3SXJA

Crystal structure of complex of bt_2972 and adomet, a methyltransferase from bacteroides thetaiotaomicron
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
245
structure length
245
Chain Sequence
b'FSFICNYFKLLKRQGPGSPEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKANCADRVKGITGSMDNLPFQNEELDLIWSEGAIYNIGFERGMNEWSKYLKKGGFIAVSEASWFTSERPAEIEDFWMDAYPEISVIPTCIDKMERAGYTPTAHFILPENCWTEHYFAPQDEVRETFMKEHAGNKTAMDFMKGQQYERSLYSKYKDYYGYVFYIGQKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of complex of BT_2972 and AdoMet, a methyltransferase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 85
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3sxjA00
2G8NA 4E32A 3EEOA 4XCXA 5DX1A 3GCZA 3HVJA 1SVUA 3C6KA 4RX1A 3TLJA 4F86A 2C7OA 3TQSA 3MQ2A 3C3PA 4AUKA 3UFBA 3P9CA 3G89A 3OCJA 2ONZA 2OB2A 5E9JA 2GLUA 5T64A 1NV9A 1EQAA 2UYCA 5E1OA 5E2AA 1QANA 2BM9A 3OZSA 3MTEA 5P8WA 3EVFA 5LR6A 1RI4A 1G8AA 1NT2A 4OA5A 3UJ8A 4RVFA 3PTAA 4F85A 3UA4A 5DPMA 2Q41A 3ELUA 5T6BA 2YVLA 4YV1A 3DXXA 5ICCA 3BT7A 2VDUE 4GC5A 4CKBA 2ERCA 2EFJA 2B25A 3F4KA 3C0KA 3K0BA 1O9HA 5GWXA 5BXYA 4M36A 2HWKA 4PYKA 3CJQA 4RTKA 4F84A 3R3HA 1L3IA 2E5WA 4H0NA 3BXOA 5HZMA 4RTJA 3ER8A 2H00A 2IBSA 3QOWA 1OR8A 1RI1A 4QDJA 3MCTA 3UJCA 3B3FA 5FTWA 1TW3A 1AV6A 1G6Q1 1WXWA 2FHPA 2NNWB 1VE3A 3P9IA 2C7PA 3CC8A 4GOMD 2P8JA 3AWIA 4IV8A 4QVKA 3FYCA 2G1PA 5FA8A 1BOOA 2Y1XA 3C3YA 3KR9A 3MB5A 5FHRA 2PT6A 4OBXA 3KQWA 2IH2A 2IP2A 3TM4A 1JR4A 1QYRA 1XCJA 2PX8A 3DP7A 1RI2A 5GIPE 2PY6A 2UYQA 2H1RA 3BUSA 1DL5A 3R24A 4E2ZA 2ZBPA 2OBFA 3KU1A 4OBWA 4ER0A 2QRVA 4PWYA 2OXTA 5FWAA 1WG8A 4HH4A 2YQZA 3LKDA 2YR0A 5EC8A 1VQ1A 2O07A 3R9XB 4GOLD 2PWPA 5DRTA 1X19A 3G88A 1VIDA 3KR0A 4PYQA 4U7PB 5FWDA 2AOUA 5DM4A 4RTNA 4PONA 2P35A 3DR5A 3EVDA 3FYDA 3OU2A 4AZVA 3NDIA 4R6XA 2PX5A 3LX6A 4C04A 2PSSA 2YXLA 5EKUA 4C03A 1KIAA 5DTQA 2P41A 3KQQA 4YV0A 3GRUA 3R6TA 2IDJA 3DXZA 4KW7A 2ZVJA 4BY9E 2DPMA 2PKWA 2ZBRA 3AXTA 4IV0A 1INLA 3OFKA 4KWCA 4R6WA 2ZFUA 5KVAA 5EEGA 1BKYA 3KR1A 4MIKA 3P71T 2GAFA 4C08A 5BW4A 2QRVB 3FUXA 3LBYA 1JQDA 1PRYA 2AOXA 2B2CA 2QE6A 3NWEA 4HGZA 5DWQA 2ONYA 3SX0A 3HCDA 3A25A 4QTUB 3UJAA 2P1DA 2OZVA 3BGDA 1NW6A 5DM0A 1MJFA 2B3TA 5IKMA 4HG2A 1YZ3A 5DSTA 1ORIA 4PYIA 3B3JA 2ZBQA 2AR0A 4PYNA 4P58A 4PIPA 4AZWA 2ZIFA 5ICGA 1KPHA 1SKMA 2ZZMA 4P7JA 1EJ6A 4ISCA 3DMFA 1WXXA 3SSMA 3LDGA 3TKAA 4GEKA 4YUVA 3OZRA 3TFWA 4CKCA 3HEMA 3P2EA 3LPMA 5EMKA 1ZGAA 1AQJA 4M37A 1EG2A 2V7EA 3CBGA 4YUYA 3FRIA 1MHTA 1D2GA 3HA5A 3NTVA 3G7UA 1NW7A 2GB4A 5E1DA 3HVIA 4EMSA 4HTFA 1ZGJA 3KQYA 5EMLA 1I4WA 2ZIGA 4HGYA 1QAQA 4EQZA 1YUBA 2EJTA 3M6VA 4FT4A 3GXOA 3JWJA 4KIGA 4C4AA 3TKYA 3PLAE 3FPFA 3TM5A 3HA3A 2DULA 1QZZA 5FHQA 1RI5A 4YUWA 5E1BA 3GGDA 3CGGA 5T67A 4FR0A 4XUDA 1IXKA 4RV9A 4DQ0A 4DZRA 2IH4A 1L1EA 1ZQ9A 3PS9A 2HV9A 4K6MA 3GDHA 2OYRA 5K0JA 3A26A 2P3OA 2PT9A 1T43A 4DCGA 4Z2YA 3P9KA 2N47A 1L3CA 4RVGA 3UBTA 2NP6A 3G2PA 1RJGA 1YB2A 3BZBA 3GU3A 1UIRA 1AQIA 3FZGA 2PXCA 3I64A 3ELDA 3IV6A 4FT2A 4KDCA 4U7TB 2NP7A 3KR2A 4FSDA 4CTKA 5GINE 3TRKA 1IM8A 5LQAA 4Y30A 5LSAA 5JR3A 5FUBA 4OQDA 4B17A 2I62A 2V74B 1RJEA 4ER6A 4EVIA 2NXCA 5K0GA 3E8SA 9MHTA 3HCAA 5DSXA 3FUTA 4C06A 4RVDA 2ZZNA 3UJBA 1X1DA 4IKPA 3M6WA 3CJTA 1JG1A 3GIWA 4KIFA 4PGGA 3AY0A 2ZLBA 4QVGA 2H11A 4R8SA 3LECA 5D1NA 5EOVA 1O9GA 3GRZA 3PX3A 1WY7A 3EVBA 4MQ4A 3G8BA 3ELYA 2AS0A 3MAGA 1TW2A 2HTEA 1JG3A 4PIMA 4MHTA 3D2LA 3PX2A 1F38A 1JG4A 5EZSA 1XVAA 5K0EA 3HCEA 4DCMA 4FZVA 3DTNA 2PBFA 3HP7A 4O29A 4DM3A 3HM2A 4EKIA 3R0QA 2CMGA 3GJYA 1P1BA 2JH8A 2YXDA 2BR5A 5GP1A 1Q0TA 1KR5A 3EVZA 3LDUA 4CWAA 4QPPA 3DOUA 3EGIA 3LSTA 2AZTA 3T7TA 4E2YA 1IY9A 1QAOA 2PGXA 3ELWA 3ORHA 3PT9A 5E1MA 2XYQA 1FJXA 3VC2A 1I1NA 2JHAA 1QAMA 3HA7A 4UOEA 3DMHA 1NBIA 5FADA 3ER9A 2JHCA 4RWZA 3VSEA 1Q0SA 3AXSA 3LCVB 2JH9A 1EJ0A 2IBTA 3G2QA 2ZULA 2PX2A 1NW8A 5LQCA 4AZTA 2CL5A 1YFJA 2NXJA 1VL5A 1U2ZA 2VDVE 3LGAA 1X1CA 2EX4A 1NV8A 3FPEA 5HIMA 3B5IA 4RTLA 4HC4A 3RW9A 4EKGA 3UJ6A 4RTPA 3UA3A 3KQTA 2KW5A 3KQPA 4GUAA 5EZQA 4PCAA 1G8SA 4FGZA 5EMJA 2AVDA 5CCXA 5CVJA 2ADMA 2GPYA 4M7RA 5D1HA 3THSA 5CVUA 1SQGA 1YF3A 5FULA 3BWCA 2IPXA 1KXZA 2AOTB 3SM3A 3LCUA 3PB3A 4BP1A 1L9KA 2BZGA 3SMQA 3EVEA 2G70A 2B9EA 4DF3A 4YUXA 1NBHA 2P7IA 3LDFA 3OPNA 3T7RA 3UWPA 5DTMA 3X0DA 2ESRA 3G5TA 2WA1A 4ER5A 5LQUA 5CUQA 5DXJA 4QQNA 3KPUA 2FK7A 2IIPA 4JXJA 4RYLA 3SSNA 3WSTA 1XTPA 3O31A 4YV2A 2O0LA 3I58A 5ICFA 4GF5A 3THRA 4CXMA 3FTDA 5E9WA 3PFHA 3G2OA 5K0LA 5FQNA 4BLUA 3JWIA 2WK1A 3LHDA 2OPBA 4FS8A 5DTRA 2Y1WA 3NDJA 2ZWVA 5ERGB 10MHA 3A27A 1WZNA 5DM1A 3UJ9A 4Y2HA 1D2CA 3FTCA 4OA8A 4WXHA 4V0RA 2ZWAA 5DT2A 4PNEA 3SVZA 2FCAA 3KPYA 5CD1A 2QY6A 3OU7A 3MGGA 2R6ZA 1DCTA 5C0OE 1R18A 2G71A 1FP1D 2I6GA 4A6EA 3U81A 2GS9A 5FA5A 1NKVA 5EVJA 4PCLA 3SR4A 1Z3CA 3NVMB 4R8RA 1M0EA 1X1AA 2P3QA 3G2MA 3JWGA 3S68A 1EAMA 1HNNA 2OKCA 3A7DA 4YMHA 2IH5A 1VP9A 2ZZKA 5LQKA 2NYUA 2PLWA 2GH1A 2JJQA 3I5UA 4E30A 4GOOD 5EHIA 1XDUA 4KRGA 4KVZA 4ER3A 3I9FA 5HIJA 3ID6C 5EEHA 1ZHFA 4QPNA 5EHGA 3H2BA 3HNRA 4FSXA 2BR3A 2FK8A 1KP9A 2ORED 3FUWA 5GIOE 4RTSA 3E23A 5EQJB 3L8DA 4G56A 3UJ7A 3REOA 1RJFA 2XYVA 4AX8A 