4DT1A

Crystal structure of the psy3-csm2 complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
193
Chain Sequence
MEYEDLELITIWPSPTKNKLCQFIKQNLSKEHVVTQLFFIDATSSFPLSQFQKLVPPTLPENVRIYENIRINTCLDLEELSAITVKLLQILSMNKINAQREPLKIILYINGLEVMFRNSQFKSSPQRSHELLRDTLLKLRVMGNDENENASIRTLLEFPKEQLLDYYLKKNRIKNGDSLAEYIWKYYADSLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Chromosome segregation in meiosis protein 2
publication title Structural analysis of Shu proteins reveals a DNA binding role essential for resisting damage
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 71
structure length 193
sequence length 213
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16834 CSM2 Shu complex component Csm2, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dt1A00
4D80A 1FP7A 3PEVA 2F9MA 1W7AA 3I32A 1R4AA 4C0QC 3UG7A 3U6KA 1SHKA 2CE7A 4FMCF 1YR7A 3TBKA 4W5HA 2G9NA 1NVXQ 4HZUA 4B33A 1XU4A 4GMXA 5SZIA 2QM8A 3GJ4A 4TTRA 4GFDA 4QHYA 5FTKA 4IHQA 3ZIAD 5D3MB 1W36D 1PVOA 2WJHA 1AM4D 4MRPA 1IY2A 1G3UA 1LTQA 3SOPA 3ICEA 1OHHA 3FFAA 4LJ6A 2PX0A 1OKKA 4UXHA 3RS0A 4C0HA 1W4RA 4QNRA 2W83A 3NEJA 3ZS9A 2QN6A 3QPWA 2V7QD 5FR1A 3REFA 3AVVA 4RZXA 1E2GA 1ONBA 3RWMB 4DDUA 1YRBA 4Q66C 4BLQA 1R8QA 1G7SA 3HYRA 3ZD7A 4W5JA 1N6HA 1Q44A 2KSQA 1R2QA 5C46F 3PR1A 3CRQA 4OQXA 1JECA 2F6RA 3OZXA 5B64A 3JZAA 3ZZ0A 4MYTA 3KKQA 5L3SA 1MR3F 1Z0AA 4M1YA 2AFIE 2JLQA 1NVVQ 3DKPA 1MV5A 4HB3A 5J4LA 1T3SA 2IYLD 2WM9B 5GADl 3MWKA 1V43A 2QGZA 1CJTC 3C5HA 5IK2A 3CRVA 1DO0A 4R98A 5C1BA 1CR1A 3PEYA 1SULA 4KBGA 3M1IA 5TDHA 2X2EA 5AUOB 4HDQB 2J7KA 3I3SR 5KSYA 3R20A 1EFRD 3C15C 3WYGA 2NO1A 4KYIB 4B43A 1NP6A 2O0KA 1L4UA 3LVRE 1YR8A 3KUCA 2H1LA 1OYYA 1ZUIA 3PENA 4B44A 2GJAA 1TADA 4D0NA 1JAIA 2FSHA 3WNBA 3ZVRA 2ZRNA 1JR3E 1NJGA 4MITA 2ZE7A 3K9HA 4NL4H 4RZ2A 5JCPA 2JJ8A 1QHYA 4PSKA 2XGJA 2ZYVX 5CK5A 1S1MA 4ACAA 1KZGB 1E1QA 4URZR 3FWYA 4P33A 2OZEA 4PSAA 5FBQB 4N3NA 2QA5A 4RD3A 4P31A 5EXXA 4XVUA 2R6FA 2PMKA 3UANA 3AM1A 2BVNA 4B2LA 4IRUB 4I1UA 4PAMA 5J5CA 3AF3A 2GVZC 5C4GB 3BC1A 3SYLA 3TUIC 1F5NA 3QF7A 4NPHA 2ZXUA 5TB5A 2X1VA 3E2IA 1RVDA 5HCIA 3QNUA 3BIFA 3NXSA 4CYMA 5DN6D 1NY5A 3ZVNA 2IS6A 1T8TA 1QBKC 1WRBA 1SHZA 4HUTA 4PANA 1RJ9B 2C98A 3MRSA 4HLDA 4PAQA 5H68A 4Q19A 1O87A 5GJBA 2ZJ5A 5TXGA 4A8JC 4XWKA 4BWYA 4M2LA 2WICA 1Z28A 721PA 4US2R 1ESMA 1AJEA 2IYXA 2D7CA 4HUQB 5AK0A 1MH1A 1ZAKA 3UATA 4A8JA 1AK2A 1E32A 1E4VA 2MMCA 2JLVA 2NO0A 4CIDA 5JSZB 3CB4A 3SYNA 2AKYA 4NHOA 2Q0HA 4CW7A 5C2JB 4BPBA 2CK3D 2OG2A 2XNDA 2ZRMA 1AS3A 5ELXA 2JIZA 1G5TA 4NCKA 4LJAA 1UBGA 1OFHA 421PA 4G5SA 3TUJC 3X1XA 2W2XA 2D62A 1NN1A 1A7JA 2PBRA 3DEFA 3E70C 5JJIA 3N70A 1O3YA 1ZC3A 1K5GA 3RS7A 4X8OA 2R6AA 4G5GA 4G0NA 5JBQA 1W5TA 5JMTA 2X77A 4HAYA 5KDOA 2ERYA 2HF9A 3OEHA 2XNSA 3SBDA 3T1VA 1D8TA 4PPQA 1GM5A 4L5BA 1E0JA 1MO3A 1LNZA 2IYTA 3TH5A 4A6PA 2FEOA 3KKPA 4P4SB 4XSHA 3CW2A 1NBMD 2QGNA 2EWVA 2V8OA 1WBBA 3REGA 2PMDA 4F4IA 1HQCA 3IO3A 2OFOA 2FMXA 3HR7A 5TY0A 4QBHA 3EAQA 1X86B 3QBVA 4QRHA 2F1IA 4TT3A 4US1R 1G9XA 1QVAA 5DISB 1NKSA 3D6TB 3GJ5A 4HLQB 4UNQA 1CJVC 3U44B 1M34E 3KFVA 3I61A 2AK2A 4G3XA 1KK3A 2ZS9A 4ZKDA 5FBVB 2OESA 3UK6A 4MGZR 1VMAA 2IT1A 3GLFB 2REXB 3MWJA 3I8SA 2D3WA 5HKKD 1F60A 3EPHA 5JECA 3CR7A 4KYUA 4M1MA 4Q1AA 1ZNYA 4KXFB 1W0JA 2ZEJA 2ZUBA 1FNNA 4DIEA 2IYSA 621PA 2J0VA 2ZYWX 4ZDIA 3KFXA 5E7IA 1G3RA 1EX6A 2QBYB 1G3MA 1JXMA 3TQFA 4M4SA 3NTUA 1Z47A 1OFUX 3KKMA 1QDEA 4M9XA 4P3YA 1F2TA 2VBCA 1UKZA 4EKDA 4XTRA 3ONWA 4HAZA 4MKFA 1Z63A 2H7VA 4HLCA 2R6DA 4GMDA 3PQCA 5DI3B 2ANCA 2RGDA 4ARZB 2O8EA 3P1JA 4EQ6A 1K5DA 4FIDA 1W47A 2ZJZA 2ZI4A 3IIJA 4EFNA 1UKYA 4CRWB 3VNUA 3KZ1E 1XMVA 1JEEA 4NCHA 3GLIB 3FMFA 4KO8A 4TMKA 4Z8XA 4OK6A 1I2MA 1KI6A 2HLDA 3ADKA 4F93B 2MSDB 2W2VA 3NBXX 4KVAA 2ZRKA 2W6IA 3T1TA 5JWRA 4LRWA 3BS4A 3BB3A 2IUSA 3KXKA 1W44A 5FTMA 3VU9B 1ZD1A 3B9PA 3CM0A 2R9VA 1Z07A 2QQ0A 1HA3A 3DMDA 3FGNA 2CE2X 4QXAA 2PX3A 4M1WA 3X1YA 3IBYA 3MWYW 1KHTA 2CNWD 5EE1A 3R9IA 1VCOA 5AUQA 1JNYA 2WSSA 1XCGB 2QPTA 4Y0AA 1XPRA 4BLRA 3VR3A 5JJLA 2WJGA 1P2SA 4GOKA 4PC6A 3CWZA 4PC7A 1G8PA 2BM0A 1NNEA 1N6RA 1OH6A 2V3CC 1J7KA 1M1YE 1MO6A 3CIOA 2O8BB 1EXMA 2GJ8A 4AI6A 3FTQA 2FPKA 4Z1MA 4HAUA 1G7CA 1W1WA 4N0DA 1D2MA 1W36B 2ZETA 1S9DA 4KITB 4O3MA 3FMPB 2KE5A 4EFLA 4GOJA 4TL8A 3SE0A 5FOUA 2Q3FA 4BFWA 1Z0DA 2VSXA 3TR5A 4PC1A 1IM2A 4WVFA 2RB4A 4WBSA 4DLSA 5BN3A 2GJKA 2QENA 1BOFA 3P4XA 4LHWA 4WA7A 1JBKA 1KDTA 1GNRA 2VQSA 1RYHA 3LXXA 4E07A 4OHYA 5CDFA 2FZ4A 4O2LA 5DI3A 1FUUA 1AA9A 4LHVA 2ZSBA 2J5XA 3K70D 2RGNC 3AVQA 1XBTA 4V0LA 3VKGA 4MKGA 1GP2A 1L7VC 5JFGA 2WV9A 2ZS7A 3Q5DA 2OFWA 3W9YA 3IEVA 3NC1C 1EGAA 2FG5A 2QP9X 1C4OA 1KO1A 2DFTA 3DL0A 4KLZA 3OAAA 2ODEA 3SBEA 3AP3A 3W5JA 3AVWA 5EE9A 1G41A 3NDPA 4JYCA 5KSPA 1L4YA 3MUFA 4B73A 2PZFA 2B8TA 2JLXA 3R9XA 1CR2A 1E98A 2NO6A 4DSTA 5DYIA 1I2DA 2YOHA 1U8YA 1LF5A 2JDID 3U5ZB 1UJ2A 3R7WA 4TL6A 4NONA 1NF3A 5IDVA 2REOA 4EDHA 3THXB 3BJIC 4CEJB 1Q21A 2BJWA 4DDTA 4HB0A 4TMVA 3B8HA 3BXZA 5SZKB 1G64A 1X8LA 3KUDA 4H9GA 1NSFA 2P6RA 3W6NA 2CMKA 5A4JA 4JJKA 4Q7JB 5J4HA 1JPJA 4LV5B 2NTYC 4DLTA 4DZZA 1RC8A 3VR4A 3HP1A 3Q9LA 3PUWA 3KJIA 2ZU0C 2A5JA 