3A37A

Structural insight into the membrane insertion of tail-anchored proteins by get3
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
346
structure length
313
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAAADLTGSIPGIDEALSFMEVMKHIKRQEQDEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the membrane insertion of tail-anchored proteins by Get3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATPase GET3
total genus 96
structure length 313
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a37A00
2PJZA 3C4JA 2IUUA 3FMFA 5JHGB 2OCBA 1ZM3A 4PPNA 2ZJAA 2A9KA 2FGJA 2H16A 4OL0A 1SVMA 1GRNA 5E7MA 2BCJQ 1KTVA 2QAGA 3CKLA 4KV9A 3LH5A 3VFDA 3RRZA 5ANRB 4DLTA 3VAAA 1E94E 1S2MA 2G1KA 3KXLA 4M4SA 1SHKA 4NH0A 3PFIA 3D3QA 1P2TA 2QQ0A 3BB4A 3I73A 1IHUA 4BLSA 4D6PA 4DB4A 5FTMA 2VP2A 3ZQ6A 1WXQA 3CUEF 2FH5B 4WZAE 1S9HA 3HYTA 3QF7A 5DN6A 1XB2A 4OHZA 1E2GA 1E3MA 1GFIA 3I5XA 3OFNA 3K0FA 3QY0A 2AFHE 4ASUD 5J4HA 3GJ3A 3I4LA 2A5YB 2J5XA 2QG6A 1Z22A 2ZRLA 2FZ4A 4D26A 2X2FA 1Q21A 2GEVA 3RS3A 4UNSA 2ZRDA 1KAOA 4Q00A 4TLEA 4MDFA 4OHXA 5TVKA 3C16C 3ZVMA 1E69A 2W83A 1KZGB 4QGGA 2Q3HA 1OKKA 2Z5FA 4L15A 1N0UA 5JWOA 1OXUA 2O0KA 4GP6A 2NPIA 1E4YA 2W58A 2FOLA 5TV2A 4IDNA 5F9HA 1II8B 4C0BA 3UMFA 2AKAB 2JJ1D 5DYIA 1NRJB 3ZZUA 2C9OA 4HZUA 2Q3FA 1BMFD 4PAOA 5FI1B 1WMSA 5C4MA 3MJRA 1HE8B 2AFIE 2ZSDA 3W3AA 3U5ZB 1G7CA 4Q9KA 2GXAA 4TMVA 4RVCA 1X8KA 3U2QA 3DVLA 1QG4A 2D7CA 1XU4A 2ZJOA 2ZJ2A 1DADA 1PJRA 1N0WA 2RCNA 2ZROA 2DWOA 1TQ4A 2BMJA 2VSOA 3B60A 121PA 1JPNA 4MYTA 3OFND 1A4RA 1OH6A 1CJUC 3BOSA 3Q5EA 4PAMA 5A0FA 4O2LA 2QT1A 1TPZA 3FHOA 3FTQA 3K0FB 1KO8A 5EE5B 3P4YA 3IIKA 4FMBB 3NG1A 4LV8B 4Q4HA 5KSYA 3UG7A 1G6HA 1CULC 4HZIA 4BFYA 3ASYA 4MGKR 4N1AA 1UAAA 1J99A 4D0NA 3EIQA 2JLWA 2WAYA 3K70B 2WJJA 3EZ6A 1R0ZA 1P9NA 3PEUA 4ZDJA 1TNDA 4RCYA 4GOKA 3MG9A 5FTKA 2YOGA 4BFSA 4DEXA 3BORA 1R5NA 1NVVR 4IVQA 2FSHA 4RFVA 5JZVA 3IUYA 1XJCA 3QG1A 4M1KA 4O3MA 4DT1B 3DHWC 2GJ9A 4BEBA 1I2MA 2YC4C 4BGDA 2G0NA 4HAXA 2ZAMA 4OHWA 3SDZA 3UMRA 4CEIB 3JVUA 2D7DA 5J5CA 4UXHA 1KO4A 3VHXA 2PJRA 3SZRA 1NVVQ 3OEEA 4A4DA 3FE2A 2W0MA 2IWHA 3CRVA 4A0FA 3MLEA 1FW6A 1G3UA 4NYMR 1FTNA 2IYRA 4PC2A 4TT3A 1RJ9A 1Z0DA 4B47A 2J41A 2WPDA 3CRRA 4L16A 4AKIA 4LBZA 4QNRA 1JAIA 3CNNA 3GQBA 4P4SA 1R0XA 2OT3B 5BN4A 3CX7A 4KFRA 2GZAA 1XCPA 2VP9A 3WMEA 1GUAA 1NG9A 3AH8A 3QKTA 1NNEA 1HQYE 2IXFA 3BXZA 3TE6A 2HF9A 4OQNA 3KB1A 2KBFA 1M7GA 4MUBA 5JI2E 1KKMA 3N2EA 1CU1A 4P31A 4WOPA 4IJMA 2WPDD 3TAHA 4E09A 4F92B 1YR7A 2EYQA 3GCGA 2AR7A 2F9LA 2WWXA 3IQXA 4RD4A 5JEDA 4L9SA 1F6BA 2ZE5A 4TMKA 3B1ZA 1OW3B 3EG5A 5EP1A 4PQYA 3K8YA 5CIWA 5DHAA 5TARA 2RGAA 1GL7A 1ZRHA 4DWJA 4EJSA 1G3MA 1VIAA 4IOKA 4MRPA 1FP6A 2OE2A 4KU4A 2WIAA 3K53A 4TTRA 3A1WA 1HH4A 3BERA 1E9EA 421PA 2QUZA 4TMXA 3MAAC 1IM2A 1EGAA 3BAFA 1KZ7B 1QHHB 1P4SA 4P33A 2XTZA 3KKPA 3R9WA 3K9GA 4EFLA 1NBMD 3LW8A 1CXZA 2IL1A 1AQUA 1XTSA 3EARA 4B75A 2RMKA 5CJPA 1KNXA 1XBTA 5FPKA 4JLDA 1JQLB 3SYKA 4TYPA 3UKDA 4NCKA 3HPQA 3TW4A 1RYFA 1IN6A 3CLVA 5TMPA 2YC2C 4ILEA 1MO5A 1XD2A 4H1VA 3ZLJA 2F6RA 3H86A 5GVRA 3IBGA 1CS4C 1G7TA 2FE4A 2QAGC 3PEWA 3EZ7A 1HEIA 4YMTA 5TY0A 4DLRA 1FTSA 4BEJA 2ZI5A 4U02A 5G41A 2ZRJA 2I3BA 4RD2A 2QM7A 1VTKA 3A1VA 4O25A 1MO4A 2GZHA 2VHJA 4FI3C 3THXA 2W6JD 3TNFA 1YRAA 1W44A 3MUFA 3BS4A 1DTSA 4MH0R 4TYQA 2QL6A 3GJ5A 4QBFA 2UKDA 2BJWA 1U0JA 3AKEA 3GLGA 1JALA 1QZXA 4BLOA 5JSZB 1AS0A 1DG3A 4EPWA 1Z2AA 1M1YE 1W0JD 2JAQA 3AVWA 3SJCA 3MCAA 2QMUA 2CLDX 1XXHA 3T1QA 1E79A 1E79D 3PEYA 5SZJA 4CDGA 4LC0A 1GNQA 1UBEA 4Q4LA 3BH7A 3L0SA 2OCAA 5BWMA 1ZMXA 1IONA 1FMJA 5FBWB 1QHSA 4A2WA 1X3SA 1VPLA 4Q01A 4BRWA 3IO5A 2BEKA 2ONJA 1NN3A 2YOHA 4JMPA 1ZVQA 4ERNA 1HA3A 1JB1A 1ZC4A 2ODEA 4HLUA 2B7BA 4PC1A 3VU9A 3LRPA 1RJ9B 3TW8B 4JJKA 2NO9A 4IDHA 3GLGB 4V02A 2XB2A 2BCGY 3OAAD 4L5BA 3SEAA 3AF2A 2QMHA 1GZSA 1WDTA 4LYFA 1YE8A 1OXSC 2PX3A 1XP8A 1NMZA 3G0HA 5BQ5A 1E4VA 1SXJC 1EFHA 5JCPA 2JIZA 5JHHB 1X86B 1D8TA 1G3IA 3VR1A 4PR0A 1VHLA 4ABYA 1W36B 2JDID 2H92A 1KDPA 1H65A 1X1SA 3AF0A 4LBWA 5A4JA 1IY0A 3AVPA 3CRQA 1SVSA 4G5GA 4PX9A 3IEVA 2CHQA 5GJCA 3UXMA 5JSZA 1GKYA 4Q7JB 1GAJA 2GJ8A 3QE0A 4R98A 2H8KA 3B7GA 4G01B 2QENA 4V0OA 4NP6A 1C9KA 1Z6GA 2FX3A 4LHXA 3TAUA 1KMHB 1G1MA 2QZ4A 4NYIQ 1E9AA 1L8QA 1UKZA 1GL9B 1KMQA 1BYUA 2FEOA 5CM8B 2KI5A 3B13B 4ZCIA 1Z0AA 2OUKA 1ZW6A 4GOXA 4TN1A 5L3VA 3NBZC 4H1UA 3HYRA 5DO9A 4Q1EA 4D4LA 1U9IA 1VG8A 2H57A 3MWKA 4NYJR 3L0PA 3LLUA 3CM0A 3QF4A 3TUZC 2IEYA 4B2PA 2UZ3A 3ZZ0A 1F3OA 2WJGA 2VTKA 1NSTA 3L8ZA 1E2EA 1C4OA 5JWHA 3AQ4A 4L9WA 5HZHA 2PT5A 4JVLA 3KJHA 2MSDB 4KAXA 1SVLA 1NP6A 4B3GA 3SHWA 1KI6B 4CT5A 3AKCA 2OLJA 3VX3A 2ZYVX 4OQFA 3QXCA 1WA5A 4FWTA 3PUXA 4KFUA 2ZI7A 3DZDA 2ONKA 4MGIR 4QHYA 4DSOA 1XJ0A 2CCKA 1HY3A 5KNDA 4QM6A 2CVHA 4G5QA 3C5HA 5JECA 4KYUA 3OEED 4B43A 5J4VA 2ZUBA 3QBTA 1PLJA 4B3CA 4PFSA 2F3TA 2ZS9A 4KJZA 4WXRA 3NBXX 3BH0A 3PITA 3ZIAD 1RRCA 2FZLA 3AB3A 5FBQB 4NTZA 2BMEA 2GILA 4QNMA 4FMDF 4HYYA 2JASA 4C0HA 1WBBA 3Q5DA 1RVDA 1A2KC 2REOA 1Q0UA 3FHCB 4DDUA 4UNNA 1IXSB 5KDLA 3SC3A 3AGQA 4NU0A 3VR2A 4XVQA 3UANA 1N6OA 1ZIOA 4GFDA 4U00A 