3A37A

Structural insight into the membrane insertion of tail-anchored proteins by get3
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
346
structure length
313
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAAADLTGSIPGIDEALSFMEVMKHIKRQEQDEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Structural insight into the membrane insertion of tail-anchored proteins by Get3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 96
structure length 313
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a37A00
1FX0A 2OBLA 4BLOA 3K0FB 1MO5A 4IOLA 2IYZA 2GVZC 1ZU4A 5G3YA 1VCNA 1FP7A 3TQFA 5E7JA 2IYYA 4AYXA 1R5BA 4LGMA 1QG2A 5JJLA 3OFNA 3MG9A 3R8CA 2UVQA 4LX0A 3LW8A 1FL9A 2OO7A 1VYVA 1HURA 3CF6R 3IBYA 3GLIB 1OXVA 3TR0A 4TLBA 1AA9A 2PZGA 1E69A 1VMAA 1CJKC 4IDOA 5A4JA 4RZXA 2LWIA 3KJIA 3HJNA 3FMOB 2P2LA 5DO9A 5AJVB 3D6TB 4HAVA 4UNQA 3V9PA 1PUJA 4FMCB 1S2MA 1G7SA 3Q3JB 4HATA 5KDLA 3U3OA 1PJRA 3PR1A 1E9FA 4BLTA 3RRZA 3LD9A 3SJAA 4LI0A 1QHXA 2WOOA 4HLQB 4OI4A 4HAXA 4QC2A 4DDWA 4HDCA 4V0OA 1P7CA 3MWJA 2RHDA 2OILA 4IVPA 5TVKA 1J8MF 4A15A 4FCVA 4XD7D 1X3SA 4Q1AA 3WP1B 3OESA 821PA 5DSZA 1UBFA 4AKGA 3H0KA 1AS0A 1Z08A 1WP9A 3SJBA 1T5LA 3ND8A 1TU3A 4O0MA 3TQCA 1ZUIA 3SBEA 1ZAKA 4B3FX 3KKOA 1XF9A 2C77A 1QHHB 6Q21A 3TUJC 1KAOA 5FOWA 2NO9A 2DR3A 2GILA 2ZE8A 1Z07A 2BEJA 2J46A 1XB2A 2NOAA 3PUXA 2F43A 3FWYA 3HWSA 4H1UA 4GT1A 4GNKA 5CK4A 2OFWA 3ADKA 2O52A 2D4HA 1NLZA 2BVNA 4O2RA 4MA4A 5GJVC 3K53A 1DTSA 1JXOA 4WA7A 1G8GA 1LNZA 3NTUA 4LYJA 2CNWD 2WZQA 1N6RA 1IXSB 2NIPA 2QTHA 1OW3B 4XTCS 4OQNA 4ABYA 2OFOA 4LJ8A 1JQJC 4XTRA 4AC9A 4ARZA 3U60B 3DMNA 4HSEA 3AF2A 2ASEA 4S35A 2AL7A 2IXGA 2GZDA 1AJEA 2XNDA 4WXRA 4DLYA 4MKIA 2JGNA 3BE4A 3FTQA 4D0NA 1M8PA 4B47A 1ZC4A 3SYLA 1G3UA 5H1YA 3EZ6A 3GP8A 4HAYA 2ERYA 1E2KA 4C0LA 2WSSD 4I4LA 5JBQA 1KO4A 2BBWA 4LCBA 4Q1EA 2C9OA 3VNVA 2CLSA 1MRSA 1SVSA 3KJHA 4KODA 1TAGA 2F6RA 3NC0C 2HUPA 1RYFA 2JASA 4RSGA 1SULA 2YHSA 5CLLA 4RFSA 3GLIE 1G3QA 1M7GA 4URUR 3Q7PA 5EE9A 3P1JA 4YC7A 3PUVA 1ZP6A 4NZYA 1GKIA 1ZC3A 2FGJA 2ZITA 3EASA 4DT1B 2A5YB 2VBCA 3GLGB 1OSNA 4JLAA 2BEKA 1S96A 4RD4A 2V54A 4MYCA 4OK6A 4MDEA 2E9SA 2REOA 1NL3A 1DEKA 2RHMA 5DHAA 2MSEB 1X8LA 1IQPA 3BIFA 5M04A 2IUUA 4K81B 1W36D 2REBA 1CJUC 1KZGB 2ZVPX 5JWOA 4M21A 1EFCA 1M7HA 1DE0A 1W49A 3K8YA 3KKNA 2XZOA 1Q1QA 4BEBA 3QOFA 4M9ZA 2OBNA 4KVGA 2YWGA 3BFKA 2ZPTX 3P32A 4G0NA 4TQ9A 4PSAA 4KFTA 2VRWA 5AJXA 3REFA 2OBMA 3A1VA 2YKGA 3U7EB 2XJ9A 1C4OA 5TXGA 4B75A 3MWYW 5EJEA 1DAIA 5CIQA 5LDDC 3TVTA 3ZZUA 4B44A 1ONBA 3K0FA 1M1YE 1NVUQ 3CM0A 4E03A 2QE7A 3WMFA 2H7VA 2FZ4A 421PA 1Q57A 2WWHA 3KFXA 4KSBA 4JBXA 4FMCF 1VYUA 3KQHA 3CO5A 1TF7A 2GRJA 3NC1C 1JXMA 4G5QA 5EXPA 5L3SA 2IWHA 1NMYA 2CLCX 3UANA 4MUAA 2PCJA 3QKUA 1W1WA 4K8OA 3L43A 3I32A 3EC2A 2CK3A 2FFQA 3LY5A 4IDNA 4JS0A 4UXJA 1TF5A 1JR3A 1L4UA 2VO1A 3B82A 1W0JA 4B35A 3HU1A 1L4YA 1YR9A 4TQUS 5BN4A 3EXAA 1YU9A 4YDSA 3KUDA 3AVUA 4UQOA 2YOFA 3ADCA 1W0KD 4DJTA 4CT5A 4BFZA 3W5IA 3NBXX 2DFKB 4IFBA 2D74A 5EXTA 4C3ZA 2F7SA 1AKYA 1KDPA 4Q03A 2ECKA 1WDTA 2A5FA 3LFUA 2IL1A 2EU8A 1OH7A 4EDHA 4M2LA 2QP4A 3KTAA 1Q0UA 3E2IA 4MITA 4GDFA 1QHGA 1US8A 1KHTA 1K5GA 2EFEB 1G7TA 1RYHA 1YR6A 3H2YA 3BGWA 4B3CA 1K8RA 3GLGE 5IDVA 1GIAA 2DWPA 3QNUA 4B2PA 3M1IA 5KTYA 2QMOA 3RSOA 2QAGC 2YYZA 2OCAA 1DAMA 2R8RA 5F2EA 2QZ4A 3PEUA 2QPTA 3QXSA 3TAUA 4KITB 1IJFA 3QEOA 2IHBA 2Y8EA 5JRZA 1LV7A 4A8JC 1E0SA 2QQEA 3NEYA 3X1WA 2QQ0A 4GOKA 2QA5A 4OHVA 2H5EA 3GMTA 4C0HA 1VHTA 1IN6A 1BO6A 4TMXA 3PEVA 3CB4A 4RKEA 4A0FA 5E7IA 3WHLA 2XOKD 4CYMA 3D7MA 3GEHA 4LBZA 1P5ZB 3NDPA 2KBEA 2OLKA 2GCPA 3UMFA 4JZKA 1KI8A 1Q44A 4BFWA 3QBTA 4U7DA 4MRPA 1WBBA 3ZD7A 2CDNA 4WXPA 3BWDD 2RKOA 2Q21A 2Z0MA 2XNDD 1P6XA 2H8KA 1T5IA 3RS5A 2BCJQ 3AF4A 4R9UC 4RKFA 1ETUA 1G18A 1UDWA 2QAGB 1MT0A 2VH5R 3N5CA 2RGNA 1W48A 3DKVA 2QI9C 2AD5A 1E0JA 2WAXA 4A8JB 3QJYA 4HUQB 4KI0A 1YR7A 4C2TA 2HF8A 4DT1A 2WICA 3OZXA 2VP5A 2FFHA 4Q5IA 3CRQA 4FW9A 3I8SA 4DLWA 4Q7LA 2NQ2C 4DLVA 4H9GA 4L8GA 5F9FA 1F2UB 1MKYA 3KXKA 4B6FA 2O8BB 1UAAA 1OYYA 1OPXA 2E87A 1W4CA 2C04A 3VR2A 3OEHA 1JJVA 1YVDA 2RGEA 2FWRA 3P27A 3LVRE 4R98A 4OHWA 1IN8A 2HCBA 3GQBA 2JLWA 3LBIA 3OHMA 2JEOA 4D0LB 3GFPA 1QHNA 3R20A 4NCIA 1S3GA 1XEXB 2JJ2A 1E4YA 4A2PA 4HZUB 1IXRC 3PFIA 1QHIA 2ZSEA 4Z51A 3WNBA 2DB3A 3CX6A 1Z0FA 3FKSA 2YV5A 4JL5A 1KOFA 3ZLJA 4Q21A 1TUIA 4QBGB 4U02A 3I73A 1W4RA 4DSTA 2OG2A 3CRW1 5LBIA 2QP3A 3CZQA 2VP4A 5TDHA 3UIEA 4DCTA 5B57C 2A30A 3NHBA 1HE8B 1XFAA 2QRNA 5IK2D 3CPEA 5EE5B 1BKDR 2ZS7A 2XB2A 2IYUA 4IEEA 1I4DD 4PQRA 1E2DA 2C99A 3EA0A 5GJCA 3B1WA 3B1ZA 2BKUA 4V03A 2VHUA 1NMZA 3P4YA 3V00A 5E7MA 4LHXA 2LKCA 2F3TA 3ZVNA 1N6PA 2F9LA 4IW3B 4L15A 2PT5A 3VR5A 4DCNA 1G8YA 4G01B 4D25A 2WWFA 1W46A 1RRPA 5FOTA 4MH0R 5C18A 4QXAA 4MYTA 2GK7A 1FQKA 1G8FA 2YINC 3C5HA 4Q48A 1GKUB 2WIBA 2WJJA 3GLHB 2CCJA 3P26A 1GSIA 4JJZA 3RS7A 2PMDA 3ICEA 5P21A 3QF4B 4MRVA 1OFIA 2J0VA 5FPKA 2B7BA 3IBGA 3RLFA 4BASA 4BLRA 2CL0X 4GP6A 3W90A 2QGZA 4XWKA 3DZDA 1X1SA 4MYUA 5J47A 4JBYA 4JJKA 2GAAA 5FBQB 3PEWA 1E3MA 3A1SA 4M4SA 3LX8A 3TLXA 1XCPA 5FBLB 5D3MB 1P62B 2VIIA 