1NW4A

Crystal structure of plasmodium falciparum purine nucleoside phosphorylase in complex with immh and sulfate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
243
Chain Sequence
NLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords uridine phosphorylase, putative
publication title Plasmodium falciparum Purine Nucleoside Phosphorylase: CRYSTAL STRUCTURES, IMMUCILLIN INHIBITORS, AND DUAL CATALYTIC FUNCTION.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 85
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nw4A00
2QTGA 1A69A 3UAVA 1ODJA 1YBFA 1CB0A 1LVUA 1SD1A 3OZDA 3E0QA 4JOSA 5F78A 1A9OA 2BSXA 1A9RA 3UAZA 3OF3A 4LNAA 3BL6A 2HN9A 5KB3A 5F7JA 1VMKA 4EB8A 1Y6QA 4F1WA 3KVVA 3O6VA 1ODIA 1Z5PA 4IP0A 3DPSA 5F7XA 4YMLA 1V2HE 1C3XA 4JWTA 4TXHA 1PR2A 1ODKA 1ECPA 1RXUA 1RXYA 4D8XA 1JDUA 3UAXA 4TTIA 3LBAA 1U1DA 1LX7A 4NS1A 3IEXA 3OZEA 5F77A 4L5AA 2ON6A 4DABA 3D1VA 4LDNA 2OC9A 5F73A 4UC0A 1A9QA 1JE0A 4QATA 3T94A 5B7GA 5EFOA 1OV6A 3OPVA 5FAKA 3OOEA 1PF7E 4LNHA 3MB8A 4M1EA 3DJFA 1SD2A 5F7ZA 4G8JA 5B7NA 2B94A 4QEZA 1U1GA 3BSFA 3FUCA 4QARA 4DAOA 4F3CA 5JPCA 1TGVA 1Y1QA 3FOWA 3BJEA 4GLFA 2OXFA 1PK7A 4BMXA 1U1CA 4G89A 2QSUA 4DA8A 1ODLA 1PR1A 4E1VA 4GLJA 1T8SA 4ECEA 3EEIA 4DARA 4I2VA 3O4VA 4D8VA 4MCHA 1M73E 3E9ZA 1OUMA 5IFKA 2A0YA 3EUEA 4D8YA 1VFNA 4OEHA 3NM5A 4OGLA 1TD1A 1XE3A 1RT9A 1RFGE 1RXSA 4EARA 1K3FA 5C80A 2HSWA 1G2OA 3U40A 1JDVA 1A9PA 3FNQA 1ULBA 1LV8A 3K8QA 4R2WA 1RYZA 3ODGA 4OJTA 2AC7A 4D9HA 1T8WA 3IOMA 3LGSA 3INYA 1OU4A 1WTAA 1V4NA 4TXJA 3DF9A 2AI3A 1TGYA 2A0XA 1Z34A 1FXUA 1JE1A 3DDOA 5CXSA 4QAQA 2XRFA 1A9SA 4U2KA 4WKPA 3QPBA 4L0MA 1PR0A 1RCTE 4PR3A 4JP5A 4QASA 4DA0A 4TTAA 3KHSA 2QTTA 3SCZA 1OTYA 1JDZA 1T0UA 2QDKA 3KUKA 4TXMA 1VHJA 5EPUA 5K1ZA 3ENZA 3UAWA 3NM4A 3EMVA 5IU6A 1ULAA 4M3NA 1CG6A 1ZL2A 5ETJA 2A8YA 1B8OA 3FB1A 4TYMA 3NM6B 3P0EA 1PW7A 1OVGA 1JYSA 1Y1TA 4DA6A 1U1FA 3UT6A 4WKNA 2OC4A 4L5YA 4X24A 1Y1SA 4L5CA 1PBNA 2I4TA 1PR6A 4M7WA 3GB9A 3DP9A 3C74A 1NC3A 1Z36A 1YR3A 4YJKA 4G41A 1Y1RA 3LA8A 1Z5OA 1SQ6A 4WKBA 1NW4A 1U1EA 4BMZA 4KN5A 4OY3A 1Y6RA 1Z5NA 5B7PA 5F7OA 5CCEA 3OZCA 3PHBE 3TL6A 5B7QA 4BN0A 1B8NA 2QPLA 3FAZA 2GUWA 4WKCA 1JDSA 4RJ2A 3PNPA 1PK9A 3OCCA 3OOHA 3ONVA 1RSZA 4NSNA 1K27A 5EUBA 1JPVA 2H8GA 5CCDA 2P4SA 1PKEA 4L6IA 3KU4A 1V48A 1Z39A 2RJ3A 1OTXA 1YQQA 4NY1A 1JDTA 1Z37A 3FWPA 5F76A 1ZOSA 4R2XA 1Z33A 2HRDA 2I8AA 2A0WA 4TXNA 4DAEA 3MMSA 3E9RA 4R31A 2PGAA 2ISCA 4TS9A 1RR6A 5CXQA 1QE5A 5DK6A 4YNBA 1Q1GA 1K9SA 3EUFA 4GKAA 2HWUA 3BGSA 4FFSA 4K6OA 1Z38A 5I3CA 4F2WA 4F3KA 4PNPA 4LZWA 4GMHA 1T8RA 4BMYA 1V3QE 2Q7OE 3KVRA 3F8WA 2IQ5A 4OGKA 1TCVA 3PNSA 1PR5A 3KVYA 1JP7A 1N3IA 2AI2A 4F2PA 4DA7A 2AI1A 3OZBA 1TCUA 4LKRA 1YRYE 4TXLA 3NBQA 4TTJA 3GGSA 4P54A 4TS3A 4YO8A 1T8YA 2OECA 3P0FA 4D98A 1PWYE 4OF4A 5CYGA 1SJ9A 4WKOA 1RXCA 1PR4A 3UAYA 5CYFA 1V45E 3PHCA 1YQUA 1A9TA 1V41E 4MARA 4DANA 1Z35A 1VHWA 1I80A 4QFBA 1NC1A 3K8OE 4MCIA 4H1TA
chains in the Genus database with same CATH superfamily
5DHQA 2H5LA 1T6BY 5HF5A 4EECA 3QTTA 1KAMA 2ZR8A 4U9HS 3ELWA 5F1PA 2PFSA 4BNFA 2BEUB 2OZLA 2Q5JA 4O4JB 3G2OA 1NXSA 3PFWO 1NR7A 1GGHA 1QH1A 2YUIA 5TT1A 3U2QA 3TW8B 4O1HA 2PSFA 4B2PA 2RSLA 1KPHA 1BVRA 1PSWA 1E0SA 2BSAA 4A82A 1V8BA 1I4LD 1XROA 3UJ7A 1L4UA 4CMIB 5JS6A 2VYCA 3CRZA 4HFRA 4A8JA 4CFSA 4H18A 4ZEWA 5LXTB 1BKSB 4DQLA 2A84A 4KLRA 4H7EA 3SC6A 4XPIA 2PVPA 3HYSA 5F7JA 4EAQA 2YASA 4RV5A 2V97A 4I4CA 3UT5A 1QX4A 3HPQA 2AMFA 1OB5A 3LXMA 1GPUA 1V1JA 1U6KA 3DAHA 4ILKA 2E21A 3H5AA 3V2GA 3IVCA 5AJTA 1BYUA 3WI7A 4C7MA 4HAIA 4R0VA 4P0PB 1SVIA 1L7OA 4JIGA 2WM2A 3E9EA 3FTFA 2A9VA 1UQUA 1GTJ1 4IP0A 3EW7A 3UKDA 4R2MA 4A0FA 1BEEA 5DGDA 1PQUA 4BC0A 3JVUA 3UOAB 1LC0A 4CODB 4ER3A 2QD2A 1ENOA 3AMVA 2HPAA 4RVFA 4X95A 5FBHA 4AT1A 1ECPA 3HCCA 4H6XA 5FH9A 1FSPA 2OZEA 2RAVA 4Q4HB 1P0MA 2VAVA 4YAGA 3DEFA 2R8XA 3FGNA 3QUBA 2V0NA 1SWVA 4YI5A 5FOWA 4BATA 3VU1A 1I8TA 1Y5IA 2A9KA 4XX0A 3U49A 1JZTA 1CNEA 4ZI7B 2M2IA 2ZR9A 1OXXK 3CY6A 4Y9DA 3ONEA 3D3WA 1LX7A 4EJMA 1FYEA 2PBRA 1WL8A 5DF1A 2OGSA 3AW8A 2Y9PB 3OZEA 1VYHA 4NOLA 4GEGA 2OYRA 3A6DA 5LJIA 1OAOC 4FFBB 5DH9A 2XJ9A 1Q0SA 3D5EA 2FX2A 3HDJA 3QLVC 1GRRA 1O6ZA 2W2QA 1D04A 2WJGA 5CW2A 1GG5A 1OKKD 3KD2A 1RQNA 3FDZA 4L50A 4MYDA 5IC4A 3VKGA 3AR9A 1B1AA 2IY9A 3HCOA 3K8YA 3QF4A 4JT4A 2P5SA 1NVMB 1KMCA 2IYRA 4UUMA 2QR2A 1P44A 2OHHA 3PR3A 4QO7A 3RG2A 3HCDA 3W3AD 1OJLA 3ZQ4A 4C2AA 1AQUA 1CXZA 1VE1A 3VNVA 1UJ5A 3KQNA 2WPDA 1M6YA 3TJZA 3S0JA 3TLCA 4ZDKA 1E2UA 2QYSA 3CLSD 1P4JA 4IQ0A 2ZI4A 3WLTA 4BKOA 4QYTA 4YJDA 3KKZA 1PF7E 4PONA 2FEXA 2FCAA 4AY4A 1GKLA 5KQMA 4OREX 4TYNA 3T5AA 1NBOA 3CJTA 1RPJA 3H3XA 5IN4A 5I7UA 3OLZA 5K45A 4UAGA 2C04A 5LQNA 2DKFA 1CLEA 1LVGA 1QVVA 1AXGA 3KG2A 3DW1X 3L6BA 3RADC 3TLXA 2JLWA 1N2CB 4IFIA 4J0FA 3AVTA 2NO5A 1CS0A 3F3YA 1UXGA 4KAXA 1GNTA 1N6RA 1KY4A 2BF4A 3IQXA 4MROA 3CRVA 5C0OE 3O82A 4F3CA 1K8YB 3BOSA 3ZIUA 2I99A 4DV6B 1T1IA 2PSEA 1W4LA 4RFSA 4EA8A 1KO4A 1DXQA 1VIAA 3TNLA 5K0CA 2BGRA 4XFDA 3Q9LA 4EO7A 4CCYA 1C8BA 1JMVA 4I1YA 4LJ7A 3SZGA 4C7OB 2FZLA 5JBQA 5CD1A 3W0LB 4E21A 3JAMA 4HNGA 4YUAA 