4DT1A

Crystal structure of the psy3-csm2 complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
193
Chain Sequence
MEYEDLELITIWPSPTKNKLCQFIKQNLSKEHVVTQLFFIDATSSFPLSQFQKLVPPTLPENVRIYENIRINTCLDLEELSAITVKLLQILSMNKINAQREPLKIILYINGLEVMFRNSQFKSSPQRSHELLRDTLLKLRVMGNDENENASIRTLLEFPKEQLLDYYLKKNRIKNGDSLAEYIWKYYADSLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome segregation in meiosis protein 2
publication title Structural analysis of Shu proteins reveals a DNA binding role essential for resisting damage
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 71
structure length 193
sequence length 213
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16834 CSM2 Shu complex component Csm2, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dt1A00
1N5LA 1JBKA 2AFIE 2BHRA 3BE4A 3ZZTA 3G82C 1P75A 2XTZA 3EXAA 1GWNA 4RD2A 2R9VA 4XJXA 2XNDD 4OI2A 5DGXA 1SULA 2G1KA 1NMYA 2HXSA 2BJVA 4Q66C 2KE5A 4TLBA 4YQFA 1KZGB 3KUCA 3NC1C 1Q22A 1R4AA 2YOGA 4LJAA 5J4YA 1T8TA 2PZEA 2O8EB 1KK1A 2QROA 2WJJA 3C14C 2FG5A 3CPJB 2ZREA 1F2TB 4YMUA 1OIVA 2V8OA 3GEHA 4QNRA 4ZIRB 2GNOA 1ONBA 1ZVQA 3C8UA 1FQKA 2QUZA 1YKSA 4C30A 1ZNXA 1XTSA 5FL7A 2HF9A 3A4MA 1KIMA 1RRGA 2CJWB 3NC0C 1XXHB 4ZDKA 1G7RA 1V5WA 2HCJB 2IYLD 1A2KC 5BN3A 3FMOB 4Q4LA 1IJEA 1JJ7A 4YMVA 1UM8A 4G5RA 4JKIA 4E5UA 4GOKA 1OIWA 3OE7D 3UXMA 3L8YA 4OI1A 1N6HA 1OV4A 1VCOA 3WBKA 2OCBA 2BBSA 4MKGA 5BYJA 3EW9A 1CTQA 4FWTA 4AURA 3VX4A 2Q3MA 5JHGB 2NTYC 3QOFA 2AKYA 5C4GB 2YC2C 1VYVA 2ZRMA 4URUR 1O87A 4EKDA 1I2MA 2NO6A 5EZ6B 1F5NA 1YR9A 2B7BA 1NY5A 3QIAA 2FPMA 3BBPA 3A1WA 3KQUA 2XAUA 1YZGA 3DDCA 3O47A 2PMKA 1I4LD 5HCNA 2OLKA 4FI3C 4GZMA 4A2PA 2VP0A 3B1WA 2AN9A 5DH9A 1Q3HA 1S1CA 3IHWA 2H7VA 1Z6XA 1G3UA 1VHTA 5L8VA 4NCHA 5DN6A 5F3WB 2ORVA 4D82A 1BYIA 1G7TA 4A1FA 5DE3A 3A4NA 3SQWA 3SR0A 5SZHB 4QGAA 1CP2A 4V0OA 5KSPA 1GM5A 4PHTA 1CKEA 1SXJE 3U61B 3FMPB 1NI3A 1K6MA 1H8HA 2J3EA 2O0KA 1GITA 1KDRA 3AH8A 1Z29A 4JLKA 2F55A 1Z5ZA 2ONKA 4FMDB 3SNHA 3CIOA 3W3AA 3CM0A 1NSTA 1R5OA 5C46F 2ATVA 2W2VA 4QHSA 4JL6A 3RS3A 2A5GA 1NF3A 4L4UA 3ZJYA 2F43B 4IOKA 2FZ4A 4Q1DA 4BRUA 1AKEA 1YZLA 1KOFA 4LYHA 4WA7A 2GBLA 3FHOA 2Q9AA 4JLMA 3HR7A 2J9RA 5AJYA 2GTPA 1E9CA 2NOAA 1JPNA 4NZYA 2W00A 2VSOA 3A1TA 3S1AB 1ETUA 1S9HA 5JRJA 2IXFA 4ZKDA 2O5VA 2FEMA 4JLNA 2QNRA 4IW3B 1XTQA 4IDNA 4JLJA 1QHXA 5H8WA 2GDJA 1T6NA 1ZD1A 2C5LA 2CCGA 2QM8A 3LQQA 1DBSA 1NBME 4XWAA 1TQ2A 4ERNA 2OCPA 2H8KA 3TAUA 1F2UB 1CEEA 5FOVA 2SHKA 1FTNA 4TZ6A 2ZE6A 2ZI3A 3KUDA 2EQBA 2GXSA 3NG1A 3L2OB 4PHFA 5JSZA 4R2HA 1US8B 1T9HA 1U99A 4FXPA 4GPTA 2ZIAA 1BOFA 5G3YA 1W5SA 4YLGA 1R10A 1XTIA 4V0NA 2V6JA 2W6JA 1SVOA 4M9QA 2O8CA 1Z8FA 2JLSA 3ZQ6A 3LAWA 2I4IA 2BMDA 2FE4A 3N5CA 721PA 3O8CA 2GHIA 2WVJA 1CJTC 4QJ4A 2RGAA 3EZ6A 1UFQA 1Q21A 2R62A 2XOKA 1II9A 2WOJA 2J0UB 4B34A 3LRPA 1UBCA 2Q9BA 4H1UA 1QHIA 4Z8YA 3C4JA 5CDFE 4C0AC 4TLDA 1OHHD 3MWJA 3CONA 1JAIA 1E1QD 4LJ5A 5FR2A 5FL3A 4A8JA 3TSWA 4EAQA 1VDZA 2R6GA 2R6DA 2W6IA 4LI0A 5HKKA 3GJ8A 4XWOA 4ZCIA 2NPFA 4GOXA 4B32A 1KDOA 1VIAA 1KNQA 2G9NA 1QF9A 3UWOA 3FKSA 1Z63A 1W36B 4JL8A 3HWSA 4II7A 4M1SA 5KTYA 3NHBA 4IVPA 3RAPR 2XXAB 1IN7A 1TQDA 2GJ8A 2P5SA 3CRRA 4EPTA 3K09C 3RS0A 1E0JA 1E0KA 3PFIA 3SJZA 3ZDQA 1EX7A 4LUCA 1NVVR 2PZGA 1AS2A 2W83A 4Q7MB 1NRJB 2QAGA 1ODFA 5A5GA 2ASEA 4EQ6B 2PLFA 3RS5A 4EPYA 1YHNA 5JHHB 3IPYA 4EFMA 2VO1A 1E9AA 4GOJA 2WTUA 4KYIB 1M2OB 2GEDA 1T0HB 1EFCA 4MH0R 1P9WA 1JECA 4HLDA 3U4QB 1II8B 1CRQA 1KI4A 2O8DA 2QP3A 3B5JA 3KJHA 3WY9A 5GJCA 2VHCA 3QKSA 3FOZA 1AIPA 2X1VA 3HDTA 3N2EA 1ZM7A 1RFLA 5IDVA 3HR8A 1F3OA 4XOIA 3T1TA 2YOHA 4Q9IA 1DAGA 1Q12A 2CNWA 3PENA 2IUUA 4KBFA 1E79D 2JLQA 5K8TA 1G4UR 1Q20A 1R5BA 4K46A 2Z5FA 1DE0A 4L5BA 4QBGB 4QJ3A 3BFVA 2O8FB 4JMPA 4KFSA 4MITA 2W2TA 5FTNA 1OYWA 1E2LA 1N6PA 1E2PA 1NVVQ 2FGJA 5J40A 1XCPA 3X1WA 2FA9A 5CB6A 3QG5A 3DM9B 1KI9A 3BC1A 4DLRA 3DEFA 2C98A 2J59A 3KJGA 2FJUA 4OHZA 4M22A 1Q1QA 2W58A 4BPBA 3GFPA 2IS4A 4HLCA 3EAQA 2EYUA 1JB1A 4MRVA 2ZETA 1IY1A 3GEEA 3C16C 4B6EA 3I73A 4B3CA 3RSLA 5KNCA 1G16A 4Q4AB 1D2MA 3Q85A 1N5KA 1RYFA 3R7WA 4CVNA 1KI8A 1Z2AA 4JLOA 1J70A 4DT1A 1P7CA 4N0DA 1OB5A 1PZNA 2D62A 4OQNA 4TWZA 3EARA 2QQEA 3X1XA 2HF8A 4PZLA 2FSGA 2GJAA 821PA 1KDPA 1RPZA 2VPPA 5DSZA 1FMLA 1TEXA 2IA5A 3SHWA 3DZ8A 3VKGA 2PEYA 4MUAA 1G17A 1UPTA 2OG2A 2WMNB 3OIYA 5KNDA 2WWIA 4BLPA 2ERXA 3D8BA 2ORIA 1I4DD 3KB2A 3WXMA 5LPNA 1MABB 2C9CA 2FFAA 3OEHD 1CR4A 5SZIA 3ADBA 3SDZA 3GPLA 1E3MA 3E2IA 1QHSA 3OZXA 4ILEA 3T35A 3CRVA 1Z2CA 2WOOA 4DSNA 4Q7JB 2D7DA 3ASYA 3GLIB 4XIGS 5AJZA 3QVVA 1G3RA 2ZJ5A 4PZZA 4WW0A 1HT2E 2F1IA 4TL8A 2X2EA 1N6IA 3ZVNA 1G8GA 2IF0A 1OXUA 3GLFB 2O8BA 4D4MA 4LV8B 5CK4A 3A6PC 1JALA 1JR3D 1G5RA 1XNJA 3KKQA 4B35A 1S3GA 2PT7A 2Z0MA 1AZSC 1P2UA 4S35A 1LW7A 4IHQA 2ZRHA 3CF6R 1RKBA 3RWMB 3VQTA 4P4SB 3AV0B 3A1VA 3CNOA 2QMEA 3RC3A 3UK6A 3V4FA 5M04A 1E2GA 2G1JA 4PAMA 4HAZA 3RSOA 2OO7A 3TH5A 3ZYCA 4LRWA 3BOSA 4ZPXA 2CVFA 1KSFX 4WBSA 2ZSFA 3WYAA 3KKPA 3ZD7A 2BEJA 1XJQA 1YE8A 3QPVA 2OHFA 4V0MA 3B2EA 3LLUA 1WDTA 2ZU0C 1DAEA 4MYCA 1CJKC 4PR0A 3BB1A 3K09A 4IDOA 2XGJA 5EXSA 1WE2A 4QGFA 3IEUA 1DELA 1P6XA 4GP7A 1TF7A 2ZI4A 