3A37A

Structural insight into the membrane insertion of tail-anchored proteins by get3
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
346
structure length
313
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAAADLTGSIPGIDEALSFMEVMKHIKRQEQDEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATPase GET3
publication title Structural insight into the membrane insertion of tail-anchored proteins by Get3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 96
structure length 313
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a37A00
5E4FA 2BJVA 4KYUA 1FTNA 1EG7A 1NY5A 4XWAA 2XEXA 2WWXA 3CKLA 1JAIA 4JSYA 1ZMXA 4DLTA 4HZUA 1NNEA 1R0ZA 3VU9B 4IEEA 1G291 3CH4B 3EZFA 2Z43A 2J45A 2G88A 1EGAA 4DLRA 3EIEA 2G77B 3HU2A 5E7MA 3RHFA 2ZU0C 1WBBA 4YMWA 1BMFD 3RDPA 1X3SA 2OXCA 3LXRA 4ACBA 4HLUC 3VX3A 5EJEA 2ZJYA 2H92A 3KB2A 2Q3MA 3CBQA 3RSLA 4KHZA 2VBCA 4NTZA 4ARZB 4PC6A 3QY0A 4XSGA 4BEJA 3SI7A 5LB4A 1R0XA 3Q7QA 3WYFA 1KSHA 3GLFB 3GJ0A 4JMPA 2IUSA 4R2IA 1K6MA 2W83A 5JBQA 1DOAA 2D2FA 1H8EA 3WMFA 5JJKA 4GI7A 2XZLA 3K9HA 1NL3A 3IIKA 1FMLA 4JJZA 1Z2AA 5SZHB 1G6HA 1WF3A 1AQUA 4ZI2A 1TF7A 4JLMA 2YOFA 4IW3B 1W46A 3WRXC 4QGAA 1S9DA 1JNYA 2X1VA 4KSCA 4ZV4A 3B85A 1OT3A 3CWZA 1E2EA 1L2TA 1XEXA 2GKSA 4M1WA 5FFMA 3ZZUA 2O8FB 4KODA 1VMAA 3UIEA 2QTFA 2BV3A 3AF0A 1ZUNB 1DARA 1G18A 2OBLA 3HR8A 4ILEA 1TEXA 4A2QA 4JLVA 5CDFA 2IUUA 1M2OB 3MWKA 4AKIA 1IXZA 3L0IB 4RCYA 1OB5A 4AIIA 5KPDA 4OYHA 2JASA 4F91B 2OFOA 3QF4B 1P7CA 3K0SA 2ZI6A 1E0JA 3OE7A 4FWIB 2HV8A 3P4XA 2PEYA 2RGBA 2AXNA 2YVUA 1L8QA 1ZAKA 5EE3A 1RVDA 1WDTA 1XDBA 3KJHA 1UAAA 3KDSE 2AKAB 1KMQA 2C04A 5JMTA 1GOTA 1NVUQ 2NOAA 5C46F 1UADA 3A4MA 5GJWC 2DWQA 3L43A 4PO8A 3QIAA 2JATA 1ETUA 4OHXA 3QF7A 2O52A 3PEUA 4QOSA 2IL1A 3ZYCA 3T1VA 2BM0A 3WNCA 3VKHA 1I4LD 2VL7A 1NVVQ 1IONA 1CS4C 3KL4A 4LV8B 5JHGB 3K0AB 1Z6TA 4JT2A 1LTQA 3BERA 2QMUA 4PC3A 5G3YA 4PPGA 1GP2A 3L0SA 5FPSA 5EP3A 3D3QA 4BZXA 2ZAMA 1PLKA 3L8YA 2ZUBA 2XITA 1W1WA 4XWOA 4QBIA 1D2NA 2PZGA 3ZIAD 1GUAA 1KI3A 1U8AA 2ZJOA 1A7JA 2VYFA 4YMSA 5GVSA 4OQMA 4DJTA 3RRZA 3VMFA 4QXAA 1MO5A 2FSHA 4YDSA 5KDDA 4NYJQ 2AWNA 3TQFA 1N5KA 1NBMA 1P73A 3RS5A 3TSZA 3SDZA 4XIGS 4ACAA 4C30A 3A1UA 4JYBA 3UATA 2FF7A 5AK0A 5JEEA 2RMKA 5F9FA 3M4YA 2CBZA 2FG5A 2Q3FA 3THWA 1DVRA 4TSFD 4KYIB 5IK2D 1OPXA 3TQCA 3A1VA 1XCMA 3TJZA 1W44A 5FOUA 2WOOA 4OHZA 3ZD7A 1XD8A 1II9A 3QOFA 1FPMA 4ZDIA 3K8YA 2ZM5A 3GP8A 3FMOB 2AD1A 1OXTA 4LK2A 2I1QA 2OCPA 4K8OA 3EPHA 4HDQB 4LJAA 3AF2A 2JJ2A 4D0GA 4KLNA 1SXJB 3U3KA 1Z5ZA 3FWYA 5A0FA 1DAFA 4HDOB 2GESA 5HZKA 1OFTA 1Q3HA 3FYHA 2GVDC 3U44B 3E1SA 4LI0A 1GZSA 3A4LA 5E95A 3SJCA 4XWKA 5L3RA 5EP2A 5J4HA 2HT6A 3FFBA 3Q3JB 1SZPA 3HYTA 4LBVA 4DCUA 1MKYA 2I4IA 3I1FA 4PQFA 2X2EA 3VR3A 4CEJB 5CITA 1JBKA 721PA 2EWWA 3DM9B 1U90A 4Q1BA 5EP4A 4GT1A 3CNOA 2ZYUX 2FPMA 1XU4A 1VYUA 4DRZA 1OSNA 1ZCBA 1D2MA 4U7DA 3GLGA 4OQFA 2IX3A 2FWRA 4LRWA 4YQFA 1XB2A 2XNDD 2A5YB 4R71A 2DR3A 5CB6A 1TQ6A 4Q4JA 4I4LA 3Q9LA 4LHVA 2ZJ8A 1P72A 2OESA 3KJEA 4P3YA 4MYUA 4D4JA 3AQ4A 2BEKA 1G5TA 1AJEA 2J0UB 3LY5A 4IRUB 1GM5A 4G01B 2HJGA 3ZD6A 5G41A 1W0KD 3IIMA 1KO5A 4GBMA 3QVVA 1W36C 1T8UA 2DYKA 3T61A 1U2RA 1D9ZA 4RFVA 3WYGA 1JR3A 2JIZD 4Q03A 2Z4SA 3W3ZB 2QBYB 5K8LA 1H65A 2WV9A 3S1AB 8OHMA 1W4BA 3DMDA 4DSTA 3EWSA 3OF5A 3CX6A 1OLOA 3B82A 3PG5A 5DN6A 4F93B 1H8ED 3W8RA 2C5LA 3KTAB 5BXQC 2GCPA 1KDTA 3UANA 2V54A 4GOJA 2J46A 3B8HA 3RWMB 1JQJC 3LX5A 1T3HA 1S1MA 2IYTA 1OXXK 1GVNB 3R9XA 2ZANA 4CVNA 2ZYWX 5KNBA 3CH5A 2IYUA 4HDCA 3LO5A 4HZIA 4BFWA 3PUYA 1KI7A 2BOVA 3RC3A 3NBFA 1C1YA 3DEFA 2EWVA 4TZ6A 4RFSA 1UDXA 3NIBA 3QXJA 4B2LA 1QHIA 1ZM9A 1J7KA 4Q02A 1OYWA 4YMUA 4W5WA 5K8TA 1MV5A 1U0LA 4D4LA 1NSFA 4UNPA 3ZVMA 2OCAA 3HPRA 1CJTC 2QORA 1S9HA 5DE3A 1JJ7A 4RD4A 1AKEA 5CK4A 3P32A 1G1MA 4L16A 3VAAA 2IS4A 2WZQA 5FOXA 1RYHA 3I4LA 2FOLA 4Q9LA 4JBWA 3THXB 4IEIA 3THYB 1KDOA 4KJZA 5M04A 3QENA 4QBHA 4LX0A 2AR7A 2O8CA 2Q0HA 5CB8A 2QAJA 3Q8XB 1DO0A 2V1UA 2IYSA 2DFLA 4QBFA 3ND8A 2WSMA 5D3MB 3IGFA 1Q20A 4PFSA 1WCV1 1Y3AA 5CIWA 4BECA 5BN4A 3CPHA 2F3TA 4P4UA 2PT5A 2F43B 1BKDR 4M1YA 2HDNB 1XRJA 2AD5A 3BB4A 4JLDA 2PH1A 2PCLA 4G0NA 1W4AA 3DOFA 4C3ZA 3ZVNA 1K5GA 2J3EA 2I1VB 1CF4A 2WICA 1P2UA 1VHTA 3AP2A 4Z8YA 1OXVA 2BBTA 4PXAA 4TMKA 3AF3A 2REOA 4DZZA 5C18A 4TYNA 3O8CA 4OI4A 3IUYA 1TU4A 2HLDA 1KI9A 2GTPA 2AK3A 4S2EA 2HF8A 2WMNB 2B21A 4AI6A 3KUCA 2AXPA 3M0EA 3RSOA 5LDDC 2HEIA 4OI2A 1KSFX 3OIWA 2B8WA 2Q6TA 4OQLA 1T3LA 3T1TA 2GHIA 3VQTA 4DT1B 2VHUA 4AYTA 2VEDA 2J1LA 4Q01A 4DKXA 2YC4C 4MA4A 4EPWA 3VHLB 1V5WA 1NG1A 2A2ZA 3Q85A 1N2CE 4PPFA 4B3BA 2GXAA 2CXXA 3HPQA 4LPSA 1KOFA 4WVFA 1XZQA 3NDBB 5H8WA 3EG5A 1YRAA 3ZH9B 1M34E 3EWAA 1NN3A 1T8TA 4IFEA 3PUZA 4LYHA 3SZRA 4C7OB 4IVQA 4CDGA 3SHWA 4MRNA 3U3JA 1GRRA 3QXCA 2QP3A 1NF3A 4LJ5A 5AJZA 1U94A 2JJ2D 3PVSA 4OKSA 4Q47A 2XB2A 2PCJA 1SVWA 5HCNA 1E2NA 5KDLA 4D0LB 1Z6AA 2XTNA 1GKIA 2D3WA 2W6JA 2QM8A 2CNWD 5J5CA 1T5LA 4GOXA 2X8AA 1RJ9B 2R6FA 2GETA 2Z5FA 4FMCB 2ZRBA 3EC2A 3GQBA 5AUPB 2GXQA 1CIPA 3TIFA 4B48A 2VP2A 3QE0A 2NTYC 2DWOA 2ZSAA 4NU0A 1IAQA 2JLVA 4IKEA 3ZZ0A 4MKHA 121PA 1WQ1R 1EFTA 