5LC1A 1TO2E 5ECDA 4DE5A 2G4LA 2QN9A 3H4TA 4OAPA 2JAQA 1WPXA 2PD3A 4EI7A 2C8VA 2VH5R 4YLEA 1DCTA 4KREA 1R00A 1JBQA 1J0EA 5HKBA 1NUTA 2D06A 1DQPA 1NU6A 1RWPA 1G98A 2EXXA 5CMLA 5JRJA 5GONB 3EGXA 3KZVA 1Y42X 3TEJA 1W93A 2IHVA 1QX3A 4PXSA 4N7JA 2PIDA 3QVTA 5D84A 5JYDA 2ZREA 5B58T 2FW8A 2F3PA 3PQ6A 1OV4A 5B1HA 4DSZA 1I3KA 2PH5A 1XMJA 3DMGA 3HGMA 4NU8X 4AX8A 1XTRA 4CF3A 1WXWA 4RTRA 4DUYB 3GAAA 5KNBH 4I55B 3PI7A 1EB9A 2DQKA 3A9CA 4K6FA 5DCYA 4A9AA 3HO1A 2G82A 4OCZA 5CX4A 4EO9A 3COZA 3HJAA 1E6CA 1HT3A 4FFWA 3DCNA 3U39A 2NMVA 3AJ8A 1QOZA 2QT1A 1KDOA 1CEXA 1V2GA 5DT9A 5JJCA 2NU9B 2QUJA 1QOQB 2HA0A 2ZJ0A 3UV7A 3RG8A 1F8GA 3R1IA 2RH9B 3NQ41 4L4ZA 3F90A 4HAUA 1IQUA 3R4CA 3PZRA 2YWEA 1T4CB 1VTKA 3CNLA 1O77A 2OMKA 4ZQCB 3UC9A 1IU9A 1DCFA 1H93A 1QONA 1IEXA 1FTGA 2FTKE 4LCEA 4BX8A 5C8ZA 2GNAA 3K2QA 3HP7A 3BE4A 1WZEA 3IUMA 1ZEJA 1RFGE 4ZO6A 1ZH0A 3WWYA 5I9IA 3H99A 3LRTA 4LBZA 3AY6A 4ICIA 5KCZA 2OT3B 4P5PA 2C2GA 3OE7A 3JQBC 3IIMA 1FQJA 2HLPA 2I6QA 4XWAA 5K0TA 4XSGA 1AQJA 4NICA 1AA6A 4YJGA 3N2IA 1WSAA 3UHFA 4Y2TA 3WIOA 3X43A 5A3RA 2X4GA 1YKFA 2GEVA 2Z3WA 3IQZA 4LWQA 4MLZA 1N5RA 3QKWA 1Y3FE 5I48A 1K6MA 4OP3A 4AMZA 1YVRA 3AKCA 1NY5A 1VE5A 3QFSA 2C5BA 4MW0A 3LFTA 4ESEA 2OV4A 1KKLA 2FRDC 1R3DA 2CZGA 5KOIA 4XGQA 2QTNA 3IQFA 1A8UA 1U4SA 2QVLA 1E6LA 3MJEA 2K4MA 2W43A 3LDHA 1A9ZA 1AUVA 4B6GA 3VPAA 5EJIA 4QSHA 2NO4A 4DG8A 1HE3A 4U02A 4J9UE 1FX0B 4K9KA 1M1NA 5TMDA 3TCKA 4S04A 2IPLA 1A4IA 1M74A 2WWRA 3WBKA 2AWNA 5HZMA 2B30A 2WHQA 2F9MA 3CB4A 2JGEA 3DDOA 4UCXA 3TJMA 3MLBA 4PO8A 4HAVA 3UKJA 4RDHA 5CDYA 1Y5RA 1QZXA 1V0JA 2C54A 2WFMA 2ZIAA 5JPIA 3AB8A 5JXGA 3DFKA 4FPXA 4EG5A 4RUKA 4IIJB 1OASA 2FR8A 3FGZA 3TNYA 1WUYA 1ETHA 3IE2A 3LSTA 3AKDA 4TSRA 3OE4A 3LGXA 3CEJA 4UBIA 5KYXB 2VG8A 1W5FA 1IUKA 1P74A 4I5IA 1DT5A 3FKQA 3FG9A 3KHKA 1VG0B 1SXJD 1WE2A 4B5LA 1GQFA 3H11A 3TZLA 3VXKA 6REQB 3U31A 4HMQA 3GMIA 3Q8XB 4OOFA 4TLCA 4Y2RA 3RYCB 1QFZA 1BU5A 3A6PC 4PRLA 4JGGA 3SYRA 4CN8A 1ADCA 1V5GA 3MRSA 4Y1EA 4OHUA 3FWZA 2JIMA 1WQ3A 1QZUA 1CZRA 1W85B 4HXYA 3SXJA 2HYDA 2NV2B 1RI5A 5K3EA 2ZZNA 1XHEA 1SGWA 5GQSA 4C4OA 1YOVB 2HB6A 5G4LA 3HYLA 1W0JD 4FGZA 1YR6A 4C08A 4X0EA 2QLLA 2HX1A 3I9V6 1Z5VA 3M6FA 3NETA 2B9VA 3GOHA 4Q4LA 3RPEA 4J0DA 3UVEA 4IKEA 2G9NA 2X9QA 2R79A 5A0VA 4UOEA 3ZJTA 5JJLA 3TLYA 2R86A 4FHFA 3KSRA 3P0EA 3PWSA 5B3JA 3UK6A 3L4BA 1ISHA 5JH7A 3OESA 4Q05A 5F64A 4MPTA 2QZ9A 2R6FA 3TLGB 5HIKA 2W83A 3K9CA 4GXTA 4AP6A 4BN5A 1CDEA 3DHNA 2R5NA 3AF4A 3KT6A 5AH0A 5KTOA 5HK8A 5LZ8A 1ESNA 4D6PA 3NVDA 1R74A 4QM6A 1Z0JA 4HQKA 4PEVA 2FSVC 3KUUA 2WG2A 4HXFB 1EVJA 1PNOA 4H1VA 4E33A 1R6XA 4XWWA 1CUIA 2ZXEA 3PDCA 2MMGA 3HFGA 2KPOA 5B3AA 4DLAA 1H2BA 1EE9A 5JFOA 1TO6A 3R20A 1QGUB 3NW9A 4KNWA 2GM9A 4CTOA 1HV8A 4H6VA 3TM5A 1DADA 1ECLA 3MRTA 4RLQA 5AKLA 4BO9A 5E3JA 1G7TA 2OVFA 3IPYA 2WVJA 1SBHA 1XDUA 5CCEA 1H5UA 3FETA 3V2IA 4MRMA 4OUDB 3GDWA 1R4NB 2OP0A 4JBGA 2PUCA 2QN7A 1ZU5A 3CZQA 1RYNA 3EXIB 5CM2Z 3STVA 3HEBA 1NUUA 4DKXA 2CVQA 1JIKA 1W5BA 1SXHA 4ZGGA 3QBJA 2I76A 4UEQA 2SKEA 1NT2A 2ZJ1A 3TZHA 2IODA 4K7JA 2H3EA 1F48A 1W1WA 2NZVG 4EKIA 1UJCA 5J23A 3P2KA 3T1HB 1I2DA 1YZYA 4IIXA 4CBVA 5KIAA 2BYTA 1BXGB 4F5DA 3BX1A 4P4TA 1FFYA 3GLFB 4C88A 2VTBB 2FUG1 3EGCA 2IEGA 4L5IA 2HK6A 1H66A 3KEQA 4XB6B 2ZUVA 2ZBGA 4JHLA 2AX3A 3VVMA 3ZPXA 1YB2A 3JQ8B 2CVHA 1L7AA 5KSYA 2CK3A 1B8VA 1B3BA 1PO7A 1QZZA 4RJ2A 1SUBA 2C4WA 1BJRE 1T4GA 5SZIA 1U7XA 4CKCA 4V39A 1PVVA 3KDAA 2K87A 2EW1A 5UKDA 4J3NA 2JRCA 3EDCA 3A1UA 5E6SB 1NUSA 1NVAA 1SK8A 3L6OO 3PD1A 2CNLA 3VBEA 3AHFA 1YTLA 1ZNWA 3AVOA 4JQYA 4RD4A 3D2LA 2D2FA 2ID4A 4D9JA 4PGFA 2PYDA 5FNZA 1X7YA 1CJTC 5F5NA 4I9UA 3D0OA 5HKKD 4LJSA 3L07A 4AG3A 3KSAC 2XA9A 1M67A 2XX3A 3GUYA 3ZVRA 3F6PA 4C0LA 1REQB 1OZ0A 3G0CA 3GJ7A 1D5WA 9MHTA 4KGDA 1FFEA 4S1TA 2Q2OA 4D7AA 2FN7A 4DUPA 1DQSA 1E1QA 3QXSA 1JDTA 5P21A 3DMPA 5EE9A 2HBRA 2E37A 2QZZA 1SXJB 3GJZA 3I2JA 4QFMA 4GT1A 5AW5A 4D45A 4G86A 1KR2A 2WPDD 3B9RA 3CW2A 4MV4A 1LLCA 3OZAA 3HKCB 1KDVA 2ONCA 1T0HB 3N8DA 1K4KA 5H3HA 2ZE5A 3E7FA 4ZOEA 3E1KA 4BYMA 3HY6A 4A0GA 1OX4A 1P33A 3EG9B 1EUQA 3OAAD 4IJKA 1E4OA 2IIVA 1Z0ZA 2EZ8A 3I6IA 4KQ9A 1Q14A 3NNSA 1UANA 1K4YA 3WQSB 3OBIA 1B2LA 1PNTA 1QDLB 3I9NA 2JGAA 1OFVA 4K6KA 4RSHA 3GCWA 3KOUA 1HFKA 1E3WA 2QG9A 1PFUA 5JWRA 1ZN2A 2VT6A 3ESRA 1CE8A 4K6OA 1NYTA 1F9EA 4BMCA 3A4IA 3BJZA 2TECE 3KP1A 4AYTA 2IVFA 4GQIA 4WDQA 3KPYA 2PG3A 2PMWB 1PJ2A 2BR3A 3HVUA 3A6HA 4QLOA 3ADCA 3SBXA 2C97A 1CDZA 1EDDA 3I39X 3LH5A 4OJKA 1P4AA 4PLYA 1U90A 3WWPA 2BGWA 3WLAA 1U0JA 3KVRA 1IPFA 2HCJB 1KOGA 3OQOA 1ZUNA 3GGCA 2VA8A 3DBLA 3V7WA 3BMNA 1TIPA 4DTIA 4EVIA 4CF7A 1OZAA 3F5DA 3DMYA 1H6DA 2IYUA 3H8VA 3CWZA 2GXSA 3CXUA 1JSCA 2JAXA 3KVYA 5K05A 5TMPA 2YIDA 4Y9UA 3HKEA 5K8JB 3AHIA 4FXPA 3ZE2B 3BICA 1R6VA 5EMKA 5TB5A 3FVRA 2QU8A 2Q0QA 2P65A 3MPOA 4AYWA 4XVCA 4OQMA 1L8XA 5AQEA 2WJZB 5ALMA 1E3IA 3K92A 1G21E 5TMBA 6ABPA 5AR1A 3BCSA 2I9KA 5F2KA 1QJ4A 4ENSA 1Z6QA 2HIHA 1BDBA 3OJXA 3EVBA 3O9MA 4CIAA 2XQIA 4PLWA 3HTXA 4BVFA 1L1EA 1LI4A 4HVTA 5JQGF 3TPCA 4PS0A 1ADGA 1UDXA 3HU5A 4JIMA 4JODA 2PA0A 4EW2A 3RSFA 3T6KA 2ERCA 2Y4NA 4Z3KA 1P80A 4G5RA 