3UMFA 2J46A 4D2IA 1SVLA 3EZ2A 4S2EA 4WVFA 1ZINA 2CL7X 3A1SA 3GLGE 1WBBA 3VR2A 3LO5A 2GVDC 2VLIA 1LF0A 4MKHA 5CJ2A 3SYLA 4D4LA 3TKLA 2GCPA 5E95A 3WRYC 4C4PA 1ZIPA 1HE1C 1R7RA 5L3VA 1GNRA 1ZJ6A 3GLHB 5DO9A 3AEZA 4NP6A 2Z43A 4C9BA 2FDCA 2FFHA 2ZRIA 2GCOA 2VHTA 3HP1A 3UATA 1NN0A 4TLEA 1VKJA 2IHYA 3LXXA 1KI1A 5EE3A 1G6HA 1GKIA 4KJZA 3EWAA 4JVMA 2E1RA 2X19A 1DO2A 4YONB 3CLVA 2ZI6A 5BN5A 4OK3A 1IXRC 4TT3A 5EE0A 4B48A 1T4GA 5CIWA 1LF5A 3PJRA 1E96A 1GL9B 4BUJA 2QE7D 1DARA 3F8TA 2IC5A 4TSFA 1NKSA 4AYXA 2O0JA 5JCPA 3K53A 4DLZA 3R8FA 2KWIA 4Z1MA 4DBLC 1QBKC 5DYIA 3TQCA 3GFTA 1EESA 1R0WA 2Z83A 1T91A 4Q4HB 4L8GA 3KL4A 1NKTA 4Y0VA 4MDFA 5L3SB 1BS1A 1ZNWA 3DMNA 4PZYA 5SZKB 1J8YF 2N42A 1Z22A 4KFRA 3B6EA 3GP8A 1W48A 2QPOA 4DDUA 3PEYA 2GCNA 4DLSA 3QKRA 4F4CA 2N46A 2UZ3A 1TUEA 2ZJZA 4R9UC 1RW4A 2DBYA 2X8AA 3R20A 4ACAA 4GMDA 2CHQA 2XSZA 4A6PA 4QG7A 4AK9A 2Z4RA 3Q7QA 3SYKA 1GG2A 4RVCA 1MO3A 3TSOA 3KTAB 4R71A 3NVAA 5DI9A 2R6FA 1B0UA 1ZC4A 1G5PA 2QTFA 5D3MB 1G7SA 4DUGA 1KSHA 2FSHA 2PX3A 1W4RA 4MDEA 1ZIOA 3UIEA 3K0SA 1DAIA 4QGHA 3IILA 2YVUA 1BO6A 4TTQA 2EFHB 2ZYUX 4WZAE 2ZR0A 3LLMA 4MGZR 2YJTD 4WXPA 1P60A 3VR4A 3TLXA 1GTVA 1G3QA 1OFUX 4B71A 2RGGA 1RRCA 3U3MA 3M6AA 2A78A 5JEEA 2J7PA 1HYQA 4YC7A 3EC1A 1KDTA 4DDWA 1MO4A 1JAHA 3T12A 3I3SR 1KI6A 1ZU5A 2C03A 2OFXA 3B1VA 3W6NA 4CEHB 2PEZA 1G3IA 3O8DA 5FPTA 1DS6A 3CZPA 4NDZA 2ZEJA 3FWYA 3MJHA 4EUNA 2REOA 3UKDA 4YDHB 4ARZA 4M1OA 1FNMA 3B8HA 1P2VA 3K9NA 3PUWA 1F6BA 1IN8A 3CUEF 1E1QA 2FNAA 3PR1A 1GL7A 1JJVA 1Z47A 4MRSA 4W5WA 5FBLB 4OHYA 1FTSA 3RWOA 4BFZA 2C99A 3IIKA 4YDSA 5KYKA 1SVMA 1XF9A 3VU9A 2GJKA 1N6OA 1XEWX 2A30A 3FVQA 1VG8A 3I1FA 3KQKA 5KHOC 1XTJA 1L4UA 2RCNA 121PA 3QF7A 5CITA 5HE9A 4Y0AA 3DPUA 1M34E 4PPNA 1W47A 5DI3A 4DC9A 1U0HC 3K0FB 4KVAA 1EX6A 4M1MA 1IXZA 3F3YA 4ACBA 4WXRA 1MOZA 2CE7A 2WJGA 3AVTA 2QBYB 2AXNA 2CHVA 1P9NA 5E7IA 2F1RA 2OBMA 1R0YA 3DO6A 5DYGA 3KQNA 2ODWA 2YC4C 2QMHA 2RB4A 4Q4JB 1K5GA 5F9HA 1G18A 5IT5A 1V43A 3QPUA 4IEIA 2JA1A 2ZJOA 5HE8A 4LYFA 1CBUA 3B1XA 3CF0A 3JZMA 2NPIA 3CR7A 2VQSA 1FFHA 5KSZA 1R8QA 1KO7A 5H68A 1E9RA 2QP4A 2ERYA 4I1UA 5EE5B 1R2QA 1BMFD 2IYVA 1ZD8A 1EGAA 2ANBA 2CHGA 1DAHA 1DVRA 1E9BA 1YZQA 2ODNA 1GAJA 1WA5A 2V9PA 3U44A 1S8FA 6Q21A 4A15A 3TVDA 1ZU4A 2FMXA 2WKRA 4RFSB 3B78A 1GVNB 4FW9A 1SKYE 1FL9A 1MO5A 2WKPA 5CLLA 3GLGB 4NCIA 1RJ9A 4MQBA 4DZZA 1P9RA 2PCJA 1SGWA 4RD3A 4KCGA 4BLRA 2IYQA 2OBLA 4HUQB 3M0EA 1D6JA 1W0KD 4M2LA 2ZSDA 3QJYA 3QF4B 4XTRA 1KNXA 3CBQA 3LD9A 2JJ8A 2KJQA 3C41J 2DCUA 1Q57A 5FTJA 2DFTA 2K5UA 2GXAA 1W36D 3ZS8A 4AKIA 5D3QA 2ZUCA 5KDLA 4HI0E 3M4YA 1Z07A 2G83A 2AR7A 1VHLA 4V0KA 1UJ2A 2BVNA 4HLUA 2IEYA 5AUNB 3FFAA 1KMHA 3JVUA 1E4YA 2G0NA 4Q03A 4TYWA 4KFTA 4UNRA 2OILA 2P3SA 1O3YA 1AA9A 3EA0A 3TIFA 1EFUA 3VR5A 4TMXA 1L7VC 2YNMA 1QRAA 3L0PA 5KSYA 3PUYA 4FN5A 1FZQA 3P4YA 3T61A 5JI3E 3NBXX 3IBGA 1OYYA 5JS8A 1Z6TA 2IUSA 4KYUA 1J7KA 1MT0A 3PG5A 4JJKA 1N25A 3THWB 1G64A 4JYCA 3REGA 3NIBA 1Z6AA 2H17A 5F2EA 1X8JA 5IK2A 2DYKA 2JLRA 2DPXA 4JLDA 4B2LA 2WJIA 3U5ZB 4IJMA 4PC7A 3KKOA 4W5JA 1GNPA 3FHTA 2NO7A 1E2JA 4IDQA 3GQBA 4KBGA 1VG0B 3ASZA 1XFAA 4Q9LA 4LHVA 4BZXA 2ZSEA 2DY1A 4KVGA 2DFNA 4QBHA 4ESVA 2QY9A 4UQOA 3K9LA 3P32A 3VR3A 4HUTA 4HAWA 2GXUA 3TUJC 4DSTA 1NMXA 1CLUA 1NP6A 2HCBA 4HZUB 2XZPA 4PO8A 4TQ9A 2WAXA 1W4CA 3THXB 2CCKA 4A36A 1ZNZA 1S0UA 1CR2A 2ZTSA 3QXSA 4UXHA 3LVQE 3FB4A 4OBEA 5C18A 5KDOA 4LBYA 1VECA 4DCNA 3NDBB 1BIFA 2CCJA 1U8AA 2GA8A 3AUYA 2B6HA 3RLFA 3D6TB 3I4LA 4P4UA 2LKDA 3BIFA 5H1YA 4URZR 2BMJA 2D06A 4TN1A 3PQCA 4LJYA 3SFZA 1SXJD 5TXGA 2BJWA 3FKQA 1GFIA 1P72A 2WIAA 5TARA 4YMTA 4LPSA 3OIVA 4HAYA 4CZ2A 1XB2A 1A5TA 2CLCX 1E98A 5GJWC 5J5CA 1E2IA 3EIHA 4M9XA 2OM2A 3EX7C 2ZSBA 1IY2A 2AKAB 3G5UA 4JLVA 4UKDA 2B21A 2EFDB 1RC8A 5J4KA 4UXJA 3AVOA 3LVRE 2C04A 4MKFA 3X1ZA 4GDFA 3EIQA 2J0VA 1IHUA 1Z3IX 2JGNA 3H84A 3CB4A 4OL0A 4F91B 1JR6A 4EFLA 2XJ9A 4XVUA 2O8EA 1A82A 2FH5B 1XEWY 2JJ2A 2V54A 1EXMA 1F2TA 4ZIRA 3RDPA 2A7QA 1NG9A 2IX3A 2VH5R 1NLYA 2PZFA 1XEFA 4FMDF 3I61A 2Q3FA 1N0VC 2ZJ8A 3LWNA 3TUZC 1AM4D 2CJWA 4LYJA 3VX3A 1XXHA 3LX5A 1E99A 4CW7A 2I1VB 3HYTA 4EPXA 4TMWA 1T3HA 2B92A 2HYIC 1D8TA 1XPUA 2GETA 3TRFA 1RRFA 5A0FA 4WZBE 2OEPA 1GKYA 1JXOA 3OAAD 4HYYA 2YKGA 4ASUD 3T34A 2J87A 1G4AE 3ADDA 3VNVA 4AI6A 1W36C 1KJZA 2NIPA 2GEUA 3B1YA 1KKMA 1N6LA 5FH9A 2PCLA 1WP9A 1T5IA 1QHHB 3GJXC 1D9ZA 4I1VA 4C7OB 2BWJA 2YV5A 3BJIC 2ZJAA 2KB0A 3IBYA 2IYYA 4QHYA 3N2IA 4ON9A 3SC3A 1VG9B 1IONA 3A1UA 4PC6A 221PA 2LKCA 4U00A 2F9MA 2FX3A 2P6UA 4BWYA 1U8ZA 3ZQJA 1YZUA 3L43A 3OIWA 3KFVA 5JFGA 4URVR 4JL5A 5K8IA 1R6BX 4W5HA 4DDTA 2XEXA 3K9HA 3K1JA 4RD0A 4Z54A 4X8MA 4NBSA 4IDPA 3WNDA 2MMGA 4M1KA 4HZIA 5EUQB 3Q7PA 3V4RA 1K5DA 3IIJA 3R9XA 1Z0FA 4BEJA 2FWRA 4IDHA 1UEIA 4I1SA 4LHZA 2WWWA 3PIRA 4YMWA 2BC9A 4CDGA 2RGDA 1KJWA 2ZI9A 3QUSA 1QHNA 5B30A 4G5QA 5DLQC 621PA 4V0ME 5TDHA 2WSSD 5FI1B 2A5DA 4BFWA 2ZR7A 2ZVQX 1DG3A 2XTMA 4LV5B 2WJHA 2QPAA 3U7EB 3ECCA 2YHSA 2P5TB 1NNEA 4G5SA 3BXZA 2JJ1A 4PSKA 3AP2A 3RRZA 2F43A 3ADCA 2ZRFA 1CXZA 1KKLA 2ZROA 4FCTA 3B85A 1P2TA 4BFSA 2AK3A 3PUVA 2DWOA 2DB3A 1OXTA 1XJCA 1XTKA 2F3RA 2QTHA 3V9PA 1Q1BA 4RD6A 