1CJUC 4PC2A 3GJXC 4BFYA 1Z0KA 2KBEA 4EIWA 3Q72A 4POAA 4O25A 4BASA 2UVQA 2WJIA 4FMBB 4BQSA 5J47A 3BK7A 1M1YE 4FW9A 2Q3HA 3NEJA 4NCIA 4MRPA 4YMTA 1W4RA 3OZXA 4GP7A 4G5OA 2QAGC 1QHXA 4C2UA 3NHBA 1PLJA 3LW8A 4JKYA 3W6OA 3X1YA 2ZS8A 5BQ5A 4YDHB 3QQ5A 1U8ZA 1ZINA 1FOEB 2ECKA 2FFBA 3IQWA 3HJNA 4EDHA 3R8FA 1Z2CA 3ZVLA 3IBGA 4A8JC 1E1QA 3OESA 4BRUA 3ASZA 5L8VA 1AGRA 4Q7JB 1KO4A 2IYRA 2RGEA 4GPTA 1GIAA 4LGMA 3MFYA 3CR8A 2O8BB 2UZIR 3B1XA 1WA5A 1WP9A 4DLVA 5C1BA 4AK9A 4JVLA 2Q9CA 2XZPA 4PQYA 2GXUA 4DHEA 4BUJA 1I4DD 5L3QB 4C9BA 3GJ4A 5DN6D 2NZ8A 3T5DA 3U60B 1NMZA 4Q7KA 1VG1A 4TYWA 2A9KA 3VKGA 3O8RA 2ZR0A 5DLQC 2BBOA 4TLCA 4IDPA 3CX7A 1KK2A 1XTRA 2LWIA 1HT2E 4RD1A 1JPNA 2ZS7A 1N6IA 4GMDA 4MITA 3UWOA 3SYKA 1WB9A 2WM9B 3ZQJA 2JA1A 2ZRLA 1YHNA 3BFXA 4NBSA 3UWKA 3LBNA 2PX0A 4A4DA 1W36D 1II0A 2OUKA 3EZ6A 1DTSA 3VNUA 1Z28A 5J4YA 3T15A 4DDVA 5KNCA 4LWZA 1SKYE 3K0CC 3NXSA 3M1IA 2B92A 2LKDA 3BD9A 2QSZA 3LNCA 4N0EA 2WWHA 3UMRA 5GADl 1P62B 1R5NA 3SU8A 5AUNB 3H1TA 2ZSEA 2ZEJA 3A1WA 5AJYA 5GJBA 1XF9A 3KZ1E 2WKQA 2ZE6A 1LB1B 1OKKA 2R6DA 2VSFA 2WIBA 3FPAA 1Z8FA 2FZ4A 4JKIA 4Q4AA 4DBLC 4MDFA 1KMHB 4TLEA 2WOJA 3VU9A 2BWJA 4BFTA 4JLBA 4XD7D 4BZQA 1XD2B 3BFKA 1Q3TA 2OV2A 3CW2A 821PA 3MG9A 5G3ZA 3LBHA 4JLJA 3RABA 1NVWQ 1GL9B 3ICEA 2QY9A 3AGQA 3K0CA 3K1JA 4JIMA 4PSKA 3CB4A 2UKDA 1GFIA 1ANKA 3NDPA 4V02A 1B23P 3W6NA 3MWJA 3GPLA 1JQLB 3EAQA 4NE2A 4BE7B 1G3IA 1FMJA 1TF5A 4PC7A 5E3HA 4ARZA 4BFVA 1E0AA 2K5UA 4IOJA 3KQKA 1W5TA 1AQYA 2F9LA 1G7CA 4UXHA 2ORVA 1N0UA 5DSZA 4D81A 1MRSA 1MABB 1VG9B 1KSGA 2FH5B 1JECA 4PTLA 4DLYA 4YXWD 1CR1A 1R4AA 5BN3A 3RRNA 4H9GA 1N25A 5EXXA 1IHUA 2QSYA 2ODWA 2ZJ5A 4I99A 5ANRB 4ZDWA 3KFXA 4CW7A 4EQ6B 1FL9A 4HATA 2A3RA 1BYUA 4EJSC 4B76A 4GDFA 5JS8A 2H5EA 1S3SA 3GLGE 1NJGA 1ZM4A 5AJVB 1Y63A 4K46A 3QUSA 5EZ5A 1D8TA 3TAUA 3VR5A 4PZYA 4N3NA 2RKOA 3FHCB 4W5JA 2F55A 2J0QA 1ZRHA 3LW7A 2FEMA 2O8FA 5JLJA 2O8EB 4UNQA 4AKEA 2HCJB 4QM7A 3FGNA 4KO8A 3W34A 4MRRA 3AP1A 1SVIA 4IOKA 3NKVA 4QG7A 4N0DA 3RANA 1MOZA 2PMDA 4TWZA 3AP3A 4D4KA 1E2IA 4QJ5A 3GLIE 1YR8A 1Z0IA 4OJKA 3UG6A 1HYQA 4QGHA 3LRPA 4F38A 1JR3E 3TH5A 1J8MF 1TF2A 4X8LA 3QF4A 1CBUA 4TL6A 2Q9AA 1AGPA 3U4QA 1KI8A 3B6EA 3I3SR 4LJ9A 4DSNA 2BMEA 2H16A 2P5SA 3IIJA 4MKIA 2XXAB 1QHHB 2GZHA 2VH5R 4L9SA 1L4YA 5DIFA 3BBPA 3MLEA 2KB0A 4RSGA 4A6XA 2W6JD 4B32A 4PZZA 3H86A 1OHHA 2ODBA 1Z0FA 4A82A 5JJIA 1UJ2A 3BRWD 1KKLA 2GCOB 2N42A 4TN1A 3QNUA 1YU9A 1OH5A 1X8KA 2ONKA 3Q5DA 1SULA 2BMJA 3UMSA 1R5OA 4LYJA 1OW3B 1XMSA 3SJZA 3K0AA 3K70C 4JSTA 2D06A 4IJMA 4FCTA 3CRRA 3PEWA 2RGDA 1F2UB 4IDHA 421PA 1IOZA 4D80A 2YV5A 4KV9A 2J0SA 2IW3A 3A36A 4LC0A 1E79A 2CLSA 2GJSA 3QEOA 2NQ2C 4IXMA 5L3SB 2VF7A 2AFIE 4AWXA 1QHYA 2IYZA 4LV5B 3QKRA 4JL8A 4CF7A 2BCJQ 3B1YA 4KBGA 4Q48A 1E1QD 3QKUA 3FFAA 1M7HA 2BIFA 4ZDKA 1R8QA 2X19A 1QHGA 1X8LA 2REXB 1T91A 1YR6A 3AKEA 4HAUA 2OBNA 4A2PA 2MSCB 3RRYA 1QVRA 4NP6A 1GDDA 5EUQB 3TSWA 5JSZA 4L15A 1G3UA 1L7VC 3K0FB 2YKGA 2QENA 1EFUA 3K9GA 1YE8A 1J2JA 5FBWB 3TKLA 3WP0A 5KOYA 3OEHD 4UXJA 5EQTA 2QE7D 2F1IA 2V7QA 2DPXA 5HE8A 5TB5A 4UQOA 1XX6A 3ZS8A 5LD2B 3B13B 4XTRA 1XCPA 3CLVA 2WWIA 3OFNA 5D3QA 2EW1A 1G19A 1RKBA 3FKQA 4QKQA 4NH0A 4C0SA 4PANA 1VYTA 1YZUA 2CL7X 4L8GA 4C0LA 1FP6A 1E2JA 1G7TA 1AS3A 5FR2A 3U7HB 5DYGA 1E1RA 1HQYE 3P27A 1Z22A 3WBJA 3KQHA 3I5XA 2QT0A 2MSEB 4TT3D 1G41A 3U44A 1XMVA 2DHRA 2ZRNA 3BWDD 1XNJA 4TYPA 2BCGY 2RGAA 4Q1CA 4D82A 4BFZA 2YJTD 2IT1A 2LCFA 4MRSA 1DS6A 1GRQA 3CRW1 4MKFA 2QMOA 4PO1A 4CEJA 2R6AA 3R9WA 5EP1A 4EAQA 1RFLA 2OHFA 1Q1EA 2FN4A 2AX4A 2RB4A 3B78A 4EFMA 1OKKD 1HY3A 1GNRA 1LF0A 5JI2E 1KI6B 5LBIA 4UNNA 2JGNA 1ZNYA 2YYZA 1XP8A 2QRNA 3AKCA 3CNNA 4LBWA 4DCVA 2AKYA 1ODFA 4TL9A 1OH6A 4C4PA 2TMKA 4ERNA 1KJYA 2ZR7A 4MH0R 2GAAA 2ZU6A 2J0UA 2FSIA 4OK3A 2R6GA 1H8HA 3AUXA 3PITA 3C15C 2EFGA 2V6JA 2CHQA 1G3MA 3LD9A 1W2GA 1X1RA 3SFVA 2FE4A 4ZCMA 4LJ4A 2WIAA 5EE1A 3TW8B 1IN6A 4RKEA 2QBYA 4LHWA 2ZRJA 2J41A 1UKYA 2QI9C 3S1AA 5FBLB 5B64A 4A15A 1G7SA 3A4NA 3QJYA 1E3MA 1E2PA 3T06B 3NC1C 1P4SA 1VCMA 3MRSA 4DVGA 1ZIOA 5TXGA 2N46A 5E7JA 5HKKA 3EPKA 2P3SA 4FIDA 3SOPA 3C7KA 1I2MA 5JCZA 2AWOA 1MH1A 3R9IA 1RZ3A 2C9OA 4BLOA 4KAXA 5L3VA 1Q22A 621PA 3MJHA 2QN6A 3SC3A 4EPYA 1U9IA 3TMKA 3REGA 3PUXA 5KO2A 2A7QA 1U8YA 1VPLA 3FHOA 5JI3E 2J5XA 2GEUA 1FTSA 1E9DA 2OFWA 3VR4A 4FD2A 4RY2A 5F9HA 2A30A 2GVZC 1U81A 4Q00A 1Z63A 1DELA 5SZIA 3ASYA 1JJVA 2BJWA 3F8TA 2MSDB 4OJQA 1EX6A 3TR0A 3BB1A 1VCNA 2WJHA 4WZ6A 4TYYA 3QSYA 5FI0B 3I72A 3GLHA 1UEJA 2A78A 4RZ3A 3KXKA 1UF9A 5HCIA 1KAOA 2GDJA 3LXXA 3AVUA 521PA 4J0QA 3LQQA 4A0RA 3BFVA 2QP9X 4II7A 3UK6A 4Y0VA 4E09A 3TUZC 3THYA 4TLBA 1VECA 2QROA 2C78A 2V1XA 2J7PD 2YWHA 1OFUX 2YC2C 1DG1G 1N5JA 3HP1A 1EX7A 3QPVA 4BFSA 1XJQA 4ZIRB 2PLFA 3TBKA 2O8DB 1KJZA 1QVAA 2ZQ5A 4NONA 5D3MA 3WNBA 3EX7C 4NCHA 1F2TA 3U5ZB 4I1SA 4TTPA 1YQTA 1BH2A 2F43A 2CE7A 3LFUA 5CLLA 3QKSA 2ZSFA 3AUYA 1NN5A 3VHXA 1NKSA 1QHSA 3W8NA 5TMPA 4NYMR 5A5GA 3H84A 4B3DA 4O3MA 1RW4A 5BYJA 4RVCA 1ZCAA 3OIYA 4B71A 1N0WA 3AVPA 4HAVA 4B74A 3P26A 1W5SA 2RHMA 1UBGA 2D4HA 4B34A 4TMWA 2ZSDA 2HYDA 1PV4A 1E69A 4QGFA 3NBZC 1HE8B 