5EIWA 2CKDA 2ZSUA 5LQJA 4RTQA 4DMGA 3FPGA 3GRVA 3M70A 4PGHA 3EEYA 2UYHA 4IWNA 4ER7A 1KYZA 3EVGA 3TOSA 2JHPA 5CIYA 2XYRA 3UZUA 2AN3A 1JG2A 3KKZA 1Y8CA 2P7HA 3EGVA 5HIIA 1N7JA 1N2XA 2AN4A 5H02A 1BHJA 3EVCA 5DXAA 3DLCA 3FRHA 5E8RA 4PYJA 5DX0A 3IYLW 5FQOA 5EG5A 3HVHA 4GQBA 4E2XA 1JQEA 1XDSA 3A4TA 4V0QA 1PJZA 3FPHA 3IEIA 2AVNA 2IDKA 3NWBA 3GWZA 2OO3A 1G38A 1B42A 3UJDA 5GM1A 3NVKI 3BGIA 4ZTBA 2PWYA 2OB1A 4RTRA 5KS2A 4DA4A 5KQSA 2YX1A 3SXJA 3KQVA 3G8AA 5CVEA 3M4XA 2EJUA 3GO4A 4YMGA 1NW5A 4HRAA 2HR1A 1XXLA 4P7FA 5EPEA 2CMHA 3LL7A 3OE5A 1R00A 2PXXA 4MTLA 2VS1A 2YXEA 1EIZA 3ANXA 1D2HA 1G60A 2IFTA 1KYWA 5HEKA 4XUEA 1R74A 3V8VA 3RODA 2IGTA 1VP3A 2CWWA 3G5LA 5K09A 1ORHA 1R8YA 2AOTA 1FBNA 2K4MA 3KHKA 4E2WA 5CVDA 2BH2A 2NXNA 1TPYA 3BWYA 4PYOA 5G02A 2A14A 4BP3A 5JUWA 3HCBA 3AJDA 1JSZA 3DH0A 3BWMA 3FPJA 3FUUA 2UZ4A 5HFJA 1KHHA 2LD4A 1YFLA 5C9ZA 5F2KA 7MHTA 1KPIA 3CCFA 1L3BA 2QM3A 2VP3A 3O7WA 3P8ZA 5FCDA 4AZSA 5EIFA 1RJDA 1XCLA 3OE4A 2ZW9A 4P7KA 4X63A 4A6DA 3TR6A 1R6AA 1M6YA 1VPTA 1I9GA 5DLYA 3OZTA 1UFKA 3ERCA 3LBFA 4QQKA 1FPQA 5E2BA 4CTJA 3NW9A 5K0BA 1SUIA 3C6MA 1DUSA 5LQRA 2PJDA 5CM2Z 4NECA 4X61A 5F2NA 2PX4A 2VDWA 3SGLA 2R3SA 2P3LA 4WVLA 5GOZA 3FTFA 2FPOA 4C07A 3KPWA 1BC5A 4LWOA 2PVCA 3P97A 3VC1A 3O4FA 3M33A 4E31A 2PV0A 3OFJA 4GOND 1UWVA 1NW3A 3KQMA 5LQNA 3MHTA 3DXYA 3E7PA 2ZCJA 4QDKA 3NMUF 3CVOA 1JTFA 4C05A 3EGEA 4MWZA 2O06A 1O54A 4L7VA 3KPJA 4GC9A 2BM8A 3CKKA 3DUWA 2NXEA 1JQ3A 3EMBA 3PVCA 5F2OA 3HVKA 4BLVA 5EMMA 3T7SA 4CKEA 4DKJA 2Z6AA 8MHTA 4P7GA 5C1IA 3T0IA 2AOVA 3GRYA 5B1SA 2C7RA 3IHTA 3VYWA 3KPVA 3HCFA 5GM2A 2I9KA 4PYMA 2ZTHA 3FTEA 2YTZA 5DM2A 3TPZA 1HMYA 5DRYA 5E8JA 5KQRA 1SQFA 1RI3A 2O57A 3HCCA 1P91A 2XVAA 3P2IA 4X1OA 5U4XA 2XVMA 5HILA 3DLIA 2UYOA 2ZIEA 3PFGA 3TMAA 4RTMA 3K6RA 4LWPA 2O05A 1XJ5A 3MTIA 3ME5A 5CVVA 4EK9A 5CCBA 5DX8A 2Z6QA 5K01A 5EGSA 5K05A 3Q87B 3EVAA 2AOWA 5K8VA 3EMDA 3LKZA 4ATNA 1F3LA 3BWBA 3QV2A 4M38A 1N7IA 2AOUB 3BGVA 3P9NA 3SSOA 4R05A 4X41A 4E70A 4RSRA 3I53A 2G72A 3MERA 4HSGA 4XUCA 4POOA 1JTEA 3BKXA 3Q7EA 3EPPA 1P1CA 5BW5A 2F8LA 3B89A 1M6EX 1X1BA 1H1DA 1ZG3A 2AN5A 3DULA 2Z6UA 1KPGA 1JSXA 5BP7A 3E05A 3HTXA 3CJRA 2GA9A 1SUSA 2P40A 4OQEA 3RIEA 2BR4A 1R8XA 1VBFA 3GRRA 4X60A 2VZ9A 3M6UA 1XDZA 5HIKA 4OX9Y 5K0NA 4BLWA 1SG9A 5EKXA 4PYLA 1ZKDA 2QYOA 1YZHA 3GNLA 3A7EA 5KYGA 5HOQA 1G55A 2B78A 3NJRA 4LECA 4E33A 3QOXA 1NE2A 1WS6A 3BKWA 2HMYB 2FYTA 3LCCA 4QTTB 5E9QA 2PXAA 2C7QA 4LG1A 2OY0A 5ICEA 5M5BA 2WA2A 3B3GA 2YUIA 3OU6A 4FP9A 5IH3A 2HNKA 5MHTA 5K03A 4YUZA 4GBED 2XBMA 3V97A 3P2KA 2JG3A 3JWHA 2I7CA 5K0FA 1FP2A 1V39A 3B7PA 3DMGA 4PINA 4RVHA 3KQSA 1VLMA 3MCZA 5K0CA 4HTFB 1P39A 2EG5A 2FRXA 3KQOA 4RTOA 3M6XA 3FUVA 4KDRA 1AF7A
chains in the Genus database with same CATH superfamily
5EJ4A 2J45A 4UARA 1N5KA 3KZVA 3SZMA 3UMBA 2COUA 1XAHA 2W58A 3T12A 4Q00A 4RX1A 5CJ2A 5HPYB 2VP0A 5L3QB 2C7OA 5I4KA 1CZUA 2C9MA 5A4IS 5CXUA 3AUYA 3EA4A 2VPPA 4BNLA 4DLXA 2DFKB 1QANA 3F3YA 3IBYA 1UBHS 3EG9B 2C97A 1IN1A 5C18A 3QHAA 1UT6A 1YSCA 2QTCA 3C70A 1G8AA 2XI4A 1SQSA 1O5TA 3HGMA 2ZUTA 2OZLB 3OE7A 1B8NA 1TYBE 1W4BA 2DFNA 1WPXA 2DWOA 3DDOA 4QUKA 3BS4A 4K6FA 4YV1A 2WFLB 3JX9A 1RWXA 3NRJA 4QQRA 1WXGA 3IP8A 3K0BA 1ZVKA 5TS2A 4BUZA 3A9VA 2A1TR 2YY5A 5K8CA 4RTKA 2XNKA 5DYNA 5FLEX 4LYGA 1KO1A 4G23A 1MB4A 4MKGA 4P5PA 3OKAA 3PJEA 4KO8A 1DIAA 2BP7B 1HTWA 2CJWB 3QOYA 3UG6A 2CFTA 1DUIA 2FP4B 2PSEA 2W2KB 2PKRA 2Z1MA 4F6RA 1RWQA 1VE3A 4J03A 3K8OE 2GRAA 1GT6A 3ZX5A 5MDHA 3O1IC 3RRJA 3UV7A 1G8GA 3FYCA 3RG2A 2AJCA 4KZPA 3BE4A 2PRKA 3C3YA 1EXVA 3KQWA 1OFIA 4I1IA 1FUKA 3DDNA 3O4IA 4KMMA 4DLKA 1BHQ1 1SOAA 1YFKA 5FX2A 1AS0A 1DL5A 3DL2A 5B3LA 5CA1F 1QF9A 1PR5A 3RVLA 1R66A 1ZJ5A 2IPMA 2Q99A 3DDWA 3H5AA 2NO9A 3R23A 3L8GA 4H31A 3PNOA 5FR2A 4EBFA 9ABPA 4LZLA 5TGZA 4BNMA 4BX2A 3Q0EA 1HA3A 2QZ4A 1C8KA 3LK7A 1ZCAA 2VDPB 1CUSA 3FYDA 4LOLA 4Z4GA 4FE3A 4MMZB 4AZVA 5JCZA 1ZM3A 2PX5A 4C04A 4YECA 3AFOA 1P7ZA 1U7UA 2OHJA 1FJHA 5COQA 4LC1A 4D0NA 3HADA 4F3CA 2EXXA 2FR8C 2XBLA 4UEKA 1B93A 4HX5A 1K86A 2ZBRA 5K20A 1S4QA 3EAFA 2G9QA 4P6VF 2HGSA 2ZFUA 5KVAA 3ENNA 3MJSA 3C5HA 3KR1A 4OXXA 3SXUA 2YZKA 4EAQA 5FNVB 4HATA 1V1RB 1MB0A 3ZOKA 2C95A 1MEOA 2J0EA 3BFPA 4JCOA 4NYJR 5DYYA 4Y2JA 4DUGD 3HWWA 4ARIA 1TGVA 1YI1A 1KKLA 2BFDA 3PPXA 1DTWA 3KEGA 2GXQA 3MHPA 4IKOA 4HJRA 5KTNA 4PVCA 2QU8A 3MS4A 1TZBA 2ZBQA 3CB4A 5IVPA 1Z8FA 4P58A 4M49A 4PIPA 1GNSA 2ZIFA 4WCVA 3ACCA 4OM8A 4AZWA 1KGSA 2QB5A 1N2GA 2QYHA 2ZWOA 4ISCA 4MUHA 1IG0A 4K28A 5GY7A 3TBKA 5JS7A 2HDNB 3KZ1E 3SZUA 4WBNA 3IDSA 5CH5A 1B15A 4UVHA 1FQOA 2QY9A 5K51A 3AIMA 5E3HA 4QG3A 4MVWA 1P2DA 3CCBA 3LT0A 5EIXA 1E2HA 4YUYA 4IQGA 3UMSA 1NUTA 1POXA 4OATA 1VPVA 5FJIA 1ZGJA 1NBME 5EMLA 4F86A 1I4WA 2ZIGA 1T15A 3RE1A 4ZCRA 5KSWB 1TD1A 4H7IA 1G1AA 2PT5A 1KC1A 5KYXB 4KIGA 4LN1A 3TKYA 3PLAE 3RIYA 3BD7A 1QWOA 1ZVJA 3QI7A 1QZZA 2HL6A 4KWIA 1M10A 1IZZA 3BDAA 3V2IA 3ZLUA 1Z4MA 5IEBA 2RHOA 3RC1A 1L1EA 3QKRA 3N7TA 1I3NA 1U9JA 1FLDA 3ESCA 4HNTA 3NP9A 1DS6A 4OAOA 2IXEA 3R7AA 2AJDA 1HTTA 1HQYE 4C0AC 4JJKA 3MB8A 1KH1A 1WQ1R 2P9GA 3FLMA 1VKJA 1YB2A 4OPMA 3NBAA 1ZD8A 3FZGA 2V3CC 2PA3A 4UNRA 