5LB2A 2PJZA 3S1AA 4G1UC 1GDDA 1H8EA 2GF0A 4LWZA 2GESA 3D31A 4NKRA 1UADA 4TTRA 1SXJC 2GAAA 3VMFA 3AF3A 5FTLA 4M21A 3MAAC 1E2HA 1II0A 5JWHA 5KSOA 4XWKA 1S9DA 2OT3B 4B76A 1F2UA 3WYGA 1KI7A 1XMSA 2Q9CA 1HQYE 2YOFA 4PPQA 1VCIA 4YXWA 3P26A 4OYHA 2UZIR 1US8A 1IAQA 1YRAA 2GJSA 2RH5A 3AF4A 4NCNA 2IS2A 1BMFA 2QRZA 5FUVA 2GWHA 3AVXA 3SJBA 3F5FA 1XJ0A 2R6AA 3QXCA 4IEEA 5EXXA 4HLQB 5CJPA 1UKEA 3GJ7A 1ESMA 3K0AB 2I3BA 4KLZA 4RKFA 4U7DA 1VYUA 3U3OA 4NU0A 2TMKA 1ZW6A 1XZPA 4LJ7A 1ZAKA 3O8RA 2XITA 2NZ8A 2MMCA 1WF3A 2QSYA 4NPHA 1ANKA 2J0UA 5SZJA 2GK7A 4FMCB 4LC1A 3UG6A 5JZVA 4JYBA 2ZUBA 5DIFA 1DEKA 4LGMA 4I4LA 1SHZA 1W0KA 2RHMA 1IBRA 2A5JA 3H4MA 1CJMA 2ZYVX 3ONWA 1QZXA 2IYWA 2IS1A 5P21A 2JIZD 3QKTA 5HPYB 4TMZA 2PT5A 1UBFA 1LS1A 1T3SA 4PAQA 3L0OA 2XXAA 1JQLB 3W90A 3EZ7A 3AF1A 2OCYC 4P32A 2CDNA 2PLRA 3A37A 3MSXA 4M1YA 4QBIA 1VPLA 2ZQ5A 4DHEA 3FYHA 3KJIA 4EDHA 3C5CA 4FD2A 2QT1A 4DJTA 4EQ6A 3U6KA 1XEXB 3BB4A 2MSDB 2AHOA 3TW8B 1OW3B 1HY3A 1PUJA 3BRWD 3DOEA 4F4IA 3I5YA 5FBQB 2ZYWX 3A58B 1JEEA 3VKHA 1XD2B 5TY0A 2F3TA 3LBNA 4U5XA 2BMFA 2H1LA 4F92B 3U4QA 1HA3A 1II8A 2HUPA 2ZJBA 2CMKA 1QG2A 1Q1EA 3HU3A 4L9SA 1E0AA 1U0LA 4QXAA 2H5EA 1DAKA 3AVQA 5GVSA 1OJLA 2FU5C 4GFDA 5E3HA 4TMVA 3VTKA 2ZE8A 4HEJA 1SXJB 4DCTA 2EYQA 1PUIA 3KDSE 1TAGA 4O0MA 1G7CA 3QBVA 1P4SA 5FI0B 3I5XA 2XNDA 2ODEA 5LB4A 1ZD9A 3NKVA 4DSOA 2GKSA 2YWFA 4JJZA 3RS4A 2QP9X 4B3GA 1C9KA 4Q1AA 4IRUB 1R8SA 2ZI7A 4Q48A 2O8FA 4A0HA 3LX8A 1X86B 3B9QA 4MUBA 4NONA 2JLZA 3KFXA 1G291 4C2UA 5FOSA 2J45A 5EUMA 4CT4B 3B82A 1DPFA 3CX8A 3CR8A 3WRXC 3BS4A 5E7JA 2F7SA 4OQFA 5ELXA 5HR5A 1A1VA 2VSFA 5KNBA 4PC1A 5AJWA 1N0UA 2QZ4A 1OFTA 4Q4AA 3W8RA 4BLSA 4DXAA 5J4HA 2VRWA 5G41A 3EPLA 3TK1A 3RNLA 3EASA 4B6FA 2D2FA 3UANA 4TYPA 3OE7A 5FPYA 2FF7A 3I72A 3I92A 3AVPA 1TQ4A 3GJ6A 2JDID 2JLUA 521PA 3TGPA 1UBGA 2PBRA 4KSCA 3CH4B 3W6PA 5GJBA 3AQ4A 1MABA 2ZJYA 2AD5A 4D81A 2A5FA 4Z8XA 4BLOA 5LD2C 4N3NA 3SE0A 1N3BA 1KTVA 1AQUA 4PHGA 3UMRA 1Z08A 3PV0A 2D7CA 3U7GA 3NTUA 5JBQA 1VG1A 3QEOA 1XU4A 3GLIA 1M6NA 3VFDA 1OKKD 4NHOA 1HTWA 2ZRCA 4D25A 5TVKA 2QGZA 1XCGB 3BORA 4DCVA 3LW8A 1GILA 1I4TD 2ZRLA 1TU4A 3SBDA 3GLFA 3TBKA 1M74A 3C7KA 4LJ8A 4PQFA 3RC8A 1UEJA 1C4OA 4KODA 4UNQA 1ZMXA 2GJ9A 4EJSB 4E03A 1QVAA 2RKOA 3EG5A 1DAFA 1Z0IA 1VIYA 3ADKA 4JSYA 4PANA 4P4SA 1WMSA 1NVWQ 2L0XA 4W9MC 1IY0A 1ZM4A 2QG6A 2Q3HA 2FSIA 3RRNA 3SOPA 3GFOA 2E9SA 3OAAA 5AUPB 2V1UA 4ASUA 5B64A 5FL7D 1ZRHA 4LYAA 4LK2A 5CM8B 1MRSA 3T06B 2CL6X 3VAAA 2OFOA 4Z51A 5FUYA 3CZQA 4C0JA 1TU3A 3X2SA 3QXJA 3AGPA 4AIIA 2DWQA 5EP4A 3VNUA 1EG7A 5AJVB 4WAUA 3QBTA 1E2DA 2GXQA 2R8RA 3Q9LA 1Q44A 4DWJA 4KU4A 4HDQB 4DCUA 3KX2A 1LY1A 1QVRA 1UF9A 4ZDWA 1G3MA 1TEVA 2H16A 4LJ6A 3TR5A 3U6BA 5DNYB 5GVRA 4HB2A 3SBEA 2F9LA 2ZAOA 1N5IA 3DMDA 4C0LA 1COWD 1FX0B 3MMPA 4OHXA 2QGNA 1R0XA 421PA 3NBYC 5ANRB 4FCWA 1TMKA 2HJGA 3GLHA 4HDCA 4JZKA 4UJ5A 5L3QB 1PLLA 1G8YA 2IYXA 3TQFA 3PEVA 3T1QA 4OJQA 4XH9B 2BDTA 1IN4A 4Q47A 1BH2A 1DADA 2ONJA 2QEQA 3BB3A 4C2TA 1AGRA 1KAOA 1KI3A 4JT4A 3E1SA 4F4JA 4BQSA 3KXLA 1NJFA 1Z0JA 2QQ0A 2R65A 1ESNA 1ZC3A 2ZR9A 4JT2A 2WSSA 3PEUA 1DO0A 4QNMA 3K0EA 1JQJC 3ICEA 5DN6D 1FW6A 2RGCA 4TL7A 2GVZC 4QFMA 2D4HA 3OIUA 4LJ9A 1SVSA 3AKYA 4QM7A 1SHKA 4JKYA 1SQ5A 4M4SA 2BIFA 4M9ZA 4KAXA 4PSAA 5LD2B 1ZUHA 1LFDB 2H92A 1H8HD 4NYIR 3A4LA 2J0QA 3FPAA 4Q4HA 3DVLA 4UJ3A 5L3SA 1IJFA 4WOPA 3VKWA 2C78A 2GAOA 2JATA 2ZM5A 3EWSA 3KXKA 2FZLA 4NYJQ 5DHAA 2JLYA 2YYZA 5G3ZA 1CRPA 4OQXA 1M8PA 4PQYA 2H57A 4IVRA 2WWHA 2DR3A 2JASA 3PUZA 4BE7B 1I2DA 2ZRDA 4OHWA 1OT3A 5IRCD 1U9IC 2EWWA 2ZANA 3LQRA 3N70A 4DLVA 2J41A 1OHHA 1SVWA 4GI7A 2VHJA 3KTAA 1J8MF 2GF9A 2JLWA 2VF8A 4Q1CA 2G6BA 5D3MA 1ZM3A 3GCGA 4KSBA 2ZRPA 3X1DA 2D2EA 1FPMA 2RAPA 3KJEA 1QHGA 2OAQ1 3Q5EA 5FPHA 5KU1A 4O25A 4TLCA 2ZS8A 1AQYA 1GRQA 1UDWA 3ZLJA 4TYQA 4Q02A 2J0SA 4J0QA 1XXHE 4EPWA 2WPDD 5DISB 3IPXA 3I62A 3KQLA 5FOUA 5G40A 2LWIA 5FUXA 5F98A 4NYIQ 3CF2A 4IXMA 5IHPA 2QU8A 4GSYA 4CEHA 3VHXA 1KO1A 2NQ2C 4IOMA 4B3XA 2V1XA 1NVUQ 5HZHA 3FFBA 4NL4H 3BK7A 2JAQA 4RY2A 1X8KA 1ZCBA 1LTQA 2VHUA 1BYUA 5FPKA 2W6JD 2JEOA 1YZNA 3B7GA 5B2ZA 2WIBA 3W3ZB 3LH5A 4R98A 4DLXA 2OXCA 1E9EA 1XD9A 3B9PA 2VP6A 4LHWA 4LHXA 2EFGA 3RS7A 4E07A 2VP5A 2P0EA 5JCZA 1ZBDA 4TYNA 5B58C 1AGPA 2CXXA 2ORWA 4A2WA 3U60B 5EP3A 1KAGA 3ZH9B 4PC2A 3T1OA 3SZRA 5G53C 4B75A 1DG1G 3K9GA 3Q5DA 2ECKA 4CEJB 1E79A 1HQCA 1OIXA 2W6ID 4POAA 3THYB 3K0FA 3Q72A 4GMXA 1W4BA 4TL6A 3FKSD 1H65A 1N2CE 3P4XA 1TADA 2QBYA 1W5TA 4KHZA 2OV2A 1E0SA 2G3YA 3MRSA 3NEYA 5LDDC 3GD7A 4A9AA 1NY6A 1QHYA 4MYHA 2P6NA 1S96A 2G0TA 4IOJA 4Q4JA 1RVDA 4ESHA 4QL3A 3AVYA 1E9DA 3CO5A 1KO4A 3TR0A 4A92A 4Q18A 1IXSB 1Z6GA 2XJ4A 2D3WA 3MWYW 1KGDA 2IYUA 1L2TA 1P61B 4M9SA 4DIEA 1SKQA 4DEXA 4F93B 5K8UA 2QENA 4YMSA 4LC0A 2AWNA 4BLQA 2HLDD 4NH0A 4G01B 4CEIB 1EWRA 1Q3TA 3OF5A 5FTMA 4UXIA 3BERA 3H86A 1GZSA 4PTLA 2VHQA 2N1BA 3IUYA 1G6OA 2FN4A 4RFSA 4XD7D 3QXHA 3M1IA 1FUUA 2FOLA 3MJRA 1Z0DA 3QNUA 4BFVA 4AY2A 4ZKEA 1YZTA 1E9FA 4QBFA 2IK8A 3OEHA 2IHBA 3GLGA 5B57C 1U98A 3NHAA 5JRZA 4FWIB 2CNWD 4IFBA 1FQJA 4HUQA 2IT1A 4QJ5A 3F0TA 3QF4A 3FGNA 4D0LB 3TAHA 4PPFA 2F1JA 4OJKA 1NG1A 4AKHA 1YQTA 