3A37A

Structural insight into the membrane insertion of tail-anchored proteins by get3
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
346
structure length
313
Chain Sequence
b'VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAAADLTGSIPGIDEALSFMEVMKHIKRQEQDEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Structural insight into the membrane insertion of tail-anchored proteins by Get3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 96
structure length 313
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a37A00
1ELOA 2YKGA 2HEIA 4JLMA 1WB9A 2O8CB 1G16A 1F2TA 1Q0UA 4RCYA 3WNBA 1J7KA 2QGZA 3FTQA 2W2TA 2ZR7A 4D6PA 3SQWA 2JLVA 3FMPB 2OFOA 1PUJA 4TQAA 4KYUA 1D2MA 3A1WA 3SBEA 3AP2A 3LLMA 1ZM7A 4L15A 2ZYTX 3ICEA 2MSCB 3QVUA 4NBSA 4HI0E 1Z5ZA 4LBYA 3RC3A 121PA 4HAUA 3GLFA 1CU1A 2ZJYA 2V8OA 2WSSA 1E9AA 2EU8A 1G64A 1ODFA 3B7GA 5TY0A 1UKYA 2QUZA 3QG1A 1QHHA 1AS0A 1Q3HA 3QY0A 2C95A 2VH5R 5AJWA 5FOVA 4E09A 2TMKA 3AF0A 4ABYA 1Z6TA 2G77B 2FH5B 4V0NA 3BORA 2NPFA 5FPTA 2VEDA 3UWOA 1RVDA 2LKCA 2VHTA 4W5HA 5FBQB 2PZEA 4LC1A 4B74A 1NBME 1EK0A 2XJ9A 4DUGD 3KFVA 3CZQA 3TW4A 4WXRA 3B6EA 1KI9A 4GSYA 4UNPA 3L8ZA 3RLFA 1FL9A 4DHEA 4PQFA 2MMGA 1RRGA 4DBLC 2QROA 2QRZA 1J99A 3TSOA 5JI3E 3PR1A 4A36A 1SKQA 2RB4A 3TH5A 2D2EA 3TR0A 4AG6A 1VG0B 3U7FB 2R6DA 5FOSA 4QBGB 4QHTA 2YC2C 1OLOA 4FD2A 1G8PA 1ZNXA 3IPYA 2J7KA 3AP1A 2Q9AA 5FTKA 1G4AE 1JR3A 1M6NA 2XZLA 2RKOA 4W5WA 2O8EA 4KCGA 4GFDA 2J0VA 4MRNA 1DAGA 1E2IA 1SHKA 3VR1A 1DG3A 4M9ZA 1FX0B 4KAXA 3B60A 2CNWD 1EFHA 3VQTA 1XXHA 1PLKA 3SBDA 2IS2A 1W48A 2WAXA 1QHNA 3IEUA 1FNMA 2N46A 3DO6A 1DELA 4RD1A 1CEEA 1E2PA 1Z0DA 2CJWB 4JLVA 4XVUA 2YOHA 4FMDB 2ZTSA 4NCKA 3AKCA 3EX7C 1XU4A 2B92A 1SVIA 2QP3A 4C4PA 4M1WA 4IFEA 1MO3A 4CIDA 3HU2A 4CW7A 2NTYC 3IBGA 4JLDA 2YOGA 5FTNA 4QGFA 4IVPA 4M1YA 3T35A 4Q02A 2W6JD 2Z43A 3NH6A 1VPLA 2XNDD 1W46A 2OZEA 2VA8A 2ZS7A 3WMGA 4PAMA 1XWIA 1NJFA 4IOMA 3U2QA 1CBUA 2AFHE 4JL8A 2IYYA 5IT5A 4WZAE 2FSHA 4QBHA 4B71A 2CVHA 4NCNA 3B8HA 4ARZA 5KNDA 1E9CA 2ZRKA 4AD8A 2AKAB 2EWWA 4HUTA 1OFHA 2VHQA 3SJBA 2J3EA 4PX9A 1XEWY 5DN6D 4MUAA 4MRVA 2J0UB 4DEXA 1W47A 1GKUB 4D4KA 4BGDA 2WBLC 5FOUA 4I4LA 1L4YA 1VCOA 1G3QA 2IA5A 4ZV4A 4M9SA 1E1RA 3A58B 4DUGA 2V1XA 4A6XA 1ZM2A 2CK3D 4OYHA 4CEJB 4Q48A 1OFUX 3DKVA 4MA4A 2ATVA 1QHIA 2ZS8A 1MH1A 2ZJAA 1G7CA 5J5CA 4DDTA 1EESA 2G9NA 3NBZC 2ZYUX 3HP1A 4BRWA 2R6AA 2F6RA 1Z0FA 3D6TB 4L9WA 2AK2A 4OQXA 1KGDA 3IHLA 5HKKD 4LJ6A 5H70A 3H0KA 2N1BA 4JL5A 3LWNA 4IEEA 3V9PA 4B48A 1ZD8A 4WZ6A 1LB1B 3AVPA 1Z0KA 1LS1A 4BEBA 1NN0A 3OFND 4RVCA 1X8JA 5JSZB 2G1JA 4TMVA 2CNWA 1BMFA 2X19A 3FFBA 4HEJA 1UDXA 2AX4A 3EC2A 2OESA 4K8OA 1N6LA 4G0NA 4QJ4A 3SI7A 1A5TA 4D0LB 1HA3A 4LJ4A 3AEZA 2R65A 1OYWA 1E1QA 4CZ2A 1XCMA 4QXAA 1P7CA 3LD9A 3M6AA 4NYJR 5LB4A 3T34A 3U5ZB 3IO3A 1G7RA 4LUCA 2DHRA 1OH5A 2RGAA 5HCIA 4AURA 5FR2A 1IXRC 5TVKA 1Z29A 4NYJQ 5CLQA 4R98A 4LSGA 4WXPA 4I1UA 3TIFA 4LYJA 2GJ9A 3CH4B 2LWIA 1FP6A 1VTKA 2BKUA 1O87A 4HAVA 1XF9A 3QKSA 4F93B 3V00A 3GLGA 3QBVA 4R2HA 1N6KA 2JJ1A 4GZMA 3X1ZA 2FEOA 3C7KA 4JBYA 2J45A 1CRQA 1KAOA 1NN5A 2HLDA 4MQBA 2R44A 1CKEA 1RZ3A 3QF4A 4K81B 2PJRA 5EQTA 4IHQA 2O8FB 3KB1A 4Q7KA 1TX4B 4H1VA 4CEIB 3R8CA 2HUPA 5L3SA 3VU9A 4B3GA 1FP7A 3O8RA 5DHFA 4B73A 1LF5A 4G5GA 1Q21A 3OE7D 2JLQA 3HWSA 4UNRA 1P9WA 1YR8A 4Q4HB 1DPFA 5L3RA 2BM0A 1ZC3A 4PHHA 4B32A 2Z4SA 3PIRA 4DWJA 2GJSA 2C2HA 2Q6TA 2QMOA 4NH0A 5KNCA 5EP4A 2QAGB 2WWYA 1HQCA 1N2CE 2G0TA 1OXVA 4GP6A 3I5YA 1SZPA 1S1CA 4D0GA 3IIKA 4A82A 4Q9LA 1Q44A 4D0NA 5L3QB 2P5TB 3OFNA 4FMDF 4EPTA 4KFUA 3H1TA 3AVYA 2IC5A 2PEYA 1NP6A 2ZRHA 3W34A 4Q9HA 1M7HA 4LGMA 1KO8A 3CLVA 4AIIA 5F3WB 1OF1A 1Q1EA 2J0SA 3TBKA 2I4IA 3G0HA 2ODWA 3SHWA 1X1SA 4IFBA 1FW6A 4Q00A 3R9XA 2IYRA 1T8UA 5SZHB 2GESA 3A4NA 1ONBA 1ZNYA 4PO8A 4S2EA 4B2LA 1VCMA 3ZYCA 2FU5C 4MGYR 1N6IA 4MGZR 2WKRA 4GOXA 2GTPA 5EE3A 1KI4A 2C04A 4IOLA 3REGA 1W1WA 1S3SA 2GILA 3OIWA 1YRBA 1AQYA 1VMAA 1G1MA 5AJZA 3ZGXA 1Q1QA 3FMFA 1OXXK 5JRZA 1II8A 2W0SA 4PQRA 3UWKA 4BLPA 4GI7A 3C14C 3DEFA 1OIWA 5EXPA 1SVMA 5FR1A 4NE2A 4KSCA 4N3NA 4DKXA 2AK3A 3SNHA 1E96A 4TQUS 3P4XA 1KSGA 5HR5A 1SKYB 3FFAA 4JS0A 2VIIA 4PC6A 5FOXA 2O0KA 2R6GA 3GLIE 1CJVC 1DG1G 2CCJA 3AVWA 2A5GA 2JJ2D 1GL6A 4OBEA 1CR0A 2YWEA 1XRJA 3ZS8A 1AGRA 3U7EB 2ODBA 2W83A 2VSXA 1YHNA 2YWGA 4C0JA 1CR4A 1QVRA 3RWMB 3PFIA 5HE8A 2RGCA 1GP2A 3AH8A 3BB1A 4HB0A 1SVKA 2WJHA 1E9RA 4YONB 1COWA 4TSFA 3T1OA 4QM7A 1P60A 5BXQC 2Y8EA 2IYQA 3THOA 1ZNZA 3GP8A 2DFNA 2FJUA 1JQJC 2WWHA 2IX3A 4N0EA 4Q1AA 2HDNB 1NVUQ 4B47A 1NVWQ 3CW2A 3AVXA 1P73A 1OW3B 1QHXA 1XMSA 4I1VA 1LV7A 1R5BA 3QENA 4OL0A 4BWYA 3K8YA 3GFTA 4O25A 3UIEA 2YZ2A 5KSYA 1JB1A 4I1OA 4Q1BA 1JBKA 1Q12A 4RD0A 3D8BA 4URUR 5CYPA 2ZR0A 3B82A 1UM8A 3V4FA 1GRNA 2NO7A 5FPKA 3EA5A 1KJWA 3ZVNA 5H8WA 2J59A 1YR6A 3LRPA 3O8CA 1N6NA 2RHMA 3IDQA 3S1AA 2XZOA 5DO9A 3DOEA 3SOPA 4BZXA 1Z0JA 4DLSA 1BKDR 4DXAA 1FQJA 2RGNA 2YV5A 4NHOA 3I62A 1NSFA 4P4UA 3CX7A 4QKQA 2WVJA 3GLFE 3MAAC 1G20E 4DRZA 4PPGA 1Z3IX 1JPNA 1VG8A 2J9RA 4KLNA 3HYRA 1HUQA 4TMZA 1DBSA 5TMPA 5LD2B 4RD6A 1DVRA 4TL8A 3CR8A 3ADCA 