2V97A 2ZIAA 4MHOA 3HA2A 4UBLA 4B74A 1BW9B 5LSAA 1T4CB 1WDLA 4M0LA 2JGLA 4IIHA 1KRXA 1R0BA 3S2UA 4ER6A 5K0GA 1P6UA 2C59A 3CWZA 3UMFA 1NZDA 3UT0A 4ENSA 1YK1A 4NULA 2ZZNA 2LZ0A 1M2WA 1QGUB 1SULA 2EFDB 3REQA 3VSBA 1YQ9A 1YQGA 4PTYA 1NWCA 1KU0A 3G2NA 1DX6A 1GAQA 1H4SA 4KNWA 1FFCA 1QPBA 4ZT6A 5FBVB 3EXG2 2KWIA 4EHAA 3CUSA 3GLIE 2VVTA 3M5PA 3LV8A 1A2KC 3BJZA 2X0JA 3U16A 1ZH0A 1LLDA 1ZCBA 2BFCA 2ZYSA 4R2JA 1HV8A 3STYA 2P4EA 4ZCIA 3OEYA 5ITZB 2QL7A 4JLNA 5ALXA 3PVSA 4S1VA 5LWQA 1MC8A 2AD5A 4HCJA 1Z2PX 1U3UA 2ZBDA 2WG0A 1Q77A 2WM8A 3LWNA 1O58A 1FRVA 2WT9A 3DWFA 1ZGHA 1YA8A 1F3OA 2HJWA 5F3DA 3DDSA 3URMA 1Q0UA 3DMHA 1E2IA 3MYRA 3VKVA 4CEIA 5FO1A 3PKIA 3DB1A 1C7IA 1GCGA 2XECA 4RGBA 1EJ0A 5EE1A 1C7JA 1DVRA 4LBVA 5FOVA 1TECE 2GJAA 3QMVA 4N3CA 4CMIB 4DB4A 1OC2A 4NVRA 4N9QA 5FFNA 3MCVA 3TDKA 4W7SA 4MUIA 2TSYB 1GRQA 1N1GA 2XCIA 3DBLA 1ADBA 2XUHA 5AM3A 3LW8A 2YKGA 4I6JA 3ESYA 1E0JA 1V16B 2UZ1B 2XMZA 2NO7A 3ETLA 4M0UA 4UTNA 4DPLA 1PTJC 4B4VA 4HLDA 4GQIA 1BG6A 1SXPA 1J9EA 5G3YA 1ZH2A 2WWHA 4XRRA 3PWTA 4WLEA 4AMZA 2FCRA 1F5NA 5K3FB 2IIVA 2WIDA 1L9KA 1P80A 1WP9A 1Z34A 5IVHA 3FHOA 2F9FA 1EDZA 3TSZA 1NBHA 2P7IA 3OPNA 3UWPA 5HKBA 1QB7A 4NF2A 1N6LA 4MAMA 3WYEA 1VL8A 1YRAA 2AR9A 2W37A 4RM2A 1BVRA 1HG0A 2G04A 1TK9A 2IVZA 1F9AA 3LDHA 4IHQA 4OI4A 4RKYA 5JPIA 3C87A 1AO0A 2PMWB 4Y67A 3DVSX 4M83A 1CFZA 2GCPA 3F98A 3PP8A 4FKBA 3L8YA 5DN6D 4UPEA 2FX5A 3LHDA 5B1EA 5CG2A 2X9NA 3NDJA 3ZI4A 4TM8A 1S01A 3G9QA 1D4OA 4MKZA 4JXKA 1U3TA 4I81A 2R8OA 4Y2HA 4OA8A 1M2KA 4RH0A 4I55A 4A92A 1SCBA 5AW0A 3B7GA 5CX1B 1DOHA 2DWQA 3GROA 4TGLA 2R6ZA 1R18A 4UTOA 4PLHA 3ICEA 1MJ5A 1G7TA 3IXMA 1VSUA 5ER9A 5CDUA 3LQQA 3OIGA 1UBGA 1RR6A 3U3JA 4PFSA 3OTQA 1G7SA 2CLFB 4WLVA 3UJ3X 2NZ8A 1QPZA 4MDHA 1TCAA 2E2WA 5K8LA 1SC4A 1KAGA 2X5XA 1XTRA 4LYEA 2PPLA 3WKDA 4QGSA 4WZAE 1ONSA 3KKOA 3ZJTA 2JCBA 2FE4A 2B69A 2A92A 2KB0A 2NQ8A 1QCYA 4JUDX 3PX7A 3RYCB 5CCBA 1I2MA 3OM0A 5IVDA 1KP9A 2JLZA 1EX9A 4ZU6X 1C4XA 3OF2A 4ME6A 4BQIA 4RU1A 2E82A 1RJFA 2GZSA 1QE3A 3NONA 4PFQA 2BCEA 3V1TC 3F2IA 4GX1A 5LQJA 3COPA 1FK8A 5L6MB 1R6VA 4F0JA 5FPHA 1LX7A 4J1NA 1LV8A 4AZ3B 2EZ9A 3M70A 6NULA 3D7NA 2DBYA 1IM5A 1FFSA 2W7TA 2PQ2A 4RETA 3WWPA 3AKEA 5ALFA 5C1DA 2C03A 4GRAA 3P5SA 2A1TS 3C5EA 3VJKA 4RZIA 2J5KA 3T3OA 4FLEA 5EIHA 5KU1A 4IYJA 5J2UF 2AB0A 2ZRPA 2QGZA 2BEWA 3PI6A 3AEQB 3I09A 3JD3A 4PBRA 2F90A 3LGSA 1QLWA 2NQTA 3W5JA 2VYVA 2B37A 5DF1A 1M8GA 5KNBH 1XCOA 5DX0A 3IYLW 2OT3B 1Z7WA 5EG5A 2CLDX 3OAAA 1NNSA 2EV9A 3ANLA 4MLCA 3STTA 3QITA 4X0EA 3KKPA 4DR5B 3VR2D 3DLAA 2F1JA 3SJ7A 3PENA 1UBNA 3NWJA 4PU0A 1P0MA 3GJ5A 4F04A 3IO3A 1AHIA 1I2AA 3I32A 4MKFA 4P53A 5REQB 2BY4A 1L8AA 1J5XA 3SPXA 3SXJA 1MX1A 1RJ9A 5F7ZA 3ZDFA 1AK1A 4WFKA 5BMOA 1AA6A 2V6IA 2JIZA 2RBKA 3M4XA 4OFBA 1TRKA 3CWQA 3HG7A 4O2BA 1SOWA 5AMXA 3TLBA 4Z3KA 5KVCA 1GRRA 5BNFA 5LMCA 1K6JA 4PX5A 4NZNA 3TR5A 3IPLA 5C52B 2QI9C 2WRZA 1Y1KE 2JGNA 5IAOA 1FYDA 2X0EA 1DKLA 2YXEA 5AW4A 3OKFA 1J1UA 1EIZA 4R1SA 4WK4B 2IFTA 3C3AA 3LC0A 3COZA 2DOKA 4PGMA 3GL9A 4KI7A 4BATA 1U1IA 3GFPA 3LLCA 3G68A 1V8FA 2VP2A 1A9PA 2ZIWB 3KU4A 1XAGA 2XOKD 5G02A 1V6AA 2RGWA 3RQIA 5JZOA 5DP1A 1E3JA 3TZBA 2UZ4A 1P75A 1Z5UA 3C48A 4MVJD 3W7AA 2CDAA 2JC3A 3GT7A 3G0IA 3O7WA 5FCDA 3ZDYB 4KR2A 2ZW9A 1D1TA 1VPEA 3DBOB 1T3HA 3M3HA 2Z09A 4A6DA 4IDBA 4PQYA 1OAKA 4RE6A 4V0NA 4URFA 2B1RA 4EY4A 4ZYVA 3TEFA 2JGJA 1JDZA 3LBFA 3LL4A 3O83A 3SAJA 5B4UA 3TF5A 2CUZA 5IYZB 4KRXA 3FD8A 4IOJA 4CEHA 1RC0A 4MSUA 3Q98A 3ZGYA 3L5KA 4PPGA 1NURA 1ZUD1 4JJEA 1BA2A 1QV6A 4QDXA 3IT3A 1XXHA 5C5DA 4YBZA 3HBMA 5C8XA 4LW8A 3MLBA 5LA6A 7MDHA 3CZ4A 3CX3A 3GGGA 3IVXA 4EJMA 1S8FA 2ECOA 2CDNA 3A4YA 4FFLA 4F2WA 5IKXA 3A1UA 2KLBA 4WK6A 4IIUA 2GF9A 2H18A 3QEOA 4WASA 2O06A 1O0SA 1P9WA 1ZEJA 4NARA 4CCWA 1V45E 5JBNA 2RHBA 4ZT2A 2ODTX 3EMBA 1HYQA 1OREA 3BJEA 3K73O 4JJ4A 4JJ6A 3T0IA 1OGYA 2B3DA 3TLYA 1Q0LA 1PAUA 2DECA 2O48X 2MOKA 3IHTA 3OY2A 3VR6A 3HCFA 3ZQ6A 4BC1A 4M1MA 4MKHA 3W5SA 3FYTA 4EYEA 3G0OA 2BM0A 2VHYA 2ZRIA 3DL0A 4PX3A 5LN1A 1L5OA 4Q6BA 1BEEA 4ZFNA 3Q7QA 3M9LA 4Y9DA 2RAVA 2O8VA 4OGGA 4D9MA 5JW6A 4TSFD 2EQ5A 3LVQE 4PF1A 1MCZA 5LBIA 4CF6A 2ATVA 4DYHA 5DNCA 1Q57A 2QX8A 4CM5A 4F9TA 3CPHA 1PLLA 4BQOA 3DEZA 2N1BA 3TD2A 4EG4A 2QN7A 2FJ0A 2AC4A 5IARA 4OH1A 4Q7LA 1ZOSA 1XWFA 4A0SA 1F0PA 5JLJA 2PS1A 1T1RA 3JYOA 3PWZA 3OQOA 1FFAA 3P9NA 4LZZA 1HEIA 3F7TA 1C3LA 3NHLA 1O95A 4BZXA 3NEYA 4XX0A 2L82A 3MWDB 1QHNA 2BGJA 3T3HA 4LFBB 4QAJA 3U9LA 4AMGA 3AIOA 4RVOA 2RC5A 4AWAA 1UKEA 4E07A 1ZG3A 2GKSA 5JXGA 3HTXA 2WP8J 2HHCA 5E4FA 4BVKA 3A04A 2GA9A 4QUBA 2DUNA 2MINA 4ZCQA 1ISIA 4XVQA 1W1IA 4GAEA 3QE3A 4E5KA 3DTYA 4HB4A 1CDDA 3FLAA 4F6CA 2WJ4A 2X4LA 2FV8A 5FEUA 4HVAA 1FVOA 1SG9A 1SVMA 1BGWA 1X8LA 2HNBA 5DI3A 5LCXA 2OKGA 3FF1A 5ALWA 3OZEA 4PAQA 3HGQA 2EKBA 3FNGA 5JIBA 2O2JA 3Q12A 4YTEA 1Z39A 2IXAA 3IRVA 4BN4A 3FTPA 1LF0A 3PHCA 1VXOA 5JSZB 3R8XA 1SH7A 4LGYA 1C7RA 3AW9A 4ENTA 3CHYA 3Q0TA 2WD8A 4HNSA 1Z0DA 5HVNA 2C92A 2X5KO 2ZU0C 4Y1RA 2ONJA 3VKWA 3RVDA 1ZAKA 4MR7A 2YYAA 4UTZA 1VLVA 2C9DA 2A6PA 4FP9A 3G6WA 3BA1A 2G82A 2WAMA 2W43A 3TFQA 2XBMA 4EX6A 2E6KA 3N3AC 4RK1A 2P1ZA 4ZIRB 3JWHA 5HUQA 