1IN8A 1G16A 1TX4B 2Z6VA 3B1VA 2LKCA 3U7EB 2P6NA 5UKDA 4I1VA 3ZJYA 5DH9A 1KSJA 3I8XA 4RZ2A 2ZE7A 3LVQE 3HU3A 2J59A 4JT4A 4I1OA 1G6OA 4LJ6A 3K70D 2IS2A 1CJMA 1ZD9A 2RGXA 3E5HA 1YZLA 4UKDA 4RZUA 5GJCA 2WJJA 3WBKA 5HR5A 2VO1A 5B2ZA 1VG8A 1UKZA 1CU1A 1Z07A 4NCJA 4GL2A 3AM1A 4DB4A 2NMVA 5EUMA 3TAHA 4KFUA 2IBMA 2CK3A 2D7CA 4D4MA 3ZLJA 1T0HB 2XSZA 1KYIA 1U0HC 5JS7A 3E70C 4C7OA 1A2KC 4BWYA 4URUR 3I5YA 1CEEA 1Z83A 5IT5A 5H1YA 4URYR 3PENA 4HLDA 2V3CC 2GRJA 2OFXA 3A58B 3TR5A 1US8B 2NIPA 4LHYA 5JJLA 3G5UA 4TQ9A 5IF9A 1GKYA 2DFTA 2QL6A 1SGWA 3FMPB 2X2FA 1RJ9A 1ZC3A 1GL7A 2VP0A 4EPXA 1E9RA 1XEWX 1AK2A 2YHSA 2V9PA 1RIFA 1E2KA 3LLUA 4FXPA 3EA0A 4XVRA 1KY3A 2C9CA 1HE1C 2OO7A 1R0WA 4ASUA 4ZO4A 1F60A 4Q18A 1TU3A 3IPXA 3ECCA 1GL6A 2YZ2A 3TNFA 2XAUA 1W47A 1XD9A 1Z6YA 3FB4A 1P9NA 2OCBA 2EYUA 1P61B 1X1SA 4ESHA 1BO6A 4IFBA 1ESMA 4PHFA 1NY6A 3MWYW 4W9MC 3OHMA 2ORIA 1H8HD 4A0HA 4LJYA 4ESVA 1E9AA 3A8TA 1MO6A 1OF1A 2G6BA 2O8BA 2P6UA 1Z6GA 5EE5B 4B43A 2YOGA 4IDQA 3OE7D 1XTJA 3DVLA 2FPLA 3QBVA 3SS8A 3FMIA 3NHAA 1JALA 1A82A 4YC7A 5L3QA 2F9MA 4HLQB 2GJKA 2ZRIA 5FPKA 1O3YA 2W58A 3V9PA 1ZNZA 5JWRA 4DCTA 1T0JB 4AD8A 3QXHA 5HKKD 2OT3B 3NTUA 2FU5C 3OAAA 3WY9A 1HQCA 3LLMA 4E5UA 2PZFA 3U7GA 4EPTA 3QXXA 4M1SA 3GEHA 5HTKA 3NG1A 2ZE8A 5J4VA 1N5LA 1XEFA 1SKYB 2ZRFA 1M74A 1VKJA 1NMYA 2JCSA 4TMVA 3MSXA 1ZW6A 3CRQA 2ZUDA 3VR1A 4G3XA 2IWRA 2BC9A 3CWQA 4KCGA 3PUVA 4CEHB 1NVXQ 1FUKA 2ORWA 5JWHA 3EPLA 3U7FB 5K8IA 2WAYA 3K9LA 1KO7A 1R10A 4NMMA 5FTKA 4TLDA 4XH9B 2A5GA 4URXR 4M1TA 4UXIA 2W0MA 3UMFA 2PJRA 1IXSB 2HT1A 1MT0A 3IDQA 3K09C 1F6BA 4A2WA 4BZPA 4OI0A 5F98A 2QPOA 3EZ7A 3MGCA 4L5BA 1J99A 4LJ7A 4BPBA 1JR6A 3BS4A 4O0MA 4A1FA 2G9NA 1KMHA 4WW0A 2C9YA 3U2QA 1UPTA 5DISB 3TE6A 2CCJA 2F6RA 3WHKA 5DNYB 3DDCA 2GJ9A 5DHFA 1IBRA 1Z0DA 2PT7A 1Q12A 1NBMD 2VA8A 2EFCB 4BRWA 2PBRA 3W5JA 4OL0A 1ZD1A 1OIVA 3THOA 1FUUA 2WWWA 4WZAE 1K5DA 1GNPA 1W0JA 1Q21A 1OV4A 1CULC 4CYMA 4NYIQ 2ZSBA 2F1JA 3V4FA 1XPOA 1RRGA 2J87A 1W48A 2GZAA 2HJVA 2H1LA 3K09A 1GKUB 1CJVC 3L82B 1G7RA 2W2XA 3LVRE 1CRPA 1OH8A 2FFAA 1DE0A 2CMKA 1OFIA 1MABA 4QNRA 4MUAA 1TQ2A 2R62A 4FI3C 5KUTA 2ZJAA 5DI3B 4W5HA 4HB2A 1XBTA 1QBKC 2ATVA 1OH7A 1HURA 4HEJA 3LAWA 4JLKA 3DM5A 2JLQA 4EQ6A 2EFDB 1EFCA 4HUTA 4C0BA 1G17A 3J81k 1COWA 1E0KA 1NN0A 2JDIA 3EIHA 4M22A 5E7IA 4Q5IA 2CCGA 4HLCA 2ZTSA 5FH9A 2FSFA 4Q4HB 1LF5A 1N6OA 2C77A 2RGNC 3QPUA 4R7ZA 4JZKA 4B47A 4Z51A 3G0HA 4M8NE 1TAGA 1F5NA 5CDFE 3GLIB 5TDHA 4A0GA 1Q0UA 4NYJR 2XOKA 2UZ3A 4C2TA 4V0KA 1AS0A 2WWFA 1DO2A 5CK5A 2ZRDA 2JAQA 2FJUA 4BLTA 1CR4A 2JLWA 2CK3D 1ESNA 4Z1MA 5LB2A 4LCBA 4P4SB 4JL5A 1UEIA 4AKHA 2KJQA 4PSAA 5TY0A 5AUOB 2KI5A 4DC9A 3UKDA 4Q1AA 2XXAA 5TV2A 4MYHA 1E9CA 4C0JA 2RGNA 5AJWA 3EXAA 4F4JA 1XXHA 1W36B 1T9HA 2IEZA 1IN7A 4FMCF 4LV6A 4Q7LA 3TK1A 1JR3D 1N6NA 2ZVPX 3BGWA 1N6PA 1G3RA 4JLNA 1CP2A 2PL3A 1P6XA 4E03A 5FPTA 2O5VA 2A5FA 4DDWA 2YOHA 5F2EA 5J4KA 3SJBA 3AKDA 1KTVA 3GEEA 3N2IA 5EXPA 1RRPA 4KFSA 1II8B 3C14C 3GFOA 4FINA 4B75A 2L0XA 4XVQA 4XVUA 5EZ6B 5AJXA 2CJWA 1J8YF 4IOLA 1UDWA 3SQWA 1ZD8A 4D0NA 2E1RA 2NO7A 2C2HA 4Q21A 1A4RA 4AG6A 5K8UA 3A37A 2XNSA 1IN4A 4DUGA 1NG9A 3GJ3A 1JEDA 2WWGA 1HTWA 3N5CA 3T35A 3O8DA 2IYLD 2NO1A 4PPNA 1J70A 4BLSA 5FPYA 3X2SA 5L3SA 3QXSA 3GLHE 1N3BA 3T1OA 4EPRA 2XGJA 3IILA 2IS6A 2Z4RA 2O8CB 3IPYA 1NBME 1QHNA 1DG3A 4KLZA 3PXGA 1Q1ZA 1RPZA 4LSGA 2HF9A 4BFUA 1EWQA 1SVLA 1XMJA 4OK5A 1BYIA 2ZXUA 3ADCA 4C0AC 3QBTA 3NVAA 1S3GA 3K0FA 3AVXA 3QKTA 4P31A 5HPYB 3F3YA 1YVDA 4BFXA 5BYKA 3PIRA 1MO4A 1DAKA 1G3QA 3KX2A 3N70A 1NKTA 1R6BX 3AV0B 2CDNA 3F5FA 2CL6X 1HA3A 2ONJA 2R2AA 1PVOA 3V00A 3PEVA 1DBSA 1GRNA 4HI0E 2JLYA 2GWHA 3BOSA 2IYQA 2XJ9A 3I73A 3BH0A 2V55B 4IOMA 2QTVB 2FFQA 2XJ4A 2CEAA 3QPWA 1UBFA 3RS0A 1E2HA 4DLUA 5KNDA 4Q1EA 2JEOA 4QRHA 3U3OA 2F7SA 2AHOA 1GG2A 3C5HA 4OHVA 3LX8A 2JLXA 4MYTA 3GLFA 2ZRAA 1YZTA 3BXZA 2KBFA 2C8VA 4P33A 3JVUA 3EPJA 3FDIA 3VX4A 5J4LA 1OXSC 4QJ3A 1CRQA 2ATXA 3CM0A 1XZPA 2IXGA 4HB3A 2Y8EA 3CZQA 3EZ2A 3LBIA 3CZPA 4R9UC 1PZNA 2HLDD 4B35A 3JVVA 3VTKA 4RKFA 5CM8B 2IXEA 2G1KA 2QP4A 3N2EA 1KO1A 2VRWA 3PQCA 3AF1A 3IO5A 2OAQ1 2CVFA 1IN5A 2ZE5A 1KI6A 4JJKA 3SFZA 1QRAA 1KY2A 3IHLA 3KKOA 4U02A 1EFRA 1ZM7A 2YWFA 2ZRHA 1YZGA 2OLKA 5FOVA 4LJ8A 3MCAA 1UKEA 2G0NA 2X77A 1XFAA 1E6CA 2J9RA 1W0JD 4NHOA 1OFHA 4NCNA 2BM1A 2VIIA 1TNDA 4PO9A 1CLUA 3BIFA 1R8SA 1VDZA 2NPIA 3CF0A 3AVOA 3QG5A 4Q1DA 2JLRA 1X6VA 3WMEA 4M4SA 1YZNA 1TMKA 4NL4H 4ZDJA 4NYMQ 4ABYA 1GTVA 3L0OA 4JS0A 4MDEA 3GJ6A 2B7BA 3T1QA 1TQ4A 1KZGB 4G5SA 1CTQA 3C41J 1E99A 4CZ2A 4PHHA 1N6RA 4KFRA 4URWR 2FDCA 3UXMA 3AVWA 1XJ0A 2FGJA 4Q19A 1T6NA 1ELOA 3DZDA 5KSPA 3A1SA 4DWJA 1UBCA 2QEQA 1G4AE 2QPAA 1JPJA 4X8HA 2JDID 4U5XA 3ZIAA 2WMOB 2P5TB 1IY0A 1G5PA 2NO0A 4P0TA 3SBEA 1CXZA 3KKQA 3O8BA 1LFDB 2WJYA 3TRFA 4HUQB 3EARA 5C2JB 1G8YA 1G8HA 4B2IA 4KSBA 2XOKD 1CKEA 1FX0B 1B0UA 4US2R 4O2LA 2O0JA 4MGKR 2B7CA 3TLXA 2E87A 2QAGB 3CUEF 4PR0A 3RNLA 1TQDA 4TSFA 2VP9A 1DAMA 3RYTC 3LV8A 4LYAA 1DADA 1XTIA 2VP4A 2YINC 4ZCIA 1IM2A 3BB3A 1XCGB 4Z1MD 3FHTA 3D8BA 1AKYA 2VHTA 4URVR 1NMXA 3U6BA 3KQLA 4DSOA 1J90A 2ODEA 2H8KA 2ZI4A 5FR1A 