1U9IA 3EPHA 3NVAA 5L3RA 4O25A 3WNDA 3I5XA 1S4QA 4BLSA 2CJWB 5AJZA 1FZQA 4PQFA 4Q9IA 3Q5EA 2JCSA 5KOYA 4DKXA 3FHTA 3T5DA 3VKHA 1KAGA 3PV0A 1HV8A 3N2IA 2O8CA 3CRMA 4LZZA 2J7KA 4M22A 2CCGA 4HAUA 2Z43A 3ONWA 4DCSA 4F4CA 3A1WA 3K0EA 4DLTA 1KSJA 1N6KA 3N70A 1Z0KA 2ZETA 1EXMA 2FEMA 5JCPA 5FBVB 1U0JA 1N5IA 4GMXA 2J5XA 3EPKA 1F48A 4TQAA 4IDQA 1E9SA 1NVVQ 3H4MA 2CCKA 2AFIE 3MLEA 2FE4A 3IO3A 1L7VC 4OKSA 3THXB 2IA5A 2OLJA 4JVNA 1FTSA 4BLQA 1OH5A 4I99A 3QI2A 4AKHA 2ZYWX 1KYIA 1SHZA 1UADA 5FTMA 4Q4LA 3AF1A 4EUNA 2PJRA 2ZYUX 1Z47A 3EX7C 1T6NA 1JJ7A 2YOHA 2VA8A 1KI7A 2V4ZA 5FTNA 1G21E 1VG9B 3U61B 2ZI7A 2W2XA 3TSZA 4BWYA 4QJ4A 1G3RA 4B71A 4HUQA 4TSFA 4EFNA 3LW7A 1AIPA 1DO2A 2CVFA 1X6VA 4V0LA 4YDHB 2OSBA 3ADDA 1G291 2G88A 5KPDA 2IS1A 1F2UA 1E9AA 2O8BA 4IEIA 1LW7A 4B3XA 4Q01A 5FOVA 5JRJA 1KSGA 5LB2A 3SJCA 2ZE6A 5DN6A 3CRVA 4QGAA 4HI0E 3I61A 2A5JA 3DZ8A 3A4MA 3DKPA 1H8HD 2IUSA 3KDSE 2W0MA 4FIDA 5JLJA 1M34E 1M2OB 2IYXA 3OIUA 4PAOA 4Q7MB 1KIMA 1N3BA 1KO5A 1XEXA 3DEFA 4FXPA 4JLPA 4CZ2A 2V1XA 4M1MA 2J0SA 2BJWA 3VFDA 4HZUA 3MCAA 3VKWA 3HYRA 3DOFA 2FV8A 1NLFA 1QDEA 5CDFA 1IM2A 1SHKA 4V02A 3QKRB 5AJWA 3RS0A 4F91B 4MUBA 1I4LD 3TK1A 1YHNA 3UG6A 1VKJA 1MR3F 1QHYA 1NN3A 5GVRA 2FDCA 5AUNB 1UKVY 5HCNA 3T1OA 2ZUDA 4ZV4A 1KJWA 1XJQA 4I1VA 2FH5B 2ZTSA 1UBCA 3BXZA 5A0FA 3RHFA 1IXZA 3SBDA 4NCNA 4D2IA 1A2BA 1QF9A 3GEIA 4TYYA 1RE0A 2GEUA 3Q9LA 4FMBB 4DZZA 5CYOA 3B1VA 3PUYA 1YZLA 4DDUA 4GOXA 3CH4B 4DUGD 3C16C 4TLAA 1G19A 4CEIA 4WIAA 3W5JA 4B43A 4ZDKA 4QJ3A 2DFTA 3T12A 2WWXA 4WZAE 2B21A 2P6RA 3SN6A 1WMSA 4AG5A 1E0AA 1XEWX 4RCYA 3I8XA 4PZLA 5KUTA 1IJEA 2RH5A 4NYJQ 3GLHA 2REXB 3B1XA 2F43B 3FGNA 5EE3A 1IN7A 2VHQA 3QF4A 4DSOA 3CF0A 8OHMA 1GTVA 4TL8A 3IIMA 4TT3A 3VR3A 5JSZA 1BH2A 2JAQA 2OCBA 3SHFA 5L8VA 2XZLA 4YQFA 1TMKA 2AK2A 3G5UA 4M1KA 2IXEA 3IIKA 5FOXA 1GVNB 3IPYA 2J0QA 2ZRKA 4ZO4A 1E0KA 5D3MA 4FN5A 1E1RA 1NJGA 4S2EA 3RRMA 3LV8A 2CJWA 2ZRNA 4PC3A 2AWNA 1KI4A 4QM7A 1TF2A 2OE2A 1NRJB 4HDQB 4F93B 4JLKA 1J2JA 3AUYA 1D9XA 3AVQA 2WKQA 1G7CA 4XWOA 4LC0A 1P2TA 1XTJA 4TZ6A 2CXXA 3WNCA 1JBKA 4I1OA 4IJMA 2XEXA 2QROA 5JI2E 4P33A 1EFRD 2BIFA 1KMQA 4DB4A 4LWZA 5DH9A 2PBRA 1TEXA 4Q4HA 3OAAA 2HDNB 3BJIC 1EX6A 1E2MA 1PV4A 4M1YA 3BC1A 2HXSA 3EW9A 2ZRHA 3LX5A 4RD2A 4L5BA 3K9NA 2A7QA 4DIDA 4YONB 4D4LA 1YQTA 3A1UA 3B9QA 4ZCLA 1JI0A 3S1AB 2WJVA 1T8TA 4OL0A 5TMPA 1GITA 3QQ5A 4L9SA 4Q7KA 1XD2B 2JJ1A 5GADl 1HH4A 4C7OA 1I2DA 2AD1A 2D2FA 4TLCA 3T15A 4DCVA 2GF0A 2N1BA 4URXR 3FB4A 3KB2A 2QG6A 1YE8A 3UWOA 3KQLA 2EFGA 1QZXA 2O0KA 3N2EA 1HY3A 1EX7A 1N2CE 3C8UA 1J8YF 5FH9A 4LJ6A 4PO9A 2GEVA 1Z6GA 3TUIC 3SC3A 1COWD 5JJKA 1R0ZA 1U99A 3LVQE 1K5DA 3RWOA 3TIFA 221PA 4CGZA 1W44A 4DB2A 1U2RA 4IHQA 2OM2A 2C78A 1UKZA 4W5JA 3T06B 2W6IA 2QGNA 2AWOA 2F55A 2WJYA 2WJGA 2C5LA 3LDAA 3U3MA 5FI0B 2BHRA 1KY3A 1AGPA 1AGRA 5C4GB 3ZIAD 1KO8A 2JLUA 4CVNA 3LH5A 3R7WB 5L3SB 5JECA 2R6AA 1B0UA 1E9RA 2RGXA 4YLGA 2C8VA 1II9A 2V6IA 2P65A 3QKRA 4LOAA 3O8DA 5EUQB 5LPNA 1OFTA 2GXSA 3MWLA 3B60A 4Q47A 1P75A 4IRUB 5HPYB 3C5CA 2V8OA 3A4NA 1CR0A 1FUUA 2GCOB 1U8AA 3F3YA 1KDRA 2C03A 2FG5A 1Z8FA 2G0TA 1NY6A 2YC2C 4GL2A 2AK3A 3VHXA 5AK0A 4AY2A 1KO1A 5B2ZA 3OEED 2QL6A 4M9QA 3U6KA 5FI1B 5H70A 4UNRA 1R6BX 3SFZA 3WMGA 2FSHA 4JSTA 2CE7A 2JA1A 3I4LA 3IO5A 3MRSA 3KTAB 2JLXA 5HE9A 4MKFA 4YXWA 2QMEA 1US8B 3C41J 2OHFA 4KVAA 1JPNA 1G16A 1KDTA 2B92A 1G64A 3NH6A 3WRYC 3BERA 3P4XA 4QGGA 2L0XA 3Q7QA 4CEJB 2P6NA 2ZREA 1GOTA 5AR1A 1FFHA 1IBRA 4QHYA 3WYGA 2OZEA 5JHGB 2RGNC 4IVQA 1KSFX 2B6HA 4M53A 3QENA 2QBYA 3QG5A 2ZAMA 3JZMA 2QT0A 1OB2A 4Q66C 2BC9A 4BUJA 1H8ED 2ZAOA 3EIHA 2A78A 3O8RA 5FOSA 1DPFA 3W6PA 1JB1A 1XZQA 1CBUA 3CX8A 5A5GA 1Z6YA 1HUQA 3AGQA 1LS1A 4Q1BA 3GJXC 3TH5A 4HEJA 1GRQA 1RRFA 4D4MA 4KFRA 3R9XA 2ZM5A 2R6FA 5E95A 1NJFA 4B76A 2HLDD 1CR1A 5L3VA 1RC8A 1E1RD 2BOVA 5HZKA 5F9HA 2WHXA 3SOPA 1RRGA 5EP3A 2JDID 1DARA 3H86A 3AV0B 4K46A 5DE3A 4JIMA 3Q72A 5B30A 1FNMA 2Q9AA 1IY0A 1NBMA 2J7PD 3A37A 5KYKA 1CLUA 2HJVA 3W8NA 3T34A 1KY2A 4RY2A 5G41A 1D2EA 4CF7A 3X1XA 1IN5A 1F2TB 3ZYCA 2CHGA 4M1TA 1XMSA 2GF9A 3AVWA 3AVYA 3KQUA 1N0UA 1HT1E 4NYIQ 1C9KA 1W2GA 4MGKR 2FA9A 1JR3E 3E5HA 4G5RA 1E1QA 4PXAA 1Y63A 3QY0A 4V0NA 3S1AA 4B3BA 1DG3A 3IQXA 1WF3A 3PCRB 1TQ4A 4JYBA 1XD2A 4G5GA 2IW3A 1P9WA 1YZNA 1ZNYA 2V6JA 1CJVC 1JECA 2VSXA 5G3ZA 2AXNA 3CPJB 1CEEA 3W8RA 1ZUNB 1EFHA 1J99A 3BB3A 3MWKA 2EFCB 4OI1A 2ZR9A 3ZZ0A 2IUTA 1E2LA 3NIBA 3GCGA 2KJQA 4J0QA 1G4UR 2FU5C 1FTNA 2JLRA 5AJYA 1RPZA 3W6OA 4WZ6A 3VR4A 1CR2A 1LF0A 3I3SR 3LA6A 5FOUA 2V55B 1ZCBA 5JJIA 3THOA 3RC8A 3CWQA 2I1QA 4NU0A 4MGZR 4TL9A 1Q3HA 1ZD1A 5AUPB 3CLVA 1SXJC 5CITA 3EIQA 3ADBA 1E32A 4Q1CA 5LD2C 1G8PA 2CEAA 2VF8A 2ZJZA 4PX9A 1TQDA 1N0VC 1OT3A 2GXUA 4Y0AA 3F8TA 3CR7A 2R6GA 3LWNA 4DC9A 2W6ID 4WAUA 5KNDA 2QSYA 3FHOA 4HB4A 1D2MA 3PXGA 3R7WA 3SEAA 4RD6A 4DLSA 4ACAA 2D7DA 1KKMA 4GSYA 1ZNWA 4D81A 1JAIA 1G5RA 3EPJA 3SNHA 2ZQ5A 3OFND 2IF2A 4NP6A 4ASUA 1MO4A 1B23P 2GTPA 5DI3B 3R8FA 1Z22A 1RFLA 1P60A 1OXXK 1R0YA 1U9IC 2ZSDA 3VX3A 1LS6A 2EYQA 3AKDA 2WPDA 4GZMA 2GESA 1NIJA 3SJZA 3IILA 2YWHA 1G6OA 1SXJB 2GJ9A 3J81k 2GCOA 1MO6A 