3H3XA 1B6TA 2X41A 4MW7A 4N0PA 4O4IF 1V3TA 1ZIXA 2BBWA 1FTNA 1ZH6A 2ACVA 5EXPA 1R0KA 5LIRA 1J0AA 1YL5A 3M6XA 4EHNA 3PGLA 3S29A 4ZV7A 4Y0VA 2G8NA 4X44A 3N70A 5B12A 4H0CA 3T61A 3F90A 2CLOB 4O2AB 4Y2UA 3OP4A 1Q7GA 2V59A 3C6KA 3PNKA 4CT5A 4D9KA 3NG1A 3AB3A 3VNVA 3GB9A 3RS9A 4BE7B 3U37A 1E7SA 1YACA 2POQX 4URYR 5E2AA 4MDEA 4MJ3A 2FZEA 4BMCA 1E0AA 2X2FA 1EGHA 2R5NA 3BIJA 8ATCA 4L4SA 3L05A 5LR6A 3KYIB 1SUPA 2CZGA 1C3OB 1SD5A 2A86A 4XH9B 2J5RA 3EQ7A 4HWTA 2J5XA 4C7BA 2OK7A 5CITA 1E5QA 2C42A 1UZLA 4U0KA 5TT0A 2YMPA 2B25A 3F4KA 4J7UA 5IVIA 5A04A 1U5CA 1PJQA 4LRYA 4JY7A 1IAVA 2LRHA 3C1TA 1FDWA 3HJBA 4I99A 4DW8A 4EG8A 3CKMA 2DHCA 3WLAA 1T6ZA 1J39A 3ED1A 1SU6A 4YCAA 4XWYA 4AT1A 1DJLA 1XKTA 1M8FA 1AMUA 4RY2A 1TW3A 2J0VA 3PZBA 3Q8WA 3KAPA 4Q3LA 4XFKA 1JHDA 4IV8A 5KNDD 1CJVC 1MHPA 2XITA 4MLPA 5KZMB 5EJAA 4CM4A 1L2TA 2HD4A 2RBGA 5FHRA 1P7PA 5JC1A 3KXKA 1DZIA 3QYAA 4JBIA 4CLXA 1UEXC 1WKVA 1WO8A 4GOKA 3USCS 1R5JA 3NFYA 3R24A 4EI2A 1KTVA 3GK3A 4DSAA 1E1NA 2V7QD 1K7FB 2G9ZA 4RF3A 2QRVA 2CJYA 4RPGA 2YR0A 2EFEB 1E1QA 4INOA 1IJFA 1O1YA 1AQLA 2E4UA 4PS1A 4UBKA 3CPSA 4W5JA 3WIDA 3GBSA 4ZHSA 3G88A 4Q4DA 5FWYB 5L7TA 1OE0A 3TIIA 4AFNA 4L4ZA 5HNKA 1Z38A 3MCWA 4BEJA 4BWYA 1CR2A 4Y6GB 1YA6A 3RVOA 2OFXA 2WUVA 3RJTA 3QBTA 1CQWA 3R74A 2HMAA 4S1PA 3UEOA 1R10A 1SU8A 4OMFG 1W59A 4B85A 2EGUA 1YB4A 1T29A 4MB6A 4R2HA 1GAJA 3DXZA 2CJPA 4B0OA 3H18A 4UUNA 3BVPA 1L6RA 4IV0A 3KBBA 1THGA 4JR0A 1T8UA 1J5EB 1II8B 4B3DA 3BGSA 3UB3A 1Y48E 1VBKA 3CN9A 3I01A 3MTJA 4M9RA 1RPAA 3FUXA 4NDNE 5DEOA 4L4YA 5G1PA 2HHHB 1LSUA 1XTTA 4ZXPA 1MBZA 1T35A 3DTVD 1I9CA 4BC0A 1YMQA 3LHIA 2P3SA 1F4VA 3E4DA 1GAEO 5L95A 4KFRA 4TT8A 1CQJA 4HG2A 3RF6A 1K5DA 4BLRA 3GJTA 4I1PA 1G5HA 1N5JA 2Q6LA 2YVKA 4WA7A 4EQ6A 1ZAYA 3CLRC 2IBMA 3JQAD 5IJZA 4LVOA 1KS9A 3U6BA 1MAWA 5FBHA 3D0KA 4ZOEA 1SKMA 1V37A 2YN4A 4P7JA 5DT9A 2HIGA 2B1QA 4GEKA 1WDTA 3MMPA 1A9RA 2JGAA 4XW2A 1GIAA 1LQTA 2YRXA 4UXIA 4LTNA 2XWPA 1ICEA 2PM8A 3IBGA 4R41A 4KQMA 4G85A 3L4JA 1LK5A 1L5QA 1PLKA 1E1LA 3QVJA 3KE9A 4FOTA 1BCSA 5FBKA 2JW5A 1D2AA 2I3ZA 2WTMA 4CG0A 3O8RA 1RBZA 3GEHA 4AMBA 4DIEA 4FT4A 1XCBA 1VKRA 2Z6QA 2VC2B 1KAHA 3I05A 4J7XA 3AVWA 1X7GA 4EJ6A 5B4TA 2V7TA 3U62A 4HFJA 3DFZA 2CBGA 3K9LA 1OWPA 1YU6A 1IPHA 1BXGA 1EZZA 3VTKA 4UZSA 5BUCA 3THYA 3OTWA 3L1KA 2QP9X 3G9ZA 1ISFA 2HA6A 3LZCA 1W36B 2QT9A 1G17A 2QEQA 3A26A 5AK6A 3VM6A 4DAEA 5B57C 2F2TA 1HNWB 3WFIA 3EFEA 1N4AA 2A9OA 1ULBA 2Q27A 3IV6A 4U0JA 3TOCA 3KVNA 2OGWA 3H0KA 3W5UA 5GINE 2YNMA 5M7EA 4C4SA 1MO3A 1YNSA 3V8PA 3E7FA 3LDAA 4MV3A 4P84A 4UULA 3O82A 4K6CA 3T7KA 2NXCA 2ZTMA 1NJGA 1XZMA 2QMOA 3AHFA 4QDZA 5CT9A 3NCTA 1PJAA 1U80A 4YWJA 4YT2A 3WAGA 5DYIA 1SM4A 2EQAA 1YZUA 2CDRA 1ZGBA 4QYIB 4ZO6A 1NOIA 1L4MA 1QP7A 1B7GO 1DAKA 4GWLA 1ABEA 3E03A 2D1YA 2VBGA 1PIWA 4OJTA 1DC5A 2C3PA 3H11A 3HCEA 1K2WA 2B8WA 4O29A 2X0FA 4FX2A 2DHDA 1XU9A 4YO7A 4RNCA 1QFZA 2GM3A 3WYNA 1Q0TA 2BR5A 3AUTA 1U8TA 3OPYA 4CL2A 3JQGB 1GNLA 4K05A 2WTBA 4IQFA 2QRNA 3AEKB 3H5NA 5E1MA 3FB1A 3OCYA 5I9SA 2ACEA 1OXKB 2VHZA 2YV2A 3I8SA 4D02A 1B8VA 3CNBA 4K9KA 4CZ2A 5DNWA 4WL0A 5FADA 1GUYA 1LLCA 4O3FA 3E6AA 3EARA 5CP8A 5DYWA 3IUPA 2D0OB 3HN7A 3VHXB 1SCUB 1CYDA 4XASA 2DUJA 1MZVA 3BULA 3DE0X 1AKRA 5L8VA 2PIDA 3RC3A 4QOIA 1D03A 1YFJA 4NK5A 5CURA 3ZWCA 2DWCA 1EVIA 2H0AA 2FMXA 2RH8A 2WIKA 3H9CA 3DS8A 1LPAB 1Z6QA 3RT7A 5EE3A 1AH2A 1Q44A 1QP4A 4JI0B 4RTPA 3HQ4O 3DB2A 1FSSA 3IVMA 1PUIA 2K7ZA 3O8QA 4FD3A 3NZEA 4BFTA 2JGIA 2GPYA 2ZYTX 3KALA 1JAYA 5KC8A 3C8ZA 1QH8A 1UQRA 1Z5WA 3M6MD 3QPUA 4MUNA 3TJZA 1VHQA 3SQLA 1TQ8A 5DXJA 3HO8A 3O31A 3QSGA 3NIFB 4MH0R 2D4HA 2IXDA 2Q3FA 1C9DB 2YXPX 1GO2A 4Q82A 3TW8B 4EELA 8LDHA 4LJ5A 1YOVA 3UM9A 3IOCA 4IIVA 4U5XA 3SQNA 3SYKA 3LOQA 3WB2A 5CDSA 3DAFA 3ZHBA 4K6HA 1A7UA 4GLBA 3ZY2A 2G1UA 4YP5A 1EWTA 1WZNA 3E5MA 1THMA 2IYSA 1MC1A 1Y4UA 5DT2A 1MX9A 1Z06A 1IN5A 5LYYA 3MXOA 4BQQA 3EC2A 2VDWB 3DFFA 1FYXA 2IOQA 2Q7DA 1RZUA 2PAFA 5CBPB 3H5WA 3EG5A 1XTIA 4BYMA 4X71A 3NBKA 4BNIA 1JSLA 1P9RA 1XKXA 2NUTA 3ZBTA 2HCBA 1L5WA 1EESA 3IAUA 4LBZA 1EX7A 1JEOA 4OJQA 1M0TA 4G0MA 1GG9A 4H08A 1U4NA 1H94A 4BNDA 2BFFA 5AUNB 3PUHA 5CGZA 3WQSB 4KN8A 1ADJA 4G8JA 1UZAA 2AYZA 2XCLA 3DVAB 4ZVVA 4NXMB 3AFGA 3PHJA 1EGQA 2HLPA 5JROA 1E2PA 5EE5B 3EQ2A 2EZ4A 3MOIA 4G56A 5JG7A 5HRUA 2J5QA 2O3TA 3EGDB 3GYBA 2Y68A 3KZCA 2R47A 4FKZA 4D79A 2H2AA 2VSNA 4PGAA 1MW8X 4NZOA 4EF6A 3UB4A 2TYSB 5IMBA 4EY7A 2ZJ0A 1FX1A 3NBYC 2OCBA 1Q0RA 1I36A 1TMOA 2RFLA 4OQXA 4B47A 5IU6A 4ZAZA 2QYSA 5LB2A 3RS0A 2JHPA 3DPSA 3F6RA 3VU8A 3B1ZA 4RLFA 1E9EA 2A8YA 1TM4E 2J9FA 3WJ1A 1PK9A 5HIIA 2AN4A 3EVCA 4JSTA 2R1TA 3ILSA 1UAGA 4H7HA 4R1UA 4B79A 2YFHA 1Y8RA 3HKEA 1W30A 4MVJM 2YUTA 3D4OA 3RVBA 5SY6A 1KEUA 4BV2A 1L8XA 2I6XA 3L4EA 1YMUA 4FSHA 4XD7D 4YCBA 2BMEA 4HXFB 2A9PA 3V5NA 5FWXB 2VNKA 2Q5EA 2RI1A 4TSRA 2YH2A 3W5DA 4D3DA 3NVKI 2V45A 1E4EA 4TV9B 3T1QA 4RTRA 4WIAA 1M67A 2ZBUA 6GPBA 1JDBB 1MG5A 3D4NA 1JDVA 1L8LA 3WMGA 1TUBA 3ZX4A 5FTLA 3VAAA 1FFXA 1L5VA 3KZXA 4Q3OA 3MELA 5BNIA 4A16A 2J9XB 3H2GA 3HEBA 3WGGA 4E3WA 1UWKA 1GKYA 3ZXIA 3TLZA 3WSVA 1XXLA 1RXCA 3C3KA 3L0YA 1YIAA 4UKDA 4X95A 4YJKA 4KXLA 4I4IA 4Q9NA 