4DT1A

Crystal structure of the psy3-csm2 complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
193
Chain Sequence
b'MEYEDLELITIWPSPTKNKLCQFIKQNLSKEHVVTQLFFIDATSSFPLSQFQKLVPPTLPENVRIYENIRINTCLDLEELSAITVKLLQILSMNKINAQREPLKIILYINGLEVMFRNSQFKSSPQRSHELLRDTLLKLRVMGNDENENASIRTLLEFPKEQLLDYYLKKNRIKNGDSLAEYIWKYYADSLFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome segregation in meiosis protein 2
publication title Structural analysis of Shu proteins reveals a DNA binding role essential for resisting damage
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 71
structure length 193
sequence length 213
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16834 CSM2 Shu complex component Csm2, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dt1A00
3V00A 3ZD6A 2NPFA 2PJZA 4D0NA 1OYWA 3LA6A 4JLBA 2N1BA 1W4AA 2RGGA 5J4YA 5FL7D 3CWZA 4NPHA 1Q22A 2FZ4A 3U7FB 3OIYA 5IRCD 2AHOA 1ZVQA 2ODEA 1TEXA 3RSOA 1FNNA 1CR4A 4KHZA 5CITA 2VF8A 2FNAA 4OQNA 5KTYA 1BOFA 3LLUA 2J0SA 4RZUA 4GZLA 2DPXA 2JJ2D 5LBIA 2JATA 5LPNA 1GWNA 4WXPA 3ZZUA 2V8OA 1DEKA 5HCNA 3SZRA 3PUYA 5ANRB 4DSTA 2FG5A 4B48A 2PZEA 1KI7A 1DTSA 1DPFA 1EXMA 2XTMA 3BJIC 4LK2A 3KKPA 3FVQA 4BZQA 1WA5A 4PHTA 3P4XA 4MGIR 1ZU4A 5E7MA 3VX4A 1N5LA 2W83A 1KMHB 3KXIA 3X1DA 2QU8A 5FOVA 3QPVA 3L8ZA 2D74A 3ETLA 1ESMA 2XITA 4A2QA 3SR0A 1EESA 3VKWA 1R0WA 2YINC 4ESHA 5JWOA 1XEWX 3WHKA 1QHHA 5TY0A 1KDPA 4Q18A 4D25A 2J5XA 1II0A 3QG5A 1ZM2A 1HQYE 5EE9A 4BFZA 4EPYA 1YZTA 2FGKA 1T6NA 4Q5IA 2HYIC 3LLMA 1YR6A 4OHXA 1KJYA 1YZKA 3X1YA 3B9QA 1G6OA 4UXIA 4ZI3A 2BEJA 2C5LA 5L8VA 5K8UA 1K8RA 4AC9A 5J47A 2HJVA 1CR0A 1P2UA 5HE9A 3GFPA 4NL4H 4V0ME 1TL7C 1LS6A 1AZTA 1F2UB 2XTNA 3H1TA 4KITB 1J7KA 3GLGE 3SDZA 4TYNA 1UADA 1XCGB 3LW8A 4XWKA 3W34A 3EZ6A 3AEZA 3EWAA 2ZRFA 4NZYA 4G01B 2YWGA 3ND8A 4I99A 4HAYA 4C4PA 2D4HA 5FTMA 2ZUBA 3NIBA 4ARZA 3TBKA 3E1SA 1EWRA 4G5RA 3RLFA 4QHSA 2I1VB 2H92A 3TW4A 5JSZB 2FN4A 4PPQA 1P7CA 2W2XA 1KYIA 3NVAA 4JYCA 4NH0A 4XWOA 3A1WA 3EASA 5FBVB 1TF7A 1VG0B 3BFXA 4F4JA 1OH7A 1N25A 1ZC4A 2UZ3A 4JL8A 3VNVA 1D2EA 2F1RA 1E98A 2X1VA 3B60A 4QM7A 1YZQA 1Z0KA 2J7KA 3K0AB 4YMUA 1IBRA 1HURA 1S1MA 1GNPA 1I2DA 4HDCA 4LGMA 4LI0A 4FI3C 1C9KA 3NHBA 1KI1A 2E87A 3U60B 5L3SB 4KYUA 1ZC3A 3F3YA 3NG1A 1QHNA 1X1RA 2GBLA 2Q9BA 4YDHB 3LBNA 5G41A 5B2ZA 1Q0UA 1W2HA 1DE0A 4HAVA 3BFKA 5CJPA 2ZUDA 4HDOB 1LFDB 5EXXA 3A37A 1R0XA 5DISB 5CJ2A 3O8BA 3N5CA 4Q4LA 1R8QA 3HYTA 5DSZA 2D2EA 3THWB 3LXXA 3T15A 3CX6A 3OEEA 4OI2A 1WMSA 2R8RA 1OH6A 4A15A 4GRAA 1NIJA 3EAQA 4QC2A 5FOSA 3KDSE 4PPGA 3OFNA 1TX4B 2G0NA 2FDCA 3VU9B 5CYOA 2IC5A 3B78A 4JLOA 4A8JB 4IOJA 1ZMXA 1PLKA 4KVAA 5F2EA 1FMJA 3NXSA 1VHLA 4TL9A 4MUAA 2NPIA 5GJVC 3B7GA 4XD7D 5F3WB 2GF9A 1SXJC 2AX4A 4TMXA 5JWHA 2PX0A 4LRWA 4C7OA 1W36C 5JJIA 1KDTA 1VDZA 2ZAMA 4M9ZA 4Q4JB 3LV8A 2YKGA 2FGJA 2CCJA 2W6JA 2CEAA 4CT5A 3W8NA 5FUXA 1QZXA 4PHGA 3Q7PA 4URVR 3T1TA 2YNMA 1VYVA 5EE5B 1G41A 2BJWA 3UWKA 2XSZA 1HE1C 2XNDD 1VYUA 2HCJB 3OAAD 4WZ6A 2L0XA 2IS4A 4LHVA 4Q1FA 4ERNA 3D7MA 3KFXA 2J45A 4HZUA 4IKEA 1W7AA 1JEDA 1EGAA 3QVVA 2ORIA 2X2FA 2C77A 1FQKA 2BJVA 3THYB 1KI8A 1RJ9B 4TMKA 1C4OA 1RPZA 2ZI7A 2IEZA 1TF2A 1PV4A 1ONBA 4GL2A 1US8B 4JYBA 3WBKA 3QXSA 3UMRA 5J4VA 5M04A 3GJ3A 5LB4A 1X8KA 5GADl 1VIYA 3RC8A 1O87A 2JLRA 2W6IA 4EUNA 1TU3A 2R6CA 5KDOA 2P0EA 5JI2E 1P2SA 1S1CA 3VTKA 1OHHA 1Z6GA 2Z83A 3CB4A 5H1YA 1ZINA 4JSTA 1P6XA 2RGNC 4LV5B 3TQFA 3MWLA 5JLJA 3RS7A 1ETUA 2A2ZA 3QEOA 1GL6A 3NKVA 3IILA 4MKIA 3H4MA 3NTUA 2IXEA 4NMMA 4Q1CA 3Q85A 5DGXA 2RGEA 2NIPA 4RY2A 2D3WA 5JI3E 1NVVR 2W0MA 2WOOA 1UEJA 2XB4A 3NH6A 5G53C 3HU1A 4TMWA 2J0QA 2ZM5A 1Z2AA 1AS2A 1BYUA 4TMVA 3VMFA 2AXPA 2BC9A 1V43A 4LWZA 2GZHA 1KOFA 1PJRA 2EU8A 3IPYA 4CDGA 3QPUA 5P21A 3K0FB 1YR8A 2VP9A 4TQUS 4NP6A 2ONKA 1X3SA 3Q8XB 4JLPA 4M22A 3K9LA 1MOZA 1RC8A 2WM9B 4ZIRB 2CNWA 1WRBA 2J0VA 4DIEA 4RD6A 2HT6A 2WJGA 4M2LA 1HTWA 4CIDA 2BIFA 2VYFA 3TIFA 3EARA 3UG7A 2XB2A 4MDEA 4HLUA 1XU4A 3DM5A 2DCUA 4OI1A 1Z28A 3A1TA 4WW0A 4KFRA 4L9SA 1KO4A 4F7WA 2GF0A 3RYTC 2QQEA 2WPDA 1L8QA 4MYUA 3RRYA 1KI3A 4CEIB 1G7SA 2GKSA 3AGQA 1S4QA 2F1IA 2OCBA 3KJGA 1KDOA 3KKMA 4YMVA 1W5TA 3ICQB 2R65A 2NG1A 3BGWA 3PUXA 2CE7A 3WP0A 5CLQA 2GZAA 2MMGA 3CZQA 1KTVA 3T5DA 5B57C 4HUQA 3J81k 2YC2C 3Q72A 4EPTA 3IUYA 4NONA 5DHAA 5C1BA 2LCFA 3IDQA 3PEWA 3TUJC 1G8FA 3BC1A 4QJ4A 4Q4HB 3QJYA 4LHYA 1XP8A 4NCIA 3TAUA 2QMUA 2VA8A 4EFNA 1OFHA 2F9LA 2H17A 1L2TA 2BKUA 1TQ6A 1E2EA 421PA 4QOSA 1GNQA 5K8IA 2B8WA 2ZJ5A 5AR1A 3Q9LA 3A58B 1F48A 2VP4A 2VSOA 3DKPA 3K53A 5DHFA 2ZU0C 4JLKA 4JLJA 3K09A 5BN5A 1JECA 1RVDA 5FPSA 4BRUA 1NY6A 2DFKB 1GZSA 1FW6A 1XMJA 4FWTA 4XH9B 1M7HA 3O8RA 521PA 3FOZA 1F2TB 3BE4A 1OKKA 3BERA 3HR7A 2OBLA 3C8UA 2YJTD 4LJYA 3QKRA 1W0JA 2HV8A 2ZI5A 1CJTC 2MSEB 2OG2A 4LJ7A 2P5SA 4BFUA 2KBEA 5KUTA 3BH6A 3GJXC 2XXAA 1KZ7B 1DAFA 3KKOA 5AUOB 1J8MF 3SFVA 2FSFA 3NC0C 4DLWA 4LBVA 5FL3A 1XTKA 1SXJB 1BO6A 3B1ZA 3PIRA 1UAAA 2P6RA 1OXUA 5FI1B 2Q0HA 5BYJA 2O8BB 2IBMA 5DIFA 1W36B 4POAA 2LKDA 1G4AE 1J2JA 5FFMA 2QM8A 2IWHA 4DIDA 1G5RA 1T9HA 3B1XA 1XD2B 2EWVA 2GAAA 2X2EA 1U90A 3ASYA 3TRFA 2DWQA 2IEYA 4FCVA 1E4YA 1G3RA 