3L0SA 1IN6A 2CBZA 2ZRKA 4QRHA 4A0RA 4F7WA 2OUKA 3NBZC 3LFUA 2R2AA 1OSNA 1JR3A 2NMVA 1K8RA 4I99A 4MRNA 3SQXA 4Q19A 2C9YA 2VP2A 1U9IA 3ETLA 4KLNA 1AN0A 1QG4A 4H1VA 3ND8A 5LBIA 1J90A 1Y63A 3BH6A 3P1JA 1LS6A 3EPHA 3KZ1E 3GMTA 2AXPA 4RFVA 3Q8XB 4LCBA 1NL3A 4JVNA 2QRNA 1TNDA 2Q0HA 5CB8A 3QG1A 1LVGA 2HT6A 4KO8A 2UKDA 4US0R 3HPRA 4ZDJA 3UWKA 3ICQB 1WBDA 4B43A 1OH5A 1U90A 3HPQA 3CPHA 5BYKA 2NO9A 2NO1A 4BECA 5FBVB 4Q21A 1XD8A 1AS3A 1SVIA 4PAOA 3THWA 3P27A 1CF4A 1OKKA 3LXRA 1GNQA 3KB1A 5EQTA 1FNNA 1WRBA 1IOZA 3AP1A 4GP6A 3PCRB 3BH7A 3L82B 2QN6A 4U02A 2IW3A 1GP2A 2RGEA 4P0TA 1OH8A 1XMIA 1E4VA 2PMDA 1KYIA 4GT1A 2BOVA 4IFEA 1HV8A 2Q21A 5HTKA 2AD1A 4MYTA 4Q00A 2IYRA 3A36A 2ANCA 2WWYA 5JJLA 1NIJA 2BM0A 2V4ZA 3PVSA 2QT0A 2VSXA 5CIQA 4B3BA 4BEBA 4HZUA 4MGYR 1TX4B 4D80A 4JBXA 1U0JA 3THXA 4O2RA 2ZYTX 1F48A 2GRJA 8OHMA 2ZXUA 1AZTA 2F1HA 3EPJA 1WQ1R 5FTKA 1MV5A 2XX3A 1P73A 5JS7A 3AB3A 2P65A 3TMKA 4A8JC 1HT1E 4EIWA 5HZKA 4UNPA 2FV8A 2WMOB 2G88A 1CULC 2WKQA 3DHWC 1CR0A 1GL6A 1SZPA 4M1TA 2QE7A 2V55B 3RHFA 4V02A 4A82A 4DKXA 2JLXA 4O3MA 5HCIA 2ODBA 5BXQC 1ZUIA 2R44A 4RZ2A 3NH9A 2XZLA 1XMJA 3LV8A 1Y3AA 4W7SA 3UPUA 4ABYA 1NBMD 1D2NA 1Z6YA 3K70D 3CH5A 1JNYA 4G3XA 1COWA 2P2LA 5J47A 1L8QA 2IYTA 4US2R 1W44A 3FTQA 1OXSC 2IWRA 1XDBA 3I8SA 3OESA 3IIMA 1PV4A 1S3SA 4D0NA 2QAGC 3AVUA 1E32A 3CRQA 2KBFA 2QMUA 1XPRA 5IF9A 2B8WA 1NN5A 2WZQA 2C2HA 3BFKA 4QKQA 3EIEA 4LBZA 4BFXA 3ZS9A 2G77B 1VMAA 1RIFA 3L8ZA 4GRAA 4C0SA 5KDDA 1SKYB 2BMEA 1N6RA 1M7BA 4E09A 4PSVA 2BEKA 4C0KA 4N1AA 1S2MA 5JECA 1WB9A 2Q6TA 1QDEA 3FMIA 3HJNA 1R0ZA 1KHTA 4LY6A 3QEJA 4QC2A 4ZI3A 2REXB 4BZPA 5BN4A 2IBMA 3QENA 2WSMA 1GOTA 5JWRA 4D26A 4B33A 4C0BA 4GZLA 3AGQA 2XZOA 4DLTA 1OFIA 3IGFA 4TT3D 4NE2A 2F6RA 3KKMA 3E5HA 5JSZB 1EFTA 3AKCA 3OEED 1EFHA 1W0JD 4TSFD 4EPVA 4BFYA 1YVDA 3VR6A 5EZ5A 5GADl 3WBJA 1XCMA 4IVQA 2A9KA 2VP4A 4Z1MD 3K0CC 4CIDA 2ZRAA 3B13B 2O8CB 4QHTA 1ZM2A 2DFLA 1QHHA 4C7OA 4NYMR 3TE6A 3BWDD 4DRZA 2REBA 1OE0A 3WNCA 3W34A 3GLIE 4OK5A 5CK5A 3TVTA 2WWGA 1J99A 1DTSA 3IO5A 5AK0A 2HJVA 2V7QD 2O0HA 3U3KA 2ATXA 3SYNA 4E22A 4BFUA 3GLFE 2XSZD 3DZDA 3PITA 3CX6A 2OLJA 4A4DA 4JLAA 4A8JB 2WPDA 2HXYA 4LJ4A 1UAAA 4RZUA 1PVOA 1X1RA 2YZ2A 4DUGD 4R2IA 4DB4A 3AP3A 2OZEA 2RHDA 5FFMA 1G41A 3AUXA 1R5NA 4OI0A 4CF7A 4F38A 4ZV4A 1XPOA 5C2JB 1KY3A 2J7PD 3GJ4A 3LDAA 3ZIAD 4A0FA 2HT1A 1VCNA 4L16A 3R9IA 3QI2A 2NG1A 4G5OA 2YWGA 3LY5A 3MWKA 4NYMQ 2QAGB 1G20E 1X8LA 1OXVA 2WAYA 1GIAA 1C1YA 1ZCAA 4FMCF 4Q9JA 1YU9A 3H2YA 2V3CC 4HAUA 4AG5A 4CGZA 3EZFA 3QXXA 4QGGA 4TMTA 1GUAA 3CRMA 4MA4A 2QORA 1DOAA 4N0EA 4KXFB 3FHCB 4Q7LA 1W7AA 1CIPA 3ZZ0A 3U7FB 1GKUB 2O8DB 2BCJQ 4LHYA 2NZJA 3GLHE 2AL7A 3QKSB 1UKYA 2GEVA 4A0GA 4KI0A 2B7CA 1AK2A 2P67A 4RD1A 3RYTC 2EFEB 5EE9A 3W5IA 4AWXA 1Q1ZA 1NJGA 4HB4A 2ZUDA 1CS4C 2ZAMA 4M1WA 3SU8A 3K70C 4X8HA 1M7HA 3FDIA 4AKGA 1E2KA 2OXRA 4XTCS 2CK3D 2J5XA 4B2IA 2QAJA 1A7JA 1KO5A 4DLUA 2BBTA 4LBWA 5JI2E 4JVSB 2IYSA 2ZVPX 3EPKA 1M1YE 1XX6A 3FMFA 3ZVLA 5BW8A 1AKYA 2BCGY 1EFRD 2V6IA 1G1MA 5EXTA 1U94A 2ZRJA 1G21E 4OK6A 2WM9B 2IWHA 2CL0X 3KKNA 3R8CA 1PJRA 2HLDA 2JCSA 4D6PA 1T3LA 4AC9A 4XVQA 1CJVC 5DHFA 1E94E 4US1R 2WBLC 4TZ0A 3K0AA 3CWZA 3OFND 3PXGA 3ZZUA 2FEOA 2OCAA 3JZAA 2IEZA 4XD7A 1FOEB 3NBFA 4FIDA 3I8XA 1UBEA 1YR6A 2VEDA 4PFSA 3R7WB 2CEAA 4DT1B 2P6RA 2FFQA 1WXQA 2OBNA 1TF5A 1D9XA 4AD8A 2FPLA 4EJSC 2GZAA 3C15C 3AF2A 1E9SA 1S1MA 2JLVA 1XRJA 3IEVA 3U3RA 3SJAA 5F9FA 1E6CA 1UKVY 1W46A 3LW7A 3D7MA 4HDOB 4K81B 4Q1EA 1X6VA 4OKSA 4V0LA 5EP2A 2A5YB 3QKUA 5J4VA 3SI7A 4RZXA 4RCYA 3U2QA 2BBOA 3W5JA 1GRRA 3DKVA 2KSQA 1NMZA 1LB1B 3K0CA 4NMMA 4OQLA 4Q9KA 4A6XA 4LSGA 4HAXA 5CLQA 4I1OA 4JSTA 1NLFA 4WZ6A 2VYFA 4JS0A 3T15A 2VIIA 1G8PA 4BLTA 4LX0A 1A4RA 4OHVA 2O8BB 5JJIA 3MCAA 3SN6A 3CX7A 4RJLA 3EZ9A 2GZDA 3MWLA 1MRNA 1X3SA 3RVBA 1NLZA 1NIPA 1XEXA 2QA5A 4HSEA 1W4AA 4M0LA 4XSGA 3TW4A 4R7ZA 3H0KA 4B74A 2X2FA 4OI4A 3SJCA 3IKJA 1VYTA 1XD2A 1RE0A 2GZHA 1LV7A 1N0WA 1W49A 4IKEA 1FP6A 1JI0A 2ZI5A 4CT5A 5FOWA 2C9OA 2HDNB 4BZQA 4ZCMA 4BFTA 3MGCA 4BGDA 1FUKA 1SXJA 3GJ3A 1E1RD 3K70B 2AK2A 2H18A 4M8NE 4Q5IA 3LBHA 2ZRGA 4NCJA 1N6KA 3NWJA 1W1WA 3SFVA 1RRPA 4L9WA 1XWIA 2QM7A 3KQHA 2RGXA 4QM6A 5IK2D 3U7HB 4LOAA 4ZDIA 2NO0A 3VR1A 2D74A 1HE8B 2X77A 1D5CA 4IOLA 3V00A 4D0GA 4KFUA 1E2QA 2Z6VA 5EP1A 3GEIA 4MRPA 3CKLA 4ZI2A 1TF2A 4XVRA 2IF2A 1G8FA 1YR7A 1XMVA 3MG9A 1HURA 3CPEA 5BWMA 2MSCB 1XP8A 2EU8A 2PH1A 2A3RA 2GCOB 4P4TA 4P3YA 2CE2X 5JEDA 2YWHA 1FMJA 4DVGA 1YR8A 2C96A 5H70A 3CWQA 1Z83A 4P31A 2W0SA 3BGWA 4QOSA 4URWR 1N6NA 2BM1A 4HB0A 1NBMA 1NVXQ 4AYWA 2ZRBA 4L15A 5E4FA 4M53A 2VA8A 3WP1B 4FMBB 2IYZA 1CR1A 2RGNC 4DB2A 5UKDA 3GJ0A 3BH0A 4BASA 4TQAA 1RZ3A 2WJYA 2Y8EA 5FOTA 2VF7A 3DL0A 3HU1A 1NN3A 1U81A 2CLSA 1UDXA 3CRW1 2KI5A 4FINA 3SEAA 3UMSA 1KK0A 4Q7KA 1YJ5A 3OHMA 3P20A 1P62B 2DFKB 5E7MA 1G5TA 4HAVA 5EE1A 4D4JA 3WMFA 3WP0A 4DDVA 2FGKA 5FBWB 4UNNA 3E70C 1TTTA 2LCFA 1EK0A 2ZPTX 4DLWA 3CNNA 2OESA 3JVVA 3QE0A 4PC3A 1YZKA 1MR3F 1IM2A 2A2ZA 5EJEA 3TSZA 2ZS7A 1G19A 1LNZA 3QKRB 4JBYA 1J2JA 1Z28A 4Q1FA 2IXEA 1NSFA 1E2NA 2IUTA 1TQ6A 4RD4A 3T5DA 2BV3A 3DKPA 4LV6A 4TLAA 4ZO4A 5C1BA 2AFHE 2BKEA 