3VOAA 1QG2A 4TMZA 3PG5A 1PK7A 5ARCA 2JJ8A 5J5VA 4D6YA 3Q6NA 1NVVR 3JASA 2W9XA 3V8VA 1A69A 2WHQA 3K8YA 5K09A 1A2QA 4HD8A 5TPWA 2NU9A 1WHTA 3ZY6A 2DSTA 3Q15C 4QBIA 3WRXA 4ZPXA 3I76A 1FNSA 3SIPA 1B0PA 1M6NA 2W2PA 4H3VA 4LF9B 3B53X 1UP4A 4OHFA 1JMYA 3RTEA 5JVDF 5F5NA 4KPGA 3REFA 4EI7A 3KETA 3U4HA 2QMYA 4N01A 4ARZA 4RKRA 4LKOA 1X14A 1IATA 3E1GA 4MRNA 1E32A 4RDCA 1FJGB 2Y1GA 3S4YA 4X3OA 4LAFA 4IVQA 4TVBA 1ILWA 3OC6A 4DVGA 4J0GA 5BVHA 3R1IA 4Q9HA 1RQGA 3NW9A 2OPHA 4AJNA 5CVTA 5K0ZA 1LZKA 2QG6A 1R4MA 3IMCA 1NW4A 1N5MA 4GVXA 1WM1A 4K2HA 3I2KA 1EH5A 1YR3A 4MMXB 3SGLA 2KE5A 4Y6SA 4ZHQA 1K75A 1WMBA 4ZVQA 3I23A 3AV0B 4PLFA 1W5BA 5ESXA 3P97A 3Q3HA 3Q3CA 4YYEA 1HTBA 1NY5A 5C80A 1IDN1 5AVUA 3HV0A 3M33A 3V9AA 1YQUA 2VHCA 4IZ6A 4EM6A 4FW9A 4RZSA 4XM1A 3UT6A 3CVOA 1R5OA 4WE3A 2XZOA 1EVKA 1L1RA 1Y34E 3GZ4A 1Q3KA 1UCFA 4UNNA 4NBKA 2PGAA 2CVQA 4N49A 5CXSA 1PI3A 4X6XA 4FEEA 3QU5A 3TLGA 2RCNA 3DDHA 4OKSA 1HR0B 4P7GA 4WGFA 3CZRA 1T3GA 5B1SA 3IIIA 4GO1A 4OB8A 2C7RA 1EHYA 1GU7A 1TB4A 2ZTHA 3C43A 3UOWA 1P72A 3VV3A 3SQWA 1EQUA 4NEGA 3SICE 5E8JA 2QAGB 5KYUB 1KYXA 3CEAA 1KS2A 1CZLA 3PQDA 4U2DA 4GE3A 4B35A 4F5EA 4X97A 4TRNA 1DQRA 3DLIA 5M04A 5MGBA 2AMYA 4CQNA 3DJYA 4RTMA 1EXMA 2YOHA 1VE7A 1VRVA 3E9NA 4HDSA 1JKJB 4BGEA 3MCUA 2WJWA 3BMQA 3OPMA 1NC1A 1N8SA 1ZPDA 2I67A 2NSDA 4H4EA 4AJ2A 5AW3A 4II2A 1GZVA 4V2IA 4AKSA 3MOSA 1SVSA 4C30A 2PFGA 4EHLA 1U2QA 4ZCMA 1F3LA 2HBQA 4M38A 5K1ZA 1N7IA 4MW6A 5AK5A 1WTCA 4PQEA 3ZWKA 2VTDA 3NHJA 2P0YA 2OMKA 5KOYA 3EZYA 3EVNA 1NJ8A 1VIAA 3W4JA 3ND7A 4YBRA 4DAOA 2YVQA 1A4XA 2NWQA 2PMDA 3EOZA 2UUAB 3AR5A 4GM4A 3FGPA 2PUHA 5BP7A 2FEWB 3F9RA 5EQDA 2J3QA 1LI4A 1WF3A 4BB5A 3GLSA 2NVBA 4M1ZA 3SEQA 4W7HA 3R3XA 4AYXA 3FR8A 3MWEB 1PL7A 3P0FA 2F3RA 5A7GA 5GAJA 2AFRA 3G2IA 3LRPA 1ZKDA 4EKDA 5ED0A 5FR1A 2Z2KA 4H35A 1OVGA 4NBWA 2A0UA 1S2NA 1GTG1 5C4GB 3ZIAA 2JIDA 4Y7DA 3ZTWA 2Q9AA 1RYEA 1D8AA 2VNSA 4Z5XA 1SURA 2HJVA 2I54A 5JISA 2X8AA 3IAFA 3L8MA 5ARDA 2ARKA 1JUDA 3CRNA 3BAFA 4EMBA 1T5TA 2PRZA 2BCGY 3H86A 1PR9A 1XEXA 1B2RA 5KPDA 2HNKA 4YUZA 1Z26A 3CNNA 4O4LF 3HU1A 4NCJA 3ZV5A 1D5WA 3UAXA 4DOMA 1QR2A 2BTQA 3OCUA 1N7HA 4H4DA 2VBCA 4OCZA 4BVJA 2N42A 1B26A 1MAAA 4YRIA 1VLMA 4YRRA 2G5TA 1U0JA 3FWZA 3TD6A 4KJZA 4LK3A 3F67A 2B92A 5C5EA 3F73A 5TARA 2GRJA 1V26A 2R6R1 1UMCB 3JTMA 3LW7A 4XDZA 3RRZA 3HB9A 4UQOA 2VTBA 3VX3A 1RE0A 1MFPA 2G0AA 4LXUA 3K0FB 1KAEA 3OZAA 3U5ZB 4FHZA 1EKXA 1Z4OA 1XR3A 2VYQA 3EZNA 2I3AA 4IFBA 5EWMB 4X93A 1J7KA 2ZAGA 1PTKA 1SK9A 3LAWA 5K7SA 5T64A 3L8CA 2BM9A 2X2OA 3R6LA 5CCDA 4BE9A 5P8WA 4YRPA 4KWTA 1MH9A 2W00A 2VWHA 4PY2A 4R68A 1SEPA 3UJ8A 5BNWA 3L7LA 4IHAA 4TLBA 1LDEA 1ZESA 1DC3A 4YASA 3KB6A 4EG3A 2VDUE 1IY1A 5ULLA 4B2PA 3DFIA 3FN4A 1AK9A 4BO5A 5CFOA 1CY8A 2F7SA 3RC8A 1R9JA 3GEPA 3AVXA 1IOZA 1WVGA 2B94A 4REMA 4XTRA 3WB1A 3I0ZA 3I28A 4A15A 1TJPB 1DJMA 2AEFA 3BZWA 2E5WA 4Z4IA 3WLSA 3QZUA 1Y9AA 2H00A 4F1KA 2IBSA 4Q1AA 4BJ5A 4BFLA 3W2FA 2WFMA 2NPFA 4A7PA 2QTVB 2RGUA 3DM9B 3GW8A 1B23P 1G6Q1 4YFVA 2H1IA 3R3JA 3ABQB 4IVRA 2QJOA 2XVYA 4QDOA 5A03A 5HGJA 5IFKA 5J2TB 1MT3A 4N5IX 4ZQIA 4D9NA 1DC6A 3N86A 1KY2A 3KT6A 3IE2A 1XPUA 2G17A 3A2KA 3UV3A 2G7MC 2XQVA 3R8FA 5CJJA 1N5OX 3CSUA 4E5DA 5C8YB 1T0PA 4Q4HA 3IMFA 3I9LA 4OL9A 5IANA 4M7OA 1PV2A 2YWXA 1TJ5A 3DF7A 4JJGA 4XQEA 1PSDA 1Q1EA 2DKNA 3RYTC 3UH0A 3QFSA 1QJ4A 5LP6B 3ONVA 5CTAA 2CB9A 3BRSA 3PNQA 2UXDB 2CL6X 4EJ0A 5EJGA 4ZVUA 4TTIA 2ZR0A 1E1CB 4FCTA 2YXLA 3KCNA 1QDUA 1R9MA 4PNZA 4TKZA 1DEHA 1NQTA 1UXIA 3KYBA 1F1BA 4RGVA 2DLNA 2O0HA 3RI3A 3VSDA 2G1KA 1QNLA 2VCYA 1CUEA 5FOQA 4KQJA 4MHSA 4CG3A 1WPGA 3BL5A 2IY9A 3DBIA 3P71T 3L4BA 3VI4B 2OSVA 3CUYA 1QIJA 1BVUA 1M2HA 4HGZA 4Q1CA 5LZ5A 1FUYB 4EHDA 3MUOA 2CNWA 1Q0ZA 1K0FA 2P1DA 3GD5A 3TM5A 5MFPA 1Z5PA 1XYYA 3SEZA 4CJXA 3QVMA 2W42A 4MA0A 3D9QX 4H0FA 4EHFA 1VG9B 2O3UA 3IQGX 1GGVA 1Y7LA 4E51A 4C4TA 1Y63A 2HCFA 2XJ9A 2C4VA 3I6QA 5EHXA 5JH7A 1K3FA 3BTSA 3VV2A 1ATIA 2Y2UA 3GLQA 3TGPA 3DMFA 1Q15A 3A6ZA 3FKQA 4XGRA 3WRXC 3V1YA 5JO9A 1SIBE 1CHDA 2QROA 3FSEA 2AC2A 3HEMA 4BMDA 3LPMA 1BE0A 5U1PA 2X1LA 3GUCA 4IHJB 4CFZA 5KTKA 2JJ2D 3NMUF 2VF8A 4I9HA 5GTDA 3BGWA 3HVRA 2NZWA 1K7EB 4E15A 4G07A 1NOKA 3IT2A 3K09C 2MT9A 4ZEOA 1P2VA 4EQZA 2C20A 5LOVF 2J48A 2WTAA 3OCCA 4LVCA 2FN8A 1AB6A 1U63A 1Y9EA 4B0PA 3FY4A 2VUUA 3MTBA 2J33A 2JFHA 2VSXA 1N4DA 3HA3A 5FHQA 3IB6A 5E1BA 4DLTA 4YQYA 1IXKA 3IUYA 2XRMA 3IR6A 2ZTUA 3O8BA 3G2KA 2JHGA 3LPDA 3OO0A 2PHZA 1TO1E 3I45A 5IAKA 4JB2A 3S1AA 4Y6PA 1T43A 3CKYA 4J2HA 4IEFB 3UT5B 4KB5A 3KHTA 1IBKB 1X1TA 3P9KA 5CLGA 3ABIA 2WOJA 1OXUA 3L3BA 2EL9A 1UIRA 2VF2A 4KDCA 5IZ4A 1MO6A 5SZIA 4HWGA 3VGJA 1J0CA 5BYKA 1OFHA 4JL6A 2I4NA 4HDKB 4M6WA 2VAVA 1Q11A 2L69A 4ND2A 4Z1OA 4DV1B 4UFNA 2HB6A 1M8PA 2QT0A 3DEYX 4LXHA 3RLIA 2MR5A 1J2YA 5BY2A 4IKPA 1I0ZA 1Z74A 4EYSA 5A4DA 1CRLA 3H7IA 2G09A 1IFXA 1P17A 1XC7A 3OPQA 1F8XA 3T9DA 3WL5A 3WAJA 4RY0A 5JY1A 3MAGA 3LH5A 4KQCA 2GAAA 1JQAA 2QVCA 3N3BC 2HTEA 1M34A 3V1KA 3H0CA 4BNYA 2Y4OA 4MMYB 2O7VA 1XVAA 4LE1A 3PGVA 5AJUA 3HHEA 1U7PA 2HXGA 1XOIA 3ASZA 1P1BA 1QGZA 1C8BA 5A5GA 3W2TA 4M53A 4TL9A 1TYDE 3IAS1 3NOXA 4RENA 3EGIA 3ESRA 4K0RA 4R2MA 