4G0NA 2ZI6A 3H86A 4JL6A 1GKUB 2KSQA 3DEFA 3MJHA 2HXSA 3OE7A 2C2HA 1NF3A 1MO4A 4IJMA 4S35A 2RGBA 2GZDA 3VQTA 2GA8A 1W49A 3G82C 3NBXX 1GDDA 3G5UA 4LBWA 4C0SA 2BDTA 2G83A 3K1JA 2PX3A 3NWJA 1NLFA 2D7DA 3ONWA 2XTZA 2IYUA 1WF3A 3KFVA 3W8RA 4LYJA 3HJNA 4Q9LA 5EP1A 2FA9A 3ZS8A 2ZYUX 2IYTA 1DAHA 4LSGA 3OEHA 5L3RA 3CZPA 4MKFA 1Q1ZA 2B8TA 2MMCA 5FBWB 4Q4AA 2WAYA 3PXGA 4LCBA 2GTPA 3CRW1 4D0GA 2VRWA 3FDIA 3I8SA 3F8TA 3W3ZB 1CULC 2GCPA 4DT1A 1QRAA 2JLSA 4EKDA 5JRZA 1NY5A 1UEIA 3W9YA 3KKNA 2RGCA 3NDPA 4AI6A 5CK4A 2J9RA 2PJRA 2FU5C 5JRJA 4G5QA 4OKSA 1TNDA 2ZRDA 3OEED 3M1IA 1P60A 2XZOA 4TZ0A 2FPLA 4B43A 1G1MA 1F60A 1Z5ZA 3G0HA 4LC0A 4D82A 1XJQA 1R5OA 4ZDJA 3GJ5A 1VCMA 2FZLA 2V55B 4HLQB 4H1UA 4WZBE 1HV8A 2WMOB 2WJVA 3B82A 1GVNB 2WWWA 3AF1A 1IN6A 1OXVA 4QHYA 3BH0A 2PL3A 2J0UB 2WWFA 3A8TA 721PA 4KSBA 3EPLA 2JDIA 2OCYC 2REXB 3CONA 3LQRA 5DN6A 5J40A 3EIQA 4KYIB 4LPSA 4KFSA 1E79A 4B3BA 2RCNA 2O8CB 2ATVA 2N42A 4LJ6A 3HU3A 4NDZA 2W6JD 3DPUA 3CRVA 2WJYA 4UKDA 1TQ2A 4P31A 3FMFA 2PEZA 4CT4B 5C4MA 3SEAA 3RVBA 2ZVQX 3E5HA 2QMHA 3GJ4A 2I1QA 5LB2A 3O8CA 2XSZD 3W6OA 4UQOA 1I2MA 3HDTA 4HYYA 5AK0A 3I92A 4JBWA 4QFMA 4PPFA 1NN1A 3IBYA 4LUCA 1NN3A 1OB5A 1GITA 3KXLA 4NYMR 1MH1A 1WBDA 2QMEA 4WIAA 1N2CE 2KI5A 4QHTA 5G40A 4BLQA 3LO5A 2HF9A 1IXSB 1A2KC 1U0LA 2VP5A 4DJTA 4MQBA 1E2HA 4A4DA 3TH5A 1XF9A 4LJ9A 2GCOB 3ASZA 3U3OA 2IW3A 1XDBA 2B21A 2OESA 2VL7A 4TYQA 4PO1A 1IXZA 3EC1A 1U0JA 2CHGA 4KO8A 5F9FA 1CRPA 2NZJA 1SVWA 1P73A 1KGDA 3IKJA 2W6ID 4KLZA 3ZIAA 1T91A 3KUDA 3GLFB 1DO0A 1ZCAA 2ZRBA 4PSVA 4TMZA 2ZREA 3PJRA 1NJFA 2OUKA 1SVKA 2ZRHA 3LAWA 3EZFA 2ZS8A 1MRSA 4CYMA 1J90A 2GXQA 5L3VA 1SKYE 2X8AA 2NO6A 3SHFA 2QT1A 3EA0A 1M74A 4HI0E 3M0EA 2J3EA 4PANA 3KQNA 4XIGS 3U3JA 3QOFA 2VO1A 5AJVB 1XXHA 3A4LA 3AVUA 4OJQA 5F9HA 4YMTA 3EPHA 4JKYA 2BMFA 5D3MA 4DLSA 5BW8A 3T12A 4O2LA 2VQSA 4NCKA 4OQFA 4QBIA 3WY9A 2D2FA 3AQ4A 4JZKA 4A1FA 2CL7X 2WIBA 5FOWA 5L3QB 4AKIA 1EFRD 1KI6B 4MRPA 5DNYB 1AGPA 1CJVC 2JCSA 5AJYA 2GNOA 3AVWA 1XPOA 3SBDA 4HUTA 2IHYA 2XNSA 4OI4A 2ZRAA 4BE7B 2CVHA 4M1MA 2PT5A 2AL7A 1J8YF 4TLCA 2FSHA 3MCAA 2CNWD 3ZH9B 1HH4A 2OE2A 3OIWA 1XCMA 3IO5A 4P33A 3LBIA 3ADCA 3U5ZB 1OIWA 4RZ3A 3TSOA 1FTNA 4U00A 1YHNA 1Z29A 4YMSA 5DE3A 5FPYA 1R10A 1ZRHA 1R2QA 2OCPA 2VP2A 2J7PD 2ZE7A 3LD9A 121PA 3TSWA 2P2LA 1P61B 4IXNA 5JEDA 1LF5A 4M8NE 2FF7A 2H5EA 2O8EA 3SFZA 2WPDD 1N5JA 2YOGA 3HR8A 3QEJA 4N3NA 3SJZA 1XCPA 4C3ZA 2W2TA 1EX7A 3QBTA 3R20A 4G5SA 3SU8A 4C2UA 3RHFA 4QM6A 2ZEJA 1LNZA 4FXPA 3A4NA 4KBFA 1BS1A 4K81B 4GP7A 4DLUA 2ANBA 4HB0A 3MG9A 4TTPA 3PEVA 4Q00A 4YXWA 2XZLA 2QNRA 4CEHB 3FMOB 3MUFA 3NEYA 5JFGA 1VHTA 5JMTA 1P75A 2Q21A 1DAMA 2YWFA 2CXXA 1YZLA 3QF4B 4IOLA 2G77B 1E0KA 1KSHA 4Q1EA 3VX3A 1P9WA 3KJIA 2RMKA 3UMFA 1E1RA 5D3QA 1JR3A 2VP0A 4IFBA 5CDFA 3GLHB 4JJKA 3TQCA 1ZJ6A 4BFSA 2ZRGA 2VTKA 1Q1BA 3B1YA 3JZMA 3K9GA 2GXSA 1VPLA 1TF5A 3KB1A 1Z3IX 1NNEA 1I4TD 1N0VC 3U4QA 1KJWA 3TNFA 3I1FA 4GMDA 2IYQA 3SC3A 3EIHA 5TARA 4JT4A 4EFMA 1IY0A 4CGZA 1S8FA 3BS4A 3OZXA 4OK5A 4M21A 1E0AA 1W0JD 2FSGA 2AD1A 1KDRA 1HT2E 5JZVA 2IS6A 4GDFA 3SOPA 1Z6TA 2VIIA 1SVMA 4LJ8A 4UNRA 2WVJA 2WWGA 3C5HA 1RYHA 1U9IA 1W4RA 1ZCBA 2ZI4A 5DI3A 3BBPA 3GEIA 1XZPA 2QTFA 4FMCB 4GPTA 2ZRMA 3EZ9A 3QY0A 3CLVA 1TPZA 5K8LA 5J4KA 2RGXA 2ZPTX 4B75A 3P20A 4W7SA 4K8OA 2FV8A 4MKGA 4BFVA 4CZ2A 5E3HA 1R0YA 3GJ0A 4F4IA 2IX3A 1AZSC 4II7A 4A0FA 1P9RA 2CCGA 1S9HA 3PUVA 4KCGA 3R7WA 2QAJA 4BEJA 5DYGA 4MKHA 1E9CA 2DR3A 4F91B 4ESVA 3OE7D 1UBGA 1II8B 1RW4A 3MMPA 3TR0A 1DAIA 2V1UA 2C98A 4DB4A 1QHXA 2IYYA 2ZRCA 4P0TA 5AJXA 2OFWA 1GRQA 2HXYA 1AKYA 2JEOA 3N2EA 1SVLA 1TEVA 2OXRA 1LTQA 4MRVA 2R9VA 1KIMA 4FMDF 4GOXA 1UDXA 1E2MA 3EC2A 4TTQA 3AGPA 5H70A 3QQ5A 1U94A 3PENA 3I5YA 4R2HA 2BMEA 3QKSA 2GCNA 3OEHD 2EFHB 3P32A 1E2JA 1CBUA 5CB8A 4PPNA 4RKFA 1ZP6A 5EE1A 4F38A 4HZUB 1KJZA 1LVGA 1AN0A 1V5WA 1XD9A 1D2NA 3L82B 1IJFA 3REGA 1Z22A 2BM1A 2JLYA 4JSYA 4CEJB 5EZ5A 5BN4A 2R6DA 4M1TA 4D80A 3QE0A 2VHQA 2VLIA 2YC4C 4HB3A 4B2IA 4EQ6A 1G3UA 3MWJA 1XPUA 1Z07A 4Q03A 2OBMA 2I4IA 4URWR 2GILA 3QIAA 2CHQA 3V4FA 5IK2A 2QZ4A 1GRRA 2ZSDA 4C0AC 3THOA 1ELOA 1G4UR 1P62B 2O8FB 2V9PA 1AS3A 4LJ4A 2JAQA 4NYJR 4TWZA 3TKLA 1CP2A 2OHFA 2VPPA 4ON9A 1KK0A 2CVFA 2G6BA 3DM9B 1JB1A 3IBGA 5FTNA 4AURA 3Q7QA 4JKIA 4Q02A 3FGNA 4JVMA 2QA5A 2QRZA 4AG5A 2QENA 1J99A 3DL0A 2DWPA 2OM2A 4Q9KA 2QROA 1OXXK 3DDCA 2JJ1A 2O5VA 2B7BA 3NBZC 4WAUA 4XJXA 3TW8B 2QAGA 4DKXA 3BB4A 3SJAA 5DN6D 3B1VA 3O47A 3CF0A 1E79D 2EYUA 3LVRE 2QY9A 2FOLA 3A1UA 4MA4A 2AN9A 2OFXA 3AP1A 3NDBB 2ORVA 3TMKA 1U2RA 4BGDA 1L4YA 1FP6A 1NL3A 2QBYA 4JMPA 1FUUA 4YMWA 4XTRA 1RRGA 2YOFA 1F6BA 4Q19A 2NZ8A 2ZJ8A 3E2IA 2IYXA 4A6PA 1GRNA 2ODWA 5E7JA 5HTKA 4B2PA 2ZR7A 1JQLB 2ZITA 2JLUA 3REFA 4BLSA 5IT5A 4DVGA 1WCV1 3PUWA 3THXA 4DRZA 2EYQA 4MITA 3WNDA 2NMVA 2ZJYA 4OBEA 2MSCB 1XZQA 5AUQA 1T5LA 4LHWA 2WKPA 4EDHA 5KSZA 1MABB 4ACBA 4RD3A 4N1AA 4OYHA 3OF5A 1OH5A 1P4SA 4V0OA 3F0TA 3ZIAD 3OESA 2CLCX 4NYIQ 1JNYA 4C0KA 3SJCA 5EP2A 1LV7A 5JHHB 1T8UA 1Z6XA 2JLZA 1JALA 1DOAA 5SZJA 3HPQA 1ODFA 4EJSC 1YVDA 3K70D 4V0KA 4LV8B 1KY3A 1LS1A 2O0KA 3WHLA 2PZGA 4HUQB 4IRUB 3ECCA 4BLRA 5KPJA 1RFLA 3SS8A 