3A37A

Structural insight into the membrane insertion of tail-anchored proteins by get3
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
346
structure length
313
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAAADLTGSIPGIDEALSFMEVMKHIKRQEQDEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the membrane insertion of tail-anchored proteins by Get3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATPase GET3
total genus 96
structure length 313
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a37A00
2IC5A 5FOWA 4B2LA 3LAWA 1GNPA 2IBMA 2NZ8A 2Z6VA 3W6PA 3GJ4A 2XZOA 1VYVA 2Q0HA 3W8NA 1E2QA 4V02A 1ZCAA 5K8TA 1Z3IX 4P4SA 3U3KA 2A5FA 2PZGA 4A2PA 3EPLA 2FSHA 4DLVA 4DDVA 3PG5A 4EPVA 2XB4A 3NBYC 3KXKA 2ZI3A 4BFXA 1T3HA 1RYHA 3OIVA 4RKEA 4MYHA 5FOTA 2ANBA 4BZXA 1XTJA 3VR2A 2C9CA 4WAUA 2WV9A 1EFUA 4Q4JB 1E32A 1HEIA 3A8TA 1I2DA 1SQ5A 1UEIA 1YE8A 4XOIA 4LYAA 2NMVA 1FW6A 2DY1A 2ZU6A 1BYUA 1G8GA 5KDOA 4V0OA 1SXJE 4RCYA 1KI6A 4DCTA 2FH5B 1KGDA 3R9IA 2OE2A 4Q66C 3FGNA 5FBWB 3O8BA 3SNHA 1Z47A 1GG2A 3WMEA 2F55A 4MYCA 3SJCA 1N6IA 4IOKA 1D9ZA 3BGWA 3CRQA 2R6GA 2KBFA 4NU0A 3ZLJA 5FOXA 4C7OA 1R0YA 3TW8B 4KSCA 1VYTA 4OI4A 3VU9B 4A92A 4TYPA 1NJGA 1OH5A 2KB0A 1VPLA 2GXQA 1ESNA 2WJHA 3PV0A 4CEHB 4F7WA 2GTPA 2CK3A 1UDXA 3NH6A 1U99A 1J99A 1Q12A 1DPFA 4QL3A 421PA 1WBDA 4QNRA 1JJVA 1XTSA 4MUBA 1LS1A 5KHOC 4NCNA 4B35A 2OUKA 5D3QA 2WBLC 5FPTA 4EJSC 5FBRB 3PCRB 1A7JA 4DEYA 2GJ8A 5C2JB 1E2HA 1JQLB 1KDRA 3KQLA 1G16A 3EPHA 1OPXA 4JS0A 2WIAA 1ZBDA 3KKMA 1QBKC 4O25A 4KODA 1FP6A 4IXMA 1MO4A 1NMZA 1O3YA 3RVBA 5FL7A 2JLWA 4QHSA 3RS2A 5JHHB 1NF3A 5DO9A 3I72A 4HZUB 2HF9A 4Q7LA 4RSGA 2ZRIA 1KK0A 4NYJR 4AYWA 521PA 3AVQA 1KK3A 2QU8A 3HP1A 3OEEA 2D3WA 2AD1A 1JECA 5FBVB 4TQAA 1T8TA 1KI2A 1P6XA 1E1QA 3I73A 4LBYA 3KQNA 4TQ9A 3PITA 4EIWA 2JLVA 2EU8A 2MSDB 1U94A 1Z2AA 4B3XA 1OW3B 2F9LA 3DO6A 1M1YE 4D25A 3CBQA 1CJMA 1S2MA 3R20A 4KVAA 1KO1A 5KNBA 3VNVA 2C5LA 2IXGA 3N2IA 4DLSA 3AKYA 2IYZA 4ASUD 4E09A 2VIIA 4V0NA 1TU4A 3I32A 4URWR 3MD0A 3TUJC 2X2EA 3PENA 4QC2A 2K5UA 2XZLA 2XEXA 2GXSA 4OL0A 1QHXA 3GLFA 4LHYA 2R9VA 1TAGA 1G3MA 3FHCB 1Z0KA 2QAGA 1IJEA 3D31A 1OH8A 1X1SA 4WA7A 2ZSFA 3W34A 2N46A 2ORIA 5HPYB 1W36D 2P6UA 3X2SA 1TX4B 2FZ4A 2WHXA 3MWLA 1SXJD 4TMWA 1KI8A 1G20E 1S1MA 1YHNA 3EIEA 1XTIA 3UWKA 2O8FB 5E3HA 5FUXA 2WPDA 5EXXA 2GJ9A 3THYA 4OQFA 4C3ZA 2FFHA 4QG7A 3H86A 1TUIA 1GKUB 3QKRA 3QXSA 2CVFA 1DBSA 1AGRA 2JCSA 1W36C 1FP7A 3EX7C 2ZRKA 2J0UB 3LBIA 1W47A 3A1UA 3EIHA 3F8TA 1J2JA 2Z4RA 1KAGA 3C15C 4I1VA 2OCBA 4KSBA 4ZO4A 3THXA 3QG5A 1QHGA 2YWEA 2R65A 3QQ5A 3ZIAD 1K5GA 3GP8A 1ZM9A 2C98A 2IW3A 4G1UC 3U60B 4AI6A 2QP3A 3QG1A 2VP2A 4JSYA 4P32A 2GXAA 1UFQA 2WWGA 4LYJA 2FGJA 1AS0A 4N3NA 1YJ5A 3RHFA 3U7GA 4NTZA 3ECCA 5B57C 2VSXA 2WJIA 1Z06A 4HAZA 5G3YA 5K8LA 3DKPA 4BE7B 5JS8A 2QG6A 2QGZA 4CRWB 3LX8A 2ZRNA 2P3SA 1LS6A 2NO9A 1RRFA 2BHRA 3NEYA 4LZZA 4UNQA 5BYKA 2ATVA 5DH9A 1VIYA 2Q3FA 3KJEA 4DXAA 5TY0A 2JIZA 4EFLA 3AGQA 2H16A 1P75A 5FUYA 2QROA 3QVUA 4MRRA 2OESA 3WYFA 3REGA 3QXJA 1JQJC 1G21E 3U6KA 1OT3A 1W4AA 3SE0A 4PAOA 4I1UA 4XSHA 3B1YA 1II0A 2YC2C 1XNJA 1W46A 1H8HD 3QY0A 1ZP6A 2MMCA 3S1AA 3GEIA 4BLOA 4ZDIA 3FHTA 4Q7KA 3I92A 3UXMA 4DT1A 4XTRA 2J0VA 1YR8A 3JZMA 1BMFD 3NHAA 4HB4A 3SQXA 1NVUQ 5FOSA 3EIQA 3IHWA 1DE0A 4DJTA 3LW7A 4PO1A 721PA 1X8LA 3SDZA 4AY2A 4W5JA 4GRAA 3NDPA 2HXSA 4ZKEA 2ZREA 1XZPA 1QF9A 2ZRHA 1XPRA 1NMYA 1WMSA 3BOSA 1G9XA 3BS4A 4PO8A 8OHMA 4KFSA 1DADA 5JEEA 5KPJA 3PUVA 1WB9A 3TRFA 4Z1MD 1E2JA 1QRAA 5BN3A 1VG8A 4TL7A 5J4VA 4Q1FA 5JJLA 1Z22A 2QENA 3TVDA 1SZPA 2OM2A 4JLBA 5SZKB 4BQSA 4BRUA 2ZRJA 3SJZA 2GVZC 4HZUA 1SVMA 1DG1G 1KJZA 3VHXA 1XD9A 2JDID 2A5JA 3SQWA 2VQSA 3DOEA 5CDFE 1DOAA 5IF9A 2Z0MA 1TF5A 1M34E 5JI2E 1HV8A 2DHRA 2HYDA 1Z6AA 2CLSA 4D4JA 1G8HA 2FFAA 1NN5A 4XWOA 1P3JA 5AUNB 3ZD6A 1TQ6A 1W4CA 1XZQA 3C7KA 1G1MA 4PC7A 3K0FB 1S96A 5G53C 3Q85A 5FTNA 3AUXA 1IY1A 2VP6A 3GMTA 4PPFA 5TARA 1EX6A 4US0R 5JHGB 3HR8A 1ZC3A 1FOEB 1ZD9A 4PAQA 2B8TA 1N0VC 2WWXA 3ZVRA 4HB0A 2FPLA 1CR4A 3LX5A 1Z6TA 3O8CA 2OCYC 4LPSA 5JSZB 3KTAA 1E9RA 1Y3AA 1U0HC 3VAAA 3Q5EA 4FI3C 2O8EA 2CE7A 1G7CA 1OFUX 2V8OA 1XD2B 3GFPA 2BJWA 2GNOA 2NO7A 1GRQA 4YDSA 4R7ZA 5SZJA 3RWMB 2QUZA 4LYHA 3ASYA 3WXMA 2QT0A 3X1DA 3ZD7A 4Z1MA 4JYCA 2V1UA 4QJ3A 6Q21A 2HCJB 4XSGA 1LVGA 3QPVA 1BKDR 4PTLA 5F3WB 1G7SA 2WPDD 5JWHA 3FKSD 3LXXA 1XRJA 4PANA 3UMRA 2W6ID 3A36A 2RGGA 3DZ8A 1RKBA 3W8RA 1S9HA 2CHQA 3A4LA 4WXPA 5G41A 5KOYA 2GHIA 3GLHE 4BLPA 1AN0A 2JJ8A 2QRNA 4ITRC 1KSJA 2EFCB 3I61A 3U4QB 2O8BB 3BH0A 4KHZA 1CXZA 1E79A 2DPXA 2AR7A 2F1JA 1PVOA 1P5ZB 3AF1A 4EQ6A 5JJIA 2YYZA 2BJVA 2QZ4A 2XTMA 1B23P 2C8VA 4BEJA 2CJWA 3LVRE 2W2VA 2ZRMA 4NBSA 4IDNA 1SKQA 4JKIA 2ZR0A 4UNNA 4B3GA 3FPAA 5FR1A 1NLZA 1X86B 2KWIA 2HV8A 3B8HA 2P0EA 2ZS9A 3SJBA 3PUZA 1U2RA 3HU2A 3T5GA 4CYMA 1W7AA 2JJ2A 1TU3A 1KDPA 2ZRPA 1R8SA 5FTKA 3TJZA 3I5YA 2YVUA 1OHHD 1QHNA 4LGMA 1J8MF 2AHOA 2ZRGA 3AUYA 5L3SB 1Q3TA 4DCUA 4L9SA 3KB2A 5F98A 1OLOA 3QE0A 5E7JA 4A15A 1FUUA 3PVSA 4I4LA 1TEXA 1Z28A 3C41J 3UMSA 2V3CC 3QXXA 1N6PA 4D0NA 5BW8A 2ZEJA 4TMKA 3ICQB 1GVNB 