2CL6X 1A4RA 4HB4A 2FN4A 4Q7JB 3REFA 4ASUD 4JBXA 1S96A 2JA1A 3QBTA 5JEEA 1JAHA 3PQCA 4C7OA 1KMQA 1WE2A 4A0RA 1KI1A 3VR3A 2RGNC 1Q22A 4XTCS 5FBLB 2RHDA 4F92B 1E79D 3H86A 4LHYA 2ZE6A 2QY9A 4XTRA 1ZM9A 2WTUA 1WRBA 2VBCA 1SXJD 5FBVB 2JLUA 2YNMA 2JJ2A 2CE7A 1G8YA 4F4CA 4TTRA 5KHOC 5CB6A 4HSEA 3LV8A 1I4LD 1PVOA 1M8PA 4URWR 2J46A 3FMIA 3I8XA 4LJ8A 4HAWA 1BO6A 2OXCA 3W6NA 2OHFA 3GLIB 1T5LA 2OCPA 4QM6A 4XWOA 1E4YA 1QRAA 1YZQA 1XD9A 1L8QA 3NBXX 4TQ9A 3HPRA 4ZDJA 3VAAA 3B85A 2OFXA 2ORWA 2NIPA 1KK3A 1QVAA 1MV5A 1KK2A 1JJ7A 2L0XA 1VIYA 4HB3A 1F2UB 2OAP1 5M04A 2QT0A 4YXWD 1NY5A 4MITA 4B3CA 1JR3E 5C18A 3KQLA 3K70C 3THYA 1AS3A 4DDUA 3QPWA 1G6HA 2CMKA 2PZGA 1GITA 1YR9A 3T1TA 1W2HA 4LYHA 1KKMA 4P3YA 2W2VA 4PZLA 1Q57A 3SE0A 5D3MA 4HLQB 1XXHE 3O8BA 4KXFB 4A2WA 3PUYA 5GJWC 3CX8A 2O0HA 2C98A 2WJVA 2IF0A 5CJPA 2OLKA 3ASYA 2BKEA 1E98A 5FUYA 2LCFA 1XEXB 5EZ5A 3LH5A 4OJKA 1F2TB 3VFDA 2KSQA 1LF0A 5AK0A 3DDCA 3ADBA 1T5IA 1Z06A 2QM7A 2IYLD 4M2LA 4YLGA 4GDFA 1G8HA 2OUKA 3BB4A 3K9HA 5E7IA 2AD1A 2J41A 1ZINA 1OXSC 2A5YB 3I8SA 4EPRA 3KQUA 5JJLA 3KKNA 1TNDA 5H1YA 1GL9B 3K0AB 2ZRLA 3RC8A 3K53A 2XZPA 5A0FA 3U3RA 4OHYA 5FOTA 3TLXA 3GLFB 4JLAA 1CS4C 2PL3A 4B76A 4CEHA 3G5UA 3A36A 3VMFA 5GADl 4EPYA 5AR1A 1K5GA 1UEJA 1KNQA 2C9CA 4D2IA 4OQMA 2B8WA 5CDFA 4URXR 2YWFA 5UKDA 5F98A 1QHHB 3IGFA 4IDHA 4GZLA 1WQ1R 3QQ5A 1DADA 2X77A 2G88A 3SJCA 3SYNA 1AN0A 1SQ5A 4A8JA 2ZVPX 3CPJB 3C4JA 1TEVA 1VCIA 1G3UA 3RS0A 1W5TA 4OI2A 4Q47A 4TYQA 3WHKA 3NHAA 5IK2D 5KUTA 2GEVA 3BB3A 2QTHA 4P4SA 4DZZA 5TDHA 5SZKB 3KJEA 1G21E 3LNCA 1CLUA 4B3FX 5IF9A 1Z8FA 3GLHB 5JWHA 4BZPA 4JLJA 4BEJA 4GOJA 4Q9KA 1G7TA 3GJ5A 2OBMA 1KK1A 4ON9A 2QG6A 3OIYA 4MUBA 4S35A 1RPZA 3O47A 4A2PA 4A8JC 3U7HB 3MSXA 4EPVA 1AKYA 1RYHA 4MDFA 3NEJA 1AIPA 2VPPA 3QKTA 4PPQA 2GEDA 3D3QA 4OK6A 4A0FA 4EFMA 5SZJA 1A2KC 4IVQA 1JEDA 1R2QA 4JVLA 3TW8B 1X1RA 3KKPA 3CR7A 4DLZA 1X8KA 3AF4A 4A1FA 1H8HD 4Z1MD 3PITA 4BLQA 1DAKA 4W9MC 1OB5A 2O8EB 5GVSA 4YMSA 1IN8A 1KDRA 2PX0A 1I4DD 5AWFC 1AZTA 1U8AA 3CF6R 1DAEA 5DE3A 3EIQA 3AVOA 3DMDA 5KTYA 1XXHB 1W0KD 2C77A 2VP5A 2QPAA 2DB3A 2HYDA 2V54A 3OAAA 5FOWA 2DFLA 2IWHA 4YMWA 3QXXA 4A0GA 2GK7A 3EAQA 5HZKA 1WXQA 2Q0HA 1K6MA 3TK1A 3TSZA 3GMTA 4M4SA 4TMTA 2ZI6A 4JYCA 2IXGA 4P31A 2CCKA 3I32A 4I81A 1F6BA 3FGNA 4G1UC 4UNQA 5KPJA 1UFQA 2IUUA 1W4RA 1J8YF 1R0WA 2C99A 1OHHD 3B1ZA 3K9LA 4LWZA 1JXMA 3E5HA 1CXZA 1U0JA 5BN5A 3CF2A 2P67A 3SJZA 5H68A 2ZJZA 3LAWA 2GAAA 4MYUA 4PQYA 2FA9A 2JGNA 1I2DA 4PC3A 2XXAA 4ARZB 1XD8A 4M8NE 3GEEA 1GNRA 3L0PA 3IQWA 2AFIE 4O2LA 4Z54A 3TQFA 1LY1A 1N25A 3SEAA 1QDEA 1RKBA 3UMSA 2HV8A 3I4LA 1KSJA 1RRPA 1CJMA 1QHGA 4EUNA 2HJVA 2AWOA 3IKJA 2H17A 1NNEA 4LBZA 4A0HA 1KY2A 1L7VC 3ONWA 4TLEA 4W7SA 4LPSA 5DSZA 1E94E 1E0SA 5EE1A 3H84A 5F9HA 1T3SA 1XX6A 4Q03A 3C16C 2QSZA 3AUXA 4C0LA 2YWHA 5J4YA 1S0UA 4OQFA 4XJXA 5E4FA 3VKWA 1J2JA 1G5TA 3M1IA 1P62B 3EPHA 3KUCA 4HYYA 2WJYA 3RRNA 3VX3A 1W36D 2DR3A 4C2TA 1TQ4A 3SR0A 1X6VA 4LJAA 5JJIA 1JI0A 5AUPB 2JDID 2J5XA 2GA8A 3FB4A 3QXHA 1E2KA 3LBIA 1Z22A 1ZUIA 1T91A 5FPHA 5KU1A 1ETUA 4BLOA 3DM9B 5CJ2A 4TMXA 4HLDA 5EP1A 2QP9X 3THXA 1F5NA 4W5JA 4Q4JA 1X8LA 2PJZA 1W0KA 4U02A 2DWQA 3QI2A 4RFSA 2BIFA 4GMDA 1NL3A 1ZU5A 3AUYA 4TLBA 4EDHA 1KDOA 2Z5FA 1TL7C 2PCJA 2X8AA 1TF7A 2D2FA 2IF2A 4L9SA 3T06B 5B64A 4L4UA 1EX7A 2G0NA 3I73A 2GVDC 3QG5A 4HDQB 1IOZA 2GJAA 4B3BA 1N5JA 4ZIRA 2ASEA 5KSZA 3FOZA 3LW7A 2JLRA 4LJ5A 3WRYC 4BFSA 4FIDA 5HE9A 1YZUA 1NKSA 3X1XA 5EXXA 1U90A 3Q9LA 2AXPA 3GJ7A 2F3TA 3QKSB 4KVAA 1ZIOA 1JR6A 2RMKA 3GLGB 1TTTA 3EZ6A 1U94A 1JAIA 1QBKC 1VCNA 2VP2A 4UJ3A 1TEXA 4XWKA 1VDZA 4QRHA 3L2OB 1K5DA 3GJXC 4FMCB 3TRFA 5K8TA 2GJKA 3QF4B 2D3WA 1H8EA 2KE5A 1N0WA 4GNKA 521PA 1OXUA 3AKEA 4XIGS 1VKJA 2QTVB 1RIFA 1XD2A 1DOAA 1K8RA 1ZVQA 3LXRA 2A5FA 4HB2A 2H57A 2XSZA 3B1YA 2EQBA 5C4MA 5L3SB 1HTWA 3R8FA 4DJTA 3BE4A 1IXZA 2BHRA 2REBA 2FEMA 4PPFA 1CULC 1G19A 2ANCA 2RGGA 5CIQA 1J90A 4EIWA 2O5VA 2CVFA 2ERXA 4HDOB 4QOSA 3THWA 1T0JB 5E7MA 4DLXA 2FE4A 3U4QA 4PHTA 2GETA 2WKQA 4QBIA 3NBYC 2IYVA 4ZI3A 4PTLA 2WMNB 1SGWA 4FXPA 4JT2A 1OT3A 1A82A 4QJ5A 1RRFA 1P2SA 2FV8A 2QN6A 2AN9A 2OLJA 4JLOA 1MO4A 1W36C 4BLSA 4JLNA 2JCSA 2WPDD 2AHOA 2AL7A 2ANBA 2WICA 1W5SA 3B13B 2FG5A 1ZM4A 2GJ8A 2GXQA 2CHGA 2NPIA 2ZRJA 3F3YA 2P65A 4BFTA 4WZBE 1GNQA 4KFTA 2XITA 1O3YA 2J87A 1ZC4A 3QPUA 4PZYA 3AVTA 4TZ0A 5CK5A 1R10A 3W8RA 4BFWA 1NJGA 1ZAKA 3GJ6A 4JT4A 2XX3A 2XOKD 1II8B 4QC2A 2VP6A 4F38A 1XTQA 1IN6A 4PO9A 1FFHA 2IXEA 2IYWA 4DSUA 721PA 3CWQA 3AKYA 4G5OA 2JLWA 4B6EA 3K9GA 3RDPA 4U7DA 1KHTA 2OO7A 4RJLA 4LCBA 3A4MA 2EFHB 3TUJC 3DPUA 3NG1A 2O8BA 2ZE8A 1N6OA 3OHMA 4NKRA 5DI3A 1MRSA 4UJ5A 2QAJA 3K0SA 1U8YA 2FF7A 2FNAA 3KQHA 3B1WA 3WXMA 2H1LA 3VR5A 1DS6A 1N5KA 3BXZA 3HJNA 3QXCA 4QFMA 5HCNA 1ZCBA 3NEYA 1E2NA 3OEHD 4V0MA 3MUFA 3A8TA 4LOAA 1P72A 3ZIAD 5FUVA 4IOJA 2ZSFA 1U81A 4KYIB 1OYYA 2PZFA 3MWKA 4U00A 4EPWA 1KO5A 4MDEA 1J8MF 4TMWA 1G5RA 1JXOA 1E2JA 2BMJA 2GXAA 1GWNA 1HV8A 2ZYWX 1ZM3A 1N0UA 1OE0A 1MR3F 1N0VC 4OQNA 4TL9A 4EPXA 1H65A 1KDTA 1Z83A 2F9LA 2IS4A 3FHTA 1DO0A 4ACAA 3BFKA 1CJKC 2WPDA 2QE7D 1GSIA 1EFRD 2BMEA 3C5HA 