3TR5A 1UF9A 4JLDA 2NQ2C 1BKDR 4FCTA 1VTKA 1ZYUA 5FH9A 1R7RA 2IHBA 1UBEA 4B73A 3WMEA 2PCJA 3CNLA 5FOTA 2GXAA 1Y63A 4KXFB 1CR1A 3K70C 3KTAB 4DCTA 4UXHA 3ZVMA 4IOMA 4ASUA 1OT3A 2ONJA 3VR5A 2QPAA 2O8DA 1KZGB 3WRYC 2CJWB 3U44B 3SN6A 4N0EA 2RAPA 1OIVA 4US2R 4HB4A 4DCNA 2FE4A 5ELXA 2EFGA 4Q7JB 4TYWA 1OW3B 2A3RA 5SZHB 4NBSA 4O0MA 3PUZA 3QKRB 4TTRA 1ZU5A 4JLMA 2R6GA 1DARA 4LHXA 2TMKA 2BMDA 5TB5A 3GLGB 1KKMA 2BVNA 1EFCA 4P32A 5HR5A 2P6NA 1N5IA 4HAXA 4Q01A 2C96A 1MO5A 4PC7A 3BRWD 4YONB 3ZJYA 4EPXA 3DHWC 1I4LD 3CNOA 2VHTA 4PHHA 2BBTA 4PZYA 3U6BA 3S1AB 2QTVB 2ZYWX 2WICA 4DLRA 4N0DA 2PMDA 3FTQA 1W2GA 3RSLA 4CF7A 2ANCA 5FOXA 4EPRA 4X8HA 5FR2A 1MV5A 5HKKA 3CBQA 4YXWD 2P67A 3WRXC 1PUIA 2QT0A 4A92A 2EVWX 4QGGA 1OE0A 2DB3A 4C0JA 2JLWA 4DEXA 2FSIA 1ZM4A 5K8TA 3IEVA 1E1RD 1JR3D 3IPXA 4TL6A 3M6AA 4Q48A 3PFIA 4RZ2A 1T3LA 3I72A 2VP6A 1R6BX 3AVPA 1KK3A 1KI2A 1OPXA 1BYIA 2UZIR 2PT7A 1ZNYA 4XWAA 2XOKA 2J1LA 2GEUA 4DSNA 4LPKA 3WBJA 4QBFA 1SHKA 221PA 1E0JA 2R6AA 2IXGA 4US1R 3X2SA 4GZMA 1U8ZA 1JJ7A 4I4LA 1SKQA 2JLVA 2YZ2A 3VR6A 1A1VA 4DLXA 1XMSA 2JLQA 4QNMA 2PLRA 4IHQA 4V0NA 2ZXUA 2OCAA 1XXHE 4Z54A 2F3TA 1TQDA 4RSGA 4ZI2A 4TN1A 3UANA 4OQXA 2R6FA 4P3YA 1G6HA 1XFAA 1XJ0A 4ZV4A 5KSYA 2G3YA 4H1VA 8OHMA 1OJLA 1XEXB 3AF4A 2ZIAA 4AKGA 4URUR 3I8XA 1F2UA 3M4YA 3DO6A 2C99A 1NVVQ 3NBYC 2PCLA 4MRNA 4YLGA 1SVSA 2JASA 4PC3A 3PQCA 3FMIA 1U8YA 5FTJA 2CHVA 1YRAA 1PLJA 4M4SA 1G17A 4C0LA 1Z0DA 1G8YA 1Q1EA 1GILA 1MT0A 3T35A 1RRPA 4BRWA 2HF8A 4NTZA 2V1XA 4NCNA 1PVOA 5DH9A 1NSFA 1TADA 4BEBA 2DFLA 6Q21A 2WSSA 1OFIA 4KI0A 3U3MA 4HB2A 4ABYA 4UNSA 5TXGA 2GK7A 2VEDA 3NBFA 2BBSA 2FFBA 4O25A 1YU9A 5JSZA 2YVUA 3X1XA 2ZJ2A 4Q9IA 2IS2A 1Q1QA 3NHAA 2AK2A 4Z8XA 2NO1A 3AUYA 1EG7A 4DLYA 4A0HA 3CPEA 4GMXA 4P4SB 4TLEA 2XJ4A 3LWNA 1BMFA 4JLAA 2EW1A 5CK5A 3LW7A 4BECA 2Q9CA 1CR2A 4FMCF 4AY2A 5JCPA 3AP3A 1XRJA 4MH0R 3QKTA 5L3SA 3KQUA 4DBLC 1JAHA 1FX0B 3QBVA 1YJ5A 3CH5A 1O3YA 4EJSB 5FPKA 2ZJAA 5IK2D 4LYFA 1OXTA 3QPWA 1COWA 2BBOA 1UKYA 3ADBA 1YR9A 1T8TA 3FHCB 1X1SA 3WYAA 1GG2A 3BFVA 1JR3E 5CDFE 4FMDB 4RFSA 3THWA 2H7VA 2WWHA 4A0RA 2A5GA 1RZ3A 4RD2A 3PV0A 4X8MA 5LDDC 4ITRC 2YV5A 1ZUNB 4E03A 3A36A 1P3JA 4R9UC 3VU9A 3K70B 2IS1A 3I73A 1X8LA 3ZDQA 3W3AA 4PQYA 1W46A 2JJ1D 4PZZA 4UXJA 4D2IA 2AD5A 1XTRA 4NHOA 4AIIA 4M9SA 5J5CA 1E9AA 1IN7A 1IN8A 2ZRNA 3T06B 5AUPB 4IDPA 4CW7A 1XXHB 3T1QA 4GP6A 1H8HA 2F43B 2XX3A 4NE2A 1HEIA 3CX8A 4Q4JA 3BD9A 2G9NA 2UKDA 4BLPA 3W6PA 4XVQA 3DMDA 4LYHA 2ZJZA 3ZZ0A 2W0SA 4XVUA 3ZGXA 4HAUA 3UMSA 1ZM7A 2YWEA 4JS0A 2G0TA 1YKSA 4B3CA 2HYDA 2WWXA 3HWSA 3SBEA 3CPHA 1CU1A 5J4HA 4D6PA 5DLQC 4DHEA 3PEYA 1XTJA 3QNUA 2F1HA 5KYKA 3THYA 3CO5A 1RJ9A 2ZJBA 5CYPA 4JLVA 1DVRA 4Q7MB 3TGPA 1IQPA 2ZRPA 4MYCA 3Q5EA 4TT3A 2A30A 3E70C 3K0CA 3U6KA 1FPMA 1GUAA 1US8A 5FUYA 3PVSA 5JEEA 1QHGA 1NMXA 3ICEA 3KJEA 2WHXA 1E0SA 4PQFA 2PLFA 1WB9A 5FL7A 2IYRA 1OLOA 2RB4A 1KK2A 2VSXA 2IL1A 2I3BA 4ZCLA 2FMXA 1N6RA 4GFDA 3KQKA 4S2EA 3TVTA 4Q47A 4AG6A 4W9MC 2ZTSA 1UDWA 3EPJA 2V7QA 3HP1A 5CM9C 2OLJA 4MYTA 4R98A 2CE2X 4DWJA 3AP2A 3WNCA 4FCWA 2GBLC 5H8WA 3OFND 4B33A 2GRJA 4LYAA 1Z0IA 2W58A 3MD0A 4EFLA 2E1RA 2R44A 3P27A 4B3FX 3LQQA 2BEKA 2GEDA 2XJ9A 1A2BA 4BLTA 2OXCA 3AF0A 1JJVA 2QP9X 5TDHA 3I32A 4Z8YA 1IM2A 3K0FA 1W47A 4WXRA 4OK6A 4GNKA 1Q3HA 4U7DA 2OAQ1 3EA5A 1E9DA 4QRHA 3I62A 4R2IA 3TAHA 3PEUA 3MAAC 3JZAA 3NC1C 4TLDA 2EFDB 1GSIA 1E96A 5TMPA 1GM5A 1Q3TA 2QI9C 1JPNA 2ZRIA 2AFIE 1MO3A 4LDJA 4TL8A 5B30A 2NOAA 1Q20A 2OO7A 1RYFA 3LDAA 1KO7A 2HJGA 2IT1A 5FR1A 1KO5A 2GJ9A 4CEIA 1Q57A 1T3SA 3A1SA 4O2RA 3LNCA 3QI2A 3SNHA 4P4UA 4LJAA 3QENA 2FJUA 4LZZA 1YZNA 2D7CA 3D31A 2ZR0A 4LHZA 3FPAA 4ILEA 3JVVA 1Z8FA 5HKKD 5GJWC 5CLLA 1P5ZB 1GAJA 4B3GA 4BFXA 2V54A 1JBKA 1T3HA 1VECA 3IIMA 4WBSA 3X1ZA 2FFAA 4TQAA 1NLYA 1G64A 2HEIA 4J0QA 1GOTA 4MGZR 3CM0A 1P72A 2F3RA 2H16A 4NYMQ 4Q4HA 1IOZA 1NI3A 1UFQA 2P6UA 3A1VA 1OHHD 2O52A 3N70A 2RH5A 5FTLA 2QGNA 5IDVA 3GJ7A 3QKSB 1JQJC 5AJWA 1G7TA 2XOKD 2D06A 2GJSA 1N6IA 2GHIA 1D6JA 3FE2A 4L9WA 4QG7A 3T1VA 821PA 3SJBA 1G7RA 1F2TA 1VMAA 4TLBA 2VBCA 3CKLA 1XTQA 5HZHA 2CDNA 2OZEA 2JJ8A 4EQ6B 5KO2A 2BWJA 4G5OA 1AIPA 5EUQB 3ZD7A 4MDFA 3C41J 1AS0A 1KI4A 4IDOA 4FW9A 4IOKA 2FEMA 3CH4B 1E9RA 4RD1A 4O3MA 2KE5A 2Q3FA 5EXPA 1QHHB 1SXJA 2DY1A 4A2PA 2O8BA 1KMQA 3TK1A 4EAQA 4QJ3A 5BWMA 4L15A 2GDJA 1XD2A 3R9IA 3RRMA 1EWQA 4HEJA 3R8FA 5FPHA 2C04A 1Q12A 1A4RA 1G16A 5JCZA 3KJHA 4ZKEA 2FFQA 1AJEA 1GFIA 2F6RA 5CIWA 1M6NA 2ZU6A 2GVZC 4OHZA 3RABA 2HUPA 4KVGA 1MRNA 2AKYA 2WSSD 4RFVA 3VHXA 3GLIA 5KNCA 3DVLA 4OHYA 2O0JA 1U8AA 3T1OA 1KSGA 1G8GA 2C9OA 2F1JA 1QHYA 3ZQ6A 4JT2A 3SI7A 2GJAA 2QBYB 5DO9A 1NJGA 4HLUC 4MYHA 3GMTA 3OIUA 2ZSFA 4W5HA 2GK6A 3VHLB 2QSYA 1LF0A 3C7KA 2GAOA 1DAKA 3UK6A 4JBXA 1NG9A 4ARZB 1HA3A 4IDHA 4IW3B 5GVRA 2X19A 3SQWA 1BMFD 4TSFA 4XTCS 1UKEA 5IF9A 4I1OA 2QPTA 3KL4A 4RVCA 4X8LA 1YZGA 3AVTA 1W48A 1JAIA 1LB1B 3Q3JB 2OV2A 1NG1A 2QMOA 3DMNA 1Z0FA 3MGCA 2JIZA 1XMVA 4C9BA 3FHTA 1II9A 2J46A 2VSFA 2B6HA 4JVNA 2AK3A 4D26A 1COWD 1MKYA 1SKYB 3AKCA 3RS3A 2BCGY 3KXKA 2AR7A 3TLXA 2G1KA 1TQ4A 1G3QA 3RRNA 1OKKD 1X6VA 3WYGA 4LBYA 3B9PA 3LXRA 4PR0A 4R71A 3C14C 5B58C 