3W34A 3FKSD 1GITA 4BZPA 3W6OA 5G3YA 5AUNB 3HP1A 2WWHA 2CK3A 2AX4A 2IYWA 1H8HA 1M8PA 1YQTA 1S96A 2P6UA 3DOFA 4S35A 4IVPA 1TUIA 2O5VA 1BYIA 1LNZA 2LCFA 4TSFD 5K8TA 2WWIA 3LXRA 3EC2A 4KVAA 1F2UB 1F48A 1UBCA 5EZ6B 4ARZB 1E1RA 1G5TA 1UEIA 1KY3A 1Z6AA 1JEEA 2C95A 2D2FA 5JI3E 3THYA 4PO8A 4JVMA 4DCSA 1E0KA 1XEXA 2CL7X 3UWOA 2DWPA 4ZI3A 1II8A 2QPOA 4XOIA 3RC3A 2BBWA 2CEAA 1W0KA 2DR3A 3FVQA 3AF1A 4HI0E 4RZ3A 1T91A 2ZANA 3PIRA 4K81B 4JL6A 4RSGA 3KFVA 2G0TA 4NL4H 2DFNA 4GMXA 3VNVA 1AZTA 4YONB 4D4MA 1GILA 1VDZA 3RANA 1S1MA 3Q7QA 4HATA 4TL8A 4ZCMA 5AJVB 1RYHA 1T4GA 3LBIA 1MRSA 1ESMA 1ZAKA 5FTNA 2EFHB 3LA6A 1IY1A 4BASA 2QY9A 3MMPA 1MABB 1P62B 1VYVA 2W2TA 3KXKA 1PV4A 1YKSA 1R8SA 4V0MA 1NJFA 1IAQA 4HLCA 2PH1A 2E87A 5P21A 3ZH9B 3KQNA 1ZINA 3WHLA 2BKEA 1ZM4A 2R2AA 1DPFA 3BB3A 4AD8A 5KNCA 2V4ZA 2QE7A 5A5GA 1KIMA 2NZ8A 2WZQA 2QA5A 3KUCA 2GJKA 1SKQA 3B5JA 4LC1A 5H1YA 2MSEB 4OQLA 4TQ9A 4JBWA 4UXIA 3LNCA 1CKEA 2G9NA 4A0HA 1BMFA 1KMHA 5BN3A 3AVXA 1G7RA 1KK0A 3GLHB 4UNPA 3FMIA 4CT4B 3MWJA 2WVJA 4NYIR 5FPSA 2B6HA 4CEIA 1GL6A 3CZQA 1UBFA 3QVUA 2X19A 4A9AA 4UJ5A 5JFGA 1G8HA 1E9CA 2IHBA 1RC8A 2GF9A 3DMNA 2H7VA 1NIPA 4RY2A 1WCV1 2SHKA 4WAUA 2ZU6A 4RD3A 2GCOB 4WIAA 1XTRA 2J9RA 2XTMA 4DHEA 1KDOA 3QVVA 3RWOA 1W4AA 4DSUA 1OHHA 3KUDA 4GOJA 3U3OA 4GT1A 1Z0FA 1OPXA 1I2DA 4PZYA 4HLQB 4IXMA 1KK2A 1Y63A 4GRAA 4RD0A 5JRJA 4DZZA 5KSPA 4AIIA 1D2EA 2QPTA 2FG5A 2C9CA 5FPHA 1XEFA 3DM5A 5BYJA 2XGJA 3NWJA 5J4YA 3ZS9A 2C77A 1AKEA 2WKPA 1UADA 4W7SA 5FI0B 1NL3A 1CJMA 4OK6A 4AYWA 1IXRC 5EJEA 4EJSB 3QI2A 3T1VA 2QTFA 2F1RA 4IFBA 2ZPTX 2P67A 2ZJ8A 2ZS7A 1QBKC 1UEJA 3IQWA 5KSOA 1N0VC 1ELOA 3NBYC 5FR2A 4URVR 4YDSA 1ZCAA 4Q7LA 5FOVA 5GJBA 2FDCA 1VCNA 3I32A 4TQAA 1SXJA 1Z3IX 5B57C 1UDXA 2BBOA 2X1VA 1ZC3A 2R9VA 1MT0A 2QRNA 2KE5A 1WP9A 3K70C 3MWLA 4D4JA 3VHLB 2IYYA 2JLXA 4A6XA 4PSKA 2WJIA 3DPUA 5IHPA 3FFAA 2W2VA 2BV3A 4DB2A 1AGPA 2H17A 4IXNA 4QKQA 2A78A 3AKYA 1GKUB 2Q0HA 3QPUA 1TL7C 4M8NE 4Y0AA 1RPZA 5EP3A 2GTPA 5DH9A 1OH5A 2IS2A 3SQXA 5CYPA 3JZMA 3U3KA 4WXPA 4JLPA 1XZPA 4LI0A 5FOSA 3SBDA 4EPTA 2C04A 4NCJA 1JJVA 3ZD7A 4JLVA 1O3YA 3K9NA 1FP7A 2IYZA 3EZ2A 1WF3A 1RE0A 2ZRAA 1VG9B 4U5XA 4TL7A 3AVQA 2WHXA 3EC1A 4OK3A 1R7RA 3KKOA 4H9GA 3KJIA 3U4QA 4P4UA 5JJIA 1KK1A 2WJHA 2JA1A 3CX6A 1L4YA 4JT4A 4Q02A 3ZVRA 2IT1A 4HAVA 4X8OA 1YU9A 2NOAA 2QP4A 1EFCA 1PUIA 2J59A 2OCYC 3OE7A 1G6OA 5AJXA 1KI8A 1QHIA 1BKDR 2VHCA 4C9BA 3W6PA 3SU8A 4QJ3A 3MRSA 4FCTA 1RW4A 1MV5A 4GBMA 1E2KA 2J7PD 5JWRA 2V1XA 1TQ6A 4OI4A 4ZV4A 3U6BA 1MKYA 1QDEA 2J0VA 1MO3A 1ZNWA 1FX0A 3LX8A 2ZRFA 1NLFA 2C5LA 1YRBA 2VYFA 4IHQA 521PA 3NDBB 2G77B 4LJ6A 1YR9A 4TLDA 4PTLA 3KQHA 3F3YA 2R6DA 4TT3D 3EWSA 3H0KA 3LBHA 3AP2A 3K09A 5FL7A 3W9YA 4HEJA 5C46F 2ZIAA 1XMSA 1OXVA 1TF2A 1XTKA 4PXAA 5ELXA 4M21A 5FOTA 2F43B 2FN4A 1FQJA 1I4TD 5D3MA 4W9MC 3NC0C 5JJKA 1R2QA 2GA8A 1JR6A 1OIVA 1L2TA 2ORWA 2R44A 5AJZA 4XIGS 3RS5A 5EXPA 1ZCBA 3QXSA 4JLMA 2F1IA 4Z51A 4LJYA 4FINA 4GMDA 4CEJB 4RKFA 1ZYUA 3QUSA 1QRAA 1VCIA 1PUJA 3W8NA 3SHFA 1IXZA 1Z6YA 3Q7PA 5LD2B 1LY1A 1R10A 2ZU0C 3EAQA 1OKKD 3GJ6A 3ZVNA 3THXB 2GESA 1XEWX 1NG1A 1ZD8A 1OXXK 5DGXA 1H8ED 1FOEB 1SKYB 2XNSA 3SNHA 2W2XA 3W90A 1VG0B 3PUZA 1Z0IA 3BRWD 1W48A 4LPKA 3NC1C 4LHYA 4MYCA 4DDVA 2EWWA 4N0DA 1Q22A 1CF4A 3KKNA 2VP4A 3VNUA 4PO9A 3TQFA 1CP2A 4FN5A 1T3HA 4S2EA 2IK8A 5TB5A 4QFMA 5FL7D 2PT7A 5CM9C 4MDEA 4DRZA 3DKVA 4R2IA 2QGNA 1M2OB 4M2LA 5CDFE 1YZTA 2N46A 4I1UA 3EA5A 4M1WA 4D80A 2NTYC 2YWGA 3M4YA 2VQSA 4US2R 3O8RA 1E0SA 3A1UA 3D6TB 3KL4A 5BXQC 5DIFA 1Y3AA 4IEEA 5JCZA 3DKPA 1ODFA 5FUVA 2VL7A 1KHTA 3Q3JB 3CRW1 4Y0VA 4A2QA 5CDFA 1OIWA 2CNWA 2A5JA 5AUQA 2HJVA 4A36A 3IDQA 4YXWD 2ERXA 1XCGB 1G17A 5CYOA 3GEHA 5J47A 3IHWA 2B92A 2RH5A 1TEVA 3TSZA 3T06B 2QMEA 2WMOB 4PAQA 4JBXA 1KSFX 2D3WA 2CJWA 1LB1B 5HCNA 1N2CE 3A4NA 4OQXA 4EKDA 1TUEA 4Q9JA 1W4BA 1AQYA 3MJHA 3QKRB 4GI7A 4LY6A 4UNQA 3A4MA 4LJ4A 3P27A 3R9IA 4B3DA 1XTJA 4MKIA 1DAHA 4PSAA 4CYMA 4LOAA 4EQ6A 4ZIRA 1PVOA 4D2IA 3N70A 1R0WA 1W5SA 1E1QD 2V54A 4RZ2A 3SYLA 4OHYA 3NH6A 1UKYA 4URXR 3UPUA 2CK3D 3E2IA 1XEXB 4LYJA 2AKYA 3EPJA 4XH9B 3NEYA 1N25A 2N42A 1EESA 1OH7A 2P6NA 2R8RA 2D06A 3T35A 4M22A 3FOZA 2QGZA 1GIAA 2VPPA 3TH5A 4HUTA 3JZAA 2HF8A 4ACAA 2K5UA 4PHGA 4PHTA 4JIMA 2C78A 1K5DA 2V8OA 1E2JA 3K0AA 3RRNA 3V9PA 5DISB 1N6PA 3AVOA 1AN0A 2GDJA 3V00A 1TF5A 1QHXA 4LHVA 821PA 3NH9A 2DCUA 1SVKA 3U3JA 2OFOA 3K09C 2J7KA 1NKTA 2JJ8A 4K46A 4A82A 3S1AB 1IJFA 2F55A 1ZUHA 2IS4A 2A5DA 2BBSA 1LS1A 4V0NA 1KAGA 4HDCA 5KDDA 4RCZA 1R4AA 2HXYA 3DL0A 1W7AA 5DE3A 4PPGA 1U0LA 2Q6TA 3TR5A 1Q20A 1ZIPA 1Q3TA 2VBCA 3M0EA 4B73A 2ODBA 1U90A 3PQCA 2HLDA 2ZUCA 1S4QA 4AKGA 5B2ZA 2WSSD 4XSHA 1WRBA 4HB0A 1SKYE 4JS0A 2P2LA 1Q1QA 4DLSA 4IFEA 4QHSA 2PMKA 1UDWA 3DEFA 3OIUA 1ZM2A 2OESA 1HURA 3EWAA 3S1AA 3GLHA 4ITRC 4C0JA 3RSOA 2A3RA 2JLSA 1AK2A 2QPAA 4JLOA 4E22A 4P32A 2FEMA 1XDBA 2JATA 1KI3A 2J45A 4EDHA 1A2BA 2N1BA 1G64A 1KDTA 2HEIA 1YR6A 2GJSA 2OO7A 1B0UA 1ZNZA 4C0AC 3QNUA 2G6BA 1T3LA 3ND9A 4Q4AA 2JLQA 4R9UC 2O8EB 3MD0A 5DNYB 4LK2A 1XD8A 1NKSA 1JPJA 4FCVA 1XMJA 3QXJA 5HZKA 4BFVA 5JS7A 4DT1A 4G5SA 2WICA 