5KSYA 5GJBA 2WWYA 5CB8A 1IY2A 2P5TB 4ZV4A 4LYFA 4IFBA 2BKUA 4Q4AA 5JEDA 1Z2CA 2QORA 3AF3A 4N0EA 3KQHA 1QHHA 3RRNA 1EESA 3P20A 3Q3JB 4TYNA 2GEVA 1US8B 3DHWC 3EW9A 3V9PA 3TSOA 3LW8A 3O47A 2NPFA 4EPRA 2QAGB 3QEOA 4URZR 1P72A 2VP0A 3WMFA 4LRWA 4D0GA 3VR3A 2F3RA 3QF4A 4W5HA 2BEJA 1NVVR 1X8JA 3IO3A 1AK2A 4B6FA 2J87A 1RRCA 1T9HA 5AR1A 3KDSE 4E03A 1KSFX 1KNXA 5EXPA 5LDDC 4QFMA 1DAEA 5GVSA 4PXAA 5CLQA 2RGNC 1W5SA 1G4AE 2QPOA 4R98A 4KITB 3UPUA 2KSQA 3IBYA 3H2YA 1GL6A 3O8DA 1F2UA 2R6DA 3LO5A 4JLPA 2FX3A 2B7CA 2ZSAA 1NSFA 1QG4A 1VCMA 3LFUA 1UBFA 2PZEA 4LJYA 3BD9A 3QXHA 1SULA 1E98A 3T34A 3THOA 4BFTA 3T5DA 4V0MA 1HQCA 3VNUA 2ZE7A 2IYSA 2AXNA 2A5YB 2IYVA 3UG7A 1UKYA 4YQFA 2ONJA 2ZANA 1JBKA 4B33A 1WDTA 2XJ4A 5BYJA 4Q1AA 4ASUA 2ZAMA 1E4YA 2C99A 3QPWA 2OV2A 2ZS7A 1GL7A 3LQRA 3NTUA 2MSEB 3LH5A 1D9XA 2QEQA 1ZIPA 3DPUA 3KJIA 2QE7A 3B1ZA 4BFZA 1G8FA 2IEZA 1K5DA 3SBEA 1W36B 1E2DA 4GOJA 3WY9A 5C46F 4G3XA 4BEBA 3KJHA 4HAWA 4DRZA 3U7FB 1XEWX 3OEED 3IQXA 2O8BA 2VLIA 4P31A 1IN5A 2NQ2C 2RGDA 1EWRA 1WP9A 2RGCA 2VL7A 1IXZA 3HU1A 3QKSA 1VIAA 2BBWA 2ONKA 3M6AA 4PQRA 3VX4A 4EJSB 4MDFA 1AQYA 4A8JA 2XGJA 4L8GA 3WRYC 4OQNA 1KMHB 2GWHA 1P2VA 2BIFA 4B3DA 3T12A 4AG6A 3RNLA 1IN6A 1EFRA 2QY9A 5CK4A 1XMVA 2FFQA 2OG2A 2W0SA 4LV6A 2GBLC 1L8QA 1E6CA 2YHSA 2WM9B 3VKWA 4IFEA 3EG5A 2IA5A 3CF6R 2QM7A 5AJZA 4JBWA 4TLAA 2O8EB 4X8HA 4NYMQ 4Q4HB 3B9PA 1G5RA 4BZQA 2RH5A 3GJ3A 3B9QA 1M8PA 4X8LA 3Q8XB 1C4OA 5B30A 4AURA 3DMDA 4URXR 2R8RA 3IQWA 4TL9A 1E79D 1XEXA 4U5XA 3TKLA 2FZLA 3JZAA 5D3MA 2ZJBA 3C5CA 4LCBA 5GJWC 2GEDA 4POAA 4AG5A 3L2OB 4LUCA 4PPGA 2PJRA 1CRPA 2QTVB 2EFEB 2XITA 4HDOB 1GAJA 1QZXA 2NO6A 1ZMXA 3E2IA 2IYQA 4TYYA 1ZM4A 4D26A 2QTFA 3U61B 3P1JA 2W6IA 4D4KA 3WBJA 2VBCA 4DLXA 3BB1A 5DSZA 1ZNXA 2V9PA 3F5FA 3CNOA 4P0TA 2VP4A 2GEUA 4BFYA 2BBTA 4IOJA 4DZZA 3BB3A 1OKKA 4TMTA 1KAOA 3K9HA 2IS6A 3RRZA 1DG3A 1X1RA 1E2FA 1ZM3A 1RRPA 1W4BA 4RKFA 5L3QA 3LDAA 4PC1A 1ZYUA 4M9SA 4TN1A 5FPSA 4PFSA 2REBA 2G88A 2ZIAA 4OHVA 2G3YA 1XFAA 3B13B 2LKDA 1V43A 3A4NA 3GCGA 1P9WA 3THXB 4NP6A 3I4LA 3THYB 4KFTA 4MRNA 3VR5A 2IF2A 3CKLA 3FB4A 3U6BA 4F91B 4UXIA 1NLFA 4PSKA 4QGFA 3M0EA 1S1CA 1NBME 3BJIC 2H17A 2WWHA 3MMPA 3U3OA 4C0LA 4CIDA 2VH5R 1YZUA 4RVCA 3T06B 1E2EA 1F2TA 3AQ4A 2R62A 5KU1A 2CNWD 4XVQA 1NKTA 5EZ5A 2G0NA 2XJ9A 1TPZA 1U8YA 1QHYA 2BBOA 1XEXB 4M21A 1S4QA 2IYUA 3VTKA 5BN5A 4W7SA 4GBMA 4NMMA 2WJGA 1E99A 3GFTA 4R2IA 5DYGA 2YNMA 4GFDA 3AKEA 1CR2A 2JA1A 3ASZA 4TYWA 2ZRDA 4B3CA 1KDTA 2D62A 3SZRA 4PQFA 3ZH9B 2NGRA 3FMPB 4Q7JB 1T8UA 3AP3A 4Q00A 3ETLA 5EP4A 2V7QA 1AGPA 3EZ7A 3K9NA 1UKZA 1G6OA 3NIBA 2ZUDA 1UEJA 4OHYA 2ODBA 4JLVA 1YR6A 2BEKA 1M6NA 4JLDA 3OZXA 4RZXA 1B0UA 1XJ0A 2ZR7A 3W9YA 4F93B 3DM5A 4RZ3A 1U9IC 2XNDD 3PUXA 4DDWA 221PA 3RLFA 2PT5A 2IL1A 1JR3A 3IUYA 4EPXA 2WKQA 1XXHE 4YMTA 1XWIA 3LA6A 4EJSA 3SYNA 4ZDWA 2QSYA 1LFDB 4Q1EA 4Q18A 4UKDA 3IIJA 1E2NA 4DDUA 3TVTA 3MG9A 2CHVA 2EWVA 2WSMA 3IILA 3EWAA 1ZCBA 2FV8A 1PLJA 4JVNA 2ZM5A 1N0WA 2CL7X 1P7CA 5A4JA 5FI1B 1JAHA 3LXRA 4BLQA 4HLUC 5GJCA 3NBZC 4WIAA 4DLWA 1K8RA 1N6OA 4ACBA 4ESVA 4UNRA 1R7RA 1XTRA 4KLNA 2IK8A 5EJEA 1KI6B 1XJQA 3CRW1 2O8FA 2OILA 3TMKA 3EC1A 4ZCLA 4LWZA 4QGHA 1KO5A 1GNRA 4B44A 3WNCA 1GILA 3OF5A 5TDHA 3SEAA 5TV2A 3NEJA 2QPAA 1BO6A 2FA9A 1DS6A 3BWDD 3RS0A 1YZQA 4BGDA 3QOFA 4DHEA 3PEVA 1D2NA 1KI7A 3MLEA 2WVJA 1PLKA 4LHVA 2XSZA 5CM8B 4QBHA 2R6FA 2WAXA 3NKVA 4TLEA 3NC1C 5JLJA 4JBYA 5LPNA 3W5IA 3BAFA 2ZVQX 5GVRA 4CVNA 5DHAA 3ZZTA 4NYMR 1N5KA 1BIFA 4RJLA 3WHKA 1NG1A 4BFWA 4PHTA 4PZYA 4EFMA 1CRQA 2W00A 3K0FA 1DAIA 4B34A 4HATA 3K0SA 5JRJA 4AKGA 3MSXA 1JEDA 1E0KA 1Z0IA 1XMIA 3BK7A 1XXHB 1KHTA 2BOVA 5HZHA 1G7RA 1HURA 3P27A 3D3QA 1JR3E 1GTVA 4V0KA 3HPQA 2E9SA 2PCJA 4KBFA 1VTKA 1W4RA 2E1RA 3L0PA 1TMKA 2CNWA 3K09C 1ZD1A 1QHIA 4M1MA 5CB6A 2J0SA 5KNDA 1KTVA 3TIFA 2ZPTX 5TXGA 2OFOA 5E4FA 3JVUA 1N6KA 1OXUA 1PJRA 5TB5A 3SHFA 3DL0A 3MFYA 3TQCA 1LB1B 4IJMA 2RGAA 3VKGA 3IIKA 2OFXA 2ZJ8A 5IK2A 1RYFA 4URVR 1NN1A 3AEZA 4RD3A 2FEMA 4YMSA 3ZJYA 4C9BA 4PZZA 4Q1CA 2ZRFA 1KIMA 3WMGA 2Z43A 4JLAA 2HJVA 2A5GA 4LJAA 4IDPA 2CLDX 3PEWA 3CWQA 3DKVA 4E5UA 4CEHA 2N1BA 4GZLA 1EK0A 4NL4H 1E1QD 2O0JA 3GJ0A 2QMEA 3FKQA 1XTQA 3K8YA 4MKGA 1PUIA 2GBLA 1NBMD 2ZE8A 3FTQA 4IDQA 1DAHA 1O87A 2YOGA 4EQ6B 1XTKA 2QGNA 2WJYA 2EFHB 5CITA 5J47A 1NJFA 2NOAA 3FVQA 4EPYA 4DSOA 2REOA 2ASEA 3TUIC 4L4UA 1VCIA 1D8TA 4JL6A 3K0AB 1T0JB 4Q47A 3CW2A 3OEHD 2WICA 1RFLA 4B2PA 4G5SA 4W5WA 1BH2A 4FMDB 1G291 5BWMA 5IRCD 2CEAA 3BBPA 3KFXA 2Q6TA 5AK0A 2IEYA 2IXFA 1UBEA 3CX6A 4A4DA 5A0FA 3ZZ0A 3B60A 5J4LA 4IW3B 3ADCA 1JXOA 3ZQJA 1NIPA 3KKPA 1JJ7A 4B2IA 1T4GA 1W2GA 1QHHB 3AH8A 4CEIB 3AVUA 5KUTA 4WW0A 4URYR 5IHPA 3K0AA 3N5CA 2QE7D 4B32A 4PX9A 1CLUA 4JLOA 5JWOA 2CK3D 1R0WA 1S9DA 1E9AA 1J70A 4X8MA 2EFGA 5FI0B 4A0HA 1N6LA 1XBTA 4LHXA 4A1FA 2DWOA 4U00A 4YXWA 4HAUA 3GD7A 2ZITA 5JECA 1ZRHA 2ECKA 1E9EA 1FNMA 2G6BA 3DVLA 1LY1A 3QIAA 4CGZA 2O8DA 2G1JA 4B74A 1XCPA 3PJRA 3TUZC 3HPRA 3RWOA 1ZJ6A 1CP2A 1E9SA 2DWPA 2J0UA 2ZJAA 1AQUA 4ZCMA 1KJWA 4IVQA 2VP5A 5AUOB 1MRNA 1Z29A 2QMHA 4DCNA 3GLIE 1NN0A 2OXCA 1OXSC 3U5ZB 4L16A 