4KAXA 4QL3A 3LH5A 1G18A 2QTHA 3K09C 3L0PA 3SQXA 2KB0A 2PBRA 1N6HA 2IA5A 2FH5B 1G5TA 3R8CA 5FOUA 3RS5A 4IFEA 1PZNA 1DG1G 4E5UA 4A82A 2XZPA 2W00A 3B85A 2J0UA 2H1LA 3R9XA 3U2QA 1E9SA 4M1WA 3ND9A 4L8GA 1RKBA 1KY2A 4PAMA 5EE0A 3ZVNA 3RNLA 3I4LA 1E94E 3LRPA 3EG5A 2CCKA 5SZKB 3QG1A 2WSMA 2ORWA 4DZZA 4KFTA 4IXMA 3UXMA 2Z4SA 4Q66C 1E2FA 2GXUA 2RHDA 4ACAA 4ZDKA 2OILA 4ZPXA 2OT3B 4LC1A 3FYHA 2FPKA 1Z6AA 3SYLA 4C7OB 3ZZTA 2H57A 2HCBA 4B3DA 4RD4A 4EPWA 1G8PA 3V9PA 2QP3A 1E2IA 1R8SA 3H0KA 4GBMA 4BFTA 1I4DD 4BZPA 1S3GA 3U7EB 1UPTA 1Z08A 3B5JA 4IVPA 1CEEA 1UM8A 3GFTA 4LV6A 3L0OA 2ZR9A 4G3XA 4F93B 5JJKA 2OAP1 4TT3D 2ZQ5A 3T61A 2GCOA 5EXSA 4R7ZA 4QBHA 2IF0A 1DG3A 3TSZA 1E9FA 1XEFA 3VNUA 4IVRA 4PAQA 2A5FA 1UKVY 1IN4A 1NBMA 1Y3AA 1H8EA 3BK7A 2A5DA 3WNBA 2ZROA 2QE7A 4B3XA 1A7JA 5CM8B 3ADKA 4UNNA 1CRQA 3GLFA 4C0BA 1OFTA 3BOSA 2ZUCA 1KSJA 3C16C 5GJCA 1F5NA 4OI0A 1T4GA 3K0CC 4QXAA 1FQJA 1W5SA 1ZUIA 1VKJA 1HT1E 4C2TA 2WJIA 4DCSA 1H65A 3B1WA 2V7QD 2QSZA 3FFAA 2Q6TA 3LVQE 4Z1MA 4U5XA 4ZDWA 5C18A 1AGRA 3O8DA 4Q1BA 3QKUA 4RD0A 3GEHA 2DYKA 2IK8A 1IJEA 3GCGA 1M7BA 3RS0A 1GNRA 4YQFA 3MFYA 1P2TA 2QRNA 2ECKA 4DEYA 3CRRA 4ZCIA 1G19A 1NIPA 3PITA 5L3QA 4UNQA 2JDID 1KI6A 1OIXA 2Q3MA 1R5NA 4NKRA 1XX6A 4QKQA 2V6JA 1E2DA 3CF2A 1E2GA 4NYJQ 2IXFA 2VHJA 2ZANA 3RDPA 1E3MA 3QXXA 3U3KA 1ZBDA 1IHUA 1Q21A 4QBGB 1XEWY 3EZ7A 4FIDA 2J41A 2JA1A 5JS7A 4WZAE 2SHKA 1ZM3A 4OQMA 5EUMA 3N2IA 1XNJA 2Q9AA 3TUZC 1KSFX 1G8HA 2DWOA 1B0UA 2FPMA 1ZD8A 5JWRA 3VR3A 4RZXA 2QP4A 4GSYA 5EP3A 5GJBA 3HPRA 3W5IA 5BN3A 4NU0A 5G3YA 3WYFA 3BAFA 2WJJA 4HATA 2IUUA 3LFUA 1N6PA 2CLDX 3U3RA 2WTUA 3MWYW 4YC7A 1W0KA 4HDQB 1F3OA 4DUGA 1A82A 2VF7A 2ZJOA 4B44A 1OF1A 1QG4A 4MGYR 1FMLA 3VR1A 3K0SA 2GVDC 2AXNA 4W5JA 4AKHA 2NO7A 2PH1A 3B6EA 4L16A 3ZVLA 2FWRA 3UPUA 4PAOA 1DAEA 4CEHA 1E32A 3FKQA 4YDSA 1DS6A 4NYIR 4GT1A 1A5TA 3QF4A 1UBCA 1S0UA 2QN6A 1NVWQ 4LOAA 5HZKA 1BIFA 5JS8A 4US0R 1C1YA 3GLHA 5FBLB 2ZI3A 2HLDA 1L7VC 4ZCMA 3LX8A 2WJHA 2VHUA 2GETA 4AYWA 4MUBA 4ZO4A 4B71A 1D9ZA 1PUJA 1SHZA 2WIAA 3PCRB 2FFHA 3RC3A 3DZ8A 3VR4A 1NMYA 2IWRA 1TUIA 4MRSA 1IONA 3L2OB 4DDTA 2C9YA 1L4UA 3AF2A 5CIQA 4BASA 4QJ5A 1XMIA 1Z0JA 4M0LA 3X1WA 1JPJA 3D3QA 4PZLA 1SULA 1R5BA 3CF6R 1M2OB 4RFSB 3ZQJA 3U7HB 1SXJD 1E1QA 3BXZA 3EW9A 1DO2A 4Q21A 4TZ6A 4RCZA 4ZKDA 3BORA 1OXSC 1ZIPA 1AK2A 1ESNA 3F5FA 3U61B 1W36D 3AF3A 1CXZA 2C9CA 3L43A 4MRRA 5TV2A 1E69A 2X77A 4XVRA 4HAZA 4M1KA 1PLLA 1G20E 2XXAB 1XPRA 3I61A 1FUKA 2Z0MA 4JVLA 4E09A 3RS4A 1NSTA 1KAGA 1QVRA 4WVFA 4DDWA 1II8A 4BLOA 1KI9A 1KNXA 5C46F 2O0HA 4JBYA 5J4LA 3GJ6A 3W5JA 1E99A 4B76A 5C2JB 5SZIA 1G5PA 3W6NA 2QORA 5FBRB 4L5BA 2ZSAA 4TMTA 1T5IA 4LBZA 3NEJA 4IEIA 3AM1A 5KU1A 1X8JA 5B64A 4KJZA 4TSFD 1OYYA 3D6TB 4K46A 1HQCA 621PA 4FMBB 1QDEA 3L0IB 3QVUA 5HPYB 4FD2A 4CEJA 2FEOA 3CPJB 4QGHA 1KO1A 2JIZD 4BFWA 2KBFA 4KBGA 4KLNA 4GOJA 1CJMA 4XSHA 4URYR 1KMHA 4PC1A 4TL7A 1XJCA 2IF2A 4IVQA 3EX7C 3UATA 3L8YA 2F7SA 2A5YB 4Q4AB 2ERYA 4OHVA 2O8FA 1SVOA 1S3SA 2VH5R 4DT1B 2XAUA 1NVXQ 2PEYA 3CRMA 4JIMA 1N0UA 2OBNA 2QEQA 3AB3A 3FKSA 2IYSA 3P1JA 5UKDA 1WBBA 1U98A 3KZ1E 3GP8A 3I5XA 3EPKA 2NGRA 2ODNA 2RGDA 3FMPB 2IUSA 1T0HB 4D4KA 2Z6VA 3VKHA 2N46A 2HT1A 1KHTA 1NKSA 2GWHA 4PFSA 5HCIA 5KHOC 5JBQA 4NCJA 3W90A 4DXAA 2DBYA 2Q3HA 1EFUA 1GTVA 1EX6A 2Z43A 3C15C 2ZE5A 5E4FA 3P26A 1D8TA 1E9EA 3RRZA 1CKEA 1U99A 1U9IC 1WDTA 3AV0B 2GJ8A 3AH8A 4HSEA 1R0ZA 2BCJQ 1SXJE 4LX0A 1EFRA 3B13B 4D4MA 3BB1A 1TUEA 1Z6YA 1W4CA 3VAAA 4DDVA 3QXJA 4DSUA 1WP9A 1AQUA 2CL0X 4M1SA 4V0LA 4L4UA 3OIVA 1GKYA 4B47A 3CRQA 1XBTA 3ZLJA 1XD8A 2ODBA 5AWFC 4GOKA 3D8BA 3T34A 2AKAB 4TYPA 2ZSEA 1SVIA 3AKYA 5FUVA 3QSYA 1MABA 2H18A 4Y0VA 1KO8A 1TU4A 3AVOA 3GLIE 3A4MA 2J7PA 1KK1A 1U0HC 1HE8B 3K0AA 4KV9A 4PSAA 2H8KA 2DFTA 1GL9B 2GESA 3KQHA 1OB2A 1NBMD 1H8ED 4PHFA 4V03A 1RRCA 2J59A 3GPLA 1YZUA 2QE7D 2W2VA 3GJ8A 1N0WA 1OSNA 3SHWA 2ZRLA 3V4RA 2ZE6A 1S9DA 5EJEA 1IY2A 3LX5A 5EZ6B 1EK0A 5FPTA 3MSXA 2YHSA 5AJZA 3BIFA 3TUIC 1QHSA 1ZNXA 2RKOA 4P4TA 2OFOA 4Z1MD 4EIWA 3FFBA 3MRSA 3QUSA 1Z47A 1G21E 2WKRA 4RCYA 1M34E 1E2NA 3IHLA 3ZS9A 5A4JA 5KSPA 3C5CA 2B7CA 1E6CA 4BQSA 3GEEA 3TVDA 3BB3A 3UG6A 4I1SA 5KPDA 1G7CA 1OFUX 1AA9A 2KJQA 3CR7A 2QM7A 4HLCA 3KTAA 2YOHA 3KX2A 4A8JA 5TVKA 1Z06A 4DLZA 3ZYCA 4A9AA 4FINA 2WWIA 2CJWA 2OLKA 3U44A 2A9KA 3Q5DA 1NN5A 1VG1A 2XEXA 1P2VA 4FWIB 3MJRA 1AKEA 2QG6A 2BOVA 5D3MB 5HE8A 1XTSA 1HY3A 3IIKA 2AWOA 3RAPR 3QXHA 1TMKA 2K5UA 2C8VA 2KWIA 2IYWA 1FL9A 4V0MA 4JL5A 2AWNA 2QAGC 2CK3A 4LJ5A 3SYNA 2EQBA 1JXOA 1G3MA 2RHMA 5CB6A 3GLGA 3RWMB 4PO8A 4JLNA 2EFEB 1Z63A 2BKEA 1SQ5A 3VKGA 4XOIA 4Y0AA 4HAWA 2Z4RA 1N6OA 1W1WA 3AUXA 3CIOA 3K9HA 5EQTA 1N5KA 5H68A 4CVNA 3S1AA 4DC9A 3U7GA 2IYZA 1DELA 1W0KD 1YQTA 4DUGD 1N6KA 4PQRA 2B92A 3WMFA 4B74A 3K9NA 4B34A 1RRFA 2NTYC 5EP4A 3RANA 2G88A 4TQ9A 4OL0A 2O8EB 5EXTA 4JVSB 3GLIB 3UIEA 3KUCA 4NCHA 1CIPA 3AVQA 2LWIA 1IAQA 3HU2A 2V3CC 3QF7A 2Y8EA 1ANKA 3VR2A 4B6FA 3KQLA 5JHGB 4EPVA 1JEEA 4BZXA 3SE0A 1J70A 2EWWA 5JJLA 3CWQA 2QQ0A 2HLDD 5AUNB 4U02A 1U81A 2QPOA 2ASEA 3GQBA 4E22A 3CNNA 2ZS7A 1CTQA 1NBME 3K0EA 3DOEA 2JJ2A 3FWYA 3CW2A 2CL6X 3GLFE 2ZRJA 4AD8A 1CLUA 1VYTA 