4DCNA 4A8JB 4HB4A 4MGIR 1YR7A 3HU1A 1W4CA 2VF8A 4GMXA 2OSBA 1MO3A 1SXJC 2IUTA 1SVKA 5GVRA 4LY6A 4CIDA 4Z54A 2WJVA 2QTHA 2IF2A 2EQBA 1LW7A 3DKPA 2IA5A 4PAMA 5IDVA 3EW9A 3SBDA 3FTQA 4AYXA 2EFEB 3EASA 4TMTA 2VLIA 5DYIA 2B6HA 1JXOA 3W3AA 2AN9A 1OXUA 4XSHA 1W2HA 1KK3A 2W2VA 4ZKEA 1G8GA 3DL0A 2ZPTX 3RS4A 1SHZA 1TUIA 2IYYA 3NH9A 2IS1A 4B33A 3T12A 2HCBA 1G20E 2PJZA 3TVDA 2WTUA 2BEJA 1FNNA 5FTLA 4QM6A 1G9XA 4Q4AB 2ZYTX 3M6AA 4DUGD 4TMXA 3RVBA 3HYRA 4FN5A 3UPUA 1SXJA 4AKGA 5EXSA 3A6PC 3D6TB 2ZJBA 1XWIA 1TUEA 2NG1A 2XNDA 1P3JA 2OAP1 1XTSA 4M21A 2ZRCA 3W5IA 4H1UA 2GA8A 1X86B 4JVNA 4Q9HA 3P4YA 1IY2A 3F0TA 3SYLA 4WAUA 2FEOA 4ITRC 3OIUA 2WAXA 2ZYVX 1NSTA 3FVQA 5FTJA 2CHGA 3PUWA 4MGZR 4KI0A 1C9KA 3SNHA 1U0JA 3ZDQA 1W0KA 1FQJA 1P9RA 3EIQA 3FKSA 4DB2A 2GJ8A 2VHQA 4KXFB 4CRWB 1ZVQA 4HAXA 2JIZA 2GF9A 1G4UR 3R7WB 3EZ9A 3HDTA 4PQRA 2D2EA 2HYIC 1CR0A 3CF6R 5FTNA 4NKRA 1ZNWA 1E94E 1UBEA 1KK1A 4KU4A 3LWNA 2PEZA 1LNZA 3DO6A 1D9XA 4PAOA 4HLUA 3NBYC 1NN1A 3BC1A 3X1XA 3GFTA 4TQAA 1KNQA 1S2MA 2GEDA 1ZU4A 4G5QA 4KITB 1US8A 4UJ3A 4HYYA 5KSZA 1U9IC 3I8SA 1SHKA 4TLAA 4ZKDA 5BWMA 4UNSA 2DY1A 5CYOA 1G21E 4V0MA 4Z8XA 3CIOA 3AF4A 1Q1BA 3B9QA 5GJVC 4CEIB 3PJRA 4JYCA 1EESA 1AS2A 2AL7A 3KTAA 4PZLA 4EJSB 4UNRA 2ZIAA 2G83A 2ODNA 2FV8A 2QNRA 3B1ZA 3H0KA 3OIVA 4EUNA 2BBWA 3FMFA 5FUYA 1R0YA 4PSVA 5KU1A 1OIWA 3U4QB 5FOTA 1VHLA 1TEVA 1YZKA 4D6PA 1EFRD 1WMSA 1T5IA 2J7KA 4B3CA 2F1RA 2QRZA 3MJRA 1RC8A 2GNOA 3RC8A 1UM8A 4D25A 3MMPA 2DFNA 3B1WA 1P9WA 4IVPA 2ZI9A 1XXHE 1IJFA 3PV0A 3EA5A 2E9SA 5B57C 2PZEA 4F4IA 4GOKA 4M9ZA 5BW8A 2FMXA 3QG1A 4OK6A 3SJAA 3SYNA 1E9BA 2D62A 1KDRA 3A1TA 3L8ZA 4TTRA 3WXMA 2BKUA 3U3RA 5IRCD 2QGNA 1OHHD 1ZU5A 3X1ZA 3ADDA 1YZQA 1WE2A 4A6PA 3THXA 1NLFA 1DEKA 4PPQA 2R8RA 1DAGA 4NPHA 2VPPA 4LUCA 3W90A 3GD7A 4H1VA 2ANCA 3QKRB 4R98A 2OM2A 1P2VA 1JXMA 4LZZA 3MD0A 4EPVA 3KUDA 1W7AA 4AY2A 2NGRA 3TSOA 1RYFA 2YNMA 3W6PA 2ZREA 1FP7A 3ZQ6A 1BOFA 1E4VA 1E96A 1AIPA 3NWJA 5TVKA 1I4TD 1MRNA 1VCOA 2RAPA 2C99A 4A9AA 3ADBA 4Q9KA 2G3YA 1E2MA 2JJ1A 3PFIA 5JSZB 1T4GA 4CEHA 3K70B 4HZUB 1CR2A 2ZI5A 3Q7PA 1KK0A 4V0LA 2GAOA 4TZ0A 4G5GA 3AB3A 5HZHA 3U61B 3GJ7A 2QQ0A 5FPHA 3AVVA 2H57A 2OBMA 1E79D 3K0EA 2QT1A 1KO8A 4QC2A 4OHWA 1EXMA 4DLXA 2QM7A 3RAPR 2DB3A 3L2OB 2YWEA 2A5DA 2AFHE 3CPEA 5FOSA 3AVQA 3IQXA 2XTZA 2ZRKA 4KFTA 4LOAA 3WYAA 3DHWC 1KHTA 4S35A 4LC1A 4UJ5A 4DT1A 1PUJA 2MMCA 4TL7A 4ZCLA 1XMIA 1NJFA 4B3XA 1ZNXA 2C03A 6Q21A 1BS1A 4JL6A 4TTQA 1D5CA 3CRVA 4CGZA 2CNWA 3CRMA 1PUIA 1W49A 2OILA 2V7QD 4WXPA 2ZRPA 1KNXA 1KKMA 1A2BA 1T3SA 1JB1A 3G82C 2CLCX 2FFHA 3IKJA 1OJLA 4EFLA 2HXSA 4M2LA 1C4OA 3BE4A 3OFND 1AN0A 3K9NA 1F3OA 1XJCA 2JLZA 1N0VC 2QZ4A 3GLFE 1Z0JA 3ZS9A 5JWOA 1P60A 3E2IA 3ND9A 4HAZA 1LVGA 4B2PA 1E9SA 4GSYA 1KAGA 2SHKA 3CO5A 3QEJA 3RWOA 1ZUIA 2C95A 3ZGXA 5C4MA 3KKPA 1LS1A 1E1RD 5DI3A 1G8FA 4X8MA 4IVRA 1SXJD 1XEXB 2ERXA 3ETLA 3RLFA 5KYKA 3B2EA 4D26A 2QG6A 2F3RA 4MQBA 2ZR9A 5P21A 3RS7A 1FW6A 1IQPA 4AC9A 1FFHA 3P20A 2ANBA 1E2GA 2BMDA 1JEEA 2CVHA 3EC1A 1EWRA 1GILA 4JLAA 4IXNA 2GXSA 1E2DA 2HUPA 1GITA 1ZIPA 1UFQA 3K53A 4KVGA 1QDEA 4Q4HA 3LDAA 4V0OA 1SKQA 2KSQA 4HB0A 3SN6A 1Z08A 2DFKB 4ZPXA 1TADA 3FKSD 4QHSA 2IWHA 3GLIA 3AEZA 4YLGA 3VFDA 4DSUA 4QNMA 3KQNA 2W00A 1Q44A 1YRBA 2WKRA 3GJ8A 4OBEA 4WBSA 3W9YA 2ZS9A 2ZVQX 2WWYA 4MYCA 4LBYA 1A5TA 5FUWA 5FBRB 4C0KA 4E22A 4OHYA 1ZUHA 3KXLA 2R65A 4M1MA 4JVMA 1N6HA 2GZDA 1AZSC 1I2DA 4P4SA 2WPDA 4B6EA 1KGDA 1P2SA 3LA6A 2WKPA 2P65A 3ONWA 4P32A 4PHGA 2F1HA 5KPJA 4NDZA 2IC5A 3NBXX 4TMZA 3RS2A 5F3WB 3WMGA 2OLJA 4FWTA 2QPTA 4B3FX 3U6KA 2BKEA 4Q9IA 2Z0MA 4HAYA 4DLZA 1M8PA 4MKGA 3P1JA 1XEWY 3BH7A 4F7WA 3B7GA 4GRAA 3D31A 5FBVB 2OZEA 5BN5A 5JHHB 1G64A 3OEEA 5G53C 2FNAA 4A92A 2VHCA 2RCNA 1II8A 5FUVA 3KKMA 4FMDB 3O47A 2O0KA 1QG4A 2Q9BA 1S0UA 2IHBA 4RJLA 1VIYA 3VR2A 1QF9A 1DPFA 5FBQB 3X1WA 1FZQA 4M9SA 4QGGA 3GLHB 1E32A 2QMHA 4O2RA 2VQSA 3CF2A 2JLSA 4V0NA 1VCIA 4XD7A 1TPZA 4DDUA 4F4CA 3REFA 1E9FA 5H70A 2ZITA 2RGGA 1RRCA 2FPKA 4GP6A 3THWB 1S96A 4I81A 4B44A 2WJGA 5FOWA 2ZJ2A 2CL0X 2GCNA 4LBZA 1WXQA 1K8RA 1F2TB 5DI9A 3GMTA 1YJ5A 4XJXA 1S4QA 1P75A 1JAHA 4M53A 1M6NA 3QKSB 3V4RA 3AKYA 2CLDX 1XD2A 4XOIA 2RH5A 1XTKA 1SQ5A 1KI4A 1TTTA 1CJKC 4YXWA 1KJWA 2NO6A 2W6IA 4DXAA 2A5JA 4KVAA 3DMNA 4FMDF 2H7VA 4DLSA 2B8TA 1QZXA 5KSOA 1SXJE 5JFGA 1Z29A 3TGPA 1KZ7B 4GNKA 4G5RA 2P6RA 1ZBDA 2BMFA 4M1OA 1E98A 4XTCS 1A1VA 4BEBA 3C4JA 1R2QA 5H68A 4WIAA 3U3MA 4BGDA 3SR0A 3CPJB 1D6JA 4RD3A 2EYQA 4GZMA 3T34A 3SQXA 2JJ1D 4C0QC 1V43A 1NVVR 3Q5EA 3C8UA 2ZI7A 4R2HA 4C0HA 3GLGB 2IYXA 2H18A 1EFHA 1VIAA 2C96A 1HT1E 4Q4JB 4U00A 2QGZA 1O87A 2P2LA 4Y0AA 1OE0A 2HXYA 2MMGA 3IO3A 4QL3A 3SE0A 2AK2A 1GWNA 2KWIA 3DOEA 2I3BA 4OI1A 1KI2A 3B9PA 3IBYA 3DKVA 4L4UA 2DBYA 3MAAC 2GK6A 4M9XA 3ZZTA 1LY1A 2VSOA 2OG2A 1NIJA 3HR7A 4Q1FA 4TYQA 5CM9C 4B73A 5IHPA 3R20A 1NLZA 2O8EA 1AZTA 1YKSA 4FCWA 3D7MA 5CJ2A 2V8OA 3CX8A 2GF0A 1RRFA 2GK7A 4Q7MB 4ON9A 4ZI3A 2H17A 2GBLC 3MUFA 3QI2A 2ZROA 2VTKA 3C5CA 4JVSB 3SHFA 4OQXA 3B60A 4I1UA 2ZAOA 1E2LA 2QUZA 4DEYA 2XSZD 3IHWA 2NO9A 2ZJZA 4GFDA 4LDJA 4WZBE 4RCZA 4LPKA 4V0ME 2VP5A 2IEYA 