1XEFA 2IYTA 4C0AC 2C2HA 4G5QA 4NCIA 2FFBA 3DMNA 4US1R 3TH5A 3NH9A 3C5HA 4F92B 4KVGA 5J4YA 4DLRA 2VHTA 2FDCA 1YZKA 2RCNA 1MKYA 3GEHA 1Q20A 4JLKA 4JKYA 5JCZA 2FG5A 4JVSB 1RJ9B 4KI0A 3IPXA 1U8ZA 4PQYA 4XVRA 2O8DB 1NVXQ 2ATXA 621PA 1IBRA 3E1SA 3LBHA 4JLMA 3U44A 4H1UA 2IS4A 1X3SA 3AVPA 4I99A 5SZHB 2JAQA 3IHLA 4A2WA 1DO2A 1HH4A 4TTRA 1DAKA 1IY0A 1RRGA 4LI0A 4LOAA 1OFTA 2L0XA 1ZW6A 3NBXX 4DCVA 3H1TA 5FOVA 1CS4C 3B1WA 5EE3A 3DOFA 1NKSA 3U3JA 4DUGA 4O2RA 2D2EA 1A1VA 3A4MA 5HKKA 1Q1EA 3U7HB 1CJUC 1Z6XA 4HSEA 1G19A 4ZI2A 5FPYA 4KLZA 2AK2A 4RD1A 2XXAB 1VDZA 2A3RA 3CWZA 1E69A 3CF0A 4FWIB 4O2LA 4ZI3A 3ADDA 3ICEA 1ETUA 3QJYA 1FQKA 5LD2C 5M04A 1W48A 3P4YA 5BN4A 1GZSA 1E9FA 2QMUA 5LB2A 3RS4A 1WCV1 4NCKA 5JWRA 1SXJC 2OAP1 2GJSA 4KYUA 1KNQA 4MYTA 1HE1C 1IONA 1YRAA 4BWYA 2ZTSA 4MGYR 1E9BA 3J81k 2OBMA 4A36A 4GSYA 3PEUA 1IXSB 2KBEA 4BASA 1KKLA 2PEYA 3H4MA 1R5BA 2CDNA 2ZVPX 3A6PC 2EQBA 2C9YA 3WNDA 1UBGA 3B82A 2YC4C 3I1FA 2CMKA 4FMBB 1P62B 4OQMA 3V4RA 1PZNA 2WMNB 1G17A 4C0QC 1RVDA 1W49A 4IRUB 2XTZA 3OAAA 3UG6A 4LJ5A 3OEHA 2GCOB 2QQ0A 1Q21A 4WXRA 4IDHA 1BYIA 3UATA 2O0HA 1OYYA 2YV5A 3B78A 1YR9A 4JT2A 2C9OA 4MA4A 2GVDC 3THWA 4TLDA 3FKSA 2KE5A 3K70C 4YMWA 3A37A 1OB5A 2ZRAA 1E9DA 3QUSA 4PSAA 4NDZA 2V54A 4QXAA 4Q9IA 3W5JA 2EWWA 2XX3A 4KFUA 2DFLA 3KX2A 4L9WA 3WP0A 2JJ2D 1E1RA 2DCUA 3ZGXA 2F1HA 4DKXA 4R9UC 1OJLA 4HB3A 4ARZB 2HUPA 1Q0UA 2HXYA 1E0JA 3LLUA 4K8OA 3IGFA 4KO8A 1A82A 4RD0A 3PUWA 4WZBE 5J5CA 4Z51A 2IYLD 2X8AA 3QKRB 5EXSA 4TZ0A 5KSPA 1G8YA 1Q22A 2LKCA 4YLGA 2R6CA 1DEKA 4Q48A 1NI3A 1KO8A 2H18A 3I8SA 4MYUA 4M1KA 2ZXUA 3ADKA 2GKSA 4ILEA 1TQ4A 4JJZA 1RIFA 4QBIA 2FSIA 5L8VA 2NO1A 2OZEA 3CZPA 2NG1A 1ZINA 2IF0A 1MR3F 4LJ7A 4MITA 1P73A 1F3OA 4NYIQ 1E2MA 4QM7A 2OHFA 2I4IA 3SOPA 3EARA 1MV5A 2J9RA 4IOMA 4L5BA 5DIFA 2WTUA 4MKFA 1VKJA 1U98A 1Q1QA 1MABA 4JT4A 1P9NA 2JLRA 1GOTA 4O0MA 1KI1A 3NXSA 3Q72A 3K09A 4B3BA 4F4JA 3EAQA 3KKNA 4AIIA 3EA5A 1Z8FA 2FF7A 2JDIA 2WSSD 1NSTA 1XP8A 4FW9A 2RGNA 3CONA 3W3AA 5AJYA 3WHLA 4CT5A 2AKYA 3BE4A 4KYIB 3R7WA 4LDJA 3GLIB 3TAUA 3ZS8A 5KDDA 4B6EA 5B64A 4QHTA 5TMPA 1E2KA 1Z0DA 4GMDA 4YMUA 2A9KA 2DR3A 1EXMA 3UKDA 2RGBA 5FUWA 4MRSA 4PHHA 1IN7A 3G0HA 4AYTA 3NHBA 3QEJA 2QNRA 4P3YA 1E96A 2PZFA 4JVMA 3P4XA 2JGNA 1R2QA 2JLUA 1E4VA 2J0QA 1R10A 3L8ZA 1GRNA 3WRXC 4U02A 4N1AA 1FQJA 1FZQA 5EQTA 4QGAA 4Y0VA 5FL3A 2EW1A 3DDCA 2Q9CA 1VG9B 4I81A 4II7A 4Q1BA 4QNMA 2VEDA 3AF0A 4HZIA 4EPTA 5A5GA 5K8UA 3ADBA 4RFSA 3KB1A 5FUVA 4ESHA 1CIPA 4D4MA 3OFNA 3T35A 2AK3A 5AWFC 1G8PA 2WWWA 5E7MA 4LSGA 3L0OA 4PC6A 4QJ4A 3RRYA 3KKQA 2DBYA 2ZS8A 5DLQC 2ORWA 3QKUA 1HYQA 3HR7A 1W0JD 5FPHA 1E9CA 1D5CA 3HU3A 3ZZUA 4A6PA 1BS1A 5FTJA 1P9RA 1GP2A 4JJKA 4RCZA 4A8JC 4MRVA 4HDQB 1KSGA 3L8YA 3FOZA 4M1SA 3R9WA 1XCGB 3EWSA 2P6RA 3E5HA 3L43A 4UNSA 1TEVA 1AA9A 1NMXA 3CPHA 4HLDA 2ZJ2A 4D4LA 2Z4SA 3FDIA 2WWIA 5H68A 3RANA 3CNLA 4A0RA 4Q4HA 2HDNB 1FX0A 4MRPA 3MJHA 3CNNA 1WBBA 2J59A 5EP1A 4ON9A 3KQUA 1V5WA 3CPEA 2OBLA 4LJ6A 4YDHB 5K8IA 2IS1A 1EFTA 3VKHA 2G0TA 2CLCX 3Q7QA 2VHQA 1RC8A 1W5TA 2TMKA 2BBSA 5DI3B 1CU1A 2FU5C 1VHLA 2C95A 5JI3E 4DLZA 4M9QA 3LRPA 4DSTA 4M1YA 3PEYA 1E0SA 1TL7C 3CR8A 4RFVA 3QSYA 2ZRLA 5KO2A 4CDGA 4Q4JA 1YZLA 4IVPA 1NG9A 3W90A 2OT3B 4NCJA 1R4AA 1N2CE 2OXRA 4NH0A 1NP6A 2GF9A 4BLTA 2QM8A 3QENA 2IUUA 1E2GA 1SGWA 1AIPA 5FTLA 4J0QA 2JLZA 2GAOA 4OQXA 5JCPA 4LC1A 1E2LA 4EPWA 3X1YA 1UPTA 4C0JA 3VQTA 2GA8A 2F3TA 2IHBA 3EA0A 4NYJQ 4HAXA 4URUR 4AD8A 2J5XA 2PX0A 2I3BA 4FWTA 3N2EA 2AFHE 3GEEA 5HKKD 1GM5A 1KY2A 2AX4A 2DYKA 4OK6A 4HUQB 2Z5FA 5AJXA 2O5VA 1F60A 3QKTA 3IKJA 4D80A 1F48A 3UIEA 2D7DA 1PLLA 1PUJA 4LX0A 2W58A 2PL3A 2ZSDA 3GJ5A 1DARA 4TT3D 3NC0C 5LD2B 4DLUA 1ZC4A 5HE8A 1FL9A 5LB4A 4ZDJA 3C14C 4DIEA 2ZQ5A 1MO6A 4E22A 2WOOA 3CX7A 4A6XA 1AS3A 4NHOA 4UQOA 4DB2A 1F2UB 3QI2A 3QF4B 1HE8B 5EE5B 3L0SA 1SVIA 2R6AA 5JBQA 1CJVC 1Z08A 3VR4A 4TLBA 4A0FA 4YMVA 2JATA 3K0CC 4MQBA 3LD9A 3GLIA 1RZ3A 4U7DA 3SFVA 2A78A 2FWRA 2XAUA 3KTAB 4KU4A 1OFIA 4GMXA 2GCNA 3AP2A 3F0TA 1OKKD 1IN4A 4TTQA 4DWJA 3RDPA 2ZI6A 1SXJA 4HLQB 2ERXA 5BQ5A 4PAMA 1G3QA 2V6IA 4P33A 4QBGB 4S2EA 4B76A 2V1XA 3CH4B 3OAAD 2SHKA 5E95A 3KFVA 2UZIR 5LBIA 1DAFA 3NG1A 2J41A 3AV0B 2JJ1A 3K1JA 2PBRA 4UNPA 1M7GA 2OLKA 4GP7A 3ND9A 4BRWA 2FE4A 2QL6A 2VHJA 3TK1A 1FX0B 4TLCA 1TTTA 1TADA 2R44A 1HUQA 4BECA 4Z54A 3TNFA 2WIBA 2ERYA 5EXTA 1FUKA 1I4LD 1Z0FA 121PA 4F4IA 4KAXA 2EFDB 2C78A 2CXXA 4MDEA 1KO7A 1F5NA 3GJ6A 5CJPA 1U9IA 4OKSA 2QSZA 4XH9B 2FSGA 1FMJA 1II8A 3BH7A 3BXZA 1VECA 1I4TD 1U81A 3OE7D 3BFKA 4JVLA 4BPBA 4FMCF 3SU8A 3A1TA 3REFA 4BZPA 4RZ2A 2HF8A 3BFXA 2ZJYA 1ZIOA 4FMDF 5C1BA 4QKQA 2OEPA 3BIFA 4HLUA 4UJ5A 3AVYA 4EAQA 4M9ZA 4AKHA 4GZMA 5GADl 3CX8A 3BB4A 1WF3A 5EE0A 3TQFA 5EP3A 3IDQA 3C4JA 4N0DA 1A5TA 1MABB 4QJ5A 1Q3HA 4OYHA 1HT1E 2G77B 2AL7A 2GJAA 2Y8EA 1NBMA 3EPKA 1XMSA 1Z83A 3H0KA 1QVRA 5KTYA 1KI9A 1G5TA 1S3SA 5H70A 1T6NA 3I3SR 1YZGA 2X77A 4TYQA 1U8AA 2UZ3A 3DZDA 1NVVQ 2AWOA 2FGKA 2G83A 1SVKA 2IUSA 4TTPA 5KYKA 4LK2A 1D2MA 4LY6A 1GSIA 5AUQA 1M2OB 2AWNA 4TWZA 2XNSA 3EZ2A 3KL4A 3MJRA 5IK2D 1U0JA 1YVDA 1OH7A 3IO5A 1Q1ZA 1D6JA 4I1SA 