1CRPA 4LV8B 3K0AA 5FR2A 4LSGA 2NPFA 3B13B 5LD2B 1NKSA 2HJGA 1LFDB 2QENA 4G5OA 3CX7A 1UKYA 5JS7A 2BJVA 5SZHB 4B3GA 4C0SA 1WQ1R 4PSVA 3KQNA 1ZM7A 2I1VB 4LHWA 2RAPA 5UKDA 2BCGY 5EQTA 3QIAA 4HZIA 2R6CA 4NTZA 4P4TA 4OHZA 1WB9A 4I1UA 4RZ3A 3RDPA 5GJBA 1HE1C 2ZROA 4DDVA 1DAEA 2FSFA 2MMGA 4KLNA 5CK5A 4CEJA 1E2HA 2A5DA 1L8QA 4NBSA 2FPLA 3GLFB 2O5VA 1II8A 4IVRA 4CEHB 5EUMA 4BGDA 2QMHA 4G5SA 5JI3E 1Z3IX 3IEUA 2ZRCA 2X77A 3BORA 2OCPA 3FMPB 2R9VA 3L8YA 4QNMA 2GXQA 2IYWA 2AHOA 1GNRA 4ACBA 3KX2A 2O8CB 4NYMR 3ND9A 4LBYA 2IYSA 3JVVA 3SZRA 2G83A 3JZAA 4JLOA 1ZM3A 2ONKA 4HLDA 4LJYA 2I4IA 2F1IA 1FQJA 3NBZC 4PAQA 1VCIA 4JBWA 4P4SA 4ZI2A 3C15C 2FFBA 3CNOA 3CPHA 4JL6A 3RC3A 1HQCA 1P73A 3AKCA 3I1FA 4CW7A 1MABA 4EFMA 3B5JA 2J1LA 4OI2A 2BMFA 3OE7A 3RANA 1F2TA 1NN0A 4D6PA 2ZVQX 3RS2A 1NG1A 1IOZA 1ZYUA 2C98A 3A6PC 4A0HA 2DPXA 2XNSA 1XXHB 1S3SA 5SZJA 3TBKA 3AP3A 4QFMA 4EAQA 2C95A 4JMPA 3C7KA 4RD0A 1D8TA 4B6EA 1OYWA 1SVLA 3CH5A 3KKQA 1PUIA 3L0IB 4AKIA 4LPKA 5CYPA 5TB5A 1Z0DA 4B33A 4PHHA 3KXLA 3ZVLA 5D3QA 4TN1A 3HDTA 3QKSB 1MH1A 1P2SA 2PZFA 4MRRA 5C46F 4QGHA 4JLVA 1RW4A 1PLJA 5CJPA 4Z1MA 1NI3A 1KKLA 2W58A 4UJ5A 2Q9BA 1CRQA 1KI1A 4PC6A 1FP6A 2NMVA 1SKYB 2H17A 1J70A 3LQRA 2PX0A 3BFXA 4FMDB 3X1YA 4RFVA 2X19A 3QVVA 4HLUA 521PA 3I72A 5FPSA 2WWYA 4FWIB 2IXFA 4M9XA 4LJ5A 1G8HA 1A82A 5BW8A 4GP7A 4N0DA 4KU4A 4D0GA 1P9RA 1G5TA 5DISB 4DBLC 2QEQA 4WBSA 1LF5A 2BKEA 1XJCA 3WHKA 1VG8A 3SR0A 5B58C 2PT7A 3GLFE 1DVRA 2YC4C 4G3XA 3M6AA 1VDZA 3LQQA 1N0WA 1MV5A 4JLDA 1GL6A 1Z0AA 2WKRA 4BECA 3VTKA 1E98A 5EP2A 3B1YA 3HU2A 1AZTA 3UATA 2EFDB 2QE7D 3DO6A 1A4RA 2Q9CA 2LKDA 4LBWA 1N6IA 3RVBA 3W34A 1E9BA 3LBNA 3X1DA 2NO1A 1GDDA 1VG1A 2G0NA 1OHHA 1ODFA 5AUOB 4E07A 3BBPA 3HP1A 1ANKA 4JT2A 2JATA 4O2LA 1Z0JA 4TZ0A 2XAUA 4A6PA 3QPVA 1PLKA 5DI3A 1ZD8A 1UFQA 5IT5A 3I62A 1XWIA 2CK3D 5FPYA 3WY9A 1JR3D 4Q9LA 4ASUD 5L3QA 1W0JD 4CEIB 1ZW6A 3EAQA 1OE0A 1E9DA 2GDJA 3E70C 4UNPA 4OK5A 4DWJA 1SXJA 5HKKA 3TJZA 2ZI5A 1XTIA 2DBYA 1EK0A 4MKHA 5TV2A 1ZNZA 2HEIA 2NTYC 2G9NA 1F6BA 1MOZA 3HR7A 2KSQA 2FSGA 2O8DB 2QM8A 2VP9A 1QVAA 1ZINA 5JFGA 1OJLA 1U98A 5CLQA 3L0OA 2W2TA 3ZH9B 2W6JA 5JEEA 2QUZA 3EC1A 2WMNB 4Q7JB 3TR5A 5JSZB 4TTRA 2Z83A 2ORIA 2QY9A 2RB4A 1I4TD 3OF5A 1YRAA 4EPVA 1NF3A 4PHTA 3NG1A 2FOLA 3BS4A 2YZ2A 2VLIA 5FL3A 2OV2A 3GLFA 1NVWQ 4AD8A 3DPUA 3U6BA 4CEHA 4MRNA 1WRBA 4Q1FA 4IOJA 1E2PA 1U8ZA 4ZKDA 4P0TA 2HT1A 3K70C 4LHZA 1S9DA 5EZ6B 4LK2A 1WCV1 1P2UA 5KSZA 1HQYE 1CJMA 4UXIA 3HYTA 2XXAB 2PLRA 4GFDA 4JVMA 1U0HC 1SQ5A 3FMFA 2PLFA 2FPMA 1OXUA 2NG1A 1CJTC 2GJKA 4Q4HB 1GZSA 1WBDA 5J4VA 4QG7A 4V0ME 4UJ3A 1VG0B 4EIWA 3GJ0A 2C9YA 1N6HA 2IC5A 4JVLA 1F5NA 4LC1A 1XD9A 1X8KA 1M7BA 1JEEA 3KKMA 4NPHA 4TL6A 5CDFE 4QKQA 4AK9A 1YZGA 1G4AE 3Q5DA 1ZBDA 2G77B 1Q3TA 1CIPA 1R8QA 1ZIPA 4PTLA 4DIEA 2KWIA 2ZANA 2WTUA 2GEDA 4ZKEA 5HTKA 4NDZA 4XOIA 4C7OB 1KMHA 1Q21A 3K70B 3BH0A 2JLSA 2FSIA 3TVDA 1KI2A 3G82C 1XXHA 2ZI6A 4JKIA 3EG5A 2GA8A 3K1JA 1P72A 2D3WA 4PANA 4RJLA 1N25A 4B32A 1CF4A 4PPNA 1MO3A 3PITA 3DL0A 3U3JA 3KB1A 3PENA 2P5TB 2WJHA 4FMDF 4BLPA 1LB1B 1VCMA 2J0UA 1E2FA 5CJ2A 3ZVRA 3MUFA 4EPTA 4W9MC 4KO8A 1ZCAA 1D2NA 2VP2A 3QKSA 4TMZA 2XB4A 2WSMA 1SVKA 4W5HA 3RRNA 5K8TA 4QM6A 1R0WA 4FCTA 3W3ZB 3UMSA 2XITA 1OKKA 2ZE5A 2V1UA 4OQXA 3NXSA 5FUWA 4DLUA 4LHYA 1NP6A 3RAPR 4TYNA 3GLHE 1NSFA 3OEHD 1CTQA 2IHYA 4FCWA 4Z1MD 1BMFA 4UNSA 3U5ZB 4O3MA 1ZMXA 2QT1A 2VQSA 3AKEA 3OIYA 4HLCA 4QHSA 4V0MA 4Q00A 3GJ7A 2KBFA 4NMMA 4UNNA 3W9YA 4D4JA 3AVOA 4DDTA 3LO5A 3MD0A 2BMJA 1HTWA 4HDOB 4M1OA 4Q4JA 1D5CA 3UK6A 2QM7A 2JJ2D 2EWVA 2V7QA 4DLXA 3L8ZA 4QHTA 4BEJA 1QHSA 4KAXA 1O3YA 4OJQA 2NPIA 1JQLB 2R2AA 4II7A 3WYAA 4QJ5A 3X1ZA 2RGDA 5KO2A 3U3KA 5GJWC 3FKSD 5FFMA 2PCLA 5F98A 1OFUX 5JCZA 4PC1A 4PZZA 1KI6A 4LV6A 3LXXA 1AS2A 4ZI3A 3K09C 5KDOA 3O47A 1DO0A 5H68A 3AM1A 3LLUA 1G3IA 1E2QA 1Z28A 4F4JA 2O8FB 5CM8B 1XPOA 4PHGA 4TTQA 2ZS8A 3AKYA 5E4FA 3QPWA 1KNXA 2JIZA 1Z2CA 4ZDWA 1OIWA 1KI3A 3KFVA 4BFSA 5KHOC 4XSGA 2W0SA 1ZU5A 4OBEA 4URYR 3IPXA 1BIFA 1E94E 1ZM9A 1E2IA 2WKPA 4XD7A 3RABA 4ZCIA 3WBJA 2Z4SA 4XH9B 4BZXA 2FNAA 4DLRA 3AQ4A 3DMDA 2CLDX 3LBHA 1SVOA 2W83A 1YRBA 3HPQA 3OIWA 2O8DA 4ON9A 4X8OA 3EWAA 1G1MA 2AX4A 2QBYB 3U2QA 1KK3A 3FMIA 3PIRA 1OIXA 4OI0A 2QTVB 1OXSC 4GBMA 4CT4B 3T1TA 2VEDA 4JKYA 1AS3A 3ICQB 3ZZTA 2PX3A 3T5GA 2GZAA 2FFAA 3MGCA 1XP8A 2C2HA 3BB1A 1Z0IA 3PVSA 3TKLA 3U7FB 3F5FA 1GFIA 2C9CA 3TSOA 3VU9B 1JALA 2H92A 1UBEA 3SDZA 5DYIA 4UKDA 3PG5A 4C9BA 1R0XA 1IN4A 4PO1A 2O8EB 3CW2A 2CNWA 2EW1A 4LJ7A 3RRYA 2ZJAA 3PJRA 2XXAA 2E1RA 5G53C 1ZIOA 5EE0A 2WV9A 4RD1A 3VAAA 4IDHA 3A4LA 1VCOA 4CDGA 1IAQA 2JLVA 2SHKA 1CXZA 1OB5A 1TADA 1XPRA 4GZLA 3VMFA 1XEFA 1DAFA 1EFUA 3FFBA 1VTKA 4TMWA 4BFYA 4C0JA 3T1QA 2PH1A 5KNBA 2WSSA 3B85A 1GP2A 2F1RA 3RS3A 3DHWC 5KSYA 1R8SA 3K9HA 1AQYA 2ATXA 3L82B 5TY0A 1KNQA 1D6JA 4EPRA 4LRWA 1HEIA 1A2KC 4HAWA 1FMLA 2GWHA 3B8HA 4OQFA 1QG4A 4BE7B 5K8LA 2HXYA 4F4IA 1OH8A 3EIEA 3LLMA 3GPLA 1KDOA 1UM8A 1TU4A 1YZQA 3GJ6A 4Q19A 4URWR 3BD9A 4XVRA 4NL4H 4PR0A 2VF7A 4PC2A 1UJ2A 4M1SA 2WMOB 1YZKA 2AFHE 3PEYA 2ZE7A 1XMJA 4ESVA 3BK7A 2ZRPA 1ZNXA 3EZ7A 