5CDFA 5AUOB 1JR3E 5J4LA 3WHLA 2J7KA 1CJUC 3MD0A 4EJSA 5AUQA 1T0JB 1JPJA 1VCMA 2ZSAA 2OFWA 3O8BA 4NYJR 3PEWA 2JJ2D 1T5LA 3AKDA 5CYOA 2J1LA 3TUIC 2XTNA 4AKEA 2ZJ2A 4KITB 4RKEA 3OEEA 1XZQA 1W0JA 2BKUA 4ZCLA 3RABA 2WWXA 3CW2A 2IL1A 3W6OA 4D4KA 1OPXA 1PLJA 3X1YA 2E87A 3ZGXA 5CYPA 4X8LA 2O52A 2NGRA 3HU2A 3DM5A 3LA6A 3WMGA 2GK6A 2OSBA 1G8HA 1KI6B 3NH6A 5CM9C 3IQWA 3C5HA 5JLJA 5JJKA 1KK2A 4B73A 1OFHA 2V7QA 1KZ7B 1KMQA 4GNKA 4AYTA 5K8LA 2QTVB 2DHRA 1KSJA 4G0NA 3WHKA 1F60A 2W2XA 1ZYUA 4TL9A 5KPJA 4HLUC 4DLYA 2YINC 4ARZB 1IN5A 1WCV1 5KOYA 1ZNYA 1FX0A 3QY0A 1E69A 3CNLA 4Q1BA 4B3DA 1OXXK 3TJZA 2EWVA 2ZE7A 5L3RA 3NEJA 2WWFA 4C0QC 5L3QA 3VU9B 2WICA 2VTKA 5C4MA 3G0HA 2EFCB 4PO9A 3T1VA 4AG6A 2QPTA 4MGIR 4B47A 2QMOA 3RRYA 3A8TA 1YRBA 4JIMA 1W2HA 4PO1A 5DI3B 5TB5A 4GL2A 3ZIAA 4B44A 1HEIA 3NDPA 3QVUA 5FUWA 3ZVRA 1ZM9A 4LPKA 4B2PA 2XB4A 2XB2A 2XNSA 5JWOA 4H9GA 4PXAA 1W2GA 2RMKA 3PUXA 3AF0A 4C0HA 1OF1A 4JLPA 1KJYA 1P5ZB 1HUQA 1XBTA 4TTPA 1ELOA 1OLOA 2WV9A 1KO8A 2IS6A 4LZZA 1KK3A 2GILA 3D3QA 1D2EA 4JBWA 2JJ1D 3BAFA 2PJRA 3BD9A 4DIDA 4BRWA 3B1ZA 2EVWX 3RRMA 4FCVA 2FPKA 2R6CA 4G5GA 1U2RA 1T8UA 4B3FX 4URXR 3U44B 1IQPA 2RGNA 3IQXA 4MGKR 2AX4A 2CK3A 4LDJA 2DWPA 1M7GA 4Q01A 3K8YA 4NCKA 1B23P 4IXNA 2XOKD 3I32A 3IDQA 4JLBA 1EWQA 1H8ED 1KI2A 3AKEA 1OB2A 2JIZA 3BFXA 5BQ5A 1RJ9B 2HEIA 1S4QA 1EFRA 2UVQA 5AWFC 2CLDX 4I81A 5EXPA 2PX0A 2HYDA 2ZRNA 3MUFA 1MKYA 2FSFA 4TQUS 1UKZA 5FOXA 3R9WA 3LNCA 5HKKD 1BKDR 1FP7A 1JXMA 1Z06A 2VBCA 1Q0UA 5KUTA 2B8TA 4DCSA 4PHHA 3OFNA 4YXWD 3RANA 1OH7A 1MO6A 3Q3JB 1N5JA 1CU1A 3WNBA 2ZE5A 2QI9C 3DOFA 1E2MA 1KMHB 1RYHA 1PLKA 3QSYA 1TL7C 4DEYA 3EC2A 4O2LA 1Z0AA 3ZVMA 3WYFA 1E2FA 5JMTA 5KO2A 1AJEA 1OH6A 4TYYA 2C77A 3ND9A 2OE2A 3EA5A 3IHLA 3LBIA 4XSHA 3KXIA 1XTRA 3GJ5A 4A2QA 1MH1A 5KPDA 1KY2A 3QQ5A 4MYUA 2AWOA 4MKIA 4PX9A 3RS2A 1GRNA 1U8YA 3SHFA 2OAP1 4MRRA 4WIAA 4PPGA 2BBWA 2VL7A 1L4YA 1AS0A 1E2EA 4CEJA 4URYR 2YWEA 3AVVA 4V03A 2C95A 3THYA 1G9XA 3H1TA 3IO3A 4LBVA 3J81k 3W8NA 2ZU6A 4UNSA 2WHXA 3AM1A 2VP9A 3QPWA 1HH4A 2PL3A 4KV9A 5FBRB 5TMPA 1ZP6A 3FE2A 1JEDA 1ZUNB 3T5GA 2RGBA 3REFA 1NN1A 4RCZA 2CVHA 4RSGA 1VTKA 1KSGA 3SS8A 3NXSA 3AVWA 1DAMA 4TMKA 1GSIA 5AR1A 2ZS9A 4HB3A 3W9YA 3MFYA 4RZ3A 2HV8A 4JVLA 2IXGA 2I1QA 4OQMA 4PQRA 3VHLB 3WMEA 4EPRA 2W0MA 1A2BA 5FPSA 1P3JA 4CYMA 5A4JA 1TPZA 2EW1A 4GBMA 3B60A 5TV2A 2FFBA 4CRWB 5AJXA 2QL6A 1X1SA 4HATA 3HYRA 4NTZA 4ITRC 2GBLC 1E1RA 5GJVC 1P2SA 2KBEA 4P33A 2ZITA 3U3JA 3UG7A 2QSZA 2Z4SA 3ZD6A 4EFNA 4CEIA 2C8VA 2WJVA 3MLEA 4K8OA 4DSUA 2MSEB 1Z0KA 4Q9HA 3TNFA 5FR1A 3THOA 4C3ZA 3L0IB 4X8OA 2JDIA 1TUIA 1SVKA
chains in the Genus database with same CATH superfamily
2A4KA 2YQ4A 1IEVA 1JVSA 3BE4A 4JEIA 5HG0A 1QKIA 3LA8A 3WGGA 1T6YA 4CXMA 2XTZA 4IZ6A 2AQHA 4QYSA 4OI2A 2YN2A 1MOPA 5DGXA 4HN9A 3VC2A 4QTYA 4DR1B 4D4GA 2VPTA 1TM2A 4Q66C 4TLBA 4YQFA 3OPXA 2A1UA 4MW5A 1UWLA 4YRKA 4R0MA 1JN0A 2FFRA 4BVFA 1TJYA 2VA9A 3BYZA 4WY5A 4QE3A 4DJEC 2V6GA 2PR7A 3W79A 1XZ8A 2D8MA 2YOGA 2JGDB 3DBHA 4EG6A 5AVTA 5LC1A 1ULHA 3HHPA 1KK1A 2QROA 2QRPA 4MVJH 1O6CA 1XZMA 3GNQA 2C3PA 3C14C 2FG5A 4JT9A 2VYND 1G55A 9LDBA 1ZHHA 1NJSA 3G2PA 3IBFA 1F2TB 4P4NA 2V8OA 2QVLA 1VBMA 3WWYA 2GNOA 4ZYWA 5KTOA 1QF6A 2I4OA 2QUZA 1YKSA 1E58A 1QQ7A 3VSAA 3KG2A 1C3LA 4B5LA 5FL7A 2O3UA 3A4MA 4BATA 4DANA 2OVFA 1RIIA 1XXHB 2WJ4A 1A95A 1PK7A 1ZWLA 1PS8A 1SOMA 3C39A 4Q24A 4WBXC 3S2ZA 3Q8LA 2VJPA 3MQ2A 2NLOA 4DIUA 3OJEA 3FMOB 1KETA 1QONA 3WG9A 1UM8A 1UM9A 4HXGA 3F6SA 4G5RA 4QUBA 4LYGA 4ZVTA 4GOKA 4E5UA 1CB7A 2WF5A 2R11A 5IVIA 3UXMA 1PHPA 2NZUG 5HVNA 1OV4A 2CHUA 2BBSA 1BWPA 1U9JA 3E2MA 3EW9A 3W7VA 1M1ZA 4FWTA 1CX9B 5JHGB 1QO9A 1H85A 2AKYA 3HV2A 1W581 3RSSA 1XV5A 1VYVA 1RKXA 3E7PA 4JBIA 4R7GA 5E9QA 2ZRMA 4URUR 3ES9A 5F12A 3ZU6A 3EXFA 2IHTA 1I2MA 4EJ2A 3WLKX 3BGVA 2ECFA 2XGOA 1HTTA 1FXSA 2HMTA 2HTEA 3ZGZA 1TAHA 2GD2A 1TTHA 1CVLA 1AGXA 2XCOA 3LJKA 3A1WA 2V9CA 1SMKA 2XAUA 3ESCA 1I4LD 5KNLA 1YI0A 4W63A 3BJZA 1EHIA 5HCNA 4AJKA 1PWXA 3NIGB 4A2PA 5IBCA 2BKLA 2PA0A 1M34A 4OEHA 2BGTA 2AN9A 3OQJA 4BNZA 1AXRA 1HMYA 3A1NA 3R1IA 5ITZB 5CEJA 1NFFA 4KRFA 3D02A 4RHTA 2MR6A 1Z6XA 3EGIA 1G3UA 3PQEA 3VHRA 5L8VA 4D3DA 4NCHA 5DN6A 5MN5A 5F3WB 4D82A 4B7CA 4DRXB 1G7TA 3SQDA 1YUNA 1TQHA 4MDHA 1OFVA 3A4NA 5DE3A 2H6EA 3SR0A 1TA9A 5DU2A 3SQWA 4QGAA 5EIFA 3NGMA 4B6SA 2Q5CA 3MWEB 4EHDA 3WIEA 2ZAIA 4MKRA 3FNGA 4E2ZA 1C4WA 3BMNA 1H8HA 1GITA 2O0KA 4QA9A 2QRQA 3AH8A 3KM0A 4JLKA 4JVOA 2ONKA 3R5FA 1CUWA 4BQEA 3MRXA 1BE1A 5HF6A 1ZA2A 3ABQB 5F1PA 3UB4A 1FX1A 4QHSA 4JL6A 2VS1A 3RS3A 3BRQA 2ESRA 1XF1A 2GUWA 3K8QA 3KZKA 3OM0A 4PYMA 1C50A 2QDXA 1OYVA 4AZTA 1YZLA 5LZ5A 4YJ2A 3MXOA 4RJJA 4Q6BA 2BR4A 3T5BA 3ME5A 2J9RA 4ZVNA 2OK7A 1AQIA 2Z8XA 3NFYA 4YRGA 4B80A 4ND8B 3SKXA 4ZHQB 3Q10A 2C8LA 1LLFA 1Z6QA 2P9HA 4BLVA 2YVQA 3F5SA 2W00A 2G4LA 3O8LA 5CHEA 1RPNA 3PP8A 1S9HA 1YQ9A 3ESZA 2IXFA 4FEGA 3G88A 4C21A 1W4ZA 2FEMA 4JUBA 5MGNA 5K4GA 3CEAA 4IW3B 3R8XA 3MOIA 2AKEA 2GDJA 5AVYA 3OQNA 4F3CA 2QX9A 3AY6A 1BJKA 3H5IA 3Q12A 1LPAB 1DBSA 3VVCA 3ICPA 3VU3A 3PHGA 4OLHA 1TQ2A 4CN8A 4MIKA 4CG3A 2H8KA 1CZOA 3TAUA 1F2UB 4XJVA 3IUMA 2R1VB 2BZ0A 5ICGA 2B9VA 