3VU9A 1ANKA 4ARZA 1TQDA 1X8KA 4C2TA 2XXAA 2H7VA 3UK6A 2V4ZA 1CR0A 3GLFE 3AVWA 1QDEA 3A1WA 2JJ1D 1Q1BA 3I5XA 3QVVA 3I62A 2IXEA 4EDHA 1IHUA 1N6HA 2WOJA 4EKDA 5TVKA 4BFUA 1C9KA 4YXWD 1ZNWA 3FYHA 2QA5A 2VHUA 2BM0A 2IYRA 2AN9A 4TSFA 3MWJA 1S3GA 1VG1A 2DFTA 2ZROA 3FFBA 2WKPA 2IYXA 2J46A 4TL8A 1GKYA 1OYWA 4B43A 4Q7MB 4C0BA 2BCGY 2Q3HA 3V00A 1BOFA 3TR5A 4A2QA 2QN6A 5KSOA 1UKEA 5C18A 4V0ME 2ZETA 2JASA 2PEZA 3IBGA 1XDBA 4BUJA 1NNEA 4FD2A 4V03A 4X8OA 4CEJB 1WXQA 2XSZD 4JMPA 1NLYA 5KNCA 3KXLA 1J7KA 2N42A 4D82A 5C4MA 1CULC 1K6MA 1W2HA 5G3ZA 1MO5A 2Q3MA 4LJ8A 4HYYA 1J90A 1UBCA 1HT2E 3FMIA 3MCAA 4XWKA 2GF0A 2GK6A 5AJVB 5DE3A 2GZAA 5HR5A 4MUAA 3P26A 3Q5DA 2J7PA 1HA3A 2MSCB 2ZYVX 1GRRA 1CF4A 1D2EA 2QQEA 4P4UA 4KCGA 2XZPA 3OE7A 4WVFA 4HDCA 3PXGA 2ZJOA 4Q19A 1XPOA 4DSNA 4GL2A 4Q9HA 1AKEA 3IPYA 2V55B 2Z83A 3B85A 1DVRA 1UJ2A 4C0KA 4G5GA 3LQQA 5EZ6B 4LBWA 3QKSB 3SS8A 2KI5A 1T91A 2BC9A 3T61A 4JLNA 1EGAA 2QRZA 3X1WA 2VYFA 1OXTA 3AF2A 2RHMA 2ZJZA 1IM2A 1KMHA 1T0HB 2JLXA 5DN6A 4CW7A 1P2SA 3GQBA 4OHZA 4LV5B 4FCWA 4PC2A 1KI3A 5SZIA 4A82A 4G5RA 2CVHA 2QP4A 4FMCB 2A7QA 5CJ2A 2BDTA 4IKEA 3RYTC 1OIVA 2BV3A 2Q9BA 1C1YA 3BORA 2WJJA 4RD4A 5J40A 2J7KA 2QTHA 2ZE6A 5EE1A 1AKYA 5HCNA 2GETA 1UKVY 5CDFA 5J4KA 1UM8A 4GDFA 4BFSA 4K81B 4LBZA 3UANA 2CBZA 4RY2A 1FFHA 3TBKA 1KI4A 5J4HA 4TMZA 2W0MA 3EZ6A 3OESA 1RJ9A 1JNYA 3KZ1E 3T1QA 4DVGA 1A2KC 1E3MA 2D74A 4PZLA 1Z07A 1OB2A 4FIDA 2BMEA 4IDOA 1WQ1R 1LF0A 4DDTA 2C04A 1KO4A 2OLJA 4D81A 1R8QA 4GT1A 4F4CA 2HT1A 4IEIA 4JIMA 4GOXA 2HCBA 2PT7A 4DSUA 2FSFA 4TT3A 1OH6A 4PR0A 4A9AA 1I4DD 3OFND 3GPLA 2WKRA 1Z0JA 3WYAA 2C96A 2YOFA 3RSOA 3TW4A 5EE9A 5BXQC 2ZR9A 3A1VA 3AF4A 3CO5A 1LF5A 1DELA 3OIUA 2VRWA 3QPUA 1UAAA 3JVVA 3W3ZB 2KJQA 3R7WB 2A30A 3WP1B 4DB4A 3UMFA 1W0KA 2MMGA 2QT1A 2GAAA 4LPKA 2X19A 4KV9A 2JLSA 3RSLA 3T1OA 3C16C 1MOZA 3AVOA 2CCKA 2IHYA 1P4SA 3OHMA 2F7SA 4LHWA 2QPTA 4Q9LA 1CBUA 1WA5A 3SYLA 2X1VA 1CEEA 4WOPA 1GDDA 4NE2A 5F2EA 3MGCA 4OHXA 1N6NA 1VHTA 1KK1A 2V6JA 2GZHA 1AJEA 2DFKB 4KJZA 2C77A 1N5JA 2ZRCA 5FR2A 4KFRA 4O3MA 1NL3A 3M4YA 5AJWA 3CRRA 2WSSA 4MGKR 3ZDQA 4P4SB 3CH5A 2ZAOA 1ZUIA 2O8CA 5FPKA 1JAIA 4EUNA 3HYRA 1OV4A 2XTNA 1P60A 2D4HA 1YZTA 3EC2A 3SN6A 2XNDA 2I1VB 2P5SA 3AVXA 1T3SA 1F6BA 2NTYC 2WAYA 2VTKA 3HJNA 2F43B 3VR6A 4LJ4A 1KK2A 1KZ7B 2GJKA 3U3RA 1XD8A 2ZRBA 4G0NA 2RHDA 3D8BA 5HZKA 3VR1A 4QGGA 3WNBA 1TF7A 2OBNA 4CEIA 3T1VA 2ZSEA 4M1WA 1JXMA 1NRJB 2H1LA 3BFVA 5B2ZA 3GLHB 1SXJB 3GFOA 2B6HA 2ZI9A 2VF8A 1H8EA 3LWNA 4ERNA 1XX6A 4HEJA 1R5OA 5ANRB 1SKYB 1ZM7A 2ZSBA 3VX3A 3OIWA 4L15A 4FN5A 1FNNA 2YOHA 4PC3A 2F1RA 4DLYA 1Z6YA 4GOKA 1OE0A 5HTKA 5DI9A 1VCOA 2FPMA 1DAMA 1AS2A 4B47A 3AGPA 2O8CB 1FMLA 1ZD8A 2BCJQ 2VA8A 5DNYB 2IYWA 1P61B 2YJTD 3C8UA 4B73A 1XPUA 4NONA 2RKOA 5JRZA 1Y63A 3W6OA 1ZU4A 2P2LA 3B2EA 3BRWD 2JEOA 5H8WA 1G41A 1IOZA 3ND8A 3PFIA 3PR1A 4OI1A 1XD2A 1L4YA 2B21A 2BM1A 2ANCA 2BMFA 4HAYA 2AFIE 1YRBA 4NCHA 4A8JB 2QAGC 3K53A 2P67A 1GFIA 2FOLA 2W6JA 4G01B 2XOKA 1ODFA 1US8A 2W2XA 4E07A 1JPJA 3GJXC 1E0AA 2EVWX 4NPHA 4TSFD 3SC3A 3AKCA 2UVQA 1UDWA 3LY5A 2BVNA 3NBFA 2RAPA 1GIAA 1N5LA 5IDVA 3TSZA 5F9HA 1N3BA 3CF2A 1L4UA 3MAAC 2VHCA 4F38A 4LHZA 5H1YA 3R8CA 1XEWY 3KUCA 1N25A 1HTWA 1YQTA 3G82C 3MWKA 1X6VA 4JZKA 2GCPA 4XD7D 5CYPA 1ESMA 2HEIA 1NY5A 1OIWA 2RGXA 1LW7A 2HYIC 1W44A 2NO0A 2PCLA 2Q9AA 4DUGD 4M8NE 1ZNZA 3M1IA 1OIXA 1GITA 2ZJ5A 1RW4A 1M7BA 2FNAA 3GJ8A 1KYIA 2OO7A 4S35A 4JL5A 3OIYA 2GZDA 5JMTA 4XTCS 2D06A 3RABA 2GK7A 3MRSA 1MH1A 3THWB 3FMOB 3ZVLA 1T3LA 5E7IA 4R2HA 3BH6A 1L7VC 3CRMA 5L3QB 1L2TA 2B92A 3LLMA 5F9FA 2UKDA 3R9XA 3I8XA 3NDBB 2P6NA 4Z8XA 3MUFA 1E1RD 3PIRA 1SVLA 4GPTA 5JFGA 2ODNA 1KSHA 1OXXK 1RE0A 2VO1A 3TLXA 3FWYA 3X1XA 1EFRD 1NIJA 5IT5A 1XF9A 2NPIA 1S8FA 1T5IA 1SHKA 4YONB 5CIWA 3QBTA 2CCJA 2IWRA 2X2FA 821PA 2REXB 3RS7A 4JBXA 3GJ7A 2FJUA 2ODEA 4A0GA 3ZQ6A 3CB4A 3S1AB 3AM1A 4M1OA 3SYKA 4D6PA 2ZYTX 4HI0E 3CM0A 1R5NA 2DFNA 2DWQA 3RC3A 1XB2A 2OAQ1 4M2LA 3CR7A 4JSTA 2C03A 3LV8A 1Z6GA 5KSZA 2VP9A 1RPZA 1ZU5A 2FN4A 3T1TA 4CZ2A 3AVTA 1KDOA 1LNZA 1OHHA 4UXHA 1DO0A 3BC1A 3U2QA 1SHZA 4AWXA 3TGPA 4CT4B 1ELOA 5CLLA 2D7CA 2GESA 1EFCA 2F6RA 2PX3A 3K9GA 3VMFA 5FBLB 1OXVA 2PMKA 2ZUCA 4IEEA 3U7EB 2CL6X 1M74A 3AKDA 3L0IB 3ONWA 1AZSC 4PSVA 1KJYA 1Z0AA 2A5DA 2LCFA 4FINA 5JSZA 1NVWQ 3EASA 5HCIA 3AB3A 4FCVA 4QHYA 4CEJA 2WMOB 4GNKA 2QBYB 4TL6A 4IXNA 4R71A 3K70B 4HUQA 2YWGA 3PUYA 1TQ2A 4Z8YA 4CF7A 1I2MA 4C0HA 1AM4D 2Q21A 4GP6A 3R8FA 4RFSB 5C4GB 1IN8A 3X1ZA 5GJVC 2AKAB 3FE2A 5JS7A 4OK5A 2GCOA 2CL0X 2IT1A 4US2R 3EZFA 1LV7A 3ZVNA 4TMXA 3V4FA 2ZI4A 1IXRC 2OFWA 2F1IA 2ZE5A 4WZ6A 1EX7A 4DC9A 2VSFA 3Q9LA 2IWHA 4XVUA 4DBLC 1XMJA 2PLFA 1OFHA 2IUTA 1PV4A 2VF7A 2XOKD 1JPNA 1CJKC 2BKEA 2W6JD 2ZU0C 1SKYE 5P21A 3B6EA 1E94E 2F9MA 1WRBA 3QBVA 1VG0B 1JR6A 2QBYA 1EG7A 2AD5A 1G7TA 1G18A 1VMAA 1A2BA 1XXHA 4C0SA 1R0XA 3KKOA 1FPMA 4HAVA 3BERA 3TR0A 4QBFA 1N5IA 2EYUA 4ZDKA 4C2UA 1F2TB 2BMDA 1YKSA 2ZI7A 4K46A 2BWJA 4OBEA 3GLGB 1WE2A 2QP9X 4C7OB 1ONBA 1UF9A 5EUMA 3B5JA 3ZVMA 4HB2A 2B8WA 3HWSA 4XD7A 2GRJA 4C4PA 2CHGA 1R0ZA 3CPJB 1Q57A 3K0CA 4TQUS 3EXAA 3TSWA 2OCPA 