1GFIA 2W6JA 3MWYW 2YHSA 2V6JA 2XNDA 4G3XA 4Q4LA 1B0UA 4AC9A 1J70A 1OH6A 4TYYA 1NY6A 2F43B 3VX4A 3Q72A 1E0AA 2QL6A 3U3MA 1XPRA 4FMCF 3NBFA 1Z28A 2GEUA 2V6IA 3KQNA 1U99A 2SHKA 4PANA 1CJTC 5CDFE 3CWZA 3FYHA 5DN6A 3SQXA 4BFXA 4XD7D 3VKHA 2OT3B 4GT1A 2ZE7A 3CNLA 2YOFA 1DO2A 3GJ8A 1ZIPA 4C7OB 2CK3A 3BERA 1UKZA 5JS7A 5FTJA 5AUOB 3CB4A 3GQBA 3ZD6A 1G9XA 4DDVA 1RFLA 3Q85A 1IY1A 4UNNA 2HJGA 3U44A 1MKYA 4WIAA 1GKYA 4Q5IA 2JLSA 4TTPA 3E1SA 3KDSE 5JHHB 2AD5A 4DLYA 1KSFX 1Z47A 3W3AA 4OK3A 2R8RA 4R71A 1NMYA 3LX5A 5HKKA 3K70B 5E95A 2D62A 2Q21A 3AM1A 2ZSAA 2NQ2C 2PCLA 3H4MA 2QI9C 4GL2A 2DYKA 3AQ4A 3UG6A 1NBMD 4TLDA 3OEHA 1FPMA 2C5LA 4FMBB 1V43A 3ZIAA 1KO4A 1YZNA 4EAQA 3EXAA 4L16A 1XTKA 1W7AA 3RABA 2BDTA 2ECKA 1OV4A 2P6NA 2VO1A 4M1TA 5D3QA 3THYB 4IXNA 1M1YE 3KQKA 2GCPA 3RRZA 3B5JA 2H16A 2QQEA 2Z4RA 4B2IA 4WVFA 2QT1A 4OHWA 4NZYA 4QGGA 4RZUA 2F55A 3IIJA 3X1WA 2QENA 3NC0C 5D3MB 4R7ZA 1KIMA 4E03A 3VR2A 1KMHB 1KY3A 4XOIA 2Z0MA 1A2BA 5CB8A 1TMKA 5EE5B 4PXAA 2G6BA 2QTFA 4C0SA 4BECA 3ZH9B 4AKGA 3M4YA 4P32A 4H9GA 3DMNA 1EXMA 1M34E 2WWXA 3GJ0A 1YRAA 4JIMA 5FPSA 1KSHA 4UXHA 5IHPA 1E2QA 1FTNA 2OFWA 2UVQA 1KZ7B 4KHZA 2BV3A 4TMKA 1MT0A 1U9IA 5GVRA 4M1SA 4Q1FA 2QU8A 2MSEB 1OIVA 3A6PC 5KPDA 3B1XA 1NMZA 2C78A 1RJ9A 1UF9A 1QHSA 1GRQA 5TV2A 1IXSB 2EWVA 1II0A 1L4UA 1NN3A 4DLRA 1EWQA 4B3XA 4DSTA 4DSNA 1GG2A 3I1FA 3KXIA 2PEZA 2CL0X 4L8GA 5J40A 2AXNA 1YZTA 4Y0AA 4CEHB 1FUKA 2Z83A 2GAOA 2RGBA 5BQ5A 2FSFA 2OCAA 2OM2A 3N2EA 4B43A 5F9FA 2VLIA 1YJ5A 4BFUA 1XJCA 1QG2A 1U9IC 3FDIA 1IQPA 3B2EA 5DIFA 3VNUA 3OE7A 3NIBA 1QHYA 1BH2A 4JSTA 3U7GA 4A8JB 4D4LA 4NYIQ 3KJHA 4C0BA 2DCUA 1B23P 4PFSA 1CP2A 1T4GA 5L8VA 3AVQA 5IDVA 4A6PA 4BLTA 4AI6A 1D9XA 1DTSA 4LHVA 2WWGA 4JKIA 4QJ3A 4TZ6A 5ELXA 2GBLA 3OF5A 4P4SB 3JVUA 2QRNA 3I3SR 2F9MA 2FSIA 4UXIA 4GBMA 3HDTA 1W4AA 3LXXA 1QG4A 1IN7A 3FPAA 3PV0A 2FPMA 2WJGA 4IEIA 3W5JA 3ZZ0A 3QSYA 1LVGA 1KI6A 3WNCA 4AKEA 3QKRA 1DE0A 1P9RA 4HZUA 4KJZA 1UJ2A 2VSFA 2QP4A 4RY2A 2EVWX 2FFBA 4AYTA 2B7BA 5DHAA 3RS4A 4C0KA 5JWOA 2GBLC 1HY3A 3OEED 3UMRA 1W4BA 5LB2A 2ZVQX 3MMPA 2EYQA 2IW3A 1GTVA 4DT1A 3P4YA 4IRUB 4L5BA 3TAUA 3Q5EA 4ACBA 3CO5A 4OI1A 3RYTC 3LLUA 421PA 1S9DA 3UKDA 1E2FA 2ZJ8A 4PR0A 1VECA 1TQ6A 1XMIA 4TT3D 1FMJA 1DAFA 2B21A 5BN4A 2QZ4A 3K0FA 8OHMA 1RC8A 2WM9B 4O0MA 4D26A 1AZSC 3QUSA 3HYTA 4QNMA 1P3JA 4BZQA 1EG7A 4HAYA 3UPUA 1FZQA 2CCGA 4H1UA 1OH7A 2Q9CA 3JZAA 1E2LA 2C96A 3SU8A 1TAGA 2FFHA 2O8DA 2GWHA 2BBTA 4AKHA 4XVQA 3T61A 1AS2A 1Z07A 1ZRHA 4AY2A 2O8FA 4E22A 1G3RA 3QNUA 3MRSA 1GVNB 1XMJA 1JNYA 1T9HA 2GNOA 2XXAB 2JLYA 1IAQA 2ZS9A 1R8QA 2J0QA 1ZUNB 3RNLA 3IUYA 3EZ7A 1XTSA 3VR6A 4FWTA 1Z6YA 3FWYA 2OV2A 2D74A 3BH7A 2REXB 3CNNA 3P26A 2UZIR 3F5FA 4F7WA 1ZP6A 4P0TA 2BEKA 3NHBA 1XJ0A 3OZXA 3PCRB 4PC1A 2QAGA 1S9HA 2WSMA 3LO5A 1KI3A 3GEIA 2VSOA 2NO1A 5DH9A 5KNBA 4RKEA 5L3QA 2OEPA 1U2RA 3K0CA 4IOKA 4KBGA 5A5GA 3JZMA 2RGXA 3N5CA 1E6CA 2HT6A 2ORIA 4RFVA 4AWXA 2IEYA 2ZXUA 3I92A 1VG1A 5B30A 4E5UA 1XEWX 4KVGA 1GOTA 3HR7A 3MLEA 1ZJ6A 5EE9A 2FGKA 3KTAA 4LY6A 1E2EA 1R7RA 2GCOA 1R4AA 4FINA 3ZQ6A 1Q3TA 1L2TA 4DSOA 2QAGC 4UXJA 1OKKD 3THXB 4US1R 4TYWA 1VG9B 2FSGA 2OCBA 4Q4JB 5FL3A 2NOAA 3K0CC 5EUQB 4ASUA 1GDDA 2V7QD 2EYUA 2ZJ5A 4G5QA 1AKEA 4KBFA 3WMEA 1E0KA 4QBFA 2KB0A 4TT3A 3MJRA 5EXTA 1FNNA 3EARA 4IVRA 3H2YA 4IKEA 1E79A 3RSOA 5EP3A 1ZD1A 2KBFA 5J4VA 2A5JA 1SXJA 2CHQA 2ZSBA 4HAZA 2ZRMA 1C1YA 4ZCIA 5C4GB 2KWIA 3O8DA 4ZIRB 1KO1A 3FKQA 1TF5A 1UBEA 3BWDD 4BFZA 221PA 1VYUA 1EFUA 5CYOA 3JVVA 1WMSA 4OK5A 1HH4A 4OQLA 2NO6A 4DB2A 4IDPA 1NIJA 4RZXA 2WIBA 4ILEA 2XEXA 4V02A 2JASA 1NI3A 3CM0A 5FL7D 1FQKA 5G3YA 1SXJC 4Q1CA 4LJYA 2IT1A 2YINC 1MO6A 3EPKA 3D31A 4YXWA 1W0JD 4MH0R 4Q7MB 4C2UA 1XD2B 1XNJA 3I5XA 4V0ME 4M53A 3VTKA 5CM8B 3TUIC 3A1UA 5K8LA 4EJSA 3DZ8A 2AKYA 1UBFA 3OIUA 2ZRAA 3TJZA 4HUQA 4M9QA 4TLCA 2J7PD 5FUWA 3SFZA 4Q7LA 1IM2A 4YQFA 1XB2A 2QPTA 5FTMA 1EGAA 1T8TA 3AGQA 3NXSA 2OILA 1N5LA 2W6ID 3FKSD 3BGWA 2ZAOA 4YDHB 2HCJB 2BMFA 3A1SA 3CPHA 1MRNA 1BYUA 4KO8A 2ZRDA 2XNSA 5EE0A 3ADDA 1UDWA 3THWB 1WA5A 2ZU6A 1GKIA 2JLZA 3EWAA 4JVMA 3QEOA 4URZR 3KXKA 3G82C 1M2OB 4PC2A 2VP4A 4EJSC 3U4QB 2WWWA 3T1VA 1NF3A 3NKVA 4LRWA 3U3JA 1ESMA 3X1DA 3AF2A 2ZANA 3PENA 4KU4A 2GRJA 2VL7A 3PJRA 1MABA 2HF9A 1IJFA 3QOFA 2WHXA 2JAQA 3SZRA 3LX8A 3ZD7A 3ZVMA 2C8VA 1ANKA 5E3HA 4ZCLA 4DLUA 3NVAA 3EIEA 2VP0A 3WRXC 1PZNA 2KBEA 3CZPA 3MFYA 4HZIA 1KAGA 4OHVA 1UEIA 3CKLA 3LQRA 2A5DA 2WSSD 2YC4C 2BOVA 3LDAA 4LX0A 4NYMQ 1R0ZA 5FBRB 3VHXA 2ONJA 4BUJA 5KDDA 1D2EA 1E99A 5K8UA 3IPXA 4OI4A 4YC7A 5IK2A 3EZ2A 4BASA 1E9EA 4NCHA 4IXMA 2GDJA 5FI0B 5LD2C 3VNVA 1LNZA 2BCJQ 2P3SA 1QF9A 3GJ3A 1OFTA 4IW3B 1GAJA 1DARA 2EFGA 2ZRPA 1SVOA 3B9PA 1XMVA 4OKSA 4X8HA 4D4MA 4Z8XA 1VYTA 2QBYA 5JJKA 3DZDA 3GD7A 3C41J 3U6BA 2D7CA 5CLLA 3BAFA 4KLZA 1RW4A 2V55B 3BH0A 4HAXA 3BFVA 1YVDA 4YMVA 4Q9JA 3NH9A 1SULA 1W0JA 1G17A 2O8BB 2ZPTX 4FN5A 4B3DA 1DAHA 5FI1B 4B33A 4EQ6A 4PPNA 2FX3A 5DI3B 1U8ZA 1HQYE 2PH1A 3L0IB 4C0QC 1W2GA 4ESHA 1KI7A 4QL3A 5B58C 4LBWA 3CH5A 1UBGA 5JCPA 4Z51A 2GZDA 3CBQA 1AM4D 2OSBA 2RCNA 4N0DA 2VF7A 3T5DA 3B9QA 4IDQA 2P2LA 4ERNA 