5JHHB 4AKSA 4DJAA 5JXIA 1SU6A 3DYIA 4YCAA 5COAA 4R8KA 4W9NA 4DN6A 1VL2A 3MWDA 3HCPA 4WKGA 5CYFA 1FSZA 1EK6A 4BVKA 2ZRJA 5K6TA 1FUYB 5LYJA 1NQ5A 1KC1A 3QLUA 4BFLA 4I6JA 3TLBA 3GRYA 2JIZA 2RK4A 4B8ZA 2PX0A 1W2GA 2ORYA 5BMVA 3P9ZA 2W2LA 4NZPA 4Q6BA 1I80A 1UBHS 2BIFA 2VDPB 2YWBA 3DCIA 5EZYA 1XDZA 3MPUA 3D3NA 1RJFA 1TTPB 2J33A 1SKYE 3ANYB 1NMZA 5LBTA 2HJGA 2AXEA 2G5GX 3P2EA 4MAAA 4N3NA 3K71B 1FBNA 1G9TA 5HFAA 1AJEA 4XXHA 3IAAA 4AUNA 2YWGA 1C7QA 5BQ5A 3OU2A 1K5DA 4KMMA 4XYGA 1O0BA 1ZSYA 4FFDA 1WG8A 2I87A 2O2XA 2WT9A 4YTEA 5FF9A 4BZZA 2HV9A 3GJYA 3T3OA 3MJDA 1GLGA 3V8VA 3QY9A 2O8CB 3LW7A 3BL6A 2B1IA 2RDMA 2HN9A 1QKKA 3CF4G 3WLNA 4CQLA 1JFFA 1FS4A 3G9TA 5CIWA 1Y63A 1ZOOA 4H3VA 5DYTA 4REOA 4RMHA 3LCRA 2IHNA 3GPCA 1VMKA 3LT0A 3O1IC 1LS1A 3PA6A 4K0RA 3MINB 1FW8A 4QOGA 4OO3A 4TTQA 4EB0A 4E31A 3AHDA 4UHHA 2M98A 4KRYA 4IGIA 1Z6YA 2A14A 1OSNA 4I6EA 3RK4A 2G6TA 2XNCA 1BZYA 2NXJA 3B52X 2G9RA 3HKBB 3QEOA 4HWGA 5DULA 3HP4A 3TRFA 1BQEA 5FUVA 4YMLA 2A3NA 4J76A 4KIUA 4RETA 5TPWB 4YUZA 1VGVA 3LF2A 3OPQA 2IS2A 4D80A 1SC6A 4ZQBA 1KSGA 3WQHA 5FI3A 4BKRA 2DHRA 1JJBA 2WI8A 3X1WA 2VC2B 4FYWA 3EC7A 3TGWA 4QD3A 3WO0A 3HBMA 3KDSE 1YFKA 1VG1A 1AA9A 2VPZA 4OI4A 3C8DA 2JCXA 4WAUA 1FUUA 4LXQA 4G23A 4B6QA 5B4UA 4EENA 5CJ2A 2W8ZA 3D7MA 2QTVB 5IKEA 2BH2A 4B9AA 4LJ4A 5B5SA 1PU2A 1EUYA 1ZYUA 2AZDA 2XD4A 3B60A 4Q19A 3EIQA 1USKA 3CZAA 4KBYA 5EMMA 1Q0RA 1RQLA 3V9AA 5KVAA 3GRRA 4X92A 2O8DA 3LOQA 3OT4A 1DB3A 2ON6A 4B6EA 1X1RA 4JEMA 4L8LA 3ER8A 2YNMA 1ZJWA 1ZU4A 3VI3B 1XZJA 1XTTA 1MRZA 4D5GA 5BN3A 3P19A 4BO2A 1DXYA 2HV8A 5KKAA 2AFIE 2QX6A 4Y6OA 2P77A 1JLSA 3W77A 2CCKA 4OI1A 3UXEA 3KEMA 4MTLA 1D0IA 4JGBA 4TMYA 2IP2A 3BB1A 4PQEA 4RX1A 2BFNA 1SUSA 4P36A 4PAOA 3HVRA 1JFRA 1G20A 3S81A 1CQZA 4BVEA 3THYA 1ESDA 5A5GA 2VWPA 1ZIXA 2GETA 4AF6A 2C8KA 5HNKA 3LCVB 5L3ZA 4MYRA 4ZOAA 1M8JA 4DWWA 5BRJA 1V3TA 4KFRA 3MS4A 3UZUA 4M1EA 1QNLA 2FSFA 2QDXA 1YONA 4PR0A 1DX4A 5GOTA 3D7RA 2OORA 3IAUA 3KYDB 4G8JA 4HLUC 2EQ5A 2YJGA 3MAAC 2YQ4A 1N2IA 3JYQA 1IJEA 1X7WB 2FGKA 2ZWAA 3QU5A 4AIIA 4PNEA 4YRNA 3D6NB 3MN1A 3N0TA 3OUZA 1R12A 3GLGB 5JI3E 2BGJA 1NXQA 5KOJB 1MU0A 4ACAA 2YWDA 2VATA 1M9NA 4AF8A 1AZLA 2C9MA 2DUNA 2BL4A 2PBLA 2QTWB 5I7WA 2AW5A 4K9DA 3R7AA 2MHCA 4J7AA 1JJ7A 3SHTA 4L74A 3P94A 4MYTA 1JVNA 3ESZA 4MXDA 4QA9A 1BCSB 2OHIA 3EUAA 3BIFA 5KOHB 1Y0BA 2XHZA 5EJAA 4TQAA 4X3PA 1R27A 3UT0A 2HT1A 1U2SA 3VO9A 4P0QB 4IXWA 2D7JA 3ICVA 1POWA 2A94A 3R5SA 2I2DA 5KPDA 3J7AC 2ARKA 4E5UA 3RGGA 3UHOA 1YVUA 1Z4PX 3Q6MA 2Q0XA 1PFYA 1UFVA 5KOYA 4HAWA 1NUPA 1DARA 4IZOA 3SJCA 4PYQA 1UJNA 4MVXA 2C4TA 3C97A 1VCNA 3Q3CA 3QTLA 4NMLA 1QOPB 4E14A 4FDTA 3VPHA 4NJOA 3P9PA 3RRFA 3SP1A 4BV8A 1YJ5A 2H2AA 3DZGA 5FBQB 2W48A 5KC8A 2VPXA 3FFBA 4I3FA 1TLTA 4C4TA 1E79D 4D9CA 1X38A 4CLDA 5IJZA 1RM5A 4K8RB 5LZ7A 3WA6A 1NSYA 2C7BA 3BIOA 1XXHE 3ZK8A 3E1GA 5FBVB 4BBZA 2DJIA 3IP3A 3KM0A 4EIWA 3GWGA 3W5VA 3E5NA 5EE1A 2H6EA 3H1GA 4ZK6A 3QX7A 3THXB 5CIQA 1NLYA 1M73E 1J49A 5G02A 5LSAA 2BGLA 4RVUA 5JWHA 5IFKA 5LD2C 2GRAA 1MJNA 2XMRA 3AUJB 3B85A 2J08A 3C8HA 5ALFA 3BFJA 5AM1A 5A06A 4I1PA 4BQNA 3RC8A 2YVLA 2VYVA 5I45A 4MLCA 1I4OA 3HJHA 1SB8A 3IA7A 3ROPA 3SICE 5EMNA 4K6CA 3L7BA 1PJCA 3HYCA 3QKTA 1JF8A 4M9SA 4ZYZA 3SQNA 5C1OA 2HXGA 4QO8A 4X6LA 2DSNA 3KRTA 1S02A 2WQ7A 4KJXA 4QDXA 3CG4A 1GZVA 4NCIA 4UMVA 3UN1A 3K0SA 1C4KA 1K3FA 2ABWA 3M4NA 1K92A 1P0FA 2XOEA 5C80A 1WOYA 3TTXA 1A1SA 3Q5GA 4JB8A 3QYJA 4BU0A 4DRYA 2DTEA 3MOIA 4DQ0A 2B8JA 1E1QD 1ZD9A 3I6QA 4GZ5A 3CJRA 1D2NA 4PLHA 4RHEA 3LJKA 5HCIA 4DC1A 2ZI7A 1OXBB 2AG0A 2WAXA 3KD3A 1LKZA 1MAAA 1PI3A 3R5TA 4M55A 1ZM7A 1TW2A 4V0KA 3VMMA 2XGMA 3WOHA 5DJ5A 4ENVA 5A4AA 4RABA 3ZD9A 3DHEA 3KTFA 4EAAA 1DV2A 1UP4A 1RW4A 3H18A 1B23P 3GLIE 1RBYA 4FBMA 3PIIA 2W6JA 1V4NA 3FMGA 4G9BA 3X1YA 5A62A 2IXBA 5KJ6A 4GVPA 2CXOA 2MSDB 2XQFA 1LK0A 1GQOA 2VJYA 3AHHA 3W7VA 1HE2A 3HR7A 4RLFA 5F3RA 1NE2A 2AYYA 1BKDR 2QVXX 5AVSA 1U02A 4WI1A 1YDFA 2C7VA 3CT6A 2KHZA 3HJCA 4ZYVA 3OX2A 3PNQA 2FPRA 3ZD6A 3O8OB 5LKRA 3FYHA 2GK3A 3DULA 3I83A 2NO1A 3D8BA 4C03A 1P18A 2P3QA 3I2YX 4MWOA 4N3BA 1DQYA 4TUYF 1CW2B 1W0CA 2DH5A 2JCYA 4FMDB 5EXEA 3WSVA 1NP3A 4L5JA 1VGRA 3OMXA 3CKYA 2KBFA 3O75A 4ZZIA 1FLNA 3JQQA 1CX9B 4MMXB 3FHTA 1M75A 4CM8B 5EIXA 2IF0A 3PF9A 2NUPB 3ZQKA 4AXXA 2V5AA 4OM7A 1EIWA 4IDDA 4TYWA 1CY0A 3AVYA 4REQA 1D7AA 2EWWA 5CAEB 3I37X 2CFSA 5LQCA 2IYTA 3LX6A 5A3JA 2PWBA 4TV8B 1U4NA 3D4LA 5MN4A 3KR1A 3UV3A 2R65A 4JL5A 4TXMA 2IYQA 3TTVA 4ZGBA 2FPPA 4PYNA 2FN4A 1XJCA 1UK7A 2A0KA 3PDJA 4MZXA 1YFZA 4JP2A 1QV6A 5EPUA 5DNUA 1OAAA 4EBFA 3KTAB 3TX2A 2X2EA 2K7ZA 3K6KA 3NI2A 2YRFA 3ENNA 3QIVA 5EERA 3EAFA 3MTBA 1MABA 1ISIA 1Y7HA 2NT3A 4MPDA 1CETA 1X1CA 4MPJA 3E9DA 5BVHB 4JI6B 2PH7A 2L69A 1ZL2A 2YQZA 1XYGA 3ZHXA 5T7BA 3QRWA 2UZAA 5LYYA 5I7OA 3TQTA 1QTNA 4DLWA 4E4RA 3ND7A 3VU8A 4BECA 4QJBA 2I2BA 1DJMA 3R7WA 1SHUX 1XJWA 2VF5X 1DCKA 5CBPA 3S29A 4D3SA 4K40A 4EHLA 5G53C 1IB6A 1P61B 4GVLA 3ELDA 4HO1X 3NWJA 2P9QA 1U1FA 4DMMA 1I7DA 1QB8A 3UT6A 3PJRA 3QVGB 1CEYA 1GSHA 1GPNA 1W0KD 4KUEA 5LMCA 2PR7A 1OBHA 3IXMA 1Q7RA 4L5YA 1I01A 4WOCA 1E3JA 3I09A 3FMOB 3T7TA 