOA 2E37A 2VBFA 1FNDA 2A1TR 3PGXA 2JHCA 4AMYA 5LQUA 4HQOA 4IVPA 3FUCA 3UT0A 4CU2A 1PDVA 2GBLA 5F64A 1FRZA 3E9QA 2XYVA 2GF0A 3JRNA 2ZYAA 1V71A 3LZCA 3S0JA 1KTVA 1NWHA 4KMMA 5IBRA 3EWNA 5AUPB 2XYGA 3N28A 3E1GA 2CFCA 2Q6TA 1L5OA 2WYVA 3WGZA 1DBRA 3H6GA 4IHJB 3M6UA 1TYEB 1C41A 2EP8A 4B81A 1DCTA 1WMSA 1L4NA 1NXXA 1IHUA 3HZRA 2ZYUX 3D6MA 3SQNA 2YJTD 1NGSA 3T15A 2A0XA 3LT2A 2AYZA 2PMWB 2O8EB 1WSDA 3FUVA 3FZYA 4MV1A 2F1IA 1K8ZB 5EPUA 3TMAA 2FMHA 1Y5NA 5F2OA 1W47A 3ZI4A 4EJ0A 1N0UA 4URVR 3F73A 3TQCA 2PUFA 1XPOA 4D9NA 4PG5A 3B1VA 4TKMA 3RYFA 4B85A 3QF7A 2H5IA 1NW4A 2O07A 4HMQA 2FFJA 1XWWA 1P1CA 1XVIA 1KI6B 1SBNE 4TQGA 4BNMA 4JYAB 5TY0A 4PAQA 2BDEA 3NOQA 3ZWYA 1T8RA 3CUKA 3NTUA 3ABSB 5F4BA 2EEZA 2EWWA 2D2EA 2I7XA 2VWQA 4UE2A 5K3BA 1CJCA 2R00C 2XUJA 4M0KA 1N0WA 1PV1A 1ZEJA 4XB1A 5ETJA 5A4AA 2O8CA 2YWFA 3UIEA 2OD9A 4KR0A 3T35A 4RTNA 1DBPA 1T5DX 1AV6A 2OD2A 3H9CA 3LP5A 4JJ6A 1P2UA 4FXPA 4FDAA 1S2MA 3G0GA 2B8NA 2ATXA 4PXAA 5C8YB 4DCUA 1WX1A 1TK2A 4X65B 1WB6A 3ETGA 4MYRA 2QLLA 2ZAMA 3T7AA 5L6LB 2PY6A 2XDAA 4JVNA 3LOQA 1K06A 3Q2KA 4UATA 1LPNA 1E7QA 2GAAA 3W2IA 1OWNA 5KAPA 2OXTA 5I7VA 1Q1EA 3D7KA 3K94A 4RTJA 1BZYA 2YJ5A 3PX7A 4JB3A 4L78A 3ZXIA 1VPVA 1GL3A 3CUEF 2IY9A 1OIWA 2EX1A 2Z3ZA 2PQ0A 3E2PA 4PS0A 2PUTA 4BO3A 3LXRA 3QW2A 1VHTA 4KFSA 2DH6A 3RWMB 2ORVA 1P7VA 1XNGA 4ZAYA 1OFTA 4AJ4A 1NY5A 1XLWA 4WKGA 3MHTA 4CV3A 2W8ZA 1GEEA 3SBDA 2RGGA 1THMA 2GR9A 2J9YB 1X7ZB 3HEAA 4OYLA 4TT3A 4N5MA 4QXAA 2VJMB 3DH0A 3WK9A 2AR9A 1C3OB 1WUYA 4H4EA 4EHHA 5BXQC 1A7UA 4HGQA 2HJGA 2GHIA 4UBNA 5JCXA 4LGYA 2XUHA 5B1EA 4N3BA 4LF4B 2V4UA 4X1KA 1ZHFA 1FUIA 3UOWA 3W5AA 1MG5A 1N7GA 1EMDA 3DOUA 1ONOA 3SZRA 3ZE2B 4TLEA 1X38A 2IK8A 2MWMA 1KZ4A 4Z3OA 1XA4A 1UM8A 4ZVSA 1T2EA 2AK3A 3JAKA 3QRWA 2DOKA 1G5TA 5BQ5A 5HKOA 3SS7X 1NJ5A 3DL0A 1HEUA 4KPUA 1KHTA 3WE7A 4BQNA 3ID6C 3OHPA 2VRNA 4INOA 1GYRA 1L7OA 1AQNA 