4FMDF 3FETA 4QHSA 3N28A 3QKUA 4RF5A 3T7TA 4UQLA 2ONCA 3EF0A 2QN3A 4Z4HA 4N3BA 4MS1A 1RWPA 3GEGA 3GMIA 1ORDA 4U9HS 1M0WA 2A67A 4P22A 1D4AA 3HA7A 4JGGA 4QWWA 4TQ9A 5JCJA 3W9BA 3ZLJA 2DFVA 1G7RA 4ID9A 2UXBB 3Q9SA 1Q95A 1QQ6A 1R9GA 4OIMA 4D0SA 3MJFA 2G36A 3LXXA 2ZDQA 2EKQA 1BXRA 1B3RA 1F2UB 2VJOA 2ZULA 3F7OA 3BTOA 4NG4A 5DCLA 5LQMA 1L7AA 4O3MA 1XTBA 3QLVA 1OQAA 1N3LA 1P1IA 2ZRHA 1ECLA 2OUIA 4MV1A 4ND4A 4OQPA 4BKUA 4YGXB 5DJ5A 4C22A 5KOJA 2GBLA 3PXDA 4NDZA 1WABA 2GCNA 3IPXA 2AXQA 4G1EB 1XK7A 2X42A 1LI5A 4CLEA 3ROKA 3UHJA 1JPNA 4P4NA 4LJ6A 3UJ6A 3KQTA 1H4QA 1U0HC 3SHVA 1RWBA 1KBQA 4BFCA 3PR3A 1Z6PA 3L7NA 3LZ6A 3OEHA 4DMLA 3THSA 2DLCX 1FQJA 2E3JA 1QYCA 1UT5A 1OI7A 3FFBA 1P2UA 3L8ZA 3UPUA 4CMHA 1SHUX 5L3VA 1QF7A 2GCEA 2GMWA 2WU4A 1KDPA 2FZWA 2ZJBA 2ESRA 3FJ1A 5LQUA 3KPUA 2OBBA 1OLSA 1LGYA 2NTYC 3AI2A 4N03A 1SZJG 2O0LA 4QUHA 2P6RA 2UU9B 3PYXA 3DBLB 5AOBA 3CZPA 5K0LA 4BLUA 1DWPA 2GD2A 1A4IA 4EO4A 4AZ0A 4MVJF 1RABA 1SC1A 2JIPA 3RRMA 3UTDA 4C88A 4DN6A 2I2XB 2NG1A 1AHHA 1N0HA 2A7QA 5BSHA 1RRGA 3T3EA 1JAIA 2GX6A 2WU8A 4V0RA 1T5BA 1MQ9A 1ZCFA 4GXTA 2CLHB 4XUGB 4PNEA 5IJ9A 5FRDA 5IULC 4IJWA 2RE8A 2ECPA 5AVXA 3JD1A 1QHEA 3GZJA 4QFBA 2I2AA 1RAEA 1X8XA 3V7UA 4F8EA 4CV1A 4D4KA 3FFAA 3SE0A 1BWRA 4G1MB 3A9WA 4XIFA 1H6DA 4NJMA 3ZZMA 4EPVA 3O3NB 4QUGA 1EVZA 2G76A 1U0GA 2QPLA 3E7XA 1X1AA 4C4PA 1C2TA 3S68A 1SBCA 5C1BA 1IPEA 3ZV4A 3LPAA 1HLDA 1D8TA 1KOJA 2PLWA 3FMPB 3K0KA 1SR8A 1BEUB 3KFLA 3IVAA 1HDZA 4G5XA 4GOJA 3KVOA 1HE3A 2KM1A 3H99A 1W0CA 5EI5A 5T3UA 3PWKA 1GZDA 3QTBA 2ZM5A 1GAWA 3PICA 2OVFA 3DE1X 5IAEA 3ZQUA 4JV5B 1LBEA 5CB4A 4ZI7A 4FN4A 4R1LA 4KSYA 4RTQA 5EZ5A 2LPMA 3L1VA 1KC3A 5M2QA 3WADA 4QRIA 3EF1A 4A8HA 4ZQCB 1PL8A 2VYNA 3PC2A 5ALIA 3RVJA 4DREA 1KE2A 4YPVA 2R8BA 4ZYYA 1U6JA 2GM4A 1YRQA 1BX0A 2C04A 2ATEA 3GAMA 1DAHA 2GWHA 1YCGA 3GUVA 1Y8CA 2LCQA 1RXEA 1LPMA 1BHJA 1VSQA 4Q93A 1BHSA 3IUJA 4WUVA 3J80A 4WESB 2I8AA 4R1MA 4AXBA 3D1VA 1H93A 2XMDA 3G9TA 3GQBA 3SU8A 3B13B 1XRSB 1EUCA 1XDSA 5HJ2A 2ZXFA 1KYVA 4KV7A 4CMBA 2VDRB 2O3QA 2GLTA 2ASVA 3HNOA 3K2BA 4JMLA 4KEAA 4KQ6A 3RH0A 1CE8A 3A31A 3OSUA 3PNYA 5FBRB 1E3DA 1DXOA 3EIWA 3N59A 5BUZA 3D2AA 3KT0A 3H8WA 4EP1A 2GEFA 1JLHA 2XB4A 1H5QA 4NENA 1XZHA 3EEIA 3W5BA 1K7CA 3QXXA 5KWIA 4OLBA 3CH6A 3OMXA 2EJUA 3KKMA 1N5RA 4JQSA 3V8MA 3G59A 1F17A 7ADHA 4UE6A 3ZK9A 5JSQA 4ZAGA 3MPOA 3CW8X 1OPXA 2HKIA 4EB3A 3C8UA 1TT7A 2R96A 1OYWA 2F64A 3UAVA 5FA6A 5I3CA 3F4BA 4ZZ0A 1GPBA 4X6LA 3U7QA 3E3LA 1LLFA 3HCPA 4HT3B 2C1XA 5FD8A 1EFCA 1GY8A 5EZYF 3SI7A 3TOZA 3ZOZA 3IP5A 4BZPA 4ZDJA 2AOTA 4HDNA 4KWHA 1DCFA 4FFBA 4GMKA 2W6NA 2ABWA 5CLHA 4TV8A 3V4OA 2OC9A 3FVTA 1J8VA 3K16A 1Z4LA 3OTHA 4FYHA 4N1AA 1T6NA 5D85A 4GPBA 1ONBA 4TWZA 5TQ2B 3HYRA 2ZYGA 2P69A 4JWTA 1JG6A 3JD4A 4JLMA 2I2CA 1KHHA 3OE7D 2PAAA 4IFEA 1R5NA 3CCFA 3OFNA 4NNOA 5HCIA 4AZSA 4QGHA 5JASA 3LY8A 5EIFA 3OE4A 3G17A 2IYFA 3NOVA 4X63A 1R6AA 4TWRA 3K9GA 1ONNA 3EIQA 3P26A 2EZ8A 1MG0A 2PANA 3NDRA 3WDKA 1WSDA 3ERCA 2QUJA 1IY0A 5EZ6B 3IJEB 4HQNA 4YONB 3WYBA 4HGQA 5LQRA 3HI4A 3NBXX 2PX4A 1Q74A 4RL4A 3GPLA 4LRTB 1B1CA 3AHJA 1IJBA 2XUKA 5BSFA 3W6NA 3D0OA 3LLUA 4TTPA 1A5SB 3WBBA 2WYIA 2B8EA 1G6OA 3I3SR 4U6SA 4BTLA 5HQTA 1Y8ZA 2ADOA 3QFRA 1ZY2A 4ENUA 2ZCJA 4A73A 2BFBA 3KQNA 1D6SA 1OWOA 1NVTA 1NC3A 4XVRA 1T0UA 1HEUA 4ZO9A 3RFVA 1N92A 2F3UA 3ZWMA 1PX2A 2QL9A 1KERA 1SWVA 4B82A 3IERA 3RSGA 2ZI3A 4MRSA 4QOEA 4RMHA 1JG7A 2QX9A 2WAAA 5DB4A 2FX3A 2EBUA 5JVDA 4Z9FA 5C1IA 4CEHB 2FUG6 1P0IA 2DC1A 2Q9CA 3DMYA 4N7RA 4PYMA 3JR3A 4BECA 1S1MA 1VKZA 1I3MA 2OK8A 4CMJA 2XUQA 2DQSA 3UXYA 1U1CA 1JFLA 1RRMA 2HOQA 3QPBA 4QQ8A 5G0SA 5LA6B 1PKXA 3MN1A 2R9VA 3FVWA 2XIJA 4B5LA 1EK0A 2LW7A 1H6BA 1O2DA 2B0JA 3QP9A 2H4JA 3SZRA 2YWRA 4DR7B 1SY7A 3V7FA 3EBOA 1Y3FE 2B83A 1YZQA 1Z83A 3BCHA 5T8KA 3U1VA 4QFCA 3K6SB 1XWWA 1FFHA 2F59A 4YALA 2H3HA 3GJ3A 2F48A 4ZALA 3OLQA 1JHRA 1RKUA 3T3IA 4AROA 3AY7A 4UD6A 4X41A 5KDOA 1YUMA 5J23A 2PYZA 3OY7A 4L85A 5JCOA 2ILTA 1E2FA 1CVRA 2I2FA 3M5DA 4G1UC 4HDQB 2H5IA 1KTIA 4M8NE 4D8VA 4IDCA 2Q5IA 5BV7A 1XF1A 1E1KA 2AF3C 1JMVA 3IDFA 1KQOA 3ZU6A 1ND6A 4QXAA 1MVNA 2Y8EA 3DOHA 3TG2A 4R31A 3K1JA 3QLVC 4U7GA 4E21A 4W99A 3Q2KA 2XZDA 2CUNA 5FL3A 4IO0A 1XALA 1N32B 1GAXA 2BKVA 2GBLC 2WWFA 3FIJA 4ND3A 3CA8A 2I71A 3O03A 4ID3A 2EKLA 3VR4H 3BK1A 3GJ4A 4PSKA 5E0KB 3CW2A 2OCDA 2IEDA 3ENKA 4XX0B 2TS1A 3B6ZA 4L78A 1JAZA 3QKIA 1DDOA 4TL8A 5FNZA 4WLFA 1WZUA 4LSZA 5I7SA 2BEVA 3A2LA 1PF7E 1W5TA 2QLNA 1ZMRA 2Q3CA 2I6TA 2Z56A 4U1RA 2J4DA 2Z3ZA 4QPCA 5AHRA 4P4TA 2E4VA 5FTKA 5KYKA 1XVVA 2E4ZA 1PR6A 5DGCA 1JFFA 2C2MA 5HF8A 5BURA 5AW5A 2EKZA 3UUGA 2PN1A 5EP4A 5CDTA 4QUAA 2W2MA 1V6CA 5K0FA 1SD2A 5JCXA 3PFIA 2AZMA 5JS8A 4MLDA 5C8DA 1XKLA 1DXHA 5ESDA 2E87A 4C3ZA 3O73A 4HAXA 1MAVA 3AG6A 4P34A 3SC2B 3N8DA 3OIDA 4BE4A 5DX1A 5LDDC 1PUXA 3F97A 3N74A 1F4LA 2YDXA 4DLSA 5H1YA 3WGMA 4MJXA 3SLRA 4CU5A 4WJZA 1VM6A 3JYLA 4GP6A 3PWSA 2BEUB 2QR2A 4LZWA 2XD9A 3L6BA 4TUYF 3W6OA 2OXRA 1N6IA 3CVVA 2JCVA 3VJLA 3TAXA 3R4CA 4Q24A 3EVFA 3JVIA 4KGXA 5K3DA 1CUAA 3AUKA 4CQMB 3AX6A 2LKCA 3TB4A 3KIPA 4PZ9A 2GN1A 1GTJ1 1O03A 3NHPA 2OLJA 4DE5A 1TKAA 2PL5A 2QLTA 2AFHB 