1H8HA 4Z1MA 1HE8B 3WHLA 6Q21A 4US0R 2G3YA 1XBTA 3TQCA 2VF8A 3TVTA 2UKDA 3UANA 2JEOA 5GJCA 2A30A 4BRUA 4I1SA 3PEYA 3MWJA 5FFMA 1WBBA 4DCSA 1JR3D 1IHUA 3ETLA 2D7DA 1XEXA 3AF3A 4YDSA 3TR5A 4POAA 5DLQC 3TVDA 2QA5A 2V9PA 2ZJBA 4EKDA 1E0JA 4PC7A 4Q01A 3DHWC 3TKLA 4M22A 4PAQA 3ZVLA 3F0TA 2GZAA 3W3ZB 3FVQA 2VYFA 2ZQ5A 5G41A 2ORVA 3RS7A 3TGPA 2R9VA 1OHHA 4IJMA 1R0XA 3HU3A 3K0AA 2H5EA 3L8YA 4FCVA 1TQDA 2F1RA 3KX2A 3HR8A 2LKDA 4DIDA 3R7WA 4BQSA 4JBWA 2J1LA 4DCNA 4I99A 5E7JA 1Z6AA 3P1JA 1D5CA 2WKPA 4DVGA 5HZHA 4HATA 2E87A 5DNYB 4KSBA 2A2ZA 1D2NA 4ZKDA 5JRJA 4MYHA 3EPJA 1IY0A 2XTZA 4G5RA 3A1VA 2ZRFA 3L0SA 5LBIA 3W8NA 3PUVA 1JJVA 4Q4AA 3CIOA 3PVSA 4RKFA 2H92A 3AP3A 3OESA 1MOZA 1CIPA 3C8UA 3LA6A 2CHVA 4O2RA 1F48A 5F2EA 4NL4H 3VU9B 5AUNB 3U44B 3QVVA 1E1RD 3EASA 3SS8A 3GLHA 4MKFA 3X2SA 4MYCA 2R6CA 4WW0A 2IXFA 2PT5A 2XB2A 2ZI4A 2ZJOA 1UKEA 2FZ4A 4NPHA 2XB4A 2NZJA 1G4UR 5EUMA 5TXGA 1AA9A 1XJQA 2AR7A 4C30A 1D8TA 2JDIA 1UADA 4LHXA 4QHYA 2R6FA 4R9UC 2F3RA 3C5CA 2UZ3A 2IYTA 1XTJA 1OJLA 3UXMA 2F1IA 2A3RA 2DFTA 3QKUA 4LHZA 2VRWA 4GPTA 1US8A 3BIFA 1TADA 4U5XA 2V4ZA 2VHJA 4B34A 1NN1A 2FGJA 1N6HA 2IL1A 4PSVA 3QE0A 5FUXA 3GFPA 4XSGA 4E07A 1TUIA 1E9SA 1OB2A 2KJQA 1TU3A 2MSDB 1BMFD 2ZUCA 3B1VA 2QEQA 2FZLA 2RGEA 4NP6A 4OHXA 1Z6XA 3TMKA 4NCIA 4GRAA 2QMHA 2IS6A 4TN1A 4Q1DA 1M7GA 3L43A 4FWIB 1TUEA 2HT1A 1I2MA 1R6BX 2ZRIA 4KITB 3GPLA 5AUQA 1ZW6A 1F60A 4ZCMA 5JEDA 4DC9A 1E1QD 1E9FA 3MD0A 3PEWA 4M0LA 5DISB 5KO2A 4AYWA 1KJZA 3VR4A 1NSTA 1OPXA 3MJHA 1P9NA 4Q21A 2GCNA 4LHWA 1TF2A 3HPQA 3EC1A 5KDOA 1AK2A 1NMXA 5KSOA 1E2MA 1Q20A 4MKHA 4A92A 3WBKA 5JZVA 1RJ9B 2N42A 1ZU4A 2BM1A 1D9ZA 2WJIA 2R62A 1BYIA 5FBWB 1YU9A 2X1VA 3RVBA 4CVNA 621PA 4AKIA 2W2XA 3RRMA 2JJ1D 3QXSA 4JLKA 1CF4A 4G01B 4US2R 1IN5A 3BRWD 4LJ7A 2HLDD 2RAPA 1R0YA 4IDNA 1SVSA 4JLBA 1G3MA 4JZKA 3KKOA 2ZRBA 2BWJA 2RH5A 3DM5A 2EFDB 3GFOA 3EWSA 4URVR 4DLWA 4BFVA 3R9WA 4TWZA 4MRSA 4DCTA 4MGKR 1LFDB 1G5PA 1JPJA 4LZZA 1LS6A 5P21A 3ZVRA 5C2JB 1KOFA 3EZFA 4ZDWA 2O0JA 2DWPA 4QG7A 4NCJA 3MG9A 4PSAA 3PEVA 2GHIA 1G6OA 1OXTA 2JIZD 1QZXA 1U0LA 2IEZA 2QGNA 2ZRGA 3PG5A 1PLLA 3Q5DA 1KNXA 4UQOA 2ZI7A 4ZO4A 2C9YA 2GXUA 4ZI2A 2NMVA 2VHCA 2O8CA 1UPTA 3WYAA 4MRRA 4D80A 2NG1A 3MGCA 2I1QA 1GIAA 1KI6B 1U0HC 1BS1A 3R9IA 5BWMA 1E4VA 3AB3A 1T6NA 3QKRB 2P6UA 3BK7A 3LVQE 4HZUB 3TNFA 4DCUA 1YE8A 1YZGA 4N1AA 4BLRA 3W6OA 3S1AB 3KJIA 4NMMA 3SDZA 1KK0A 1ZUHA 3T12A 3ZDQA 2EFCB 4LV6A 2YJTD 3P27A 1NVXQ 4PHFA 1LW7A 3RRYA 1N3BA 1CTQA 3P20A 2F1JA 3N2IA 4DT1B 1KZGB 2XJ4A 4A9AA 4TLAA 2XOKA 4JJKA 4QGAA 3J81k 3TSWA 4GP7A 1SXJE 2DBYA 2CLSA 2VTKA 2A9KA 1FMLA 3GEHA 4JVSB 1Z2CA 1SKYE 1Z6GA 3W5IA 1IN4A 3WMFA 4R2IA 2OAQ1 2ZUBA 4BPBA 2DFKB 3K0FB 1V5WA 1YKSA 4LDJA 2ODEA 5G53C 3U61B 4B2PA 1DAIA 4B35A 1DEKA 2IYZA 3L82B 3W9YA 3K09A 2P0EA 3KUDA 1OSNA 1HURA 1Z2AA 2PBRA 1PV4A 2O8DB 2EFEB 2WZQA 1RYFA 3R20A 1S3GA 2F1HA 2ZAMA 3QF7A 3NC1C 2BVNA 2I3BA 4RD3A 3LFUA 4CGZA 1AJEA 2ZSDA 2P6RA 5K8IA 3QJYA 3PUWA 2HYIC 5JWRA 1U98A 1C9KA 3RSLA 5C46F 4Q9IA 3WP0A 2WOOA 2VP9A 2HF8A 2IBMA 3GJ4A 5FPYA 4Q66C 2JIZA 3K09C 1COWD 4TSFD 4O3MA 4DLTA 4Z8YA 2BBSA 2X2FA 5AJVB 2ZUDA 1XZQA 1FX0A 4OJQA 4FI3C 3DKPA 3LBNA 4QHSA 3W6PA 2FMXA 5FTLA 1G7SA 5J4LA 1NRJB 3SYLA 1S1MA 1P2TA 3TAHA 2QORA 3TUZC 2G83A 2QE7A 1EFRA 2H8KA 2CJWA 4M21A 4AG5A 3AGPA 3Q8XB 2NZ8A 4M9XA 4BFYA 2BBWA 2CXXA 3PUXA 1GZSA 4BE7B 3SHFA 4P33A 1KO7A 3DOFA 3EG5A 2YVUA 4LI0A 5ANRB 3ZLJA 2CEAA 3KTAB 3L0OA 1Y3AA 2GCOB 3NDPA 821PA 4RSGA 3LW8A 4YMTA 4NTZA 2QPOA 4CYMA 1P6XA 5EZ6B 3SN6A 2W58A 2B7CA 3QXJA 4MKIA 2ZETA 4C9BA 1NLFA 1XCGB 4XD7A 1UKVY 4XVRA 1NKTA 4WBSA 1E32A 2C03A 2IYXA 3RWOA 4Q18A 1SHZA 2KI5A 2XAUA 4LV8B 5G40A 2BCGY 3RS5A 3UK6A 1GUAA 2WAYA 3RS3A 3WYGA 3HU1A 3ICQB 4HLCA 4UKDA 1IBRA 2J0UA 4PSKA 5TARA 4NYIR 3B78A 1Z0AA 4WA7A 5JMTA 3IO5A 4JL6A 1TU4A 1X86B 1SXJB 4F91B 1ZCAA 4LPKA 4CEJA 2A78A 1FOEB 1NLZA 3F8TA 3FHCB 1XFAA 3T15A 2CDNA 4KFSA 4LYFA 1MO5A 5J47A 4WAUA 3EPLA 1SVWA 4QNRA 2ZRNA 4WOPA 1Z0IA 3IQXA 4JSYA 1NBMA 1A1VA 1GNPA 3MWLA 2OBNA 2B8TA 3ECCA 1KKLA 1XZPA 4V03A 1CR2A 3I72A 4TL6A 1M7BA 3K70D 2FPLA 2GK6A 2ZYVX 3VKGA 1IY2A 2HXSA 4LV5B 1R5NA 2QQ0A 1JQLB 2ZITA 3SYKA 3CF0A 1JEEA 1IJEA 3E2IA 1S4QA 2DPXA 1F3OA 3KB2A 4AK9A 5JSZA 2PX3A 3OIVA 5KYKA 2ZRCA 4EJSB 1ZD9A 3BH6A 3BS4A 5IRCD 4HUQB 3KKQA 4M1KA 4X8OA 3KJGA 3TE6A 3W90A 2ZJ2A 1S2MA 1KTVA 1EX6A 1NVVR 1R8SA 1OH8A 1AGPA 1YZLA 1KJYA 4JJZA 1HEIA 4JLPA 2DY1A 1BIFA 2NGRA 4UNSA 1Q1ZA 3CRQA 4XSHA 1NVVQ 1P5ZB 2IHYA 4J0QA 4JYBA 4K46A 2ZEJA 1NIPA 3KKMA 4FCTA 1N6RA 5KOYA 5JECA 1X3SA 2GXSA 2C9OA 1P2UA 4PAOA 4CF7A 1I4TD 2F43A 1AQUA 2V1UA 4V0KA 1JECA 1NLYA 3AF1A 4ITRC 2V3CC 2BEJA 1WF3A 1E2HA 3BOSA 3KXLA 3VHLB 4CT5A 2IHBA 2EW1A 1MABB 1W4CA 1NG1A 3PUZA 1E9BA 4DEYA 3A37A 4A15A 3IBYA 1P4SA 2WIAA 1WP9A 2XTNA 4DLVA 3A4LA 1W49A 4M1OA 2FFQA 2ZE5A 3SFVA 3K0EA 3FHOA 4RD2A 5SZIA 4C3ZA 1G41A 5BYKA 4ZKEA 2Z6VA 1VHTA 4URYR 5KDLA 4OI0A 3V4RA 4CEIA 4HLUA 1T3HA 1E9DA 2ERYA 1XCPA 2GZHA 3BJIC 2ZREA 4PO1A 4MYTA 3A1TA 1OIXA 5AJYA 5JI2E 4TTQA 5TB5A 4CDGA 2RGDA 2PMDA 4NU0A 1E2DA 2WMOB 2FWRA 3GLHE 3CRVA 3LBHA 2E1RA 5CK4A 2IUSA 