2IZ5A 4EKEA 2GEFA 1ZUD1 4PPGA 1GTVA 3CIOA 2RBEA 5D7BA 2OBFA 4ESEA 1HXHA 1N2CE 3I9OA 1IQPA 2I2WA 4QDTA 3UAWA 1SCQA 3ZGVA 2A9RA 1V9LA 3OCZA 3DEIA 3AT1A 3LHSA 4J1SA 5ALRA 3TZQA 1QOZA 1I2DA 2ZS8A 4R7TA 2BM1A 1QGZA 1QGOA 3IDFA 1DC5A 1UBNA 5BSVA 1A2BA 4L6CA 4RDXA 3SDBA 1W2WB 4F4JA 1UMBB 3QVSA 5AM1A 3M70A 3PI6A 3RS3A 3MWFA 1A2OA 4UPDA 3UB2A 2PMDA 5AKEA 2NQTA 1OI4A 3K0CA 3ZBQA 2BC9A 4TZTA 2C2BA 1CQIA 3OPYI 4HAZA 3WIUA 3INYA 5DGCA 4YPOA 1FDVA 2G0AA 3ANNA 3OFNA 1XZPA 3CINA 4M0DA 4QFMA 4KPFC 3T4XA 4FZRA 4BO8A 1BU8A 1PEDA 5DLPA 4NOMA 2OV6A 3KZKA 5FBLB 4UQOA 2HFJA 1IDOA 4AN0A 1YZTA 4CL2A 3EPLA 1UP6A 1N2SA 4BFWA 4DM4A 1E2QA 2EAUA 2XUQA 1J23A 4TSRA 1V8BA 2HLHA 2ZIAA 3GNQA 3ZCPA 4EB8A 2O20A 4LMBA 1NI4B 2AOXA 2EW8A 1RYMA 4O4HF 4LOHA 4ESHA 1M54A 2W90A 3N76A 1II0A 5ALOA 1NXPA 1B0ZA 2DLNA 2F1RA 5TX7A 3FAZA 2QROA 2ZTVA 4MHOA 3TIXB 5JAPA 1T8SA 2C7QA 3FNHA 4PLFA 2BHNA 4RLFA 1IRXA 4US0R 3O3OB 5CYFA 1GPJA 1C2YA 4DNOA 4ZALA 3QKRB 2IPOA 3GFSA 4JJEA 5DBHX 5LN1A 4NMWA 4LE0A 3K9CA 3E8MA 4D3FA 1RW4A 4G0VA 3PFGA 3N2KB 1RNLA 2ETVA 1EDDA 3EDOA 4RH0A 1WXWA 4YAKA 4OYHA 3EVAA 2D59A 4MUXA 2PZAA 4MR8A 4RK0A 1W9HA 3NDPA 4AZVA 3COSA 2HJSA 4MKRA 5AHXA 3VZCA 3WQRA 5I4CA 2VTEA 4U3JA 2RD2A 3NHKA 3H16A 5LWQA 1QPBA 2Z58A 2JI8A 2Z9DA 1FYFA 3IKMB 2UUCB 3T0GA 1UWCA 2YW2A 5JQGB 1VJRA 1UDXA 1FMLA 5REQA 5AI9A 3DHWC 3BXPA 3K0FA 3BORA 3G9TA 3NU1A 4ZCLA 1P3Y1 2ZJFA 4XFKA 1C0IA 1Z6ZA 2AVNA 2V3VA 4RKWA 3WJ7A 1CDDA 1EA7A 5IVPA 4ZYZA 1P1FA 2VAPA 3ZHXA 5IJ9B 9MHTA 2ONCA 1E0KA 1CF4A 1ORTA 2HN9A 4CR6A 1ECGA 1CR4A 1ODJA 3L8MA 2VJAA 1PQ4A 1J7KA 1TA9A 3X0DA 5EIBC 4FWTA 2WHRA 3VNAA 1W8DA 1VE3A 1YMVA 4NMMA 3WZ2A 4C3OB 4CLEA 1MQ8B 3RTAA 4GZ5A 3ILYA 1L1FA 1I32A 1A88A 1BMFD 5CIWA 1L1EA 1X1SA 2CFTA 4QNMA 2PD6A 2BIFA 2IEYA 1CUIA 2JAXA 5CT8A 5LB4A 4CDRA 4NWIA 1FDSA 1UZLA 2FV8A 5DKFA 1JSXA 2G71A 1ULAA 3E9ZA 1NV8A 2WTEA 4UMVA 