2JFPA 2VWQA 3B12A 4PYKA 3RCBA 3GJ6A 1KI2A 5LDHA 1CEEA 1BO6A 4RTJA 4XDGA 1P8AA 3SP1A 2DM6A 1ISMA 3NEAA 1O4WA 1X74A 4JB0A 3AF2A 3F6BX 4JR1A 4WKPA 3AB7A 4DIOA 3WL6A 5KCZA 4Y2SA 5KHLB 3B1WA 4FC7A 1W85A 4TTJA 2Z9CA 3A9RA 1SHTX 4JNCA 1CVLA 1CZOA 1PR1A 2CVPA 2DFLA 4FFPA 2GHRA 2P9FA 4EHBA 4OHYA 4TYNA 1MAUA 5IT0A 1TK2A 2VKTA 1RQLA 2ZJ3A 2CNBA 1TFUA 3JQ8A 5FWAA 3RJ9A 1L4UA 2JH3A 1Z0ZA 2WJGA 3DZJA 3R7DA 3ESZA 3DSRA 4R81A 4MAFA 2HLDA 1L7VC 2GESA 4DB2A 1WB4A 3VR0A 4PYQA 4B4DA 2J9YB 3NKLA 3RVPA 4PONA 4M9QA 2F1IA 2E6UX 4P33A 5ALGA 2CF6A 3GBVA 1DCMA 4A8TA 4A0QA 4EENA 2QTBA 3EA5A 4KIWA 4QJIA 1Q1BA 2VJMA 1U7XA 2ID8A 1CTQA 3GRUA 2YY7A 5IYZF 3EZGA 1C0KA 3TQQA 4CE6A 4I1VA 2A88A 1OYOA 4KWCA 3GLHA 3LS2A 4ZK6A 4HWPA 1QDEA 5JPDA 4I4NA 2AF4C 1RHQA 1X42A 2COEA 2DPGA 4KO1S 2EWVA 3OJOA 4LHZA 4RVSA 1M1NB 2IZ0A 2QRVB 4JR2A 3FMVA 5TRTA 2RHRA 1MOQA 4ND8A 3IDAA 4UM9D 5F35A 1CR0A 5P21A 1RT9A 2QP4A 4LDNA 3OQMA 4PSDA 4ZAYA 2GETA 4DY6A 3SEFA 5CA0F 1ORIA 2BKLA 1JU3A 3PE4A 3KB8A 1EFTA 1X9HA 3SHFA 3ZS8A 5JBQA 1HDGO 2AK3A 2HSZA 3GJSA 1PWEA 3K2IA 4RZ2A 2VT2A 1KPHA 3Q3EA 1RM5A 4N39A 4W5WA 4M1OA 4PLPA 1J06A 2C99A 1KZ1A 3BORA 3H0EA 3P5BA 4TMKA 2ZREA 3GGPA 3WHIA 2XUPA 3RRNA 4HQ6A 5ARBA 3I39X 2W8BA 4Y9TA 4FUQA 4ZN6A 1JEYB 4I8XA 4FBMA 2C83A 1DARA 1O6GA 1RHRA 2WU0A 4HMQA 2QJFA 5FORA 3RROA 1G3UA 3UKDA 1XMOB 2ZCVA 3R2JA 4YJ3A 5JARA 4FI3F 5BUQA 1Z4IA 2QUKA 4XYBA 3JZAA 5A62A 3ADDA 2QLLA 1CQJB 2MSCB 2VG8A 2X0DA 2Y05A 2XCOA 2HY7A 2B61A 2MIIA 2HWYA 5KJ6A 1U8CB 2P5SA 2VQSA 3V2UA 5BT8A 5D5HA 1OMOA 2YWGA 1JVNA 3EEFA 4A8JA 3ITKA 2DULA 1RI5A 2SCUA 2OCYC 2D5IA 4NCHA 3T5BA 5CAEA 4RV9A 2IY8A 5FUXA 3QWAA 1PG5A 4IF6A 3WV5A 1AJEA 2X9LA 2C88A 4AJKA 5I7HA 3MT8A 3AP2A 2EBHX 2GZ1A 2J3HA 2A3RA 1RJGA 2J08A 3SXPA 4FT2A 4U7TB 1AQIA 5JD3A 5KSOA 3DOFA 4I1YA 3QBDA 4P8RA 2PNJA 2QRUA 3DAPA 3KR2A 3MWYW 3NPMA 1H2HA 3PC7A 4CTKA 3K05A 1BCSB 2ZYRA 1LNZA 1YJBA 2HU2A 3L9XA 3VGPA 4OQDA 4A2WA 2I62A 3EULA 1A97A 1XP8A 3NO4A 3RS8A 1QGYA 3PUJA 3FMGA 1JYEA 2VYVD 4XYLA 2FVYA 5K45A 3RJ5A 1RPZA 3D5QA 3OAAD 4AP9A 3AFNA 1N5DA 3A06A 4DQ0A 4HFRA 5D1NA 1ZOIA 2QUHA 4DRXA 1H1LA 4O4HA 1O9GA 4ND7A 3W2GA 3THYB 3EVBA 2G9NA 2PD3A 3ONDA 3I9KA 4KH0A 4TTSA 4Z0PA 1KMNA 3AF5A 3SS7X 4LVUA 2H4HA 2P68A 2BFEA 5E7QA 3S8MA 2JI4A 3HP7A 1W6RA 2XGSA 3P0RA 4FC6A 4NS1A 1U8AA 4OXNA 4B73A 4DM3A 2Q3MA 3S55A 2JIZD 1ODLA 3WDMA 2FW0A 4KOAA 3LDUA 2ZIUB 3P9XA 5DBGA 2ZJOA 4P2GA 5AYVA 4HI0E 1EBUA 2DBVO 1H2RS 4NBUA 3ZY5A 4J43A 1DEXA 2CUKA 4HEQA 3PT9A 4CM8B 4KQ2A 5LKRA 5T8KC 2CNLA 3THOA 1WMDA 2VLIA 1I1NA 1L7MA 2VJKA 3BICA 3HJGA 3CLRD 1V6SA 3IVGA 3K35A 3L46A 4L5IA 4ZT7A 5KCMA 1KE1A 4LDQA 3V9PA 5JCOC 2AX3A 2R8ZA 4OV6B 2J6BA 4XCVA 1W5EA 2HV8A 3SBEA 3VSEA 3W1EA 4D81A 1GL6A 1SG0A 4JI8B 2ZT8A 1RYMA 1GTZA 2GZDA 3IIMA 4MWOA 4MWCA 4F2HA 5I7WA 3HXOA 1JSRA 5ALJA 4KZKA 2JLWA 3AMVA 1AG9A 1CR6A 4LE2A 3PEEA 1SQ6A 4REQA 1SUCA 2GBCA 2P4SA 2OM6A 1NDQA 3CNEA 3H87A 4FGUA 4PG4A 4XOUA 4PIVA 3U4QB 2NP6A 5CFZA 4MI3A 2CLSA 3DZDA 5A71A 4IKEA 2VAPA 4N5HX 1QO0A 1ZIDA 4N0EA 2DH5A 2FR0A 2W2QA 3DYVA 4AF6A 4GUAA 3KJFA 4L4RA 3PCXA 1G8SA 1WY5A 2CNKA 5CCXA 3ORFA 3VMMA 5T7BA 1N3BA 1YF3A 2JFWA 2AG0A 1YZFA 4YRGA 3F2VA 3LCUA 4EABA 4F60A 3ZCPA 4PO9A 5HX7A 2FPWA 3GZNB 5HTKA 5BWBA 3E3OA 4E7PA 1IMJA 3DWGA 4DLYA 4OUKX 3VZQA 4EUEA 3U7HB 2OHOA 3MT0A 4G0OA 3FPAA 4MA4A 3FR7A 3NXKA 4L9RA 1H9AA 2J6CA 2WDPA 2ZT5A 2OE2A 4YV2A 3K9CA 1U6KA 3P19A 5JI3E 5MN5A 3PFHA 3OWHA 2JVIA 3RKRA 4OU4A 2OLKA 1DC8A 2R6GA 2NZYA 5AW6A 4LXGA 4N5DA 4V03A 4YK7A 3LUBA 2GVDC 2IT1A 1ECBA 2CCJA 2SECE 2C8JA 4QELA 3RREA 1HM5A 1PYOA 1R0WA 1ST3A 3I34X 3O8QB 621PA 5H16A 1UKBA 1T13A 4KC0A 5BMVB 3KTFA 3RTGA 2B8JA 3VPAA 4S2UA 3QPVA 2VUHB 4N6NA 3VR6D 3LP6A 3LUHA 1MOPA 4P81A 3T7JA 3RU3A 1VYUA 1K6EA 5I7EA 2XDAA 3NVMB 4OHPA 3KRTA 3G2MA 1FMJA 1H6AA 4MKRA 4WTOA 1GKKA 4YRLA 3AJEA 2O8DA 4F97A 5B2FA 3N0RA 5EWJA 3WK4A 4BZQA 4PG5A 5LQKA 1U2SA 1MV5A 1CY6A 2GFIA 3AETA 4M1KA 3LYHA 4FWIB 4K2AA 1UDAA 1KJQA 3P32A 3RS7A 3G5UA 2PJZA 1KSFX 1NONA 4U2KA 2QUAA 4FGKA 3REOA 4J0EA 3OJFA 1HL7A 1SXGA 2H31A 3H2ZA 1GTVA 4KTTE 1CS4C 3E2MA 3WMWA 2DGDA 2HX1A 3GRVA 3DE5X 3T1OA 1WXHA 3UWKA 1OBHA 3EEYA 2PWBA 4MGHA 4XIIA 3DPIA 2TECE 4BU1A 3AUUA 5JH7B 1KYZA 2CFIA 3H9BA 2E85A 3UAOA 1HQKA 2HF2A 1EFPA 2ZYHA 2BFFB 4UD2A 4QTYA 4W5RA 3KWLA 3EZ7A 2RAUA 2J3KA 4DBZA 4WKOA 3NGLA 3F3MA 4MYRA 3AVUA 4WK2B 4R5HA 5F73A 1U7OA 1C1HA 5DK4A 1JNXX 1L5GB 1IK6A 4Z54A 4KNVA 5IJ0A 4CFSA 3WTCA 2XX3A 3MJ4A 4KAXA 3I8OA 1RIIA 5KNCD 3L0DA 1S2MA 1PJZA 5LZ8A 5HS6A 4NP6A 1EJ2A 4XOIA 5AUQA 1CNMA 5LKAA 1RCUA 1WF6A 5TDHA 1W9MA 2XIQA 2OB1A 2ZVPX 3COSA 4RWEA 4YMUA 5KS2A 1RTTA 2H63A 1EBFA 3FNRA 5KQSA 4YRFA 1PGPA 1DBWA 3HZOA 5L9AA 1BHO1 1Q0HA 4ETIA 1BE8A 1YAHA 2B82A 2H1VA 2HK6A 4KUGA 2WMOB 4V3BA 3WE7A 1OSNA 1AK2A 2WIBA 1FNBA 1JIXA 2GN0A 5D3MB 5EXDA 4BKMA 3ZJ4A 3A3KA 8AT1A 1Y8RB 1IULA 5KSZA 3HKEB 2YHIB 3PFNA 2MSEB 4FYIA 4DV5B 1EP3B 1D2HA 1PN3A 2VJCA 3QOFA 2ZUFA 1EVEA 1D1PA 2WIFA 5LP1A 4KX3A 4DUPA 1TTTA 3HKCA 2B1IA 4HEHA 3T3DA 1ZA1A 2NXNA 1Y9ZA 1V5WA 2W6ZA 1QFJA 3BIXA 4FNOA 4GP9A 2R5FA 2MU1A 4GE0A 2Q50A 5ALPA 1DIGA 4TKVA 4RFSB 1TUBB 5BR8B 2F43A 