1ZD9A 4A0GA 2GBLC 1Z5ZA 1ZBDA 1VHTA 2RGBA 1OW3B 3ZIAA 4LK2A 2WIAA 2PLRA 2GBLA 3C16C 5EXPA 1OLOA 1EX7A 2NG1A 4G01B 4IDNA 4JVLA 4R2HA 2JJ2D 4Q9LA 5KPDA 3NWJA 2P5TB 2D74A 4RKEA 3EX7C 2V7QA 4JL8A 5E7JA 3AV0B 1UF9A 2IX3A 1B0UA 4NYMQ 1KK2A 2WWIA 4P0TA 4M53A 4GDFA 3SJCA 4TMTA 1P62B 3BOSA 1GKYA 2QAJA 4PQFA 3GD7A 3U7HB 4N1AA 4NYJQ 3GEHA 4HI0E 4EPWA 4P4TA 1ZW6A 1S0UA 4KI0A 4TYYA 5CM9C 5AUNB 1E2QA 5L3RA 3K0AB 1U0JA 3QEJA 2FZLA 3SC3A 4D0LB 3GCGA 2ZRAA 5E4FA 2AK3A 3AF0A 1KO5A 5L3QA 1DAEA 2GJSA 3HDTA 4BFYA 1DAMA 1DARA 2EYUA 2P6NA 2C99A 3A1UA 4I4LA 4URYR 5FOSA 4B47A 5J47A 1H8EA 2FA9A 3KL4A 2GXAA 1E4YA 2CVFA 3MJRA 3FE2A 3GLHA 2PT7A 2N42A 2H5EA 2O0HA 4GOXA 1PLLA 4LHYA 2OILA 1E3MA 1NIPA 1US8A 1ZNWA 2ZAMA 3A4NA 1FW6A 1P73A 4H1UA 1R0YA 1EFRA 2B6HA 3SFVA 3U3MA 3H0KA 2C04A 1W2GA 2YC2C 4NYIQ 1WB9A 1DAKA 2VF7A 3LQRA 1Q1ZA 1Z06A 1CLUA 2WJVA 1EFHA 2Z4RA 3O8RA 2OHFA 4OBEA 4QJ4A 1NVUQ 2J7PA 1HH4A 1FUKA 1G16A 2PEYA 5F98A 2DCUA 4AYWA 1WP9A 4LYFA 4WXRA 3THWB 3SDZA 2IYUA 3CPHA 3EASA 2OCPA 3P20A 1DVRA 2CDNA 3L0IB 3ICQB 1IJEA 4I1VA 2F3RA 2V1XA 5P21A 2Q9BA 4GP7A 4A0RA 4TYNA 5EP2A 2OCBA 2QQEA 2IYRA 3ND9A 4BFXA 4BFVA 1KI1A 1R8SA 1GL7A 4RD4A 2P67A 2WIBA 1LVGA 3K0FA 3Q72A 3B85A 3MFYA 2GXUA 2D06A 2WWWA 3EZ7A 4M1OA 1P61B 5DN6A 4BASA 1VECA 3EG5A 4M9ZA 4A1FA 3CH4B 4YLGA 4ASUD 4HZIA 1AQUA 3PJRA 2ZRIA 1XP8A 1NMYA 3DM5A 3U3OA 3BORA 1T5LA 1WA5A 1F3OA 1G3QA 4NMMA 2DFNA 2ZR7A 2C5LA 1XEXB 4DLRA 4W7SA 2O8CB 4C0KA 1FFHA 4IW3B 5TVKA 4ZI2A 3KQUA 3K1JA 3U61B 1Q57A 3SN6A 1KDRA 2F55A 2AD1A 2QSYA 4MUBA 1MKYA 3SFZA 3W90A 3ZZUA 1TAGA 3WP1B 4CT4B 3P32A 3OIWA 2NO7A 2WKQA 5KNCA 2QE7D 5F9HA 1NN5A 2ZSFA 4MKHA 2C78A 1IXZA 2D2EA 2FPLA 4ZCLA 2FGJA 5DSZA 5CB6A 5K8TA 3L82B 1N5IA 1EFUA 3F8TA 2ATXA 1E9RA 4RFSA 1Z29A 3G82C 2N46A 4Q1BA 5FUWA 1KTVA 3ADDA 1HTWA 3FPAA 3X1ZA 3H2YA 2FE4A 4TSFD 4YC7A 4V0KA 4YMSA 2JGNA 3TK1A 2GHIA 4EJSB 1S96A 2A30A 2FNAA 2FX3A 1W2HA 3WHLA 1YQTA 3LD9A 3PUXA 1HQYE 3OF5A 4R9UC 1UKVY 4A2WA 2A3RA 3L8YA 4QNMA 2CLSA 1N0UA 2I3BA 3U60B 2BBWA 2EFCB 2FSFA 1UDXA 3U7EB 4XD7D 3CRRA 2VHCA 3KXIA 4HB4A 2YHSA 4B3GA 2NZJA 1A2BA 4JVNA 2ZJOA 5DO9A 1F2UB 3ASZA 3EW9A 3PUVA 1Z6YA 5KTYA 2ZSAA 3QF4B 5HCNA 4UKDA 1DE0A 3EPLA 4AKIA 1OFTA 2XTZA 2IL1A 1YRAA 1TX4B 2E87A 4JBYA 4DBLC 3I1FA 5HZKA 3LBIA 5KOYA 3RNLA 1IN4A 1KOFA 4BEJA 1QG2A 4N0EA 1Z08A 1Q20A 5FTNA 3SEAA 3W6PA 1CJUC 2FJUA 2VLIA 4IDPA 1CXZA 2XEXA 3CF6R 2ZRPA 3Q5EA 4OQFA 5EQTA 4L8GA 2WHXA 4OHZA 4RSGA 2B7BA 1XTKA 3GJXC 3PVSA 5HKKA 1T91A 5KHOC 4J0QA 5CDFE 3RWOA 5H8WA 2J1LA 2GZDA 1S1CA 4JBWA 5CYPA 2O8CA 1RKBA 3OESA 4JLOA 3VFDA 3IDQA 3ZVLA 4LSGA 3EA0A 4OJQA 2GNOA 4Q4AB 4A92A 1JXOA 1LV7A 5DNYB 1SXJD 1KNXA 4GZLA 2GF0A 4Q02A 5AWFC 2P2LA 2PLFA 4EAQA 3EPKA 3DZDA 1VG9B 4QFMA 3A6PC 4Q00A 2ZRDA 4AC9A 1Q3TA 2NZ8A 3CH5A 3QXCA 1FMLA 4LI0A 4QKQA 5HZHA 3MWLA 2ZRFA 3ZZTA 5FOVA 1DOAA 4LJ5A 3PIRA 3QIAA 1P3JA 2RMKA 1A82A 1JJ7A 4ITRC 2RCNA 3RSLA 3T61A 1KJYA 5TMPA 1NLZA 2AWOA 1Z0JA 1NIJA 1GL9B 1KAOA 2FFHA 4Q9HA 5FR2A 3AP1A 3QXJA 821PA 4PSVA 2CJWB 3LY5A 3KB1A 4LBZA 3KQLA 4A15A 2O0JA 4V03A 1QHHA 2A78A 4BLTA 5J4VA 3L8ZA 4KFRA 1X8KA 1D9ZA 1IY1A 3GJ6A 5G53C 1YR6A 3OFND 4DC9A 1CEEA 3OEED 3A1SA 4QGHA 4KAXA 1RYFA 3K9NA 2IC5A 1CR4A 3A1WA 1UAAA 4PAOA 1YVDA 4DSNA 2YINC 1SVIA 3LAWA 2XOKA 3P26A 1DAFA 4C4PA 2R62A 4PC3A 4DWJA 2H92A 4MGYR 3BD9A 2AKAB 4YDSA 3HU2A 2YZ2A 3HJNA 4GRAA 1XB2A 4PO8A 2CHVA 1XTRA 3LFUA 5FOXA 1TNDA 1MRNA 5KDDA 3C7KA 1FMJA 1FX0B 1AN0A 2GWHA 2VHUA 2W2TA 2F1RA 5ANRB 8OHMA 1XFAA 4Q03A 5FL7D 3O47A 2HCJB 2VHJA 5FPHA 5JS8A 4Y0VA 1CJKC 1E9CA 2AFHE 2WOOA 4I1SA 3LQQA 1XXHA 4DCNA 4F4CA 3M6AA 4FN5A 1NG9A 1N2CE 3BH0A 3AUYA 5FUVA 4LC1A 1NLYA 3K53A 4QGGA 4WZ6A 3K70C 5JZVA 4Q4LA 5K8LA 2WMOB 2WJYA 3TMKA 2FV8A 2OBMA 2BIFA 3R8FA 1QG4A 2F43A 3GLHE 1G6OA 1VG0B 3PITA 3ASYA 4Q4JB 1XWIA 1LY1A 4E09A 5D3QA 4JLMA 4C30A 1XMIA 2CEAA 3AEZA 1P60A 2EFHB 2P0EA 1XJQA 2CJWA 4XH9B 1OH8A 2OV2A 2W00A 4FWTA 4GP6A 3HR8A 4JL5A 2BMDA 5F3WB 3O8DA 2AR7A 4K8OA 1FPMA 4UXJA 5GJCA 2ODNA 2EFGA 1II0A 1TEXA 3PV0A 1TF5A 3PUZA 3U3RA 1XCMA 4KFTA 3QXSA 4LPSA 4IOKA 1P2TA 2G0TA 4GPTA 4DCTA 4NH0A 1EFTA 2C9CA 1BS1A 3A1TA 1Z8FA 5D3MA 1Q3HA 3KB2A 4PPFA 4DCVA 4S35A 2ECKA 5BYKA 1S3GA 2BM1A 3RLFA 1ZCBA 1ANKA 1KI3A 1ZCAA 3BAFA 3EZ6A 4IOMA 2QTVB 3RHFA 3WMEA 2A5YB 4BGDA 1JR3D 4BUJA 3CKLA 3FDIA 4MA4A 5B58C 2E9SA 1TQ2A 3NHBA 4A2PA 3AKYA 1UBCA 4ZIRB 3AVOA 3HWSA 2IXGA 1CRPA 5AJZA 3SS8A 4MRRA 5K8UA 4ESVA 2EFDB 2WWXA 1OF1A 1ZNXA 4KU4A 1G18A 3V9PA 1J8MF 5DGXA 4C0JA 4DCSA 2JJ2A 3EIHA 2ZRCA 1E2HA 3DM9B 3I62A 2ZI5A 3THYB 3ADBA 3IBGA 4PXAA 4DLVA 5JWOA 3L0SA 2FU5C 1WBDA 2ZSDA 2EFEB 4BFUA 1M7BA 4DLWA 4S2EA 3SJBA 5K8IA 1ZYUA 1L2TA 4JLAA 1OE0A 1YR9A 2ZROA 1NN0A 1U94A 4DIDA 3EARA 3W34A 1HURA 2HF8A 2ZRHA 4TLBA 1NN3A 3MMPA 2FSIA 2R6GA 3L43A 1C9KA 3BRWD 5FFMA 4LZZA 4MDFA 2QL6A 4IJMA 3W5IA 2WWFA 3FFBA 3TUZC 2ZJYA 4XIGS 5EJEA 3U4QB 4Q7LA 3KJHA 5CM8B 2OSBA 4ESHA 2NPFA 3LX8A 2XTMA 121PA 1E9BA 5KO2A 1ZUNB 2ZANA 2XZPA 4PHGA 2GA8A 4NP6A 5LB4A 2C9OA 2V54A 2W6JD 1AS0A 2GAOA 3RVBA 2OE2A 4A0FA 1SKYE 4AIIA 4DKXA 2J0SA 2Q6TA 4JJZA 1FTSA 1ZVQA 1DO2A 2G3YA 5H1YA 4LHZA 2QSZA 2WTUA 2FGKA 1T5IA 