3GJ0A 2F67A 2JK1A 3GUUA 4WSOA 3DQZA 2QMUA 1NVDA 1MR3F 1SBQA 3OQVA 4GWGA 2G28A 2W2LD 4D4MA 1IQ0A 4DKJA 1ULSA 1Z36A 4P53A 4KO8A 4OLHA 1KMQA 1I5OA 4Y6RA 3DLBA 1JIXA 3LT5A 1W2HA 3IO3A 1GG2A 2ZE6A 4IHKA 5M2QA 3H05A 1A98A 4CKCB 1Z5OA 3GZTB 3DM9B 2BV3A 3SSNA 1WSDA 3LHFA 4HATA 5EXDA 5KCMA 3SI7A 2P7IA 5K99A 1Y6RA 1OXTA 2VJMA 2YZ7A 4LYFA 4YJ2F 2YXDA 4UXHA 5DBFA 4BO7A 1C9YA 3PEEA 4WN9B 1JTFA 1QE0A 4GXRA 1ZMTA 2QNRA 2H9YA 1T2CA 3M9XA 4HDRB 1KI7A 3TL6A 2G1JA 3AL3A 3F9IA 1X7YB 4WZBB 5CDSA 3O92A 2O8EB 3PX3A 1Z4MA 3ROXA 4MGHA 4OHWA 4G1VA 4HZGA 5FWAA 3TZ6A 3JCZA 5LU9A 3INNA 1NVKA 1BDMA 2HF2A 4AWAA 3PTAA 1DI0A 2BMDA 3OO0A 4Q9NA 5K3OA 2JL1A 3WMWA 1QK3A 3W1VA 1LTKA 3OKAA 3WISA 4E15A 2HEGA 4XE5A 1WCXA 1RZVA 1ZN7A 4MA0A 4BYGA 5JEDA 1LXCA 3KXPA 4FN5A 3C4VA 3R44A 4P83A 1NI4B 4QNNA 5DGCA 3TOCA 5L8VA 1XPOA 5GJBA 5BPFA 1GGNA 1Y80A 3LIIA 1PSZA 3ORHA 4LJ9A 4WJLA 2JG3A 2X7HA 1H8HA 4R7GA 3PITA 5B3KA 4ZVUA 5EYPB 3FROA 1DKUA 3D9QX 3VZRA 5IKPA 1PEYA 1ZWKA 5HJ7A 2NWQA 3G9ZA 4IGEA 1N8KA 1DBQA 2N47A 5ALWA 1N3LA 3R5JA 4OGFA 1E3WB 1IOZA 1VPVA 1KJWA 2XDYA 1DEKA 2WHPA 4IFEA 1MZVA 2HCTA 3KZKA 5E38A 1XHLA 2A78A 4RJKA 3G23A 4W7SA 4LYDA 3IE1A 4DG9A 5FWXA 3AIKA 2DFDA 4C4AA 2GLXA 4QNRA 2IDKA 2ZRPA 3IP9A 1JDJA 4YRSA 4JROA 3PDIB 3I5AA 1GTG1 4H3SA 1GQ2A 4XVQA 5E2BA 5JMPA 3VSBA 3LK6A 4RDIA 2YQ5A 1XFAA 4U9IS 2NU7A 1EBFA 4WTOA 4C4SA 5CB4A 1ULZA 3ZIAA 4MS4B 3P4UA 3W1EA 1Z39A 4CMHA 1ZKMA 4CYMA 1Z2DA 3BE5A 3EMDA 3TEMA 2NVOA 3WO1A 4U3JA 3K2EA 1NZFA 1ZIOA 3MIIA 4DWVA 2ZITA 2X58A 2AZ4A 1U3DA 5J40A 4NRDA 1VA4A 2IDZA 2YHSA 2HRDA 2L0XA 1VSVA 3ESYA 2UZ4A 3G0DA 4AZSA 3S1SA 2GD0A 3VPDA 4E30A 3RYTC 4GR5A 2EKDA 3JD0A 4AMBA 2X3UA 3GEPA 4J43A 4TS9A 3O4GA 5ESRA 1FP4A 2EJUA 4KXNA 4GEKA 2JIDA 5CXQA 1QLJA 3AI7A 5REQB 2CNNA 2J0EA 1Z18A 3E05A 1SCNE 2LW7A 5EHXA 2NW6A 1VMEA 3BXEA 2I7CA 1Q1GA 5IXJA 1TLFA 2G5CA 4WA8A 3UFXA 5A04A 1IWOA 1JALA 2YZKA 4PXYA 1OAOA 2VAWA 2ZAIA 4UQPA 5IYZB 5DNAA 1JI3A 1IQRA 4P93A 5FLKA 1L6IA 1RE1A 4HLQB 4KO3S 2OLKA 4CW7A 1QB7A 4QGGA 1SNYA 2QVCA 3CA8A 1B0AA 4JGIA 3ZN2A 4C4XA 3OECA 3MBIA 1DMRA 1MQSA 4JU9A 4A26A 1HT1E 2WPNA 1P1JA 2Y8EA 3EDQA 1JQ3A 4DIKA 1S8OA 5F98A 3NHYA 1BXRA 2ZYGA 1Z83A 4X8HA 1E6WA 1UDAA 3R6GA 4K03A 2F8TA 2NM0A 2RBGA 4MR7B 3GQBA 3IUJA 2QVZX 3ND9A 3QW2A 3IGFA 5EQDA 1HYHA 1YB1A 5K7SA 4LRSB 1L8LA 2QD5A 1X8KA 5A7GA 2C0CA 3L8HA 3SMVA 3WNZA 2UU9B 4TX1A 4KO2S 1HDEA 4ZU6X 1T9GS 3ENKA 4EFLA 4D43A 1DOHA 4IVPA 1JLKA 4ZOLF 1LY1A 4NE7A 3PRJA 4TXLA 3REFA 3JPYA 3NV7A 4BLQA 4JI3B 4F4CA 1SVNA 4N76A 4TL7A 1KRHA 1ZN8A 4CKZA 1L4EA 4NK5A 3ROEA 4B75A 2O3UA 1T3HA 2OECA 5E1MA 2CLKB 2JGRA 2AUNA 3FWYA 4QBIA 4OF4A 1IN8A 4CM5A 1KI1A 1ZQ1A 3UAYA 3NC1C 1JFFB 1L4HA 4ZHQA 5C8XA 2YV4A 4MA4A 3V1LA 1W36C 3ZWCA 4PHTA 2DUJA 2POCA 3QX9A 2VYVD 1B8PA 4R9RA 3ZHBA 3B36A 1C1DB 3VU0A 2IX3A 3O7WA 4FYPA 1EJBA 1NURA 2XNKA 4GQAA 3NCTA 4LHWA 4AJPA 1KEEB 4B35A 1JA0A 1PS0A 3A1NA 3R2JA 3P2YA 2XAAA 1GNSA 1K88A 2PGDA 3AETB 2XKBA 5G1OA 5C5EA 1F3OA 4QEKA 1HOXA 3O4RA 3T95A 3DWFA 1QF9A 2CLMB 1NLMA 2AKYA 1DE0A 4MCIA 4NJMB 2I80A 3BK1A 4FILA 3S5UA 3QVUA 4J16C 2M6LA 2VYQA 3PVSA 4WCFB 4AJOA 5NULA 3IPXA 2VUHB 2PQ2A 3FMIA 2JBWA 2D4AA 1ODJA 2IPOA 1N7HA 1TZKA 3EVDA 5AJUA 3IJEB 1X86B 2HU8A 2O4CA 3BD6A 1LVUA 3F3SA 3HZHA 3L1UA 3G5AA 5ARBA 1BX0A 5BV8A 5KNBD 1MB0A 2C9OA 3E58A 4E2XA 4ZI2A 3B1WA 3UYKA 5LKAA 4YY3B 3AJEA 1XZ8A 1MO4A 3SEAA 2CYAA 3GEBA 1J90A 3HU3A 4KZPA 1DINA 4DLLA 2WTUA 1IQPA 2VOJA 2H7VA 2EQBA 2WIJA 1KDPA 2ZGVA 4YJ2B 3DTVA 3NHZA 3VU9A 5FL3A 2CCJA 4MQBA 3OHPA 2P2SA 1K7XB 4QSMA 2DWUA 1ZVQA 4HNHA 2XLCA 2ZYVX 3B70A 3DXXA 4EB3A 2FP3A 4DR7B 4EA6A 1TKAA 5ALXA 5DTRA 2DP4E 1TADA 1XZIA 2EAUA 2I4IA 3HKDA 3JQBA 5BSGA 1H2RS 1N9GB 2DHCA 4D82A 4P7FA 5F7XA 2X0FA 2R4TA 3VPGA 4QBGB 2XB2A 5E8RA 3C1TA 4CETA 5J2UF 4U1RA 4DT1A 3DOIA 4WFKA 1FPMA 4WXEA 4TYYA 2CHGA 1D6SA 3TLJA 4KR9A 3U7IA 1BKYA 3PC4A 5DN9A 4RF5A 3U9SA 2W7TA 1T4BA 4RYLA 3WIEA 3ZCUA 4WV3A 5K8TA 4GYJA 4MWBA 4B46A 4D8XA 3K05A 2VK8A 4DIMA 2SICE 3ZBQA 3AEUB 3ICEA 1I1NA 2FRDA 2WTMA 3KQTA 1DPFA 1ODSA 3M6LA 3F1LA 4N7RA 5BP7A 2Q5CA 4RVCA 1E1CA 2VBFA 1EM8B 2G3YA 4YFYA 2B34A 1FYDA 1XDBA 5KAPA 4ZCTA 2FSGA 4AF7A 1EHYA 4F3RA 5DIFA 2PRKA 1U0LA 5F77A 2A5FA 3KT0A 4EDFA 3A3KA 1QUFA 1ONSA 1WD5A 3MJ4A 4NBLA 2NIPA 4PO3X 1IC6A 3BJRA 1XDGA 3EZGA 1GL6A 1U7HA 3RT9A 3HCFA 3RBAA 1FFDA 2Z6QA 2XTZA 4WXPA 2PL5A 2WJPA 3ICOA 4KQEA 2QM3A 2B25A 3P45A 5JSZA 1ZAYA 3NOVA 2GPYA 1YE8A 1DOAA 2B1QA 4BJ5A 3DL7A 4Q9IA 4OLJA 1ONOA 1D07A 3EFOB 5BW5A 1FDIA 5JAIA 3ADBA 5F3DA 4EVQA 5K3SA 4UU0A 4DV4B 2R96A 1QM5A 3C8UA 3TLZA 3F97A 5ITZB 1R5JA 2XMZA 3U37A 4B6SA 3HA3A 5EP2A 4BDTA 4HH1A 2BMWA 1O6BA 3T1YB 5JXHA 3PUIA 2F3UA 3ABOB 1RWNA 2NVWA 2IPMA 2YUTA 1WB9A 2OM6A 5FOXA 3S55A 5IKOA 1EZ1A 4L57A 4RO0A 4BJ1A 4H31A 4DLRA 2X42A 3GNSA 3KQYA 2GCGA 4G67A 2O06A 1U2RA 4LJ6A 5E9QA 4I6GA 1NVXQ 5LB2A 5E2IA 1O6CA 5JANA 1A9XA 5J58A 1KSHA 3BSFA 2BBWA 4CIBA 1QO7A 2Z1NA 2G0NA 1CQJB 1P2GA 2MMCA 1JLLA 1F8YA 4RZHA 5DHRA 1BA2A 4K3UA 1PUXA 5HS6A 4EI2A 1M0SA 3CUVA 2JIBA 4KWTA 3H97A 4QXOA 1Y5NA 2ZJ3A 4XQ0A 2YIMA 3RSQA 3TIGA 1IXKA 1QCDA 2WT4A 3C15C 4J0CA 3ZDQA 