3EPJA 2PH1A 5EUQB 1TF2A 2YWHA 4NKRA 4OK3A 5CK5A 1H8ED 3T15A 4H9GA 3LNCA 1ZUNB 2HLDD 3QNUA 2H5EA 4WBSA 1XJCA 3SHWA 1MO3A 1LTQA 1OSNA 1VYUA 2I1QA 4Q21A 4LV8B 1GKIA 4IVRA 2RB4A 1GNQA 2P65A 4IHQA 4HUTA 3ZS9A 3GLFB 1T5LA 4M0LA 4ZIRA 2WWFA 1NY6A 4W9MC 4M4SA 4ZKDA 5FOUA 3EZ9A 1G4UR 3RC8A 3NVAA 3WBKA 4XWAA 4Q03A 1KOFA 2LWIA 3SI7A 3SJAA 1JI0A 4ZCIA 1DAGA 1BMFA 1FTNA 1II8B 3AP1A 2VSOA 4V0LA 4B3FX 2CCGA 1OF1A 1ZM2A 3CLVA 4BLRA 5JJKA 2RMKA 1U0LA 4PHGA 4ACAA 2HJGA 1H65A 4MGIR 5UKDA 1ZNYA 1NN3A 2NIPA 4OQLA 1JB1A 4Q4LA 5CIQA 5CYOA 4AKIA 1SVOA 1KMQA 5L3SA 5L3VA 1COWD 5G40A 3K70D 2FEOA 1Q44A 1GUAA 3FFAA 4GI7A 4OJKA 4RZUA 4OI0A 3GLHA 4AC9A 4M53A 1CTQA 1W0JA 2EYQA 1G3UA 3W6NA 1G3RA 4QM6A 1G5PA 3QXCA 3A58B 4C30A 1QG2A 3GLGE 4ZPXA 1GL9B 1YU9A 4DCSA 4MKIA 3AVVA 1JEEA 3PQCA 3D6TB 4Q01A 3SFZA 4B75A 3K0EA 3U3MA 2J45A 1QVAA 3CUEF 4LC0A 2FMXA 5DISB 4BFVA 4UXJA 2IYYA 1KKMA 1MT0A 2H92A 3LVQE 2HT6A 3SR0A 4KBGA 2D2FA 3A1SA 4OI2A 2H57A 3TAHA 3CRVA 4DLTA 4XIGS 3IEVA 3UWOA 3ZIAA 4XJXA 1UADA 4Q4AB 5DGXA 4B71A 2WZQA 3P32A 4MKHA 1R6BX 2NZJA 1AZTA 2V7QD 3Q7PA 1DTSA 2O52A 4TMVA 2WJVA 4I1OA 4WZAE 4Q02A 5KPDA 4LJ9A 4QOSA 5KDLA 3IEUA 2CE2X 2G9NA 3GLGA 4YC7A 2ZYUX 2ORVA 2W2TA 3B7GA 2YWFA 1E2IA 5HE9A 4OJQA 4AYXA 1A4RA 4AKEA 4PO9A 4Y0AA 4PPNA 4M22A 1Z5ZA 3H84A 2J1LA 2JLYA 1HQYE 1EFHA 1N6RA 1W0KD 3DEFA 4TZ6A 2GILA 3RAPR 2PJZA 1CR1A 3K9LA 2R2AA 1IJFA 4JL8A 2ZUBA 2OSBA 1G64A 1ZVQA 2B7BA 1H8HA 2AXPA 4KXFB 4Q5IA 4PHFA 5D3MB 1IAQA 1XU4A 2A2ZA 1SVWA 3KUDA 1FTSA 2F43A 3IIMA 4H1VA 1KY3A 4RD2A 1G3IA 2G1KA 4Q9KA 2E87A 3RRMA 4D2IA 3F3YA 5FBQB 3VFDA 1E2PA 3LBNA 4JYBA 3VHLB 1N0UA 3N70A 2H8KA 4MGZR 1ZAKA 5DHFA 5ELXA 2QAJA 3MWYW 2JIZD 4QRHA 2OCAA 5FH9A 3CIOA 3HDTA 1S0UA 4Q1DA 4AK9A 2W83A 4NYIR 4M1TA 4OHWA 4M9XA 3NWJA 4DEXA 1KZGB 2IX3A 3D7MA 3FHOA 1TNDA 4EFNA 1G6HA 2DB3A 1GWNA 2XB2A 1EWQA 4DT1B 3FMFA 5JZVA 5DI3A 2GDJA 1Z63A 1XCMA 2J7PD 3B1VA 5DYIA 3DM9B 2YINC 1J8YF 1COWA 3HYTA 1U90A 3KJGA 3G5UA 3RS5A 3TE6A 4ZIRB 1MRSA 4MH0R 2QMOA 1IQPA 4FCTA 1M7HA 2ZI5A 4IOLA 1YR7A 3B1XA 5CM9C 1JR3D 3U4QA 4Q9JA 1W1WA 5FL7D 4BLSA 5FTMA 2ODWA 4P4TA 3U44B 3O8RA 4ABYA 5DN6D 1YZNA 2O0KA 2QI9C 2YZ2A 3RS3A 2VPPA 1HY3A 2FPKA 2PLRA 1SVSA 2GXUA 2ZYWX 4DIDA 1VCNA 3KQKA 2IS2A 4HLCA 3E70C 5B58C 3SBDA 4UJ3A 4LBVA 5AUPB 2BMJA 4NZYA 5EP2A 1II9A 1JALA 2PMDA 1CKEA 4D0LB 2CJWB 4JLJA 1ZUHA 1P2TA 2HLDA 3KXIA 5FFMA 1TUEA 3QF7A 5L3RA 2JLQA 3ZYCA 4B48A 4RD6A 3CZQA 2YKGA 1P2UA 1CJTC 3L82B 4FXPA 4G5OA 1QHSA 3WYGA 2RGEA 2J3EA 4PPQA
chains in the Genus database with same CATH superfamily
3LAWA 2NZ8A 2GASA 1VL2A 3ZV7A 2WV7A 5L6MB 4F72A 2ZJ3A 4B8WA 3OPVA 1THGA 2C84A 1WV1A 3ZVKA 3KR9A 4CKCA 1SKUA 4N54A 2FKNA 3EXFB 3JAMA 3C3CA 3DV0B 5K5EA 2PZGA 2Y92A 2FWNA 4QU8A 2MOKA 3DJFA 1UOOA 1FTQA 1WDMA 3O84A 4LOIA 4Q12A 4EPVA 5A5FA 3A4VA 3NBYC 1AK1A 4TTAA 2XWPA 1H0KA 1RYHA 2MYUA 2QQ5A 1DJLA 2ANBA 2HX1A 3KU4A 1UAYA 2C9CA 3DZGA 2AMVA 1Z34A 3GVXA 1V7QA 1EFUA 3L7YA 4KXXA 5IANA 3WBBA 4Q4JB 2Q41A 3FNQA 4LOKA 2CXHA 2YXEA 4XOIA 4DMUB 1SR8A 1Y80A 2BTQA 2UVPA 5JAQA 2NMVA 1V1MB 1ZSNA 3WICA 4CI9A 2CZGA 2AJ8A 1GCUA 3RB8A 3ZE8A 1VRWA 4DV3B 1DI0A 4DXDA 1ID1A 5LA6A 4V24A 5KDOA 2YQZA 3OD1A 5F2NA 1PFQA 3OTIA 3L7MA 2Q5HA 4CV1A 3R9IA 3TLKA 2DSNA 3LA8A 2VJCA 4JEUA 4UU7A 3DQPA 3QVGA 5JMWA 4PEVA 4DV2B 2C2KA 1UC9A 1YQXA 3WMEA 1AE1A 5KYUA 4MYCA 4P3OA 2XIQA 3SJCA 5IABA 2XOEA 5BMVF 1D9ZA 3CRQA 2C8JA 3F7TA 3PFFA 2PWBA 4RYDA 4UHBA 5ECYA 3P52A 4NU0A 4B4UA 4JFAA 5JDCA 1R0YA 4P3XA 5J43A 3U17A 4KSCA 3NATA 3VU9B 2Z9DA 4A92A 5KWVA 2XE6A 1ATIA 3OZSA 1OH5A 4IV8A 1PR1A 1VJCA 2EL7A 1PD1A 1CY6A 1VPLA 2Z2IA 3DLTA 3JD2A 2ZWOA 3L0BA 5DM0A 3U3DA 3IMCA 3W5HA 2HWKA 4L8LA 2JHFA 4KQIA 5LP6B 5JJ5A 1Q12A 1WBDA 2CJYA 4ARVA 1NVKA 1JJVA 1XTSA 2BRUA 1LS1A 4O2BB 3JATA 1I80A 2OUKA 3O92A 4IIBA 4NCNA 5FBRB 2ZQYA 2F2TA 1YR1A 4R9RA 3NM6B 1RAFA 1WUIS 1E2HA 2XA1A 1JQLB 4QYXA 5AW6A 4RPJA 5L7WA 3BZBA 4ZZ1A 3LPCA 4R9VA 1NGSA 3BCSA 3VPAA 3EPHA 1ZBDA 3WIEA 1R66A 2AJDA 4O25A 3E4DA 2GFIA 1IEVA 4KODA 5J1SB 1C14A 1MO4A 4LJLA 3UJAA 2JLWA 1YIDA 4HK4A 3KE9A 2IYEA 4FOOA 1T43A 1RWXA 4AJJA 5DO9A 2G08A 1AKTA 3H8JA 1GQQA 1V45E 2CXNA 2HGSA 3FUTA 3PUKA 4HZUB 4RSGA 3TQHA 1WXIA 1WW3A 2QRVB 4QPCA 1SWVA 3UT0A 5L4NA 1Q0RA 1ULUA 5J2UF 1EM8B 4TTIA 5AW8A 3CC8A 1UXIA 3OC6A 2RIPA 5ALNA 3U7QB 5ARDA 3OEEA 3ABZA 3ESYA 1G5IA 1HL7A 1UOEA 1K6EA 4JFRA 5FBVB 1A4UA 3WQRA 3KQNA 1EDBA 2O2JA 2YZKA 4TQ9A 4EHHA 2ZTHA 2JLVA 3BRQA 3GRZA 4F6RA 1JTVA 4B3XA 1OW3B 1E4EB 3I2IA 4IP0A 4CLHA 2F9LA 3N2NA 1XHEA 2BR3A 3DO6A 3SAJA 3WRVA 1ZGAA 1WPQA 3CBQA 1CJMA 1FFEA 3ABOB 3UBTA 4GMFA 2BHNA 5E6UB 1P2BA 4U6NA 2PE5A 1PN3A 1PT6A 2VUTA 5ALOA 3TSAA 3SQLA 3GNLA 3Q6IA 4ASUD 2M6RA 3T3NA 1K9VF 3I32A 1MVLA 4PLPA 4UFPA 5A4AA 3MD0A 2WYWA 4FIZA 3UC9A 3PE4A 1OWOA 1E3IA 2XEXA 1EB9A 3I9NA 4Y6QA 3G23A 1QHXA 3HH8A 3K1AA 3KK0A 4TRRA 3GLFA 3VH4A 4IQ4A 1AUPA 4JI6B 2ZTLA 1U3GA 2PSDA 1IJEA 1NWCA 2DKNA 3KQYA 2PQ6A 4IBOA 4LSZA 2Q0SA 3ICWA 3OEWA 4WA7A 2ZSFA 5JNVA 4FE3A 2N46A 2VCEA 3L7BA 3NP9A 2IOQA 2P6UA 4G1CA 1P9OA 1KYZA 1QGDA 4NMHA 1SXJD 5ILOA 1G20E 1S1MA 2P2ZA 3EIEA 4X6UA 2O8FB 