1YRAA 4Z8XA 1V8DA 1XZIA 3ICEA 3UGJA 5KOYA 5L6MB 1T3GA 4LZLA 3IQXA 4DA4A 2R5FA 4K88A 4RF2A 1WXFA 4B4KA 5FWDA 4BNDB 3KT8A 3HM9A 1QP7A 1ZVVA 1BS9A 3ZLTA 3QEKA 3EGOA 3QBDA 3KQOA 4JIMA 4AJ2A 4F2HA 4XYBA 1Z3IX 4TXNA 4UAJA 3DO8A 2O1XA 3KNZA 1AB6A 3BMCA 2PL5A 3VFDA 2XGMA 3HVUA 1U7WA 4V0ME 3D1VA 4LBYA 4XIFA 4CU5A 4RJTA 3GLFE 2I29A 1CZUA 1E9EA 3KOXA 4WESA 1GNPA 5LLSA 3W5UA 1LY1A 4DGQA 4DR1B 3SLKA 4PG6A 1YE8A 3PA8A 5AQEA 1KEEB 3KB6A 3WSVA 4BGUA 4ZMBA 4PS1A 4BFVA 4YV7A 5ALLA 3HV0A 2VKTA 3GT0A 4H6XA 2YZ7A 3UA3A 3TLGB 1K3UB 2Q6VA 3HCEA 1E3MA 3FD8A 1T6NA 3DXZA 4FSDA 4PCAA 4N40A 2D5BA 4GWLA 1Y0BA 2EKLA 3W3AD 1KXZA 1C14A 4UCFA 1MC1A 1LUAA 1SMKA 1NX6A 1FFBA 1Y1LA 3EWIA 3FSJX 4GP6A 3T34A 3WZLA 5GPBA 4RY0A 4W5TA 2WTBA 2WP8J 1B42A 5DTQA 3E7DA 1N2HA 5LR6A 1Y5LA 3ICCA 4RDCA 3AHDA 4IIUA 4ZDIA 4NOJA 1E60A 2PKEA 5A3RA 2R6AA 1S3IA 1O6CA 4D8XA 1HL3A 3UK7A 3LDFA 3L41A 5HBGA 2X14A 3ZX5A 1JIJA 4CKEB 3I0MA 2D5CA 3DUFA 5HF6A 2E5LB 3BB3A 4TYMA 3AUFA 2XCSB 1Q3HA 3FHOA 2NVWA 3DF7A 3P9KA 4RZSA 2BJWA 3MCUA 1DAGA 4UNIA 3L5OA 4LVCA 1CS4C 3A4MA 3QOYA 1BSVA 2XE6A 2FFQA 4JI1B 5A3SA 3ZS9A 4D7AA 3P9QA 1IXRC 2JHAA 1TA4A 2AEJA 3KQTA 2YICA 2DR2A 1EKXA 2YHSA 3H5OA 1KK1A 2QGZA 3P7MA 3SXUA 4EKGA 5AVJA 1YQTA 4YYEA 5KWVA 1JALA 4KPEC 3WWZA 3Q3GE 4QGAA 4OX9Y 4Q7KA 2IYRA 5KI6A 1LTKA 2G88A 1XZKA 3EMVA 4E11A 4IKEA 3NC0C 2AKAB 5DV9A 5DEOA 5IC6A 5E3HA 5KTSA 3UBTA 2QD1A 3AV3A 3NBKA 4BLWA 2RHMA 5BSFA 2RGYA 3RYIA 2NSLA 1ORRA 2I6UA 4N1AA 3GMTA 4FCVA 2PLNA 5K0CA 1WJGA 1WMFA 5TE9A 3CF0A 1KC3A 2E85A 2GN2A 3LZDA 4NC9A 3ROFA 3TSZA 3CZRA 3GXBA 4HB0A 1NJ8A 4JWKA 1E77A 1TLTA 1ZD1A 3DLIA 3WMEA 2BSXA 5CPBA 5ALFA 2GD0A 4YACA 2ORWA 4L2IA 5DO9A 5G3ZA 2VQSA 3IT2A 3VKGA 2G5TA 4HUQA 1MFZA 5HW0A 3H86A 4QU0A 1KO4A 1O1YA 3LX5A 1TQ8A 3WXBA 1UMCA 5I9MA 5B30A 3WGVA 4DA8A 4LDZA 2VA9A 5JDIC 1HUQA 3C7AA 4MLDA 4C3ZA 5HIKA 4GRAA 2HRCA 2GQ0A