5GM2A 2CSUA 2JHAA 1Z22A 4WLFA 4EW3A 4TMKA 2Z2XA 5AKXA 4FYKA 3FY4A 5CFMA 1JGTA 2IHUA 4AZWA 1MIHA 5CFOA 1ZCJA 2WBLC 2Q21A 1PGPA 2ODPA 2QSUA 2VK2A 4CTJA 3DZFA 5AUNB 1AF4A 3E70C 1GCOA 5DP2A 4NH0A 1AUOA 2DFKB 1VPLA 4I99A 3KR0A 5HEKA 2C8JA 5LA6A 3RU3A 3DC2A 2PU7A 5C3UA 2UVDA 2QYOA 5KU7A 4M76B 3TRJA 1EVZA 3IO5A 3S2EA 4NQZA 1K7FB 1JFTA 4XR4A 4RVNA 1XNGA 4QBHA 1G18A 1P2TA 3E6AA 2FSVA 1E5TA 3VBCA 1A95A 1LZLA 4CM9D 2X15A 2X8JB 3K0EA 1TC1A 3FNHA 5JNTA 3C6ZA 2P9HA 1D1TA 1QF7A 2IGBA 3VR6H 3G1WA 3TYXA 1M0EA 3MA0A 1NNEA 1ZGAA 1MB2A 1B0PA 2PKWA 2IVZA 4AW9A 4F3YA 3NANA 3PBKA 2PKCA 3DS8A 3JD2A 1OYWA 2Q50A 4Y1FA 2VQFB 2UUPA 1W581 4D3FA 2V45A 5CTAA 2ZM6B 1JHOA 4AP5A 4WY5A 2YJ4A 1XN4A 2IYNA 4NCAA 4F38A 4J0EA 5ICFA 3IEMA 4LXTA 5B55A 1HYGA 4RL6A 3SAJA 3VKHA 5KQPA 1U0HC 5CH3A 4AZ0A 1PL8A 4OUKX 2HXYA 4J6FA 4O2AA 1PQPA 3UG6A 4DY4A 4N8SA 2NP6A 3RTBA 3RJTA 3RU7A 4UXIA 1OWMA 1RAFA 3OCJA 1IPHA 2ZSUA 4L7QA 4BGIA 4EGJA 1JEYB 2A4KA 1SVLA 2WICA 4BX0A 4QTXA 2ZIUB 121PA 4XGIA 4O5AA 2GK4A 3KT8A 3ONWA 1E6MA 3GRCA 3UKOA 4Q7QA 5FYQA 1OI2A 1Y3HA 3HVJA 4QUIA 3F3MA 3R4VA 1W4RA 4YGXB 5WRFA 2I4MA 3GLIA 4O4HA 3IR5A 5IM4F 5KC9A 1OA0A 2GXQA 3IOMA 1OBVA 5CNJA 1A72A 3ZHRA 4II3A 3INYA 2GLTA 4KQ1A 1Y9AA 2HBZA 2R44A 3MGCA 2NTVA 3QUSA 4ZVNA 3VNUA 4IQGA 1NATA 3EXG1 3OY7A 1LSSA 3DTYA 2D0PB 3HFSA 4D8WA 5HXAA 5KVCA 4C14A 1C9DB 3OOYA 5LQAA 4IIGA 1ZM9A 2FH5B 4BNGA 2X0JA 3GA0A 2QKYA 5IMBA 3K30A 2ZZKA 3P5SA 5KYVA 5DI9A 1A50B 2XRFA 3C4JA 1GZSA 2BE9A 1KSJA 3FNRA 4IS3A 4YRKA 5CFQA 1UPXA 1E7RA 2VUUA 4HWKA 2QUHA 4RTLA 5IZ4A 4HNVA 2VSXA 1XSEA 4CDNA 4FSHA 3L7NA 3M33A 1C0KA 3LWZA 4FZVA 4JBLA 5KJ1A 1ODCA 1Z3IX 1D1SA 4KI7A 1IN1A 2CNWA 5CBPB 3LUDA 3IULA 4A8TA 4NFYA 5KNDH 4EG7A 3SLKA 4X63A 5E9JA 2EKBA 3PQ5A 2QRPA 3QOFA 1VPWA 1N6LA 2PTHA 2ZSBA 1HDXA 3LUHA 2QTTA 4MX8A 4P2GA 3SCZA 1DAOA 3HCWA 3ZHQA 4XB1A 5KJEA 4Q18A 3CXRA 5EY5B 4XWOA 2Y93A 3UW3A 4Q7KA 3ONDA 3TL2A 2HNKA 2W6PA 3R09A 5IFLA 4IEEA 5K0ZA 4ISBA 2PR2A 3S3TA 2WZDA 4A4DA 3LDAA 1ACLA 4BGUA 1DBWA 1S2NA 1TT5A 3BUSA 3K9FC 1L3IA 1Z62A 3J81k 4MUKA 2Q46A 4IHJF 5DTMA 3GJXC 2O8FA 2IC5A 4HADA 4CEIA 4PHGA 2CFIA 2VJMB 3D81A 1Z6PA 4PYKA 1CG6A 1YU9A 3EGEA 3DKKA 1R0RE 1ST2A 1LLUA 2ZFUA 1B8OA 2Z5GA 4MQ4A 1S9HA 1OH8A 3NM6B 2IZZA 2W2OA 3BWBA 3T1OA 1O89A 1WBBA 1M6VA 1EBUA 1TJPB 5FOUA 5HX7A 1GG8A 2PZAA 3SC4A 4FXOA 4EGAA 1JYSA 4RADA 1SMKA 1WVIA 1II8A 2EFDB 3I73A 4YCDA 2DPHA 3FZGA 3NX4A 2A9JA 4NECA 4WKNA 3ZDRA 4NNJA 2JGIA 3KWLA 4LQLA 1T5DX 4X85A 4CFYA 1Y7IA 5FFFA 3A58B 4ENRA 1R64A 1QZTA 1MBZA 3LM8A 1NZJA 2V54A 5IK2A 4DUGA 4LF6B 1NSFA 2Y77A 1FQWA 3BB3A 5DM2A 5D5QA 3X1XA 3DP9A 2MIIA 3CPHA 2O07A 3NYRA 3QVVA 1XC7A 2EFCB 2PLWA 4ZT3A 3KQPA 1S4QA 4P4NA 4CKWB 3CONA 4QPDA 1HTBA 3WYNA 2ZSHA 3S2ZA 2IH5A 2R7NA 4BBPA 1KA9H 2P79A 1JG6A 2WAOA 3MLEA 3Q7QA 3RRMA 3U7QA 3ANNA 3WOVA 4L4SA 1NW4A 2CVFA 5ILOA 3FTPA 3U7RA 2P1DA 4FD3A 4QLBA 4LEIA 5AOCA 3QLJA 1KZ1A 4HBZA 4YRCA 1VDZA 4E5SA 4V3CA 1KVRA 4FP9A 3KV1A 4NHOA 1E1YA 1QRUA 5TQJA 5L9AA 3MWLA 3C43A 3VHQA 3MWJA 2A30A 5DM60 1M34E 1Q1BA 2UVPB 3OFJA 2A58A 2XGSA 4MYUA 1R0CA 1RJ9B 5GZ6A 2C98A 3C4QA 2BJHA 3D7NA 4P4UA 5KYTA 1NMXA 1FFCA 5C5IA 5I5GA 4PYLA 2YWHA 4NXMB 4FZRA 3L8DA 1J42A 4ZVPA 1N3BA 1KS2A 5BN5A 4Q3LA 3JWHA 4NMMA 4QHYA 5B30A 1I5EA 2AEJA 3F96A 3I76A 4WKCA 3QVOA 5FPSA 1M2GA 3UGJA 4LX8A 2P0YA 4PCVA 5JCZA 4FGJA 1OI7A 2O3RA 4EDHA 4RZSA 3KK0A 3B48A 2GCPA 4DLYA 3E0XA 1OLSA 2ATCA 2IHZA 2O2DA 2OWDA 2RGUA 3IOEA 3KHTA 3LYHA 4HDKA 4JBXA 4CMAA 2ET6A 3PNPA 5ENVA 3H8WA 4UHCA 2QSZA 3BK2A 3L1JA 3RW9A 4G36A 4UREA 3O90A 1G3IA 4IVRA 4CU5A 4ZIRA 3HA2A 4NLLA 2ZIFA 3PF8A 1RMYA 1J0XO 4P7BA 1EA7A 2D59A 1CV2A 1M1ZA 3WNBA 1D2EA 1QIJA 3PGJA 4Q21A 3T4EA 2FA9A 5F21A 3CPEA 3M1LA 4RD0A 3LWBA 3K73O 1I4EB 1WZNA 1WX1A 3AHGA 1QQAA 1JEDA 2XYHA 3DO8A 5EE5B 1DRUA 5EJGA 1JDBB 1Q0QA 3ZWOA 1Q44A 2ZJZA 3WLIA 4LHZA 3D0QA 4FD2A 1DGQA 2GCEA 2DU8A 2O2HA 4DIOA 4OM8A 3AV0B 2R5WA 3GGDA 1GR0A 4PCAA 1XF1A 5K0NA 3MBOA 4ANFA 4EPRA 3QLEA 1RQ2A 1Z2AA 3A9UA 4OYLA 4RQTA 5GM1A 4DBZA 3LKBA 3HJBA 3A70A 4G65A 4AZVA 3LBIA 3E9RA 4DBVO 3K32A 4E94A 4AS1A 3E61A 3D6MA 4OSOA 4TLEA 1ZJ6A 3L6DA 1G21B 4E5DA 3EC2A 3BFPA 2QRJA 1VXOA 2DERA 5SZJA 3EDRA 6LDHA 5DK6A 2HL6A 2DQSA 1O97D 2ZYRA 3RK1A 4CFZA 4CL8A 1K9SA 1EVIA 3I1YA 4FX2A 2QUAA 4GMXA 3ONFA 3LAWA 3TZEA 1Y4ZA 1TJ4A 2H9AA 2OAGA 2DETA 2FE1A 1VB3A 1OREA 2YV5A 4KPGA 3H9JA 3DW3X 2IDMA 3LLMA 2V6FA 4O4IA 4XOIA 3HHPA 4QXMA 4F60A 5C1DA 5DTQA 4PPQA 4JJ6A 1HNZB 5JLJA 5JCXA 2WA2A 5IWCA 5INTA 2WJ6A 1EQ2A 5DSTA 4CM4A 3H2ZA 3KSUA 1HF3A 4F4DA 3V46A 5H8WA 3MLAA 2WSYB 1H69A 1XCBA 4BFXA 2HJ9A 2DPYA 3FWKA 3RBZA 2VNSA 4RIGA 4RTQA 4OHFA 1X87A 3F6YA 4NFLA 4O25A 3U80A 2FN9A 4CKBB 3TH5A 3QFTA 5HQTA 2CN1A 3D02A 3HFRA 2Y1GA 2QLJA 4RMJA 5KREA 4E88A 2GOYA 4PQFA 2CSXA 1W87A 1NBIA 2I54A 4WXHA 1SKYB 2WC1A 4QYIA 5JDIC 3LY5A 2HGZA 4W8HA 1ZMOA 1ONPA 1MDFA 2GM5A 2O48X 1UQTA 2MWMA 3HB7A 3T5CA 4HLUA 3EIFA 4GM0A 1QHEA 3OZBA 4K6MA 2K2QB 4R84A 3O95A 3VV3A 2IOHA 4PZUA 4BO8A 3NBQA 2FXVA 3E1SA 1YHNA 3LUJA 3OM1A 3W3ZB 1U7WA 2RIRA 2XMQA 2YIVX 1ONBA 3DWGA 5IWAB 3M1IA 4QE3A 6PFKA 1QP0A 2OD2A 1T9AA 