3ANTA 1HSZA 1MAAA 2ZI3A 3CN7A 2W6QA 1JFTA 4IMRA 4R2HA 1US8B 3AFNA 3BMQA 3KD2A 4C43A 3VR4D 2ZIAA 1BOFA 2GEBA 3N2ZB 4YI5A 4XFKA 3KOZA 3GGCA 1VMKA 1SH7A 1DQNA 3KPYA 1N5MA 4Q37A 4V0NA 2CN1A 4YLGA 3J81A 1M2KA 1SVOA 2J4FA 4U6QA 1QIHA 3ECSA 3LAWA 1IJKA 1FC0A 1ZKDA 4MKZA 3N5CA 3O8CA 4KMSA 3RSQA 2WVJA 2IOFK 1WUKS 2EC5A 3PNKA 5EWJA 3KYJB 1NPYA 3GUUA 4QJ4A 4RV5A 3QYJA 5G0TA 4CKWA 3HDVA 1PTKA 1Q21A 1Y4SA 1PJ4A 2H3HA 2RSLA 1NGSA 2MJLA 2XOKA 1II9A 4P38A 5E2BA 4F8JA 2X7HA 2WOJA 4P7KA 2PMFA 2C58A 4B34A 1JQDA 2Q9BA 4NATA 1JHUA 3UAYA 3TJRA 2AN5A 2Z6QA 2ETXA 3IALA 2WHPA 4S0XA 3ZW8A 4C0AC 3ENQA 1PT7A 1QLJA 3ZY6A 4PWZA 5EKSA 3JYHA 4JR1A 4YFVA 2GLUA 5FL3A 1JZSA 1VDZA 2R6DA 5HF9A 3QLUA 5HKKA 2C3UA 2I29A 3AFOA 2NPFA 4E30A 2P9JA 3KYDA 4ZCIA 2XI4A 5JJBA 3E7FA 2PFGA 1V95A 3UWOA 5IYZA 4LNUB 4NESA 1WULS 4BV2A 1Y1QA 5LZ4A 4PLYA 3E84A 4IVPA 5JSUA 4CFYA 5TNXA 4DV7B 3GT4A 4J1TC 3OZGA 1V3QE 5BUQA 1XCBA 2XCLA 2ZCVA 4CTOA 1KH3A 5BW4A 3K09C 3RS0A 1J0EA 2NTNA 1EUCB 5GP1A 2WTNA 2YICA 1YH3A 2XDQA 2XWJI 1ACJA 1AS2A 2P4HX 1SC1A 2C4MA 1NRJB 5G0VA 1ODFA 3OQIB 5A5GA 2GGSA 4FE4A 5DEOA 3RV4A 4EQ6B 2VF4X 4EPYA 3TZQA 1VSQA 3DKRA 1KVUA 4EFMA 4HV4A 2HA4A 4ZJPA 1E1YA 4AP9A 5ADWA 2GEDA 5DBFA 4AJ4A 5EHXA 3VNQA 2IYOA 1L8XA 1EDEA 1DOHA 1RADA 3PYXA 4RFLA 1PJBA 4DYHA 4EKIA 1K4MA 1CRQA 3QELA 3VPFA 2FXIA 4AULA 4BJ3A 5B36A 4W5RA 3GRVA 4RZHA 2ZBUA 2YJ5A 4IQGA 2I71A 5GJCA 2VHCA 1CE8B 5B1IA 3FOZA 2X1VA 3HDTA 2BFDA 3PCXA 1QU3A 1PP4A 3GRPA 1QV9A 2O2DA 4U7JA 2A1IA 1JDVA 1GV0A 3HVHA 1FBTA 4Q9IA 2JB9A 1ST2A 4Y9RA 3UW1A 2PM8A 1IY8A 1I0IA 1Q12A 4TM8A 1EBBA 2ZPAA 2HOQA 3MOSA 4KQHA 3ROPA 1TCCA 2NX2A 1DE0A 4L5BA 2IHJA 4CFSA 4F86A 7MHTA 2PU7A 4MITA 5LIRA 4RY0A 3H17A 4XR9A 1E2PA 2FGJA 2H1VA 3GEGA 4BP3A 4LDZA 4PRLA 3X1WA 2FA9A 1V45E 3I9NA 3GWZA 1OBVA 4DLRA 4I1RA 3B1KA 3L6RA 4TTIA 2C98A 2J59A 4IV5A 5JTUA 1RM4A 2EJVA 2OD2A 2WIJA 5CLGA 4RSHA 2JD2A 1IOWA 3QE9Y 2W58A 1W9HA 1HLFA 3MJCA 5AFSA 3K6JA 5TQ0B 2VQEB 1AN9A 2F64A 1JB1A 4R9NA 4ZV7A 3VI4B 2YCBA 2O59A 5A4IS 3C16C 1IBLB 5ELMA 3OO1A 1T1EA 2J9XB 3PWKA 5D51S 1LDMA 1V6CA 4E7OA 4Q4AB 5ALIA 1MTOA 3SY8A 1GQSA 3G49A 2CXRA 3OBBA 3R7WA 2WQ6A 4FZ3A 4DT1A 3CE9A 1QTIA 1J70A 1P7CA 4N0DA 1A7AA 1J0CA 1NV8A 1PZNA 2D62A 4TWZA 5G1OA 1XUOA 5BOVA 4D8XA 5JDIC 1UPXA 2HF8A 3FJYA 3IA2A 1SXHA 1VJTA 3MAJA 1YGYA 2VPPA 1A1SA 3VR5D 2CMHA 4DWWA 1XAGA 4HTAA 4JENA 3VKGA 4LZAA 5K3FB 2QW1A 2YNMD 5IDQA 3IERA 2WWIA 3GPDG 4J1QA 3I64A 3VYTB 4BLPA 4DQVA 5AD1A 4B4VA 3KB2A 3CZMA 1JMKC 4EUFA 1NTRA 1Z4MA 2C9CA 2JVKA 4UCXA 1ZFNA 5ENDA 3OZXA 2BDUA 2G08A 3VO8A 4XIYA 1IBKB 2WLSA 5F1YA 4P7GA 4GPZA 5E38A 4XIGS 1BX0A 5AJZA 4UAGA 3QVVA 4L22A 2JIMA 5DNDA 1XZDA 4PZZA 4CI9A 1BFUA 2VWQA 3C3JA 4PICA 4YJKA 4IPTA 4JC5A 3ZVNA 4KX5A 3UQYS 3QW4B 2FPOA 1G2QA 2Y05A 2EL7A 1OXUA 3GLFB 1EE1A 4D4MA 4ENRA 4DKJA 1UQRA 2Q2QA 4WHMA 1JALA 1XNJA 1G5RA 2ASVA 1D4FA 1Z45A 2OV6A 4OYRA 3H4IA 1ZG3A 3EEFA 3V46A 4DSAA 1WMDA 2PZBA 3BX1A 4IHQA 4YX9A 1TQ8A 3O7MA 3VQTA 3EBLA 3FTNA 4O4HF 4GM1A 1NT4A 1QH9A 2B4YA 2X5NA 1XNGA 3AV0B 3FCCA 1SBCA 3CNOA 3VR3D 3VPSA 3A6HA 1DFGA 1K0FA 3V4FA 1TVKA 2HBQA 5CLFA 1ZK0A 5LXTA 5H02A 1SR8A 5LQNA 2OO7A 2B0CA 4HBZA 4CF3A 2B1JA 1U4NA 1KSFX 2I6SA 2NVOA 3FETA 3HO6A 4JJAA 1IPFA 4XIJA 5ER9A 1RWPA 1XTBA 2J4CA 4KL8S 5H0IA 3B2EA 3F7OA 4KJXA 3V80A 1VLJA 3FSRA 4MZXA 3BB1A 3K09A 3G9XA 1ISFA 3OU6A 5CBPB 2J85A 3ZJ5A 3HY4A 3JR7A 2QB5A 1DELA 5JD5A 2DR2A 4RYDA 2GFHA 1JWBB 3BZWA 1UT6A 1UZMA 1YBVA 4BMOB 1KS2A 3JR3A 4WVFA 4DS3A 3QM1A 4OCZA 3BCSA 3VR2A 5I4KA 5KU7A 5F5LA 1WBBA 4KR2A 5CJ2A 3SYLA 3TKLA 1YAHA 2GCPA 5E95A 3WRYC 4C4PA 4C7XA 1QQTA 3QFFA 3FPGA 3B6ZA 4U7TB 3K3PA 1N2SA 4JOSA 2NNWB 2ZRIA 1I5OA 4A16A 4X66B 1CFJA 2QN1A 2DBRA 3AFMA 4LC9A 1LV8A 2IHYA 5IW8A 1RJFA 3R6TA 4QTUB 4G56A 2WU3A 4AL4A 5C8YF 1SU8A 3FIJA 2H2WA 4EAAA 2XCIA 2AN1A 2XODA 1X9IA 4P84A 3B20A 2Q3JA 1YFKA 1X8XA 1XTZA 5ALXA 3M6WA 5BT9A 1YULA 3GW8A 3FVWA 4M7WA 1QOQB 5DRYA 3D4OA 1Y8ZA 3OX4A 4J94A 1VLQA 1IFXA 5EE0A 5CIWA 1XRLA 1AA6A 4F3YA 1M1YB 2AOUA 3SOZA 4KQ9A 3MWDA 4EZIA 3M3HA 4ISCA 2ISQA 1AMOA 1YJCA 2WP0A 3ANYB 4HFNA 1HE3A 3F8TA 4OGWA 1MX9A 1UPBA 2FPPB 4JSRA 1N33B 3U13A 5ERXA 1EVIA 5JCPA 4DLZA 1W34A 2KWIA 4WH0A 1R27A 3L8DA 3TQCA 2QVCA 2D5IA 3W4IA 2Q5EA 3DV0B 3HXMA 4ONEA 1CRWG 4PLCA 5A5EA 5IBQA 3FYDA 4P3PA 3X1MA 1LI7A 1D4AA 1ZNWA 3MTQA 3GP8A 3AHCA 2WKWA 3D0OA 4YUZA 4QU8A 1BH6A 2UZ3A 4YQEA 5FBHA 3G7SA 4FOSA 2OCKA 4RAOA 4ACAA 3T3MB 1HXHA 1NATA 1KYYA 3FLEA 1MA3A 3OQPA 3WIOA 5KX5B 1LW6E 5B37A 5DT2A 4C07A 4EM6A 2Q7DA 1H2ZA 1JEAA 3FLBA 1DFHA 2WJPA 4YMGA 4P1ZA 2P1RA 1G5PA 3F67A 2RONA 3JXEA 2IOYA 3G9UA 3HYCA 3Q40A 4RETA 4KR9A 4BC1A 4DUGA 5A3JA 1ZIOA 2JD1A 4KK3A 3RO7A 4EZBA 4PG8A 5K8JB 4TTQA 4WZAE 1CUFA 3A6LA 3PLNA 2BGUA 2HIGA 3PQFA 2CGEA 2R5NA 1Y7IA 3ZGLA 2H2AA 2CFTA 2JIOA 3TLXA 3ZWYA 1GTVA 2DQSA 1AKUA 4CG0A 5C7OO 4E2XA 5K1ZA 2BH2A 3A06A 2H2DA 2DKOA 4IS2A 4EUKA 4FGSA 3ZCXA 2MSWA 4LK3A 1W5FA 3OQVA 1AE1A 4YC7A 1HT3A 3TTUA 4D1YA 1MO4A 1JAHA 2VXYA 3HUEA 1U0FA 4JAVC 3BJMA 5EIBC 4LRUA 4UOZA 5A2QA 3P9KA 1ZU5A 1MW8X 4MQMA 2JW5A 1EHYA 3M9LA 1I13A 1CT9A 1OX6A 4QYIB 3HGTA 5ERGB 5IG2A 3BXXA 1SNYA 5FPTA 1DS6A 4V0SA 