1ZNZA 1WE2A 4M9XA 1P9NA 1MR3F 5E95A 2DHRA 4ASUD 1IXRC 1IY1A 2ERXA 1E2QA 2QGZA 1NMZA 3U4QB 1GKIA 3IGFA 1VG8A 4PC6A 1G9XA 5DYIA 3P4YA 4HLDA 4KODA 4E07A 5IHPA 2P65A 1SZPA 1R4AA 1E1QD 1RIFA 2WMNB 2LKCA 2DFNA 3CX7A 4QGAA 5BYKA 1NLZA 3I3SR 2BMJA 4DCVA 3WMGA 1XEXA 4W5WA 4ZIRA 1DADA 3C4JA 2QUZA 3DOFA 2C03A 4Z51A 5A5GA 1ZW6A 1ZM9A 3L0SA 1ZD9A 5DI3B 3OHMA 2A78A 3UWOA 4DSOA 3ADDA 1W44A 1S96A 5BXQC 2C78A 4X8OA 2F55A 4DLTA 1NN0A 4Q7KA 2WZQA 4XSGA 2ZETA 5EE3A 4G5GA 4C0QC 5LD2C 2ZS9A 3FB4A 2C95A 4DDUA 2WKQA 2WBLC 3EIEA 4D4JA 3PR1A 2R62A 3H2YA 2D62A 4LY6A 3R9WA 1NRJB 3CUEF 3R7WB 2AFHE 2BM0A 4AKEA 2G1JA 2NO0A 1JR6A 4BWYA 4Q1DA 4WA7A 1UKZA 4PXAA 4MGKR 4P4SA 1HYQA 2E9SA 3AVVA 2A7QA 2ATXA 1D2MA 1M1YE 2WV9A 3WP1B 5KSOA 2MSDB 2ZVPX 4M9QA 5KDLA 1FX0A 2F9MA 2J87A 3IIJA 4G1UC 4A2WA 4AWXA 4EJSA 3BH7A 3QXCA 4A6XA 1G291 1D9XA 3HYRA 2ZE8A 1Z83A 3IHWA 4AK9A 3RS2A 4BPBA 2ZRKA 3EZ2A 4FN5A 3SYKA 1FZQA 1KKLA 2EFCB 1VCOA 1BH2A 1VCIA 1K6MA 3EXAA 4D81A 5G3ZA 5KNDA 3GLHE 1GIAA 2BHRA 1UBFA 3A6PC 1CJKC 5KOYA 3GD7A 3FKSD 1GL7A 1JXMA 1N6NA 4KFUA 1ZAKA 2UVQA 2VHCA 2BV3A 4Q9JA 4A36A 2IYVA 2PZFA 3CR8A 3IO3A 3LY5A 4TYYA 2CMKA 1YR7A 2JLXA 2WWYA 2YWHA 4AYXA 4OJKA 2WOJA 1XTIA 1D5CA 1FOEB 2F43A 1EFHA 4ZDIA 2V6IA 4IEEA 2CLSA 3DKVA 1OH8A 2CBZA 3B2EA 2QL6A 1E2KA 1E2LA 2P3SA 2RGAA 2QAGB 1AM4D 5JECA 1QF9A 1K5GA 2Z5FA 4XD7A 3DZDA 3VFDA 1E4VA 1UJ2A 1FFHA 1T0JB 4DB2A 1CS4C 1VCNA 5FTKA 4UJ3A 4OK3A 4IDNA 4DCUA 5GVSA 3WXMA 1DAGA 2IYLD 3BWDD 3T5GA 1FTSA 4HZIA 2ZYVX 1FNMA 4D0LB 2P5TB 4AYTA 1VG9B 3IEUA 1Q44A 4QNRA 4UJ5A 2NO9A 2REBA 2R2AA 2XNDA 3IQXA 2OEPA 1EFTA 1XB2A 3EWSA 3GFOA 1KAOA 3OAAA 1NP6A 2YYZA 3KB2A 4WOPA 4C30A 1Z2CA 1YRBA 4Q1AA 2ZYTX 1M8PA 1QG2A 1OV4A 2OSBA 5FBQB 3THXB 3AVXA 1LY1A 1S2MA 1LW7A 1MO6A 4RKEA 2PMKA 1W4BA 4V02A 4F4CA 1M7GA 4GI7A 4I1VA 4OHWA 4PO9A 1HUQA 4OQLA 2GEVA 3B8HA 4M1OA 4B35A 1ZUHA 1NVUQ 2JGNA 2GJKA 2A5JA 2RGNA 3JVUA 1TAGA 5FUWA 4B2LA 2WAXA 3TE6A 4QGFA 1WQ1R 1TTTA 1IN5A 2V4ZA 3UKDA 3LBHA 4PTLA 1FP7A 3AKEA 1AQYA 4IDQA 1DBSA 1X86B 5F98A 2REOA 4UNPA 1CF4A 5C4GB 4I1UA 1RE0A 4URZR 1Z0AA 5A0FA 4M53A 4KSCA 4DLVA 3AVYA 3MLEA 3H84A 4CRWB 1NKTA 1QHIA 4URXR 1H8HD 4PX9A 4BFYA 4PSKA 1QBKC 1QVAA 2O8CA 1GP2A 3IQWA 1CJUC 2ZSBA 3ZVRA 1KNQA 5FI0B 2ZI9A 3TJZA 4A8JC 4B32A 3MWKA 1G3IA 1ZD1A 1XWIA 4TLAA 4C0HA 4BUJA 4B6EA 2O8DB 2CK3D 2HDNB 1ZNWA 1SGWA 4KU4A 2ZAOA 1E2PA 1YE8A 3RWOA 5E7IA 4M1YA 5BQ5A 5DI9A 4D4LA 3FHOA 2FX3A 3K8YA 3AKDA 2XGJA 1JI0A 4H9GA 4A0GA 1N6LA 4Q9HA 5LD2B 5KDDA 4Q7LA 4PC2A 1N3BA 4RJLA 2IUTA 1ZIOA 5KNBA 3NH9A 1VIAA 1WXQA 4F92B 4JJZA 3PG5A 1B23P 1K5DA 4I81A 2BBWA 1E9BA 3KKQA
chains in the Genus database with same CATH superfamily
4KMOA 3EMKA 4K6CA 5CAEA 5ABPA 5D6NA 1EVEA 1ZH0A 3LA6A 1W96A 1GCOA 1QUFA 4DZTA 1FB5A 3EH1A 3D64A 4BQEA 2OCXA 2O8NA 3GEMA 1LQTA 3H2SA 4XWGA 3K2QA 1NJ1A 2MSWA 5COQA 5DTMA 1LVHA 2FZ4A 2I4TA 3U7FB 5IRCD 2GF2A 4TXMA 1N7HA 3RSOA 1FNNA 3A4IA 3RT7A 1M0TA 5A4KA 2E48A 1GUBA 1JG4A 2VF8A 1NGSA 5IEJA 4OQNA 3BZWA 1ODTC 1YL5A 4ZMSA 4EEZA 2PPVA 4I8IA 1QGOA 4OQZA 2A1IA 4Q82A 1GWNA 3GUZA 1SU7A 1H0HA 1UT6A 2V8OA 3KLNA 3PUYA 3G68A 5DWQA 3K4PA 2Q45A 3BVPA 4CR7A 3I9KA 2Y6UA 4F8EA 2FP4B 1NATA 1EXMA 2XTMA 1S2NA 4MV9A 1WA5A 1H0RA 4MGIR 4JY7A 3JQFC 1ZU4A 3V34A 4RGQA 3Q9NA 4PWYA 3AHGA 3T9BA 3IT0A 4KK3A 3FMVA 3QPVA 2G5CA 1WO8A 3ETLA 3L8ZA 4FIZA 4A2QA 3STTA 2JFGA 4PV7A 3SR0A 1EESA 3VKWA 2PWAA 1OX4A 2FEPA 4QSHA 3ZJ4A 4RWEA 4G36A 3WHKA 1A9TA 4MAFA 3DFFA 5AW5A 1Y8RA 1RU3A 4Q18A 1XLTC 3LT2A 2FX5A 1L4LA 2XT9A 1A2OA 1XQWA 3A7EA 3PGLA 4YJHB 3LLMA 4LQLA 1RZVA 4OFZA 2YZGA 4URHA 4MULA 3I76A 4HEA1 1M3SA 1KJYA 4AP9A 3HXOA 2GPNA 1CSEE 3KYCB 4HQ6A 5BOSA 5LP6A 4UXIA 4JB0A 5EPUA 4DV0B 3L8CA 1YFLA 1QAOA 5F78A 3HO8A 3ETNA 4FKZA 3RVMA 4EUFA 2L69A 4IIDA 2HJVA 4RUKA 1DIGA 2J48A 2XUPA 4QDTA 2VPTA 3I6YA 3CJTA 3WRWA 1AZTA 1F2UB 2WTBA 1ATIA 1OGYA 4AECA 4EOGA 1WVGA 1J7KA 4X90A 3LRTA 1HDYA 3PGA1 3SDZA 3L93A 4O3FA 3SF8B 4F4FA 4FB4A 1UADA 2D4AA 3BMQA 3T9DA 1HNZB 5E6RB 3LW8A 3E7DA 3ML1A 3OT4A 3AR7A 3QTBA 4G0UA 4F72A 4OSPA 3CF4A 4IHAA 4IUYA 3W34A 2XGMA 1BHJA 9ATCA 1YL6A 4UDOA 2QR3A 3VJKA 3PXAA 5CEEA 5CLGA 4YGYA 5D84A 1N5RA 1QO7A 3DT9A 3HCNA 3M1AA 3T52A 3NIBA 1JT9A 1DUIA 3O3NB 1A9ZA 2AG0A 2GO7A 3RLFA 3SSMA 3F7MA 4RHUA 3LLCA 5K0CA 2FW7A 3OJCA 5GIPE 3TW4A 4J0HA 3H5VA 3C24A 4MROA 5FV4A 1GTSA 2FWJA 1L7BA 4LY9A 1JDBB 3ZY6A 3UMGA 4NH0A 1GFSA 1OH7A 3A1WA 3EASA 3IB6A 1VG0B 3BFXA 4F4JA 2Q4OA 3BILA 2NADA 3WJAA 3NBMA 5DCYA 2X1VA 4RPCA 2PTGA 3GOQA 4QM7A 3IDZA 4XM2A 5LDHA 1YB5A 3K0AB 1A8SA 1KJNA 4MVJD 3GVXA 3HXLA 3STXA 2Y2UA 1L3BA 1UWKA 3BA6A 3CISA 1C9KA 2I33A 2BKAA 1KI1A 2H9AA 2JGDA 3LI2A 4XGKA 1TJ4A 3VZCA 3P4UA 4UTRA 5L3SB 5T4EA 3F3YA 5C52B 5B2ZA 3OUTA 3OX3A 4XD2A 1W2HA 1SBYA 3H17A 3KVVA 3Q41A 1Z4NA 1CHDA 4HDOB 2PUBA 3A37A 1R0XA 1IEVA 4IMRA 3P2YA 3BE6A 3N5CA 4RF5A 4CWAA 4Z3DA 4DPMA 3HYTA 4MHSA 3HKBA 1T10A 3OEEA 2NO4A 3DBHB 1OH6A 2E3JA 3TLZA 4A15A 4ATNA 1HT0A 5FOSA 3JQQA 1U7UA 1LDYA 4PPGA 3ZY5A 4JENA 5F35A 5FPQA 1RJFA 2ZSJA 1GYRA 1L7QA 5K0TA 4O2AB 1DIOB 2IC5A 3FTEA 1Z3CA 3R0VA 4BRZA 4KVAA 2REQA 4IWYA 1XZFA 3WDLA 5BSKA 1SHUX 4WZAB 3G3EA 3TXXA 3MTEA 