4US0R 3AVTA 3KB1A 4LYFA 1R5BA 5EXTA 1PLLA 3I61A 5KTYA 5KDOA 1QHHA 2BBSA 3WNDA 4FCVA 1X8JA 4US1R 1DAHA 5J40A 1HUQA 1WRBA 4PHTA 4JBYA 1E9EA 5A4JA 3AVYA 4DLWA 2BVNA 1GAJA 1KI1A 2CCKA 2IK8A 4BLRA 2WSSA 5CLQA 3WRYC 4YMVA 1E0SA 1KDPA 1AA9A 3HWSA 2GBLA 2YWGA 1Q57A 5EE0A 4RFSB 5TARA 2GCOA 1JI0A 5AUQA 1ZM2A 2D74A 4HAWA 3TVTA 3I62A 5FL7A 2DWPA 2GEVA 2QQEA 1Z47A 5FI1B 3TW4A 3C16C 1L4UA 3NH6A 5FL3A 4HUQA 2IF0A 2OEPA 4B3GA 4ASUD 4D2IA 1NIPA 2N1BA 3L0PA 3VKWA 3JZAA 1SVSA 4IDOA 3X1DA 1FX0A 1N6LA 1R7RA 3DZ8A 3KKNA 1HV8A 2OXRA 4Q66C 1F2UA 2P0EA 3NEYA 3OEHA 4KBFA 4N1AA 4EFNA 2QAGA 2QE7A 5ELXA 5LD2C 5LPNA 4URZR 2PX3A 3QVUA 5KHOC 5DGXA 1BMFA 2ZUCA 2WPDD 3IEUA 4RD0A 4Q9JA 2OE2A 3LQRA 4NCKA 3BORA 3VR6A 3KJGA 1MR3F 4A8JA 1D2EA 3PR1A 3TUIC 2XX3A 2ZRMA 3T5GA 3VNVA 4MRVA 1NI3A 1S8FA 2EU8A 3NC0C 3ADKA 4NZYA 5JZVA 2V4ZA 2D7DA 3PCRB 2QU8A 4TT3A 3BH6A 1HH4A 5JRJA 5C4GB 5G40A 2C98A 3RRMA 2FX3A 4MUBA 1U99A 4AURA 1OIXA 2FGKA 2BDTA 1GNQA 3OEED 5DO9A 3WHLA 3SEAA 2CHVA 4WA7A 3OAAD 2VSXA 3KFVA 2XB4A 2REBA 2O0HA 4V03A 5CJPA 3FOZA 3KJIA 1N6KA 3WP1B 4DCSA 3H2YA 1UKVY 1Z06A 5CIQA 1P2TA 2RGCA 4QJ4A 4BLPA 2XTMA 1GSIA 3H4MA 4RD2A 3PEYA 4P4TA 4MGYR 3KXIA 4LHZA 1Z6XA 2PLRA 1F48A 2P67A 4Q4LA 1ZC4A 2WBLC 4L9WA 1KIMA 1G5RA 3GEIA 2ZRGA 5DHAA 4DIDA 3CR7A 1LS6A 2VHJA 2ERYA 4HSEA 4OQNA 3UG7A 4AG5A 4LHXA 2WHXA 4M1KA 1ZYUA 2PMKA 1G8PA 4B6FA 1E2QA 5JECA 1P5ZB 1SVMA 1HEIA 3BAFA 1AM4D 4F92B 3JZMA 5CYPA 3R7WA 4IDNA 2W6ID 2G1JA 2GJAA 3B5JA 2J0VA 4DDTA 2CE2X 2ZI3A 2EVWX 5FUXA 4RZXA 3MWLA 4IHQA 2W0SA 4G1UC 4QHTA 5KSYA 3AH8A 1YR9A 1VYVA 1ZP6A 4X8OA 1N5IA 5EE9A 2W2TA 1RE0A 1M7BA 2RHDA 3DPUA 1TL7C 5HE9A 1VG0B 3LH5A 3I92A 1M7GA 4PC1A 1ONBA 2R6CA 2FA9A 5B58C 4E07A 5FTMA 2FSGA 3BJIC 5AWFC 2Q21A 4JLOA 1OYYA 1IJEA 4AYWA 4CEIA 5JRZA 1PJRA 2QMEA 1NLYA 2ZETA 2VP6A 4JBXA 2R44A 4EJSA 1VTKA 2KE5A 2NZJA 1COWD 1WBDA 1QG2A 2QA5A 3KQUA 3CNLA 4M0LA 1XTQA 2XZOA 3GFPA 5B30A 1U98A 4A0FA 1ZM3A 2IHYA 4K81B 2IXFA 1ZJ6A 1S1CA 4TQUS 4WOPA 4CT5A 2GILA 2WVJA 3TUJC 1XXHB 1E4YA 5AR1A 1XPUA 4A36A 1LV7A 4PX9A 2JLUA 1FNMA 1FQKA 2OCYC 2DCUA 1IY1A 1SVOA 2J7PA 3IEVA 1DAEA 5IK2A 1BIFA 2Z83A 221PA 3ICQB 4NYIR 4CT4B 2G0TA 1E2FA 2V6IA 2EFHB 2ASEA 4PAQA 4GZLA 2CJWB 3GJ5A 2R9VA 5JEDA 3RS3A 4EKDA 2IYWA 2JJ8A 4W7SA 4DIEA 3GCGA 4QHYA 4QBGB 4M9QA 1XPRA 3I32A 2BHRA 1DAIA 3CONA 4QFMA 3ZVRA 1IXRC 2WSSD 4YONB 2IYVA 1Z0AA 5SZKB 4DEXA 3AGPA 1NRJB 2FZLA 4TL8A 4WXRA 1OB2A 1Z3IX 2NPFA 3R8CA 4BLQA 3FE2A 4ZIRA 2O8DA 4RD6A 1Q1QA 1NP6A 5FL7D 1EK0A 5JCPA 4JLPA 5SZJA
chains in the Genus database with same CATH superfamily
2WF8A 4R3UC 5TT1A 2BJVA 3B48A 4QUDA 5KWSA 1ZSYA 3DTVB 5CA0B 3H1PA 5LCXA 4XWAA 2XWJI 3X43A 2WWXA 5C7YA 3E05A 1PBTA 4DLTA 4TV8B 3C3PA 3VISA 4BBJA 3VU9B 4RHTA 1G291 1NTRA 3BJRA 3CH4B 3NRJA 3O3CA 4HWKA 3L93A 1EGAA 4M6WB 4U7GA 1PZXA 1P2BA 4PGAA 1SU8A 3R24A 4DLRA 4YLEA 4C06A 4BWFB 5KC9A 1SUAA 1GT91 1I10A 1PNOA 2CFCA 3WLQA 1FNSA 5DLPA 4U2BA 1WBBA 4YMWA 4ETWA 1BMDA 3WYEA 3LXRA 4ACBA 3VR6D 2ZJYA 3LOUA 5JCXA 3WL6A 2PS0A 2H92A 4BGIA 1C1HA 1M1NA 3A27A 3S2EA 4HAOA 1GQ2A 4MARA 3HN2A 1E8DA 5ER9A 2H9YA 2QJRA 1GG9A 3C3WA 5IUNC 1VLQA 3QY0A 1F7VA 4EA8A 4D9MA 2RHBA 4JI6B 5EVJA 2UYHA 1MB2A 3CEMA 3EVGA 5LB4A 4M0EA 3HVIA 4S0ZA 3O2SB 5KYUA 3RS8A 1KBQA 1OXBB 2EGHA 3CEAA 1UXIA 3GJ0A 1JDNA 3OOYA 3R3ZA 4JMPA 3EXHB 1K6MA 4BNWA 1N4DA 4UD6A 4B3MB 2PKQP 4M0FA 1V4NA 4FIZA 5JJKA 5FX2A 3T7SA 3D6VA 1SOVA 1GG5A 1QOQB 3O8OA 3RVLA 1YGPA 3K9HA 4MIEA 4JJZA 3UQYS 1TVKB 1Z2AA 4RKWA 1WF3A 3UN1A 4F2DA 1I7QB 1UT8A 1TF7A 3F47A 5CP8A 4IW3B 8ATCA 2D3TA 3WRXC 3H4IA 4ARSA 1S9DA 3FRHA 4X93A 5JCJD 2X1VA 5JXWA 4W7IA 5F5NA 1HLDA 3B85A 4OXQA 4Z0PA 2PZMA 3SIXA 1QCYA 3CLUC 3C6QA 3TZLA 1OVGA 2H4JA 4DMCA 4EENA 4R81A 4HDSA 4KP7A 5KTYA 3VC3A 3NHRA 5FA8A 1VKZA 5CD9A 1VMAA 1GARA 4HH4A 5KX5B 2AGVA 1FMCA 1M67A 1PR6A 2VT6A 3H19A 3RR2A 4ILEA 3JCZA 4RTQA 3D7NA 4JP1A 4JLVA 1ML4A 1VL0A 5TQVA 4E4RA 5FOQA 5J2TA 1OI7A 1UZUA 1ZH8A 2JCVA 2PV0A 2RI1A 2YQ5A 4NICA 4OIMA 3ZKWB 3RYIA 4FB5A 3U19A 1OB5A 4CI9A 1JDZA 1UK8A 1JXAA 3QV2A 2JASA 2GM5A 2H9AA 1P7CA 2PUBA 4EKYA 3GFSA 2ZI6A 4LOJA 1P2FA 1ZIXA 3OQ6A 3IB6A 2Y4OA 2AEJA 2ZYAA 3DQQA 4OAOA 4Q3BA 3RBXA 1AMOA 1ZAKA 2GM3A 2VQFB 3L7NA 2RHOA 2AJ8A 2JH8A 3Q6MA 3I6YA 2YMLA 3UPTA 4H7IA 1JU4A 3O4IA 5JMTA 2GJ4A 1V3UA 1XDGA 3STHA 5GJWC 4N03A 3DGEC 4EI8A 3IJ5A 3JQFA 3F96A 1MW9X 3L43A 4PO8A 4E2WA 1YRYE 3MWEB 4G9BA 4IG4A 1R9MA 1U4SA 4HRVA 1SCUA 3CUKA 4IEFB 2Q7OE 2BFFA 2O52A 2EF0A 3ZYCA 3PGKA 2BM0A 5TEWA 4DM3A 2DAPA 1QIDA 2PMWB 2WG0A 5ITVA 5TJ9A 3TDKA 2QV0A 4ZAVA 3Q0TA 3FR7A 3D3EA 4LV8B 2FYTA 3RJ9A 4Z4EA 3HSSA 3DTNA 1PQYA 5JHGB 2PGAA 2GN9A 4ARUA 4R68A 1VHWA 2W9XA 2PGDA 2Q3BA 1U7DA 2QMUA 1GP2A 5KTSA 5FBZA 2O7RA 2ZAMA 3K6JA 1HETA 1I6WA 5HUHA 4L0CA 4YQZA 1KE1A 4XWOA 4MHOA 3RSHA 1B42A 4ZQGA 3KO8A 4LNUB 5GIPE 2ZJOA 2I6TA 1A7JA 2VYFA 1GQOA 3CTPA 3N6VA 5JUWA 4MO2A 5BSVA 2IU4A 3SNKA 3DLIA 4UBLA 3RRZA 1NI5A 3FSGD 4W9NA 4XXHA 2X58A 4LCEA 1MO5A 3L1UA 3N2LA 2JFGA 3PFFA 3K9WA 5KDDA 4H4EA 5LZ7A 2Q1UA 2I7TA 1YBHA 4ZO9A 4ACAA 5I3ZA 4FE4A 4JYBA 4C03A 1UC5B 1Q7TA 3UKOA 5KZMB 1Y6GA 1K1EA 2X6TA 