2E9SA 2OXRA 4Q4HA 5JHGB 3WP1B 4PHGA 2ZIAA 3AV0B 3CX6A 2QBYB 3BBPA 5AJXA 2QM8A 3N70A 1UBCA 3IIMA 3T5GA 1PUIA 1W44A 3ZQJA 2FPKA 3Q3JB 4HLUC 1R5OA 3GCGA 4KI0A 4DIEA 2R2AA 4EQ6B 1T0HB 3Q7PA 4RZ3A 3BC1A 3WY9A 3U3KA 4A4DA 4Y0VA 5JCZA 1YR7A 2GKSA 1G8FA 5A4JA 3RAPR 2PT7A 1KI8A 2CLCX 3OEEA 2GF0A 2G1KA 1C4OA 3C15C 4P4TA 5CM9C 3ZZUA 4D82A 2Q3FA 4NDZA 2H7VA 2MMCA 2Q3HA 1G8GA 1HT2E 2ATXA 1P2VA 2NO9A 5BYJA 3E70C 4LBVA 3ADKA 1M74A 3CRW1 4GOKA 3NDBB 4FCWA 1EFTA 2QNRA 1OFIA 4A2QA 3QPVA 1D6JA 1KMHA 1HT1E 1NG9A 3BFXA 3UG7A 2NO0A 4ZPXA 3MCAA 4OHZA 1WBDA 2W0MA 1ZMXA 1A7JA 2Q9BA 2CL7X 4RFSB 2FDCA 3EZ9A 1G3IA 5BN3A 2PMKA 2IUTA 2ZI3A 1GL7A 1XPUA 2ZI9A 3U6KA 3IEVA 5CITA 5GJBA 1KI2A 3CRMA 2AWNA 4KODA 4LK2A 3OAAD 4Q19A 4EFLA 1CRPA 2QMUA 4PZZA 1G18A 2WOJA 2IK8A 3QIAA 5EJEA 3AVVA 3NTUA 2H18A 1E69A 3SC3A 3UMFA 4B75A 3ND9A 1YZKA 4Q1EA 4FW9A 4B6FA 1VYVA 4NONA 4RD4A 3RHFA 3KZ1E 4GMXA 2OBLA 3PEUA 1GRRA 2PLFA 2X2EA 2FOLA 3R7WB 2D06A 3IHWA 3Q7QA 2FFAA 3PXGA 1XPOA 4V0LA 3RANA 2JJ8A 2BC9A 3RS2A 1VIAA 2WJJA 3ASZA 4F4JA 4YMUA 1KYIA 4TYPA 1T3LA 2IYSA 3I61A 5BW8A 3U3OA 3ND8A 4D4JA 3X1YA 2DWOA 1BOFA 4ZDIA 2ZR9A 4RCZA 1ZNWA 4Q4AB 3WBJA 3LY5A 3KFXA 5EP2A 5JFGA 4DB4A 1TPZA 2CBZA 3FMOB 3T1QA 3ZZTA 2HXYA 1Z08A 2ZU0C 4DDWA 4JVNA 5KSPA 4ESVA 3EA0A 5B2ZA 1N6PA 1XTIA 1YQTA 2HCBA 1E3MA 2XGJA 2YYZA 1JALA 3ZS9A 1W36B 5HTKA 1E2GA 4TYNA 2I1VB 2OE2A 5JS8A 5DGXA 2VQSA 2WV9A 2ZM5A 1S8FA 2IWRA 1EFCA 2ONKA 3DVLA 1PJRA 3BD9A 4IDOA 4M1MA 1OKKA 1Y63A 4XH9B 2WWIA 1GM5A 2W00A 5DI9A 1FTSA 1WDTA 1P61B 4MKGA 2O52A 3ZJYA 4C0AC 1PLJA 1US8B 2D4HA 2V7QA 3SJAA 2IS1A 3AVUA 4RZ2A 3QEJA 4LYAA 1FUUA 2JATA 4G5SA 2VHUA 3WNDA 1ESNA 1ZBDA 3CUEF 2ZI5A 3CONA 1N5IA 2GVZC 3FE2A 4II7A 4NYMR 4X8MA 5JBQA 5LPNA 4JKYA 1EWRA 2GF9A 4F4IA 2ZSEA 4D81A 3LQQA 4DCVA 3KL4A 4EFNA 3P32A 4X8LA 1VHLA 1GILA 1ZYUA 1P75A 3CRRA 4CRWB 3UATA 2BJVA 5EXSA 1XEFA 5GJVC 4D25A 2CE2X 4LC0A 3GLGE 1WCV1 2ZROA 2ODNA 1RE0A 5B57C 1HYQA 3D7MA 1UAAA 1G291 4MRPA 1XP8A 4CT4B 5L3VA 4HDCA 1Z63A 2BBOA 4V0OA 1CJUC 3LVRE 5FL7A 3EIHA 4AYXA 2Q3MA 3NWJA 5DYIA 2OG2A 4LJ9A 5FH9A 3GLIA 1LTQA 4ZDKA 5LDDC 1IONA 5JLJA 2BMDA 1HE1C 2REOA 3WYFA 3CNOA 1CR1A 1XDBA 5CIWA 2XTMA 4QGHA 4C0HA 2J7PA 3U60B 1F2UA 2WWFA 1SVLA 2JLXA 1H8ED 2B6HA 1II9A 4MGIR 5J4HA 4KV9A 3AKDA 3IILA 2W6IA 3K1JA 3FKSA 2BJWA 4XWAA 2PLRA 2A7QA 2CLDX 5J4KA 2OCYC 2QMEA 2XSZD 3M0EA 1RRCA 2K5UA 5C1BA 3EW9A 1KDPA 3CPEA 5DYGA 2IYUA 4TL7A 5G3ZA 2QSYA 4JMPA 4B44A 3K9NA 1TQ2A 1XTRA 5HPYB 2P5SA 3DL0A 1DAMA 1Q1BA 4KFRA 2F7SA
chains in the Genus database with same CATH superfamily
2PFGA 4WD3A 2YKGA 1WB9A 4QVGA 2Q6KA 3WIEA 2CLEB 3CE6A 4RCYA 2QGZA 4H0CA 3INYA 3E05A 2NYUA 2O57A 2OFOA 3FMPB 2HD4A 1U9CA 1P8JA 2AGVA 4JZYA 4P4LA 5EZSA 4C05A 4B9AA 4MW9A 2ASVA 3ICEA 1X74A 1J06A 2ZK7A 1XU7A 4LBYA 1QC5A 4MZDA 1NDHA 2CUZA 1CU1A 3DAFA 1VKNA 4KQMA 4RF4A 4XB2A 3DB1A 4PRKA 4C0XA 2OQ2A 4R1LA 2QM3A 3IUNA 3LSYA 2W71A 2YIMA 1TECE 3HRIA 3SKXA 2N3ZA 3B7GA 5TY0A 1IG3A 4Y6OA 4B84A 2Q2VA 1YDWA 1NVEA 3CLRC 2ODPA 1L9XA 1T4CB 4R3WA 2C95A 2VH5R 3PX2A 4MZXA 5FOVA 3RJTA 4JI3B 2PLNA 3SIWA 4L73A 2TMKA 2XNJA 4U3JB 7GPBA 4I1PA 1U3DA 1Q83A 2PR2A 2GUWA 1HE3A 4P93A 1EFAA 3O0DA 1DLJA 1E18A 2GZ1A 4C5AA 4DMKA 1XZAA 3WKEA 2XDWA 1RVDA 2LKCA 2OLEA 4OSPA 6ADHA 1Y1SA 3CGGA 3UPDA 3RIGA 4A91A 1DV2A 2LZ0A 5H9WA 5GOTA 3EWNA 1Q3KA 3TW4A 3WGQA 2OHXA 3GEGA 4GSYA 3L8ZA 3RLFA 3IA2A 3H6KA 1V7PC 4NNOA 4PQFA 1P0PA 1GAEO 4JIGA 2AMVA 2PIAA 3OCZA 2O6LA 3C87A 3Q8MA 1YS6A 3SLRA 4N6GA 3U5TA 1IZ9A 4JI6B 2EZ8A 3W1VA 3HKCB 3ROKA 1E3DA 2R6DA 3LLCA 4CCSA 2G9QA 1WVGA 4TV8F 4A8HA 1OGJA 4DM4A 1V4BA 5AVRA 4B3IA 3D02A 3TW8A 1G8PA 1ZNXA 2H9IA 2O7VA 3CF4A 3VR5D 1VLLA 2BMAA 3VPAA 4H6WA 4TM8A 3A11A 2PGAA 3AFIA 1JR3A 1OLSA 4PCAA 3GFGA 4W5WA 2O8EA 2QRPA 4RABA 4B7ZA 1TIKA 2BISA 2UZ1A 1I6MA 1E2IA 1SHKA 1R9GA 3K1AB 1M3SA 2CDCA 3MQ2A 3QI7A 2OG1A 3IP1A 5CCBA 2JKVA 1JDPA 3CJRA 3CZAA 3LQFA 3VQTA 1MP0A 1GQQA 3BHIA 4EARA 5K20A 3PU6A 4IIFA 1DXYA 1SD5A 4E5PA 4DV2B 4OX9Y 1A5BB 2AF4C 1UJ6A 2N46A 3DO6A 1DELA 3RF6A 1E2PA 1Z0DA 1YI8A 4JLVA 3VHRA 3IMFA 1JZSA 2VPQA 2YOHA 4GGPA 3S0JA 3D7SA 3SP1A 1VOTA 2HLNA 2DBVO 2HFJA 4NCKA 4XCQA 2P5UA 5BWNA 4D8VA 2B92A 1SVIA 3PXUA 4C4PA 3AEYA 2PZJA 4NI5A 2M6SA 4M8KA 3HU2A 4MKRA 4CIDA 1B0ZA 1WOYA 3OKCA 4J91A 1NQAO 1ZUWA 2O5RA 2Z43A 1UT5A 2FN3A 2E4ZA 1ODCA 2WT4A 4B80A 2AOUA 5EPUA 3PS9A 3HJUA 3HXTA 5DYYA 1MXHA 1NJFA 2WD8A 3U2QA 1CBUA 1O4VA 3Q9UA 4Z3OA 1P33A 3GBPA 4JL8A 1AHPA 3QITA 4QPJC 5LJLA 4B71A 4KR3A 4GR9A 1A7AA 3KZCA 1XLTA 1GUBA 1N7GA 3GLVA 1E9CA 4H18A 4PTYA 3WWOA 4HWKA 4DQUA 2QRKA 4GLOA 2FPXA 1Z39A 2BMVA 1TJ3A 4JYMA 4AJEA 4BEVA 1XEWY 5CIYA 2XWJI 2J0UB 2LBPA 3LPMA 3AILA 4EQZA 4QUHA 4D4KA 4BGDA 4GEKA 3C1AA 5FOUA 3KBOA 4NAHA 4ZV4A 4NCBA 5BYBA 3A58B 3V1MA 2EW2A 4DUGA 2KX7A 4PSDA 2CNBA 2V1XA 4A6XA 1ZM2A 4OYHA 4CEJB 2XOXA 4XX0B 4TS4A 3SMVA 3UH0A 1OFUX 2BR4A 2XMQA 4TSRA 5A4DA 2WB2A 1P1HA 3U37A 3HXOA 5FWYA 4BNXA 2ZS8A 1J9ZA 2ZJAA 4QRDA 2HB6A 3UBTA 4M46A 3GGDA 1C8BA 1H3EA 3O2SB 2AI1A 4X1OA 3DBVO 1SCDA 3AIMA 4Q3AA 5TMDA 1B8NA 3EOBI 4OQXA 3W3AD 5HKKD 3TG2A 1SOWA 5H70A 3EEQA 3TW6A 