1BOFA 2NPFA 3O47A 5KOYA 2YINC 2QBYB 5SZKB 1Z28A 1QHYA 5FPTA 4LYHA 4Q18A 3T61A 2ECKA 2WSSA 2G3YA 4BFUA 2WTUA 2EFGA 4PSVA 1GSIA 3HU3A 3V4FA 1GTVA 5HKKD 2GZDA 2QMOA 4D25A 3UK6A 2DFTA 2BKUA 2ERYA 1OYYA 4DC9A 2FSIA 4CEJA 1SXJE 5EXTA 3WMFA 2OEPA 4M1MA 4RFSA 5L3QA 4OI2A 3KQLA 1E0JA 4XWAA 2OFXA 2VEDA 3TBKA 4D0GA 3GEIA 4HAZA 1XD9A 3ZDQA 5G3ZA 5TXGA 3CPEA 2CXXA 4JLKA 2BMDA 2WWWA 1IQPA 1U9IC 3TUIC 2XOKA 3B1WA 2DY1A 2F43A 4B32A 4GPTA 721PA 2ZRPA 1N5KA 2JLUA 4Q4AB 2O8EA 3W8RA 5TDHA 2I1QA 5HPYB 3G5UA 4QL3A 2EFCB 4Z1MA 1XRJA 2QP9X 4LZZA 4C0QC 4R71A 4Q9IA 1LV7A 2J46A 3K0EA 3ZQJA 4WZBE 4YMUA 4QGHA 1H8HD 4I99A 1HT2E 2FSFA 3F5FA 3RS7A 5EZ5A 3WHKA 3OIVA 3KTAB 4CIDA 4OBEA 2ZRMA 1Z0JA 4B35A 4W5JA 5FOWA 2GWHA 4TMTA 5GJWC 1E9BA 5IK2D 2NIPA 1G4UR 3HU1A 4B6FA 3L2OB 1II9A 1M7HA 4EPVA 2XZOA 1CJKC 3AEZA 4L8GA 5E4FA 2ZJ5A 2CHVA 5CB8A 3U7GA 4UNRA 1U0HC 3U44A 1F5NA 4LV5B 1Q1EA 2GXQA 3LFUA 1TMKA 4E5UA 2NG1A 2Z43A 1FUUA 1XMVA 5CIQA 4QBGB 2WWGA 4I81A 5AR1A 2CMKA 5FR1A 4F4JA 3DM9B 4NBSA 4MYHA 5KSZA 5FPYA 5IDVA 3T5GA 1EXMA 4POAA 1N6KA 4EFMA 1AA9A 3QKSA 1FUKA 5L8VA 1L4UA 1ZNXA 2W6IA 3KJGA 4TMZA 4LV6A 1Q44A 4N0EA 5EP4A 4JYBA 3RAPR 5C1BA 2Z0MA 4DCVA 5FUXA 1NVWQ 2VSXA 2XOKD 2AWNA 1TU4A 4KFSA 1KI7A 4LWZA 2NO6A 4QJ4A 1DG1G 2XJ4A 5CK4A 3X1YA 3O8DA 4A8JB 2PZGA 2ZR9A 4B34A 3FHTA 2CLCX 3LBNA 4V0LA 2XEXA 4GP7A 4EPRA 1XXHE 4PO1A 1GRRA 4C4PA 3U60B 1Z07A 2AXNA 4FD2A 1W47A 3E1SA 1NY5A 1O87A 3H1TA 1HYQA 2Z4SA 2GRJA 2QAJA 1EX7A 5EQTA 2RGNC 3VU9B 3PCRB 3QKRA 5H8WA 1Z63A 4TTPA 1ZD1A 3U44B 2FPMA 4CEHB 5AWFC 4Z1MD 1ZU5A 1SVIA 2GBLA 5CJ2A 2FF7A 1X8JA 2YVUA 4HB3A 4PC7A 1DS6A 3PVSA 4UQOA 2OFWA 1BS1A 4C3ZA 2Z83A 1DAIA 1G8PA 4MGZR 4UKDA 2O8CB 2V1UA 3ZD6A 1XXHB 2QN6A 4US1R 4QC2A 2O8FB 4M9ZA 4ZPXA 3AP1A 4LJAA 2XX3A 3QJYA 1N5JA 3LVRE 1KSHA 1P9RA 2JDIA 2WV9A 4PQFA 3U7FB 3RLFA 4NONA 3NKVA 4TLCA 1WQ1R 2HCJB 3AVTA 1Q1ZA 2ZRBA 1FMLA 4F4CA 2AN9A 1Z0KA 4DLWA 1P2SA 1TU3A 1YZGA 3N2IA 1QVRA 1HUQA 3OAAA 1Z6XA 2CL0X 4MGYR 2Z4RA 2E9SA 1R6BX 3GP8A 5KO2A 1ANKA 1DEKA 3I8XA 2C9YA 2YOFA 2ZRCA 1CBUA 3A37A 1KNQA 2QNRA 1FNNA 3SFVA 3TJZA 3WXMA 1CJVC 1G16A 1M34E 4OJKA 5H70A 2YKGA 2EQBA 1US8B 2IUSA 2V3CC 3E70C 4NCHA 3KJEA 3GLGE 2QEQA 2WKQA 1I4DD 2V7QD 5LBIA 5KYKA 1UBGA 2P5SA 3OIWA 2UVQA 1IBRA 2J7PA 3L82B 2EFEB 4HLDA 2B8WA 3EIEA 2ATVA 4NHOA 3K0CA 3TVDA 3QG5A 1QHGA 4BECA 4GZLA 1S3SA 5G40A 3P1JA 2C8VA 4G5OA 3RWMB 2PMDA 5C18A 4I1OA 2CL6X 1RIFA 4Q1BA 4I1SA 3X2SA 2Q3MA 3LXXA 3SOPA 4AC9A 2AXPA 2ANBA 2ZI4A 1FZQA 1P72A 1LVGA 1VECA 1IN4A 2WOOA 3AF3A 2J0UB 3B9QA 4II7A 1US8A 3I8SA 3TQCA 4WZ6A 4Q5IA 4M1TA 4DEYA 1YJ5A 1G5RA 3KTAA 4Q03A 4W5HA 5D3MB 1R0YA 2DB3A 2X2EA 3FPAA 4A92A 4HAUA 3X1DA 3SN6A 1OSNA 1XFAA 3THWB 3AVYA 2EVWX 2FV8A 3KKQA 2IS1A 2P5TB 3X1WA 3TKLA 4DUGD 1KI4A 1CJTC 2WOJA 2E1RA 1W1WA 2GHIA 3TUJC 1OJLA 2ZUDA 4MRNA 2NMVA 4A0RA 2QORA 2OCPA 4MKHA 3GLIB 3ICQB 1P7CA 3H2YA 2JLRA 1OIXA 4G3XA 4V03A 2VA8A 1N6LA 1K6MA 1NSFA 3SE0A 3VKHA 2ZXUA 2NQ2C 1XZQA 4NDZA 1G8FA 4HUQB 3VMFA 1ZUNB 4XVRA 1G8YA 1GNRA 3VR3A 2RGEA 4Q4JB 1RKBA 1E99A 4CEHA 3B6EA 2HJGA 4BPBA 3AUXA 4ZKDA 3ZIAA 4QRHA 3NDPA 2HYIC 2IEZA 3U7EB 3WNBA 1XNJA 3K9LA 3FWYA 3LO5A 4TZ0A 3V4RA 1F2UA 2KJQA 2Z6VA 3O8BA 4JSTA 3GLIE 3K0CC 1IN7A 1Q57A 2YZ2A 2OHFA 3MSXA 5HE8A 4L4UA 4A8JA 4B33A 4YXWA 2L0XA 2GXSA 6Q21A 2ZITA 3B1YA 4Q66C 4PANA 4IOMA 4YQFA 2ZEJA 3O8CA 3OEHD 2B21A 4B74A 1WE2A 2BWJA 3LD9A 3BGWA 2XB4A 3ZGXA 3U6KA 4KSCA 1JBKA 1EFTA 2CLSA 1NMXA 3C8UA 4BLPA 1LS6A 2VP6A 1E2MA 1FL9A 1S9DA 4MUAA 5J40A 5FUWA 3ADDA 1ZU4A 3QPWA 1XEWY 3K70D 4EFNA 3BFXA 2CE2X 4MYUA 4EUNA 2FSGA 2IWRA 4IDOA 1NLYA 1A5TA 1COWA 2W00A 4M9QA 4Q1AA 2ZVQX 3WNDA 1IOZA 3FYHA 5JJLA 2PZEA 2ZRHA 2I1VB 2YYZA 4HSEA 2GVDC 1GWNA 1OV4A 3L0IB 2IYUA 1KKLA 3A36A 4KO8A 3R7WA 1KGDA 5KPDA 2OBNA 1TAGA 2O8BA 5F9FA 1GVNB 3FMPB 2QROA 4YDHB 4EQ6B 4C2UA 3GLFA 3WNCA 2JLYA 5EXSA 4TYYA 2OXRA 1S0UA 2OLKA 1Q1BA 1VCMA 2VP0A 3SFZA 4B3FX 3T12A 2GETA 2ZSFA 2H5EA 4HAYA 4HAWA 4LBVA 4LJ9A 2VSFA 3CH5A 1P2UA 2ZI9A 3VKWA 4NZYA 1EK0A 3GJ4A 3VQTA 4CVNA 2LKDA 1F2TB 2X77A 1OYWA 621PA 2HDNB 3OHMA 3LVQE 2JIZD 1GP2A 2PLFA 3ECCA 3R7WB 1SVOA 5CITA 2EFDB 2HYDA 3EA0A 4W5WA 1P5ZB 2QE7D 3CPHA 1AJEA 1CLUA 4LHZA 4LJ7A 4G1UC 1P6XA 3I3SR 3GFOA 2OBLA 3P32A 4YLGA 1LTQA 1D9ZA 1Z83A 2YHSA 3BBPA 3CPJB 1KI2A 1YZKA 2V55B 2EW1A 4UXJA 4AG5A 1QHNA 2KBEA 2NO7A 4XTRA 4CGZA 5DYGA 4OHVA 3GJ0A 1SZPA 4NCIA 3ADKA 3WP1B 3JVVA 4MQBA 1MRNA 4Q4HB 4C7OA 5D3QA 1W0JA 2QSYA 5BW8A 2IXGA 1J8YF 1OFHA 2GXUA 2ZJZA 4X8LA 3D7MA 4TTQA 2OAQ1 3HJNA 2KSQA 1W0KD 2ORIA 3EPKA 4DLUA 1E9SA 3BB1A 1XTIA 4Z8XA 4ARZA 4A2PA 4Q48A 5IRCD 3M6AA 2GF0A 1E9DA 1Z8FA 1SQ5A 1Z47A 1MOZA 2Q9BA 5EXXA 2IW3A 2WM9B 2BVNA 2IXEA 4ASUA 3C5CA 4JL5A 5JLJA 1IY2A 2D62A 1DE0A 4KXFB 1CRQA 1OT3A 1FPMA 4LRWA 2C98A 2NGRA 2NZJA 4URWR 2IUTA 3U61B 2GK7A 1NVXQ 1AS2A 1RFLA 2WMNB 2EWVA 3CF6R 3WBJA 2R6FA 1U2RA 1G19A 2IYXA 4XTCS 2F9MA 4DCNA 3FGNA 1KI6A 2ZM5A 3FKSA 3RNLA 4D81A 2AHOA 5K8IA 5DN6D 4K8OA 4B2LA 2REXB 2J0UA 1EFRA 1P2VA 2XNDA 2J0SA 2OV2A 1NBME 3EPLA 1XX6A 1X6VA 2DPXA 4KFTA 1KY2A 1D2MA 4IOLA 1GRQA 2W0SA 4JLBA 1NN0A 2TMKA 4XSGA 3GLFB 