3CX6A 1MO5A 5FBRB 4EPXA 3ZJYA 2EWWA 1OXSC 1EWQA 2JJ1A 3LDAA 1VDZA 2KBEA 2BMJA 1AZTA 3G5UA 3GPLA 4LYAA 4ABYA 1RJ9A 2OEPA 4B3BA 2EVWX 3FYHA 3UPUA 1T9HA 3NC0C 3QQ5A 3VTKA 3IHLA 2ZQ5A 3GLGB 2FSGA 1CR0A 2LCFA 2IHYA 4JLPA 5FL3A 1TQ6A 4GNKA 2R8RA 1KGDA 3VMFA 4B34A 1AKEA 4HUQA 1K6MA 3QENA 4H1VA 1G7RA 1UADA 3K09C 4ERNA 3Q7QA 3CNLA 1NJFA 1WE2A 2QG6A 3JVVA 1GITA 3L0PA 4Q1DA 4FMCB 4Z8YA 5JSZA 4YXWD 1JAHA 2WKRA 3DHWC 1N0WA 1GSIA 1ZUHA 1SVWA 3K09A 3NH6A 3P4YA 1HV8A 4KFUA 4RD2A 4DT1B 2DBYA 1CULC 4ASUA 3TSOA 4QOSA 2Z43A 3BFVA 3EZFA 1IHUA 5KPJA 1D2NA 5FI1B 3IUYA 5TV2A 1YZGA 2RGAA 1QVRA 1U9IC 4DB4A 2BCGY 2PJRA 2OM2A 1JR6A 3T5DA 1KI4A 2IS4A 2ZTSA 4F7WA 1YZLA 2Z6VA 1U9IA 1FNMA 5F2EA 1GOTA 3U4QA 3X1WA 3W8RA 3VQTA 1N3BA 3B5JA 1HUQA 1JJVA 4DDWA 1GRNA 4UNSA 3A1VA 2QE7A 2GEVA 1SXJB 2IS1A 1X3SA 3BH6A 3FMIA 4U7DA 1QHXA 2WPDA 3D3QA 4L15A 3WNDA 5DHFA 4C7OB 4P4SA 2O8DB 5BW8A 4Q1CA 1ZU5A 4UXIA 3IHWA 2GCOB 1E1RD 2RKOA 3D7MA 4F4JA 4UQOA 1NY6A 3QVUA 3TVDA 2Q3MA 1T0JB 2WJJA 4NZYA 4PPGA 1DPFA 4TSFA 1KI8A 3TW4A 3AVYA 1W4CA 1XCPA 3QKSB 1GL6A 2C8VA 3A37A 3CNOA 5EE5B 5JJKA 4KSBA 1U0LA 3WHKA 1TL7C 3U44A 1ZM4A 3IEUA 2WVJA 2CLDX 4ZV4A 3B9QA 5JI2E 3I72A 5CJPA 3GLFA 3LV8A 4PR0A 3RYTC 4XD7A 5LBIA 2BV3A 2MMGA 5BWMA 4AURA 4AYXA 4K46A 3EWAA 5CK4A 5FOTA 2ASEA 4F92B 3AP2A 3QKUA 2X8AA 4TL7A 4TN1A 4LV6A 1E2NA 2G6BA 4HSEA 3SR0A 4ZCMA 5E7MA 5UKDA 4M9SA 2XSZD 1XRJA 4DLZA 4OHVA 4PFSA 5CIQA 4CGZA 5E95A 5JI3E 4TWZA 3TVTA 2PZGA 1ZIPA 5J40A 1H8HD 1Z2CA 2ZE6A 2QT1A 3E5HA 4V0MA 2QBYA 1CJMA 1XXHE 1Y63A 4QJ3A 2JLUA 4X8HA 1KO4A 4JLBA 1NVWQ 4V0NA 4XWAA 4FINA 1KO7A 4JKYA 3QXXA 2IW3A 2O8FB 2KWIA 3BH7A 2IXFA 3RRYA 1E69A 1TUEA 3KKOA 3GP8A 5J4KA 4MYHA 3SJZA 4ARZA 4O25A 2CL7X 2XX3A 3S1AB 2JLYA 2GZHA 2MSCB 1VCMA 2DFLA 3WRXC 3VNVA 2FFQA 3B13B 3WMFA 1J90A 1VG8A 1XD2B 2AWNA 3GFOA 3GLIA 3VX3A 3PXGA 1YZUA 3GJ7A 4CF7A 3WNCA 1VPLA 2OT3B 5AJXA 4OHWA 2ZI3A 4L16A 5JHGB 2HCBA 3B7GA 5EE3A 3E1SA 2JLZA 2IBMA 5G3ZA 2BJVA 2FFBA 2ZJAA 3LO5A 1PJRA 4RFVA 4Z51A 3VU9A 3T12A 4RKFA 1ZM7A 5E3HA 1XTSA 2J0QA 4JVMA 3PEUA 1M2OB 1P2UA 1KJZA 1SZPA 5EUQB 2QT0A 1BMFA 1IN7A 4TMXA 3I5XA 4P32A 4Q9KA 4B3CA 3ZLJA 4HB2A 2ZI6A 1TF2A 1AIPA 4KVGA 1KYIA 3ETLA 1L8QA 3N2IA 2H57A 4QM6A 3BFXA 1W0KD 1IN5A 1HEIA 3BFKA 5FPTA 4E5UA 1G1MA 5BN5A 4LJ4A 2EW1A 3DKVA 2HT1A 3OEEA 2XXAB 3SJAA 3NHAA 1TF7A 1XZPA 3TQCA 1SQ5A 4GT1A 4BQSA 1R0XA 2ANBA 2QU8A 2W0SA 1II8B 4JIMA 2O8BA 1W36C 1E1QD 2BEJA 2VH5R 3EIQA 4WOPA 4D26A 2B21A 1ZM2A 2JATA 3AB3A 3KJEA 3LVQE 4IKEA 2XB4A 3V4RA 1A2KC 1ODFA 1R10A 2Z4SA 3IPXA 4XTCS 3AVUA 4OKSA 3OIUA 4MRNA 1G5RA 4AK9A 1LW7A 3SU8A 1AS2A 1VYVA 2QORA 3GFTA 5BN4A 2JLSA 1XZQA 5DI9A 2P65A 4LX0A 2QEQA 1HYQA 4D0GA 1IONA 3QPUA 4B48A 4PZYA 2ZSEA 2BMEA 2JEOA 3CONA 3LRPA 1OB2A 4TYWA 2R6CA 2ONKA 2CLCX 4BRUA 3AQ4A 2UKDA 2QRZA 4DLXA 4DSUA 2LKCA 1U90A 3VR5A 5FL7A 4OYHA 3IO5A 3AKEA 4Q4HB 1XD2A 2BC9A 2PJZA 3MG9A 3DDCA 4WW0A 2VP6A 2DWQA 4FCVA 1E79D 1ZM9A 2NGRA 3ZQ6A 4A6XA 2PT5A 4B76A 1SKQA 3HPRA 4WIAA 2V9PA 1D6JA 2BKEA 4W5WA 4B6FA 2F3TA 4MGIR 3A8TA 4OI2A 1OIWA 1ZC4A 4D4MA 2JIZD 2ORVA 2CCJA 1OJLA 1G8HA 2PZEA 3DMNA 4HEJA 4FMDF 4RCYA 4D81A 1EFCA 1QF9A 4M22A 1P5ZB 4LJ7A 3THXA 3TE6A 4CEJA 3AVPA 3WYFA 4KBFA 1YZTA 1EK0A 1CIPA 5KNDA 4IEEA 1NVVR 3UMFA 1BKDR 1KNQA 2C9YA 3LLUA 4BFTA 4M0LA 4URWR 4XJXA 4C9BA 4RZ3A 3TIFA 4FD2A 1MABB 2IF2A 2TMKA 2IS2A 4BECA 4AKGA 1GFIA 1P2VA 5J4YA 5LD2B 1DS6A 1A1VA 3QG1A 2VHTA 2AXNA 4IDHA 4LYJA 1NKTA 3SQXA 2GXQA 3SNHA 5EP1A 2VSOA 1FOEB 4LHXA 1RRCA 2P3SA 1EG7A 1G4AE 3RAPR 2HJGA 1T0HB 2ZUCA 3JVUA 1CTQA 1CKEA 2JLRA 3Q3JB 2QAGB 3T35A 3N5CA 3GEIA 2OFXA 5HTKA 1XD9A 1LS1A 2ORIA 4QC2A 1E96A 1HE1C 1E2FA 1G8YA 2ZR9A 2G88A 4OQLA 3NG1A 1W49A 4KHZA 4IDOA 4TLEA 5IHPA 3ZS8A 1Z22A 2WKPA 3K0AA 1E9SA 3BK7A 5EUMA 4D2IA 3KQNA 2IA5A 2G77B 3AVXA 3WXMA 5KU1A 5CLQA 3RC3A 4UJ3A 4XVRA 4MGKR 1WF3A 3THOA 1HT1E 2B8WA 3DO6A 2CL0X 2VL7A 4IDQA 521PA 3WYAA 4R7ZA 2YKGA 1AKYA 1BIFA 3IIKA 4EIWA 1U99A 4MQBA 5G41A 3NDBB 3OIVA 4MUAA 4BRWA 3M4YA 3QVVA 1E99A 3CUEF 1S2MA 2IYQA 2CK3A 4PO1A 4TMWA 5CITA 2WJIA 4GL2A 4G5QA 1E94E 2RGCA 3KQKA 4JT2A 4EPTA 1AZSC 1AGRA 3HYTA 1R0ZA 1RE0A 1T8UA 2EQBA 3CPEA 5FBWB 4Q1FA 1IQPA 4OK5A 3TSWA 5KYKA 1RRFA 4CEHB 1KI2A 4IXNA 4XSGA 4HAVA 1S4QA 4DLYA 2DR3A 1Z0FA 4KJZA 3SQWA 3ND8A 1N6LA 2HLDD 2QTHA 4URVR 4AKHA 3CF0A 4OI1A 1KSHA 2BHRA 1N25A 2W6ID 2RHDA 5KDLA 3THWA 3PFIA 2ZJBA 2W6JA 1X6VA 5JLJA 5FH9A 1NBMA 3R9WA 4U00A 3LBNA 3OIYA 4ZDJA 1Q0UA 1JQJC 1KJWA 4WXPA 1XPUA 4DUGD 2NMVA 2R44A 4MKIA 2QMUA 4DEXA 2BDTA 1DADA 2ORWA 1E2IA 1QHNA 2RGEA 3ZVMA 3UMSA 2WSSD 4OHXA 4B3DA 4BLPA 4IEIA 4V0ME 1OFIA 5HPYB 3AVTA 4BZQA 4ZDWA 3M0EA 2QAGA 3CBQA 1J2JA 1J8YF 4LJYA 4C3ZA 2QMOA 4LCBA 1DBSA 3B1WA 3BE4A 3NEYA 2GRJA 1G8GA 4HZUB 4A4DA 2YJTD 2B92A 2YVUA 3DOFA 1JEDA 3GJ0A 4PQYA 2ZRGA 4JYBA 4YMVA 5B30A 1XEXA 4JKIA 3FOZA 2EYQA 2FEMA 1UBEA 3QKRB 1E9DA 3WMGA 2N1BA 3H1TA 5IF9A 3JZMA 4Q7KA 1N5JA 2D4HA 4W9MC 3GLIE 4PZLA 2VO1A 1BH2A 1OIXA 4HLUC 1KDPA 1NMZA 4QBFA 2QPAA 5EP3A 1E0SA 4PHHA 1UFQA 1Q1QA 2Q3HA 4YXWA 2ODBA 2Q9CA 3ZH9B 3AKCA 4RVCA 3U7FB 1OH7A 1LFDB 2WWYA 2ZM5A 4Q01A 3IGFA 4HLUA 1NI3A 1Y3AA 2DB3A 5EP4A 1YE8A 