3TSWA 5E3HA 5BWMA 1CS4C 3C14C 4U00A 721PA 1UF9A 4TSFD 5BQ5A 1XTSA 3KJEA 2KE5A 2IS4A 1V5WA 5GVSA 1ESMA 1VIYA 4AG6A 2ZR7A 3QSYA 4AKEA 4XVUA 1NG9A 3GFTA 1I2MA 1A1VA 4RCZA 1T91A 5DN6D 4ITRC 1UEJA 3VHLB 4Q1DA 1OXTA 2YJTD 4A2WA 1M74A 1VHLA 3RSLA 2MSCB 2CL7X 3TMKA 1AN0A 1E2EA 1W5TA 4FD2A 1NNEA 5CB6A 2BV3A 1FNNA 1Z6TA 4IXMA 4R7ZA 5G40A 4QBFA 2V7QD 4CRWB 2OT3B 4A2QA 4LJ9A 2BWJA 3ZGXA 4D4KA 3O8CA 2PL3A 2ZI4A 4KCGA 4NE2A 4MRSA 4BFVA 1Q1ZA 4IKEA 4I81A 1RJ9A 3AF3A 3K0AB 3KXIA 3SE0A 4LBVA 3KZ1E 1G17A 2AXPA 2RCNA 2V9PA 5FPTA 4NONA 2NO7A 3WBKA 4MDFA 1NBME 1WXQA 3QXCA 4DSNA 1Z2AA 2O8FA 1R5OA 5FL7A 5KSPA 3RYTC 5KU1A 2ZJYA 5DNYB 4LYAA 2ZSBA 3CR8A 1CULC 1TNDA 2XTMA 3PUZA 1OFHA 1JNYA 4N1AA 1W0KA 2I3BA 2YVUA 5J5CA 1G41A 3RNLA 1ZD9A 1HYQA 5HZHA 2GAOA 1KJYA 1ESNA 2JIZD 4A9AA 2IYVA 4OQLA 3BB4A 4D80A 1T8UA 4Q9JA 1NVVR 2G6BA 3IHLA 2CL6X 3VQTA 4M8NE 4NH0A 3U44B 5SZKB 1SZPA 1XD8A 2ZXUA 1XEWY 1II8B 3KQKA 1WE2A 3FPAA 2NO6A 4MGIR 1E2GA 3LAWA 3HPRA 3ZQ6A 1E2JA 2F1HA 1DELA 1XU4A 3DDCA 3W3AA 3BH7A 2ZIAA 1AK2A 2RGCA 4ZIRB 5JS8A 1CP2A 1EFTA 1X86B 3QXXA 3K09A 2Q3MA 4TT3D 2FZLA 5KSOA 2XZPA 1T0JB 3AP1A 2H57A 3QKTA 2XSZA 4EPWA 2ZRAA 4LV5B 2PEZA 5BYJA 2WWIA 1GRRA 3VU9A 2PJZA 2ERXA 4P4SB 4BQSA 4GRAA 1KK2A 2VHCA 3BRWD 4BRWA 4DEXA 2O8EA 2PMKA 1R2QA 1OH6A 2GK6A 2WIAA 5KPJA 4YMVA 3AVPA 1MABB 1E2NA 2XOKA 4B34A 4EJSA 2NZJA 2OXCA 4JYCA 4ZCMA 2IS6A 1N5LA 4US2R 4HLUC 4A6XA 3AEZA 5IF9A 2OEPA 2IX3A 1XTQA 2PZEA 2UZIR 3OAAD 2ZRIA 4PQYA 5J40A 1RVDA 1R4AA 2IYRA 2WAYA 1BS1A 1NVXQ 5K8IA 1N5JA 2IK8A 4NCHA 4URVR 1XBTA 2VHTA 3VX4A 4C0AC 3NDBB 5HCIA 2RGGA 1VIAA 3L0PA 3ZS9A 5B64A 5FR1A 5BN5A 1KJZA 2ODBA 2CE2X 5FPHA 3AVTA 1UPTA 3SI7A 5ANRB 2JJ1D 3K9LA 1DAHA 2YWFA 4XVQA 3FDIA 3WRXC 2FF7A 3K70D 2J59A 1J7KA 2DHRA 4PPQA 1GAJA 4D26A 5FTKA 5F3WB 4Q4AA 5JHHB 1R7RA 2GJ8A 4PPFA 3U7HB 2ZEJA 2DFLA 3C4JA 3EZFA 2HYIC 1XDBA 1AKEA 1CR4A 4P32A 4FI3C 2ZJOA 1XJ0A 2ZSFA 1N6LA 5FUVA 2BMEA 1GNQA 4HB0A 4B73A 1PZNA 1UDXA 1L2TA 1FUKA 1R10A 1K6MA 4TMTA 4NYJR 5EXXA 5J4LA 3V4RA 3UWKA 1IONA 3ZDQA 5H8WA 2ODEA 4U5XA 1XX6A 3GJ4A 4KFSA 3SFVA 2AN9A 2HF9A 2WWWA 1DS6A 2VHJA 3AB3A 3VR6A 2X1VA 2QP9X 3FE2A 2R62A 3IDQA 1G7RA 2IYLD 2ZUBA 2CHQA 1Z06A 1MRNA 4G1UC 4KBGA 1TQ6A 3X2SA 5L3QB 1W5SA 2OUKA 1KK1A 3NH9A 5IK2A 3O8BA 1JAHA 5AWFC 2ZI3A 5BYKA 2B7CA 3H84A 3AUXA 4KYIB 4PO8A 3CF2A 4OJKA 5J4HA 3EA5A 4GMDA 3WP0A 3GLIA 5DGXA 3THWB 3IQWA 5K8UA 5EZ5A 2XGJA 3GJ3A 1Y3AA 5J4KA 3BAFA 4GOJA 2BDTA 2C96A 2DWOA 2RGAA 2AKAB 2WVJA 2J9RA 4BZQA 5FTLA 2EYUA 4RZUA 5FL7D 4OHXA 4B2IA 4A1FA 1W2HA 3EPLA 3WYFA 4YXWD 3U7GA 4PAMA 1U8YA 4ZDIA 2WWGA 2VSOA 2FJUA 1KK0A 4XIGS 1GILA 3LRPA 3U44A 2GNOA 1XMIA 4LPSA 1XTRA 4V0KA 1T3SA 2QPOA 4EPYA 2ZYTX 5FBWB 3I5YA 2G1KA 1DG1G 1RZ3A 4NKRA 4KSCA 2X2EA 1YJ5A 1ZJ6A 5SZIA 1W7AA 4ZIRA 3CWZA 3WXMA 2UKDA 3TUZC 5IRCD 1IY1A 1QHHA 3M4YA 121PA 1N6OA 2A3RA 3MJRA 4X8HA 2VSFA 1G3MA 2IF0A 5EXSA 2ZU6A 621PA 2ZU0C 3THYB 1AM4D 2ZRDA 2JLQA 1N6NA 2GKSA 2QNRA 4ILEA 3FVQA 2XSZD 2ZJBA 1Z29A 4WOPA 5DLQC 3OIVA 3LNCA 2GCNA 4C0BA 1TX4B 1E79A 4JVSB 4LDJA 2NZ8A 1EWQA 4GI7A 1VPLA 4I1SA 4POAA 4DVGA 1KZ7B 4TLDA 1E96A 2GHIA 3QPUA 4IOKA 2BM1A 4B48A 2OAP1 2D2EA 1KMHB 1NBMD 1R5NA 4PZYA 4WVFA 3E1SA 4L9WA 3CNNA 4R2HA 5EP4A 2HV8A 5JMTA 3CNLA 1SGWA 4EQ6B 3ASYA 2XTZA 4MGYR 1FOEB 2ZI9A 2J0UB 3AP2A 2GETA 3KL4A 4P31A 1E1QD 2Z5FA 4US1R 1SXJE 2ZJ2A 4TMVA 3FOZA 3CONA 2UZ3A 2CBZA 4QOSA 2IWRA 3UG7A 1EGAA 3NWJA 3VNUA 2QPAA 2ZJ8A 4P3YA 3SQWA 1O87A 3GD7A 4L16A 3WMEA 2FMXA 3GLGA 4AWXA 3FHCB 5FBRB 1TTTA 1GRNA 4A82A 2TMKA 4M9SA 5EE1A 1KO7A 4OQMA 1XRJA 4XJXA 1TEVA 2OXRA 2P3SA 1HT2E 2QORA 2XTNA 2IEYA 4JSYA 1XTKA 4Q4JB 3BFVA 1OLOA 4DHEA 1KTVA 4JLMA 4Q18A 1EWRA 1H8HA 3ZVMA 1Z6XA 2Q0HA 2QSZA 3EZ2A 2B8WA 1XZPA 2ZJ5A 1H65A 1LTQA 3SYKA 3EZ9A 1WA5A 1Q22A 2ZRBA 1QBKC 1YKSA 1KI6B 2P67A 3IGFA 3QXJA 3ZQJA 4C2UA 1UEIA 3MJHA 1F60A 1OV4A 4KJZA 3B78A 1A7JA 1W47A 3ZS8A 4HYYA 3MMPA 2A5GA 3NEJA 4US0R 3QXHA 1E4VA 3B2EA 1OIVA 1G5PA 4HUTA 1RIFA 4YMSA 1UBGA 1W4AA 4W5WA 1U90A 2ORWA 3MAAC 2J87A 2X8AA 1Z5ZA 2XX3A 3ECCA 2EQBA 4OYHA 4AURA 3SHWA 2WPDD 3T61A 2DFNA 2ODWA 3ASZA 4PSKA 4C0KA 3THWA 3TGPA 4QBHA 4DUGA 4Z54A 2QMUA 1DADA 3EWSA 4QL3A 4IXNA 5FUXA 2MSDB 4LY6A 3R9WA 1TPZA 4F92B 2WM9B 1P61B 1Q12A 3F0TA 2QTFA 4MYHA 3AVVA 4B2LA 2O0JA 4PC7A 1XXHE 4BRUA 2G1JA 2Q6TA 2W2VA 3ZJYA 5JZVA 4NYIR 3QVUA 4BZPA 2DWQA 1A5TA 1RKBA 3UMRA 3MFYA 2VL7A 2YWEA 4DCUA 2FPKA 2H18A 3QE0A 5J4YA 1DAGA 3K0CC 2ONJA 4N0EA 5DI9A 1G9XA 2BM0A 1BYIA 4BFTA 3NBFA 1GNPA 2J3EA 4ERNA 1IHUA 2OESA 3Q85A 3VKGA 1NKTA 1JEDA 4H1VA 1X8JA 5EP1A 3NHAA 1FPMA 2K5UA 4F7WA 2OCYC 4RVCA 1C1YA 2H16A 4JLJA 5HR5A 2VP0A 3FYHA 4D82A 2BBSA 4A4DA 1SKYE 2ZRFA 3A1TA 4IFEA 5C2JB 3THYA 1SVWA 1W36C 3IIJA 2AKYA 2MMCA 2GJAA 2GBLC 2BBOA 4E09A 4KHZA 3TE6A 2QU8A 2JJ8A 2ZRLA 3W6NA 2WJIA 4EKDA 1EFRA 1E99A 2VYFA 3CKLA 4M1WA 2O0HA 1GM5A 4PPGA 3TAHA 1E79D 2EVWX 1KGDA 2DY1A 4TYQA 4Y0VA 3GJ5A 2CHVA 2F9MA 2YNMA 3TNFA 1YZTA 4LUCA 3K9GA 4IDPA 2BBTA 1GG2A 1P3JA 3OE7D 1Q20A 1E6CA 3FKQA 5TARA 2IEZA 4ESHA 4LYFA 3CZPA 4EQ6A 4FINA 3D3QA 3DM5A 4Z8YA 3R9IA 4A36A 3HU3A 1BYUA 3H1TA 4TYPA 