4XD7D 5FJJA 4D6XA 2Q3DA 3ENVA 4RWZA 5JWHA 3T1YB 2PX0A 5JJIA 1A8QA 1GPH1 1SA0B 3IEIA 2DOKA 3STVA 3LV8A 1XQ9A 2HMYB 3ENWA 1TMYA 2CCJA 4G9EA 2HGSA 1S4MA 4HAIA 3SZOA 4EENA 3H2HA 1FBNA 2WU3A 1DWUA 5LL6P 3Q40A 4PHGA 3W5DA 4URVR 2JIDA 4AU1A 1YR1A 1GPJA 4A8TA 1I10A 3MINA 5EE5B 4BHTA 1G41A 3UWKA 3A1EA 3EQ8A 4BQIA 4IZHA 3QFRA 1A9XA 2E1PA 1NWHA 1O9GA 2C3MA 2QUJA 1VYUA 2OB1A 1GGHA 3I1JA 2IS4A 3CT6A 4HH4A 1QPZA 1REQB 5F9FA 3D7MA 1BVHA 1EP9A 3PXUA 2QLBA 1ZR2A 4HZUA 3O8OA 1XKXA 2QTRA 2ORIA 3BTSA 1O6GA 2C77A 1ZVVA 1SB9A 4MLCA 3S2EA 1W52X 1O1YA 4L5JA 3ER9A 1C1DA 1DKLA 3WB2A 3WYEA 5HYVA 4WKNA 2ZI7A 4G1BA 3H6GA 1ISHA 1EM8A 1FFXB 2O2DA 4G4SP 4PYMA 2WLSA 1DC3A 3M8KA 4GL2A 3KFLA 3HKDB 5JAPA 4E1VA 3CSSA 3AZOA 4EUSA 1P5JA 5J4VA 3MS2A 1RXWA 3FD8A 1O6FA 4Z0PA 1X7XB 4NG4A 1O87A 2V6BA 1J07A 3TLAA 1YS2X 2FEAA 3IRVA 2LPMA 1TU3A 2M6SA 4BV2A 3JQAB 4FEEA 3NO4A 4DJDC 3OOHA 4Y2TA 6ABPA 2YY5A 3IAHA 5H1YA 3KJXA 5D7NA 1UBMS 3L8GA 3E9EA 3TL2A 3AHCA 5I7WA 1CRLA 1Y1RA 1GZHB 3PLRA 4MVJE 5EKTA 3UMVA 3RS7A 1K6IA 2J4CA 2A2ZA 1UJNA 2MYTA 1GL6A 3QEOA 4MKIA 3S55A 3T38A 5KTMA 5BQXA 3NTUA 1HFJA 1V11A 3FI0A 4Q1CA 3ZHSA 3Q85A 4MRMA 4D9BA 5B7PA 5LR6A 8GPBA 3H97A 4OL9A 2A86A 2NIPA 2D3WA 3JCZA 3ZTYA 3SYRA 2ON6A 2H63A 2W0MA 4HNVA 3OZDA 3CZ5A 3HU1A 1Z2AA 1AS2A 3BXHA 3GRPA 2ADOA 1XTPA 2AXPA 2OZLB 4R5MA 4X00A 1UC8A 3FNEA 4XPIB 5T8KA 3UTDA 4BB5A 4LWZA 3GDOA 2GZHA 2EU8A 2QOEA 4OYYA 1Q19A 5P21A 3ZCVA 1G20B 2QYTA 1YR8A 3HO6A 5FWDA 2DHQA 4EKIA 3MJDA 5JBIA 1XRSB 1D4FA 3U7JA 3ZNPA 1A1SA 1U2SA 4QPCA 4WPGA 5ER9A 3WLAA 5CDHA 5DXJA 4H7KA 4P3OA 5KJ6A 2KW5A 2WM9B 3ACDA 1W9HA 3H4VA 3FCYA 3CLSD 1MIOB 1K97A 1OZGA 4P22A 4C21A 4DIEA 1T2NA 4INPA 3I6BA 5JTUA 3LK6A 1QZ3A 2V6FA 4D3ZA 2D1FA 3N05A 3UG7A 4ALJA 4BKQA 4OFWA 5HSGA 1RTKA 5KYYB 4MDEA 3E3NA 3V4SA 3DM5A 2PJDA 4LRQA 4ZT2A 3NUZA 1C41A 5BQFA 4WW0A 4L9SA 1G8MA 1P18A 1FTYA 1HE3A 2VUUA 4MPTA 4OMDA 1TU0A 3RTAA 3RYTC 4BJ6A 4EBBA 2WPDA 3WLJA 3RRYA 1JG1A 2QUAA 2P2NA 1LD3A 3AGQA 3TNYA 2F1IA 2OCBA 1ONPA 1T6ZA 2GERA 3Q3CA 5CYFA 1UMBB 2VRBA 1W5TA 5K3DA 1VE3A 1M2NA 2UYQA 5B3JA 2I8LA 2MMGA 1U2GA 2XUZA 3LBYA 3N7TA 4PFQA 3ZVKA 5DZSA 5EYPA 5K6AC 1OBFO 4B85A 2FX2A 3FYUC 5C1BA 1T26A 4ND3A 3IDQA 3PEWA 5IKPA 1G8FA 4F9FA 2D5IA 4X1YA 3R41A 1XP8A 4AKTA 2GDZA 2QMUA 5IVHA 3GF4A 1WCWA 3L7MA 3W0LB 5CA1B 4J6FA 4L5CA 4K26A 4QOSA 1L7EA 5KNBH 5AR1A 1UZMA 2IY7A 2SCUA 3WDSA 1F48A 2VP4A 5DHFA 2VT6A 3A31A 3NOXA 4PTYA 4EW3A 3U9TA 4ZVQA 3RROA 4GPIB 4L28A 3T0FA 4C14A 3K09A 3N0XA 4IQGA 1H69A 4F2GA 4KNVA 2AC4A 4L3OA 2DFKB 1JSCA 1GZSA 4ZOEA 4AF8A 2OCLA 1M2OA 3EXIA 4Y9SA 4MXDA 4QYMA 2XHZA 2N9UA 5F7OA 1PR9A 3C8UA 4B87A 4LJYA 2Y4OA 3QKRA 3NVDA 4X7RA 3D6JA 4Z9YA 1MXHA 3HUUA 2C88A 2YN0A 1CJTC 2MSEB 1J5EB 1SXQA 4BFUA 2D1QA 2XNJA 1KZHA 2KBEA 4OSEA 1WSWA 3KSUA 3MBKA 3KKOA 1SOWA 3EHDA 4YH1A 3SFVA 2FSFA 5BSWA 2ONYA 4LBVA 1JG3A 1KU0A 2BW0A 3B1ZA 1GUYA 4G26A 2Q0HA 2IBMA 3LWZA 1W36B 4TGLA 1RYYA 3NAQA 1XZCA 3O4GA 1G5RA 1NJ5A 1PO7A 1X1DA 3OE4A 1QFJA 4XCXA 1U90A 4Q9DA 3CINA 1XZ8A 3H9UA 2H9YA 5CBKA 4KX3A 2AX3A 4CKCB 3LT1A 4PAWA 2IP2A 3H86A 4PONA 2RH9B 2FUCA 3BXXA 1IUOA 2RBKA 1P44A 4JL6A 1TC2A 2KSQA 3DEFA 1YIDA 2HXSA 4UBIA 3L46A 5TVGA 3PA8A 2VPIA 1ADCA 2F90A 1BN6A 1W49A 3PLNA 1C80A 2CLHB 3RCBA 3VQTA 1SVUA 4ER5A 1G66A 2NT4A 2PUWA 1IRXA 1V4BA 1OWNA 1NLFA 1WW2A 1PR3A 2IYUA 2XTZA 5F1YA 5I3CA 1I6KA 3KFVA 1CFJA 4Q12A 4Q9LA 3ET5A 2WINI 4XJTA 2Z8YA 1JKIA 4QQKA 4U4AA 3LHIA 3CZPA 5IDXA 5EPOA 2H4HA 2B8TA 4WE3A 5FBWB 2X7JA 4O4IB 3UCXA 3PXGA 2COKA 1DB3A 3I8SA 4K9NA 1WXFA 3W3ZB 1T3ZA 4U7FA 1QRAA 2A1TR 2JLSA 4MHTA 3GZ4A 4P4NA 2V0GA 2DP4E 4X63A 3H1BA 5HK9A 4IHJF 3USES 4YAUA 2SKDA 1FY2A 3RADC 2QTMA 2HBYA 5KJCA 1DX4A 3BMNA 3HKEB 4UCXA 1RJDA 1ZZEA 3N75A 5AK5A 4BO8A 3OUZA 1G38A 1S7GA 2EFJA 3NQ41 1DFIA 3TRIA 2QG9A 4G5QA 3QH4A 2IQ5A 3B2QA 1TNDA 2O2EA 1QGDA 2VBIA 1FU4A 1GUDA 1AX9A 3ELUA 1P60A 2W8BB 3M1IA 4HNHA 1NURA 4HEQA 4K6FA 2FK7A 2XZOA 2LIPA 3C6KA 1BX1A 1YTLA 4Q15A 1F60A 1Z5ZA 4H7JA 2R6JA 3KTFA 1R5OA 2DX7A 5TIIA 4ZDJA 2ZZMA 5LVAA 3G23A 1U7TA 3H1PA 3P9SA 2V55B 2YFQA 3E4CA 4HLQB 3KHTA 3A6JA 3KVYA 4H1UA 5IJ0B 1R8JA 3LSTA 1L7AA 1CJBA 1C50A 3B82A 3GBPA 1J1UA 1GVNB 4P53A 3AF1A 4QHYA 3UBTA 2J0UB 3A8TA 4E5YA 4DAOA 2OCYC 3CONA 3MELA 4RE6A 5J40A 3I30X 1YIOA 3BE5A 4MJLA 4KLRA 1CYDA 4B3BA 3G02A 1PQUA 5CPFA 2WJYA 4J3FA 1T4CA 4OXKA 4DMHA 1RABA 4CR8A 3SAJA 2PEZA 2V9ZA 2ZJ6A 4CT4B 2XD4A 2XHEA 5EHXA 3E5HA 3GJ4A 1P1BA 1FLDA 1CNFA 1NUTA 4MW6A 3O8CA 1IAVA 4R8SA 4R8KA 4UQOA 4HYYA 1U0NA 3I92A 3LKBA 3UGKA 4U3JA 4W1PA 3DL4A 3T54A 1CG6A 3ERCA 1ZO8A 1MH1A 2V96A 1CUJA 1Q6YA 2QMEA 3VVMA 5G40A 4N5MA 2NZVG 2J9XB 1E5LA 2PSHA 4NZPA 5JDIC 5AM1A 4AN0A 1Y1QA 1Z7BA 2NU6A 2VJNA 1A2KC 1U0LA 2VP5A 2QRPA 3DZCA 3O75A 4MQBA 4MWCA 1E2HA 4QODA 2C5AA 2P9YA 2V5UA 3E84A 1D2HA 1JU3A 3OG9A 2P77A 2XYPA 5WRFA 2LNDA 1XDBA 2IW3A 3ULKA 1F4PA 2XQVA 4DA7A 4N3AA 5IZCC 1SCKA 1Z2NX 2VL7A 3LUHA 1I7DA 4ARCA 1R4MB 1J22A 4EP1A 1SURA 3BJZA 2JLAA 2Y71A 3KYJB 3B3QA 3V4VB 2Y4NA 2EF0A 3DMFA 1J42A 3DLPX 5A6SB 3AVXA 1P39A 1U7ZA 4KLZA 2I2BA 4LDNA 3SVZA 5JD4A 3W05A 3WLNA 1D1QA 2Q50A 1NJFA 3H1AA 5LWHA 2ZS8A 1SM4A 1ZEJA 4CYMA 3FF4A 