1G18A 3IHLA 1SULA 3L0OA 4KYIB 2P3SA 5FTLA 1NN5A 4RFSB 5L3QB 3GPLA 2Q9AA 3VX4A 4BWYA 3CR7A 1SHZA 2G88A 1PZNA 2RGXA 1KI9A 1YZLA 5CLLA 3B2EA 1G291 4A1FA 4OKSA 1E0AA 3P26A 4M9XA 1OLOA 1SVWA 1A82A 2V6IA 3W5JA 2D4HA 2OILA 2FFBA 2GK6A 3GFTA 3Q72A 1DAGA 4DBLC 4IDQA 5GADl 2QM8A 3L43A 2EU8A 3RABA 4JVSB 3T5DA 4BFZA 4AI6A 2OM2A 3M1IA 1JXMA 2FA9A 3TLXA 3N5CA 4BE7B 1A1VA 1Q3HA 2IHYA 4EIWA 4HDOB 3KX2A 3LX5A 5K8LA 1G7SA 1OB2A 4EAQA 2RGDA 4EPXA 4C0SA 2F1JA 2RHDA 4D82A 3PUYA 2P65A 2F3RA 1W5TA 2PEYA 3CO5A 4KBFA 3ZZTA 3HPRA 4DUGA 1Z6TA 2A30A 5LPNA 5HR5A 2ZR7A 3WRYC 2FWRA 1F2TA 4O2RA 4US0R 4C2TA 4KHZA 1GNPA 2HXSA 1XTQA 1IN8A 3GEEA 3QQ5A 5E95A 1OXTA 4X8HA 3RS0A 3F0TA 3LQQA 3RYTC 1ESNA 2ZREA 1F60A 2ZVPX 4JVNA 4F4IA 3LY5A 3SJZA 3I5YA 5EE3A 1HQCA 1S3GA 1K8RA 2C03A 1YR8A 2FFHA 2QP3A 4BFTA 1HE1C 4HB2A 1TTTA 1AKYA 1JXOA 3RRMA 1DAFA 3NIBA 2V9PA 2AK3A 5KPJA 4YMVA 1JR3A 1XPOA 4RKEA 4URYR 3REFA 3CNOA 4ZDKA 3B1XA 3GJXC 4NE2A 2AD1A 2GCNA 2ZE6A 2XXAA 4GL2A 3BWDD 2WJYA 1ZJ6A 4ZI2A 1E2LA 2RGNA 2VHQA 1CIPA 3OIYA 2FFQA 4V0ME 2IBMA 1OB5A 1VIYA 2RGCA 3TVTA 1FQKA 3GFPA 4AG6A 1OFTA 2ZETA 4F7WA 4QHTA 3QSYA 4EPYA 4IW3B 2MMGA 3AUYA 3VR5A 2ZJBA 3H84A 3P4XA 4DJTA 1E2DA 1G20E 3SS8A 3K0SA 1E98A 5FBLB 4JLAA 3QIAA 4MRRA 3P20A 2ZRGA 1ZNYA 1JEDA 1FNMA 3SQWA 3GJ7A 5M04A 2O52A 3AVUA 2F7SA 3CIOA 3RS4A 3EIHA 1U98A 1BH2A 3RHFA 2IYTA 2QRZA 3R8FA 1W49A 1LF0A 1W4CA 2QTHA 5DHFA 3MFYA 3C7KA 1EFRD 5FTJA 2VF8A 4BLTA 4IRUB 1HTWA 3DDCA 2A5FA 1XD2B 3MGCA 3MWYW 3KDSE 4JYCA 2ZYUX 1W36D 1UF9A 2VP5A 2BDTA 3DMDA 3LDAA 2IYQA 3E5HA 4PHHA 2O8FA 3PXGA 3SJAA 3BFKA 1KO1A 4JBYA 3A4LA 2ZYWX 2DHRA 4Z8YA 2RGGA 2CJWB 2OG2A 3OF5A 2RKOA 4KODA 4FCWA 4M1YA 2VHTA 4ZDIA 2LKCA 4E07A 1H8EA 3HR7A 1W4RA 2G1JA 1OF1A 3NTUA 1VCOA 2B7CA 3AP3A 3EZ9A 4QXAA 1QVAA 2GKSA 4C30A 4Q9LA 2OSBA 3GMTA 3LWNA 1MH1A 3DZ8A 4JLJA 1FX0B 1TX4B 2XJ9A 3UG6A 3BE4A 2QT0A 2GEDA 4MRSA 2O8DA 2FMXA 3CB4A 2CHGA 3UWKA 4LJ5A 1NF3A 3PV0A 4ZO4A 4DXAA 5KHOC 4PHFA 2IS6A 3UIEA 3KQUA 1EWQA 3CF2A 4MKGA 1IN5A 4NKRA 4YC7A 5J4KA 3SYNA 5DSZA 1QG2A 2VRWA 4AKHA 5FBRB 5FL3A 4O0MA 3REGA 3U7HB 5LD2C 3X1ZA 1N6IA 4TZ6A 1E2PA 4AYTA 1UFQA 2XITA 1AM4D 1XCMA 1UKEA 4JJZA 2VIIA 5DI3A 2VHUA 1PLKA 2RB4A 4I4LA 3J81k 2ODNA 4BFXA 4Q21A 1X8LA 2HCBA 4GZMA 4RD6A 3I61A 3ADBA 3TR0A 1TQDA 2WBLC 3T34A 2R6AA 1CR0A 1GOTA 4QG7A 3RSLA 4OQMA 1J8MF 4DLYA 3C41J 4TL6A 4XD7A 2BM0A 3HU2A 3W3ZB 5GJVC 2CCGA 4F91B 4JKYA 1Z08A 2ZJYA 3TRFA 1NVUQ 1GM5A 3PG5A 3FMOB 2ZSAA 3EASA 4BZXA 5DLQC 3A1SA 4Q1FA 4DIDA 3AF4A 1M74A 3I72A 1G41A 1PLLA 4NCNA 4Q9HA 5L3RA 1GG2A 3THWA 4NYJQ 4OI0A 1JR3D 1B23P 2GNOA 4Z54A 5KDOA 4XWKA 1UJ2A 3RRYA 3D8BA 4FMDB 3D31A 4PPQA 1Z06A 3CR8A 2GCOA 3QENA 5FOUA 3B8HA 3QBVA 2D2EA 4FMCF 5HE9A 4LBYA 1JAHA 2JJ2D 1VHTA 2QU8A 2JEOA 3OZXA 4BFWA 4F93B 1ZUIA 1N3BA 1ETUA 3LW7A 4HLUC 4Q7KA 3THYB 4KLNA 4HUQA 2OAP1 1NJGA 4N3NA 2WSMA 3WMGA 2NO0A 2PL3A 3VKGA 1G21E 2YNMA 5KU1A 4PZLA 2PZFA 3LLMA 5B30A 5GVSA 4FWIB 3Q9LA 2JGNA 1UKVY 2ZQ5A 2FFAA 4KI0A 1YZUA 5EP2A 4TQUS 3FDIA 1J70A 4DIEA 1KSGA 1Z29A 1UPTA 1LW7A 4LCBA 2F1HA 3LV8A 4OK5A 3QEJA 4X8MA 4DCUA 1W36C 4LGMA 4AKEA 1KK3A 2ANCA 2WWFA 1SXJB 3B78A 2R62A 3TSOA 1MO6A 1R5OA 3BFVA 1I4LD 4DCTA 2C99A 1MABA 1DO0A 1E2HA 3C15C 2MMCA 3KXIA 1OHHD 2A5GA 3TSWA 1CTQA 1U99A 1P3JA 3IILA 1T5IA 5F2EA 1VMAA 3CNLA 2D74A 4C7OB 3IO3A 2YWHA 3CH4B 4HZUB 5BN5A 1EX6A 1D6JA 5B58C 3I92A 3I1FA 2AD5A 3EZFA 3NHAA 4RZUA 1TADA 1CR4A 2DFLA 4M9SA 2CNWD 1MR3F 1U8ZA 4BUJA 2RGBA 4ON9A 3U4QB 4ACBA 5LDDC 2IX3A 4BLRA 5B64A 1ZM7A 5KTYA 3CWZA 1T3SA 5AUOB 5EE1A 8OHMA 3CF0A 1TQ2A 1T8UA 3A1TA 3KB2A 4B44A 4CF7A 5IF9A 1VYUA 1T5LA 4TWZA 5E7IA 2WWYA 4MA4A 2BHRA 5E7JA 3QXHA 4TLBA 3I62A 1TEXA 2ZE7A 1P75A 2GAAA 1T0JB 2GVZC 2PEZA 2W6JA 1R5BA 3FKQA 3LAWA 4IVRA 4Q47A 5DI3B 1C1YA 2BIFA 3K0AB 1BO6A 3NHBA 3SI7A 1DO2A 1NY6A 5IT5A 2J0QA 3R9XA 5CK5A 4EJSC 1T8TA 4KLZA 4URUR 4BLQA 5KUTA 1EWRA 3B9PA 4JT2A 3FFBA 4JSYA 2R65A 4ESVA 5JMTA 2FJUA 2NO1A 5FOXA 4JZKA 1E2NA 3EX7C 2WAXA 4TMWA 2HLDD 2ZRNA 2VO1A 3PEVA 4P3YA 5CLQA 4OJQA 3QF4B 4DLZA 2CDNA 3GD7A 4PC3A 1J7KA 1KOFA 4Q19A 3ZVLA 4LUCA 3IEUA 1GKIA 1KO5A 2IF0A 3Q85A 1NI3A 1SGWA 3EW9A 1NLZA 2AWOA 1G5PA 1XJQA 1D9XA 1W2HA 2EYUA 1E2FA 2WKRA 4JL8A 2ZE8A 2DWQA 1KJWA 3HWSA 4HDQB 3THOA 5J4LA 3T1TA 3AGPA 1YVDA 4G0NA 3LQRA 4LJ8A 4OI1A 4B71A 1N6HA 4YMWA 2ZRIA 5FBVB 1X1RA 3A58B 4P0TA 2DYKA 2BMFA 1G3RA 3KQKA 4A15A 1YHNA 2I4IA 2WIBA 3DOEA 4YMSA 1JQJC 5BYKA 2C96A 1DOAA 3BD9A 2CCJA 5H68A 2XTNA 5LB2A 2XAUA 1KO7A 3UMSA 2RAPA 3BH6A 3CW2A 1KJYA 4PQRA 3OESA 4IKEA 1J2JA 1E1RD 4I1VA 2V7QA 3R8CA 3WP0A 2CBZA 2IYSA 1WBDA 1OE0A 1BIFA 2BJVA 4CRWB 2VH5R 4AYXA 2ZSEA 2REBA 3U3RA 4ZIRB 5DI9A 1S1CA 3T15A 4G5RA 2VLIA 4ESHA 2O8DB 3ZJYA 4UJ3A 2IYLD 1DAMA 1G3QA 1E1QA 5C4GB 3AV0B 3IIJA 1LF5A 1II0A 5AUPB 1NBMA 5CB6A 2DBYA 3QKSB 3ASZA 4XWOA 2PBRA 1HT1E 3SJBA 4P4TA 4M53A 1AIPA 3GJ8A 1RRGA 4QM7A 5L3SB 3PENA 2O0HA 1RZ3A 4XJXA 1G8GA 2CVFA 2ZI3A 4R2HA 3AKDA 4HB4A 4C0KA 3AM1A 3ZYCA 3X1XA 3IIMA 1NMYA 5K8UA 4ZCLA 3H4MA 3GLFE 2W6ID 4TSFA 1ZBDA 4LYAA 5E3HA 4KSBA 4QBHA 2JCSA 1Z5ZA 3WYGA 4M1OA 3VR6A 3WBKA 1VKJA 4LSGA 4A0GA 1NIJA 