4IHAA 1SCAA 5DGCA 2WPDA 5E3HA 3T3HA 3THYA 4C3ZA 1YI0A 3D81A 2UVPB 1PFVA 2W5UA 3H86A 1F4VA 1GKUB 2AMYA 1YJAA 3JVDA 1NUSA 3PT5A 4LCJA 4E5VA 5A4MS 4BJ1A 3SY8A 2A3NA 2HJSA 4ZGWA 2Q5CA 1DMRA 2IGTA 2J0UB 4MEJA 5L40A 3BA6A 3RVMA 5E1DA 1SHLA 1DV1A 1XK7A 3MVEA 4ZTUB 1XDDA 4EMUA 3TFOA 1CY0A 4AMGA 4ZRNA 1NX6A 2Z4RA 3D5TA 1PJTA 1CFJA 3EGWA 5EVCA 3U40A 4MMXB 1Z62A 2G72A 1YB4A 3CCCA 3G6WA 3JWJA 1RXEA 4E15A 4EX6A 4DWVA 1CDDA 5AVYA 1NRIA 1TKCA 3ZIAD 1QGED 3QQ5A 4K0RA 3RKSA 1GSAA 4FFOA 1F12A 4TGLA 4AZSA 2QJOA 2OP0A 3EMKA 3R75A 3OKPA 3TQSA 3VZDA 3M4XA 4FK8A 4I6JA 4DABA 2O3SA 4P32A 3AEUA 3EFOB 3PFKA 1MW8X 2DPLA 3ZWNA 3DE5X 2GX6A 1X1AA 8ATCA 4LYJA 3FWHA 3ZK8A 1UANA 3FPHA 4PYKA 4BCDA 1H1LB 1XTZA 3Q3EA 3QU2A 2O1XA 3N8IA 3U7GA 3JQ7A 3ECCA 2F00A 5G3YA 1KZHA 1IPHA 3R0QA 1EHYA 1V3VA 3B3AA 1KORA 3G0BA 4HDNB 3SD7A 3I2YX 4YBRA 1TDJA 1UT6A 3EVFA 3NOXA 2QGZA 4CRWB 4ZJZA 1O96A 2V3VA 2ZRNA 3M33A 2CKMA 4XWWA 5BUZA 2BHRA 4R8RA 4TSRA 4E1BA 4E5DA 3KWLA 4DA4A 4MQ4A 5CH5A 3URKA 3A4YA 2BKAA 1EGHA 3A3PA 3FOCA 4RLHA 1EBBA 2HJRA 3WOHA 1P5RA 3TXXA 3WK7A 1A8PA 3U6KA 5J1TB 3GQBB 4LYEA 3RVQA 1OT3A 1W4AA 3MXOA 4Z0NA 4PAOA 2VKQA 4I1UA 5DK6A 4EO7A 5AIBA 4MS3A 1RAGA 2HSZA 3E3LA 4Y9DA 4K6HA 4Z9FA 5EHZA 2P75A 3U16A 3PQ4A 3BE8A 3S1AA 3WWYA 4ZDIA 4BY9E 4M8SA 4KC0A 3EVCA 3FHTA 2AXEA 4GYKA 4ND8A 2OCXA 3LLSA 1W88A 3PNLA 4A2CA 4PG8A 1U7TA 2JVKA 3NHAA 1BU5A 2PPVA 3SQXA 2YRWA 5AJTA 1NQVA 4R40A 5HQJA 5TPWA 1P4HA 2XXJA 3RVOA 2JFFA 2VCHA 3EXG2 3FMGA 3EIQA 5CLFA 3DE0X 1BVYF 4ZVOA 721PA 5AKHA 2JI6A 4GBED 2FWMX 4YMLA 4PGHA 2PMCA 3RO7A 3QBEA 4A8TA 4GRAA 4OHCA 1E1NA 1YHZA 3NDPA 4ZK2A 2ZREA 5K3EA 1L4FA 1QF9A 3M6VA 1WMFA 1XPRA 1NMYA 3BS4A 1AHHA 4PO8A 4JC0A 4QUIA 1YS9A 2G9QA 1BMQA 5DBIA 5JEEA 3PUVA 3OLCX 4ZO6A 4R0VA 3TRFA 3WJ2A 1EX1A 5HVNA 3W5AA 5JJLA 1OLXB 2QENA 3BSFA 4DQUA 4AZTA 4EUEA 3GNQA 4LQCA 3M6MD 1DG1G 2ZCJA 2QN8A 5H5JA 1L7BA 3EGXA 3FPGA 3Q7TA 3DOEA 4X6XA 2UUBB 5CDFE 1R9JA 2BUBA 5IF9A 1BGWA 1KU6A 3BTVA 1MN6A 2QRGA 1HV8A 5JQGB 4D4JA 4XB2A 1G8HA 2GZRA 4Z49A 1NJ8A 4CV3A 4N9WA 4F96A 2C8KA 3GRFA 3T41A 4XWOA 3ZD6A 3ORQA 2YRFA 1W4CA 4NV3A 3SKXA 1DNPA 1E5LA 2CJXA 1XA0A 3MT7A 4J7CA 1G1MA 4IY1A 1X7DA 1U7XA 4MWBA 3TRIA 1C7JA 3HXOA 3I9V1 1A9OA 3AUXA 4YALA 4PPFA 3GMTA 5FCDA 1RXIA 4OATA 4GKKB 1FOEB 1U0RA 4BC1A 3UJ6A 2I7VA 1HQDA 1N0VC 1XZFA 2WWXA 1JHVA 3ZI0A 4B40A 1JZTA 4EW2A 2RJ3A 3D6FA 1I7PA 2OCYC 1WDLA 4UCWA 3KTAA 3VAAA 4FI3C 3SWWA 3DZBA 3BYZA 1IHDA 5TPZD 1ONOA 4PQEA 4PG7A 1XCJA 1KEWA 3S81A 1JIXA 4JYZA 2W6NA 4ZCMA 1EFPB 4WCVA 5HTOA 3C6BA 1YCFA 3KOZA 1EWVA 1HZZA 4R7ZA 4P0PB 4LYHA 3ASYA 5KQPA 3NVKI 2QT0A 4FYPA 1C0IA 1N34B 2TMGA 1L7NA 1LLDA 3W3AD 2OBYA 1PQ4A 4XSGA 1LVGA 2HBRA 3QPVA 2ZB3A 1T5TA 3HS3A 5REQA 4BMZA 2LZ0A 1TZJA 5ENZA 5F3WB 2WPDD 1P33A 3G2KA 4LXXA 3FKSD 2MU1A 3AHGA 1AKRA 4L4SA 3A36A 2B1RA 2F3PA 3TF5A 1WWKA 4Z4GA 1WTCA 3WLQA 4D8YA 1UK6A 1EP1B 1YRHA 1Y5RA 2RBKA 2UDPA 3K4QA 5B7GA 2PZ8A 3OX4A 1PNRA 4MW7A 2JL1A 1UIRA 4KHZA 3P9PA 1NQOA 4CMGA 1XPJA 2DPXA 1NMEA 2F1JA 2DR0A 2XDYA 1PVOA 1LU9A 2DOKA 3G0CA 1RP1A 3N2KA 4YI5A 2YYZA 1C80A 1SOVA 2BCEA 3VGJA 4E70A 2ECFA 2QZ4A 5AK5A 1B23P 3ONFA 3OZVA 5F5LA 4CFSA 2ZRMA 2L42A 3UAXA 1J00A 4A23A 1SKQA 4ZK6A 3FM9A 2NVOA 1P1BA 5EIHA 5ITWA 1DEXA 1HNNA 2FPXA 2Z8YA 3N0XA 1JHUA 4HVTA 4NBWA 1RT9A 4PTZA 5FR1A 2G1UA 3RASA 2C00A 1E60A 4HTFA 3SJBA 5JCXA 1ISMA 1CY8A 1LI4A 1TZ2A 2CSXA 1T2AA 2ZT6A 5ERYA 5BO5A 1TU3A 1KDPA 3S2FA 2N75A 4KPYA 1FEZA 3K1TA 4B9EA 2BELA 3CQ9A 1QHNA 4GDMA 4YJ2B 4DN6A 4A3SA 5LIPA 1N77A 2ZT7A 1H2YA 3GJZA 5F98A 2NXNA 3PVSA 4P5EA 5CH8A 1TEXA 1Z28A 4OXIA 4YJKA 5ECWA 3A6LA 2Z30A 4LZWA 1GTZA 4K6MA 4H7FA 1SM4A 5BW8A 3ETNA 4IM7A 3JRWA 1N7HA 3AEYA 4M8LA 4EGCB 5GJBA 4IGKA 1IY2A 2PSHA 4U6SA 4Z4HA 4C6TB 4IFBA 2BKUA 1K98A 5EZYA 5DX1A 1RHJA 3LT4A 3W5BA 1ZK1A 5BV0A 2IEIA 2QORA 5F2OA 3BVPA 4COKA 5IBQA 4HMOA 3MZ0A 5L53A 3MERA 1J25A 1GZUA 1CZHA 4CMIA 4HDAA 1MJNA 5HGXA 1X7WB 3GZNA 1E4OA 1K3UB 1HYGA 1US8B 3DHWC 1MORA 2PNFA 1UBRS 2G8NA 3COZA 3QNMA 4RMHA 4EYEA 4GIBA 2WT9A 3AXSA 3AUJB 3IB6A 2XKBA 3ZX5A 2BEJA 1NVVR 2CXOA 4DM3A 1PTJC 1X8JA 3IO3A 3N3AC 1B6SA 4CIBA 1JLKA 2Q5FA 1BVRA 1EK1A 3GO4A 1EUDA 4UCQA 1LDBA 2QTTA 1KNXA 1MTZA 1OI3A 3WGHA 4GXNA 2A9VA 2ENUA 4CLRA 3WLKX 4Y1GA 2VUUA 2QVGA 3H7IA 2RGNC 1W5SA 4G26A 4KITB 2KQUA 4CODB 5F23A 3FVVA 1GL6A 3R41A 1T24A 2ZSAA 1UM9B 1VCMA 3HRHA 1Z56C 1DIBA 3V2IA 3QWFA 1E6KA 1YHYA 2Z98A 1HQCA 2JPDA 4FEEA 3PFHA 2H4FA 2BONA 4L5YA 1T8SA 3LO8A 2IYVA 2A5YB 4IF4A 4F9GA 3T95A 2CLKB 4G4SP 2JFBA 1KA9H 1O2DA 3GHHA 3K4HA 4UMDA 3RE1A 3UG7A 3V1NA 2WE7A 1MX9A 1JBKA 1SMKA 1WDTA 3DH0A 3HB9A 5BYJA 2AEMA 2J33A 1JG7A 4OU4A 4PZAA 3R7AA 2OHVA 3I37X 3RUPA 4FC7A 4D7AA 1FP4B 1B15A 4GPD1 4DQKA 3I01M 1QTRA 1E6LA 1RPJA 4Q93A 2QEQA 2QVYX 3DPUA 5CEJA 3GVPA 2QE7A 3NAMA 2DHDA 5DTMA 3MWEB 3TG8A 4AXBA 3UQYS 2JK0A 4E21A 3CF4G 4H6XA 1XROA 3E61A 2VAWA 5FPHA 2CL5A 4G3XA 4I1RA 5HF9A 2ZB7A 3OUZA 1WHSA 4HX2A 4V3BA 5AM4A 3OEED 3R5HA 2WD9A 3DV9A 4IMPA 1O95A 1NI4B 3ROMA 4YFVA 2QX4A 3FSJX 1QM5A 5LU9A 1ECJA 2MDTA 2V74B 2VKTA 1CPYA 4ZAXA 1G2OA 1I36A 1WP9A 2ORED 2WU8A 3QKSA 1IXZA 3GGJA 4G9BA 