3FSGA 3M6IA 3LWNA 4U7HA 2VJDA 3HZZA 1ESEA 1ZD8A 4WZ6A 1H69A 5L40A 3CVXA 1Z0KA 5KWIA 4JP1A 5DDIP 3FNEA 1CY0A 4KN6A 2V0CA 1NN0A 3I1JA 3QBEA 4QULA 3I0NA 2E1PA 5EJAA 2HA4A 4OSEA 5K3FB 3T99A 4FFRA 1BMFA 2X19A 3FFBA 3SYTA 3KLNA 4EO7A 2I6TA 4D3YA 1BDHA 1UDXA 3EC2A 2EIHA 1UXGA 2OESA 4K8OA 4EHLA 3HB5X 4G0NA 1UJNA 3OP4A 1YS4A 2YXDA 4YUZA 4J94A 4JOSA 1OX5A 4F6CA 2PYIA 4Z0NA 4ARIA 1AKQA 1GPMA 4LTNA 4UTPA 1MX3A 2A1UB 3DZFA 3OHSX 5KYYB 3HLTA 2UZAA 5ALJA 4E12A 1L3CA 1JDTA 3T34A 3FD8A 1H3NA 1JZQA 3IVGA 4Y9SA 2PE5A 5JOQA 4QGBA 4DMGA 2QYOA 5HCIA 3TD9A 5FR2A 4HAOA 3IPAA 1IMJA 3IAEA 1PBNA 2IODA 5CLQA 2LD4A 1E1CB 4LSGA 3MQFA 1IHYA 1Z5WA 2WTBA 2RHHA 2GJ9A 4I1UA 4LYJA 4PLFA 4CKYA 2G0AA 3QKSA 1N6KA 1VXOA 4FFLA 5KTRA 1M6WA 4GZMA 1SB8A 4IWXA 3EY9A 1K88A 3C7KA 4PCLA 5IAKA 4PY2A 5T3YA 2UYGA 1OI2A 3IT3A 1I7LA 2HLDA 3N6XA 4B4KA 4MQBA 4YT2A 4ZAVA 5CB4F 2PJRA 4CV1A 4J43A 4X90A 3OCWA 3G0IA 5HW0A 1SZJG 1Z37A 3I52A 2Y9MB 3AY3A 3FSEA 5HJ7A 1AXRA 3OD5A 2C42A 2W8BA 3KB1A 3O95A 4NVRA 4AJNA 1ZWKA 4H1VA 3S8EA 1N33B 4RU1A 3L93A 3AY7A 1MPXA 2C1EA 3BMCA 1BROA 3PQ8A 4I8XA 3D3NA 5I47A 4L4YA 1I24A 1LNQA 4HF7A 4FYMA 1LF5A 4G5GA 2OGZA 2B7LA 3FTNA 1PT8A 3FTCA 4EUHA 2V98A 1HNNA 3LHDA 1JFFA 4TVKA 1UXOA 4RMGA 3CLTD 2NP6A 3ZDAA 1J42A 2H3HA 3L46A 4IX1A 4F5EA 3PIRA 4OQYA 2GJSA 2Q6TA 2A14A 3P2OA 2QMOA 4FFBB 4JP2A 3N1UA 1MF7A 4RGQA 4X91A 2D1RA 1UBTS 3S7TA 4XOUA 1ADCA 4IF6A 5L3QB 5LIRA 4A82A 1R5JA 3OFNA 4EFKA 5ALKA 2K87A 4FMDF 3MUNA 3VSCA 2X9NA 4DR1B 3AVYA 5EMJA 1NP6A 1WIWA 1ZW1A 1YL6A 1A8UA 4MS1A 4LGMA 3CLVA 4Q9HA 4WJZA 4OBXA 2WSBA 3STUA 2IDZA 4G2NA 4E0BA 2XXJA 4H3HB 3L84A 1LLUA 3G0HA 2QZ9A 4MHTA 3BWYA 3KKLA 4LQ4A 4P80A 4RLSA 4UTZA 4F04A 3K6SA 1FW6A 4WNYA 5DYWA 4RSMA 1T8UA 1TW2A 5EIWA 3SZGA 4KQ1A 4GE3A 4KO4S 3RSHA 1IE3A 1VBMA 3C3PA 1ONBA 4BNZA 4EYGA 2GMWA 3JWEA 4B2LA 1VCMA 3ZYCA 4MGYR 1F8YA 4DR7B 3B3FA 1N6IA 3OUTA 4MGZR 4GUAA 4KIGA 3Q1KA 4GOXA 1A8SA 1JQKA 4TS3A 2RHTA 3R0IA 1KI4A 4R7TA 3UJBA 1J5XA 1OASA 3HMQA 2FG6C 1YRBA 3KFLA 4HHEA 2BF7A 1OXXK 1WUYA 3GN2A 4IY1A 1II8A 4Y2PA 2PLAA 5EJ7A 2EV9A 2XDAA 4N3CA 2OORC 1SKUA 4OHKA 4YGYA 5G02A 3N86A 1O6BA 5EXPA 1T3ZA 4FDVA 2C4TA 5FR1A 2B0CA 4KSCA 4IRXA 3OZDA 2W9XA 2AK3A 4LFBB 1L8XA 1UOPA 1XZCA 1CUAA 2CKDA 2QX6A 3LS2A 4J7XA 1KSGA 3NIGB 5EZYF 5LWQA 3ZWBA 4BRZA 4Q6BA 2JC3A 5FOXA 2R6GA 1Q2XA 4EKGA 2FKNA 3NR2A 1V3VA 1X39A 3JQ9C 5KX5A 2A5GA 3NANA 3RO7A 1GL6A 1S2LA 2V9CA 2BP7B 1XRJA 2IZ7A 3GV0A 4GI1A 5ITZA 3U7EB 1MAAA 2ODBA 2COKA 1USIA 4ZYYA 4PLTA 5TVGA 1QUFA 1GPNA 3S2GA 2VDJA 5JSFA 1BGWA 1YC2A 3P9RA 3B3QA 3V8QA 3AR2A 3WIUA 3AH8A 1RHMA 4CKBA 1OLUB 1RI3A 4OUDA 2WJHA 4TSFA 4UM9D 4DNPA 4QM7A 1GUDA 4QNNA 1U1CA 2QNIA 4BGIA 4KYTA 3GP8A 3KWMA 2DFNA 3FYUA 1CUEA 1NVUQ 2BGRA 1NVWQ 3HFJA 3CW2A 3GK3A 1F4PA 3PDIB 4UUQA 1KZHA 4U7JA 4EG6A 3JXEA 3DLAA 5JDIC 2Q62A 3QTTA 3VU3A 2W90A 3VSDA 2OQRA 4I1VA 1LV7A 3AOEC 4OL0A 5DCWA 3O9MA 4RQTA 1L4KA 4AMGA 1JB1A 1VXRA 2OVFA 1NFFA 1JBKA 2X8JA 3HKDA 1GYPA 4HNAA 5CYPA 4LXTA 1U2GA 4PG8A 2PKCA 1UM8A 4TZKA 4F9FA 3SZOA 1HLGA 4MEAA 5F3RA 3C7CB 1V71A 4FJ2A 2B3DA 1N2CB 1GG8A 2OXEA 4Y6LA 3ZVNA 1BN6A 2CXSA 1I1OA 1XRNA 1YR6A 3RV3A 1ZBQA 2RHMA 3P9XA 1KYVA 2C5FA 2IZZA 3S1AA 3UT6A 3DOEA 2O2JA 3SIPA 4YJFB 3ZDBA 1FQJA 4L9AA 4AT1A 2ATCA 1ZRSA 3CEJA 2GVNA 5SV2A 3CX7A 4QEZA 3RSCA 2WVJA 3T41A 1R8YA 1X7ZA 1K9SA 3ELDA 4DRZA 4IV0A 3U7IA 1JPNA 5KOHB 3G8YA 1HUQA 5FDFA 4DPLA 4LOIA 3TLGB 2P2YA 1DBSA 2A67A 4K28A 1S6YA 4H77A 1T2NA 4RD6A 3HYCA 5JE8A 3CR8A 2WHPB 3NHRA 3WV4A 2CL6X 1A4RA 4Q7JB 3ICCA 3GEMA 2GGSA 1MA3A 4Q3KA 3JPWA 3QBTA 4ZALA 4GBJA 3AHJA 1JAHA 3PQCA 4C7OA 3W2HA 4RK0A 1NVDA 2HDHA 1KI1A 5D6NA 5T41A 4A0RA 4DQDA 4YYZA 2F4NA 4XTCS 2WTAA 2RHDA 2SCUA 4B3SB 1W76A 1E79D 3BKXA 3FPBA 4LHYA 1QVZA 2HSZA 2ZE6A 4X92A 4HX5A 1MBZA 3JD2A 3L1HA 3FTFA 1WRBA 5KZMB 3A3PA 1V8OA 1YI1A 2C59A 2JJ2A 4Y30A 2XV1A 4MMYB 4EY7A 3UJ6A 1SCNE 2HA7A 1F6WA 3LV8A 4RLFA 1FDSA 7REQA 5FWNA 5A3JA 3IKTA 1M8PA 1HX7A 3I8XA 3TM5A 2OXCA 1ISGA 1Z16A 3LKZA 2I2FA 4YHBA 4LMPA 1T5LA 3THSA 3NOOA 3L0BA 1TQHA 1PJQA 3FUUA 2JG3A 1YZQA 4D3DA 3NBXX 4KN9S 4TQ9A 1CHNA 1Z38A 3HPRA 1EKXA 2DLNA 2O2SA 2OFXA 4GOOD 1EBFA 1K1EA 2WYIA 3A7DA 4LG1A 4V39A 3VTFA 5KQMA 3PPWA 3DC7A 5KTMA 1MV5A 2ACKA 2I6QA 4HB3A 4CM7A 4MP3A 4OHOA 1UFKA 1F2UB 2OAP1 3HUTA 1VJ0A 4UFOA 3O5AA 2V97A 3BGOS 1ZH4A 2OZLA 3T7JA 5KYUA 3WL8A 5C18A 3THYA 3RCBA 2QXTA 4DC1A 2IH4A 2DHEA 3UK2A 3V4VB 4EHBA 1YR9A 2HQRA 4AROA 3PXXA 4LYHA 4P3YA 4JP5A 2G4LA 1ADFA 2IIVA 5D3MA 1JHMA 4HLQB 3CRZA 3P9SA 1TGYA 1SD2A 4KXFB 4QPZA 5AOAA 2FSPA 5GJWC 3PK0A 4L75A 1IRXA 1PR0A 2WJVA 3CF4G 2HWYA 3LY8A 3OZRA 3T4PA 1EDOA 2XB9A 4OUKX 1ZSNA 1E98A 4YBRA 1TA0A 5FUYA 2ESRA 2XOEA 2V6FA 1XEXB 3VU0A 1CFJA 2AHRA 3LH5A 5IANA 3L1JA 1E89A 1ZN7A 2BFPA 4XLTA 3MTGA 4OMUA 1TM2A 1D07A 3A6EA 4RULA 1T43A 3D0QA 1C1XA 5CFLA 2V65A 1G8HA 2V7WA 2M9MA 1EA7A 4EPRA 4AN0A 1OXSC 3I8SA 1IXKA 1H85A 1IHOA 4LZNA 1CVIA 4EATA 2VT7A 2I2XB 1U9JA 3RASA 3G7NA 3OJCA 4FFVA 1QC5B 3ESZA 3MWEA 5IC5A 2VNKA 3T1HB 4JLAA 4OXYA 2HM7A 4HNVA 1OXBB 3G5UA 4XQGA 3VMFA 4C14A 3LNTA 1K5GA 1KNQA 2C3UA 5JNLA 1HE5A 1SR8A 2C9CA 2VT3A 4OQMA 