2ZEJA 2Q99A 2Q5OA 2OHVA 1F0PA 3AEUA 3MW8A 5TMBA 3G0DA 3UKDA 4M1OA 1NUAA 4X5OA 4YRZA 3B8HA 1PSDA 1P2VA 3BMXA 3EIUA 3K9NA 3PUWA 1F6BA 3E6AA 1V7QA 2FNAA 3Q3IA 1E7RA 1MN6A 4TS9A 4U2EA 5F21A 4YRBA 3B48A 1E5QA 4PLVA 5DB4A 5F4ZA 5LSAA 4OHYA 2DVMA 1Z5UA 2WVHA 3KBOA 2ZM6B 4OY3A 1AUOA 4BB0A 3IIKA 3MBOA 4QREA 4YDSA 5KYKA 4OQQA 1AK1A 1HDCA 3VU9A 4MVJF 1BQEA 4MJXA 1Y1SA 2VTBA 5IKXA 1XEWX 1DXOA 1K63A 3I1FA 3KQKA 8GPBA 1XTJA 1L4UA 4MQLA 1KJ9A 3LI2A 5CITA 1PV1A 1ULUA 4Y0AA 3DPUA 5HE9A 4EGAA 3C7DB 3L1IA 1JIIA 3U7RA 4EITA 2QTBA 1O08A 4ACBA 1HKHA 4LTDA 5ALEA 3RH0A 1W76A 2YRFA 1V9LA 2IDMA 4DMFA 3UWDA 5FLYA 4U7PB 2H52A 1R0YA 4YAKA 1V3UA 3ND6A 1MGOA 5I8ZA 3BDIA 3D2AA 2RB4A 1G18A 1ULZA 2I8AA 3LCMA 1MQSA 3OD1A 3O4FA 3UO8B 5CEEA 1QNFA 2JA1A 4JASB 5HE8A 2OLEA 3VUFA 3CF0A 3JZMA 4N3CA 1M8FA 3JASA 3P9RA 2OAEA 4GSLA 5AW9A 3VMMA 4D5GA 1VPEA 3HACA 1OBOA 4RCVA 1KO7A 1CUZA 2HBRA 3LWZA 3WL3A 4WBNF 4RE6A 5I7RA 3NM5A 3OM8A 3AB8A 3BSYA 5AHRA 5JAZA 4I1UA 4UZEA 1R2QA 2BFOA 3LPMA 2UXCB 2NSLA 1JSZA 2ANBA 1G8AA 2CHGA 1E9BA 1DVRA 1YZQA 2E89A 4I55B 4C0WA 1WA5A 2N47A 3ZWPA 4DV6B 1S8FA 3PDUA 6Q21A 4A15A 1E1KA 3FPEA 1E8MA 3GAFA 4IDBA 4MS1A 3RJTA 1H69A 2X5KO 1FXUA 3BZUA 1UDBA 3M5PA 1F9AA 1K3UB 2W6MA 4HGQA 4OM7A 2Q1YA 2A84A 1VDMA 3EDOA 4HS4A 4AM8A 1NHWA 2ZBQA 3GCXA 4JIGA 1FL9A 1P74A 4BAGA 2WKPA 2QX7A 5CLLA 4FU0A 4NCIA 4BBJA 2XMZA 3AR7A 3FZGA 3TLBA 4NXMB 1MT3A 1BG6A 1NJ5A 1JHZA 2PCJA 2G17A 4RVNA 5ILOA 1M83A 2A9PA 4BB6A 3RVSA 3T5CA 4DQ0A 3M0EA 3ENWA 3QF4B 4XTRA 1L3BA 5BT8A 1KNXA 3G5LA 3TIVA 3IHKA 2E6UX 3C41J 2W2KB 1Y5MA 4WASA 4AUKA 2FE1A 1ULAA 2AYZA 1TRHA 2D2VA 4AKIA 3D6HA 3H2IA 4HI0E 5KDLA 1G9SA 5IN5A 3M4YA 1Z07A 1SBQA 1A9XB 1VHLA 4V0KA 3AUUA 4MR8B 3M49A 1WOMA 3JRNA 2YMLA 4ND2A 5SY4A 1WUTA 1KMHA 4ZT7A 3R74A 5AUNB 1SXIA 2IZ7A 2G0NA 3LIPA 3BEOA 2ATEA 1FS6A 3DUFB 4KFTA 3KL2A 4XPIB 1CZNA 4LZWA 1AA9A 4HGOA 4J43A 1FLVA 3IPCA 1OFUA 3EEOA 4BTEA 2H2HA 2BRUC 3OA0A 1A5BB 1OREA 2O3JA 3EDYA 3JAKB 4JH0A 3WV4A 3CVXA 3M4ZA 3H6KA 4YAIA 5JROA 1DJLA 5JI3E 3NT5A 4BE9A 2D2IA 3IBGA 4WX2B 1JTFA 4EYKA 7ABPA 3K15A 3EXG1 3ANXA 2JFQA 4PYOA 4KYUA 1S4MA 1GPJA 2NPOA 4JJKA 1N25A 4LMBA 1YDWA 4H6WA 4LWQA 4NBRA 2PPVA 3QLEA 5CVUA 4IGAA 2G76A 4DQXA 1G64A 4JGIA 3WV5A 5CFOA 5L7WA 1EFAA 1HWYA 3NIBA 2H17A 2E82A 4RH3A 1M6HA 1EVJA 2JLRA 4MR9A 4PS0A 3L40A 5CUQA 3ULKA 4PC7A 4WCVA 1EFVB 3UMCA 2ORED 2XMCA 2NO7A 1XVIA 3S2EA 2O3QA 2X8BA 2EJCA 3LBFA 1Z25A 4Q9LA 3RS9A 3WC4A 4C03A 2RH9B 2ZSEA 4Q6WA 1NXQA 1E3EA 2GFIA 3BXEA 2DFNA 5JY1A 2A3NA 1QPBA 2J0EA 2OKGA 4UBKA 4TYMA 2GPYA 2ZWIA 3HC7A 3V5NA 2KX7A 1HE2A 2AR0A 2GXUA 2VDQB 4HAWA 4OXRA 3TUJC 5DNVA 3SF8A 1DIGA 1XVAA 2DRIA 3HB5X 5BR4A 4PO8A 4GR9A 4WRRA 4AJLA 1XDWA 1D6NA 3WVNA 1IUOA 2ONCA 2BLLA 1W4CA 4G81A 1ZNZA 5GQSA 4YYZA 1CR2A 2ZTSA 3QXSA 3RLIA 2NVWA 1ND5A 1C3OA 2G9ZA 2GEKA 1V39A 2ZRQA 1A2OA 3JS5A 3MINB 3OCCA 5KDOA 3DLCA 2I1LA 3GEBA 4WLNA 3WFZA 3KOXA 4HRAA 1SEPA 3OY2A 1N92A 3FAZA 4NV0A 4MJ3A 2C1EA 4AO7A 2H29A 3GMDA 4P4UA 5HQ3B 2LKDA 3L93A 4HPXB 1YL7A 2JPDA 1O57A 2FW1A 4UUNA 1JHMA 4DA8A 5CFMA 3DPSA 5JXJA 4JX8A 1BDJA 2OBBA 3HCFA 4TN1A 3ED5A 4LJYA 1BXGB 3RIGA 1GFIA 1P72A 1WPQA 2WIAA 4S24A 5TARA 4BV3A 3ONVA 1ILWA 4MQ6A 3OIVA 3EXHC 3JQAD 2O9JA 4HRVA 1XMQB 1A5TA 3VBCA 2TS1A 4N3BA 1IWOA 1E2IA 1SOUA 3MJDA 1KERA 2FW8A 3HDQA 4G24A 4M9XA 5LP6B 5EEGA 1FLDA 3IAS1 1E66A 2AW3A 2ZSBA 3M2TA 3WLAA 2PRKA 3BPSA 4FFNA 1VA5A 5LLSA 3DT8A 4F96A 1FNDA 4LJLA 4DN6A 4G4GA 3RUCA 3MTBA 3GLTA 3FSJX 2A0XA 4DL9A 2H11A 4UXJA 3AVOA 4PXYA 1QQ5A 3X1ZA 1DUSA 3KU4A 1MX5A 1RCFA 5EZYB 1WQ3A 2JGNA 2DFDA 3CB4A 4OQYA 4EFLA 1N8TA 1U8CB 3Q8MA 5E6SB 1WEKA 2XUAA 2ZIFA 3F9RA 3ZWQA 4XVUA 2O8EA 2HREA 3DJYA 2I67A 3P2YA 1WJGA 2BFWA 4X7RA 3I9V1 3KK0A 1OX4A 1JU4A 5ICEA 2B82A 3N75A 2A7QA 1NG9A 3SEQA 4ZZ2A 3AHDA 3AL2A 3ENKA 1XEFA 4LGCA 2Q3FA 3SLKA 2PXHA 2CJWA 2X76A 3FOCA 2CNDA 2D1RA 3IRUA 3LX5A 3ONDA 4DVJA 5MN4A 1MC4A 1B6GA 3PNBA 5ALSA 4WCFA 4TMWA 3OCZA 3DE6X 2B92A 1D8TA 1RI2A 1QGUA 1ENOA 2ZB8A 2FK7A 4PYIA 1CRLA 2CNKA 4M37A 1YE5A 3CLRD 1R9JA 4FSDA 4WZBE 5BQPA 4HNGA 3ANSA 1A8UA 4HYYA 3LYLA 4CM6A 4ASUD 4FJ0A 1W36C 1KJZA 3ZD9A 2IYNA 2GEUA 5LM3A 3EODA 3UV3A 1DPGA 2PCLA 4CGYA 2E37A 2V0NA 1NR1A 3V8PA 2WABA 3GJXC 1O03A 1YQDA 4I1VA 4MNTA 3L7DA 4NWIA 4M55A 2IYYA 1QK3A 2D8AA 1ODKA 2WVGA 4G9EA 4ON9A 3E8XA 1ATZA 4HH3C 3EUEA 1M6YA 5F52A 3OTOB 2VUSA 2AB0A 2C8JA 2CYBA 3VYWA 1T26A 2Q4OA 2BRUA 4FWBA 3ZQJA 2XT6A 3NC4A 2XVXA 4FDLA 2AEEA 3DBLB 3OIWA 1ADBA 4I1YA 4RVUA 1O8BA 3K35A 1U3VA 4DDTA 4B6PA 2EQ5A 3K1JA 1QZ3A 4Z54A 1IYZA 4X8MA 1M1XB 2XA9A 3WTCA 3GDHA 1TEHA 2PVCA 2C83A 2WFAA 3HJHA 1NBAA 2FUNB 3OZSA 4HZIA 4UUMA 4B7AA 3GAAA 9LDTA 2I2AA 3V4RA 3RS8A 1TZMA 5AKZA 2G06A 5ALHA 4HFJA 1VL1A 2HGZA 2XMPA 4CMBA 1FRZA 1QANA 1BKYA 1ISJA 4KIJA 4YMWA 5LYJB 4DV0B 4O4LA 1QC5B 4Y18A 4RV9A 4DR6B 4FNGA 1HX7A 5J2TF 1MFZA 4LJKA 5EKDA 1VKZA 1A9TA 1ODLA 4ZCPA 1QGDA 2HSJA 1M0SA 3IAHA 3HKEB 3O9ZA 4AFNA 3AI2A 1ISIA 2X8JB 4AMGA 4J75A 1ZESA 3EGDB 1DG3A 3GRFA 4GOLD 1WKVA 2VJBA 2JBWA 2WTMA 3DDNA 2QPAA 2H85A 3AL3A 4D42A 2POCA 1NZDA 2F43A 2WNIA 3VKFA 1F6DA 2I4RA 3ILXA 3ADCA 1EP2B 3D6AA 2ZROA 4FCTA 4AJ2A 4O4JB 3B85A 