1UMCA 4OI2A 1Z8DA 3L1VA 2R1VA 4D98A 4PLPA 5FL7D 1I0LA 1ZICA 1PR4A 4AC9A 4IHJB 3EH1A 2XUPA 3PT5A 2QV0A 1WJGA 3IL2A 3RAEC 1FNCA 3R0QA 2QPOA 3STYA 4RHUA 2BZ1A 4C89A 4G81A 4C7JA 3E8MA 1NV8A 2E1PA 2HMAA 1IWPB 3VPCA 3A1WA 2PFGA 4QTUB 3IAS1 1JXMA 3T1QA 3PWKA 4C4RA 3P4YA 1RXIA 4R54A 1Y89A 2Z1MA 3LMKA 2IX9A 3FYUB 3HSKA 2QM7A 1GAXA 4XSVA 5DTJA 1KK3A 2IZ6A 2JBAA 4M0UA 1SPXA 1ZMBA 3AUAA 4RIEA 5DM4A 3LF1A 3DO6A 4NESA 4PG8A 5JS8A 3MD9A 4ZVOA 3ZJUA 4YRRA 2N46A 3UK7A 3GYBA 4YRLA 5AW4A 5FUYA 3I5MA 2DFPA 3GLQA 5FNVA 3KZMA 2F4VB 1EM6A 1RLTA 4IOLA 3S27A 4IDBA 2GF9A 3ZUGA 2ZXUA 1QVZA 1YBFA 1RRMA 3PLNA 4GX2A 1NMSA 4RIIA 4WASA 3WXBA 4FLFA 2C3PA 3W5AA 1V16B 2ZUCA 1A9OA 5EAIA 5F78A 1J2EA 2ZWVA 4YDQA 5AOBA 1E1DA 2DKNA 4TRMA 2IS6A 1FXWA 2RJOA 4B82A 3HVIA 4KGVA 1WEKA 5CLQA 4JCCA 4OBEA 2AFIB 1VM6A 1VE6A 1JIUA 2AXQA 1NJSA 3COSA 1PJ8A 1PG2A 1MLDA 1WXFA 1YKSA 3B1KA 1Z6TA 3W79A 2PGXA 4GPAA 2JLUA 2NGRA 1I24A 1XIVA 2HSZA 3KZ1E 3UV6A 2DC1A 3AFIA 4MSUA 1M7BA 2WJ3A 3ND8A 2J3MA 2HQSA 3FI9A 2QD3A 4D3YA 1YDHA 1TQ2A 3K0FA 5JQGA 5EKTA 4IIEA 1KI8A 4URYR 4YP9A 3GH1A 3ZC3A 4M9XA 4OQFA 5DHUA 2JJ1A 1IZ7A 1SC3A 1TLLA 4TXHA 5IAEA 4AN0A 2UUAB 1HSZA 3RWBA 2AC4A 1R88A 2FLVA 2CNWD 1IZ9A 1KPIA 1YO6A 2B0JA 2YN2A 3O38A 4QOSA 5E7JA 2VXOA 1PJAA 2DFLA 1WDTA 3LHIA 3V5NA 2QLTA 3NC0C 4TSKA 4ND8A 3EAQA 1YRWA 3FYDA 1G16A 5AM4A 2CMFA 2XUKA 4Q9AA 3WLOA 5CITA 2OSVA 2OXCA 3NYIA 3O5AA 4AJ1A 4JA2A 3PA8A 1WHTB 2VHJA 3B3JA 1GAWA 3B6IA 1G8HA 2DT8A 5HBRA 1GA6A 3IEXA 1GEEA 1OI4A 2P4EA 4IUCS 5CDFA 2FP4B 4ZJUA 1CJBA 3PWTA 5EPEA 1N0UA 1E3LA 1IHUA 2IS4A 2I3DA 1XLVA 2SECE 3USZA 2CNOA 3QEAZ 2Q27A 4HGPA 2ATVA 3H83A 3E9QA 3OUTA 4KVAA 1V37A 3GHYA 1T0PA 4V0ME 5CFNA 1UC4B 3O21A 3JWEA 2GPBA 4IJUA 4M0FA 2WF9A 1A9QA 3JVIA 1Y9JA 4IDEA 4DR6B 1MVNA 2A0FA 8ABPA 4TLAA 4HUJA 1N2BA 1E9VA 1JJAA 3EHDA 4Z1OA 2AF4C 5J3JA 2RKOA 3AR4A 3SYMA 4Q1DA 3DLTA 3K94A 1K3TA 1U8ZA 3N87A 1OH7A 4R2KA 3LYUA 2RGYA 4B2LA 1GQSA 2IYEA 2UVQA 1GUFA 4KQIA 4YJ3B 3S2GA 2HCRA 1YQ9A 1E60A 3TVYA 1R0YA 3DTTA 5KKNB 3CEMA 4KXFB 3VAYA 1XXHB 1TIKA 1YR1A 1NRIA 1TMKA 2F8LA 1DHRA 1I3LA 2OV2A 4RXUA 1RYBA 4L4UA 3EDYA 3NKLA 1AS2A 1UKZA 2QT9A 2JVIA 2R2GA 1XCMA 2UAGA 3DNFA 4LI3X 2RB5A 4DUGD 4ZCRA 5IK2D 1U1GA 4EWLA 1ZOIA 5ADHA 1ZGBA 4FFVA 1Z6ZA 2J9FB 2AMLA 3AGPA 2NVBA 3ZHVA 1KMHB 3TWOA 1L5OA 4WW0A 3VV2A 3GFOA 3ILSA 2ZUWA 2X1HA 3FSGA 3P1JA 3MWKA 4ENQA 4B73A 2VHEA 2CJWB 1G2PA 1PEDA 4Q3DA 4DVGA 1XL1A 4V0SA 3D8HA 2KE5A 3PQ7A 3CH7A 2V7TA 4GLFA 4RQAA 4TQ9A 5DI3B 4EI9A 4YCBA 1AN9A 3T5GA 5JJ5A 2VDKB 4ZALA 4O5OA 4CR8A 4P82A 4IXNA 1ISPA 2JFYA 1VI5A 2Z2ZA 1L7DA 3FPEA 2ZOSA 3H1EA 5IEJA 5JO9A 3ZDXB 1BOFA 1L5WA 4QZVA 1U1IA 3NDPA 3WKDA 3FCXA 1NPYA 3A1SA 3HA5A 2QJRA 2GFHA 3QF7A 3HE3A 4TWJA 2BEWB 3TAUA 3UGQA 5AW7A 1FVOA 1PJTA 3BILA 3QSYA 3KCNA 1UBLS 5BSMA 5T67A 3NXKA 2EJWA 1KY2A 3GCDA 2J8ZA 4X5OA 5C51B 4DCVA 1KC3A 1E2LA 5JNSA 1YIDA 3PRKE 4JNCA 1AS0A 1U2PA 4DDTA 3QHAA 221PA 4GZLA 2GMWA 3O4VA 3GLIB 4YPVA 3GP8A 1EFHA 1QZ3A 5I5EA 1LUAA 4NBKA 4EGQA 5KYGA 2AJTA 2OCXA 2DOKA 1XTPA 4JDUA 4KE9A 4G4GA 4UUOA 2GERA 1RRKA 2IITA 4HN2A 1XEWX 4NVRA 1S8AA 1TOAA 1CFJA 1H2EA 3Q88A 2W70A 1QGDA 1WNFA 3HL0A 4JAVC 2R1UA 3D8SA 4UU8A 1RAGA 4EG4A 1J8VA 2JI6A 3EVEA 1EJ2A 1W52X 2DBZA 5IH7A 3D2AA 2X41A 2VLIA 4H0FA 3N76A 3UMRA 1DBVO 3JQDA 1JNXX 1P0PA 2YN0A 1BGXT 4I4TF 4W82A 3UPDA 2OPBA 1SULA 4J7XA 4OTZA 1VI6A 1X7XB 2PZJA 3QXXA 4X8MA 1AH2A 1KDZA 3REQB 3RTGA 1P6XA 5JR3A 1JR2A 1P1RA 2WDPA 1IK6A 5FTMA 4CL3A 4KPUB 3UMSA 2QTBA 1M2WA 4GZ6A 1ENZA 1RZ3A 2Y1LA 3IT3A 2WSIA 4UTPA 2HKIA 3PUVA 3OT1A 3OU7A 3C7CB 1UXKA 2PRIA 4W4TA 3PKJA 2I1LA 3K1JA 1P5JA 4XGKA 2JGFA 1W25A 4YALA 4UJ5A 1I2AA 3D4NA 4Y30A 2BMEA 4TROA 5DM0A 1FZQA 2GEFA 1QO0A 1UKAA 2XMSA 3TTTA 3VR6A 2BR4A 2CL0X 4IMRA 2X2PA 4MLDA 2ATEA 4MRRA 4B6PA 1F60A 3VU3A 1NJ5A 3EASA 4FMBB 2XYPA 4RD1A 2A0XA 3RTCA 7MHTA 1UZNA 1R16A 2MOKA 3K9QO 4NABA 2QPAA 4MW9A 1Z34A 2FN8A 4IEFB 4KOEC 2Y0CA 5EWMB 2ODQA 3DD5A 3SM3A 3TM4A 4M8NE 1MUUA 1RHQA 2VSYA 3KUCA 3AHJA 3ON5A 5CB0A 3LQRA 2RGWA 4BE9A 3LLVA 4IHAA 2CUKA 3WGOA 3D64A 1LPPA 2WYHA 4R41A 1J4AA 1KERA 1WQ1R 3QPBA 3RTDA 3Q8MA 1OX5A 1GR1A 2JFUA 1HFEL 4UNNA 2MCFA 3DFFA 3T9EA 2VZLA 1P60A 4M83A 3ND5A 4YLYA 4QJIA 4G5XA 4UASA 3IQWA 4UE6A 4DV1B 3SK0A 1GTVA 2J3IA 3FH0A 3I58A 3JW8A 4P22A 2QK4A 4KO4S 2Z58A 4L22A 3K0BA 3SZRA 1K8ZB 4FNMA 5F2NA 3RVPA 2E6KA 3QP9A 4N5MA 2XODA 4ZTZB 1YS9A 4N12A 2F3RA 4RQBA 3BFKA 3DAGA 4JOQA 4YBZA 1C4XA 4UUBA 4DILA 4Z49A 3IAM6 4W1QA 1F2DA 3U1BA 1KBZA 1W7AA 3V3KA 5CPFA 1FC0A 4BWYA 4F9FA 3VYVA 4H6PA 3VR2D 2GN6A 1H2YA 3EISA 1GZ6A 4PN3A 4BGDA 5LUAA 2GN2A 2O8CA 4L8WB 4FYIA 1DDIA 2W8BB 2NSDA 2XEXA 4F06A 3L8EA 2RARA 5IAAA 4UTRA 2WK1A 1SU4A 2IZOA 2ZRCA 1F1BA 3ODPA 2VTKA 1ID1A 2IYAA 1V11B 2WJJA 1MDBA 5ALGA 3GVCA 5C7OO 4MHSA 2HMYB 3M6WA 4XIJA 3VZSA 2R11A 4ER6A 1P6QA 2ORED 2QF7A 3MWEA 4Q7LA 1T2DA 2Y4OA 1AQLA 1T9DA 1GITA 1V1RB 2H52A 5JAUA 5BSUA 4DA6A 1LI5A 2HRRA 3DOEA 5ITVA 4EABA 1VJ5A 5FORA 2P9EA 3KJHA 1JJVA 4EY4A 3TTUA 5KNDA 1ZMXA 2WE8A 4EITA 1LK7A 2OILA 1CQIB 3C48A 3WMRA 5IAOA 1RHKA 1T1JA 1GGMA 3S5JA 1I7SB 1Y6GA 2CFTA 4M7WA 1XTZA 1ODTC 