2BBWA 2AA3A 3VX4A 5K6AA 4X54A 3DOIA 3FDZA 5K0SA 1ZUNA 2IODA 3NW9A 2CMFA 1NPYA 3HL0A 3HR4A 1JHOA 3IEPA 3A2NA 5HK8A 4IWNA 5JDIA 5JZSA 3HKEB 1WPXA 2R1ZA 2EZ4A 1V5GA 2JGKA 2A1IA 4U7PB 1O77A 2JHPA 2OL4A 1TFRA 1WM1A 3IB3A 4AX8A 4AG6A 1ULZA 1YMUA 5MFZA 1EFRA 3DYVA 2PL9A 4RA9B 4UBIA 1GPYA 5DGDA 1PO7A 1GTL1 2X9VA 1IPEA 3JQGB 4FT2A 2GBLC 1WD5A 4C78A 5KNCH 3U1BA 1L8QA 2WYOA 3VKWA 1ZMTA 1Z73A 4M76B 1VP3A 2EKDA 2IA5A 1N2GA 3L7CA 2QM7A 3N8DA 4K2HA 4KGXA 1VKNA 2VDOB 5TPWB 2HREA 3STTA 2G1PA 2FZVA 4HFJA 4BB5A 2O8EB 3EVTA 3S2GA 3TX6A 2C3MA 3LT2A 3DCIA 2XMCA 3DNMA 3B9PA 3KC2A 4U6QA 5KJEA 3CLTD 2YWBA 2RH5A 1BDBA 4PXYA 4LXTA 1M8PA 5BUCA 4AAYA 1VB3A 3D54D 1SIBE 1Y3HA 5EGSA 3CXUA 4ETWA 2QX9A 1FDIA 4GYWA 1I3KA 4QXOA 5F2KA 5FBHA 3ZTWA 5K0GA 4TL9A 4QOEA 1RI4A 1U6IA 2FW1A 2I8LA 1Y89A 4U5XA 3OQPA 2H11A 4MW0A 5AHKA 1NU8A 1X38A 4LCBA 1THTA 3L04A 4IGEA 5GJWC 3AI7A 3UUGA 3L2OB 4B85A 3R5JA 1FLDA 5I6DA 2GZMA 4OIFA 2QTVB 2DTDA 4BBZA 3HY4A 2YW2A 4TXMA 2HBZA 2NO6A 1E8NA 1H1LA 3ANYB 3PE6A 5TVGA 4I46A 1EA5A 4MPJA 4C4RA 2QTFA 4P7GA 3P1JA 3KB6A 3LT1A 6REQA 4D4KA 4BATA 2XUAA 5DN9A 2VBCA 4S04A 5K99A 3AHJA 3WJAA 2V9PA 3F5FA 5HBGA 4UTVA 5A04A 5CR9A 3QMMA 3V4SA 4YT2A 1PWHA 2JA2A 4UE6A 4G0ZA 2PUGA 4BFYA 2CD7A 3EWNA 1PR2A 3WADA 2FQQA 4TMTA 5T8KC 5CHYA 3JYLA 1KAOA 1ZGCA 1NBOA 3QOXA 3BMCB 3TIXB 5ALFA 2IS6A 4RDXA 1W6RA 3CT4A 2G06A 1RYDA 1K4YA 2GQ0A 3H16A 2VZ8A 5ESWA 4ZGGA 1UQUA 1X1RA 2XA2A 1U8TA 1RRPA 5TJHA 3WGGA 1ZG3A 4M9SA 5IC6A 4TN1A 5FPSA 1QHEA 3GRPA 3H1EA 3K2BA 4PFSA 4BX0A 2XV1A 4YY3B 1U2DA 2REBA 2P9JA 3BWMA 2G88A 3O4FA 4MUNA 1R4MA 1Y1PA 2XNJA 1YQGA 3A4NA 1H4SA 1BCSB 1LBIA 1UODA 3K8ZA 3F4LA 3SEZA 3P96A 3DZJA 4K9OA 1V8FA 2LDBA 1UBHS 3THYB 3O9VA 5B2FA 3UHJA 4KQ9A 4F91B 2WU4A 1C7ZA 3HCEA 4WPGA 1S1CA 4KX3A 1E6UA 3S8EA 5AVVA 2WWHA 5BV8A 4W1RA 3SX4A 1U4OA 2IQIA 4LDZA 4RHXA 5KNDD 1F2TA 1HDEA 4XWYA 4L9AA 3KTDA 4XVQA 4RS3A 3WGZA 3DE7X 5A9RA 1TPZA 2WVAA 1KQ3A 3CLKA 3TKAA 3MJFA 3JQPA 1RM5A 3JAKA 5JJCA 2IYUA 1TKRA 3VTKA 5DEIA 1IB0A 2AOTB 1TECE 5BN5A 3DLBA 2GYVA 3KYCB 4G1VA 3GT3A 2WJGA 4LNUA 2O2YA 2J3HA 1AB5A 2PKYX 1R8JA 3DP9A 4XGKA 1ML3A 3GFTA 5DYGA 4X91A 5J23A 1D1SA 3CNHA 1XVIA 5HS6A 3ASZA 4YECA 1CE8B 3DFZA 1X7ZA 3DLIA 3V32A 3H1GA 5I4KA 3SZRA 3OI7A 3C70A 2VHXA 1IQUA 4UTOA 1D7AA 2J6HA 2NGRA 4XJTA 3ZH9B 1I32A 3ETLA 1BRTA 4RETA 1AMOA 3NNNA 2QZJA 3MOGA 5CW1A 3DT9A 1V4VA 4OHYA 2H31A 3KOYA 2ONCA 3UUFA 2O19A 3BKXA 2BEKA 4KDCA 4LX8A 1QUFA 1XJ0A 1YB5A 3VPFA 4IYRA 3NC4A 1MJGM 5KQRA 4O4IA 1PT5A 3H2GA 3PUXA 4DDWA 2D1SA 3IUYA 3H75A 1JR3A 3WZLA 4WEOA 3H9EO 4RFLA 4D45A 2GN8A 2HNAA 1GXSA 2CXSA 3B48A 1ECLA 4HH3C 1XWIA 5TQ2A 1C3OB 3SYNA 2HWUA 2PX5A 5T4EA 3WWEA 3P94A 1EJ2A 2WDPA 2ZJ6A 1EGQA 4M0FA 2A84A 1ZVJA 4Q1EA 3ZHCA 4PYOA 4JJ8A 3NJRA 3IILA 3I39X 1PBTA 3LHIA 5JOQA 4KDEA 3U37A 2ZM5A 2SICE 1ZOLA 3IP7A 4ZQGA 5FI1B 4DA0A 4HLUC 2QRVA 4I36A 1QR6A 4J4BA 1K8RA 1N6OA 1U2QA 1JT9A 3PX7A 2EDCA 3AFOA 5FWXA 5JNSA 3KLNA 4JR0A 4ESVA 1P8AA 4RHFA 4XASA 4RHTA 1QJCA 4KLNA 3K05A 1T1JA 3KE8A 3OY2A 3AM4A 1XJQA 3G8BA 3REQA 2PH5A 1ATZA 3IR7A 5F73A 4YUWA 2MYNA 4Y1RA 2C4TA 4Y2JA 1RKUA 4NV0A 1ZUD1 2OILA 5CH3A 5D5HA 3TMKA 1CY7A 5C5CA 5CLJA 4PLWA 3HKCB 1ZH4A 3H0CA 1J42A 4PRKA 3WNCA 3R09A 4B44A 1TYCA 4KN5A 3SEAA 4DPLA 4L0MA 3M81A 2ZAGA 3GZ4A 5FX2A 1ZL2A 3C97A 1IEQA 3NVMB 3QPAA 1IE3A 3BWDD 4MDHA 4MZDA 1YZQA 1Z37A 1IBMB 3NKLA 4PIVA 4MW2A 4EF6A 3TZCA 4CM7A 4OX9B 4AZVA 2GNPA 5LYJF 4CWAA 2V7VA 3ODPA 3KJZA 3QVGB 1PLKA 4KN6A 3S5UA 4EHBA 4QBHA 2R6FA 5B7NA 4B4DA 4EJ0A 2XRYA 4C2AA 5CFQA 5IJZA 3X44A 1I2AA 3HVJA 2ZOSA 4BYGA 1V16A 2I5PO 2VSQA 4QFDA 4GVXA 5GVRA 4KL8S 2EQ5A 2BT4A 1K86A 2J5QA 3BEOA 4RO0A 3E9MA 3MIIA 4NYMR 4KR0A 4XCVA 4LDPA 1GGJA 1NE2A 2AOUA 2V0CA 1UWCA 1KGSA 1FSGA 2DHQA 1OREA 4G36A 4Y2QA 2LRHA 4ESEA 5E1BA 2CJPA 2IY9A 5A05A 3DKIA 3K0SA 3ME5A 5FUBA 1HE4A 3HO8A 4FHGA 4ZXFA 4BNTA 4CQMA 3OZRA 4MVXA 5J58A 1E0KA 4BNZA 5CX1B 5KOHA 1G7RA 2YFQA 4JJ4A 4C4OA 5B4UA 3ZU3A 1HORA 1WCYA 3IEMA 5AHXA 4YJFA 1D1TA 4LTMA 4M1MA 1VZ2A 2QMQA 4LG1A 3KWFA 1JVBA 1W59A 4FS3A 4DNPA 4B4OA 2HHHB 2ZPTX 2GK3A 3ZTYA 1K1EA 2P5UA 3JVUA 3DOUA 1N6KA 1JILA 1OXUA 1PJRA 3QYAA 1WCWA 4HYQA 1ULBA 3SHFA 4A03A 3F7OA 3ETHA 3DL0A 1PGNA 1V2GA 2W90A 5A5EA 4WBNF 3A6HA 2EEPA 2YZ7A 1C3JA 2RKWA 2RGAA 3PRHA 3ZY2A 3IIKA 2OFXA 4Q6WA 1ZMOA 3DV0A 4QRDA 2X8WA 3PX2A 5C34B 4F9TA 2PR2A 4LDNA 4DR1B 3ZJYA 4C9BA 5M7EA 4R54A 1TM1E 1Y3DE 2Z43A 4Q4DA 1Q2XA 1PJQA 3GL9A 3QM1A 2CLDX 1DHTA 1RZUA 1SAYA 3P2OA 3DKVA 3PEWA 4CKZA 4PICA 5F77A 2N1BA 4GZLA 3E22B 1M6YA 1F20A 5KQLA 2J5RA 4HRXA 1E1QD 3WRXA 1I30A 2PGXA 4OLFA 4R69A 5LOVA 1XTQA 3KSDO 3K8YA 1XLUA 1Y7LA 4YP6A 3FJ1A 2XYRA 1CNEA 3PNMA 2EJCA 4JGGA 4W5NA 3PNBA 2RH9B 4QLOA 1QPGA 5LLSA 4GR5A 3T3GA 5CA1F 1XTKA 4MEBA 2H48A 2WJYA 1CYDA 5LDGA 4WKNA 5CITA 3N76A 5KU7A 1NJFA 3ANLA 2XDQB 5ARCA 3D3KA 3HBJA 1C4XA 2REOA 5CVVA 5EIWA 4DSOA 2OZLB 4A27A 4I2NA 1UMDA 1E7SA 2YHBA 4TSKA 4Z4FA 3OEHD 1RFLA 4QOHA 4P4GA 1SBQA 1P2DA 1ZITA 1BH2A 1LSJA 1Y4UA 3OKAA 4FMDB 3Q1KA 2HU8A 1FTGA 3C2QA 1LPOA 2WSLA 3RRJA 4A4DA 5A0FA 1KEEA 5GOTA 4ARBA 2D1TA 2HSJA 2C57A 4K88A 1H22A 2A0KA 