4C30A 1GKYA 2Z4RA 2NGRA 4AYWA 2EFHB 1W36B 5JEDA 1M6NA 4RZ2A 2VPPA 1LVGA 2QAGA 1T4GA 1S1CA 1YZUA 3CUEF 3NKVA 4LJAA 3U4QB 4QGFA 1U0LA 3BH6A 4Q9HA 4AI6A 5KNCA 1EESA 5C4MA 2FEOA 2IBMA 1COWA 1EG7A 1QVRA 3UPUA 1LY1A 4TMKA 3V4FA 4A8JA 4A0RA 3A36A 4QRHA 1T0HB 2NO0A 2A2ZA 1CU1A 1RRCA 3QG1A 1NSTA 4Q02A 4CIDA 4DEYA 2IS2A 4X8MA 1P9NA 3KUCA 1T3HA 4EFLA 3IHWA 4M0LA 2RGBA 4KV9A 1S0UA 2DYKA 2ZS9A 2ZSAA 3B6EA 2HCJB 2LCFA 3TW8B 4EPXA 5KDDA 1KSHA 2H1LA 4URZR 4FWTA 1FX0B 2ZRMA 3ZIAA 1PVOA 2HT6A 1ELOA 3L2OB 1P4SA 2WOJA 1P2VA 2VTKA 4F38A 3KKPA 1VECA 1Z83A 3QEJA 1RJ9B 3IKJA 3D8BA 1JPJA 2PEYA 3L0SA 4LHVA 1Q1EA 2ZYVX 3DM9B 3QUSA 1GL7A 2IT1A 2Z6VA 1OHHD 1FMJA 3SU8A 4PFSA 3TRFA 2F3RA 1SKQA 4C4PA 4A0GA 1XMVA 2GZHA 1TQ2A 5AUQA 4C0QC 1N5KA 2V3CC 2ANCA 3BOSA 3GJ8A 3IEVA 2P6UA 4YMWA 2KI5A 1XNJA 2GXAA 3OEEA 4YMTA 1E9CA 3G0HA 5FTJA 1DAKA 2J45A 4AIIA 2ZUCA 1SXJD 4TLEA 4EJSC 5HKKD 1BOFA 4L4UA 1ZRHA 1NN1A 1NY5A 1SVIA 4E22A 2F1JA 2Q3HA 3UKDA 2WBLC 1IY2A 1SVMA 1Z63A 5CB8A 1TL7C 4IOMA 2P5SA 4TL7A 3ZD6A 1QRAA 2XJ4A 3M0EA 4ZPXA 4B74A 2ANBA 2N42A 4RD3A 3K0SA 1W4BA 2W6JD 2G3YA 3CRRA 3GEEA 4AYTA 4PHFA 1YR8A 3NBYC 1CKEA 1NLYA 4OK3A 3I92A 2QAJA 2P0EA 4TTPA 1ZM2A 5BN3A 2D06A 2VP6A 4MKGA 5LB4A 4BPBA 5DIFA 5BXQC 1OF1A 2A9KA 1ZM4A 3VR1A 4TYWA 1VYTA 1Q1BA 1XPUA 2IYTA 4KFUA 4NCJA 1D9ZA 2R44A 1H8EA 4KYUA 3KJGA 1T9HA 1XCGB 1GL9B 2ODNA 1U81A 3GFOA 1J90A 2RMKA 3PUWA 4HB3A 1DOAA 2Q3FA 5JWHA 5JWRA 4XWAA 4X8LA 4B3DA 4EJSB 2FN4A 2CVHA 2HYDA 1X1RA 3UXMA 2JLYA 3LXRA 1NMXA 3JVUA 4ARZB 4E5UA 1ZUHA 2FX3A 2HLDA 1II0A 3QF7A 1NIPA 3AH8A 5CM9C 1FW6A 4JL8A 1S1MA 2JDIA 2D7CA 2X2FA 3SYNA 2B8TA 5FUYA 3AF0A 1S8FA 2J7PA 2ZR0A 3AGPA 2R65A 4LYHA 3FFAA 2N46A 4HAZA 4BFUA 2QN6A 3K0CA 2ZRGA 3D31A 3MSXA 2IYQA 3A58B 4GPTA 4P4UA 4JT4A 3RS4A 3CBQA 2JLZA 4Z8XA 1G6HA 3PQCA 3IUYA 4W7SA 2D62A 2J41A 4R2IA 4OHYA 3DOEA 4UXHA 2KB0A 2FGKA 4RFSB 3TW4A 3T35A 4DRZA 1ZVQA 1V43A 4WW0A 4XSHA 3AVXA 4LJ4A 4Q9KA 3REGA 3T1VA 1F3OA 5IHPA 4N3NA 4Q4AB 1HA3A 4NCKA 3P20A 3SQXA 4KXFB 4NHOA 4ZDJA 1AZSC 4YMUA 4QBIA 1KI9A 3RWMB 3THXA 4A92A 1G20E 2ZRJA 3EARA 4KBFA 4KLZA 2GBLA 2OFXA 1AQUA 2QRZA 1T3LA 1NN5A 4HB2A 2AR7A 5DHFA 4R71A 5C1BA 3U4QA 2GJSA 2GVDC 5CIWA 4JLBA 1DBSA 1E9EA 3SS8A 2ORVA 5DYGA 4QNRA 3DVLA 2DCUA 4JLNA 3Q8XB 3HR8A 4NYMQ 2EWWA 2YOGA 1PLLA 1U94A 3B7GA 4TWZA 3CIOA 1OKKD 5HE8A 2OAQ1 3U3RA 2W00A 4BFXA 1GUAA 4WZBE 1JR6A 1UKEA 4DLZA 1XCMA 3QBVA 1BMFD 5ELXA 1GWNA 3A8TA 1TUEA 4MQBA 2R6DA 3ETLA 1S9HA 2ATVA 1Z6AA 4DXAA 3B9PA 4DSUA 2CMKA 2BMDA
chains in the Genus database with same CATH superfamily
2OBLA 4KLRA 1MO5A 1VJGA 3U4MA 2QSUA 1QH0A 3AXSA 4G09A 3QELA 2G71A 2P9JA 1LI7A 1LXCA 1D6SA 2PPVA 4OQPA 4UMVA 1DQNA 3GEGA 4X1KB 5G3YA 5IDWA 3TQFA 1HORA 2FQXA 4XWTA 2OCLA 2V98A 3E4DA 4B4KA 4KV7A 4L7QA 1MEEA 5AW5A 2PA0A 3SDBA 1OXVA 4TLBA 3A70A 5ESDA 4Q05A 4IDOA 4H1HA 5A4JA 5ALJA 3P0FA 4RPCA 4XOUA 3KJIA 3IUSA 5KQRA 3CMMA 3FMOB 4FEAA 5AJVB 1G60A 3U7JA 1GGMA 2GTIA 2M2IA 1E6LA 3G0CA 4B3TB 3NX4A 2CVOA 4LRTB 3Q3JB 1PJRA 3TTYA 1GA6A 4L6AA 2F8SA 4OI0A 3LRTA 3LUHA 1QHXA 2X8JB 3TIVA 2G07A 3FOFC 4HLQB 4ND1A 1KBOA 3SIRA 1BW9B 4HDCA 4J1QA 5TVKA 3C45A 3VPCA 1T8RA 3TBHA 5J1SB 4Q1AA 3DMGA 3OESA 5D1HA 2J48A 821PA 1Q1GA 4WX2B 3KVVA 4J1TC 1RKVA 4YLYA 1AS0A 4AKGA 1KR5A 2DFPA 3KZVA 5BT8A 3R5HA 3SJBA 1BZYA 4R05A 4ZO7A 3K72B 3T5CA 3ND8A 1TU3A 4O0MA 1JHMA 3TQCA 1ZUIA 3SBEA 4YJKA 1BCRB 2L69A 3NOQA 1KH3A 3KKOA 4HNSA 3O3NB 1S3FA 4K9PA 1QM5A 4H77A 3FOBA 5JAQA 3PC8A 3H97A 1X1QA 3LY7A 2YYAA 3TUJC 4R1OA 4IJQA 1M1YB 5FOWA 3NRBA 2DR3A 1C9YA 2NOAA 1NMEA 5IJZA 1QCCA 1UBKS 4DV3B 4BLVA 2D8AA 3HV2A 4Z9AA 2P6OA 5B7PA 2C2KA 5D3ZA 3K1AA 3NR2A 4WJKB 3U17A 2ZZKA 3C3WA 1VPEA 1FLDA 2BVNA 3KQQA 1SKAA 1P77A 1MX3A 2WE8A 4JI4B 3DXXA 3OVMA 2QK4A 2GPWA 2PT9A 3K5WA 4WRRA 4LYJA 3TIGA 3TTXA 4WJLA 2X4IA 1N6RA 1PZEA 2ZXEA 4XTCS 4OQNA 3URKA 4LJ8A 4AC9A 3AVXA 2QTRA 3DMNA 2YWXA 4DFDA 2PWPA 3Q10A 1VKOA 4X54A 2AL7A 3C3DA 5F64A 4IZOA 5LUBA 3GCXA 1P45A 2H1VA 2XNDA 4QYIB 3IL2A 4X41A 3QKWA 4QLAA 1ZC4A 1TVEA 1G3UA 1NQAO 2QLTA 3L07A 3EZ6A 3PLRA 4QPCA 3SYLA 3RK4A 1ISPA 3IE0A 2WSSD 5JBQA 3FTCA 4CE6A 1VLHA 3NC4A 2WVGA 2IHJA 1KIFA 1KY4A 1XRQA 4KODA 1ZXXA 2F6RA 4MJ7A 4BE9A 1TKCA 2HUPA 1GQYA 1Z2NX 2VAWA 3A9RA 5TQ2A 3SAJA 1TCVA 4L1KA 3IUBA 5TQ0A 3UM9A 2GEKA 1G3QA 3AHDA 3GNQA 4DZTA 3HWX1 2C20A 3HCAA 5EE9A 3CR3C 1HDEA 5JS6A 4RACA 4XASA 3WFJA 1EXWA 2WTXA 4KQ2A 1OSNA 4KBYA 2NSHA 2R7MA 4JLAA 4RD4A 3AUUA 4IR7A 1XZIA 1AO0A 3HY4A 4DREA 2V4UA 3WX0A 1BKSB 1GTJ1 1HC7A 3BRQA 5BSMA 3WGNA 3ZJUA 1A9RA 1F4VA 3BIFA 1W36D 4IIJF 5KVVA 1LBSA 2OVBA 1VLZA 3H6HA 1CJUC 4UBLA 4AMBA 5ENVA 4IJVA 5JWOA 5FA8A 4PYJA 1W4LA 5E2AA 4RUKA 2C7VA 2CDCA 4ZHQA 5JS2A 1EFCA 1M7HA 1DE0A 4J4HA 3KKNA 4W63A 4L8FA 3I9V6 3QOFA 4NNJA 3N2GA 1QFXA 4Q9AA 2ZPTX 5L7WA 1L4BA 1OLXA 3Q3EA 1U3UA 2VRWA 5EZYB 2IY8A 5IJXA 5AJXA 4G1VA 1C3VA 3KAKA 1DUVG 1NFFA 3REFA 2XQVA 3JCZA 3ISJA 1L4FA 1NWCA 3FZEA 2XJ9A 4OQEA 3RBAA 5LDGA 5TXGA 2NU6A 1NJSA 1Y37A 2DVMA 3K0BA 3MWYW 5EHNA 3VBEA 1K75A 2AUMA 4IIUA 5EJEA 5DLEA 3UCFA 5I4IA 5CIQA 1UBUS 1HDCA 3TVTA 5C0OE 4HRAA 1U7WA 1ECFA 1KGSA 3CEPB 