4TUYA 4OGWA 4P3NA 3K9HA 1YR3A 3YASA 1TM1E 3IEVA 1QGOA 4FEGA 3EVZA 4LMBA 3RJZA 2I2FA 3AEKB 2Z83A 4XM0A 2NPIA 2W93A 5FBZA 3LECA 2F3SA 2ZJ4A 1O94D 5ER9A 1ISJA 1D6JA 1SKUA 4CUJA 1BC5A 2IGTA 5B53A 3CH5A 2PZFA 1K7YA 1RNLA 4G1UC 5FPTA 1WY7A 3GYGA 1FDUA 5DZSA 5GINE 3OZCA 5J4KA 1Z2CA 1EXVA 1WU8A 1M2VB 4PX2A 4ZYXA 3GL9A 1CQPA 3MT9A 5DHPA 5IDWA 3HEMA 1OA1A 2CXRA 3RDPA 4EB6A 2C2WA 2AJLI 2GD2A 1ULHA 4CMKA 4B48A 3O3MB 1KEVA 4WN3A 2WEKA 4RVOA 4KIFA 3EPJA 2E4UA 3BH6A 4D25A 1U2DC 2JI4A 4K88A 1U4OA 2PT9A 2AN9A 2Q1TA 1OFGA 3ANXA 1JXOA 3GVPA 1AO3A 3IB6A 2QMEA 4LHVA 3MQ4A 5KTKA 2FF5A 5ADUS 2C4VA 3CVUA 4JI7B 2ZB4A 4YMSA 3TS1A 1ZOLA 2JJ1D 3FLEA 4J16A 2DPGA 4ZCIA 3H5IA 4TKLA 5JD6A 2QX8A 4H59A 3KAJA 2COKA 2PKQP 2XRYA 5IT9A 1XGKA 2ZRDA 1L5YA 3L7KA 3RNOA 3E48A 2J59A 2VXCA 3FN4A 1IHOA 1YRHA 3BXGA 4EATA 3PENA 5TEVA 1V95A 4R01A 1RSZA 2FK8A 4IIUA 2WWIA 4JQCA 2PRSA 1TQ8A 4U6NA 5F12A 4C07A 2ODNA 3IFSA 2HWWA 1H0HA 1SXIA 4DQDA 3NHFA 4PZCA 1Z2OX 3UWMA 3P0JA 1WP4A 4L4XA 4ZI5A 5JS7A 4XIGS 1Q17A 1CC1S 1EUDB 1PDWA 1XZQA 2GD6A 1FB5A 3AIOA 3LPDA 2H7CA 4RU1A 2ZYUX 3TAXA 5A4JA 2NT4A 3V6MA 2HK7A 3CMMA 1UM9A 1ZX1A 5SY6A 2ILVA 1H4TA 3LS2A 3F74A 4LAFA 1EFCA 1R6BX 1NVTA 1J0CA 1MD9A 2H06A 3T3EA 1UFOA 1QAQA 4ER0A 4DBLC 3Q0TA 4NY1A 3SHWA 2FPLA 1G8PA 2WYWA 4TVBA 4LMAA 2KYRA 3CRQA 5EFZA 3RVNA 3AU9A 4QXQA 2F8SA 5E4FA 1C3VA 4R05A 1XTVA 4DAEA 3SC2A 3HB4X 3RUPA 2PFKA 2PTGA 4CQNA 3HDHA 1LCIA 3D2CA 4I5DA 3EXFB 3T7JA 4C6HA 3EODA 5KYNA 3KQKA 2Q4BA 3IODA 4LGMA 3LL4A 4DQXA 5MN5A 2HHHB 3QVSA 1DIHA 3G85A 2Q5FA 3OJCA 3R5XA 4AS2A 4B80A 4ZJYA 1LNQA 5FADA 2EJVA 2ZPAA 1Q0UA 3FVWA 2WKRA 4O29A 1KK0A 1Y1PA 4WJZA 5AJWA 4GKAA 2IYVA 3K0AB 5EL0A 1E2JA 3PUZA 3MMZA 2IYPA 1P6UA 1G5HA 4COKA 3B82A 4WACA 1ZC4A 4F1JA 2JJYA 2WJVA 3TCNA 4BQFA 1V9SA 3ZGZA 4RTJA 1UIMA 3WYDA 3AOEC 4DMGA 3H5TA 1OBOA 3EB9A 3FSGD 5JARA 2HA7A 1F9AA 3LFUA 4LRTB 4NBNA 3I1JA 5DHAA 1G8FA 1GZHB 1HKUA 1PSDA 1PT5A 3ZY6A 3SDSA 2QN3A 1Q91A 2DUUA 1N5OX 3F9CA 1IXYA 1Z5ZA 1JP7A 4IIYA 1WCIA 1ZUHA 3DWEX 4IMPA 4N3CA 5ALVA 1IBSA 1U9JA 5DX0A 3WLRA 3IBGA 2XGGA 3I9OA 3M1YA 3K1TA 4IUYA 2QN8A 4WESB 5T5QA 1GIAA 3IEIA 1MF7A 3EXHB 4XCQA 3FPBA 4ESVA 1YKGA 3B3AA 4PZYA 4KXXA 2VRWA 5A6SA 3K70D 2C88A 1JJIA 1NNI1 1JRLA 4LKRA 1UADA 1YRYE 2ERXA 4MUMA 1JKMA 5FA5A 2G8NA 2YCLA 4Q7MB 3GGSA 4JP1A 3ILXA 4M6WB 4YAIA 2OA0A 3HACA 1UXOA 1QE3A 4BKUA 3IPLA 4BNKA 2IXEA 3HS3A 5JFTA 2BFCA 1CUAA 2P6OA 2P8SA 4EMUA 5DLPA 1B2RA 4QDUA 2JFGA 2IYYA 4X3OA 3OO1A 1E0KA 3HBFA 2JLSA 1AM4D 1CZNA 2WUEA 3KBOA 2PWAA 1KORA 3IP1A 3W6UA 1VP3A 1XAJA 4JFAA 4YAEA 2VJAA 4RHXA 3SM9A 3BHNA 2GPTA 3TXAA 1SZCA 3EXEB 4H1WA 5FD8A 3HFJA 2LDBA 1QVRA 3SR3A 3TQQA 4AKGA 5FV7A 4EY6A 4PYRA 2KX7A 4BRSA 5EIAA 3EBLA 1W5TA 2ONJA 2ORWA 1GQYA 3UMYA 1LJLA 1XMOB 2FZ5A 1FDSA 1E9SA 4MUNA 3RT1A 2H11A 1G55A 3R5HA 1FDTA 3AQIA 2IW1A 1G8GA 3KOWA 3QG5A 2B9EA 2IKSA 1I1QB 2VJDA 2YXBA 3KKKA 1Z0KA 3WHKA 1G2IA 3D6AA 5CX1A 4XWYA 1ZGCA 4OK5A 1UBNA 4TN5A 2Q5OA 3CNOA 2GZDA 4B31A 2Q2QA 1GRVA 4QFDA 1TI7A 1TYAE 2BFBA 3N59A 3BE6A 3NIGB 3BTVA 4H15A 1IG0A 3JSAA 3D3JA 3ECAA 4UBNA 2AX4A 5ILGA 2OG1A 4ED9A 3OMWA 2JLVA 1QYCA 4IM7A 3U3OA 1U9ZA 4MJXA 1O54A 4PG5A 5BN4A 3OE5A 4NCHA 5ISMA 1AXEA 2E4WA 3NKVA 1W30A 3LNCA 3NVAA 3C16C 4IRXA 3KLPX 4B3MB 4I14A 1A76A 2NPOA 4KHZA 4FNOA 4ZQGA 5BRNA 4KITB 5B36A 1VG9B 4ZQHA 4DFDA 2CFRA 4LOKA 2ZVJA 2QG6A 1YA4A 4YRFA 4AUEA 2E5FA 5GJWC 3QOXA 1N33B 1GDHA 1Z68A 3DDZX 2B8TA 3GXBA 4OBWA 5TX7A 2L18A 4EPTA 1IBKB 3QY0A 1B16A 1YZNA 3KB2A 1M66A 1PJ3A 2QY9A 1HL3A 4C06A 2G07A 5ESDA 4AJKA 1RXYA 1T6YA 3M5DA 4DA4A 2NPFA 3WB0A 1OAKA 1VHQA 2CEAA 2DR0A 2O7NA 2DULA 2QMOA 3L41A 2X2OA 3SX4A 3IUSA 3OBBA 1NW7A 3DMHA 2YBEA 4TN1A 3BL5A 2YC2C 1G64A 2P69A 5DLEA 5MFPA 2FPGA 2QOEA 2NU8A 2H1WA 5ECGC 4Z6KA 3RIMA 4AN1A 1QHIA 4WQMA 4XJSA 1SXGA 4C01A 3WNCA 3GLHA 1T3GA 2O8VA 4PPYA 2V7QA 2OBLA 3K5WA 4QGFA 3UMMA 5JD3A 4GZMA 4QUBA 3SQOA 5HJ2A 4XD7D 3F2IA 4ARZB 3EVNA 1XU7A 5ALZA 4C43A 2YHIB 4DMCA 4URZR 4XARA 3MD0A 4BFTA 5L51A 4KRXA 2DTDA 4IDGA 4OQQA 5JY6A 1U7TA 3TNJA 1VMIA 3T94A 1EDOA 3UJ3X 4MPRA 4NONA 3NIFB 3MCVA 4AL4A 1SURA 1H0RA 5ILQA 5FAKA 1Q12A 1TJNA 1ZCAA 1VPDA 4XI9A 3THSA 2A59A 3OQIA 4RWEA 3NOOA 4DCGA 2CYBA 2E4VA 2BKAA 2Q1XA 3EMKA 5I9BA 3JQ7B 3W5DA 4CT4B 2ZU0C 1NF2A 2X8WA 4RACA 5TGTA 3TRDA 3P9XA 1Z47A 2XVXA 3RQSA 1EHIA 1UOQA 2AKEA 5IP5A 1ZNXA 5JU6A 3K70B 4N40A 4QU8A 2BHLA 1Y8RA 4HXEB 4CMGA 3D54D 3A10A 5L3SB 1P5RA 1Z73A 5KNDD 2MSLA 1TJYA 2F1HA 2VBCA 3MHTA 2G67A 1G8YA 2VTVA 1JKJB 1P7VA 1MAWA 2IQIA 5AOAA 5J2UA 3CGWA 3CJQA 3C3YA 2AOUA 3NHAA 3T1TA 4V3BA 2JGMA 9ABPA 1JHDA 5DSZA 4F7DA 3KNZA 4OP2A 4UVIA 5MN6A 4LXUA 3ETGA 4FIDA 3Q2OA 2HPVA 1Z82A 4N5HX 1UT8A 5F52A 4IY1A 4CKEA 2AMYA 1RRCA 3SEZA 2NNWB 2WMNB 4BO6A 1M1YE 1PK7A 4LVNA 3IB3A 1T36A 3HABA 3TKYA 2FOXA 3FVQA 1XCLA 4KH0A 4EA7A 1PZFA 1CJVC 1MMFB 1UBRS 1T0BA 4JT8A 3G5UA 2VTDA 3MCZA 4PAWA 3V7NA 4TLBA 1COWA 3WGUA 1ZJJA 2X1LA 3P9QA 5GVSA 4NBRA 2O5CA 2I9PA 3FYSA 3Q3JB 3FF1A 4XTCS 4DB4A 1CJUC 1RIFA 2VJNA 5A7FA 3QV2A 4YHHB 4OLAA 5J4LA 5KVVA 1PLLA 3TUZC 4D56A 3SVZA 3PXUA 1KDTA 1ZCBA 4L07A 4AYXA 3AEQB 1M5TA 2D1QA 