1SKYE 2GFIA 3JTEA 3OM8A 1BQ4A 3EVEA 3PFNA 4ZRMA 4DL9A 1M76A 1RM3A 1RP7A 3OJEA 1UJ4A 4HI0E 1XVTA 3M0EA 1SC9A 4PANA 4N6NA 3DBLA 1TZKA 3AV3A 3OECA 3RYCB 3QOFA 1NR1A 5L4LA 2VO1A 5CBPB 4RVNA 1XXHA 1A95A 2EP8A 4MTCA 3U17A 3AVUA 4IX9A 1XZBA 2XT6A 3QJGA 3VPSA 5D3MA 2BMFA 1YB7A 3E6AA 1TO6A 3INNA 3EPHA 4UCFA 4O2LA 2VQSA 4X66B 4K6GA 1HFEL 3IR7A 1P4AA 4R1TA 1TQHA 2H85A 2OC4A 3AINA 4ZVKA 3WZ2A 3D7KA 3ZN2A 4PNEA 2FB9A 3JD2A 3WLMA 4A1FA 3UF0A 5L3QB 1XVLA 3FVTA 1EFRD 1P7PA 4MRPA 1AGPA 3TL3A 2AR0A 1ZOLA 3AVWA 1UBHS 3TTUA 3H1GA 1Y4DE 1IHXA 1YA8A 3W5UA 4BE7B 3WGLA 3AI7A 2CVHA 4M1MA 1T5SA 2PT5A 1BRMA 1J8YF 3ISVA 2CNWD 3EAGA 4Y9UA 5TNXA 2OE2A 2VYCA 4LWPA 4M9CA 4DLLA 4UVEA 3ADCA 4MR9A 1Z29A 1KWKA 5IJ9B 5FPYA 1DZIA 1R2QA 2XIQA 2ZQYA 2ZE7A 3OU2A 1Y3FE 2Y1LA 3BRWA 1GPAA 1V9SA 3GGJA 3GMDA 3FPBA 2R6HA 3BIOA 3LKVA 3N0RA 1XVAA 2WTEA 3HLTA 5JEDA 4GKJB 1VYHA 2Q5HA 3QEJA 1OMOA 4C3ZA 4P4LA 4D5GA 1DNPA 1B0PA 3OURA 3R20A 3SU8A 3GT0A 5KHLB 1E3SA 3BMQB 3HVUA 5FT9A 2OFFA 5ALQA 3COVA 3WTBA 4CMGA 3IUNA 3OWOA 3O9VA 4EVRA 1CE8B 8ABPA 3C3WA 4J0EA 1WMAA 4GGMX 4DJAA 3HG7A 4LRUA 4WJKB 1QTQA 4GP7A 1QIIA 4GZ5A 4PVDA 1SG0A 1E4OA 1VSBA 3DB1A 3MG9A 4OLHA 4WJZA 1KEPA 5C5IA 4QXQA 2NU9A 4JEUA 4CEHB 2XZLA 3T7AA 3LDUA 3MUEA 5JFGA 1EVQA 1X70A 1P75A 1XELA 2Q21A 2YWFA 1EE1A 3NU1A 1PJ8A 3QF4B 3G9TA 2OK8A 3G0GA 3VZBA 1Y42X 3VX3A 3KJIA 2UU9B 2RMKA 1LBQA 4AQ7A 4BU0A 3GLHB 4JJKA 3TQCA 4WH0A 2NWQA 2QTLA 1Y4UA 4ZQCB 4BFSA 3JQBA 4GI1A 3NT2A 1TIPA 5D1NA 4LCJA 2GJ4A 3MCUA 1G2OA 1NXTA 3L7KA 1I4TD 4HTFB 3ZE0B 3C1AA 3U4QA 3TD9A 1NLUA 1QOPB 4JA2A 2LCQA 2X9GA 4N3CA 4PSDA 2KS6A 1BDHA 2O07A 2BKLA 3SC3A 5FWXB 2IQIA 5TARA 4JT4A 3WQHA 4ARBA 1IY0A 4LMBA 2JGDB 4RHTA 4CGZA 4DLKA 3OZXA 1GTZA 4IEFB 4EW1A 2AN1A 1W0JD 1QMPA 4QU5A 5JH7A 2FSGA 2IDZA 4BZZA 5JZVA 4U2FA 4MWTA 2FK8A 1Y6ZA 3O1LA 4Y0NA 4UNRA 5BP7A 1TT5B 2WVJA 5KVQA 1C4KA 4JU9A 4LJRA 1CJSA 2ZI4A 2R85A 3OQVA 4GPTA 4FMCB 2QTFA 5K8JB 1YE5A 3QY0A 3KUUA 1FK8A 2QLFA 5DGTA 1G5QA 1N8SA 1KQNA 4LTDA 3H9QA 3HC7A 2D13A 1AOXA 1JDTA 1V1JA 3CPSA 4FOPA 3P20A 4PIMA 1VGRA 2FV8A 3CCFA 4GLBA 4K8OA 4W7SA 1E6EA 4FFMA 4BFVA 4CZ2A 5TQ0A 5JNTA 3NAZA 1VPWA 1K68A 4B6GA 4A16A 2IX3A 1AZSC 1KZ9A 4MWEA 4II7A 5C0OE 3ZY2A 3MGAA 4XGIA 3PTLA 1OFVA 4NZMA 1RZRA 3PUVA 5IHXA 2XECA 4Q0MA 4CU2A 2QAJA 2YXPX 3BG5A 5TJHA 2E2WA 4KO2S 4O63O 4BEJA 5DYGA 5HG0A 3P5SA 1BDMA 3MBIA 4ESVA 1II8B 2Z5VA 3L4KA 3TR0A 3LLSA 3BJRA 3K2EA 1MZPA 4AM8A 2JCXA 4OQEA 1VFNA 1X19A 4FSDA 2IYYA 2O6HA 5AJXA 2OFWA 1GRQA 3BFJA 2PGDA 2JEOA 3N2EA 1MQ8B 1NW4A 2OXRA 3DV9A 5DHUA 2R1TB 3BKWA 3M83A 4FMDF 3NOQA 3QHPA 2F67A 2F3SA 4TTQA 1E2MA 3EC2A 3CUYA 5C5EA 5HXAA 2HU2A 3BL8A 5T64A 1A5BB 3QKSA 1JIUA 1ODSA 3BHJA 3HCEA 1IQRA 3I9JA 3P2IA 4J0DA 3UA3A 1KRWA 3P32A 3FSGD 1GXSA 2PGNA 3FJOA 1Z4LA 4YROA 1ENYA 3P97A 1CBUA 5IP5A 1PRYA 4RKFA 1ZP6A 1RYNA 1RAAA 4HZUB 4MRAA 1LVGA 4TZKA 3O8OB 1BJTA 1GGMA 1QQ5A 1WZUA 1IJFA 1J9ZA 1O4WA 2BM1A 3K5PA 5EC8A 4Y6LA 5ELMA 5DMXA 1YHZA 4B81A 5BN4A 4G1FA 1E8MA 4M1TA 1T9DA 1QVWA 2G80A 1GQRA 3IE1A 1GR0A 3LS2A 2YC4C 4WESB 1G3UA 4DMMA 4CMAA 1W8IA 1Z07A 1XA0A 4GPBA 4Q03A 1F14A 1UDCA 4Y6RA 5KQSA 3ZJTA 1KF0A 2VPQA 5IK2A 2PV7A 3JWIA 1GRRA 2BZSA 3LUDA 1ORHA 2ZSDA 1UFOA 4L9AA 5IVIA 4C0AC 4F4HA 3GRRA 3E0XA 1UK7A 2JAQA 1ATZA 1OQAA 1T9KA 3IAFA 1N36B 3DO5A 1G0NA 3EVCA 1UK9A 2VPPA 5EI5A 5FIUA 1YTUA 2G6BA 1JB1A 5JNSA 3DZJA 5EFOA 4EG4A 4Q02A 3FGNA 5KC8A 3LX6A 2HA6A 2QRZA 4AZ3B 4AG5A 1M8GA 2OO3A 3AILA 3DL0A 5E2AA 2PDAA 2QROA 2W4MA 2OV4A 3ZU5A 3M3DA 5LMZA 5AW0A 4WAUA 1AY0A 2JCBA 1DWPA 1M6YA 1NUAA 1QH1A 1I7LA 1LXCA 1OLXA 1X0VA 1SWWA 2RK3A 2H06A 4LSWA 5DN6D 3M4JA 2ZJ7A 1E3LA 1N2SA 1JDSA 3KZOA 4KWIA 1Z8HA 4RV5A 1HE5A 1U04A 2JLBA 4RQUA 1ITZA 4GQIA 5BSUA 2FOLA 4IHJB 1SBNE 5D86A 4MA4A 5IUKC 5JMOA 4FYVA 3E8MA 4QLOA 4X71A 4R1MA 2ORVA 3WGKA 4BGDA 1L4YA 1NQ5A 1FP6A 5JIBA 5TPWB 2HQBA 4BGIA 1PK9A 1Q5PA 1RRGA 2DCMA 2NU7A 5LYYA 1GPUA 4B45A 4F96A 4HXFB 4AP6A 1TIBA 2NZ8A 4RMGA 3E2IA 5C8DA 2O5CA 1CERA 3IIIA 2FXIA 1ZL0A 5DHQA 2G1PA 3M9LA 3PFGA 4YIKA 1W59A 3RFTA 2BFEB 2PBLA 4V2UA 2ZITA 5KTSA 2JLUA 3ETEA 4YB8A 3C85A 5JNUA 3PF9A 4DVGA 2O7VA 2JZOA 3AJ8A 3PUWA 3ANXA 3QUCA 4BVKA 4MITA 3WNDA 3DCJA 3OIFA 2ZJYA 1A97A 1GAQA 3WQQA 1S3IA 2B1IA 1FU7A 4O4LA 5AI8A 3A6EA 3S2SA 1NBHA 1MHTA 4OHUA 2ZR8A 1MABB 2GBGA 1Q95A 1X9HA 5BWCA 3OZEA 3ZBPA 3HUTA 3OH8A 4FHDA 4MJ7A 5ES4B 1XCBA 4B3MB 5DNAA 1BXRA 3A28A 2H7YA 2Q2NA 1FXUA 3IHKA 4J1TA 4OYHA 5EG5A 3OX1A 3U4HA 4UOEA 2CW5A 3V2HA 3O1IC 4ZU6X 5JO9A 1FQOA 2OGTA 1Y7LA 4V0OA 3ZHBA 3G1WA 1MVNA 1YS4A 3OESA 3V4LA 4GVLA 5GV7A 4TS1A 5EP2A 2QYHA 3SJCA 3LY7A 1JALA 1HETA 1HE2A 2IDJA 3HPQA 3QPBA 1YVDA 3K70D 1DBIA 1ZUWA 1BXZA 5CD9A 3GVHA 3IQDB 3JX9A 3L6CA 1N1MA 1XVIA 1P1CA 3PWKA 3HJGA 1P0QA 3HM2A 1F12A 4A8PA 5FH9A 2W5UA 3SPXA 1DOHA 1ZBQA 4JUIA 1PJLA 4KH0A 4B73A 5CG1A 4UD6A 4QYWA 4RA6B 3CNLA 3EOZA 2GXAA 1Y63A 2IOQA 3HKCA 4MV6A 5I4IA 1G59A 1S2OA 2JFNA 4DCTA 1EJ0A 1H93A 2IZ0A 4CG2A 1OT3A 2ONJA 2HSDA 5DB4A 3TX6A 1E4EB 1CV2A 4EL5A 3V8MA 2I6UA 3R0ZA 2NLOA 4DMKA 3U44B 3VXKA 1HE4A 4LK3A 3L7YA 1Q0QA 1Z0UA 2C4TA 4N0EA 1EGMB 1MX1A 1Z34A 5HP4A 4MQLA 1BGXT 2VN8A 4PXYA 3LY9A 5E8RA 