1GR1A 4N5MA 1UQUA 2FG5A 3DFKA 4INAA 4TSFD 3DBRA 2YVLA 4QTYA 5E8JA 4AECA 1NA5A 2OK8A 2PR2A 2ZUVA 1PTJA 4RJIA 4RV9A 4TKUB 3ZLUA 1H23A 2MYUA 3R5FA 1UBMS 1HG0A 3OOWA 2WOOA 3ZD7A 3HV2A 5BMVA 3QOFA 1Z17A 3K8YA 2PFSA 2QRVB 2W2KA 4RQTA 2AD1A 1OXTA 2FX2A 2ZBPA 3OQJA 3COJA 1ACMA 4XA8A 3JWHA 4D0GA 3HNPA 1K4MA 4KLNA 4MR8A 4JV5B 3FWYA 3PRKE 1DNPA 4LQDA 3KWJA 4RK1A 5A0FA 1PGJA 4MW2A 3G0IA 1RBYA 1GAWA 5TF4A 1Y8QA 3FYHA 3ZW7A 2ZDQA 3U44B 1JG6A 1YCGA 1GZSA 3BMCA 1UDCA 1K68A 1CFJA 4HXGA 1H94A 1XYYA 3D0QA 4XWKA 2R6JA 5CVDA 2MINB 2HT6A 4WDRA 5EP2A 1Y8RB 4DCUA 4YAGA 5I7RA 3OPNA 5I7SA 1IE3A 1FNDA 1T2AA 1RXIA 3A11A 5CU7A 1XCLA 5KOJA 4DMMA 1PD0A 4UVDA 1ONSA 3JS5A 2CD9A 2JCXA 2EWWA 721PA 2MTBA 5DBGA 1U3TA 4Q1BA 1OGJA 5EP4A 4YRFA 5CB4B 1EEHA 1CS0A 2P4SA 4M37A 2QXTA 1D2MA 3H5TA 1JIKA 2ZLBA 4XWGA 2HPZA 3ASUA 1KJ8A 4CT0A 8LDHA 2XNDD 4KR2A 1PJLA 2DR3A 4NECA 3VM6A 5CB6A 4I4LA 1SO8A 3OTIA 3KJEA 2BKLA 2IPXA 1J2UA 3CCBA 1L5NA 2YQZA 3AQ4A 4YJ2B 2DUNA 3TMAA 4D4JA 4FNOA 5CTAA 1HSZA 3AI1A 1JHUA 3ND7A 2VJLA 5BWBA 1GM5A 3OKCA 3Q6IA 2FMUA 2DERA 2VJCA 1RWQA 5D85A 1GPMA 2XT9A 5IEBA 5DYWA 4FEGA 5G41A 3HP4A 1X3LA 3EXEB 3IIMA 1EVIA 3P9KA 4ND2A 4GBMA 4A26A 2A88A 1HXHA 1OFGA 5LYYA 4FT2A 4YAFA 4KR7A 4DABA 2H2AA 5A5VA 1U8EA 2X5JO 2EJUA 4MQFB 2I99A 4OQPA 3TTUA 1JR3A 1UKCA 2B8EA 2JIZD 4H77A 1XTUA 4RV4A 3RSSA 4CTMA 3S1AB 8MHTA 2QGFA 5JFTA 3CX6A 5DWDA 4LY9A 1SCKA 3W8RA 4B5KA 4ZYZA 4QWWA 4LZJA 3PRJA 2BFAA 1I0LA 2P3OA 5EHNA 3SSNA 4AMBA 2GCPA 1ARZA 4DUPA 2V54A 1O89A 1ODIA 3B8HA 4MP3A 1HSOA 5EJAA 1GGFA 1JQJC 4Z53A 1TYBE 2IBTA 1LI4A 4MVWA 4YJKA 4YAIA 1QU3A 1E1NA 3JWIA 2PIAA 3UQZA 3EGXA 5DCWA 2Z2XA 3R9XA 1O94D 1DWOA 2ZYWX 4CVNA 5JMOA 3IAEA 3LO5A 3AUJB 2LNDA 1Q11A 2W22A 3PUYA 5KWEA 4I8DA 2ZAIA 2MCFA 4UPEA 5CDSA 1NURA 3E03A 4H27A 1WPQA 2AZDA 3OUUA 1QAQA 3HKCB 3RFXA 1M0EA 4TZ6A 4UHFA 1FEZA 3EUWA 4ZRMA 1QHIA 4CIXA 5LNK1 4AWAA 1J7KA 4Q02A 4YMUA 2CXSA 4JYZA 3DW1X 3GI1A 5ALTA 5LQCA 2BFPA 3GZJA 3Q7IA 3HYNA 4LDQA 3WB1A 1MQSA 2O5CA 3IR6A 2UXBB 4JVOA 4PLTA 1MZVA 4F3RA 1K8XB 2M1ZA 4MVJG 1TT7A 1CJTC 2EP8A 3CR3C 4XWTA 1L7MA 3WFJA 1AKEA 1QR6A 4UAGA 2ZWPA 3H1AA 5CK4A 5CTJA 5E6SB 5BSKA 3OIDA 4GLLA 3P32A 1G4HA 4AJ4A 3VAAA 3ZHZA 1DUVG 1JHZA 4U7FA 5FUBA 1RYHA 3L9XA 3I4LA 3WLKX 4Q9LA 1TFUA 4JBWA 5EKUA 3THXB 1ZPDA 2PUDA 4KJZA 4TQGA 2W98A 2B3DA 4RL6A 1W4ZA 2OAGA 4JU9A 2AR7A 4Y98A 2O8CA 1TDJA 4MEAA 1VBMA 4QBFA 5A5FA 1KP2A 5EVCA 2OV8A 4NZPA 4RIIA 4ZVMA 4BECA 3CPHA 4D9EA 4RHUA 4P4UA 1SBZA 5M34A 3QKIA 1BKDR 3Q3CA 2YCBA 5U9CA 4NFHA 4NU5A 3MW8A 2AQIA 4QASA 5AW5A 2B0CA 3BB4A 4JLDA 3WHIA 1X1CA 4C3ZA 1W4AA 3TCKA 5CXUA 3ZVNA 5ARBA 4I7EA 2CYAA 5HSGA 4DR1B 4FCCA 4K0RA 4D9CA 3VO9A 2VSYA 1GQYA 2GPWA 2JFZA 4D9IA 4DZZA 3KQOA 2C7QA 2BGTA 2REOA 1GUFA 2IXAA 1JEQB 3M3HA 3OVMA 4Q6WA 4ZT4A 5G0SA 5TMDA 3W79A 4E2FA 3B52X 1MT3A 1Z62A 1F6DA 2LRHA 3IUYA 3IFSA 1KI9A 2GTPA 5CLGA 4K05A 3E22B 4S3MA 1D07A 4J91A 4Q9NA 3VKFA 2X1HA 4AI6A 3M0EA 1SG9A 1MOQA 5LOVF 2HO4A 2IPOA 1ZSVA 2HEIA 5JZBA 4OGKA 5IBRA 5I47A 2C4TA 4F4DA 3JARA 5BUZA 2Y68A 2BELA 4JUBA 1ULUA 3MHPA 3OQ1A 1H6AA 4UEQA 3MT8A 1Q2UA 2J1LA 4TM8A 2QD1A 3W78A 4MA4A 1AHHA 3LTNC 3BRCA 1V5WA 5DTRA 2IELA 5K3DA 3SXJA 3ZZMA 3OF3A 1AGNA 1EXVA 2BT4A 1ENZA 4CFZA 5ICEA 2XUJA 2IZ1A 3V8QA 3RTEA 2CVQA 4LMBA 2AOVA 4WVFA 1ORRA 1XZQA 3NDBB 3JQRA 3N3BC 3RVSA 5H8WA 4O63O 4ZODA 1N7GA 1YQUA 2TS1A 4KR9A 5EWLA 1ECGA 4Q3EA 4DA0A 1T8TA 1L4BA 3H1EA 3KALA 1OZAA 1RWVA 3QUAA 3U26A 4CDGA 3BFJA 3K4HA 2KX7A 3SHWA 4MRNA 3DVAB 4ZHQF 1GRRA 5K20A 2I7VA 1NF3A 2VRNA 2BHSA 2WYUA 1FDUA 1UJ4A 2EJWA 4UUNA 4ZRNA 1X92A 2NUPA 2XUOA 3PVSA 1J8DA 3H3XA 3CLHA 3ONDA 4ZWNA 5K5EA 1GZVA 4HNHA 1SVWA 5DLYA 1R15A 5DNVA 2XTNA 2IFTA 3IYLW 3RSFA 2ID7A 3S0JA 3DLBA 2CNWD 1K5HA 1H2FA 5J5CA 4B8YA 5J3JA 1CEXA 2R6FA 3ORSA 4W82A 2GEJA 5DX1A 1RLMA 2ZRBA 5GP1A 3FYSA 3KE9A 3QE0A 2MDTA 2Z1NA 3ISVA 3ORFA 4JKOA 3DP7A 3RC2A 3MLAA 4HS9A 3VR3D 4ENVA 2JLVA 1UDRA 4IKEA 2CHEA 2EW2A 4QUBA 3BSSA 3I45A 2ZT5A 1ZA1A 4O4JA 1H3EA 4IJWA 3L8DA 1G5IA 1M2EA 4BFYA 2X1LA 4JBIA 2I4TA 3L4SO 3EMKA 4POAA 4CL8A 4RTMA 1CC1S 2JGDB 1IZ7A 2WAOA 3IULA 5K0FA 3Q41A 1RYMA 1MJHA 3ZHBA 1CUZA 1WMDA 4GP7A 2E2WA 1BXGB 3FLBA 3T9EA 1USIA 3LCUA 3NHBA 1PLJA 3C39A 1ENOA 5NULA 1FTYA 4H2DA 3DJYA 3UWMA 4ZMBA 5JH7F 2AUMA 1YNSA 1W9HA 5DM4A 5D86A 1YDFA 1IHPA 3QQ5A 4GEGA 5DKFA 1U8ZA 4BMDA 3BCSA 2ECKA 4KQJA 4PU0A 4EDHA 2Y1FA 3HJNA 5EMNA 1Z2CA 3IA7A 1F0YA 4Q9DA 1UM9B 2CKDA 1PJTA 3BA1A 1GPKA 1QQ6A 4Q7JB 4EGQA 3DZJA 3KKZA 3F74A 4GPTA 1E1LA 1WY5A 5AHOA 3DOOA 4ZAYA 4YRBA 4KQIA 4JLUA 2UZIR 1WA5A 2ATCA 2DOKA 2ECOA 5DP2A 2OECA 3TEFA 2PE5A 5CGZA 1XFDA 1LBSA 1E0DA 4BUJA 1NXPA 2JIBA 1P0IA 2FN3A 5DN6D 1DRWA 1REQB 1SOMA 2P77A 5E1BA 3LP8A 3K05A 2A9PA 2V6BA 3IJRA 4Q7KA 4C01A 4JI2B 3QJGA 3LK7A 2A9KA 4OY3A 3VKGA 5BMOA 1BS2A 2V3WA 4O33A 4OQZA 1YL6A 5CW1A 3MCTA 1XTRA 3SS9X 4A7PA 4DOMA 1GHTA 1A0OA 2WTXA 4C21A 1HT2E 3PHCA 4WLNA 3DHEA 5BN1A 1ZMBA 3AFOA 4Z86A 4CM5A 3OU2A 3MZ0A 4PGMA 4YP5A 1WB9A 3ZQJA 4EB0A 3UH0A 5F9MA 2PX0A 5G1PA 3QA9A 5GWXA 3V2IA 1GUYA 5JNRA 2VPTA 3HMKA 5BRNA 1TYCA 5CT8A 1R16A 3RU3A 1DTSA 4E4TA 5L4LA 1ZSNA 2QOEA 