2EZ8A 5CXXA 4UARA 4DC1A 2INGX 2DB3A 2CVZA 3C70A 2Q41A 2XIQA 3BFPA 1Y42X 2NTJA 4ZOQI 5AQ1A 1JLLA 4YRDA 5I5EA 1Y8AA 5I51A 5LB2A 3L6UA 4LCJA 1GDDA 2V96A 1H8EA 3RGGA 3QU2A 1NXPA 3FMVA 2AMLA 1UADA 1QIFA 2OC9A 4Z9AA 3ILHA 2ZB2A 1T2AA 3AF3A 1NBEA 4DHWA 4EHNA 3OZTA 3PI7A 1ORRA 1II0A 3LGSA 1RPTA 2Y6UA 2C8KA 4XWKA 5KSOA 3IT2A 2OT3B 2LGJA 2ZCJA 3WMXA 2BI8A 3AHFA 4YP0A 3T7EA 1SU7A 1H05A 1VL2A 2LDXA 2V8BA 4JU8A 5CB4F 1QFSA 1SWWA 5HJ7A 4D97A 2QJWA 2B1QA 2QX8A 2QD2A 1YK1A 2UZIR 3HDYA 4MIOA 5AW0A 4S2UA 1GLNA 3LZ6A 4L02A 4JFRA 1UMCB 2HCFA 2ZVDA 5JVDF 1RXCA 4NCNA 2HSDA 2Z09A 1EGHA 1BMFA 1EK5A 1AHPA 1VA4A 4TV9B 2R6AA 4IEEA 4NAUA 1TEZA 4RIHA 5TF4A 5LFAA 2B5OA 1UKEA 3BMCA 3ER6A 3W3AH 3K0AB 4KLZA 1VPTA 2I3BA 5ADUS 2KMLA 3DR5A 3EDQA 4BGEA 5BSTA 1XCJA 1DXQA 1GTL1 4N5DA 3JWHA 1VCHA 1ZAKA 3C3MA 4BLWA 3I37X 3QVSA 2W43A 1I7PA 4QXMA 4ZFNA 3LUBA 3D6VA 2J0UA 3IRVA 3Q3VA 1TOAA 5ALDA 3DTYA 2BFPA 2GK7A 4B3HA 4NMXB 3VM6A 2AOVA 4KIUA 3H16A 3UG6A 5DIFA 4I4LA 2NU6A 1SHZA 1JJFA 1LPBB 3B38A 4TS1A 4F3KA 2F2TA 1T9GS 2GSDA 2UUAB 2A5JA 3H4MA 3ABOB 1PS9A 4NF2A 2ZYVX 3TG2A 5EYPA 1E1CB 3N0WA 3TSYA 1AUQA 1RLUA 3DZFA 5C31A 3ZU5A 1MZPA 5FD8A 2J30A 2R8XA 3QKTA 4G5FA 2WWTA 5BQFA 1UBFA 1NE7A 4ALJA 2OQIA 3BJEA 4PAQA 3L0OA 4DA6A 3CVYA 1EIZA 3W90A 2FB9A 1WPGA 1HPLA 2CDNA 2CJFA 3PQ5A 4IM7A 4WK4B 3A11A 2VYQA 2WW8A 1Z5PA 4GOMD 3JU3A 3A37A 2JGAA 4GYYA 4XYMA 2JARA 2J3QA 3C8MA 5FLKA 4DHEA 2SCUA 2OSVA 1Q16A 2E1PA 3PUHA 1YA8A 2H06A 5AK3A 2C2BA 2IY7A 3KJIA 3WIVA 4EA8A 4ZI5A 5B7QA 3KQMA 1L6IA 2ZJ6A 1RDFA 2I55A 1U3FA 2QT1A 1RNLA 2XMSA 3DKIA 4FD2A 3KKZA 5IP5A 2MSDB 3U6KA 1ES9A 1OW3B 1HY3A 1V1MB 3CUTA 3DOEA 1ZGBA 3OG9A 4MRMA 4QPZA 4HWSA 5FBQB 3RTCA 1VGRA 2B0JA 1JEEA 1PS0A 1VQ1A 1Y3HA 2UU9B 4B79A 5AQEA 1B41A 1CS0B 1DDOA 1WHSB 3RBZA 2AHRA 3LBNA 2YX1A 4U5XA 1OAAA 2BMFA 2IYEA 4F92B 1II8A 3WLIA 2ZJBA 4AMUA 1KEUA 2QN2A 3A14A 4EA6A 3ZKWA 1U0LA 3T0IA 3P94A 4EEXA 5GVSA 1OJLA 3Q98A 4C3UA 1K6IA 5E3HA 4RY9A 2WA2A 2ZE8A 1V41E 2P9TA 3MA0A 1QCCA 1CY8A 5IJ9A 4HH4A 3U16A 1GUFA 3KDSE 1G42A 4O0MA 1EP3B 2ZSJA 3QBVA 2HNKA 4CMAA 3GT7A 4KQKA 5FI0B 2B25A 1S8OA 2RCYA 2ODEA 5F76A 5LB4A 3AG5A 4W1PA 4DSOA 2GKSA 4JJZA 3PWSA 2QP9X 2ZIXA 3EGWA 5EFOA 5CVJA 3NEPX 4Q1AA 4XGKA 3RS4A 1QV6A 2HLHA 4Q48A 2O8FA 4JODA 4A0HA 5TS3A 4RTOA 4LGVA 4NFHA 4TKZA 4D92A 1QCYA 1GY8A 2YV1A 2WB2A 3B9QA 2Q45A 2PUGA 1GKKA 2HXGA 2JLZA 3KFXA 3VU8A 1SC4A 3LWBA 3TM5A 3TPFA 3VC1A 2MYUA 3IKLA 5LLDA 1VE7A 3FWPA 2X9NA 2QRKA 1QHEA 1L8LA 4OUDA 3A9CA 2HJWA 3CR8A 3CX8A 4DNPA 1O4VA 3I9FA 1YQUA 3D3WA 4XWTA 3ZEIA 1JF8A 3AY0A 3GUZA 1X39A 3QE3A 2HN9A 5E7JA 2N0SA 5TJ9A 5AHOA 1Z3CA 2H2IA 4CV3A 1EP9A 1CUHA 4YAUA 2WE8A 1U65A 5HR5A 1P1JA 4DA0A 1R50A 4HCJA 5AKKA 3USZA 2QZ4A 1PK9A 4NCAA 1RPAA 2GM5A 4WJZA 4DXAA 4LY3A 1P7YA 5K0JA 4ILKA 4JR0A 3IL2A 5HFNA 4MI1A 1F8GA 3RNLA 1UP4A 2QTNA 2D2FA 2P41A 4HF7A 4BC0A 4B8WA 3U4GA 4BQPA 5LR6A 4TYPA 1H23A 3AZPA 3D1VA 3OE7A 1BNCA 2GZ1A 4BNGA 4B81A 2OHOA 3DOJA 1TUGA 7AT1A 1AC5A 4N8DA 5CHYA 4F6RA 1LLUA 2JDID 1NNLA 3DV2A 2PBRA 3AQ4A 1MABA 2ZDGA 4WXEA 5KOHB 1A50B 1I6WA 1C8BA 4X00A 1KTVA 1QYIA 1WUYA 3FTPA 3UMRA 2JA2A 2BGWA 1OWNA 2EHJA 3U7GA 2YHIA 2ADOA 5AI9A 3GLIA 2PGJA 2DOKA 2WWRA 3V2UA 4I9GA 4J49A 3WL6A 4CLXA 4DCVA 1XCGB 1R4NB 2NSHA 4XUEA 2E49A 3B51X 5FRDA 2IU0A 4EY7A 4DUYB 2XBMA 4J7UA 4XIFA 1MQ9A 4DADA 4DIMA 2ZRLA 3QRWA 5CCEA 4DMGA 1JEQB 3ZLUA 3JZDA 3KTFA 3AKZA 3L06A 1S8NA 4H31A 4LJ8A 1I10A 4PQFA 5DTIA 1UEJA 5HJ2A 4BYGA 1C4OA 4KODA 4E03A 1M33A 2AXQA 2FZ5A 1E0DA 2Q1XA 2RKOA 1N4DA 2WYWA 2PWZA 3BBLA 3EG5A 4M9CA 2P6PA 1AXEA 3UJNA 4JSYA 1DZIA 4RESA 1NHGA 3B3QA 4W9MC 2L0XA 4BMCA 1HNNA 1WB6A 5G4LA 1Q1GA 1ZM4A 2YJNA 3BEDA 4X1YA 1R6XA 1M8JA 2Q3HA 3M33A 1MAVA 2VHZA 1HRDA 3EPRA 2E9SA 4Q7EA 5B64A 1RWOA 5FL7D 1ZRHA 4J4TA 1LTHR 1PYGA 4LK2A 5DWQA 4LFCB 1Y9DA 1TCAA 1QR2A 4G6ZA 2AW5A 3VAAA 3R4CA 5EJ5A 3LBAA 4Q3DA 5FUYA 1LH0A 2O23A 3PX7A 4AIIA 4YNBA 5FJJA 1KVQA 3AHHA 1EG7A 3RT1A 4UBLA 1FMCA 4TKLA 1C1DB 1LLQA 3DMFA 1B15A 1Q44A 2O2IA 2XCQA 4HDQB 4KU4A 3OE1A 3V55A 3ZTYA 2BH9A 3KX2A 4ETMA 5DNYB 3PL5A 1GR0A 2G09A 4QDXA 2Q1UA 5L6LB 2WM2A 1M1UA 1N8NA 4EEKA 3RK1A 1PBTA 1UMDB 1HEUA 1VMEA 2F9LA 3SBEA 5JUWA 1XAIA 1COWD 3QKIA 2HU7A 5J23A 2O7QA 1X38A 2FFJA 2VT2A 2CY0A 3GO4A 4HN4B 4YRSA 4OHXA 3PPXA 2ZKIA 4H6VA 3GLHA 3ZD8A 4IMPA 1T4CB 4YREA 2EIXA 2JAWA 3VJRA 3RVKA 3L41A 1ZA1A 4OJQA 3H1PA 3ZU3A 4ETIA 5H3HA 4R9RA 2CZGA 1BH2A 1DADA 1KR5A 4NU8X 1AGRA 3E1GA 4DYDA 2QPLA 3E1SA 3MZ0A 2C84A 2OVBA 3DD1A 4F4JA 2NSYA 4R16A 2C82A 1Y4ZA 2QQ0A 2VVTA 4I3GA 1ZC3A 3H1AA 5JCOA 1W88A 2PZJA 4JT2A 3UK0A 3DZIA 3V8EA 3RSZA 1Q2XA 5IEJA 4X84A 3VZCA 3WADA 3OWOA 3FR7A 3KP1A 3IFSA 4QOFA 1JQJC 1UPAA 3NNSA 5DN6D 3IDSA 1Q7EA 4ZCRA 3GROA 4CKXA 3OIUA 4FYMA 3LUPA 1XR3A 2X9LA 3QZUA 4CPDA 1OLUB 4JKYA 5KMGB 3M4XA 1AB6A 4PSAA 2QYSA 3S7ZA 3FWZA 5BR8B 1L5YA 2PYZA 3AR8A 1AT1A 4TXMA 1D1TA 3IV6A 1H8HD 4YWHA 2HSWA 3A4LA 4CKCB 1OU4A 3DVLA 2QX6A 1YMUA 5IT0A 1P80A 1IHDA 3WA6A 3L7CA 4CETA 3VKWA 2C78A 2GAOA 1B0PA 2IU3A 2X8LA 4QOJA 2ZM5A 3AU8A 5C3MA 1K7XB 2FZLA 1SB8A 5D1NA 2JLYA 3WO0A 2IW1A 3JQ8B 3TQOA 3VR6D 1JVNA 1JMVA 4PYNA 3T1NA 1M67A 2DJIA 3EEBA 2DR3A