2B8WA 5K3OA 5HFAA 4IO1A 3WDKA 1HFEL 4P34A 5F98A 5CURA 3CHYA 1WXHA 3I0ZA 1ZK2A 5LOVF 1I5RA 3DCNA 3QQ5A 3ZCXA 2WYHA 2H08A 3VMMA 2QXUA 1AN0A 4E5YA 2C4VA 5IFKA 3C4JA 7ADHA 1SJ9A 2VZ8A 1VCIA 2BM8A 3RS0A 4H3SA 2JBWA 1OBFO 2Z6AA 4KG7A 4JLWA 4U0JA 4HOYA 2XD9A 1SCAA 3WHKA 5J5AA 2PUGA 1MLDA 3UFXA 2CN1A 5IK2D 1M33A 3MF4A 4YJ3A 3BB3A 4YR7A 2YZNA 3BUSA 1A71A 4P4SA 4DZZA 5TDHA 1U6IA 5BWBA 1PG5A 2NXNA 5JDCA 1CLUA 2DU8A 3GLHB 1USWA 1D4FA 3OM1A 5DKFA 5K8VA 3KM0A 4I4IA 1G7TA 1L4BA 4BP3A 4Y2SA 3F3SA 2OBMA 1RXUA 4LFAB 1E2BA 1KK1A 2H7YA 2QG6A 3MFQA 3OIYA 3P7MA 4MUBA 4S35A 3GAAA 2ZKLA 1MNQA 3BULA 2W2MA 1NYRA 3MSXA 3U7HB 1QTRA 3G2QA 1AKYA 1K27A 2P3OA 1IZ7A 1QOZA 2PQ0A 3DE1X 1PQ4A 4W7IA 1Z7EA 4XR9A 1AIPA 2VPPA 1JTEA 1R0CA 2D0IA 4PPQA 5IAGA 4OK6A 4IGIA 5SZJA 5L51A 1D0SA 4BOYA 1RRVA 2VYCA 4O4HA 4XQ9A 5ER6A 1JEDA 1Y6GA 4UQLA 1STOA 2FG7C 3KKPA 5E4TA 2HEGA 3TW8B 1KMNA 1X8KA 2JHCA 3CC8A 4L4XA 4N6OA 4OFZA 4RMIA 5NULA 2XGSA 5FAKA 2G25A 4MW0A 4Z1MD 5LLSA 1OLSB 6PFKA 3IAS1 3ZWWA 4W9MC 2O8EB 4HQNA 5GVSA 4HH4A 4YMSA 1IN8A 2I7CA 3NUQA 1PDWA 5BMOA 3KR0A 4FNMA 5DNEA 2ZG6A 1GFWA 4GKAA 4RWEA 3Q12A 3PC8A 4AZ3A 3KJZA 3BSWA 3WLKX 1ILWA 4R16A 4PN3A 5KTYA 1MB0A 2R7KA 1AUQA 1SK8A 3PPYA 4Y0NA 2M6LA 1QF7A 3OAAA 4OG2A 5FORA 2YQZA 1U2TA 1RYEA 5ESDA 5FWXA 4U8GA 3LOUA 3TZQA 1Z4MA 2KPOA 4J3FA 2XA2A 5HZKA 4MIYA 1PYDA 1Z36A 4MV0A 4GVLA 3TK1A 1GNLA 1DPGA 5LZ8A 3ZXSA 4JYCA 3VKVA 1JIUA 4NEHB 4C20A 5K7SA 4Y2YA 1UR5A 3OO1A 2ZYRA 3FGNA 3L02A 3OOEA 3IRVA 4V24A 2OV1A 4MAFA 3QLEA 1AQJA 3V1KA 1UFQA 2IUUA 1ORIA 3UY4A 2VTEA 3H19A 3DD1A 1R0WA 3SS9X 4ZK6A 4CU5A 2C99A 4XYMA 2DKNA 2P78A 3E5HA 4HGRA 5KTPA 5BN5A 4BO4A 1JHYA 4UMVA 5I8PA 1B6RA 2AOUB 4FFNA 1PJCA 3W2IA 1Y82A 1BMTA 2P27A 4PQYA 3PVCA 1YB7A 1FYEA 2BE9A 5H4HA 3GPIA 3WQSB 5BORA 1QLWA 1X92A 1EVIA 1NXXA 1I2DA 3WFJA 4PC3A 5ADUS 4RH3A 2YJZA 2Z1NA 1WL8A 1J22A 3E0XA 3KIPA 2XXAA 1XD8A 4L95C 3L0PA 5IBPA 1PBTA 3IQWA 5H3LA 1SQ6A 2V7XA 4O2LA 3RUFA 5K09A 1N25A 1P77A 2AZ4A 2ES4A 2HV8A 2LTAA 5A0TA 4EUNA 1QHGA 4KDRA 4FS3A 3IKJA 5BNFA 4G5FA 3W4JA 4PGHA 1NNEA 4M9CA 1ECPA 2IUFA 4N0PA 4PRYA 4W7SA 2AH5A 2Z08A 2DVMA 1UBUS 1Z0ZA 2BGMA 3LC0A 3H84A 4W63A 5KWSA 1CZUA 2C83A 2CYCA 4DDKA 1QVWA 4PXSA 5FWYB 2LCQA 2PUBA 1CDZA 2E4XA 4N65A 3G8CA 3M34A 5J4YA 3KNZA 3EH1A 4RESA 4AZ0A 3VKWA 4EKYA 1USUA 1U3TA 4UM5A 1G5TA 1E59A 3M1IA 4R83A 3BGIA 1V6CA 4HYYA 3WYNA 3T0FA 4FFMA 2LIPA 4I3GA 1C7QA 1PTJC 2DR3A 3K15A 5D5QA 3RVSA 4Z4EA 1N2ZA 2HF7A 1M75A 4L9RA 1ULHA 1G9TA 1M2VA 3D1JA 3PFKA 3SHOA 2JDID 3FB4A 2GA8A 4LAFA 1F7VA 3WNZA 1K0UA 3AI3A 1XN1A 2WC1A 5CFPA 1ETUA 5KU1A 4NXMB 4K9OA 1UH5A 1WUKS 4CMEC 1JHPA 1PUXA 5EP1A 5C8XA 4R1MA 2DG2A 3THXA 1F5NA 4BY9E 3OWHA 5B36A 3C8MA 4MV3A 3FUWA 1LH0A 1RQRA 2PU7A 3K9BA 4P54A 4WFKA 1A97A 3GCZA 2PJZA 3M5WA 3NTOA 1H93A 1P0MA 4U02A 1NJ8A 2DWQA 1YVEI 2JAUA 3QI2A 1RLMA 4FLEA 3AUYA 1GEGA 1PGQA 3A6ZA 1UANA 1KDOA 3Q88A 4HBZA 4IFTA 4O0LA 4RKWA 3H13A 1PHRA 2QUJA 2C5GA 2GERA 3C7AA 1N2BA 4DANA 3T06B 2EHDA 5ISMA 4FBLA 1S2DA 2MYUA 2R66A 4HNUA 3I73A 1FC0A 3O1HB 4QVIA 3ZZ1A 4WEOA 2JW5A 1P4HA 4G24A 4ZAWA 3SM3A 5CXQA 1JDUA 3GA7A 3EQ8A 1UDAA 3HUDA 3TN7A 5JQGA 1CY8A 3TLYA 2PUHA 1FVXA 2W4MA 1OJ7A 2PX6A 3LW7A 1J25A 1WKBA 2JLRA 1ZJ5A 3VZRA 1MU0A 3VR0A 3VR4D 5F73A 1YZUA 4KGXA 5LCXA 1E64A 3FHLA 1RTKA 4JVOA 2JLAA 3Q9LA 2D5LA 2F3TA 1JTFA 3QKSB 1GSOA 1Q50A 1ZIOA 4PIMA 1J56A 4HXGA 1U04A 1V96A 5IKXA 5DSXA 1U63A 4FGJA 2Z9DA 4FMCB 1YQUA 1ZIDA 5BNZA 5K8TA 2GJKA 1P6UA 1H8EA 3IUBA 1BX0A 1N0WA 1NURA 1OXUA 2F90A 4J75A 2JFHA 3R75A 2QTVB 3JVIA 4O63O 1T3GA 3Q2KA 1DIHA 1DOAA 3USZA 4JYZA 3BQ9A 4Y98A 3FNRA 2XSZA 4PQEA 2TMGA 4LE2A 4OY3A 3BMCB 4TV9A 1NJ1A 2EQBA 3NPMA 3V6MA 4CR7A 2VP3A 3L7DA 4DJTA 3G68A 1NBWB 2REBA 2VYND 3TZBA 2FP4A 2GASA 2JFVA 3NTVA 4JASB 4TTVA 3QMPA 1ODIA 1WZ2A 1E5XA 5CIQA 1A4IA 2L17A 2C7BA 2QJOA 4BYGA 4YJ2A 1MORA 1EEHA 2ZW9A 4O2BF 1NZDA 4HDOB 3KLBA 3UUFA 1QTQA 1J09A 2Q4OA 4MWCA 4QOSA 3DE4X 1MB2A 2F8LA 1T0JB 1YE5A 3QOYA 4J76A 2FE4A 4PHTA 4FYYA 5LQRA 5AJHA 4QBIA 1ND6A 5LKAA 1A4UA 4PRLA 2WSIA 4JT2A 1OWNA 4FGKA 4R8KA 4JN6B 4MS1B 1YB4A 2A88A 1P2SA 4KK4A 4O6VA 1JKXA 2X9GA 1EJ2A 2XZTA 3VO1A 1O6CA 1Z0SA 2PMFA 5ILOA 1KMCA 4PEVA 3ZCUA 3HEBA 3U4IA 4CF3A 3OCYA 2AE2A 2AHOA 2AL7A 1G5FA 2KYRA 4AWBA 3K6SB 3KR2A 2XE8A 3E3NA 2HNKA 5FULA 2F3UA 4CMGA 2GJ8A 3DE3X 4WY5A 1ZVKA 2A3NA 4P0PB 1QORA 2NUPA 4D9GA 2E5FA 3R6LA 2J09A 4PG5A 4S1OA 2HU8A 4A1OA 4BEBA 5E6RA 4ROTA 4MJ7A 1H4TA 2XITA 1O3YA 3E3MA 1BE6A 1YQQA 5CK5A 1R10A 2H7XA 1CCWA 4GX0A 4QELA 3HWX1 3OEYA 4PG6A 1KDYA 1J8QA 1ZRMA 2VJLA 2WG1A 1L5KA 5GV7A 1M2FA 2V59A 1H05A 1VQ1A 1K2VN 1II8B 1PGOA 4IZHA 2R6JA 1AA6A 1XTQA 1Z4KA 1FFHA 4YJHA 4YP1A 3FKJA 4I5FA 3NAMA 1LVHA 3ETJA 3RIHA 3UH1A 4U7DA 3GY0A 4EH1A 1JU9A 3A4MA 3ZHBA 3UGJA 2IYAA 1KYTA 4MVJD 5AD1A 2IZ0A 1JHZA 4E21A 3NG1A 3DSRA 4EG0A 3OHMA 2REQA 4L08A 3ITDA 1I5OA 2FPUA 3NT4A 5ITZB 1HO3A 1MRSA 3I9V1 3LZCA 1L6IA 3M33A 5D1NA 3C5EA 4IGFA 5DTRA 2FF7A 5AW9A 1H4QA 5IKOA 4IJUA 4CQLA 2W6MA 4XE5A 2D1YA 2HV9A 2H1LA 2W6NA 4NBLA 4P3OA 3FA2A 3QVMA 3PLNA 4GC5A 4MRMA 3VR5A 3N76A 3HJNA 4OUDB 3OLYA 3KO8A 4L22A 1PI3A 