2BBOA 2I4IA 3T06B 1R0WA 2VP4A 4TLCA 4EJSC 2OLKA 1M6NA 1ETUA 2YYZA 2IUTA 3OHMA 4M8NE 1J99A 3VKHA 2YWHA 4MH0R 4OQMA 1DELA 2IF0A 4EJSA 1MRSA 2ZPTX 3W6OA 5C4MA 4X8LA 4C0SA 3P27A 1H65A 3UXMA 4C0AC 1IJFA 2XAUA 3OAAD 1G19A 4IVRA 1KK0A 3CNNA 3RDPA 5L3SB 4ACBA 3K8YA 4KODA 1P75A 1QHIA 4I81A 3AUXA 3EPJA 2BWJA 4LOAA 1VYUA 2D2FA 4DVGA 1N6PA 2YWFA 4DLUA 5HE8A 3U2QA 1F2UA 5KNBA 4UNNA 3QF4A 3X2SA 4LWZA 4RD1A 4RCZA 3RRZA 4V02A 2BOVA 3VR6A 6Q21A 3CWQA 2CHGA 4B2PA 4I99A 2CNWA 1PUIA 3KTAB 2YOGA 3ZQJA 2F7SA 1UEIA 3QE0A 3TAUA 2VPPA 5DE3A 3FKSD 3QKTA 2QY9A 1AGPA 4U02A 4YDHB 3WBJA 4BFSA 2A5GA 1P7CA 4NTZA 4QBIA 5JEEA 1TEVA 1BYIA 1Z6XA 1E9FA 4K81B 4P4UA 4FMDB 3D31A 2XJ4A 1N6OA 1XEFA 3GQBA 2ZREA 2NO9A 3QKRA 4HAWA 2OBNA 2OCAA 2PCJA 3SHFA 3W8NA 1A4RA 2XSZA 2R65A 3RSOA 1LB1B 3F5FA 1GNQA 4Q48A 3PCRB 2RAPA 4Q4AA 5JS7A 2Q9AA 2IUUA 3LLMA 1H8HA 3PEWA 1IBRA 4B6EA 3TRFA 1VCNA 2ZYUX 1B23P 1E2KA 3I73A 2XITA 1SVOA 4LGMA 2O5VA 3BGWA 3MAAC 3U3KA 4ZCIA 2ZRLA 3AF1A 1OIVA 4ZO4A 4BZPA 2OXRA 1F6BA 5M04A 4JLDA 2R2AA 4NCJA 3T1OA 4POAA 2C95A 2BBTA 3Q8XB 1F48A 1KI7A 3T34A 4D82A 3D8BA 4CDGA 4NU0A 4TL9A 1MO4A 4GBMA 4A8JB 4D25A 3GJ3A 1R5BA 4BEBA 1I4TD 5H70A 1H8ED 1FQJA 1QHSA 5KSOA 5LPNA 4FCTA 1Q1EA 2XZOA 3AGQA 1Z2AA 3U7GA 4WZBE 4NE2A 1N6NA 2JDIA 4MYUA 5EZ5A 2IHBA 2XZLA 4BFZA 2CHQA 2HXSA 3FHTA 1E6CA 1PLJA 2FWRA 2GETA 1BYUA 3C5CA 1G7TA 2HDNB 3KTAA 2GESA 2NOAA 3OE7D 2IWHA 3LXRA 1T4GA 1VCIA 5GJVC 1W0KA 2GEUA 4TZ0A 2WWHA 3CRMA 1UM8A 1TMKA 4C2UA 3MJHA 4OI0A 2HUPA 3DZ8A 1WXQA 4BZXA 2J7PD 2F1JA 4R2IA 3W3ZB 4A0HA 3LBHA 4B71A 1CS4C 1FX0A 2QZ4A 3QOFA 4XVQA 3FB4A 3TNFA 1Z3IX 1YKSA 1COWD 4JSTA 1KY3A 4YMWA 5EXSA 1TPZA 1XDBA 4ZKEA 5JEDA 3EA5A 1UDWA 3KKNA 1FTNA 3CF2A 4KCGA 1Z6AA 1AQYA 3FHCB 4IFEA 4LV8B 2OLJA 5FUXA 5FTLA 1KDOA 4UNRA 4LBYA 3L2OB 1MOZA 3IIMA 3K0CC 4A82A 2ZE5A 2WWGA 4Q18A 2GK6A 3PUYA 2QP4A 2P5SA 4RD0A 1XMSA 1W5SA 5GVRA 5GVSA 3K0CA 1VG1A 5IT5A 2VP2A 4LDJA 3IQXA 1BO6A 1W4BA 2QUZA 4Q4JA 5FTJA 2A2ZA 1S8FA 5DHAA 1VHLA 2GK7A 1PLKA 4B75A 1P72A 1VYTA 4E22A 2GVDC 2JLWA 1D5CA 4QBGB 3QXHA 1NSTA 1RRPA 4EUNA 1KZ7B 1A5TA 1E79A 2QMHA 4ON9A 2GCPA 2BBSA 5C18A 3GJ8A 1R6BX 4NYMR 3DPUA 4A9AA 4I1OA 1UBFA 2WSMA 2Q21A 4BLSA 4QG7A 2WZQA 2WAXA 5L3VA 1G4UR 4L4UA 2GTPA 4NYJR 1F2TB 1T3HA 4PC2A 2QPOA 3EWSA 4QHSA 3EC2A 2GDJA 1Z83A 1NBME 4PPNA 3G0HA 2IYZA 2DYKA 2VA8A 4QL3A 3EZ9A 2O8EB 2H16A 4C0BA 1TQ4A 4EQ6B 1PUJA 1NLFA 4WZAE 1C1YA 1NMXA 2AN9A 3CRW1 4RY2A 3UG6A 3AF4A 1XMJA 3B1YA 3U3JA 2VF8A 3C8UA 2OUKA 2O52A 4B3FX 1T6NA 2DY1A 4LJ8A 3DOEA 4OQNA 1P9WA 4NBSA 3I8XA 1KI6B 2AL7A 3BB4A 3TAHA 4ZIRA 2CXXA 1KAGA 2X2FA 1GNPA 2QTFA 1NG1A 4B32A 2RGGA 4TLAA 1N6IA 1KMQA 1ZNZA 2FF7A 1QRAA 2VIIA 5L8VA 3QBTA 5JRZA 1IOZA 4PZZA 4NYIR 4GZMA 4KSCA 4UJ5A 4US0R 5AJVB 2DFKB 4QM7A 3THYA 4G5RA 3MLEA 3O8CA 4D4KA 4EFMA 2AX4A 4FW9A 5JWHA 3TKLA 1TU3A 4LY6A 3SZRA 4CEIB 3L0OA 1E2JA 2C77A 3KDSE 3MGCA 4PX9A 2A9KA 2EU8A 3VAAA 1KKLA 3K9GA 1VIAA 3VX4A 1E9AA 2VP9A 3KX2A 4Q9IA 4FXPA 4KLNA 2F9LA 1Z0KA 2J9RA 4LJ9A 2HXYA 2VP5A 1FZQA 1MT0A 3Q7PA 3WP0A 3IPYA 1QZXA 1S3SA 3I4LA 1Q22A 3F3YA 3NBFA 3GEEA 3K0SA 3RC8A 4DB2A 4G5OA 3VHLB 1FQKA 2I1VB 4BE7B 1P9RA 1U98A 1X1SA 2IYVA 3LA6A 4YONB 2WOJA 2ZAOA 2ERXA 3KJGA 1GWNA 1YJ5A 1ZIOA 3FMOB 2ZRBA 2GXSA 4V0OA 4NKRA 1E0AA 2A5DA 5B57C 2FOLA 3CZQA 4JMPA 5FOWA 1GIAA 2UZ3A 1OH5A 1UKEA 1ZINA 2CVHA 2H8KA 2GAAA 5BYJA 2GZAA 1W4AA 2ZVPX 3EZ2A 1E2PA 1WMSA 2RH5A 2WBLC 3LH5A 1RIFA 3LWNA 2IEZA 4Q5IA 3QUSA 2ZJ8A 5AR1A 4DXAA 1JQLB 5HR5A 3MD0A 1YHNA 2YC4C 3CPJB 1CBUA 2ZRJA 1KIMA 5TARA 4R71A 2YWGA 2JASA 4YQFA 5KUTA 4DHEA 1P6XA 4LPKA 5FUYA 1R5OA 4PQRA 1T3LA 1XJCA 2DPXA 5B2ZA 3GLGA 1M7GA 2FDCA 1IY0A 4MDEA 3R8CA 2WMNB 4Q21A 4DUGA 3R7WB 4DSOA 1XEWY 4KV9A 1ZD8A 4HDOB 2XOKD 1YZKA 3V00A 4MYCA 5FI0B 1GVNB 3IILA 4B35A 1OHHD 4RZUA 3NBYC 4D6PA 2W58A 4CEIA 3AKDA 1OKKD 1R5NA 3N2EA 1VTKA 4A2QA 1VIYA 1KK1A 1SVSA 2CBZA 3UWKA 4DT1A 3LX5A 4EPRA 1N0VC 1KKMA 2FH5B 2HEIA 2GJ9A 1P9NA 3C14C 1OB5A 3A36A 1WQ1R 3LW8A 5BXQC 4IXMA 1Z0IA 1U8ZA 2G0NA 3C41J 4JLJA 1OV4A 1DEKA 2PH1A 5CLLA 3H4MA 1OXTA 5LDDC 4NDZA 1IN8A 2ZUDA 1K8RA 1N6KA 2FN4A 5CIWA 3UMRA 1TUIA 1CRQA 4DRZA 4WAUA 1SXJC 2ZR0A 2Y8EA 4TTPA 1IN6A 3RRNA 5DH9A 4X8MA 4HAXA 1SXJA 2QM7A 4AYTA 2VHQA 4B2IA 2GILA 1JB1A 3Q85A 1RPZA 1GG2A 2ZS8A 3CX7A 2ZJ2A 3GMTA 3HPQA 4IFBA 4C7OA 1EESA 4TYPA 2O8DA 1YZQA 4FMBB 2GCOA 1U81A 3NVAA 2IXEA 5IK2D 2QI9C 4LC0A 4PTLA 1U0HC 2V55B 4IOJA 3A4LA 4ZPXA 1TTTA 3QKSA 1GKIA 3B2EA 2RGNA 5G3YA 1IXSB 5FBLB 2J59A 2JCSA 2OBLA 4Q7MB 5BQ5A 3WBKA 4IVQA 4OI4A 5L3QB 3A58B 4FWIB 4RD6A 5KSZA 3RANA 3QI2A 3ECCA 2VTKA 4II7A 3OFNA 3BBPA 2OAP1 1R7RA 2G83A 1X1RA 4C0LA 4EPYA 3PG5A 1G291 1ZJ6A 3GLHB 2J46A 1RZ3A 2VRWA 4ZDKA 2VSFA 4HDCA 4MRSA 2ODWA 1US8B 2ATVA 3B60A 4O2RA 1G20E 4EPVA 1RW4A 3F0TA 3RS2A 1NRJB 5JCZA 3NBZC 2FPMA 4TQ9A 2JAQA 4JBXA 1XEWX 2NIPA 4QHTA 2J87A 2JA1A 3FKSA 4AKEA 1GTVA 3EC1A 4TMZA 3TGPA 1ZMXA 1J70A 2XTNA 1ZU4A 1GILA 4JLNA 3X1DA 4LBVA 2O8FA 2A5FA 1UEJA 1G8FA 1ZRHA 2GKSA 1OXVA 2AXPA 4M9QA 1XJ0A 2C03A 3QEOA 4AG6A 1KSGA 5CJ2A 1HY3A 1EWRA 2ONJA 2W0MA 2DWOA 2DWPA 1JI0A 3S1AA 3T5GA 2C2HA 2REBA 2ZVQX 1GAJA 1GDDA 3RRMA 1CP2A 1JALA 