3LCCA 5C1PA 1UOPA 2NPOA 3FFTA 2YXLA 2A3RA 3EXIB 5D6OA 3ORFA 4L2IB 3VU0A 3DLBA 1XZLA 2VATA 3FPJA 4EPVA 1VKNA 1D09A 5IKMA 3ORRA 3PNMA 4L07A 2C2MA 3QKRB 1L5LA 1EK1A 3URKA 3V1UA 1YC2A 5ISMA 4DV1B 2HDWA 2Z8YM 1V8OA 2J3DA 3FNBA 3RQIA 3JQ7B 2TMKA 2DUMA 1LEHA 3J81k 5COAA 3PNQA 1WLSA 4E2YA 1LX6A 2XF8A 2ZCUA 1MO5A 4YO7A 4KGDA 3G6KA 4HJXA 3DHWC 3UH1A 1WAMA 1X7ZA 4DN6A 4BMVA 2I80A 4URFA 3R4VA 4HGRA 3U4MA 1BXGA 4PS0A 3UT6A 1I4LD 3CNOA 3CMCO 3OZGA 4HRYA 3DLTA 1AHHA 1S2IA 2DJ5A 4MUKA 3QMMA 3GGCA 4DLRA 3HNPA 1JIIA 3A26A 3D81A 1VZ2A 1WDMA 2PQ6A 3RC2A 2D0PB 1UWCA 1W8DA 1EFPA 2IH2A 1K7FB 4KPYA 3IP6A 1MV5A 1QIFA 3TE7A 1JYEA 3D8UA 5DNWA 5FRDA 4HVTA 1ZY2A 1NM5C 2P67A 1QAMA 2WM8A 4YXWD 3WRXC 1A88A 1JQKA 4C4ZA 2YYSA 4A92A 3FAKA 3RK0A 3EUEA 1GQOA 2DB3A 2JLWA 3DZGA 5IAKA 1ZM4A 1X39A 4MO9A 3L8FA 4DEXA 1E1RD 1M0SA 3SCZA 3U5TA 3HVRA 1VJ5A 2J6CA 2XQKA 4YAIA 3NHZA 4UD2A 1SUAA 3TJMA 1LWOA 3I72A 1JRLA 1R6BX 2VP6A 1H4VB 5BNIA 1RWVA 5B4UA 4AY5A 1TUGA 2C2ZA 4Y6OA 4E5SA 3EH2A 3B3AA 3ACCA 3QMPA 2WYIA 2XOKA 3AI3A 5H7XA 3RVRA 4NNJA 4PZ9A 3WBJA 4XX0B 1E0JA 2PLNA 1EU1A 2Z1NA 4GZMA 1U8ZA 1JJ7A 1U1DA 3CCBA 4LKOA 5TEVA 1R9MA 3GHYA 3MT7A 3T5CA 5DTJA 2XMDA 1EX1A 4V38A 5L53A 2YZ2A 4CN9A 4IDEA 3OKAA 2ECQA 4ZI5A 3OLCX 4IM7A 4RSGA 1T8YA 1WZEA 4U0KA 4TN1A 3GFSA 4Y2SA 3RG2A 2R6FA 1I7QB 2PUEA 1BWQA 3AU8A 4DCMA 4H1VA 4Z4IA 4MI1A 3KOOA 3TVYA 5HBRA 2WR8A 4IG9A 1L7MA 3PIIA 4V39A 1C8BA 1ZPDA 2Q5JA 3NBYC 2RC6A 3I39X 3QLTA 4MRNA 3SICE 1SVSA 2Q27A 3UCFA 4EYGA 1JDNA 2ZK7A 4HGOA 1WLYA 2RH8A 1K7EB 5DIZA 5CVTA 2XIJA 1MCZA 2QSUA 1O95A 4M4SA 3FUUA 4MLPA 2XDQA 1G2IA 4H0CA 2OGSA 4MUHA 4CU5A 1RRPA 3GLUA 4BRWA 1R9NA 4NTZA 1PVOA 3OX4A 4NCNA 4X93A 5G0VA 2I67A 4H17A 1LUAA 3PPVA 5DTRA 4M36A 4HEA6 4BO6A 3UO8B 4BEBA 3FR7A 5L6MB 1P1KA 2CXOA 1E8NA 1KU6A 4HB2A 4BMCA 4UNSA 3NBFA 2PQMA 4B5KA 4HFRA 3BXFA 4O25A 1C14A 3KE9A 2ZJ2A 2PMCA 4XW2A 3EGIA 5B1IA 3HA5A 3V8EA 2IS2A 1Q1QA 3ESYA 3NHAA 5IT4A 3QWFA 2GUWA 1SOVA 3CPEA 1YO6A 3O94A 1FQWA 1CQJA 1KA9H 3OPYA 2VYVA 2UZ4A 3UHAA 3IMEA 2IZOA 2XJ4A 3S1SA 3LWNA 3MTAA 2CMGA 2GPAA 5AD1A 2RHOA 4KKXB 5FWNA 1NDUA 3RREA 1SCUB 5IH7A 4GVPA 3KTOA 1U9YA 4IGIA 1JEQA 1BMTA 4ETIA 4BYGA 1YACA 1TCAA 2YJZA 1PGQA 3GFQA 1KEEA 3O4VA 2V7TA 2C31A 1QYDA 1JAHA 1FX0B 1NBIA 3BICA 3QBVA 4BTVA 4DW8A 1O3YA 2QLTA 4L0DA 4YRRA 1ACMA 2YVKA 3WK6A 2Z6AA 1COWA 1UKYA 2BBOA 2FVXA 2TYSB 2XRFA 1NNUA 4FEGA 3BFVA 1R4NA 2F48A 3D8RA 4B7CA 4JOQA 1NBAA 1VSVA 4FMDB 3RVSA 2H7VA 4A0RA 3CBGA 2BI7A 1WETA 1A3CA 3LK7A 1U2PA 4FR0A 4LMPA 4RD2A 3ZGNA 1D6MA 2CZCA 4X8MA 4PM4A 1F1BA 4G65A 4LVCA 3WO0A 4D3FA 4E03A 3A36A 1VKZA 4IJKA 2PGAA 5ALMA 3W2GA 3VU9A 1I6LA 1UM9B 2IS1A 1X8LA 3HB4X 1OREA 1U7XA 2JJ1D 3T5PA 2XRMA 4HNRA 3OWHA 4MWBA 1RPJA 4CKZA 1MEOA 4PLHA 3RVJA 2Y1FA 3QVOA 1OBCA 1QJ4A 4IDPA 1XXHB 3T06B 4AN4A 5I4BA 1AV6A 3AJ9A 1I36A 5JS2A 4P81A 3WL6A 3R5HA 3PYXA 3MCWA 4G63A 4TSKA 2C5HA 1EVKA 3FMGA 3NS7A 2ACKA 3FVWA 4NE2A 4G8BA 3SQNA 1GPWB 3U0BA 5LMCA 3V48A 2ZIVB 3KKZA 4XVQA 3REQB 3KQPA 5LP6C 4YRZA 5GP1A 1V7ZA 1XN4A 2IEGA 3UMSA 3MB8A 4L4XA 5HILA 3GN1A 2E18A 1ZM7A 4LOLA 5JU6A 3JQ6A 1D8AA 4TVBA 1GPLA 5TC4A 2PK3A 5BNFA 4WD3A 1VHDA 1XDGA 3SM9A 4HGYA 3R7BA 4RQBA 1H2BA 3GROA 4AULA 4ID9A 3PRJA 1AVTA 1VE7A 4LHSA 3DVAB 4MUNA 2BMVA 4K1LA 4AICA 3I2JA 3QNUA 5CT9A 5C3UA 4KL8S 4PEVA 3QA9A 1RLOA 2ZT7A 4OA5A 1RJ9A 5FHRA 3KQOA 4JLVA 1V3TA 2EBHX 3LIPA 4LRSB 4FZRA 4OHFA 5H59A 1H2AS 3EDCA 3Q5EA 2J5KA 3RRBA 3SQLA 4NV0A 1AO0A 4RMNA 3RB8A 2HN9A 1US8A 5FUYA 3KLMX 1N2GA 2V7VA 2GTIA 5ADUS 3C3YA 4RPGA 3CVVA 1Q3KA 4C88A 3X1KA 2WHXA 4MVWA 2XWQA 2I9KA 4L08A 3H13A 4K2AA 5C1DA 5FL7A 4GR4A 4ZYXA 1WB9A 2YYYA 2FPSA 5FWAA 2IL1A 2I3BA 3ICOA 5MF6A 4ZWNA 2ZYAA 1OI3A 3HLYA 1JQ5A 1DBQA 1UOOA 3F96A 3V8BA 5A4FS 3ENKA 4W9MC 2YHIB 5H3LA 3R1IA 4JFRA 1AKMA 2XPCA 3EUAA 4MPDA 2Q6LA 2V7GA 3T4XA 3A1FA 5CXQA 4HDAA 5CM9C 1RPTA 2OLJA 1EQUA 1NVTA 3AP2A 3FPHA 2V0CA 4FS8A 3WNCA 1FS5A 2WT4A 2VBGA 5BURA 1OBOA 3ES9A 4RS4A 1U3UA 2W58A 3ER6A 2XF2A 3MD0A 2E1RA 2ERCA 2R44A 3FUVA 1GAEO 3CXRA 3LQQA 2BEKA 3I6MA 4DQXA 2RK6A 3TO5A 4OJNA 4BLTA 1N2HA 4ENPA 2VZ8A 4FDUA 3UK1A 1OC2A 4FDAA 2AIRA 1L7PA 1JJVA 2QP9X 1QX4A 2OECA 5TDHA 3URMA 3K0FA 1SUPA 1P7WA 1VA5A 1G2QA 5LLTA 4OK6A 3BD7A 4OP3A 5CH5A 1Q3HA 3DDNA 1T5OA 1E9DA 3IVCA 3LIIA 3I62A 3P2MA 2I66A 2YL2A 1YQQA 2V74B 3NTVA 1A4XA 2JAWA 1P2BA 3PEUA 4PZUA 1PG5A 4S1OA 4EARA 4E14A 4TLDA 1XMOB 5AVXA 1GSIA 1ORDA 1QJCA 2OAEA 5EHGA 1PZEA 3Q4GA 2QI9C 2OENG 3PR2B 4OLFA 1N9KA 2AFIE 5J63A 1MO3A 1YIAA 3IOMA 3A4VA 4FFRA 4INOA 4XEUA 2NOAA 5EQDA 3TL6A 4Z7NB 2R8ZA 2RHTA 4PAGA 5B4VA 1K63A 3RHTA 1E6UA 3HN2A 1KO7A 2H29A 2HJGA 4M98A 3GRFA 5C53B 4CEIA 4WXMA 1Q84A 3A1SA 3W9SA 5IWAB 4GXTA 1GGEA 1SFRA 3WO1A 5C7OO 5LXTF 1ZRNA 5IF3A 2MYUA 5B37A 4CTOA 4ZO6A 4QUEA 5IT9A 5HKKD 1YS7A 5CLLA 4ZEWA 1YBMA 2OB2A 4LQ4A 5DVZA 3Q3HA 2PGJA 1YRHA 2X5XA 1T3HA 1VECA 3IIMA 4WBSA 2HLHA 1H05A 2WZDA 4V0RA 4TQAA 5BSRA 1G64A 2HEIA 1L1RA 3ROXA 2VPYA 5CA0F 2ZDHA 2J9ZB 3CM0A 5I8PA 3H3JA 4B40A 1GPMA 4CKBB 4LF9B 4KZKA 1NI3A 2X40A 1DXOA 1WUYA 1EE2A 1OHHD 2GD0A 2P6UA 1UJ5A 2O52A 3Q2KA 4Y98A 2ZWAA 3KG2A 3ZDFA 1Y6JA 4GKBA 3RSCA 3QKSB 2G63A 3G8YA