2GAOA 3CRMA 5JS8A 3WYAA 2ODWA 1N6RA 4RJLA 1U8YA 1AZSC 4TLAA 4U7DA 1M7BA 1COWD 4WBSA 1M6NA 4OYHA 2OXCA 4E03A 2GJAA 2ORVA 4B48A 2JLVA 5IK2A 1GDDA 3QXXA 2ATXA 1EG7A 4FIDA 3DO6A 3ADCA 3IKJA 5JRZA 2IC5A 5C2JB 3PUVA 1UM8A 4DSTA 2CE7A 4AK9A 4TYWA 5EE0A 1XPRA 2J87A 1W2GA 3KFXA 1W46A 221PA 3BJIC 3KZ1E 4B3XA 4V0KA 3A6PC 2J1LA 3G82C 3OEHA 2QBYA 2XSZD 3FB4A 4KCGA 4DSNA 4QJ5A 5SZIA 3TK1A 3TGPA 1XWIA 1Z2CA 4NYMQ 4QGAA 1L7VC 5KNBA 3PJRA 1OFIA 1JI0A 1JR3E 5F3WB 1U81A 2BM1A 1N5LA 1E32A 2H1LA 2Q9CA 2VF7A 4M1SA 2GBLC 3QOFA 2BBTA 4LHWA 4Q1DA 4KVGA 3IPYA 4MRVA 4AY2A 2HT6A 2KB0A 3ICEA 3B1VA 4QBIA 1ZM9A 1S8FA 4NMMA 3NXSA 1DAEA 4DDTA 4XVUA 3RDPA 1KI1A 1QHHA 2AL7A 1CEEA 4URZR 2ZTSA 3IGFA 4IOJA 1DELA 2R6GA 2GEUA 2XNDD 1JJ7A 4BRUA 4PPFA 2FU5C 3ONWA 1D2NA 2ZS8A 1T6NA 3AVVA 5EUMA 4JLNA 4R7ZA 2P6RA 3W6NA 4A6PA 4WW0A 1D5CA 4MITA 3EPHA 4B6EA 1LFDB 2LWIA 2P0EA 1E2QA 3BK7A 4IEIA 5JEEA 2J3EA 4KBGA 1G4AE 1OFUX 2PX0A 4C0LA 2DFKB 4PC6A 1JNYA 1E96A 3VR4A 1VG1A 2C2HA 2PCJA 3ZS8A 2OZEA 5JBQA 1U94A 1IJEA 3CX8A 3QPVA 5EE9A 4IDPA 2JJ1A 3RVBA 1E6CA 1N6NA 2BOVA 4LPSA 1YZNA 5FH9A 3CWQA 5AJYA 1DAKA 1KYIA 1ONBA 3HR8A 3L8YA 1KSJA 4B3BA 3BC1A 3IPXA 1P60A 4QGFA 2Y8EA 5SZHB 4LDJA 3NVAA 3F8TA 4ZDWA 2V6JA 3OE7D 2XSZA 2QSZA 4GNKA 2ASEA 3BIFA 2JLZA 3ND8A 4FXPA 3CZPA 1KDRA 1E9RA 3QKUA 4QOSA 4D0LB 4JKIA 4KITB 3HDTA 4Q1CA 1AGRA 2O0JA 3TIFA 1XMIA 3PUWA 3GLIA 1XF9A 3CBQA 2YJTD 3SBEA 4Q7MB 2OBMA 1P61B 1V5WA 4FW9A 5AJWA 2QTVB 2XZPA 1YZQA 3RS2A 5HKKA 2FPKA 4WA7A 1EFUA 1WB9A 4FMCB 3Q8XB 1JECA 1TF7A 3U3MA 4B2IA 4ZKEA 1DBSA 1HV8A 3EXAA 2ZAOA 3R20A 3SR0A 3K9HA 4PZZA 5G53C 5AK0A 1NN1A 1DVRA 1P9WA 2G83A 4AWXA 1CR1A 4D4KA 2AK2A 2XZLA 2A7QA 1P73A 1U8AA 1J90A 2QQEA 3QEOA 3WYFA 4TL9A 4DLXA 4MKFA 2GCPA 1Q12A 4M0LA 1QF9A 1A7JA 1T0HB 2ZYTX 2UZIR 3A8TA 2BC9A 4CZ2A 2ZSBA 2ZI6A 4NPHA 5HCIA 2R6CA 3B82A 3ETLA 1OH8A 1E9FA 3CONA 4RD1A 4LX0A 4GDFA 2B8TA 4GSYA 5LB4A 1CRPA 2JJ2A 5HTKA 3K1JA 5F98A 4TYNA 3GLHE 2YV5A 4AURA 2PCLA 1N5IA 2A2ZA 2ZR0A 5EUQB 5FUYA 2Q21A 4DVGA 2HV8A 2FNAA 2IA5A 1CR2A 4BQSA 1AS3A 4DDWA 1R8QA 1V43A 3TMKA 4DKXA 2WJVA 2IYVA 2IF2A 2BEJA 4RZXA 2X8AA 2HUPA 3WRXC 3C14C 2FGKA 4CW7A 1RRFA 4XD7D 4B76A 1ZP6A 2MSCB 3IBYA 4Q4JA 2YWFA 3WY9A 1E2IA 1XPUA 2KWIA 5L3SA 1K5GA 2QAGB 4J0QA 3UATA 4DLVA 4BZQA 2HT1A 2O8BB 4A8JC 5FFMA 2QI9C 2XXAB 4P4SB 3W5IA 1FFHA 2PLRA 1T9HA 1VYTA 1G9XA 2RHMA 2ZRKA 3KKMA 1ZD9A 4F38A 4WVFA 2FPLA 1KJZA 3PR1A 5UKDA 3NBFA 1DARA 2O8CA 2YWEA 3NEJA 3T1OA 1RRPA 3RC8A 2H18A 3VTKA 3B85A 1SXJD
chains in the Genus database with same CATH superfamily
2IP1A 3V1UA 2PX6A 1RWBA 2H2HA 4NH4A 4NRDA 4OQYA 2ZJAA 2A9KA 3HFJA 2H16A 2Q3CA 5ICMA 2X9LA 3PC2A 2CSXA 3HJHA 4OO3A 1HDIA 3RIMA 4KV9A 4B45A 4MINA 4E1AA 1GXSB 5GGXA 1E0DA 4GI2A 3HL4A 1DKLA 4MRMA 3VAAA 2FW8A 1S2MA 2G1KA 3SD7A 2Y1KA 1SHKA 2ZCUA 2NAFA 3PFIA 2H65A 2VJCA 2ID8A 2X5JO 2XDQA 3BB4A 3KQPA 3OTQA 1C80A 4YAOA 4PSDA 2UYCA 3K92A 5LZ8A 2B6NA 1FVXA 2BDEA 1KR2A 4JR0A 4GMKA 3ZQ6A 1WXQA 3O82A 3IIEA 3CUEF 3BIJA 3QGMA 3UF0A 1YXMA 4UMVA 5DHPA 3SBXA 2FEPA 3D0QA 1K3FA 3FCCA 3QF7A 5DGHA 3KK0A 5DN6A 1O97D 3ZI4A 4MKXA 2DBQA 3OFNA 3QY0A 3ZW8A 4QXPA 1EP2B 1LKZA 1HQDA 1UINA 1Y9AA 2IY8A 1FF9A 2P68A 1OR8A 3AIKA 3GJ3A 2QG6A 3K1TA 2FZ4A 4A23A 1JDVA 1U9JA 2X2FA 3EQ2A 3LRXA 4MW7A 4BLWA 4D26A 1ULSA 1JWLA 5CMLA 3CXUA 2GEVA 2WZDA 3CZMA 3RS3A 2ZRDA 1APBA 3I37X 1QKJA 2VN8A 1MJHA 4PEVA 1QMPA 1Y8RB 1ZEMA 3ENNA 1T43A 1I80A 3KEGA 3JYQA 4MCHA 4TS4A 1Z4QA 4YMIA 5E1DA 3CF4A 2FPIB 3IUNA 1LPAB 2AQ8A 1JEQA 3EOAI 3P0HA 3GU3A 1GGNA 3KUUA 2V9ZA 2AG0A 2FOLA 5TV2A 3FUXA 2H48A 5SICE 1JHAA 2A59A 1FYXA 4I9FA 4ME6A 3BMCB 2AKAB 4UOZA 1J23A 4ZYZA 1JFRA 2Q3FA 4HZUA 3R7NA 4CI9A 4PAOA 3OMXA 5FORA 1V6CA 5FI1B 3NORA 3WO0A 2CKDA 4LQ4A 5C4MA 1O94A 3U5ZB 4IIHA 5A7FA 4R2JA 1RQNA 4KP7A 4TMVA 3WB9A 1H5QA 3ELYA 5SV2A 2XB8A 1OXMA 2YWBA 1QG4A 3K0BA 1G38A 4KR7A 2ZJOA 1F2VA 3PQDA 4G56A 3EGEA 1CY8A 3HUUA 1ECPA 4D5GA 1RPNA 3E27A 3DWGA 2BMJA 1VJCA 4MYTA 1NJ5A 1JPNA 1RMYA 4ENWA 5KMGA 3C1UA 1AUOA 1EH5A 3HUTA 4TV8B 4ZMRA 2XZDA 4RDXA 1OH6A 3IV9A 4FYIA 1G42A 4PAMA 3OPMA 1M6VA 3HC7A 4MR9A 3T54A 1THZA 3T9AA 4TTVA 2QT1A 3S28A 2GEBA 2I6TA 5EHQA 1WUKS 2JCVA 2C4TA 1XZIA 4NJMA 3DG9A 3SQDA 4XM2A 1LQTA 2IJGX 1MN6A 3KQQA 3LX6A 1VKNA 2G7ZA 3IB3A 2IFTA 4HZIA 4M0EA 4HC4A 4BUCA 1J99A 2UYHA 1PR6A 3EIQA 2IYNA 1QOPB 3KZKA 1C9JA 1LK0A 3N53A 3TRHA 3K70B 1MA3A 3HTXA 3PZBA 4P53A 3ZYZA 3ZHTA 1TNDA 4ER6A 1XVAA 2IV7A 1KBZA 2YOGA 4IWYA 3VBCA 1RIIA 1RE1A 1XA4A 2FSHA 2JI9A 3NVDA 4R1PA 3LWZA 2XUPA 1XJCA 2R1VB 1EDBA 2M6KA 4M1KA 1D03A 3QFRA 2RIRA 4CQLB 1JR4A 3CLUC 3G5MA 4BEBA 3BL6A 1I2MA 1N7HA 1XZBA 2G0NA 1QS0B 3WGLA 2VF5X 1L5RA 1YDFA 4OHWA 2D7DA 2PX8A 3LSTA 2VZ8A 4UXHA 1AGXA 1KO4A 3LPDA 1NVTA 4JOBA 4FX5A 2PJRA 3OEEA 4OAQA 2ZB3A 2W0MA 1SUAA 3CRVA 3FBWA 3OQVA 1UXOA 2C59A 2ZFUA 4A0FA 3NGMA 2HLNA 1RJ9A 1FLVA 1Z0DA 1WZCA 3O8QA 5CGQB 4B47A 2ZTMA 5ALMA 2QB5A 4QNRA 4L2IB 3QW2A 3RARA 3GQBA 3CNNA 3TZBA 4FHEA 3SWWA 3GDWA 3CX7A 1XHEA 4HX9A 2AMFA 3LOPA 3WMEA 1GUAA 3GN2A 1SC4A 3EG9B 3FNHA 5KNDH 2VK4A 4WN9B 3JD2A 3NBQA 2H29A 4OQNA 5FWDA 4NARA 4OEHA 5EJAA 