5LB2A 3RS3A 4BLOA 4TQAA 1XNJA 4JT4A 1PZNA 2L0XA 1D9XA 4FCWA 1ELOA 2ZITA 1TU4A 3K0FB 3K9LA 1X8JA 1Z6GA 3CX8A 5AJWA 5DLQC 4B3XA 3TR0A 2QP3A 4JLVA 2PL3A 2XB2A 5AJYA 1E2MA 2QMEA 3U6BA 2XNDD 4PHFA 4L9WA 4U5XA 2QRNA 1XX6A 3C4JA 2PCLA 1GRRA 2AD5A 2QROA 2IYYA 1W48A 2Z0MA 2Z83A 2UVQA 4CT5A 3RS4A 5CYOA 2CCGA 1OYWA 2A7QA 1LS6A 3FKQA 4IVPA 2GEDA 3HU1A 1XTJA 1OXXK 2J3EA 4QGFA 4FI3C 3O8BA 2AHOA 2YNMA 3OEHD 1GRQA 2XXAA 4AWXA 3AGPA 5SZHB 3VR1A 1G5PA 2BCJQ 3VHXA 5FPKA 1II8A 2P6UA 1DAHA 2J0UB 1FL9A 4E03A 1OPXA 4Q9JA 1YU9A 4PHTA 2KI5A 4RFSB 3VKWA 2D7DA 3QSYA 3MSXA 2HT6A 3B1VA 5G40A 4JVSB 2J41A 2V4ZA 1E0KA 3CO5A 3OE7A 4JL6A 1XTQA 2OXCA 5A5GA 2BMFA 4TT3D 4F91B 4XOIA 1S9HA 1RRGA 4M1SA 4JSYA 4NCNA 1JR3A 2JJ1D 1U2RA 2J45A 3GFPA 2X19A 5DIFA 2OO7A 3TLXA 2G1KA 2HYDA 2ZI7A 1U8AA 3LNCA 1COWA 4ILEA 2LWIA 2C96A 1DAIA 2ZIAA 1W0JD 3WY9A 3SYKA 4Q47A 2KBFA 4Q4HA 1SVKA 2QNRA 1SKYB 4DDVA 4L9SA 4UNPA 1KSFX 2H18A 2ZYTX 2ZE8A 4TLDA 1I4LD 2CCKA 3BWDD 4GI7A 3KXLA 1HT2E 2G1JA 1G17A 2VP0A 4OK3A 4MRVA 1Z6TA 1WCV1 5F9FA 1IXRC 5AUPB 4CZ2A 2KB0A 2WAYA 2VEDA 4F38A 1KY2A 5JRJA 3J81k 4YMTA 4LUCA 3UWOA 3IKJA 3QPVA 1Q1BA 2OAQ1 2IEYA 1E9EA 3ZGXA 1KMHB 1OT3A 3EIEA 5JHHB 4GSYA 3DVLA 1D2EA 4TQUS 4NCIA 4HATA 1G21E 3ADCA 1G3IA 2HV8A 2V6JA 4IOLA 2YOFA 1ZP6A 1FP6A 3FVQA 2IWRA 2I1QA 2B7CA 4HYYA 3B78A 1PV4A 4Z54A 1P4SA 2RHMA 3TW8B 3CLVA 1IAQA 1SVMA 2E1RA 2WPDD 4Q1EA 5HE9A 2J0UA 2HJVA 1CU1A 2IK8A 1W46A 3VR2A 1ZM3A 3GLFE 2CL6X 2KJQA 1MABA 1E2LA 4JLKA 1V5WA 5LD2C 1ESNA 3I92A 4KFSA 2PEZA 3V4FA 5IRCD 3GLGE 2IYWA 1KI9A 1M8PA 2DHRA 3AH8A 3QG5A 3K0EA 1DAGA 4URXR 3B1XA 2QAGC 4AY2A 4XWOA 1TQDA 1QHHB 3TJZA 4A36A 3CZPA 1OXUA 4LYHA 1N5KA 3QJYA 1JPNA 3A4MA 3NIBA 2SHKA 4OJKA 5A0FA 1M7HA 2NPIA 3SI7A 3WRYC 4PO9A 1E2EA 1LF0A 4QGAA 3ZDQA 2V1UA 3ZD6A 1XTIA 1XD8A 5DYGA 5SZJA 4ZI3A 3CR8A 3SHWA 1VKJA 221PA 3B6EA 1HE8B 5FPYA 4Z1MD 1KO8A 4TYQA 2RGXA 5EE0A 4D4JA 4OL0A 3BB1A 4M21A 1I4DD 1II9A 2ZU6A 4JS0A 2K5UA 4M1KA 5EZ6B 1GUAA 1SXJE 3T15A 1N5LA 4QJ5A 1WDTA 4TTQA 2BKUA 1XF9A 4URUR 5GJWC 4YMUA 1RFLA 2NQ2C 1YZNA 1QHGA 4G1UC 1DTSA 1SVLA 1M74A 4JZKA 5FPSA 3T1QA 2YWEA 3H86A 4RJLA 3ZYCA 3NH9A 2UZIR 3KQHA 1UPTA 4D4LA 4C2TA 4M1TA 4O0MA 2BEKA 3RS5A 1KMHA 1XPOA 2XJ9A 4DJTA 1G6HA 4AD8A 2GF9A 3QY0A 3FHOA 4TZ6A 1E2DA 4CEHA 1GKUB 4AG5A 2YV5A 2Z5FA 4B74A 1XXHB 3I5YA 1DG1G 4LBWA 5EXTA 3H84A 4DEYA 3HU3A 2GCNA 2ZI9A 3LW7A 2V6IA 3B1ZA 3TSZA 1GZSA 1E1RA 2OCYC 1NL3A 2LKDA 1CF4A 2VYFA 2F43B 2H17A 3BERA 4DCUA 3K70B 3IQWA 1KSJA 3W3AA 5CB8A 1Q12A 2FFAA 2HYIC 3B82A 3EXAA 4CVNA 1OSNA 2MSEB 3RABA 1BMFD 3UIEA 3UKDA 1DG3A 3NKVA 2F1HA 3MCAA 3AF2A 1SGWA
chains in the Genus database with same CATH superfamily
3EXG1 5ALWA 4R31A 3N74A 5JAZA 4WK4B 1TYAE 3GUYA 3SQDA 4BLVA 3UG7A 1YVUA 4PLWA 3A3OA 1NE7A 1QVWA 2O3RA 4FMCF 4A3SA 1WV0A 2B37A 2HRRA 1C0EA 2P2SA 2ZIUB 4HZUA 4B33A 1XU4A 4GMXA 2XE4A 3JYHA 4NJMA 1T5SA 4CIVA 5ADWA 5JC8A 4FYHA 5DYTA 1F4LA 4KHPB 2ZBQA 3C97A 3BJZA 3I23A 1L5YA 2I7CA 1Z2PX 5IT0A 3G8CA 3NOXA 5LDGA 4ZVUA 3VC7A 2AZMA 3IUBA 1RWXA 1K7FB 1W36D 2YIJA 1QQ5A 4GKKB 2ZIWB 4HF7A 5THXA 4R51A 4XFJA 3TLBA 2OMEA 1LTQA 3SOPA 4MQFA 3KZMA 1GCIA 3FFAA 2IX9A 2BR5A 1P7WA 3WLEA 3FG9A 5TX7A 1R88A 1W4RA 4M7WA 1JZSA 4G8DA 2QN6A 2IZ6A 1JMVA 2P1ZA 4U7FA 4V0SA 2GNPA 5GOTA 4AMVA 5FR1A 3ZS9A 4BNVA 1U7DA 1V96A 1KYYA 3GRVA 4RZXA 1DKOA 1ONBA 4BN0A 4QYIB 1YRBA 4IF6A 2OHIA 1XF1A 3UCEA 5A4AA 4HGOA 1G7SA 5IJ0A 2E4YA 4FLEA 4KPUB 1MT3A 1UPXA 5REQA 1GSAA 3FWHA 4OMDA 4BJHB 5DW0A 1EP2B 1R2QA 4DIKA 4CKZA 5CX1B 1L1RA 4OQXA 3UJ9A 1P4RA 1JEYB 5BSWA 4MV8A 4ETIA 2CW5A 1RHKA 4LE1A 2JFPA 3KKQA 3GAMA 4U0KA 2M6KA 5K0CA 2Y99A 4PN7A 1MR3F 3SZMA 1STOA 2HQOA 2BHNA 3T3IA 1V4BA 1DKNA 1W73A 5IM5A 3DKPA 5J4LA 1T3SA 1J2TA 3EMVA 1YJBA 3ETDA 4XGRA 5EZYA 5MGNA 3LQ4A 1A9QA 5WRFA 3MF4A 1V43A 1EAMA 4GRDA 4ZREA 1IZ9A 1X7XA 5L4SA 3EQ2A 4G1MB 4R98A 3PU6A 1PDOA 3PC6A 2ONCA 4P3KA 4KBGA 3M1IA 1AK9A 1KGSA 1CZHA 2RC6A 4S24A 1Z88A 4YIKA 4IIJF 2VTEA 3B6JA 1F06A 3JWEA 3JY6A 2NO1A 4B43A 2MSWA 2QRUA 5EZQA 1PDVA 1YR8A 5BY2A 2VNIA 2QMQA 3S6JA 1PUXA 3NU1A 1UWLA 4BOYA 1TADA 1CUEA 3HBNA 4D0NA 5B7PA 1JAIA 2JCXA 5HVNA 1G38A 1PFKA 3RVPA 4MITA 4RZ2A 5CTAA 2PZAA 4MVXA 1ECPA 4TXHA 3A2LA 3DMTC 4PSKA 1BMQA 5CK5A 1EH5A 2NU9A 1T4CA 5KX5A 4YRRA 4ACAA 4J1TC 1Z36A 1A0OA 5CPFA 2VYNA 4ZU1X 3DMTA 3QE2A 2OZEA 4PSAA 1M6VB 4N3NA 2W42A 5EC8A 4BGVA 4LS3A 2G06A 1D7OA 1BQ4A 1MBZA 1PTJC 2DLNA 2GGSA 3I9V6 3LHKA 4M60A 3AM1A 1FU7A 3OCJA 4HOYA 1E58A 4Y1RA 5HQTA 3ZDCA 3TZCA 1M66A 5AHKA 2GVZC 5C4GB 1FBTA 1PTJA 2PD6A 1F5NA 3AI3A 3OCCA 3OLWA 3SYLA 1RHJA 2BM8A 3T7KA 4LRQA 2QK4A 4E3WA 3SYRA 4QDJA 2FAXA 2X1VA 2ZXUA 2A1IA 4ZOCA 1UFRA 1GZVA 3D2CA 4ALJA 4CYMA 4IX9A 3EPPA 3KVVA 4DYHA 3M4ZA 2CYCA 2GK3A 4DV5B 1UK7A 4HUTA 1SM4A 4JQSA 4PANA 1T0BA 4CMAA 1U1DA 1GAXA 4HFRA 3S4YA 2QRHA 2CDRA 3V46A 5GJBA 4BKPA 4R40A 3OM0A 4QE3A 4WJLA 2BEUA 5BSMA 2HSWA 2C94A 3F2IA 1QO0A 3N39C 4M2LA 2GRAA 3F6CA 2NU7A 4C01A 721PA 2H1WA 2AG1A 2XUGA 3Q2IA 2UZ1A 3NT4A 4IH4A 2IYXA 2D7CA 2EIHA 2RI6A 3BXXA 5AK0A 5KYUB 2OGUA 5J1TB 4O8ZA 1IIRA 2CMGA 1J9ZA 3KKKA 4D3SA 4B4KA 4CIDA 4BGUA 1XVLA 4EUKA 4C14A 1QIFA 2GARA 4F97A 1BHSA 