4IO1A 3EG9A 3BEDA 3K0FA 1NVUQ 4E03A 1XF1A 3OOWA 421PA 2QHXA 1YCGA 3UFXA 1Q57A 2P2GA 4KVFA 4AJ4A 4W8GA 5LZ9A 1Z33A 3HDJA 2YWRA 2MYNA 3AO0B 3S5UA 2ZTHA 2CHUA 1ORDA 1TF7A 3GAFA 1VMKA 1F1JA 1PL7A 1BOOA 1P9LA 3G7NA 2GRJA 3GFVA 4LGCA 3S28A 5L3SA 3IEIA 4G5QA 4HVAA 2WLSA 5K0GA 4IX1A 4WD3A 4JLSA 2CLCX 5DLPA 4BX0A 3VR0A 2VYNA 3DMFA 4K8OA 4JS0A 1GQ2A 2C3YA 3LY5A 4UXJA 4A23A 2IBSA 1SIOA 4TWAA 1TF5A 3UA3A 2CVPA 2VJDA 2IUYA 3B82A 1DQRA 5GM2A 3HU1A 4AY4A 4B35A 7MHTA 1R6TA 4MCAA 2H6EA 1YR9A 2VSNA 4HQKA 1KMIY 5BN4A 1N34B 16PKA 4Q3AA 1KQGA 3AUKA 1XVTA 4LNHA 2B1JA 2YOFA 2JANA 3HB5X 4YUAA 1RPZA 3BMQB 3KUKA 1Q1NA 1V25A 4NV0A 3D9QX 4CU2A 3NBXX 2IOHA 4C3ZA 4DDKA 1CUGA 1XTPA 2Z2ZA 1V7CA 2FP4A 1MA0A 2GN6A 4DUZB 1UMKA 3LFUA 3BSWA 9GPBA 2EU8A 4GL4A 3GCDA 2HSEA 4EL0A 3FZGA 2QP4A 2A88A 3NS7A 2G17A 4OUDA 1Q0UA 3E2IA 4CG3A 3W1EA 5JDCA 1QHGA 5CH8A 1AZLA 1KQOA 5AOCA 2DKOA 3BXOA 4CCYB 1OZAA 4MB0A 3S2GA 4CR6A 3EVGA 4BO1A 2Q2VA 1M0TA 3JATB 3B6ZA 3JQPA 5IDVA 9LDTA 1GIAA 1RFGE 1BU8A 4UEQA 5PGMA 1N2SA 5KTYA 1PR9A 4LJKA 4PFQA 1KC3A 4YP5A 2OAGA 2FR8C 2QAGC 3RSOA 3L8DA 4I2VA 2YV1A 1K06A 3DZKA 4EVRA 1X9HA 1QVZA 2DQ4A 3E7DA 2C7GA 4DWVA 3UPTA 4XX0B 3ZKWB 1IJFA 3QEOA 5INTA 5JJ5A 2HJWA 1TYCA 3IAM6 5JRZA 2NN3C 1I5OA 2PFSA 1LV7A 5AKKA 2QQEA 4C5AA 9ABPA 3NEYA 2CSXA 2B37A 2WJAA 4OHVA 1EGVB 1CEQA 2GNAA 3WK6A 2C1ZA 4XLZA 2GK3A 1WOYA 1C30A 5TE9A 3ZWDA 2XYGA 3JQGB 4ENSA 1BGVA 3JY6A 4FC6A 4YRTA 5BW6B 3D7MA 3EVZA 4XPIA 3I9OA 1HZZA 3IAM1 4YJ3A 5H3HA 1PV1A 3R3UA 4P0PB 3KJFA 4QOHA 4N7MA 4FOSA 1WBBA 5C80A 1ZUWA 2CDNA 3I6YA 3O4FA 4JAVC 1STOA 3TGWA 1JG7A 4X66B 1C1XA 1JVSA 4BKMA 4KR2A 2Z0MA 2C9BA 2H8KA 1DX4A 1RM0A 1T5IA 5IVPA 1P33A 4H35A 4UHFA 4Y2HA 3D7NA 5A9SA 1UDWA 4AF6A 1MT0A 2B4RO 2VH5R 3WIOA 1L6IA 2HD4A 4RHUA 5ED4A 5ALXA 1CC1S 4KGXA 2B3DA 1R3UA 2QI9C 1U2QA 1RHRA 2AGVA 2YFYA 1Y5IA 5HQ3A 3DL7A 2R8ZA 2WAXA 3D8TA 4F56A 1PTKA 1KEZA 3N58A 5GIOE 4XQEA 4Y7CA 1EVKA 2TS1A 4HUQB 1P1IA 3AVWA 1XR3A 2HF8A 2WT4A 3IEPA 3IYLW 2VK2A 3PHIA 1VL1A 3OZXA 4MUEA 1AU9A 4MDHA 2B69A 5FKJA 2QX4A 1CUVA 3VHRA 4DMFA 2FFHA 1OXBB 1IIBA 1JWLA 3H0EA 3ABRB 3CRQA 3EGXB 2E1PA 2NQ2C 3DEHA 1MKYA 3VZQA 4HWKA 2D0DA 3DAHA 4YAKA 4BPRA 3QV1A 3DO5A 4ZOAA 1C8VB 4KN5A 1Z4IA 2Q6IA 4RTRA 1M6VB 3P27A 2OWEA 1RR6A 4MJ3A 4R51A 5E4JA 4H27A 3IAFA 5J9FA 1DUIA 3I6ZA 4XB2A 2YN4A 3H0CA 3U4CA 3OHMA 4XLLA 5H0IA 3E48A 1AE1A 1XZCA 2XCOA 2VPXA 3VH3A 3WKCA 5LIRA 4NCIA 5CB0A 3WKEA 2PZ8A 3AEQA 2HIAA 4XKJA 4CQMD 2RE8A 2M6SA 1SU4A 1E4YA 4A2PA 1IXRC 3PE4A 3N28A 4V0SA 2ZP1A 4QODA 3VI4B 4DANA 1Z0FA 1KOFA 3N7AA 5CBPB 5L45A 4ILKA 1K68A 4O4LA 4U02A 1B73A 3ZWWA 5EEHA 3A6FA 4DSTA 4LHEA 3A6DA 4O02B 3RVKA 2QP3A 3OOJA 3AR2A 4GZ5A 2XCRB 2VH1A 3Q2OA 1Y34E 1XFAA 2QRNA 3HV0A 1ZJJA 3CPEA 2WFLB 1E61A 2W6NA 3P2JA 2CLIB 4IEEA 4IQFA 3MHPA 4MMZB 3DZIA 3AR3A 1J1UA 2K6GA 5H82A 3EA0A 5HILA 2Z6AA 5KTSA 4LVUA 2P69A 4GF5A 3A10A 3HCOA 1PEDA 4BDSA 1HOXA 3C3YA 2A9JA 3DCYA 2PWYA 3P4YA 4TWBA 1X7WA 1UMBA 3SD7A 4CMAA 5KMGA 1NP7A 2J9FA 1UL1X 4J0KA 4OKNA 2H2FA 2FEAA 4DCNA 5FQNA 2NO4A 1V16B 3C8HA 1Q3KA 5IC6A 1UXIA 4FNMA 1QUFA 1B8OA 4QXAA 4WUTA 4MYTA 2HXGA 2WJWA 2XHEA 1GKUB 4BP9A 4CM9A 3GLHB 2CCJA 1R8XA 2QOEA 4LK3A 3E58A 4XGIA 4ZAFA 3ICEA 3PLNA 4BQQA 3QF4B 4MRVA 2O2EA 2M6RA 3VPBA 5LZ8A 1OFIA 1L1FA 4F3RA 1TMGE 3D8SA 1RHJA 2BMWA 3PFNA 4NV1A 1QGUB 2B7BA 2Q07A 1FS4A 2QXTA 3IBGA 3OC0A 4BLRA 1SCUA 6AT1A 4GP6A 3KE8A 3F3KA 5HBGA 2WYWA 3TMYA 4AZ3B 4EUKA 1HKHA 3TZBA 4K2AA 3WB0A 5F12A 4CGYA 1L4KA 1XCPA 2VHWA 5CHEA 5FBLB 2V5VA 1O08A 2E7ZA 5D3MB 1QCZA 1X3LA 1XDUA 2VIIA 5LZ2A 3NVAA 3EPHA 2Q3DA 3WNDA 2X9GA 1AUQA 1FZQA 4GOOD 4KRYA 1UBMS 2AZDA 2ZOSA 3IESA 5AJZA 3G5AA 3LLCA 1K27A 4B9EA 2B34A 5CTJA 1B3BA 2OV4A 1CUXA 4XGKA 1QE0A 3UYKA 4B5LA 4DKXA 3F47A 5JCXA 2GFHA 1S2DA 3D0QA 4OY3A 4KN6A 3C4VA 3DE3X 1HV8A 4NESA 3RYHA 4TV9B 1K7FB 4UMEA 4YRDA 3SX4A 4LZZA 1XNHA 2FMUA 2J7KA 5DCLA 2IYNA 4BBPA 1ZK4A 3REOA 1REQB 4ZCPA 1XZEA 1XAHA 2VNKA 2C29D 3ONWA 4J9VA 3UOWA 4KTTE 3EXG1 3K7EA 3FPFA 3S7ZA 1Z7EA 3BMCB 4NZNA 5BNZA 5FWYA 1Z0KA 1SU8A 4B79A 3CVWA 1NPYA 3MXOA 4RDHA 1GTZA 5FBVB 4GMXA 1LZKA 2J5XA 4XCXA 4CMBA 1YJBA 1MGPA 1NVVQ 2HA5A 3K92A 4BVBA 1SWVA 2CCKA 4DV0B 5H4HA 2ZG6A 5F3DA 1L7VC 5AO9A 1RWQA 3THXB 4JVNA 4MP6A 2KMLA 4X61A 1OH5A 3HKDA 2YRFA 3TX2A 3QU2A 4AKHA 5ICSA 1JJAA 1KYIA 1MX9A 2Y2UA 3GVHA 2OBYA 4HGYA 3AF1A 4TS4A 4ANFA 4D02A 2VZ9A 4G0UA 2PYZA 3GRZA 3EX7C 3IB3A 3EJWA 1RABA 1X1TA 2VA8A 2YOHA 3JQ7A 4FM9A 4YDRA 1KFBB 1G21E 3R0IA 1R4NB 1W9HA 2OO3A 2OYCA 2BI4A 2W2XA 1UC9A 2C1XA 3TSZA 4B71A 3H3XA 4ZWNA 4R2XA 3BD8A 4EFNA 3E61A 5KC9A 4KFCA 4B3HA 3W5VA 1XL0A 4BMCA 1AIPA 3N8KA 1U0OC 4V0LA 3WIEA 1X6VA 3NBQA 2GI4A 2OSBA 1G291 3QVKA 5A3JA 4KMOA 4I5GA 4CFSA 2QI9F 4KQJA 4PG7A 2O8BA 3CNEA 4IEIA 3FZQA 4Q01A 3PNBA 3AWIA 3OMLA 1NU8A 3H05A 1HPLA 3H1FA 1ZK1A 2ZE6A 4J9UE 3IP6A 2WP0A 4QGAA 4U7JA 1PK8A 2I2DA 1ZCZA 3DZ8A 1UJ6A 1JKJA 1EB9A 1Z4JA 2REQA 2W2LA 3KDSE 3NHPA 1QP7A 1YQQA 3W04A 4F8YA 3OIUA 3Q0IA 1RQNA 2PL5A 4MRMA 5CX4A 2BN4A 1CF2O 2GN9A 3ORFA 1KIMA 3D7LA 3L4BA 3F3SA 3GH1A 4W4TA 4FXPA 4ZT5A 2FN3A 4YP0A 4ERXA 5ADHA 3VTAA 3DDHA 3PVZA 