4FBMA 2MIIA 5IN5A 5TPZA 5TQJA 1EXDA 1NJ6A 1K1EA 2DFDA 3WDKA 4P31A 2YJZA 4F92B 2WPDD 4YRNA 2AR7A 5JEDA 1WY7A 1F6BA 1GLVA 5EMKA 2AJCA 1VSBA 5J59A 4RS4A 3UC9A 4PQYA 1YFJA 2E1PA 1E1KA 1O6GA 2X5KO 3K8YA 5CIWA 1L4EA 3EFBA 3H2GA 5DVZA 1H2YA 3Q1LA 1THGA 4DV2B 1V35A 4NR0A 4M83A 1Q15A 5A3SA 2WIAA 2QZ9A 4KAJA 1TPYA 1SAYA 4KBYA 4FXOA 4KIGA 2DBZA 4C6TA 4EMTA 2YHAA 4EVIA 2AW5A 1QHHB 1P4SA 2P2SA 1ZL0A 2X4LA 4G0ZA 4P33A 2NU8B 3ZY6A 3JD0A 2C94A 4WMLA 3P2EA 4Y2QA 4EFLA 3LW8A 3ELBA 4KQHA 1XTSA 2FW0A 2RMKA 4Y9DA 3P2MA 4YJ2F 5FPKA 3DAYA 1KY4A 4R1OA 3DOJA 3GCDA 4N5IX 2GO1A 3COYA 3L40A 3NLLA 4TYPA 3SYKA 1B7GO 1YQUA 4NCKA 1QFYA 1ONOA 4XCXA 5ALEA 1IN6A 2QI9F 3NFRA 1HE5A 1P33A 2PKEA 4BU0A 2FHPA 5K0NA 3BMQB 3KL2A 3MCWA 2AUMA 2H07A 2PKYX 1MO5A 1QYWA 2WNHA 3JZIA 1RLTA 1L4LA 5IYZA 4X6UA 1C5KA 2F6RA 2JI8A 3H86A 4QWMA 5GVRA 1G7TA 4LTNA 5I9NA 3PEWA 5DMHA 4R69A 1FTSA 2ZI5A 4U02A 4CM4B 2I3BA 3LPCA 3C6BA 1HORA 4RMHA 2EF0A 4P22A 3V1TC 1SBHA 2QM7A 3HRKA 4U2CA 2Q8PA 3NASA 1XTUA 3HVUA 1C0IA 1B8PA 1P4AA 4KPFC 3JWPA 3THXA 2W6JD 3FGPA 1YRAA 3ABOB 3R4VA 3M6XA 5DULA 1FNCA 2HIMA 2Z9DA 4JVOA 4QBFA 2YV4A 4TYQA 4DM3A 5DKFA 1N3IA 1U0JA 1QZXA 3KEQA 4BGIA 1PFKA 1AS0A 4GS5A 5KTMA 3AERA 2O59A 3T3GA 2F3SA 1H5NA 1PGOA 2JAQA 3H2BA 4AF6A 3QBJA 2QMUA 4LRTB 3UMYA 1KU6A 2COKA 4L8VA 3R7SA 3H11A 3BYZA 5SZJA 4EOGA 2NZYA 3I2HA 3C5EA 3IA2A 1T9BA 3USCS 4Q4LA 5KVCA 3L0SA 1UDCA 4OQQA 1ZMXA 4LNAA 1FMJA 2I4NA 2AXQA 1LBTA 2HXGA 3ETJA 4IDBA 1GQFA 2C5AA 5JMOA 4GC5A 2E5LB 2WUWE 5DX8A 4XFDA 4BQQA 1R3DA 2ONJA 4C5AA 4FLMA 3VGPA 1HA3A 1JHVA 1X9GA 2ARKA 3LRPA 3TLEA 1WZEA 2OBBA 4LRSB 4JJKA 4IDHA 3JYHA 2FMUA 1ZCZA 2BM9A 4OSOA 3UTCA 5JNTA 1WUTA 2BCGY 2QRPA 3KV1A 2WJZB 2FUNB 2QMHA 4HDRA 2Y1GA 1XP8A 5LM3A 4IZIA 1Q74A 2XCIA 1QF7A 1EFHA 3OQBA 2BFDA 2HHJA 1RWMA 3K2QA 4PYQA 3VR1A 5CLGA 2PSFA 1M6EX 1KDPA 2H92A 2O6HA 3IT0A 3UFXA 2UXCB 4XEUA 1CT9A 1WIWA 4D9CA 2IBTA 3IEVA 4PINA 3NETA 3QMVA 2CHQA 4IIGA 3UXMA 2YIMA 1RS0A 1PT6A 2BZSA 1EVIA 2PV0A 4YJFB 3NGXA 3ZUPA 5F35A 4C6HA 5ALPA 3M9LA 1OXBB 3B7GA 3DYBA 4MQFA 3K96A 2VSYA 2QSUA 1JJBA 4ZZ2A 4FB4A 4UU7A 5CX1B 3KT0A 3H6KA 1G2QA 2O2GA 2CYAA 1SUCA 3QH4A 1EEXB 3ESRA 4NZNA 3MBOA 5JXWA 3GRUA 3KU1A 3I9MA 4TN1A 1ZW6A 4GOXA 3DKRA 2Q7DA 5A5DA 3CT4A 3GUZA 3H1BA 3KYBA 2CYBA 1R6VA 3NBZC 4LISA 3GHYA 4Q1EA 5TEWA 5IS2A 1U9IA 1VG8A 2UVDA 3MWKA 3N2GA 3JVDA 3QKWA 4GG1A 4IHJF 2XKAA 2JAXA 1SQSA 2JKVA 4NCXA 3GEBA 5EEGA 1ZH2A 2F00A 4YECA 1LI4A 1O08A 5FP0A 3TUZC 3EVAA 2WVAA 2CFCA 4I6EA 3ZZ0A 3TLAA 1O03A 3OQPA 3STYA 5HZHA 2WLSA 3HFRA 5L7WA 4M38A 2COUA 2MSDB 1Y7TA 4LY9A 1GGKA 1J8QA 3VVBA 3ILVA 4QQRA 3I5MA 1KI6B 1PQPA 3OIGA 4JNKA 4UE2A 2WNIA 2PZMA 2YZKA 2ZYVX 3HGMA 3MWEB 1JSZA 3BGIA 4RM2A 3U17A 1Z4MA 2GS9A 2WF7A 4V39A 3M5DA 3ZE1B 2RHBA 3PFKA 2XDYA 3STUA 1X77A 2YXPX 3FDXA 1X1EA 3A1FA 3NWPA 3ZWPA 3D6AA 2ONKA 1PJBA 3DZDA 4KIUA 4QHYA 1YB5A 5J2UF 1L1EA 3UAGA 1K06A 4TVKA 1HY3A 3HZZA 1QZ3A 4QM6A 4Z7QB 1EJ2A 1TQHA 4N40A 4UTXA 4RA9A 4ZYXA 3C5HA 5ITVA 5JECA 4EK9A 1CY2A 4QDJA 5KJEA 5C1DA 2ZUBA 3D59A 3QBTA 2I8AA 2WYIA 2F3TA 4J91A 2OPHA 3ED5A 4QARA 3D2BA 3ZIAD 2C20A 3PITA 1QUFA 2VK8A 5CX1A 5FBQB 4NTZA 3RSCA 2BMEA 3C3BA 3L0YA 3LT4A 3N2KA 4HYYA 2A9VA 2OORA 3PXEA 4CM7A 4C0HA 4XQ0A 1WBBA 1P1RA 1XRSB 5LXTA 1O77A 3LVFO 2G63A 4ZAVA 3PFCA 1M2KA 2YS7A 5KVQA 4UNNA 4WKPA 2OWDA 1IXSB 4E12A 4CTNA 4C7JA 3LT5A 4RU1A 5B3JA 2AF3C 4CQLA 1SEVA 1MFPA 1KQOA 4BBZA 4MVWA 3PC4A 3W34A 3IQDB 4L22A 3DTVA 1GITA 4HNQA 3NHZA 4BZPA 2A57A 1P4RA 2Q4RA 4J0EA 5EHGA 4AVYA 3HP1A 4J94A 4BX9A 3KXPA 1Y6QA 4KN8A 4G5HA 3FZQA 3VRHA 1XDZA 1N1GA 1W25A 2ODTX 3RVOA 2A4MA 4I50F 5G1PA 4UVGA 3VDMA 4S35A 2ZSJA 1TUIA 1QFMA 2OV3A 3KWJA 2YVAA 3TRKA 1SQ6A 4BVLA 4G63A 4W5NA 3RC7A 3EC2A 1UBCA 1IDOA 4BVJA 3J7AC 1UCFA 1YQDA 3OBIA 3MMSA 1GPDG 1MG5A 1FYVA 3PNYA 4ZV7A 2D2FA 3VO9A 3JWIA 1K8YB 2QYTA 1XEXA 1UMCA 5F33A 2CL7X 3KHKA 3UWOA 4IKOA 1XTPA 4DCSA 3UPDA 1VRCA 3DOCA 2O19A 4QTUB 1L7RA 3FOBA 5K0ZA 4JQYA 4R7TA 3W6ZA 2CEAA 3KNZA 2DR3A 1S2NA 1UH5A 1UXKA 1T91A 1NI4B 4E2XA 2R5WA 2ZANA 3JARA 5IXYA 1Z39A 4JL6A 2HBQA 1MX1A 5IJXA 1HNNA 1OGYA 1R0LA 2H4JA 2ET6A 2PFSA 3A6HA 3AR5A 2G0TA 3CISA 1HDCA 4KH1A 3INYA 2DFNA 4PWYA 4S3MA 2IXTA 4CFYA 3H3JA 1Z4LA 1AZTA 3TIGA 2CDAA 4YONB 4D4MA 1GILA 3N2KB 4UREA 4RK0A 2YXBA 3C4QA 1BAPA 1O58A 4TL8A 1RPAA 3E7PA 2I65A 3KAPA 5DN9A 1X1CA 3TLGB 4ZCMA 5BR8B 1HNXB 1BC5A 2EFHB 3LA6A 9LDBA 1IY1A 1EZ1A 2G9VA 4ZV9A 5D85A 1Y4AE 2PMEA 4PGMA 6NULA 1G60A 2WMDA 4IQ4A 1VYVA 4LRYA 2BFNA 5CXSA 4C6TB 3WAJA 2W2TA 3OU2A 1UK9A 4Y1RB 5DBHX 3KXKA 3TOVA 4EECA 1YKSA 4NU5A 1R8SA 3OQIB 1KMCA 1LTKA 2FPWA 2GHRA 4V0MA 1WF6A 3TLCA 5IWAB 3M9WA 3T1NA 4DNQA 3KQNA 4N0MA 5K0EA 3WICA 3WHLA 2BKEA 3KC2A 2R2AA 3RM3A 3VYVA 3ZTYA 5CDYA 1ORWA 1XVIA 5I51A 3HDJA 4U9HS 4EGQA 3DMYA 4JB3A 5ED0A 2VYQA 4UMDA 1H93A 1P8JA 3LUDA 4OQPA 3G9QA 1K6EA 1HWYA 3IP3A 4RPIA 4DLLA 1O94D 1YQGA 2ZBEA 1YS7A 1DZ3A 4YCDA 1JKIA 2MR6A 3LNCA 4TRJA 1PZXA 3RVQA 3WIBA 3T9BA 4OKNA 4PFKA 2G9NA 1BMFA 1JYEA 1LSJA 2VYCA 3KLBA 1G7RA 1VYHA 3GH1A 3EULA 4OMFG 2EBWA 5GM2A 1GPMA 4BMYA 3S81A 3VPXA 1B0ZA 1PEAA 4HEA6 2VRCD 1FFGA 3FJ1A 5A04A 