2WLTA 1FDIA 2Q0HA 1M6HA 5U1PA 3VI4B 2CK3D 2W6PA 5C2JB 2QVYX 3WB1A 2ZRMA 4E46A 2JIZA 1N4DA 2ZJ6A 3OPMA 1G5TA 4K6HA 4NCKA 4CCYB 3JRXA 1DIRA 2YWCA 4UAUA 1MD9A 4GPBA 4EH1A 1Y8RB 5FWDA 3RVMA 4ZT7A 4RETA 4GYKA 2HMAA 3A6LA 4G5SA 3QU9A 2WW8A 3LT5A 3HUUA 4GVPA 3N70A 1O3YA 2C2BA 4ZQEA 2R6AA 1VBNA 4G0NA 5AI4A 4PIMA 4HAYA 1GGKA 4EA9A 3SBDA 3T1VA 3BSYA 4L5BA 3GG9A 5AVTA 4JVOA 4C3OB 4D8XA 2VKTA 4OIFA 4EJMA 1LNZA 2IYTA 3AM3A 3QM1A 4E4TA 5TS2A 4IWYA 1GVHA 3FPSA 3T94A 3TNDA 2QTRA 4XSHA 4FM9A 1CUHA 2F4NA 3CT6A 3EXIA 2VHXA 2CLMB 3FTCA 1Z9BA 2HKIA 1ZAYA 2QGNA 1TCCA 2EWVA 1UC4B 1PQWA 2DBQA 3O7WA 1FC0A 1TB4A 4I7EA 5TMEA 1KIAA 1RTKA 2ZIEA 1Y4DE 3CSDA 3AONB 3NETA 4GS5A 3BILA 4S1WA 1H2WA 1DFIA 5TY0A 4CKEA 2YV4A 2G8NA 1WQ4A 3EAQA 4ALMA 2F1IA 2NZXA 1G9XA 1QVAA 2O8BA 5J2UB 4L2IB 4LISA 3U44B 1CJVC 3TTVA 5I01A 4Z53A 1M34E 1EM8A 1KMNA 2V3VA 3KFVA 3KQYA 5DT9A 3G0BA 4YT4A 4EB6A 1KK3A 4MA0A 2Y1OA 3ENZA 1GN9A 5FBVB 1AXEA 4U9UA 3MWJA 4CL0A 3A1NA 3I8SA 1OYOA 4MTCA 1NBWB 3PLRA 2BP7B 3M1YA 1AV7A 3CR7A 3HN6A 1ZNYA 1W0JA 3LHIA 1HDCA 3NEAA 4OSPA 5CR9A 3WA6A 5E9QA 4HWKA 1CD5A 3CWCA 3KTFA 5AKJA 1QU2A 1DRUA 4WEQA 4EYEA 2QTZA 3Q3IA 4NMHA 5KKNB 2YJZA 4Q1VA 4UHJA 5C1OA 4OX9Y 2IP4A 3FB1A 4UHKA 3T9AA 1IQUA 1QPBA 2VH1A 2HJ9A 3QLEA 3TQFA 1FS5A 1WCIB 1P80A 4P3YA 3DH0A 4MRAA 4P6VF 5TQVA 1GNSA 3ZWCA 1KFJB 1H2AS 1QGUB 2RHTA 3AHIA 3SS9X 4EKDA 3NVMB 4EX7A 3ONWA 1RI5A 5EHXA 4HAZA 1S89A 5HQ3B 4H0CA 2A92A 5IF3A 5GGYA 2HC9A 3PQCA 4ZOLB 2O8EA 1TIKA 4RA6A 2PZBA 3EDQA 5TSDA 3P1JA 4ARZB 4EQ6A 1X92A 4DWOA 3O8OB 3DNFA 3O3OB 3A6HA 1XAIA 4KUHA 4MXDA 4ZV7A 5G02A 2G80A 3TB4A 3BWBA 3IQEA 1AGNA 3NVDA 4P7KA 4N5LA 2FCAA 4NCHA 1XMVA 1JEEA 2XNJA 4AX4A 3VNUA 1P8JA 3FMFA 2FCRA 4KO8A 4E94A 1ODIA 3OOSA 2O14A 4P3XA 4ZPJA 1Z68A 4O2BB 3VISA 4AZ3A 4BRZA 5JNUA 1E1CB 4MIYA 2HLDA 3ADKA 4P1ZA 1ZBQA 2MSDB 2PSFA 2W2VA 3NBXX 1TUBA 4IJ5A 3N2KB 4Z4QA 2VWGA 4KVZA 3PHGA 4RVUA 2A0FA 1B2RA 1Y1PA 4ECAA 1J1UA 1O8CA 1HO3A 3BB3A 4HGNA 4OXRA 3DWGA 3KAQA 4MW7A 1U1GA 2BH9A 3HCPA 4OA8A 4RZQA 4MV1A 1QU3A 4QXAA 2X7HA 5H80A 1IVSA 4TS4A 3QEAZ 2VP3A 2VJBA 4NMXB 3VJMA 1YI8A 3ODGA 1UXKA 4PGFA 3DE7X 3E0QA 5EVJA 3DP7A 3SDBA 4O1HA 2FZ5A 1TPYA 1P2SA 3FGZA 3I5MA 2PZ8A 5EG5A 3NKFA 3OZRA 5JFTA 2HRDA 1WPGA 4M46A 1ESZA 2PV0A 1MJHA 2HN9A 2YFHA 1YS4A 1OH6A 5ALRA 1M1YE 2GZMA 3IVXA 4IIJB 3CIOA 3T3GA 3ELUA 3ZY6A 4AI6A 1ULBA 3FTQA 2FPKA 5D7BA 5A9TA 4N0DA 4IRMA 4UNIA 3OZDA 1XG5A 1EGMB 1JG6A 2XA1A 3FCSB 1U1CA 4KITB 5LFAA 4Y1FA 1BHO1 3CJQA 5AW0A 5JQGB 4O3MA 2HU7A 1O0CA 4U2KA 3CUKA 4TL8A 3UWMA 5CLFA 3DLCA 3WE7A 5EIOA 3TR5A 5LWQA 3TG8A 4XCXA 1A9XB 1XRSB 1XKTA 2ZWIA 4QNNA 2RB4A 4DA0A 1AHPA 2PXHA 1BOFA 3ER8A 3LUCA 5BSRA 4N65A 4MQEB 1KDTA 1RWMA 3QELB 1VE9A 2EHDA 2HHLA 3BE6A 1XJ5A 2DTEA 2RJNA 1XTTA 4OPMA 4RMJA 5CDFA 3FBTA 5DI3A 1AA9A 3FYTA 3PDCA 4FR5A 1JNXX 3RVNA 1WULS 3I0NA 4DF3A 4V0LA 1EWKA 1W96A 2OZPA 4BE9A 5L4NA 4UOQA 1L7VC 2FN7A 1BU8A 3ONDA 3IAXA 4E32A 4D3XA 4UTRA 4M3NA 3NC1C 2FG5A 2IIPA 5K0NA 3VTAA 3VU8A 3T6KA 1C4OA 3FZGA 4OUDB 2XE8A 2CNKA 3W5JA 4GGOA 4JV5B 1A8QA 3WGHA 5C5CA 3NKLA 2B0JA 4ZZ2A 3DGEC 4JYCA 1RMQA 3GGJA 5KSPA 1GQRA 4BX2A 4V1CA 1IZ7A 3DGFC 3EGCA 3TYXA 1HOXA 1V8ZA 4DSTA 3NOQA 2O2ZA 3ILVA 2HPVA 1I2DA 2PXXA 1LF5A 1OCEA 4D8TA 1UJ2A 1RFGE 3R7WA 2J30A 3QMWA 1DJOA 2G40A 3L46A 2BTQB 2WA1A 5ILOA 3ZXSA 4KN8A 3THXB 2KPOA 4RWEA 2Q1TA 4HB0A 1DTEA 3B8HA 3GV0A 3H99A 2C3UA 3BXZA 4ZK2A 2YQZA 3SJUA 4AJKA 5DN9A 1G64A 3KUDA 4S05A 4JP3A 2WTAA 1OWOA 2Q28A 4KWHA 4KBYA 3GRRA 3K20A 5E1MA 5AW8A 4F11A 1C2TA 1RC8A 3HP1A 3BK2A 3PPVA 4JP8A 4G0ZA 1EYZA 1H6DA 1BFDA 2V7EA 1C8VB 3KJIA 3PD0A 1I4OA 3SOZA 1ZD9A 2HA4A 2QX7A 2HU8A 1QZ3A 1Z4PX 2JHAA 4YAEA 5J23A 3BXHA 3DFIA 4NABA 1OW3B 3GDHA 1JQDA 3D3JA 2JG3A 3DE6X 1R64A 2WIAA 2JI6A 3K92A 1CDZA 1PR4A 1A8PA 2AEEA 1BHJA 1U5AA 3D2BA 1PR0A 4G01B 3WSVA 4PCLA 3ZX4A 3EVGA 1GZ7A 2K4MA 3TTSA 2WQ7A 2P5TB 2D74A 2QZSA 3FWPA 3Q15C 2EGGA 2WUFA 3SIPA 1SBTA 5CA1F 5LUAA 3R3VA 1PJSA 2NZUG 2GT1A 4G0PA 2IX3A 3GP5A 2R6R1 4XCQA 1KK2A 2WWIA 4BDTA 4M53A 4CLXA 3OQNA 1P33A 2QM0A 3BOSA 3UJAA 2QIPA 3V1LA 4DYDA 5KQPA 5DCYA 4PQFA 4QATA 3ABZA 3U7HB 2YWRA 4B3HA 2AEMA 5JBNA 2O5CA 2QV0A 4HHEA 4YP6A 1BMTA 1RBMA 5IAAA 1FRNA 4GQAA 1WZIA 1U0JA 4B84A 4YRZA 2ZUEA 1AC5A 3GCGA 2ZRAA 1JTFA 3WQBA 1KO5A 3D8RA 4GU5A 4XE5A 1DARA 2I8AA 4BXOB 3O1HB 3A1UA 1Z15A 2OQRA 4I4LA 4HLNA 4ZAFA 1N2CA 4Q39A 3STHA 1P39A 4IXWA 1H8EA 2FA9A 5J47A 3KL4A 3LQYA 4GG1A 1B6RA 1U7WA 3OQHA 5T41A 3IBSA 1E4YA 4Y2QA 1OI2A 3VZPA 2HDOA 2M1XA 3L7JA 3MJRA 4HTAA 4OFZA 3MJCA 1PLLA 2AJ8A 4FTWA 1NIPA 1T1JA 4BFZA 4DV1B 2CXTA 5JOQA 1FW6A 3E03A 4WUVA 4H1UA 3CO0S 1D4OA 1RVV1 1VL6A 3HVIA 4ALNA 2B6HA 1OAOC 3E27A 3PF9A 4CMHA 5BPFA 3H0KA 1AMUA 1QYXA 2YC2C 2JIMA 4PTZA 6LDHA 4REQB 1PK7A 3ZLBA 1IIBA 3LE8A 1DAKA 1I14A 3JWIA 1OAOA 4B9EA 2HO5A 3LQRA 3OA2A 3T9FA 1CLUA 1DKUA 5A9SB 4INZA 5IYZB 3CINA 4QJ4A 5ECDA 1HH4A 2BMAA 2J7PA 3UXYA 1C4WA 2PEYA 4UVDA 1CUZA 4P93A 3ZI7A 1XTUA 3QXGA 3HL4A 3DBIA 3V1YA 1QLHA 3SDZA 4OB8A 4EG6A 3EA4A 1SQ0A 4DMFA 3L0IB 9GPBA 1JI3A 5EEHA 4RTPA 4HBZA 1IJEA 2YZNA 2F3RA 3ICQB 1Y8QA 2V1XA 3QPDA 5P21A 1B41A 2AYZA 1Z4IA 4JOBA 4JI2B 2OCBA 1C9MA 