5BUZA 1DCMA 4KJXA 5K09A 1Z13A 1SU6A 2WFAA 3GGCA 5ICEA 1OBCA 4Y2JA 1NI4B 1SHKA 3IPCA 3GO4A 3L7IA 5TS3A 1WP4A 4X63A 2BFNA 4KRXA 3U3ZA 2AQKA 2Q6LA 1H69A 4K6OA 1VKJA 4BJ6A 4X71A 2KLHA 1CYEA 3KV1A 1OFUA 4PE5B 2BYTA 4JJ7A 5AUNB 2I2AA 3SXUA 2VJBA 3BMNA 3OPXA 3TOVA 2YHIB 3KG2A 2NACA 4Q3CA 4Y67A 3SBDA 3RVDA 1IXZA 1SG9A 4O5OA 3ML1A 4GXTA 4J8PA 4TYYA 2B36A 3IMKA 3BSFA 3Q9LA 1PHPA 3PF9A 4I50A 4BB5A 4GOXA 1E6WA 1FBTA 4FSXA 3C16C 4TLAA 3DHVA 1TMYA 3O91A 2ZT7A 3FNEA 3I01M 2CKDA 2IV2X 3TZQA 2NUPA 5IZCA 2E5FA 2P6RA 1OU4A 4HQ0A 4AG5A 3WQQA 1YBMA 2NV0A 1CW2B 1EP9A 1XEWX 2VYQA 3EFOA 3FDFA 3OCCA 4RCYA 1HYHA 3WISA 5I9LA 3FJ1A 2DM6A 4X1IA 1KJIA 5ISMA 1Y5RA 1V3UA 2NSLA 3FGNA 2OZKA 4MR9A 2XODA 3Q7SA 4B83A 4BFCA 4H3VA 3PQ5A 2BD0A 3GGOA 4N0QA 4DSOA 2CFIA 2ZT5A 4UE3S 2V58A 1FDTA 3IIMA 1XYGA 4R1LA 2XMDA 5JSZA 2PYIA 3PCXA 1BH2A 2OCBA 4K0RA 3SHFA 2BZ0A 2X5XA 4YQFA 2J6CA 3QI7A 1F7UA 3LWBA 2PGJA 1C9NA 3RU3A 1RQXA 5HFNA 2EL7A 3IPYA 2GX6A 3L0BA 2XYRA 4C78A 2ZRKA 4J1SA 4FN5A 1E1RA 1NJGA 2AN4A 3CO0S 5BSRA 1TE2A 5K05A 3RRMA 1XRLA 3HM9A 2CJWA 3H87A 3R9XB 2Z2KA 4MVJE 3D3WB 3N8IA 4F93B 4JLKA 1J2JA 3AUYA 3OTQA 2WUWE 4UM9B 3AYZB 5JSKA 3VH4A 3H1EA 1YDWA 1P2TA 4ZVUA 4YYZA 3DTYA 2CXXA 4DC1A 2H29A 3WNCA 4TZ6A 2XEXA 2QROA 2YYYA 2HRQA 5B1EA 3O21A 4P33A 4XAQA 1I51A 1EK6A 3PHLA 2OHIA 3U80A 2DSNA 4RU1A 2VJNA 4L5JA 2PVPA 3AF5A 3FH0A 1S5PA 2YNMD 1VLJA 3F6BX 4GQIA 4OLHA 5CFPA 3BM5A 3RYFA 1TM3E 3BC1A 4NBLA 3TSCA 2SKDA 1ESDA 2ZRHA 3L41A 4OHRA 2X0DA 4RD2A 3H83A 3K9NA 1BG6A 1N1GA 2VDVE 4LEIA 4YONB 1V8FA 3L8CA 4CFZA 4DIDA 2IHTA 1L8OA 1P18A 2Z2JA 4KLAA 1ECLA 4ZCLA 1FY2A 3R7AA 2BGGA 3FGPA 5TMPA 3TZKA 1QO7A 1PS8A 4L9SA 1GGNA 1JEYB 3ENQA 3ELBA 4RTSA 4ZICA 2FPXA 4MVJF 1HH4A 1FEZA 4L78A 3MF4A 1I2DA 2AD1A 2D2FA 3STYA 3AG6A 4AJHA 4UBIA 4YV0A 2VQ6A 5U1PA 4AKTA 2Y77A 2PQMA 2QG6A 2A0YA 2WG0A 2XMPA 4KKVA 3UWOA 1EDBA 5AW6A 5BO5A 5LQDA 3N2EA 3KQLA 1HY3A 1EX7A 4RJTA 3M82A 1C7IA 2ZBRA 4LJ6A 2JAOA 1A8IA 3B3GA 5FULA 4E2YA 5KCMA 5JJKA 2QRHA 1R0ZA 2JH3A 3G2HA 1SOUA 2OGSA 4ZTZB 4B45A 5EHXA 5G0UA 3OQIB 4X1YB 4DB2A 4NDNE 4F6RA 5AW7A 4ZMSA 1GG8A 3MZ0A 3U4AA 1WABA 4GR4A 4NMWA 4XGQA 3AFOA 3E2MA 2H3EA 5KYNA 5CXSA 3LIPA 2FY8A 5JATA 2PNJA 4L9RA 2QGNA 2F55A 2JFFA 1JLLA 1UXKA 3LP6A 4QEKA 1WKBA 1JUDA 4C05A 2C5LA 1Q77A 2WAAA 2BHRA 1KY3A 1QJCA 1UJNA 3I9NA 3HRHA 2MINA 1NBAA 5I9BA 4UU0A 4YFYA 4WLFA 5JXWA 3SVLA 2PY6A 3TZLA 4KR0A 1V47A 2QN8A 1HL3A 4JCCA 4CKXA 4K05A 3DGFC 1CHDA 3OCJA 5JPCA 4EW3A 4DUPA 1R8YA 3DEZA 1JMVA 1I30A 4M9RA 1II9A 3SZUA 3H2KA 2O2CA 3GFBA 4LOAA 2AOXA 2IKSA 3O8DA 5IP5A 2AA3A 3F1LA 4IEFB 3VNSA 3BG5A 3KQTA 4R83A 4DW8A 1RZRD 5HPYB 4IRUB 5IBPA 3FVRA 3DDSA 4MDYA 1FUUA 2WPNA 1JLRA 3ESCA 3F3YA 1T3ZA 4P92A 1N4AA 1V35A 2C03A 2YC2C 1NY6A 3VHXA 3DUFB 2Y27A 5AK0A 3AJDA 3RAJA 4AZ0A 1XG5A 3OEED 1LPAB 1SBTA 3GZNB 5IAKA 3EBPA 3AK4A 1N2JA 1RMYA 4KUGA 1N2CA 1OA1A 3SFZA 4ITUA 5K99A 2CE7A 2CF6A 4DNQA 3T95A 2GLTA 1SRQA 4PGAA 1RQGA 5HE9A 4NECA 4YGYA 4LZLA 4MKFA 1JIQA 2GPAA 4YXWA 4F3TA 1US8B 3C41J 4L50A 1B3RA 3BUSA 1S3IA 5FUQA 5JANA 1IZ8A 1F1BA 3I9JA 3NH6A 3OM8A 1MXHA 3QV2A 4EUFA 1X7DA 3U4IA 4KDRA 1QIJA 4QGGA 4N3GA 1PQYA 5AR1A 2V03A 5F5LA 3KBBA 1EFPA 2CD9A 4QHYA 2CDBA 2HUNA 1FFEA 1OROA 2KM1A 3M4JA 4RO0A 4NK4A 3TJRA 2XIQA 2ZFUA 4QSMA 5JHGB 1PHRA 2B6HA 3ZHTA 2E5WA 1K7EB 3T3IA 5EJ5A 4WESB 1KFEB 3FSEA 5DNAA 3STXA 4F2WA 1BXRA 5DGIA 4LAFA 5AOVA 1MT3A 4FYKA 1EB8A 1B6TA 4FW8A 1IXYA 4GICA 3HEAA 3GELA 1R00A 5FO0A 3VR3D 5DTRA 2NVUA 2EZ4A 2OM6A 2EOAA 3CX8A 3DBLB 2VHEA 3LZCA 4HP8A 2J5KA 1EFVA 1LS1A 3AGQA 4Q1BA 3EUEA 3HB7A 1NE7A 2C1EA 4YCLA 2P4EA 1NKVA 3JZDA 4N7BA 2A0FA 4O08A 4P58A 4KFRA 4NV3A 1VKHA 1JDBB 1TCBA 1Z8NA 2WYHA 2ZJ1A 3PL5A 3BRCA 4R2WA 4CFYA 4E1AA 2BOVA 5F9HA 1RRGA 5EP3A 2PLAA 4JIMA 1LSSA 2YR0A 4GBGA 4QQRA 4YHBA 5AW8A 1NBMA 1OWOA 2ZWMA 3UC5A 5KYKA 1CLUA 2L82A 2H63A 4Q3DA 3BTSA 3W8NA 2VZ8A 2G82A 2Z3ZA 1J0DA 1XL1A 5G41A 2Q6KA 1D2EA 2MYTA 5HRAA 1IN5A 1WNTA 5CXUA 4MV8A 5JTTA 2CHGA 5KVQA 5HVNA 2WUGA 2H2WA 3AIOA 3KEMA 1EFKA 3AVYA 1W19A 3K4HA 5E1OA 2EIHA 1N0UA 2NSDA 4LDPA 3O7WA 3HBAA 3LHKA 4BMYA 2QMYA 3GBSA 2YN0A 1JR3E 2NAPA 2ZIVB 5TPWB 1PT5A 4G5RA 5TPZD 4F97A 1YZHA 3CZCA 4PXAA 4PM4A 3QY0A 3E7PA 4OFBA 3S1AA 3ZY3A 4YMGA 1FP1D 1M6YA 5KCZA 2ONZA 3AHFA 1IBCA 1WF3A 2CB0A 2ZR8A 2QLBA 3ESRA 1XD2A 1YZNA 1ZNYA 1DIBA 5ER6A 4BWVA 3FUCA 4W9NC 1CEEA 4S1OA 3H8VA 4ZVTA 2Q2WA 5FV4A 3VYWA 3NHZA 3QUBA 4Y98A 3NHKA 4I36A 5JH7A 3MWKA 1YJCA 3I37X 3Q2IA 1WEKA 2NUBA 2IUTA 4MWGA 5DZSA 3STVA 1ACLA 4IICA 2WRZA 3BJMA 5AI0A 3W2TA 4J0QA 1YRQA 4M3NA 3FYUB 1BH6A 1DC8A 2FU5C 1JEQA 1LX6A 5CT6A 4Z2YA 3W6OA 3EULA 3EGDB 1UT5A 4KO3S 3VR4A 4YUXA 1U1GA 2V55B 3M6WA 3WJ1A 3ENZA 3KYCA 2FW0A 1P1FA 1ZH4A 4NU0A 5T6BA 3SM9A 3KPUA 4MGZR 2BSXA 3BULA 1NNI1 3HDQA 3EIQA 2AYYA 2I7DA 4C7MA 3ADBA 4DPLA 1G8PA 2UV8A 4OHKA 5C34B 2D2IA 1NT2A 1YMUA 1TQDA 1OT3A 3JQ8A 3O8QA 1J8DA 1W6UA 4W1QA 4Y6OA 1WEHA 4E21A 2BKVA 3W4KA 2QAIA 2VK4A 3CR7A 2R6GA 1QB8A 4WAUA 1BROA 5KNDA 3FHOA 5IASA 3WQRA 2XUJA 3SYTA 5JYEA 5JASA 2BZSA 3SEAA 3DC2A 3CNHA 4MQUA 1G2QA 3IBFA 1VHWA 1J8VA 5A5FA 4B40A 2BFMA 4YTEA 4LXIA 1YGPA 