5DEOA 3PE6A 1LPOA 2E4AA 4H7FA 4BCBA 3VOAA 5E6UA 1F51E 3L7JA 4NEGA 1G8HA 2C2GA 2IHBA 1Y8CA 1O7JA 1QLJA 1WD5A 4M9RA 2JGIA 1AKRA 2JZOA 5LDHA 2ZZMA 1TIKA 5HK9A 1W5AA 2HD4A 1ZONA 2DUJA 4DGQA 2R79A 2ZU6A 4RD3A 3UBTA 1PQUA 1Z17A 3IBTA 4C3VA 3OA2A 3QUCA 2J9RA 1Q0SA 3FPSA 1BA2A 1UT8A 5AOBA 3OLXA 2XKKA 5M5BA 1HLPA 1OREA 1SBQA 3Q2OA 4PG4A 5KQPA 3TZ6A 3U3OA 2Y99A 4IH4A 1TT5A 1GL3A 1I2DA 4WI1A 4HLQB 1TXGA 2AZMA 1CQXA 4IXMA 2IY7A 4IUBS 2Q1YA 2XRYA 4RD0A 4W5QA 1DOHA 4AL4A 5CRIA 3H8JA 4NXNB 4M89A 4Z86A 5ABPA 1KZ6A 2VNIA 1DXQA 3GO4A 3M5PA 4BXOB 3A3YA 3Q0IA 5K3FB 3C6MA 3ZS9A 5J4YA 2C77A 1AKEA 2EZ9A 2XGJA 4ER7A 4HGPA 2ZYAA 5FI0B 2HSWA 4AYWA 2FN7A 5BWCA 3NJ8A 3QI2A 1M33A 4BKMA 1A27A 4B81A 1C7QA 1CRLA 2ZJ0A 4GNRA 1VXOA 4QZVA 1DDIA 1N9GA 2J3IA 4QU9A 3SF0A 3HFGA 1UEJA 2PBFA 3IQWA 1N0VC 5KSOA 4KE6A 4URVR 1FDVA 4UOEA 3A2NA 3BEOA 1W5FA 3ZGVA 1EKXA 4S12A 2R96A 3MHPA 4IWNA 2VNJA 3L6UA 3R0JA 1U2DC 1Z3IX 1RQRA 4J0FA 1AQIA 1UDXA 2BBOA 2VZEA 4N5NA 4ADSG 4IH9A 1CG6A 1FTGA 2R9VA 4FFBA 1MT0A 1W9HA 5JDCA 1XRRA 1NR5A 2WUVA 4XI9A 1LUAA 2DULA 4KR0A 2OOKA 5FDFA 4A6XA 5K3EA 4PSKA 2O50A 3G68A 3FFWA 4MUJA 3CLHA 4C43A 5IHPA 2H85A 1EJ0A 4RJJA 5BYBA 1V8FA 4MV3A 2Q0HA 5HYVA 2M6LA 3TI9A 4Y0AA 4JBIA 3B89A 2WSIA 3V8QA 3IP1A 2V0NA 4RJ2A 1PP4A 5DH9A 5EP3A 2QN3A 3ENQA 2IS2A 4IHJB 3BGOS 3D2CA 3EGDB 3O0TA 2YFYA 1TM7E 4OFBA 4TRRA 1MQ8B 2Y1CA 3DHNA 3GGOA 1JIIA 1XZPA 1C7IA 5IM4A 3FMGA 4D4IA 5FOSA 1SFRA 3LPMA 3WVNA 2R4QA 2XNHA 3GRZA 2A9OA 4ZEOA 1JJVA 3VPBA 5EINA 3ZD7A 1E58A 5LDGA 3HO8A 3F6SA 3JYOA 2C2KA 3A9UA 1MQ9A 3AINA 5FLYA 1QBGA 3VO1A 3PC8C 1RWKA 4QPDA 1VG9B 4CG3A 4CIYA 1WR8A 2Z3WA 4U5XA 2VBFA 5LUBA 2DHQA 4ZP1A 5K3BA 1R7RA 4E7OA 4EO7A 3KJIA 5IFLA 3OFVA 2PKWA 3A6FA 1J2RA 1PGPA 3N05A 5FPPA 4CU5A 2D7JA 3L8GA 2A67A 2VCEA 2ZBGA 3DHYA 3DZIA 2PPVA 1L4YA 3C0KA 5DHQA 1XL0A 3WJ2A 4N5HX 1W19A 1Z2PX 2IT1A 4E4YA 4HAVA 4UQPA 1T8WA 3CUYA 2NOAA 3LECA 1EFCA 3L7DA 4QIHA 3TDMA 2YWDA 2XODA 3I1JA 3UAYA 5AJXA 1ECCA 3GBPA 2YY7A 5JCOA 1BKDR 1C9NA 1YJCA 4JP1A 4U2DA 4X93A 3SC6A 3F1LA 3TL6A 4BVBA 4EHAA 2G1UA 4YCLA 5CNKA 4GBMA 1A9QA 1MT3A 1X1AA 2B1RA 2C54A 4YJ3F 1XDWA 3NT4A 1TQ6A 1TA9A 3U6BA 3QMMA 1KDVA 2BGJA 1QDEA 1AA6A 1MO3A 2XGOA 1FRZA 2BGLA 4M8IA 4OSPA 2PYIA 3LX8A 1GQRA 3VU0A 2WB2A 1QZZA 5L45A 1MAUA 3IFSA 1O8CA 1YRBA 2VYFA 3TFOA 5DXAA 4FOOA 1BKYA 4LJ6A 1YR9A 4JP5A 4TLDA 4PTLA 3KQHA 4R9SA 1OBFO 2WV7A 3F3YA 3ABSB 4NESA 1YGPA 3MZ0A 2BTEA 3NHUA 2COEA 4R05A 1PJ8A 5BPHA 4F3KA 4HEJA 5EPOA 2GT1A 2A58A 4PXAA 5HIJA 4DXHA 3GJZA 1N3YA 1PR1A 4LRXA 5ALYA 3G8YA 3KCNA 3FRJA 3I0NA 1JR6A 1P7YA 3O1JC 3NW9A 1DIOB 4KXNA 1D5WA 3I0MA 5AJZA 1T8YA 1BTOA 2CHEA 1ZCBA 2XMCA 3QXSA 4IS2A 2FN8A 4JLMA 4KOAA 4LTDA 4L50A 3JQCA 3RQSA 5D7BA 4UEJA 1YDHA 4RKFA 2QX8A 1G63A 2X9QA 3QUSA 1VCIA 5FJJA 3W8NA 3CZ5A 4A91A 4FE3A 5E2BA 1LY1A 4DWOA 4OQZA 1NNLA 3LBAA 2G9QA 3EAQA 3GZNB 4Y9UA 2I6QA 3T3MB 1VB5A 1ZD8A 2BH9A 1NI4A 3W90A 1EB9A 1PT7A 2BMWA 2W2XA 1PFYA 3HDGA 2LIVA 5HF6A 3BRWD 2O4UX 3HFSA 1JT9A 1W48A 3DFMA 3V2UA 3F3SA 5LP6B 3E1KA 2RKWA 3FPLA 3NC1C 3FWPA 1VC2A 2VJKA 1Q22A 1KYWA 1RM3A 5JRDS 1AKTA 3U7IA 3VNUA 2QN9A 3PE4A 1JXQA 3TQFA 4NMXB 4S2EA 5HJ5A 4J0JA 5CM9C 2IPMA 3TCXB 3EEQA 1CHDA 3RAJA 3JD3A 1RXYA 1ZD5A 3AUSA 1QVVA 4R2IA 1FUYB 3PC7A 1PU2A 3NP9A 2Z5LA 5G4LA 3SICE 4D80A 1M0WA 4AN4A 3M4YA 4CCAA 3BSSA 3G0DA 1O5IA 4HV4A 1ZVVA 3DLTA 4R6WA 3QOWA 3WYNA 5BXQC 7ABPA 1Y3AA 3SG0A 1ODFA 1JUDA 2Q27A 1KDYA 3BE8A 4Z1OA 2FEAA 4J75A 2FR8C 5K0BA 1MVOA 2O3JA 1QH8A 1HG1A 2QJWA 3BMNA 4B1FA 3FHLA 4GF5A 2XMPA 1ZR4A 4QUIA 2A5JA 5EWLB 5AUQA 5HBRA 3LOUA 1XCGB 5HM8A 3L46A 1PG0A 1T1GA 2QIPA 1GPUA 2IIVA 1L5OA 2FRDC 3GEHA 2V7BA 3D7SA 3IHWA 4K6MA 4MICA 3TQIA 1TEVA 3QE9Y 4OATA 2H1IA 4O4HF 4F9GA 1KSFX 1PJLA 3B1KA 2GLXA 2QD3A 1HI9A 1LB1B 2YRFA 2FWNA 2GCIA 3IEIA 4OHPA 2XMSA 3HN2A 1N2CE 3A4NA 5HCNA 1TUEA 4Q9JA 3QEMA 1W4BA 1X15A 4XOUA 4O29A 3O1IC 1UPAA 1PT8A 1HQKA 5COQA 2HMSA 1PNVA 3FVRA 3I2IA 4X1IA 1KQPA 4ZT6A 3W5UA 4EQ6A 4LOKA 4CIBA 3I1IA 1R0WA 4BLUA 4YXFA 3QHAA 3B6IA 3DFKA 1RAEA 2HWUA 2K2QB 3JALA 2BFAA 2ZWPA 3NH6A 3SYLA 1K4YA 1O6FA 1UKYA 3DBLA 2HPHA 4FR5A 4URXR 2GPJA 2MDTA 3DEYX 3DDWA 4EF4A 2QJRA 5K05A 1K2VN 1YB4A 4XH9B 2N42A 2LGJA 4UEQA 2H51A 2P6NA 2R8RA 2D06A 3F4LA 4R2LA 3SXJA 3T35A 1RZRA 2F2TA 4XLZA 1WMDA 4X7PA 3QX3A 2QGZA 4JWTA 1GIAA 1KFEB 3NUQA 3JZAA 3U4IA 4PHTA 3R77A 2BFEB 2C78A 4W4TA 4WACA 1UL1X 1K5DA 4FGZA 3IPLA 1E2JA 1C1DB 2FW7A 3V9PA 3TB4A 3DV2A 2HHAA 2C4KA 2XOXA 1R6XA 3AVOA 3V00A 2Q3JA 2UUPA 4I4CA 4L28A 3UMMA 4QLAA 1CRZA 1VKRA 2YICA 4LHVA 4LOJA 2WHEA 1BCRB 3IP6A 3T7CA 1XCLA 1O57A 2XUAA 1SVKA 2KM1A 5AK6A 4EHDA 3REOA 3U80A 4GVXA 2GFIA 2JJ8A 2W2PA 3PVZA 3S1AB 1N8NA 4ZU1X 1IJFA 4J4TA 1E5DA 1M8JA 2C61A 2V5VA 4QFBA 5TPWB 5TVGA 2ZUVA 2RK4A 3DOIA 3ZLUA 2D1RA 4O2AA 2IS4A 4R40A 4C2UA 2BBSA 4G0XA 4V0NA 3FLAA 1QV6A 3GFGA 1O97C 4BTVA 4N01A 4JOQA 1VKZA 4D9NA 3TR5A 3ZC3A 5BVGA 5KQLA 1GA4A 3P2IA 4ICIA 3M0EA 3UGKA 1UKCA 1G6Q1 4CKCB 4IG9A 5BSUA 2P30A 4HWTA 4C78A 2XCRB 3R3UA 4WE3A 5D01A 5B2ZA 3PFNA 4KXQA 4NG4A 4DAOA 3ZXXA 1YUMA 4XSHA 3FF1A 4RV4A 4DUPA 5I8PA 1XMQB 2ZT5A 2P2LA 3C74A 