2WRZA 3F2VA 3HWX1 2AN3A 2C84A 1YASA 4PC3A 3IUQA 4P84A 4V24A 1Y4DE 2GCIA 1G5RA 1RI1A 4QOHA 3JWPA 4BLWA 1Z4KA 2SKDA 4H7IA 4KL8S 3L3BA 2VVTA 2F1RA 4JLAA 2EIHA 4OIFA 2NQ2C 4PSAA 1OUMA 3U3KA 1CP2A 2JFXA 2WVAA 3U4CA 5THKA 4CQJA 3OLCX 3DMDA 2GBLC 3CZPA 3WLQA 5BYJA 3JQ9C 1L2TA 4HMOA 1Z0AA 4BL5A 1H4QA 1G3UA 1GGJA 1LPOA 5LMZA 1WMDA 4HXGA 2DUMA 3F78A 3W7BA 1EFPB 1NMEA 5JWOA 1KI9A 2ZCUA 5AXBA 2CNKA 2QRLA 2A2ZA 1TU4A 1NV9A 1QMPA 3MTJA 3I52A 5B2ZA 2RD2A 1Y82A 2GHRA 1XI2A 2P6PA 4EGSA 4ZEMA 1JTVA 1URPA 2GAAA 1NVFA 1IRIA 1XA4A 3EN0A 4HN4B 1QRTA 1CJCA 1E2HA 4LF9B 4IJMA 4HPWA 4AI6A 4HKTA 3KJQA 4IRUB 3QENA 3D8UA 1NBMA 3IAHA 3RF6A 4YRIA 3G6WA 3WGVA 3BMOB 4F6RA 3ZKAA 1CS4C 1TPZA 5BSFA 1V26A 1IUOA 4GMGA 2ZSFA 4Y67A 5CK5A 1A3CA 5JV5A 3ET4A 1RMQA 1K66A 5LFAA 1QTRA 4GWLA 3BMQA 3FUWA 5FTWA 1X80A 2YBDA 3BD9A 4D9HA 3O8QA 2DBYA 3DBHA 3DH0A 2HREA 4NEGA 2NUAB 3I9JA 3MJSA 2OBXA 2A1UA 4D81A 5CEFA 5HZKA 3PR1A 1P7ZA 1A04A 1CZOA 1PHPA 3H8JA 1CUVA 5K8CA 2HTEA 1E89A 2WJ4A 3EPLA 3D3QA 2V0GA 3AVUA 4ZQFA 4NARA 3EF0A 1FBTA 2Q07A 2G9UA 4RPHA 5CT6A 4UUPA 3WMFA 5EKSA 2PKQO 1ZFNA 2FRVA 1LF0A 4P3KA 3S40A 3K6SA 1KFBB 3GT0A 4Y0NA 3L0ZA 4MIKA 3SJZA 3NBFA 3CF0A 3KLBA 3TSCA 4BMNA 1AO0A 2UV8A 4Q34A 2A9PA 3HO6A 2EKPA 3QM1A 4G5QA 1PP4A 4KR0A 4BNDB 3WBJA 1HRKA 5A5VA 1D2AA 1Z29A 4MV5A 1U7PA 2PUHA 4CNQA 5JS1A 1J2YA 3LI2A 3M6VA 1X9IA 4OFXA 3ZDYB 2YZ2A 4PR3A 4JI2B 3OQMA 3KC2A 2G1PA 2VCHA 1HY3A 2E85A 4JP5A 4J0JA 1E2PA 1JR3E 4HGYA 2ECQA 2ZBEA 5H59A 1HURA 2H1SA 3HR8A 2MYTA 5L7TA 3UATA 3OZWA 1XMIA 3DUFB 4ITUA 3INGA 2FPIB 3NBMA 2EATA 1WZIA 3JQ6A 1YWGO 5A1TA 5C53B 3TW0A 4BNNA 4DMHA 3T0FA 4MS1B 1H0KA 2GFQA 2WILA 1JBEA 1EFRA 2X0RA 3DB2A 4POAA 3BXHA 4NYJR 2NXCA 2BCGY 3PSAA 3JR7A 3GAZA 5SYNA 2QJFA 4MOWA 4DEXA 4ZZ1A 4BWFB 1CR6A 5DKFA 1Q11A 1XD2B 3UJAA 2LCQA 3ENZA 3M7IA 2H18A 4MV6A 3VDXA 5K3BA 4LPSA 4UDYX 1IIRA 3EMVA 2LPMA 4H3HB 1W6UA 4MDFA 1SOVA 5HE8A 3RROA 4CLRA 1ULAA 4IJWA 4CHTA 1OWOA 2WWGA 4URXR 5HQ3A 2PD4A 2JC3A 4LG1A 5ETJA 3ECSA 4NYMQ 1N6NA 1ZUD1 1C3JA 1LRKA 2OXRA 2AEEA 2A9QA 1IXZA 1M1UA 5HKAA 1ZIYA 1H9CA 1E9EA 2JARA 5LP1A 4W5WA 4J91A 3A6LA 4X65B 2ZPUA 4AJIA 3L8MA 1WOMA 3MCUA 2Q3BA 4TZ6A 2W2TA 5CTJA 1YDGA 4PTYA 2AG6A 4X97A 2AE1A 1OLXA 2JHGA 2ODWA 3II6X 4GBMA 3TGPA 2P9ZA 16PKA 4GNRA 4CRWB 4NE2A 3QQ5A 1IUNA 4PZPA 4FUQA 3VHLB 4BZWA 5JDIA 3ZDAA 1XAIA 1LQUA 3E35A 1AMUA 2H3HA 1Z5WA 3EVAA 1U8CB 2JZNA 3DR5A 4KV7A 2BT4A 4BUZA 3KOZA 5TPZA 1TIBA 4JXXA 5E1DA 1CERA 1D8TA 2IV7A 3NP9A 2IEAA 4GIBA 1C1YA 1FTQA 1JW9B 2XUFA 3DEIA 4MP3A 3P0HA 4IILA 4QTZA 1Y1RA 1ZBDA 1QK4A 4DXAA 3T99A 2WNSA 4OJQA 4BJHB 2JATA 1DCMA 2Z8XA 1Q3KA 2CHQA 2WZCA 3MEQA 1SCDA 3OQHA 1PEKE 5AVOA 4DEYA 5JMWA 3X1KA 1DKQA 5TJ9A 4CI0B 2VPIA 3R9XB 2X6QA 4MR9A 1RHRA 3NHRA 2XXAB 1K0FA 3ZS8A 2XYRA 1LPAB 4I8IA 1KQ3A 3DF7A 2D0OB 1HPLA 4ML3A 3VDRA 2UZ0A 1JH9A 1EP2B 4KNYA 5KSWB 1M8FA 2FZKA 3M4YA 4ITRC 1U2GC 4JLPA 4NYIQ 3WGTA 2M6KA 2ISQA 3B2EA 1A4RA 4YLGA 1L4NA 3K1YA 4C0QC 3H65A 1NIPA 4MVJF 2Q5QA 2QAGC 2FZEA 1HSOA 2O5RA 2V8BA 4RVGA 3ZW8A 1M6HA 4K2AA 4HJRA 3UMJA 4GRDA 3WRVA 1B6TA 5U9CA 3THRA 3NIWA 3EEYA 1GN9A 4GBJA 1ZD4A 4PQRA 5CDGA 3QWIA 4PZDA 1XMQB 1XVLA 4IFTA 4E4TA 1WXQA 4NPAA 3UUGA 3NMUF 1CUYA 1I4TD 2GBPA 5IDVA 3PXEA 1M8PA 2XKAA 4C0XA 1MH1A 3U5TA 1PYOA 2C9ZA 3D6UA 5G3YA 1J21A 3M9WA 2DUWA 1LDBA 4CGZA 4UVEA 5FBKA 3DL2A 2B2XA 3PXXA 3N2GA 4YPOA 1FLVA 3L93A 3K2IA 1JHAA 4LV8B 4U39A 2I7VA 1XWWA 2H8GA 3JYLA 3I34X 2AQIA 1EINA 1ZI9A 4KXLA 2FMXA 5DGIA 4YV0A 2WFLB 4RENA 1OIXA 1P5ZB 2RHOA 3Q8KA 2JJ8A 5ENDA 1LLQA 2NV6A 3P9RA 4LYGA 5JSUA 4I4NA 1VSQA 2PRJA 1RM0A 1P4RA 3LLSA 3OEHD 4B43A 5MGBA 2DX7A 2NU6B 2SCUA 3W8NA 4E1AA 4O6VA 2ANCA 2C29D 3K8ZA 3SF8B 5A02A 3E8SA 1NJ8A 1TB4A 1Z3CA 2QRKA 2VP0A 3MNFA 1C81A 2VWQA 5HF8A 2Z0MA 5D6OA 5KPJA 1KGSA 2XQVA 1M7GA 5IKXA 4BU1A 1S89A 4NYIR 2DBQA 5ALNA 1JG2A 1UMBA 4MR8A 5LLDA 1QHXA 1QP4A 3LTEA 3VOBA 2HPZA 2PBFA 4OL0A 5CG2A 1KNXA 2DH6A 4DR2B 3H84A 2YVAA 4FYMA 1TKCA 2EFYA 3KYCB 1G3MA 1NVVQ 3PC8C 4PNZA 4X3CA 3A2MA 2O52A 5COQA 3WWCA 2J31A 3MXTA 4EX7A 5KTNA 3SQXA 1RAAA 3EUFA 4R1MA 4RA9B 1AZTA 1RADA 2OEPA 3UWSA 5LOVF 3H5WA 1RLUA 2CXSA 3T1VA 3A6KA 2X5XA 4QJ3A 3U56A 4G0VA 3JY6A 3VX3A 5JLAA 5L3QB 1JAXA 1RHJA 2XZPA 4CQMD 1GPH1 1RM3A 2VSNA 4KK3A 3TPZA 3W4JA 1P9WA 1TYDE 4B2IA 6NULA 5K3DA 4X7BA 3OX1A 4ZYYA 4AQYB 3P2OA 2FZGA 4LFCB 4DV3B 4TL8A 3E7DA 3KVOA 3F8WA 2IQ5A 4FS8A 5GV7A 2C1ZA 3U61B 1I1HA 4CEHA 4W1SA 1XTUA 5HTOA 3GW8A 1FY2A 4G0PA 4HPXB 4EUFA 3SBOA 4DF3A 3RCBA 1VQ1A 1COWD 4J3FA 3KKLA 1VXRA 1FRNA 1ZRHA 1JPUA 3IBSA 4OGGA 3W1WA 4XVUA 4F9GA 4O2BF 4J2OA 5IASA 4I50A 1LNSA 4OXKA 1WUJS 4F2PA 3ILVA 3KOYA 3KFLA 4R1UA 3AB3A 4TZKA 5K4AA 5TQ0B 3KELA 4QTTB 2BOVA 4K86A 2H9IA 1TYEB 1KJJA 1SK9A 1MJGM 1M3SA 3A2KA 5C7LO 2JFNA 1AKQA 3WTCA 2ZR7A 2IIBA 5A0FA 2YV3A 4LF5B 4WCVA 2QUBA 4LI0A 5AW2A 1YQDA 4NENA 2D00A 4W1PA 4A6EA 5GGXA 4HUQA 2JFHA 4J07A 1PZXA 2GTIA 1EQAA 1TRKA 2OBNA 2Q6LA 2ZAYA 3D8RA 1AV6A 4YR7A 4F2HA 3FVTA 4X54A 2ZUBA 5A5EA 3WQQA 4U6SA 2CHUA 2C95A 1JIQA 1S2IA 3DMTC 3HUEA 5DM70 4W8GA 3U4QB 4EYSA 4OYHA 2ES4A 4P32A 3U4DA 2EG9A 3KHUA 3FHCB 4PSVA 1KH3A 2AT1A