4XQ0A 3ZCQA 4WRRA 3WAJA 3RG2A 1CUCA 1HDCA 2QQGA 2WWTA 4NENB 1PG5A 2BM8A 3M1IA 2B92A 3UAOA 1KQGA 2AZXA 3BD9A 3F6YA 4C7VA 2QSZA 3WMXA 1F5SA 1GUZA 2RBGA 3CVOA 4YWHA 3ZXUB 3RSQA 2UZ1B 3EIWA 3KLNA 4WK0B 2WEKA 2UAGA 4YAJA 1Z9BA 1BFUA 4H7DA 5GJBA 1UAGA 1XF9A 2QD3A 3G2LA 2V7GA 3KZ1E 3PC2A 4MVJF 3TW0A 2CY0A 2NLOA 4E88A 2QDXA 1LB1B 2VSFA 3HDVA 4GOOD 4MVJH 2EOAA 1NC3A 1CR6A 4Q4AA 1L1FA 4ALKA 4BB9A 3TLAA 4BFTA 3ZN2A 3IJPA 3KEQA 4DIUA 3M5DA 3RFVA 1JE0A 3LXMA 821PA 4CDNA 3DNFA 1K3FA 4QXRA 1GZUA 4WNIA 3RABA 5F7OA 1NVWQ 2RE8A 4C9BA 5T41A 2H7CA 1DT5A 2GFQA 1OASA 2DEUA 1CV2A 2UKDA 2O3TA 4YCSA 1GFIA 1ANKA 1WCXA 4V02A 1R8XA 1AGYA 3W6NA 1JQLB 3WGTA 4O4HF 3DBHA 1FMJA 3BTSA 2DUJA 3EBPA 5A4AA 1K06A 4UM9D 5BYAA 3EQ6A 3U49A 3VPSA 5BW4A 3KQKA 1ZX1A 3EFOA 1CQWA 2ORVA 5DSZA 5CX1B 1M8GA 2ARKA 1MRSA 5LXTF 1R0SA 3GLKA 5IKMA 1WHTB 5BN3A 2KYRA 2HF2A 3IRUA 3M9LA 3EYWA 5CPFA 1YC5A 5CYFA 3FOCA 4NABA 5EXXA 4B7ZA 1C29B 3OTOB 2ODWA 1PNRA 5AVXA 1IBCA 3RBVA 2JFVA 4HATA 4TOIA 2A3RA 1GV0A 4YCBA 1LLDA 4B76A 2Z5VA 4LAFA 4Y6PA 3ZDFA 2CT8A 1JQ5A 2AG0A 3TIIA 1SEPA 2EKZA 1GU1A 2OUIA 3OX2A 1D8TA 3HV0A 3QUSA 4K46A 5AJVB 4PLVA 3TAUA 3LWBA 1EA5A 3FKJA 2PH3A 1ZRHA 2O8FA 2FEMA 2QTZA 4PIVA 4EY8A 3L6OO 1H4QA 3JTEA 5JLJA 1IVNA 3X2EA 4QPCA 5KQRA 2HCJB 5MGNA 4GICA 3LC2O 3NYIA 3OZIA 1JT9A 1SKBA 2C8LA 2EJBA 5DEOA 4IILA 4MRRA 1CUXA 3V8MA 5K01A 3NKVA 3UGJA 4N0DA 3SIRA 4TWZA 2VP3A 3EN0A 2DQ4A 1QOZA 3AP3A 1UZLA 1JFFA 4P92A 2YW2A 1H4VB 4FZ5A 1NPYA 1T15A 1YR8A 2C3YA 4HBGA 4NAUA 4OJKA 1PWYE 1WV1A 3HFSA 3GVPA 1RWBA 1J8MF 1ISRA 1ISPA 1N2XA 1EAMA 1NTOA 1S3FA 1YSCA 2ZBGA 1PJAA 4ARBA 5HK9A 4LXGA 1XZCA 2Q9AA 4BJ1A 1SNYA 3B6EA 1Z2PX 3I3SR 2JIRA 4LJ9A 3F7MA 4LY3A 4B3HA 4YT4A 1EB8A 3AI7A 2XXAB 1CUJA 1T9DA 2VH5R 3OZFA 1MDBA 3MLEA 1EM8B 4WNAB 5AKJA 4ERXA 4RSGA 2ALJA 2G9ZA 2R79A 4C5AA 2X15A 2V7XA 2QKYA 3STXA 5JVDB 1Z0FA 2CZQA 3TQOA 2XA1A 1VYHA 4HX2A 3D7KA 2Z6UA 1QYVA 3HN7A 4TN1A 5KWVA 1SMKA 3PQEA 5TPZA 2QVLA 5G4KB 2EWMA 2AN4A 3TZKA 4JHLA 4RPLA 2OV4A 1GVHA 5I9NA 1CUEA 4ALLA 3DLHA 2EKPA 2EEPA 3Q5DA 3ZI7A 2BMJA 1EE1A 2D54A 3BUSA 3ZCSA 1K86A 5IC5A 4AMZA 3CXRA 4HGOA 5DNUA 3KOUA 3T9BA 3HJGA 4LYJA 2E4XA 3URMA 2F8MA 2FW1A 3T5MA 3K70C 4LFAB 5ESXA 2Q5EA 4K1XA 1U2GA 4L5YA 4AZSA 2QRKA 4FCTA 4BS9A 1O97D 1RI3A 4KUEA 1SRRA 2I8AA 2W42A 4C0XA 1JMVA 3I53A 2WIGA 2IW3A 1YMUA 3JWGA 4FFLA 5BWOA 3L18A 1TMGE 1RTTA 3LI2A 3P9QA 4RY0A 5REQB 3U7IA 4IXMA 3UFXA 2AFIE 2IYZA 3QKRA 4NOJA 2PU7A 4QPJC 4KBGA 3PC8C 1A2OA 4Q48A 4Q4DA 3WGZA 4D02A 4DILA 1K89A 1Z36A 1MVNA 2X19A 2E4WA 2REXB 1X8LA 3DWGA 1HFJA 1V6CA 2NVUA 3ADOA 1MGPA 4G5HA 1HNNA 4HAUA 3A3OA 1ETHA 4A2PA 2DBRA 1UKBA 1QVRA 3I37X 1W5BA 2VUIB 1M2JA 1WPGA 3M81A 3OY7A 2DP4E 4FWBA 1I7NA 4NP6A 4RSRA 1E89A 3LUKA 4UHKA 1L7VC 2IHUA 1T5HX 1EFUA 2WFLB 2AOUA 3TKLA 5AXBA 3WP0A 4G07A 1E1MA 1S2NA 1TKBA 4UXJA 4XASA 1CZNA 1LRLA 1PJ4A 1Y0BA 2R2GA 4NFSA 2FJ0A 2O2JA 5EQTA 5HE8A 2DX7A 1AXEA 1XX6A 2UUCB 3JYHA 2HQRA 2KPOA 4MTLA 1MQ9A 1T13A 2D1TA 3OFVA 3EY9A 4MWCA 1G19A 1FA9A 1RQ2A 3LKDA 4QKQA 4FBLA 3GVIA 4H15A 4GO1A 2CL7X 3ICVA 3ZJTA 1EH5A 3HNRA 2O1EA 1AS3A 1U8TA 5EQDA 4WZAA 1XRPA 2VQ6A 1E1RA 5DYGA 3H9JA 1E3TA 2QL7A 3K20A 2LV8A 3WBJA 3GGGA 3CZCA 2QT0A 3EDYA 1VGVA 1WS6A 4TVBA 2O6HA 1QE3A 5KNCD 2H1RA 1IM5A 1M0WA 2DHRA 3ZX4A 1DT3A 3PNSA 3GPBA 1P1HA 2FX5A 3EOBI 4ND5A 2C0CA 5ECYA 3ZE0B 2RGAA 2YJGA 2YJTD 3TJRA 3L4BA 2FZGA 3E8SA 1QCDA 2HBZA 2NU9A 1DS6A 3JY6A 4JGGA 1XWWA 3ROPA 3WGNA 1XOIA 4C4YA 4ZQHA 4UQLA 2DBZA 4I4TA 4ZZIA 1ZQ9A 1RFLA 4TV8F 3B78A 1M8KA 2OWDA 3QU4A 4EFMA 2Y1XA 1B6RA 1BVYF 4GGMX 2J6IA 5KTKA 4F3KA 1LF0A 1H2ZA 1Q7RA 2NUBA 1DL5A 1KI6B 2VNAA 3ODPA 1TM2A 5JI2E 1YS2X 5AICA 2BGWA 3P9PA 2PAAA 1R0RE 2LCIA 5BW5A 2JFUA 2YYZA 1WTCA 4CCSA 1TOAA 3AKCA 3CEHA 3PWKA 2AKYA 4TL9A 1U0GA 3JQBC 5EJFA 2O3UA 4MA5A 2B4KA 3RUAA 5B3JA 3UV3A 4E4YA 2ZR7A 1YB6A 4BDSA 1DBQA 3FCAA 2WF6A 1PYDA 1JR2A 2FSIA 5EWMB 4WA8A 2Y77A 3AUXA 5LZ5A 3IL2A 3NALA 4CM4B 2O48X 1SQGA 5ALGA 3ZYZA 1YMVA 1ZK4A 3OZTA 1XG5A 3JZDA 4UBIA 1D6SA 4YDRA 1JA0A 2XECA 3JQAA 4ZQFA 3SFVA 1E5TA 5DYYA 5TQJA 2VDWB 1TFRA 3NGMA 5F21A 2WIAA 4HFRA 2ZTLA 2RGWA 1HX7A 3TW8B 1CNFA 4RKEA 2QBYA 3IAUA 1EP3B 3WNQA 4AY2A 4A15A 1SVUA 1XEAA 3E9MA 3OLWA 3ETHA 1WZ2A 1EHCA 1EDOA 1FS6A 4GBJA 1E3MA 2V5AA 4W1RA 1ZD4A 3TLJA 3WIUA 4PG7A 3AR5A 3V3KA 2AW3A 5TXGA 4DM4A 3QLUC 1N2ZA 4YROA 5HKKA 2H4FA 2QF7A 2XHEA 5JDIA 4MR9A 3EPKA 3LJKA 2B78A 2H51A 2RHGB 4DR2B 5JCZA 1UMCB 4B3IA 3UC9A 8GPBA 1GTJ1 3R9IA 1RZ3A 1VOTA 2C9OA 4KAXA 2HQBA 3PHBE 5BV1A 3EG9A 4FTWA 1AOXA 1BVRA 5IVDA 621PA 4FN4A 3C6MA 2OBXA 1L7BA 4KQMA 3DBVO 4PBSA 4YK7A 3UWSA 4UOZA 3TMKA 1S7CA 2QD5A 1WTAA 1O95D 5KJCA 1E9DA 1X7GA 2OFWA 2A1TR 1IZ9A 3A9SA 1O0CA 1VFNA 1KP9A 1O6FA 4C87A 2YRFA 5F9HA 1U81A 4TM7A 1Z63A 1DELA 3K94A 4KH0A 3ANYB 1KPGA 5SZIA 5LQKA 1PL0A 4YYEA 4H7EA 2BLLA 4Y6SA 1K7YA 2BJWA 4KREA 2CBGA 4MPDA 1WPXA 5KEIA 1EX6A 3TR0A 2Z8YM 5KSWB 2ZJFA 3EEBA 1B43A 4BO6A 5KYXA 3JQGA 4V2IA 2BP7A 1LPOA 3QSYA 1YDGA 2INGX 4PYKA 5LOVA 3KXKA 4KAFA 5HCIA 5LQNA 2GDJA 1CB0A 3G7UA 3LXXA 4MS3B 4MUIA 3RJTA 4EHJA 3AVUA 3TUZC 3BFVA 3NATA 4K6CA 3UK6A 3VVBA 3N3AC 