3RYIA 3T7TA 1LBIA 5FBZA 1V8ZA 2ZB7A 2PMKA 3IT2A 4IFEA 2PR7A 4N65A 1HKUA 4QHSA 3IUPA 3HR4A 3MJFA 1P4GA 5IKEA 2HZBA 5IN4A 3GLHA 5ES4B 1WSAA 1IVYA 4WUVA 4XA8A 4N76A 3EZXA 3TI7A 2C2WA 3WO1A 1AK2A 1IB0A 1L1QA 4JLOA 2JK1A 2LD4A 2RI0A 3DWEX 4E22A 3DBOB 2LZ0A 4LE0A 5DB4A 3BX1A 1IPHA 3P96A 4W99A 5AVKA 4BO1A 1SBCA 3UM9A 4JASB 2UZ4A 4R0VA 5FI3A 1A2BA 3W2IA 3ANNA 1B0AA 2IXAA 1G64A 2HEIA 4KTVE 1YR6A 3QHQA 4RW0A 3WMWA 2OO7A 2QRUA 1XVUA 5IAJA 4DJJA 4INJA 1V39A 4MV5A 4MI3A 5GONA 2O8EB 1YRLA 2JLQA 2ZUSA 2R97A 3LQYA 1TI7A 4LK2A 1XD8A 1K7FB 2QLNA 1AUQA 9LDTA 5HZKA 4BFVA 5B3LA 2G8NA 4DT1A 4G5SA 1LBSA 4PO3X 2VZ9A 1CS0B 4RVFA 1X3LA 3CYFA 1CSEE 1TCVA 1N57A 3V8RA 4IV5A 4HMOA 2Y1EA 4M76B 1X7XB 3O75A 4EB3A 5BO5A 1Q50A 2QBYB 2NVUB 1U2PA 1Z28A 3I53A 3PS9A 3FAZA 2H9YA 4Q18A 5FPTA 4BWGA 4XQGA 5LLDA 4E31A 1HRKA 4QOIA 1GSIA 5DTEA 5JNSA 1ZMOA 5AI0A 3V4FA 1GTVA 3VR6H 5HKKD 5INTA 3A04A 2C4MA 2JJYA 4LC9A 5TLSA 3UK6A 1JQKA 1U0NA 2BKUA 4LXGA 1QZUA 1Z38A 1I6MA 1OYYA 1X9HA 4Y2HA 1JIQA 4DC9A 3E7FA 3RFUA 1Y7IA 5EXTA 3IAUA 1RHKA 2I6UA 4WY5A 4B6JA 4KRYA 1TZKA 2FP4B 1E0JA 3A2MA 4TXJA 3ZQKA 5EJ8A 3DDUA 3WFJA 3EEOA 2OFXA 4XXHA 2VEDA 3WLHA 4BB9A 4Q6WA 1TKCA 1XD9A 4GMFA 4R5MA 3H2IA 4JBGA 5TXGA 1I2BA 4JLKA 2IOYA 3EXHC 1ZI8A 1Z62A 3O73A 4RSRA 4RK5A 4OAOA 2NVUA 5KINB 3F7MA 2XYVA 2G9RA 2OCIA 5IBCA 2JIQA 3B1WA 2BGWA 2P4UA 4EHBA 5HNKA 1VGQA 5JXHA 2I2CA 4B32A 1SURA 4GPD1 4GPTA 4HWKA 5CNIA 4PHCA 5EKUA 2Q46A 2O8EA 2BCEA 1NVKA 5TDHA 3SGLA 5JO0A 2Z3ZA 4Z1MA 1T34A 1XRJA 3QPAA 4IAOA 3U13A 1URPA 2ZIEA 2ODPA 4YAJA 4BJ5A 3FJOA 4R71A 3ZGLA 3L1KA 4KX5A 5JALA 4JU8A 3ZQJA 1HXHA 2ZK7A 4C4YA 1PBNA 5D5QA 1HT2E 4FFWA 3F5FA 4OM8A 2CFIA 2ONYA 4JCCA 2HI0A 3WHKA 4EGAA 3T0GA 4OBEA 1H2WA 1Z68A 3QJ5A 3DZHA 4YJGA 3UGQA 4W5JA 4X20B 3VSCA 1Q92A 1T8RA 1SQGA 1E9BA 1DP4A 4TMTA 4D97A 1DBWA 1DIHA 1T5TA 2Z09A 3EYWA 3HCBA 2VPXA 2PGAA 2WTBA 3HU1A 4ND2A 4Y2YA 3R7DA 4B6FA 3HCDA 4V1CI 1II9A 1M7HA 4EPVA 3VJRA 2C88A 1XHLA 3EQ6A 2OGTA 3PX7A 3QW4B 3OWXA 3H9JA 4FDLA 3AONB 3MIZA 4OMUA 3RI3A 3RU9A 1F5NA 4RPHA 1UFVA 1VI2A 3RK0A 3U44A 5A0VA 3VTFA 4G37A 1QNLA 1TMKA 4OMCA 4E5UA 1N7JA 1WJGA 2NG1A 4YBZA 4BBJA 1XMVA 2KPOA 5E6RA 4DFDA 5I45A 5CIQA 5AR1A 2WWGA 1Y9JA 1RR6A 2F1OA 3OJEA 3WZMA 2H08A 4F4HA 2Q5QA 1J00A 1XTVA 5LWQA 2R68A 4GQAA 1HTBA 2Q6IA 5IDVA 1EXMA 4MQEB 1N6KA 2IZ0A 4UVDA 1FUKA 4O4IF 4EL0A 5L8VA 4RHEA 3T1HB 4C04A 3E7WA 1ZXLA 1QHEA 4I4NA 1IQ0A 2OFPA 4OGGA 3ZY3A 3G2JA 2JFQA 3D8TA 4HR7A 5K1ZA 1VA4A 2IQIA 3G1TA 1MTOA 1W30A 3S40A 2BUBA 5FUXA 1N2SA 1NXQA 1U8CB 2AWNA 4Z0NA 4L78A 1TU4A 1EFPB 1U8TA 4JA2A 4JB8A 1GPJA 3QEBZ 1QVWA 4LWZA 4UZSA 4M88A 5DZSA 1J5XA 3MVEA 1A9RA 4JXXA 2H2FA 3FTDA 3X1YA 3O8DA 4A8JB 1AQLA 1R0CA 4Z9XA 4AMUA 1KH2A 1V11B 3HB5X 1H05A 3FHTA 1UEXC 1U7WA 3JRXA 4YCSA 1HL7A 2CLCX 2YX1A 1P7WA 3FB1A 1J49A 4BS9A 4DJAA 2PNFA 2DQKA 2W2OA 3RHSA 5KQRA 1XXHE 4C4PA 5I4CA 4LOHA 3G2KA 2H4FA 4BNWA 3BXHA 1QP4A 5CCEA 3JQDA 1O87A 2R4UA 2QG9A 1C2YA 1E3JA 2GRJA 5FWXA 4U39A 1JWAB 3PXBA 4QPNA 3VU9B 5CA1F 1PGNA 4TTPA 1B8VA 1ZD1A 2QRVB 3DOUA 2PXAA 5HK8A 4O59O 3FX2A 2Y1FA 3E9MA 2XD4A 2OD2A 4JGIA 4ZVNA 4EITA 1SVIA 3K32A 2GBLA 3KG2A 3OURA 4L8FA 2YVUA 5D6OA 3ZK9A 2Z6QA 1WETA 1DU4A 1SR8A 4JJ7A 1M0SA 2H6EA 2I6FA 1TA0A 1ZXBA 5DLYA 1U6IA 2QMYA 3BWMA 1XL1A 1I94B 2O8CB 4ETIA 3QVLA 2VHYA 2V1UA 1QP7A 2QX4A 3N6VA 1XXHB 2B94A 2NU6A 3D4IA 4UTNA 4G1EB 4US1R 3RKUA 2W6OA 2Z2JA 2O8FB 1WHTB 1GGEA 4M9ZA 3O7MA 3DMTA 2JAWA 3WK7A 1DBPA 1RM5A 4KMOA 1KSHA 1G9TA 3D7LA 4H77A 4GR5A 3MRVA 4GR4A 5AKLA 2XBLA 3IB6A 2FCRA 4OB7A 2WD8A 4TLCA 4IQGA 4F4CA 1H3EA 2HBYA 3LO8A 3AEUA 3L5OA 3H5VA 4ZI7F 4BNLA 3E6AA 1WXDA 3COVA 1PNTA 3M8KA 3EIXA 4C87A 1TRHA 5IZCC 5DIZA 1I33A 4JK3A 4FYWA 4GOMD 4UVHA 1R6BX 3GP8A 2WG2A 4O4LB 3E8MA 4PCLA 3RU7A 4BKOA 1L7EA 1XKXA 4F4DA 2D2VA 2GDZA 2WIJA 2ZRCA 3AHEA 3HRHA 1ECGA 1KMIY 5C35A 2NXWA 2HN9A 1P3DA 2IEDA 4H16A 2PDAA 4KXVA 5H3LA 3IOEA 5JAQA 4R5HA 1DHTA 1G16A 2CMHA 1GUZA 1N9KA 1Q7CA 2JIRA 2EQBA 1ZGCA 2JIMA 2M1ZA 2YVQA 3FPBA 3UUGA 2WKQA 4L1KA 4IGEA 4DW8A 5JD3A 1ZAYA 3NM5A 4WV3A 4N7MA 1R5JA 4A5SA 1B15A 4I2NA 1UBGA 5LOVF 2P5SA 1IBRA 4KG7A 1ZGGA 2EFEB 3GRYA 3MLAA 4NHOA 3LOQA 3VV3A 4AROA 3ZE6A 1ZUWA 5CBPA 4FSHA 1B26A 1N5RA 5A05A 1LJ8A 2E55A 2VAPA 3HVKA 3KQYA 4F8YA 5GIOE 1L4GA 4WCDA 3AT1A 1KRHA 3SLGA 1S4MA 3CLUD 1A2OA 1Z13A 3LDFA 4FOLA 5AJUA 4RMJA 4ATNA 2O2HA 2VT7A 2ZI4A 3LCJA 3ZGYA 5CHEA 2Y0CA 4PV7A 1Y89A 3VDNB 5FOQA 1E59A 3PR3A 4WZ6A 5LZ9A 4WN9A 1AF4A 4TS9A 4TN5A 1GZ6A 2FRXA 3VHXB 4DRXB 5D3MB 4XARA 2DB3A 2FRDA 1XFAA 1NVDA 2IS1A 4OM7A 2P5TB 3O4HA 1FUIA 2CT8A 3X1WA 3D9QX 3BCRA 3HCEA 3PNBA 4DUGD 3FM9A 3V1KA 3S2ZA 4L7VA 3C6XA 2ZUDA 3A6EA 4MRNA 1NDUA 3LZCA 4A0RA 4CUZA 3W06A 3GLIB 1FA9A 3NPMA 5LQSA 1JFVA 3NIWA 1LQUA 1Z7YA 2JLRA 3PQ3A 4Z2YA 5KOHA 4BO9A 3RC2A 1UMDB 4XPIA 3VZRA 1NSFA 2VQ3A 3EY4A 1U5BB 5L9AA 3VKHA 1VI5A 1DKMA 2O2SA 2QXUA 3VMFA 1G8YA 1C50A 1YZYA 6REQA 3WLQA 4RVHA 4MGHA 1PSWA 4RSHA 4WL0A 3DTNA 1DCFA 1KC1A 2AQKA 2F64A 3FFXA 3KYJB 1RKBA 4GO1A 4Q4JB 1KQNA 3VKVA 3B6EA 3ZGOA 1F06A 4C0QC 3MAGA 4CEHA 1BQEA 1N5MA 4MHSA 4PLCA 4R2WA 4EA8A 2XKBA 3OO1A 2HYIC