4GEGA 2FCAA 1KEVA 4HD8A 3AVUA 1JDBC 1O4WA 4RAOA 1H2FA 4R0NA 4E7PA 1IIRA 4EY8A 3AEKB 3N6XA 4FYVA 5IMSA 1PQWA 4RHCA 1CLUA 4BAUA 5JWOA 2CK3D 2B35A 2Y68A 4EG5A 3E3AA 1N9ZA 1U0NA 2PM8A 5LOVB 1TVEA 1R0WA 3EVGA 4KACA 2PX8A 4DMMA 5I7UA 2W2NA 1ACLA 5FI0B 2QXTA 2X7JA 2HHAA 4L0DA 4OGKA 1JFLA 1T9GS 3WB2A 4YT5A 4RJTA 2X23A 3CN7A 3GD7A 3KR2A 4HAUA 4TKUB 4UVHA 2X1HA 3BDVA 4X1IB 5BPFA 3Q7EA 4JDPA 4DV5B 2Z56A 1ZRHA 2G6BA 1FNMA 3DVLA 2O8DA 3QIAA 1PNVA 4CGZA 3VH1A 4EG7A 1G21B 3Q2IA 1G8AA 2ADMA 3GT7A 3PJDA 3HPRA 2PX6A 4K1LA 4OHFA 1T6BY 2GPJA 3RWOA 2V0GA 2WTAA 2XMQA 2ZJAA 1EX9A 3G59A 3IYLW 4IVQA 3AU8A 5AVTA 1E1CA 3AESB 3KVRA 2P4QA 4KUGA 1PJ4A 2Q4DA 1RMTA 3RFTA 7ADHA 1YS4A 3FDFA 1KAEA 2C2HA 4G5QA 4MVJD 3DMNA 4US1R 4MJLA 1BD4A 4KVGA 2NVWA 1DBRA 2OB2A 3DYBA 1YZKA 4FDVA 4N7MA 2FDCA 3O73A 1CE8A 4N6GA 1L5QA 4U2BA 2RCNA 1MKYA 3HVUA 3KL2A 5JCZA 4MLPA 4MR9A 3LPNA 1YV9A 3CZ5A 4ENSA 1RS0A 4XVRA 5SYNA 1E59A 2V9CA 4MVJA 3V5NA 5SZHB 1P2FA 2JAQA 3IHLA 3JQDA 5T3YA 3N39C 1DO2A 4L28A 5CX4A 2OXIA 1RRGA 3M5CA 3SNKA 3VR0A 5EXDA 3L1HA 4F3NA 4W63A 4KWTA 5FOVA 3RFXA 4CF4A 1QP8A 3F96A 3ZU6A 3DOFA 1DBPA 4W1PA 5LZ2A 2VJMA 5HKKA 1HZZC 3LECA 5THQA 4XYMA 1Z6XA 2EKBA 1S8OA 3LC7O 1I7LA 5H82A 3SF8B 1H94A 4BS9A 5JROA 4ZI2A 1Q92A 2AC7A 3VUFA 1VDZA 3CWZA 1E69A 4O2LA 2V97A 4MW9A 5A4FS 2BMWA 1ETUA 3QJYA 4JLWA 5LD2C 1W48A 2M32A 2L19A 1GZSA 3P4YA 4JJIA 3D0OA 3OY7A 4O2BF 5BN4A 4LJRA 1RBYA 1OFGA 3QKIA 1S8NA 2AG0A 4BO5A 4NXMB 2GO1A 4POOA 4ML3A 1SXJC 2O23A 1GCAA 2ZBUA 1K66A 3G1WA 4Y2RA 3TTXA 2DXIA 3EPPA 4JEIA 1NVFA 3PL1A 1Y9AA 1Z4NA 1IONA 1YRAA 4RHYA 3FSGA 4P84A 3MUEA 5EQDA 3F47A 3UB3A 2OBBA 3J81k 1JEYA 3CE9A 3HXMA 4WA8A 4ZVTA 2NTVA 4LK3A 2YVAA 3BD6A 1ZD3A 4TUYB 3FYUC 3WYEA 2KBEA 2QX6A 2I9KA 4QATA 1KKLA 2WHPA 2PEYA 4G24A 2XH8A 3GZNB 2CDNA 2FW9A 4FFVA 4EA9A 3A6PC 5HDBB 1RYEA 4GS5A 2XR1A 4GC9A 1Z7WA 1PZNA 1JKXA 1ORTA 1OA0A 4BN4A 5SY9A 4FQ7A 3TLJA 4IRUB 1MQ9A 1YNSA 3OAAA 1F9EA 1VBFA 2VXBA 1K68A 3OEHA 4I4CA 4LJ5A 1OZAA 3HTXA 4GX0A 1Z6ZA 2G07A 4CETA 3F46A 3BF8A 3PHJA 2O0HA 1OYYA 3N7TA 3VKHA 1YR9A 2QM3A 3CNBA 3OCWA 4JT2A 4WXEA 2CWDA 5E0KB 3URMA 3AF6A 4JAVC 3CSSA 5WRFA 4B3HA 4MARA 1XQXA 5FWNA 1JT2A 2Q7XA 1E9DA 1BJTA 3CUYA 1ND5A 1J8VA 3HJHA 4IJUA 4J3JA 2P7HA 1W25A 3HABA 3O4IA 3OZCA 2Q8PA 3NHMA 1JR2A 3WP0A 3KLPX 3S27A 1E1RA 2DCUA 1HFKA 1Q0LA 2F1HA 4Q6BA 3EEBA 3WDSA 3ZHBA 4DKXA 4E11A 5J2TB 3CG0A 4HB3A 2X0IA 4MVJF 3LLUA 1Z39A 1ONSA 4KO8A 3DYIA 2JJMA 3PUWA 1XDGA 4RY8A 3DE2X 4WZBE 1EVJA 4OP3A 2BM8A 1IBSA 5EXSA 1IXYA 1XI2A 2C07A 4GI5A 2GHQA 3UICA 2I80A 3WI7A 3WL6A 3AILA 1SUCA 4YLGA 5ICMA 1DEKA 4Q48A 2DQ4A 3EVNA 2LCIA 1JA9A 5JD3A 5I4IA 4O8CA 1VMIA 4XX1A 4BEWA 2K6GA 4IR7A 4IDBA 5L95A 1QQTA 2GKSA 2OD7A 1RIFA 3DGFC 3PI6A 4IDDA 4TUYA 5B7QA 2ZG6A 1TJPB 3CF4A 3CZPA 3QTBA 4EG4A 1CJBA 1MR3F 3O7MA 3ZY6A 1P73A 3DOJA 4XX0A 4QM7A 2I4IA 4ENQA 4X3PA 4QU5A 1X14A 1PTJA 4IOMA 3SQDA 4H6WA 4PSDA 3KRTA 1U98A 1NM5A 1Q1QA 1MABA 2HRCA 3GW8A 2CNDA 4JT4A 4PAGA 4BLVA 1KQGA 1B6GA 1TPYA 2FKAA 3K09A 2VK1A 4AIIA 1E3WA 2WSSD 2JDIA 1FVHA 1NSTA 1T15A 3LUGA 4FW9A 2RGNA 3CONA 2ZJ7A 3W3AA 2IDJA 3LUDA 3BE4A 3WHLA 3L1UA 3V4PB 1PRYA 4DIKA 4HN4B 2RG7A 3Q7RA 4MO2A 3PDIB 1N2OA 4LDAA 4CQMD 5KDDA 1QYDA 2XGMA 4DY4A 1YFJA 4D3XA 2J31A 5B64A 1EE1A 4K05A 5TMPA 2XCRB 1CNMA 5I3ZA 1KY4A 4BNVA 3C5WP 4FT4A 2A9KA 1ECFA 1FRVA 5FFNA 4BVEA 1NW4A 4O4HB 2AKEA 3YASA 1EWKA 5BW5A 5CGZA 3NBAA 2WJ3A 3AJEA 5CB0A 2ZT5A 1QQ6A 3C6ZA 2I71A 4AYTA 4ZVPA 3B5IA 4P3YA 2PDAA 4YP1A 1YKFA 1X74A 1BZYA 1T9GR 3CX4A 2JGNA 4LRXA 4GLOA 1P2GA 2P2CA 1IULA 1A97A 5JISA 3CG4A 3AXTA 2R6JA 3L8ZA 1GRNA 3OEYA 4UBKA 1N8NA 2XWBF 1OYVA 5CTJA 1YA4A 1XMQB 2Z6AA 3FPJA 1SCNE 3ZWOA 1ZIDA 4X65B 5IVKA 1SD5A 4LF5B 3S55A 1OU0A 4D6YA 2Q9CA 1VG9B 5A5GA 3TQRA 4HZIA 2VT7A 4YRKA 2FPWA 1A5ZA 5JQGA 3ZKAA 5FUVA 1THMA 4FEGA 1DKRA 3LBFA 3T35A 4OKNA 2WJZB 3PPYA 1NTRA 4YROA 5AWFC 1G8PA 5E7MA 2PMEA 2EKZA 3BWEA 3L0OA 4CCAA 1I5RA 1ZJ4A 3FBGA 2ORWA 1HYQA 4MV9A 5C0OE 5BRJA 4BNNA 1YD7A 3HRKA 4MI1A 2ZYHA 1L5FA 4JJKA 5COAA 2Y2VA 4ZGBA 1KSGA 1SWWA 3KEFA 3L8YA 1MV8A 1PR9A 4C76A 5K0BA 3OZGA 3NAZA 1AHNA 2PKRA 3I64A 3I09A 1UZMA 1KJQA 4J4HA 3VBCA 1NMXA 3WDKA 1BFKA 4LNAA 1ZSYA 4QT4A 2ZJ2A 5KQGA 3GRCA 4FILA 2Z4SA 3E7DA 3O8QB 1VIVA 2TMDA 5G2OA 2FR8C 1X7YA 4MRPA 4QTXA 1U2GA 3OTGA 3MJHA 2J59A 1ACJA 1QO0D 1R3UA 1CZRA 2D4AA 1GVHA 3ZQKA 4DSAA 4FUQA 4JUAA 1V5WA 4CM8A 5TIIA 3RIEA 1RWVA 1Y9JA 3RTAA 4ROTA 1WSWA 1ST2A 4EKNB 1W5TA 2RHOA 3UAOA 3PKZA 1YBHA 1X7HA 3ZXIA 2C95A 5JI3E 3LRPA 1NF8A 4S1NA 3UGJA 2X5XA 4M1YA 3PEYA 5AKGA 4FYWA 4TVKA 1M10A 3WTCA 2IHNA 3CFYA 4MOWA 2VWHA 4CDGA 3GBVA 4RVOA 2OGSA 3EE6A 4IVPA 5FV7A 3W04A 3GZJA 3I9V6 3W90A 4NU5A 2XPCA 4YI3A 1Z0UA 4AQDA 1NP6A 2NU7B 1I5EA 4OHOA 2QM8A 3QENA 2IUUA 1L5WA 3Q15C 4OYLA 4BE4A 1U0EA 1O9HA 3D7SA 2O1EA 1NV8A 4JH0A 4L4YA 2WTEA 4PYNA 4EJMA 2GAOA 4LC1A 2NZVG 4E32A 1F4PA 2QMYA 5IM4F 3ILHA 2ZTVA 1UPTA 4C0JA 1BE1A 4YRNA 5LYJB 1DLJA 4O4JF 2F3TA 3BIOA 4ITVA 3EA0A 4NYJQ 2CFCA 2LUOA 3K96A 4HAXA 3QYJA 4MR7B 4AD8A 2J5XA 4W8HA 3RK0A 1JLLA 2QTCA 3NNDA 4MYSA 4NX2A 1EYZA 3GEEA 1BQ3A 3K6JA 1Q2UA 2DYKA 4HUQB