1AKTA 1PS9A 4G0YA 3TQSA 1SHUX 5BSMA 3SJUA 1U81A 3FYUB 3K2IA 1T9GR 2VHZA 1SBQA 2PA0A 3LKBA 1N3IA 4U00A 3O03A 4N9QA 2DQSA 4QO8A 4TMWA 3IQFA 1G5RA 3L07A 3ABZA 3RKSA 1NPDA 3ZY4A 3GRYA 2IXDA 1HV8A 4C2BA 1N0UA 5FAXA 1A7KA 1FUIA 3K1TA 4HMQA 2IQIA 2X8JB 3CVJA 3HKDB 2ADFA 4HNAB 2BRUC 2R7LA 1RZRD 1KPGA 3D8SA 3CUVA 3NT5A 2C2OA 3OQ6A 4KIWA 4Y6SA 2C7OA 2Z8YA 2F9LA 5I7EA 2AMFA 1BE0A 2IS4A 3LUDA 5L7YA 1KVTA 3D8UA 3P0JA 2WPDA 3FNHA 2VS1A 5CT8A 1QF6A 1ULBA 4JMLA 3THRA 3V3TA 4YP7A 5KQPA 1GFIA 4P7JA 2IV3A 3MWYW 5GGYA 3UHAA 3S3TA 4AC9A 2HADA 1ZCFA 4Q4LA 5WRFA 3G2KA 2PSSA 1J2UA 1TJNA 2Y6UA 3FAZA 2DKFA 1QK5A 2QL6A 3K30A 3LWDA 1RBQA 3P5BA 4EYOA 1H3FA 5C1DA 4PBSA 1X7ZB 3GX1A 1XPRA 4X66B 3LU1A 3VZBA 4ZV9A 1VIVA 4B46A 1JEJA 3OCVA 5NLLA 4BO9A 4Y2XA 3CVYA 1PNOA 3CWZA 3CTMA 5EJ4A 2IX9A 2VAVA 4XUGB 2SKCA 1LI5A 5ALVA 2YOFA 3V1YA 1BVYF 2PO5A 3FBGA 2PV7A 2CLIB 2NSYA 3GJ8A 1ZIPA 1E5VA 2DJ5A 2ATEA 3OTGA 3ACBA 4R2WA 4X7MA 4C7OB 3OPXA 5AUOB 3RU2A 5IVDA 1VJRA 3E35A 3CB4A 3GQBA 2SCUB 3K72B 4YRTA 1MXFA 3W5VA 1RFLA 1LZKA 2H4ZA 3AHGA 3B70A 4GDMA 1MKYA 3PE4A 5C8DA 2Q1WA 4BGEA 2WHQA 1GKYA 5A4FS 1X13A 2JLSA 5AH0A 2OV3A 5CVTA 4FC6A 3LT1A 3E1SA 2P40A 4ZOBA 5JHHB 5T4HA 2J4CA 3E6AA 4N47A 2AD5A 4L72A 1A2QA 4L2IA 4IIEA 7REQB 3W3AA 3OZSA 3A3NA 4OK3A 1NMYA 4TKZA 5F9MA 1B4DA 3DF7A 4FOPA 4OVKA 5EYPA 4Q3EA 4B7UA 2Q21A 3VVBA 3IYLW 3FFTA 3KRTA 4IUBS 1CERA 3PRJA 2VJOA 1GU7A 5D2CA 4AXXA 3DR5A 4KACA 3SSAA 1VBKA 4TLDA 2Z3WA 3QUAA 1XQVA 3DFUA 2C84A 2ISQA 2P91A 1WPQA 4FDUA 4U9IS 3TI7A 1F7UA 3FCEA 3WA7A 1KO4A 3S44A 4EOGA 1DJLA 2P6MA 3ESQA 3EXAA 4L16A 3R7AA 4YAKA 3QBDA 4EW1A 8ADHA 4AN4A 2ECKA 3K5PA 3PQ7A 5IUJC 2VHWA 3RRBA 4DIUA 2R751 2ZSKA 1C29B 1OV4A 2M6RA 3IV7A 2H5LA 5BSVA 2CHEA 3PF8A 3U19A 3I53A 5FUMA 2JI8A 2OZLB 2Y9PB 4M1TA 3ET5A 5KYUB 3D6UA 3THYB 1EUYA 3KQKA 2Z57A 3KKEA 4KRYA 2IV7A 2QQEA 3JATB 4WVFA 4OHWA 4NZYA 1DOHA 4LNAA 5D3MB 3MIIA 4R7ZA 3IDZA 4QQFA 1V1JA 1KMHB 3UB2A 3R0ZA 4EF6A 3HADA 1O1YA 5CB8A 2XWBF 3D3KA 1BWPA 2H06A 3DCJA 3MW8A 3WQRA 4C0SA 4AKGA 4LTDA 4P32A 2I5PO 4Z7QB 1ISIA 2I22A 3BKWA 1S4MA 2GEFA 3IXMA 1EXMA 1M34E 2GD0A 2WWXA 1YRAA 3IMEA 4S12A 4X95A 2FZEA 4JUDX 2X5KO 5IHPA 1E2QA 1FTNA 1R12A 3OLWA 1DQSA 1HPLA 1W9MA 4QTZA 1MT0A 1U9IA 3TAXA 3TKYA 4Q1FA 4QZVA 3QTLA 1HGXA 2JAOA 1C1XB 1GUYA 2VUHB 1DMRA 4G8CA 4GC9A 3A6PC 3IPRA 1UF9A 3ECSA 3H0CA 4Y9TA 2KMLA 3PRHA 4N03A 4OGKA 5DHUA 5IYZF 2RSLA 5TV2A 2JHGA 4GVPA 1RFGE 5ENDA 4OB6A 3EVAA 4HPWA 5JAOA 4DLRA 3RAFC 1X9IA 3J81A 2YMLA 4KDEA 1ABFA 4DSTA 1EVQA 3MWEB 4WLEA 3S28A 3SC4A 2VAMA 3GT4A 1YZTA 3K0BA 5J40A 1Q1GA 4LN1A 4WCDA 3WLOA 4BMNA 1FUKA 1VZ2A 3EUFA 3QBJA 4L7VA 4MI9A 2WHYA 4I4TA 4BMZA 1VJGA 2OM2A 2J3QA 4KQKA 5DOVA 1LWNA 2MR5A 4JGIA 1QG2A 4KQGA 2B5OA 3KDPA 4C88A 3AEQB 4GMKA 2C29D 4DMUB 2R25B 3VNUA 1VLVA 1ORDA 4OAOA 2WAMA 1ZJYA 3NIBA 4Z4QA 4D45A 1BHO1 2IZ5A 4JSTA 3U7GA 4D4LA 2Q1SA 2MDTA 5CXXA 5E8RA 1B23P 1PDOA 3U9LA 1QR2A 2XCRB 4F96A 1T4GA 2HJHA 2DPHA 4BP8A 4LHVA 4PCUA 3U4HA 1N3LA 3C85A 3JWIA 1H2WA 4TZ6A 4YJ3B 2TMYA 4PS1A 4ZZIA 2GBLA 4P4SB 2VSNA 1XHFA 3HZRA 3JVUA 1VJ5A 1WHSA 2XCUA 1SBCA 3RBAA 2NZYA 4ENPA 3ZY5A 2QUHA 2BPOA 2XDQA 3C5VA 4GBGA 5E3IA 3TXXA 3U9TA 1A88A 1FFYA 4NBWA 2OV6A 4IHAA 1B8PA 1HT0A 1NM5A 3ME5A 4YUVA 3ROQA 3VZPA 3HDHA 3T5MA 6NULA 3LXUX 2FPMA 3TDMA 4PBTA 1SCJA 2Q41A 5JUWA 2VN8A 4MVYA 1TT5A 4S1VA 1LVGA 3ZZ0A 3U4GA 4D8YA 4EEZA 4U7WA 3MCUA 3IMCA 3PNKA 3GPBA 4CR6A 1UJ2A 3NV9A 3NYQA 4WOKA 2QP4A 4V1CA 5LVAA 2FFBA 1Q19A 3W5CA 4AYTA 1KEEA 5DHAA 1EQ2A 5K05A 2C2MA 4EG7A 3F6SA 4O4HB 2VZEA 3OEED 5A1TA 1BSVA 4YR9A 2GCIA 3ZKWA 2ZTVA 4MIOA 3V5NA 5SY4A 4IMRA 1KQOA 2NU7B 5CVJA 2B82A 1PT9A 3ND7A 2LDBA 4YK7A 1FNCA 5LNK6 9LDTA 1X42A 4MPPA 2EG5A 3JQFA 3IUJA 3PUHA 1L5FA 1V1RA 4W8OA 3O3NB 4F2DA 3IDOA 1DQYA 1SCUA 4N0QA 4AZ3B 5K3DA 4BDTA 2EGUA 4JR2A 3LLUA 4PGMA 1YULA 2C9ZA 3BTUA 3IVCA 1B73A 4JSRA 5IM4F 3GXOA 3EXFA 4TT3D 2GZMA 3QLJA 5FWXB 3ZCRA 1C50A 2EKQA 4JA0A 3AONB 1QIFA 1GADO 4MCIA 3EZGA 1YTUA 2CLFB 2D2VA 1YRQA 2JGJA 4O0MA 3H2ZA 4RSRA 3I4FA 4C21A 4D26A 1P3JA 2G80A 1EG7A 3WLFA 4D99A 3UPUA 1FZQA 3TOVA 1NOJA 1EFKA 1XCLA 3NOXA 1CY2A 2O23A 1FYFA 4NF2A 4QOFA 3SG0A 3TTWA 2FFHA 2E85A 2JZNA 2ZYIA 4CTKA 3AETA 2NTNA 4YAUA 3CLUD 1YAHA 4ZEVA 3RPEA 3GFQA 4I5GA 4WLFA 4G4SO 4AY2A 2WIGA 4LMBA 3K71B 2X8LA 1LU9A 1G3RA 1I7NA 3JQRA 3MRSA 3QNUA 4REMA 1XMJA 2WLTA 1JNYA 4GZ3A 2XXAB 3HSYA 1ENPA 1HZZA 2MTBA 3DP7A 2XY4A 3ZBTA 5CU7A 2I8CA 4GXNA 3OX2A 3TPCA 3Q9SA 4QPPA 4FWTA 1Z6YA 3Q15C 1QH8B 2C3YA 2X1LA 2D74A 3P9PA 3G1UA 3P26A 3HKBA 5L45A 4Q3CA 4F7WA 1ZP6A 2QTZA 2D1SA 1JDZA 4P0TA 4QECA 4F4HA 3NHBA 4CNQA 2I2AA 1LGYA 1UK9A 3PCRB 5AKYA 4PC1A 2QAGA 1S9HA 4G5YA 4TYQA 5DV9A 1DEHA 1OCEA 1PCXA 5ED0A 1NQVA 2C8LA 5CPFA 2VDUE 2XW6A 2PPVA 1JBQA 1U2RA 4L07A 3K0CA 4AZ0B 4R6WA 1DBPA 4JCOA 4IOKA 3FF1A 4BV8A 2O07A 5A5GA 2DPMA 4FYKA 3CCCA 1OQAA 1E6CA 1PWZA 2HT6A 2ORIA 4HFRA 5HF5A 3M5CA 1UC9A 2ZXUA 1V7ZA 1ZCZA 3CJTA 4CF6A 2V03A 4E5UA 4KVGA 1HZJA 1GOTA 3COWA 3MLEA 4ENUA 1M2VB 1J20A 3IH5A 4IM7A 1XKLA 2VCYA 1E2EA 1R7RA 1X7GA 4BQOA 4EF4A 1UZNA 2YMMA 4JB3A 4OLAA 3M6XA 4PGAA 3I01A 4GL4A 5TF0A 1OKKD