1QWOA 3N8DA 2WF7A 1TYDE 2WMYA 4IV0A 4WZAB 4I4CA 3UT0A 1ZI6A 2P67A 3K0FA 3VJLA 1M33A 1XPJA 1Y9DA 1DTWB 1HDGO 5IN4A 2B9VA 1TAQA 1VE3A 4WBNA 2VC2B 3T4UA 2D06A 1ZX1A 1O94D 3H8VA 1VECA 3EG5A 1NQAO 3CH4B 3D59A 4YLGA 5M2QA 4WH0A 5HFJA 4Z2YA 2FX5A 3GFRA 4LXGA 1V5FA 2CSUA 1N9KA 3HJTA 1J2EA 3K94A 3L7DA 3U3OA 1DMRA 3VKVA 3V7UA 4MO2A 1G3QA 2ZR7A 3KOYA 2C5LA 4DLRA 5ALZA 3HB1A 4FIZA 1SBCA 3TZEA 4ZI2A 2JGDA 1E5QA 1ZOLA 1N2GA 3I2JA 1BDIA 1U0NA 3R6WA 4B7CA 1FP4B 4XR4A 5D7NA 1KDRA 1SURA 3G8YA 3L7CA 4YUZA 2QSYA 1E3WA 2CLOB 4AM8A 2EJUA 3WP1B 3TLGB 3H0CA 5F35A 4I08A 2G71A 5F9HA 1KQPA 1T15A 2OZLA 4KDRA 2PRYA 1V3TA 5E6SB 5H59A 3TZ6A 1LPBB 3ZY3A 4MS4B 2CUZA 1WXWA 5IC5A 4OXXA 3F8TA 4EP1A 4EW2A 4QEZA 2ZIZA 3B3FA 1E9RA 5BW6B 5C5IA 1VP9A 1WG8A 1XZCA 1L8LA 2N46A 2NUAA 4Q1BA 2X0DA 2NW6A 3PL5A 3TQIA 1GCAA 5ELMA 3P9KA 5EERA 4A26A 4YMHA 2FE4A 1Y7PA 1CJCA 2G9VA 2ET6A 3OIDA 1XZDA 1YGPA 1EHIA 4YMSA 3TK1A 4DRXA 4FZ3A 5G4LA 4EJSB 2BFCB 3MXOA 4FNMA 3VDNB 2VBFA 1M83A 5B3LA 2UZ4A 1D8AA 3WHLA 3CZ5A 3GROA 3LD9A 1EE1A 4RAOA 4O4LF 4Z3DA 3JALA 2A3RA 3SXJA 1CX9B 2MYPA 2VPZA 4YJFA 2G70A 2VPTA 2W4IA 2VA9A 4J91A 2X0EA 2EFCB 4N6GA 4XD7D 1UZAA 3KXIA 3IOCA 5EWJB 2GYWA 2NZJA 4MLPA 3UV6A 4IQ4A 3ASZA 3EW9A 5KTYA 1HDIA 1P2FA 4D9FA 4UKDA 1DE0A 1KC1A 4NLLA 4CHTA 3G5MA 4CLRB 1K89A 1OFTA 2IL1A 1OWMA 4KQKA 4NV1A 3AUJB 2OHVA 4HDKA 3I1FA 4DNXA 3KYBA 1EFKA 3EMBA 4U63A 1IN4A 3Q6MA 2AFVA 4N0EA 4BEJA 3JW8A 4G1FA 1Y5IA 3VXKA 1Z08A 3F4LA 4F5DA 1C1HA 3C48A 2GO7A 3QUAA 1XZLA 3BEOA 3OHSX 2FI1A 1A27A 4L02A 3E6AA 3JR7A 3CF6R 2ZRPA 1W5BA 1K92A 4OHZA 4L8GA 5KC8A 2B7BA 3KPYA 3PVSA 2YX1A 1TCBA 4TKLA 4IAOA 4WDRA 1T91A 2I22A 3IESA 3RTAA 4J0QA 2JZOA 3S2SA 1Z4MA 4RKQA 3U7IA 3ID6C 4LI3X 2X76A 1ZGBA 3PTAA 3ADOA 4I50A 4JLOA 2JARA 3VFDA 3P0EA 2OB2A 3EW7A 3REOA 2I1WA 1L1FA 1LV8A 4OXQA 1QTQA 5PNTA 4A92A 4WLEA 1E3IA 3RT1A 1KNXA 2C2WA 1F8FA 2P2LA 3SKVA 3EPKA 1FQOA 1U3CA 2GASA 3HKDB 3PWTA 4G89A 4GX0A 4O5AA 5F78A 5FLEX 3WMRA 2NU6A 5HZHA 4QTTB 3ORQA 1ENPA 2G8LA 5TF4A 3ZZTA 5FOVA 4ZYXA 5JVDF 1R3UA 3PIRA 3QIAA 4GAEA 4QDXA 1L5FA 1UJNA 3R77A 4H7IA 2RCNA 2PD3A 3TSAA 3LZCA 4OAPA 3INNA 4HZGA 1NLZA 4LMRA 1C1XA 2BUBA 1WTAA 2IXAA 4LWPA 1H22A 4Q9HA 5I4BA 5FR2A 2JKYA 2HMVA 2WR8A 3QXJA 821PA 3S5JA 3LY5A 1Z6QA 5CA1B 4W6QA 3VPBA 3KQLA 5L9AA 4MEJA 2O0JA 4A15A 5BUZA 2XR1A 1T6YA 3L8ZA 2EP5A 3HB9A 4KFRA 1H3NA 3DBLB 4XGQA 1HDRA 2XHZA 4FDVA 4LXHA 2HFJA 4NULA 5G53C 4DE5A 4ARUA 3OEED 1BX0A 3R6TA 1XNRB 2PYDA 3JQFC 1ZVJA 3X1KA 4BO7A 2OY0A 1PG0A 5JNRA 3V1NA 1Z2NX 3WDLA 2IC5A 1UAAA 3A1WA 4O3FA 4F6LA 4PAOA 4PSCA 4DJFC 3ONVA 4DSNA 1SVIA 3KEMA 1KH2A 3EWNA 3LAWA 1AMNA 4JR1A 1QIHA 1Y6RA 4FHDA 4RE6A 4L9RA 1T9GS 2GTIA 2PFSA 4QO7A 4C4PA 1WUYA 1QF6A 3TEJA 4BQIA 3ZHTA 5IM4F 1U1IA 2AKAB 3QRWA 4NZPA 4YEDA 4D3ZA 2IPMA 3HU2A 4UARA 2PRSA 2YZ2A 4EYSA 1G8AA 1XB2A 2X0JA 2Q3LA 1VI6A 3DAYA 4PO8A 3CEPB 5FOXA 2ZAYA 3SBOA 1ZWLA 1GJRA 3OJEA 2DPHA 1HC7A 2O6HA 4QPZA 5K8CA 1PT9A 2A9PA 3L4JA 3C7KA 2B2XA 4HNSA 2DULA 4HNRA 1AN0A 4YRFA 5KQSA 2BLNA 1MJGM 1PWEA 4J0JA 5ANRB 1MQSA 3FZQA 3CHYA 1ECLA 2R8PA 2QTAA 3ENVA 2IPAB 1L4HA 3VC3A 2DOKA 2DUUA 1RPNA 2VHJA 3C74A 5FPHA 5JS8A 4Y0VA 3FOFC 4GXTA 2Q5OA 5AW3A 5KQRA 1I80A 2WOOA 4I1SA 1X2EA 1JLLA 1XXHA 2JAXA 4DCNA 3A4YA 4Y1GA 1NG9A 4RIIA 3OUTA 3AUYA 4LC1A 2HLPA 2R0QC 2R2GA 3AY3A 4YPVA 1JTEA 2Y27A 1Q0HA 3TMKA 4F9GA 1N8SA 1QG4A 3GLHE 2HBRA 3P9QA 4QT0A 3OPYA 1IM5A 5EVCA 4Q4JB 1XWIA 1FXWF 1LY1A 3OQJA 2ZOSA 3HM9A 3CNEA 1XZGA 3DWFA 2CEAA 2EFHB 3IUNA 1GADO 1XJQA 4JYMA 4Z7JA 1PZHA 1M1UA 1FLDA 2VJPA 5AVRA 2A0XA 1UC5B 4GP6A 1J20A 4ZAZA 1NOJA 5CDSA 1EHYA 2H4ZA 3DFKA 3M6XA 5GJCA 2H5IA 3CR3C 3FWZA 1IBKB 1WMDA 1NHWA 1A3CA 1RAAA 2QHXA 3G85A 3F7TA 2JFHA 3PUZA 2CLLB 5K3CA 3FWKA 3ENWA 3U3RA 1XCMA 3ORFA 4WADA 1GPBA 1DCKA 2Z1MA 3DHEA 4RC9A 5LQNA 4GPTA 2GD2A 4DCTA 4HGYA 2ZKIA 2JZCA 4TZTA 4MJXA 1JLMA 2E18A 4BGEA 1CHDA 4PU0A 1QV7A 1GLNA 3THRA 4UEOA 4X61A 3D6FA 4UDYX 5C1PA 4S35A 3HWX1 1YQ9A 4LMPA 4KQFA 4NI5A 4ZGBA 1NNUA 2D2VA 1S3GA 1T9BA 2BM1A 2HIHA 3IQDB 3MCZA 4N7RA 5D1HA 2QRVB 4N8SA 3H4VA 3OPNA 1KI3A 1Z4JA 1ZCAA 2XBUA 3EZ6A 4LZLA 3GJTA 3WMEA 4RJJA 1Z0ZA 2A5YB 2LPMA 1RQPA 3WQHA 2FWIA 4NOLA 1JIJA 2P4SA 1YR3A 4MVJH 3P7MA 3BWYA 4BNJA 1CNFA 4FZRA 4QYIA 1YB5A 3EDCA 4EFDA 3ZU5A 4A2PA 3ED5A 3AVOA 4XUDA 1CRPA 1T8WA 4MWBA 1L9XA 1N92A 5CX1A 1XWFA 1JEYA 3B53X 2FWAA 3E05A 1G18A 4ZVKA 5SYNA 4BB5A 2RONA 4AY6A 1BKSB 2ZRCA 1JX6A 3DM9B 1TFUA 3CNHA 3G6KA 2P5YA 4PXAA 2ZAGA 4QQNA 3UUFA 2OQ2A 1K08A 3TG2A 1HFWA 4HWTA 2ZSDA 1PO7A 3NIDB 3LKBA 2Z57A 3VKFA 3LVFO 4WKBA 2PL5A 4LMBA 5EJ6A 1Y33E 1U7XA 1OE0A 5IKMA 1T0PA 2CDBA 4GC9A 3BG5A 3LF1A 2VNAA 3HDGA 1YGYA 3T9BA 2HF8A 1O2DA 2B25A 3UJBA 2EDCA 4F3YA 1IK4A 4NX2A 3T5BA 1R4MB 3QLUC 2W98A 2YR0A 3ROEA 1QXSA 3K0KA 2HLHA 8ABPA 1VGVA 1YULA 4MDFA 4HPJB 3QLUA 4IJMA 4NR0A 1SCAA 3N8HA 2PUVA 4GSLA 3CZMA 1NHGA 2ZJYA 4G0MA 4N5HX 4WKNA 2F17A 2TECE 1PWHA 4DAOA 5IC4A 8ATCA 3DXZA 4UUNA 5CP8A 1H0RA 4BIIA 5EIEA 4ESHA 3PD1A 4RMNA 3WJ2A 2YCLA 1PZXA 4RABA 2Z9DA 121PA 4H7PA 1C14A 1YJXA 4HRVA 2OFFA 5IUJC 5CPBA 1R9MA 3CBGA 3NYIA 4G8JA 4MMXB 2HZBA 1ABEA 4NP6A 3E7DA 1JR4A 3GLUA 4D79A 5LB4A 2V54A 