5IWCA 1GXSA 2CEKA 2ZQ5A 3OFND 3W7VA 1E8DA 4YWHA 2NXJA 4WKGA 4F4IA 1T5TA 3FR8A 1ENZA 3MLBA 4YRCA 4BN0A 2J6IA 4MKRA 4NWIA 5CX1A 5GWXA 5A5EA 2XT9A 1P60A 5CVJA 1UEXC 3AF6A 3H6GA 3OO0A 2NQ8A 4P4GA 1SUEA 5GOZA 3SJZA 3O92A 1QTIA 4P3KA 1FW6A 1XZDA 1XPJA 2XMZA 3IILA 4Y6GB 1K7CA 2CB9A 4NQZA 4D8VA 1MAHA 3LKVA 5B4UA 1B8PA 4OA8A 3L6BA 4XDHA 4F06A 1RI5A 4HYEA 5CCBA 2VXYA 1H6CA 1EEHA 2AZMA 3CX7A 4WKCA 4ZGBA 3JAKB 4TVKA 2ZDQA 3IDSA 4FLFA 3OU7A 2HQBA 3C3XA 3PGJA 3SVZA 4HUJA 4C0SA 4WECA 5I7UA 4XEHA 1ZM7A 1LPSA 1JBQA 4TRJA 5EQTA 3JSXA 1YA4A 2R6CA 4NTZA 4C3VA 4RZSA 5F7XA 4K1XA 1FDRA 4TXHA 2JCGA 4UTNA 1PZHA 1KYWA 1QYWA 5GJBA 5HRCA 3AKZA 1GADO 2QZSA 3E22A 3QSGA 5AVVA 1HE1C 1L4LA 3T8YA 2ZROA 4DDVA 5DFAA 4M7WA 3O4GA 3PQ3A 3HGQA 4KLNA 1HO3A 2DGDA 4UTRA 4CEJA 3DL2A 3BE8A 1E2HA 3KVRA 2A5DA 1L8QA 3SR3A 2FPLA 1NJ1A 2P4SA 4Z2AA 2Z3VA 5G2OA 3N8NA 1E7MA 3FNRA 4IVRA 4AF7A 4EECA 5DM0A 2WUFA 2XAAA 1Z3IX 3E0XA 1W8DA 3FI0A 2HPZA 3UT5B 5HFAA 1JWBB 1H2BA 3HUUA 4C08A 2ERCA 2R9VA 4EM6A 2QWXA 3KAQA 4TVSA 4QNMA 1RIIA 1WCWA 2P2DA 4DR6B 2CXUA 2JGDA 1JZSA 4A7PA 3ND9A 1SOWA 4R5HA 4A8HA 4E08A 4QDZA 2GEJA 2DAPA 2G83A 4BEVA 1J8FA 1MAWA 2IX9A 3DP7A 4IDFA 3ANXA 1JI3A 1PT9A 1U1CA 1W25A 3PXCX 1W59A 4ZVVA 2VC2B 4D4IA 1PJ3A 2HCTA 3DZFA 4EY4A 1R66A 1VCIA 3EEIA 5LVAA 1BD4A 3QMMA 1I7QB 2GDZA 3C15C 3PF8A 2E89A 7ADHA 5JALA 4DCMA 3KQYA 1R64A 2CV0A 4XDYA 5HXAA 2OORA 3AETB 4TWJA 4WGFA 3FLEA 3OPYI 1U6IA 4OGWA 3B5JA 4RANA 2AC4A 4UM9D 4R8KA 5DVZA 2BMFA 3GB9A 3OE7A 5AJTA 2VNIA 2GYUA 4NDAA 1KYZA 2BRUA 4EUEA 1YL6A 2MR6A 2V97A 1IOZA 1E3TA 1CE8A 1QYVA 1O6CA 4FTWA 4HCJA 1S3SA 2X14A 3AP3A 5ALZA 4ZALA 1N9GA 1ZBQA 3BQ9A 1V8ZA 1VC2A 3SEFA 4CL0A 5CG1A 4M38A 4B6EA 5AVUA 5HKAA 2I22A 2HDHA 4M7RA 2CLHB 4K9DA 3UJDA 3KKQA 2QNBA 4MINA 1I7PA 2PKCA 2ZK7A 5CYPA 1Z0DA 4PHHA 3F71A 3HB1A 2YV4A 1AY0A 4U39A 3WGGA 3DQPA 3ZHQA 3PTAA 4OLJA 4S1NA 3PFHA 3QKSB 4O6VA 4E51A 2YW2A 3B7WA 3QEAZ 3RLIA 4JLVA 1TEZA 1T9KA 1UFRA 5A6SB 1JA9A 1PLJA 2XWSA 4WEQA 5CJPA 3KOMA 3VSBA 4UOZA 4ATNA 4UJ5A 5JYDA 1RWPA 3PC3A 2GZ3A 2BHTA 2B1QA 1KI1A 3IJRA 1A8HA 2CJPA 3BREA 3UHOA 4RNCA 5CH3A 1U5BA 2G7MC 3DULA 3L7MA 3P9NA 4FMDB 2JKVA 4UDNA 4CF4A 1RXWA 521PA 2X19A 4HLUA 3QW2A 2HK9A 3WLAA 4FWIB 4M9XA 1SUIA 1G8HA 2VJLA 4C1NA 5BW8A 4KU4A 1P9RA 1G5TA 4DBLC 3WLEA 2QEQA 5BSVA 3TLJA 1LF5A 3WFIA 1VG8A 2BM8A 3EFEA 1TD9A 5FA6A 4JI1B 1EFDN 3LUDA 3GLFE 4Z4QA 1DVRA 2EKDA 3HB9A 3ODPA 4G3XA 3PEFA 5C8XA 4Z53A 2O2JA 4MQFA 1DINA 4IIDA 1FSFA 4UVIA 1CUAA 2X6QA 2QE7D 3GZ4A 4MW5A 4RE6A 2Q9CA 5E9WA 2LKDA 3DE5X 1UODA 3LJKA 4LBWA 5ALTA 4G8DA 1E9BA 1JT9A 1EAYA 3HCBA 4G8CA 3VR4H 2NO1A 3PJEA 4IYJA 2PX8A 3WMRA 2DTEA 3R5SA 4E07A 2WM2A 2WABA 3WRXA 3G6WA 2O06A 1SQFA 3O4IA 4MEJA 4O2LA 2XAUA 4JUAA 1ZD8A 3LPLA 1PEAA 1XWIA 4B47A 4Y1RA 3RK1A 4ALIA 1EUCA 1GNLA 2OOSA 1OI7A 1A69A 2H07A 2FWJA 1W0JD 2BL4A 4CEIB 1XI2A 4UNPA 1E9DA 1TJ3A 1U3TA 2XE6A 4OK5A 3UV3A 3WVNA 4YIHA 2AFRA 3A6HA 4FDUA 4LA4A 2VKQA 4H17A 3DBIA 1B8VA 1XTIA 5BR7A 5KNDH 3H2HA 5FLXA 1U3WA 1YH3A 2HNBA 1F6BA 1YZFA 4IS2A 1XRRA 2KSQA 1M6WA 2OQ2A 3TW6A 4L27A 1SBHA 4PW0A 1QVAA 5JFGA 1OJLA 2QQFA 2QUZA 3EC1A 2G08A 2PMFA 2P6MA 4CLOB 2WMNB 5MDHA 2P9TA 3TR5A 2O9JA 2E21A 4ZZ3A 3QEBZ 1I4TD 1ZFNA 1TAHA 1YRAA 1VHJA 3C1TA 3OF5A 3ZNPA 4BO7A 2ZBVA 3IA7A 2FOLA 3BS4A 4MV1A 3I01A 3B6JA 2F3PA 2YZ2A 4OREX 3GMDA 2OV2A 1C4KA 1NVWQ 3OF3A 2X0NA 5A4AA 4CEHA 1AZWA 5ERGB 4IOJA 4HX2A 4C6TB 1ZRNA 4OX9Y 3N2ZB 2HT1A 2GBCA 3E35A 4D74A 3I1IA 2ZSJA 4IJ6A 4LK2A 2PVCA 4NZOA 1B1AA 5LJIA 3DBRA 1ST3A 3G68A 4HDRB 4UXIA 1UXOA 3HB4X 2W4IA 1SIUA 2IV3A 2PLRA 3HL0A 5KKNB 1WMBA 4WGGA 3M5WA 1DBWA 5FTWA 3ZVMA 1OXUA 1P7PA 3L0DA 1XTTA 1GSHA 2GJKA 1N3YA 2GN2A 3DD5A 3LA8A 4Q3BA 4Q4HB 3P94A 4XARA 1PQPA 1TJPB 1W73A 2QW1A 1U0SY 3IS3A 4QG7A 2WG1A 2X5JO 3MEQA 5HG0A 2Q1YA 3DMTC 4JVLA 5FI3A 4CQLB 5DNEA 1C2TA 1F5NA 1ZVMA 4LC1A 4Q4DA 3SC2B 1XD9A 1X8KA 1AHIA 1ZXBA 3GV0A 4MV6A 1GHTA 1HK7A 4R3WA 5CB4B 3IELA 3MTJA 3MT7A 3ROKA 4P08A 4P34A 1FP4B 1F9EA 4FOTA 4Q7EA 3A3OA 1KEVA 3L7NA 2KWIA 2GEDA 4ZKEA 5HTKA 4XOIA 4C7OB 2P35A 2ISSD 3C2QA 4RHTA 2OV3A 4MI3A 1U2ZA 4AJNA 1ZIXA 5EAIA 1XXHA 2ZI6A 1DKLA 4M87A 5AHOA 2CF5A 3EG5A 3LKZA 3TLBA 2VWGA 3EYAA 4PANA 3DWIA 1Y1QA 2GNPA 2Q9UA 3RCBA 4POOA 1EUZA 4PPNA 5T64A 3REQB 1Y8AA 3KB1A 2Q6VA 2R7LA 3IAUA 1PNVA 2WJHA 2WUDA 3EEOA 1VCMA 1F0YA 5G4KA 4C21A 4W9MC 1NQOA 1P1CA 1QP0A 3T3NA 4LZWA 2AEEA 4RKRA 1H5QA 5JNLA 2WSMA 4W5HA 1MF7A 3WGHA 5K8TA 1K2WA 3D6NB 3W3ZB 2BH9A 2XITA 1J4AA 3DMYA 4EYSA 1WPXA 3S6JA 5IH7A 4OQXA 2BR5A 5JAUA 4LHYA 5COBA 1A4IA 3VR2D 1PS9A 1EWTA 3GLHE 1NSFA 3OEHD 5EMHA 3BKXA 2J4FA 3IV7A 2XNHA 3DZCA 1BMFA 3OD5A 1G2OA 3EVAA 5E9QA 2VQSA 2QT1A 3AKEA 1T29A 4JB0A 3RTAA 4QHSA 1T9GR 3PPIA 4V0MA 3VYSB 2Z3WA 3AEYA 4P2GA 4F11A 1O95C 1XJ5A 4QWWA 2OD2A 3EDCA 4Q4JA 1MX1A 1F7VA 2CW5A 3UK6A 2V7QA 3C48A 2XDWA 1QHSA 2NPIA 1JQLB 2ZSKA 2GPJA 3RROA 5IAEA 4ZJZA 5CBKA 5KO2A 4KLCA 1QIFA 2W11A 1LQ2A 4CETA 2YX1A 4A26A 1AV6A 2O7NA 1TEHA 4PZZA 1CJBA 2Y05A 1K08A 4WLOA 3OZGA 1IAVA 4CLXA 3H8JA 1Z28A 2HRCA 2VCYA 2C7BA 3ZNOA 4JP5A 3BPSA 2ORED 4PHGA 1I3KA 4TV8B 2XUZA 3AKYA 5WRFA 1CCWA