3THYA 4P83A 1VECA 3PUJA 2VZ0A 2HBQA 4IIYA 5DHPA 4NC9A 1P77A 1OFUX 3WDMA 1DG1G 4L02A 5ALFA 5HKAA 1Z33A 1ECLA 1W581 2CUTA 3CLKA 2ZSIA 4REMA 3TBKA 4CNQA 4TRJA 2O8DB 1U2DC 1YCFA 2I3GA 3EWIA 2IPNA 2WF5A 3JRXA 5IN5A 5U4XA 4BMNA 1BMQA 1IEWA 1SZDA 5CLLA 1U0RA 1QE0A 4Z6KA 1ORTA 1ZWKA 3H6KA 1NN5A 2E6KA 1QHSA 3FFTA 4OJTA 5A04A 4ZHQA 1RAAA 3FY4A 3V7UA 3I12A 1Z4LA 1O1YA 4O3MA 4M9CA 2WLTA 4U5QA 5CPBA 3PFNA 4I1YA 3PD0A 3HADA 1ULHA 3ELWA 3FWNA 1ZCAA 4RVCA 5B3AA 3U31A 4CM8B 2VRCD 1MLDA 1TPYA 4N39A 3F9RA 2HA6A 2I1LA 1U7UA 3CFYA 1DC3A 4TMWA 2UVDA 4B85A 1E69A 3NNNA 1G1AA 5C5DA 1PV4A 1E3IA 4OBBA 1TX4B 1IN8A 1C1DA 2KW5A 1RWWA 2Z6VA 1B2RA 2LKCA 3AEQA 3B1VA 5A71A 3U7EB 3W5VA 5UKDA 4MZXA 1QK5A 2X8JA 3GBPA 1EVLA 1KSJA 1A88A 2YZ7A 3PRHA 2CF6A 3F6SA 4RHCA 3VA7A 1NJ5A 1R9GA 2J59A 4U0KA 2V0GA 4I1OA 3EQZA 5B37A 1OBVA 4I8XA 3MWDB 3RYTC 5BVGA 1WXIA 2AOTB 3M6WA 3UEOA 1J0XO 1M34B 4K9OA 1RQPA 2WUDA 3HJTA 5CNMA 5B2ZA 1J56A 3G5AA 4UHCA 4IAOA 1Z07A 1I2BA 2C20A 3GAZA 4GL2A 4DB4A 4I2VA 1LPBB 3TAHA 4ZVTA 1ZI8A 3KYCA 4BNUA 2D7CA 3IUBA 4DCJA 1RCUA 3FWZA 4RKRA 1INLA 5I5GA 1QV7A 4YUAA 2C58A 4C7OA 4RPGA 3RUDA 4XD2A 5JH7A 1YK0A 4PS0A 4NCBA 4URUR 2B4QA 1AG9A 3ASVA 1F0NA 3WOHA 1Z83A 5JXJA 4W1SA 2ATIA 3KJXA 3AJ8A 3BJEA 1TT5A 1Q74A 1US8B 1Y5MA 1RQLA 3DEIA 3QYFA 4IDEA 4YAEA 2Q0SA 3G5UA 5I9TA 2AN1A 2JBAA 2X6QA 3G2JA 3QWFA 2DFTA 1J00A 1SGWA 1RPJA 3VO8A 1VL2A 1GRCA 3REQA 1P91A 3ML1A 4R9SA 2ZULA 1LVHA 4K26A 4B3TB 4PNHA 1LDBA 5KJEA 5ICCA 3VO1A 2HSDA 1KOGA 4P3PA 5C1PA 2APJA 2B98A 2XMBA 2GLUA 3EA0A 1VA5A 3MJTA 4OIFA 1VHJA 2VDKB 2A0FA 4PIPA 1M1YB 3NX4A 2K87A 3F1LA 1COZA 3ESZA 1R0WA 4C3OB 5ARCA 4CUJA 1WCIB 4UEOA 4ASUA 4ZO4A 1F60A 3C7AA 3MTGA 4TXJA 3ZWQA 2JFXA 2RHRA 2XQGA 1RZRA 3E9CA 1V3VA 1L4HA 1TU3A 3L0YA 3ZWPA 4FEAA 4FILA 5GQSA 1GL6A 4BIMA 3TNFA 2F4VB 3EQ7A 2KMLA 4YJ2F 2DLDA 3E8XA 4R69A 3ZBTA 1DTWB 1W47A 1PEYA 1Z6YA 4RORA 3PA6A 1P61B 1M6YA 1BO6A 1VJTA 4ESHA 3V4PB 4D9KA 2A7XA 3ZNNA 4U3JA 1NY6A 2Q6LA 3ZY4A 3EISA 4C7BA 3TL3A 4G8DA 4LJLA 4R84A 3UOWA 3FN4A 3L7OA 4A0HA 5EHZA 5JQGB 4LJYA 3A8TA 1AT1A 5E1DA 1MVLA 3I9V6 3KQYA 1ZK0A 1QGYA 2HTEA 3R9KA 3RFUA 1XQXA 2G6BA 2XDAA 5CLJA 3P0JA 1E63A 1Z6GA 5EE5B 1PTKA 1BCRB 2YOGA 4QDTA 1RWXA 4RNCA 3R76A 2YIJA 1NUQA 2FPLA 4KO3S 4MVJA 4TRRA 1BC5A 3WNZA 4EHFA 4EI2A 2PKWA 1I7PA 3O9MA 1RPNA 2D8AA 3PCXA 4IJ6A 1VKNA 4RPIA 1KEUA 1TW2A 1VBNA 1AUPA 2ZRIA 4LQCA 5FFFA 3WBBA 4G0VA 3K9BA 4S1OA 1Q15A 3OD1A 1KZYC 4U8HA 5ED0A 1JV2B 2W11A 3MT9A 1SN7A 1Z5UA 3LHDA 1YUNA 1Q1GA 2PZFA 4N65A 1G8KA 1Z68A 1M83A 2PQ2A 3F49S 4O8CA 3N8DA 4ITUA 5GTDA 1SKYB 1Z18A 3X44A 3UK1A 1NQTA 4LF4B 1THMA 3PHIA 4O4HA 1P0CA 2JCSA 3ED1A 1KZ4A 1LRJA 2A1UB 1Z4JA 3MSXA 3QFFA 4MVJI 5ALEA 1TK2A 5ITZA 3OI7A 3P19A 3WLEA 4YDQA 4RZSA 3JZFA 4DV6B 4FDUA 4C6TA 2UUBB 3HB5X 5JWHA 1KFEB 1GPAA 4GOMD 3EPLA 5K8IA 3U7FB 2X5OA 4XX0B 3VR4D 4EHKA 2WAYA 3K9LA 1SIBE 2IH5A 4MW1A 4TLDA 1BW9B 1X1BA 2A5GA 2W0MA 2PJRA 4YI3A 2MIIA 3DWEX 4ZA2A 1TLTA 2ZSJA 1MT0A 3E5RA 1AF7A 2GTIA 3QUQA 1N5MA 2QPOA 2HLPA 3EZ7A 1CZRA 1KETA 3MGCA 1V8FA 5A9SA 2OK7A 3UNXA 3B7WA 3M2TA 3ZBUA 1UPXA 2H08A 3AMVA 5DNYB 1PWHA 3IQGX 4LY0A 1Q95A 5DHFA 1Z0DA 1Q12A 1Z5GA 1IEVA 2VA8A 3LPLA 5JC1A 1EFPB 4BRWA 4OL0A 1ZD1A 1OIVA 3I83A 3O4HA 1DKRA 1FUUA 4AW9A 1YB7A 1P45A 3CSUA 3R9XB 1LSJA 2Q6OA 1Q21A 3EH1A 1U65A 4CU5A 3QWBA 2FEPA 3AV3A 3GVHA 2FMHA 4MPJA 2YJ6A 4HO1X 4WCFB 1GQQA 3ZGZA 4M89A 3V4FA 4CXMA 4B31A 1RRGA 2GAJA 3AEKA 3D5QA 3FDZB 1RM3A 3Q98A 2M32A 2W2XA 3J80A 3IE0A 3PFGA 2VH2A 1WO8A 4XQCA 4GR5A 4AJHA 2BFOA 3H5AA 1FX1A 1IZZA 1F9EA 3AHGA 3NM4A 3OPMA 3ZQ4A 5CEFA 3O4RA 5IT9A 4FI3C 5DI3B 1S8NA 1D4ZA 3IAXA 3D3JA 1HNXB 2BONA 3VH1A 2ATVA 5CT4A 1OH7A 4CIBA 3NHJA 2ECPA 2WKWA 3ZHCA 3DM5A 1JGTA 4DLKA 4X45A 5CRIA 3VPFA 3FUXA 1BHQ1 3J81k 5EIOA 1COWA 1E0KA 1NN0A 2JDIA 2WHPB 3A4TA 3JQ9A 4URHA 3TSCA 5E7IA 3I4FA 1Y1SA 2RAVA 3URKA 1V5FA 4G8BA 4Q4HB 5C4IA 1DC7A 2C77A 1JKXA 3LBAA 3VSCA 1CRWG 3C6YA 1M6WA 5FWYA 4Z51A 1HT0A 4EECA 4KXUA 2WFAA 5TDHA 4LMAA 2NZXA 5TGZA 2QHXA 4FE7A 4C2TA 3ELUA 3SHQA 2IYPA 1AS0A 1UBNA 2XCLA 1PDVA 2DBVO 2YIVX 3DV2A 1VBKA 4KRYA 3H11B 2RAFA 3TI7A 1FFWA 3B9BA 3EEYA 1TJ5A 4S12A 1VE7A 1E5XA 1FU8A 1IHYA 1L5FA 1SC9A 2IYNA 3CT4A 1V11B 2WIKA 4JL5A 4K9QA 3SXUB 1YDHA 3KB6A 5TY0A 3UUEA 4C89A 1OTXA 2P0YA 2KI5A 1SBYA 4FM9A 4YP0A 2HRRA 3VYRB 2QUKA 5TV2A 2JRLA 1IJBA 4KGZA 3FUWA 3HZOA 5HTOA 1DZIA 2BR5A 2J9GA 2PZKA 2RGNA 3GA5A 4G09A 2BTOA 1NQXA 2PKRA 4H0FA 2IEZA 3JWEA 1WEKA 3CZ4A 1FDOA 3DNMA 4H1TA 4Q7LA 2QR5A 1JR3D 1N6NA 1Y5NA 2EZ4A 2R4TA 3UAGA 4F06A 2ZVPX 3ESYA 1DJQA 1KJJA 1N3YA 1G3RA 2VWPA 3F46A 1CP2A 1M1UA 1P6XA 2PL3A 2FPIB 4CBVA 4UTVA 3FOFC 4BO2A 3BVPA 3F7NA 3MMZA 5LR6A 2PRIA 2WV7A 1U7HA 4QPPA 2QX7A 4RTJA 3TKYA 3GEEA 1OGYA 2CSUA 3GEPA 4CLOA 4KFSA 2ZFUA 1K7CA 3V8EA 4XVUA 4BVEA 1QH0A 2L0XA 4EZBA 5C8XA 5GZ3A 3OFKA 2CJWA 2D5AA 1J8YF 3I9KA 3N8GA 4IOLA 3CLSD 4GI5A 1WKCA 4X97A 3QE9Y 2NQTA 1IU9A 2E1RA 3E9DA 3OCVA 2Z1DA 4I3GA 3R0VA 5L9AA 3DA8A 3T94A 4YRJA 4AG6A 5BNIA 3PL1A 1LLCA 1WSAA 2VK2A 3A37A 2PL9A 2XTJA 3IC5A 1F14A 4FKZA 5K8UA 2QRLA 3C43A 1VXOA 3PFWO 1A7UA 1GLVA 1WXGA 1JEDA 2Y1WA