3L8FA 1M6VA 4K8RB 2W8BB 4BQPA 1LBSA 2DQSA 2BUAA 1EG2A 3V97A 2OE2A 2A0KA 2VXOA 2Y3IA 2UUOA 1DX9A 3M9LA 4CTOA 4TQGA 4UAGA 3L0YA 2ACEA 2XIQA 3NXKA 2Z2YA 2G08A 2EV9A 4ZI7F 1IBCA 1DO2A 1EZ1A 1K8XB 1N7JA 1RBQA 1WAMA 6ADHA 1LJ8A 1GTRA 3NATA 2W6ZA 4LHZA 5F2OA 2WTUA 3CX6A 2I0FA 1LK0A 3BD6A 2ZYGA 3H97A 4PN3A 4A1OA 4C4OA 3EDRA 1SUAA 3HJHA 1LRKA 1ZMBA 2JJ1A 4LOIA 3LDAA 1C7RA 1XVVA 3USES 5MN5A 1RPTA 3FNFA 1DX6A 1U0FA 1R0SA 3G5UA 3S2YA 3GPLA 1A5AB 5TLSA 3QBDA 3STXA 3KAJA 1ORHA 3DYIA 5D2CA 3HXKA 4BNHA 4UTVA 4F4HA 3UPUA 4CG0A 1I4EB 1N1GA 3NC0C 2AF3C 5T3UA 3U19A 2ACWA 2XNCA 1OILA 3GMSA 2FSGA 1CUBA 1RI2A 3TF5A 1GPNA 1CR0A 3M81A 1BX3A 4JLPA 5HIJA 4TVSA 1VPDA 4GNKA 1NWCA 2R8RA 2H7CA 1XUOA 1FTGA 2H07A 5IBPA 3VMFA 4DR2B 1VMDA 3QENA 1O94C 3R3UA 4H1VA 1I2AA 5CVUA 3Q7QA 1NXVA 4Z8YA 4G1VA 3L0PA 4Q1DA 3WIVA 4FX5A 5E4JA 4RU1A 4YXWD 1O94A 1PV2A 3DHWC 1N0WA 5B58C 1ZUHA 3F74A 5CFRA 3NH6A 2BI7A 4YB8A 2V6FA 1RCUA 3IVMA 3NCTA 4BCDA 5IUNC 1CULC 1RAHA 2B2CA 3KM0A 4PCAA 3JYLA 3Q98A 2FSSA 2PBLA 3MUEA 4M1ZA 4QOSA 3EZFA 4V3CA 3QU4A 1L5ZA 1JIKA 5EJ4A 1D2NA 4CCYA 1UOOA 1M1NB 2I5PO 1Y8RA 2BCGY 1RXWA 3T5DA 3WAKA 2HA2A 2ZTSA 1QCZA 1QAMA 1UBJS 4X90A 3MBKA 1X38A 4PZPA 4U6SA 3A3KA 3U7JA 1H9CA 1GOTA 4ID9A 3X1WA 5K4HA 3M6FA 4KXNA 2VWHA 3COYA 3HFJA 3L05A 1TAUA 2XAAA 2NM0A 1C3EA 1SXJB 4DY4A 3V2HA 3BH6A 3COVA 1BRMA 1R27A 4N03A 2PVCA 3FMIA 4V3BA 3TNYA 3ND7A 5BXYA 1QHXA 1XNHA 3GWGA 2ZCJA 2EHJA 4UXIA 3UJ3X 3TCKA 1CUGA 4C5CA 5SICE 1Z5VA 4PLPA 4R69A 3D7MA 2H4YA 5JMWA 3E23A 5DNDA 2I2AA 1T0JB 2EX1A 1H2ZA 4NZYA 4PPGA 5G1NA 2HW8A 2ZYAA 3ORSA 3RS9A 1W4CA 3GP3A 2NO5A 1O95C 3QKSB 2C8VA 3EQ6A 4I8XA 5EE5B 3VPGA 3ZHUA 4L2IA 5FD8A 3B1FA 3U44A 1TL7C 3OQIB 1KARA 1ZM4A 5JAHA 1ACMA 5LIRA 1O95A 1RWNA 3AIOA 2EZTA 3IXQA 4E2FA 1U8XX 3I72A 3C5WP 3WLNA 1VLHA 2NYRA 4DIOA 4E15A 5D00A 4XD7A 3MMNA 2RAFA 2BN4A 3EVBA 1BMDA 3MBIA 3E7XA 4G37A 2PDAA 1QOPB 2BP7A 4ARBA 2VPQA 2WIFA 3EWAA 4K46A 5CK4A 5DULA 5LQRA 3I2IA 4F92B 3AP2A 3QKUA 5DWDA 4LV6A 3IRVA 2G6BA 4X6LA 2O2GA 2X42A 3GVPA 4KIWA 4ZCMA 5UKDA 2YXDA 3ZZNA 4EHKA 3BRQA 4FKMA 5TNXA 4DLZA 4OHVA 4CGZA 2EJWA 4X24A 3RPEA 1T9KA 1NYRA 3IVCA 1SPXA 2RBGA 3ABOB 3M6IA 4UUBA 2C3MA 3VH2A 4BN5A 2Q9UA 5DXJA 5BN4B 3ZTTA 1BXZA 1WCIA 4X8HA 4DW8A 1QQBA 1NVWQ 4K40A 4WV3A 3G8AA 1QGUA 1I5OA 1KO7A 2H2GA 2PX4A 2IW3A 4FINA 4H3SA 3RRYA 3CURA 1GDHA 4O5OA 5HQ3A 1E69A 4P2GA 4YP9A 3JD3A 1TKCA 5BUQA 2ZXEA 5J4KA 1W76A 4ZOLA 5A4KA 3T5TA 4MYHA 3SJZA 4ARZA 4BNNA 4DA6A 4O25A 2PSSA 3JAMA 3OKFA 3RHSA 3O8OA 2JLYA 3MFQA 1WHTB 4HWGA 1XHEA 3K2EA 3WSTA 2WVAA 1MN6A 1VCMA 5BNFA 4EZEA 1YA4A 1VG8A 1XD2B 4AROA 4WLFA 1W59A 2RGRA 2X8LA 2HBYA 3D0QA 3TL3A 1IHXA 1N3IA 2OT3B 4O2BA 4OHWA 1E1CA 2ZI3A 2O0MA 3LG2A 3M9XA 2PVSA 2HCBA 4MIEA 4E12A 3N2KA 4H60A 1YDWA 3PQEA 4E0BA 2FFBA 3ODPA 5KSWB 1IG0A 1Y8CA 2H0RA 2A1TS 3K5IA 4RFVA 5IKXA 3VV3A 4B31A 2J0QA 5A3SA 2HSJA 3OX1A 3TPFA 2WSYB 3C3AA 5AOCA 3UHFA 3CKKA 1QDUA 3WVNA 2VRBA 4WN3A 4YQZA 1SZPA 1Q7TA 1BMFA 1IN7A 2LDXA 4LXQA 1L4MA 3L4SO 4RZIA 3TVYA 5HKOA 2NX2A 2ROQA 2JHGA 3HWWA 4CUZA 1AIPA 1FK8A 1DBRA 1KYIA 1A96A 3ETLA 3IPCA 3MW8A 3N2IA 2VR1A 4RSHA 1DZIA 1AQNA 1E4OA 3ZHXA 1G1MA 1LPNA 5TMDA 3JQAB 2XVYA 4TWBA 2FUNB 2EW1A 2XXAB 2P75A 3OEEA 2HT1A 1H42A 3EGDB 1XZPA 1CV2A 1W1IA 5L7WA 3GYBA 1DBIA 3CSUA 3BD8A 1R0XA 1UMCB 2QU8A 2W0SA 4RY9A 4QGSA 4IIJA 4HFJA 2HOQA 4K5QA 2JH3A 4NENB 4WOPA 5H3LA 4C1NA 1XE3A 3QU5A 5BO5A 5A3RA 1JW9B 1AVTA 2B21A 1ZM2A 1VHWA 2JATA 4WRRA 1A2KC 1R10A 4FDTA 2Z4SA 4XTCS 5JQGA 4AK9A 4KC0A 1LW7A 5LU9A 1WB5A 3SU8A 2OV4A 4L9AA 3PYXA 1H4TA 1P2GA 2M9MA 3P8ZA 5DI9A 1A9XA 1YC5A 3K6RA 5LQMA 2VUHB 3EOZA 5JIBA 3K2BA 5EHNA 3QPUA 1ADYA 4D0GA 4MQEA 4TKZA 3QELA 2ZSEA 3EJWA 4M9CA 3RIYA 2JEOA 4M9UA 4TYWA 1EPUA 5CMLA 2R6CA 3PQDA 3Q0TA 4ADSG 1XLTA 1YQEA 5FLYA 5FO0A 4E5DA 1VIDA 4DLXA 4KQEA 3T52A 2ADMA 4FR0A 1K97A 5JYDA 3ANXA 3GCDA 4G86A 4ZI7B 1I7PA 5IJWA 1CEYA 3QLTA 2YRWA 2A5LA 3ESDA 4OUDA 4PR3A 5SV2A 4PYQA 3AK4A 5DXFA 4FCVA 1KFEB 4NCXA 3P9PA 1JZQA 5KYVA 4B76A 2PT5A 4CFZA 1SKQA 3RH0A 3AR2A 1O08A 1ZJ4A 3CLRD 4RLFA 4TS1A 2E3JA 4WIAA 3UAYA 4D9MA 4MINA 1VZ3A 1LK7A 3QOXA 2RHLA 2GOYA 3K96A 3FIUA 1NTOA 3ANMA 1S4MA 3T7AA 1WD7A 2CCJA 1G8HA 3P9XA 3Q10A 1M2OA 3VNSA 4D81A 3C4QA 1EFCA 1QF9A 1JHPA 2E85A 5AKZA 2ZUTA 3X44A 1E5XA 1SG6A 1YNSA 3H5LA 4ZVVA 1Y5LA 1CZKA 2VATA 3AI7A 4IIBA 4B6QA 4N6NA 3WYFA 5K99A 1NAIA 1UP4A 2Q8PA 1HK7A 3GAZA 1FE8A 1NXXA 4G41A 4LOHA 2KW5A 4R2LA 5COAA 3FNEA 4D7AA 5HEKA 2G6TA 1UJ5A 4IEEA 4UEQA 3VMMA 4AJ4A 4IBOA 3MCWA 5K2OA 1Q1AA 4RQBA 3QE3A 1CUFA 2Z1NA 2GLXA 3EBOA 4URWR 1L5QA 5JC1A 1X1BA 3D4NA 5KCZA 5EKSA 4BVBA 3VU3A 2IYPA 3OM8A 2XKBA 4RYDA 1MABB 4IDFA 2PS1A 4RCVA 4WY2A 4ZTUB 5AVJA 3IRUA 3NHLA 3GZ4A 3T5MA 4ZYTA 4RTMA 1MW8X 5J4YA 5K0EA 4EK9A 1IY8A 1FNBA 3ZCUA 1IDN1 1A1VA 4YROA 3NHRA 1JU3A 2WAMA 3LRTA 3SQXA 1NKTA 1KZ6A 1PZFA 2GXQA 5AW5A 5AVWA 1Z62A 4LHXA 2C59A 3COSA 4P4NA 1DOZA 1E66A 1JQKA 2P3SA 4NFYA 3E22A 3ZY4A 5H16A 3G2NA 1NLMA 4P86A 5HZMA 2ZUCA 2HB6A 4HCJA 1CTQA 2E0IA 4HN9A 3ZJUA 3FLAA 1KTIA 3N5CA 3CVVA 3OMXA 1XD9A 3B12A 4MARA 1VGQA 1E96A 3KZNA 2ZR9A 3SM3A 1G8YA 1NAHA 4TLEA 3W7AA 1DC3A 1W49A 2AUNA 4KHZA