1TQ4A 4JT4A 1OLXA 3QG5A 1SVIA 3IEMA 5C9ZA 1V1JA 1KPIA 4P3YA 4GLLA 3R0JA 2KHZA 3B1FA 2QTMA 2JLQA 3CG0A 3CZMA 1FFWA 3C6YA 1GV0A 3R76A 1CDZA 1A9XA 2X8JA 1KO4A 3GXBA 4LDAA 4MV5A 4FIZA 3S0JA 4OGWA 3L7IA 4I50A 3TNDA 1SUIA 2V4ZA 1W34A 5CH8A 2IV7A 3EUWA 4GHWA 4F5YA 3G02A 5TPWB 3GFFA 1BWSA 2WHYA 2XTJA 2PUVA 3HH8A 2NU9B 3WTBA 4A8JC 1MC4A 2Q49A 3HL4A 4ARCA 1F8GA 3EXIA 1AOXA 3CF4G 4YJ2B 1JPUA 4JFAA 5JQWA 4NU0A 1I7PA 1JXQA 2WNHA 2WNIA 4IH1A 3FIUA 5EPOA 4AW9A 1UWVA 4CYMA 4DPKA 3B1XA 3HK2A 4LOKA 1NIJA 1DDIA 1MRSA 1WZ2A 2ZAYA 1FUUA 1O54A 1XPJA 4ICIA 3DV2A 1WP4A 3MLEA 2E0IA 4B76A 3B9RA 1GA1A 1E1QD 5BVHB 1TKRA 1FDTA 1W94A 2G5GX 1GUAA 2A94A 1R4MB 2G77B 3EDRA 2Q2OA 3GRYA 4GXQA 3BL8A 4RLQA 2ZVDA 2VDQB 2Q7OE 2ZT6A 3ZYZA 1R4ZA 5DRYA 1AY0A 3H1EA 1YRBA 1B14A 5KOHA 1UL1X 4G4IA 2NVUA 2D74A 2NGRA 3B2EA 4BJ6A 1P2SA 2QPAA 2Z2ZA 2ZUCA 3JQFA 3LWZA 3PQFA 2UYOA 2ZIEA 3K8QA 4IJMA 1KI4A 4R71A 3U44B 4E6PA 1RSZA 4XE5A 1MKYA 1NP6A 2Q2WA 5K05A 1KQGA 3LTEA 1SRRA 1X1SA 3PRYA 3RKSA 1FP7A 5DGXA 13PKA 1QLJA 3TLGB 4Y2GA 4Q19A 4PQRA 1SKQA 2P90A 3L7JA 3OESA 4GDFA 3ZNNA 2IODA 5I7VA 4MS3A 4RSRA 2IS6A 1WQ3A 1ZRMA 3JSXA 1QFMA 2VPZA 3DW3X 3Q7EA 4INAA 3ZNPA 4BAUA 3AOEA 3NPAA 1JGTA 2G40A 2W6CX 3HUEA 3FOCA 4BP8A 3S44A 3IQDB 3M4NA 3B2NA 3SNKA 1Z17A 4FNGA 4NONA 4XIGS 2FSIA 2HLHA 2HZBA 3A6FA 4HDSB 3QG1A 1V5IA 4I46A 2BR4A 2CCKA 2XH8A 2IDZA 3BMQB 4OX9Y 1QIFA 4JOSA 4N5LA 1QU3A 5E6UA 2YHSA 1UADA 3VKUA 1M2EA 3ZZ0A 2XB6A 2QGNA 3GAFA 4NMHA 2GCGA 4ZO7A 1GITA 4D3XA 4ENVA 1P4SA 1NXTA 5KQMA 1YZHA 2RGAA 3FJOA 3K0SA 3KJEA 4MW0A 5AJTA 4DQDA 7GPBA 2CL7X 2YRFA 1E79A 4UCQA 4WKCA 1SXIA 1CBUA 3LUDA 4J76A 4RKEA 5ALKA 4ZOLF 3LFHA 2VI5A 3W2EA 4AMVA 3K8ZA 4KACA 2ZYDA 2JI6A 2VHWA 2P6PA 4H6XA 2POCA 3WGUA 4CM6A 4TLAA 3RBAA 2BWJA 1KDOA 5IH3A 1Z4NA 3LCRA 3MGBA 4LJ9A 1F5SA 3LQ2A 4MS4A 3JXEA 5KNBA 4W5OA 3VBEA 3GLGA 2YN0A 3BD8A 3S5JA 1C2YA 5DBFA 3U17A 2O7NA 4PG8A 2A3NA 4EUSA 1E1DA 1F6WA 1O96A 1AKTA 1Q1QA 3FWKA 1CT9A 4FYJA 4AF8A 1GEGA 2QJWA 2J0QA 3FUVA 3CZAA 3WYCA 3SHQA 3KQUA 2VHXA 1D4FA 2YNMD 4YJHB 3NC1C 1A9SA 4XCXA 4KXNA 1A96A 3ZWQA 4CKXA 1PZEA 3B9QA 2QTHA 3F96A 3M1IA 1CYEA 5CFPA 2D2XA 1RRVA 4QUIA 1QC5B 4LNUA 1NQWA 3DXFA 3RWBA 1A98A 2ATCA 3AKCA 3OX1A 1XSEA 3C3PA 3KD2A 3NWPA 1V25A 5E9JA 2LVBA 3T8YA 1U4SA 2D1RA 2I9PA 5J1SB 3EWIA 4H1TA 4AO8A 3NBZC 5EESA 1C5KA 1CZHA 5DTJA 4OHMA 1T9AA 3ICOA 3L8HA 1AIPA 1YQWA 1TAGA 2XE8A 2Q41A 5T6BA 3DGFC 3VC7A 3FHJA 1SHZA 3QVVA 1CNFA 1FU8A 4AKTA 4BAGA 2B99A 1SPXA 5H8WA 5BXYA 5GWXA 2RGBA 1WB5A 4D74A 3EIHA 3HJFA 1H22A 4H0NA 2IWHA 2BZ1A 1JHVA 3AVPA 5BT9A 2JEZA 1PR0A 4MWDA 5BR1A 2Y77A 4HAIA 2IYXA 5FLYA 5BXQC 3KJNA 2PYDA 4L51A 3BH7A 4J4HA 1QIDA 4ZC1A 4W6ZA 2C7PA 3GNQA 1ULHA 2LDBA 4A2CA 2LDXA 1UP6A 2XHEA 3SJAA 4NFSA 4C5CA 5BSKA 3KWJA 5GPBA 2ZTVA 2ZRLA 3MB5A 4TROA 4F4CA 1BJRE 3FNQA 2GD0A 4E3ZA 3N05A 1G8HA 1Z07A 1GLVA 2FMIA 2O6HA 3TM4A 5EWLA 3DP7A 4IQ4A 2C7GA 1PEYA 3CS3A 1ORTA 1SA0A 2EOAA 3W6ZA 4C78A 2GBFA 1I6MA 5DIFA 1NYQA 4ZMBA 4V1CA 5E3IA 3INRA 3Q7PA 4OBWA 4P82A 4ER0A 3CZQA 1QH1A 3DUFB 5HE9A 2OXTA 3S2IA 1XMVA 4PNHA 2WWVD 1Z9BA 3WHKA 2AJTA 5EY5B 3UBMA 2QRPA 4DWOA 3DCNA 4RMGA 4UHHA 1J97A 1TKBA 1YQTA 3NVDA 2ORIA 5CDFA 2PQ0A 3MJEA 1NNEA 1PYDA 4B7CA 3AL0C 1NOJA 3WYAA 3ZE2B 2IDJA 2Y6VA 4AB1A 5L40A 4QM6A 3PDIA 1RAFA 3IEKA 4D9HA 1XT6A 2UZ3A 3IXLA 1A5BB 2XKBA 1INLA 4UCXA 1J49A 5ESRA 4JA2A 3LXUX 4YHHB 4EY8A 1E8NA 3UUEA 3AVOA 4Q4HB 1ML4A 2C2HA 1PRYA 1NMYA 2P4UA 1DBQA 3PQ8A 1CDOA 3ON5A 1T24A 1K8XB 3BF8A 4QTUB 3R7SA 5ALVA 3LLSA 1A76A 3AR2A 4OQFA 4QTXA 1G8KA 5G0TA 2H2DA 5JBIA 4MIYA 2D6FA 3W0LB 1SIOA 3UJHA 4UDXX 3U9TA 4AM8A 2PGNA 3QY0A 1H3NA 2CJXA 4TTQA 1BDBA 2MCFA 4EPWA 2JFZA 3C6ZA 3PXXA 4JP5A 3WISA 4BFSA 1H3EA 3Q9LA 1CUJA 1T4MA 5IXSA 2DYKA 3RYFB 2QX4A 1Z8NA 4JN6B 2RK3A 5ECWA 3P2EA 3EXEA 5LXTB 1A1VA 4NBVA 5DFAA 5BRAA 4KQEA 3IBFA 5FAXA 3JAKB 3MMSA 2XQJA 3T1HB 5BV0A 1CQZA 1RC1A 3GEIA 2II6A 2WSMA 4WOPA 1UXHA 4Q9KA 5E1DA 4L4XA 3QBJA 3ETCA 4HUQA 2MTBA 1YT5A 3KQYA 4S1NA 4PAOA 4MR8B 1QAQA 1J07A 3RGGA 4DDHA 1B8OA 1LC0A 2BCJQ 1N1MA 4LUCA 1YQDA 4TXJA 2HRRA 2I34A 1I4OA 1TYEB 5AKYA 1UKVY 1WXQA 2Z2YA 1LBSA 3MM4A 3ETJA 2WVJA 1Q50A 4I36A 4CI9A 5LJIA 2WABA 3VHQA 3W04A 2IHBA 2YINC 4GMDA 3T15A 2WPDA 4ZT4A 1JLMA 2J31A 1UBSB 2OG1A 2ZSKA 3HSKA 4G0XA 4C0BA 4D9EA 3R9IA 5KNCH 4KR7A 1L5HB 1QRTA 5FDFA 1W35A 5AI9A 1Q7CA 4DCJA 5TEWA 3ZW7A 2ANCA 3GU3A 4ZREA 5D6NA 4J07A 1AXRA 2PQ6A 3UATA 3NBQA 2ZANA 3GGCA 2F3TA 6AT1A 4JL5A 1UDCA 3PDCA 1S8NA 1SZDA 4O1IA 2XVXA 2Y1CA 4KQ9A 1J4AA 2NZVG 1KKUA 1OZGA 1TZMA 3RK1A 1LW7A 2A0FA 3C7CB 2P2SA 1WB6A 2XNHA 3ABOB 1M2OA 3FUTA 1I5RA 5AKHA 4E11A 5CFMA 9ATCA 3HYSA 3DEKA 3M4ZA 4YWHA 3UJBA 1X1DA 3ND9A 3EOAI 4MX8A 4X64B 1Y5IA 3GIWA 3WHLA 5I51A 1A9ZA 1KEZA 4UHKA 4D43A 2X3FA 2HF7A 1AO3A 4OL0A 1QV9A 1HURA 1EG7A 1G8PA 3THWA 3D2LA 2DTEA 2G7ZA 4MHTA 2P2LA 1J22A 3AH8A 4II3A 4LZAA 4AF7A 4DCMA 4YT8A 3LIIA 1J25A 2J5BA 1NYTA 3JQFC 3L0SA 1PDVA 5AI5A 3RRBA 1KDYA 2NTJA 3GZTB 1TEVA 1K5HA 1JR3A 2Q5LA 1C7EA 2CB0A 4FHFA 4MPTA 4QPPA 3D64A 3UAZA 3UG7A 4AC9A 5KWJA 3QUTA 5AR1A 4M6WB 1JBQA 2DHQA 4GI5A 1V7QA 2NYAA 4FQ8A 4JIMA 4N54A 4Y9SA 4E2FA 3KQLA