1NW4A

Crystal structure of plasmodium falciparum purine nucleoside phosphorylase in complex with immh and sulfate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
243
Chain Sequence
b'NLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATKYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uridine phosphorylase, putative
publication title Plasmodium falciparum Purine Nucleoside Phosphorylase: CRYSTAL STRUCTURES, IMMUCILLIN INHIBITORS, AND DUAL CATALYTIC FUNCTION.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 85
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nw4A00
3K8QA 1JDTA 2PGAA 1U1FA 4TYMA 1Y6QA 1PR6A 2QDKA 4TXJA 1YRYE 1Z5PA 4D98A 1JDVA 2A0XA 3IEXA 1PR2A 4QEZA 4TTJA 1ULBA 2HSWA 3UAVA 5EUBA 4G89A 2IQ5A 1RXUA 2A0WA 1PBNA 3TL6A 3DF9A 5IFKA 3FAZA 4WKNA 3DPSA 4UC0A 1NW4A 1PK9A 3OZBA 2OC9A 4YMLA 2HN9A 4OGKA 2AI2A 2B94A 2AC7A 2OXFA 1TCUA 4TXHA 5F76A 1Z35A 4OF4A 5JPCA 1LVUA 2I8AA 1TCVA 3GB9A 3E9RA 3FNQA 3KVYA 4L5AA 4U2KA 4WKBA 4D8VA 1V45E 4D8XA 3E9ZA 1U1CA 4GMHA 4F1WA 1Z33A 1Z5NA 3KU4A 4YNBA 1TGVA 1Z38A 4MARA 5EPUA 3PNSA 3IOMA 4DARA 1ODIA 3DDOA 1PR5A 1YQQA 4TXLA 3PHCA 2OC4A 5K1ZA 3K8OE 1Z36A 5B7NA 4F2PA 4H1TA 3KVRA 1U1EA 1PR0A 5F7OA 4YJKA 1ECPA 1Y1QA 1K9SA 3QPBA 1FXUA 4R2WA 1G2OA 4EARA 4X24A 1VHWA 3BSFA 4K6OA 4GKAA 3MB8A 3NBQA 2RJ3A 5C80A 1LX7A 1YBFA 3BGSA 4LDNA 1JP7A 3OF3A 3SCZA 1RSZA 1SJ9A 3FUCA 4TS9A 3DP9A 2QTGA 4PR3A 1OTYA 1PF7E 4TXMA 3LBAA 1RXCA 2A8YA 2HRDA 1K27A 1YQUA 1JYSA 1RCTE 1V3QE 3LA8A 2AI3A 3FB1A 4OJTA 3UAZA 1RYZA 1T8SA 3F8WA 1M73E 4MCIA 4JOSA 1VHJA 4F3KA 1C3XA 1VMKA 3O4VA 4I2VA 4JWTA 3INYA 4KN5A 4TTAA 3OZEA 1NC1A 1V48A 1Q1GA 3KVVA 1ODKA 4EB8A 1A9TA 4LKRA 3FWPA 1B8OA 3BJEA 4GLJA 3EEIA 4NY1A 3DJFA 4LNHA 4F3CA 2QSUA 1T8WA 4QAQA 1PKEA 1JDUA 4QASA 3FOWA 1SD2A 1Z34A 1LV8A 1ZL2A 4FFSA 1NC3A 1OTXA 1CB0A 1RR6A 3P0EA 3UAYA 1QE5A 3PHBE 4R31A 1Y1TA 3EMVA 4YO8A 4PNPA 4DA6A 5FAKA 1RXSA 4L5YA 4OEHA 4QATA 3NM4A 4NS1A 3LGSA 3OZDA 4WKPA 3EUEA 4DANA 3T94A 3UAWA 4JP5A 1TD1A 5EFOA 5CYFA 3OOHA 3ONVA 1ZOSA 4OGLA 1N3IA 4DA8A 2AI1A 1CG6A 4M3NA 1PK7A 1OU4A 3KUKA 1VFNA 4M1EA 4IP0A 1ODLA 5B7GA 3ODGA 4BN0A 4ECEA 4L6IA 4DA0A 4BMXA 3OCCA 4TXNA 4DA7A 1Y1RA 5CCDA 1Z37A 1JPVA 5I3CA 1YR3A 4DAEA 3OZCA 4WKOA 1OVGA 5F7XA 1JDZA 1ODJA 3U40A 2Q7OE 1A9RA 3MMSA 4QFBA 4F2WA 2OECA 4L5CA 2ISCA 1JE0A 1A9PA 3D1VA 1PWYE 1U1DA 1I80A 1XE3A 4D8YA 4MCHA 4GLFA 1B8NA 5IU6A 1A9QA 2XRFA 1OV6A 4QARA 4D9HA 2I4TA 1V2HE 3GGSA 3EUFA 1SQ6A 1Y6RA 3PNPA 5ETJA 4WKCA 3UT6A 1A9SA 1RXYA 1K3FA 1ULAA 3NM6B 4G41A 4TTIA 4NSNA 3E0QA 2ON6A 3UAXA 1JE1A 4BMYA 1V41E 3OPVA 1TGYA 3C74A 4RJ2A 1Z5OA 1T0UA 5KB3A 5CXSA 1OUMA 1Y1SA 2QTTA 3O6VA 1RT9A 2GUWA 1JDSA 1U1GA 5F77A 5CCEA 4LZWA 2BSXA 4DABA 3P0FA 1SD1A 3ENZA 3OOEA 1PW7A 5DK6A 4DAOA 4G8JA 5B7QA 5F73A 1Z39A 5F7JA 5CYGA 4L0MA 2A0YA 3KHSA 3NM5A 1RFGE 2QPLA 1PR4A 5F78A 5B7PA 1WTAA 4OY3A 4LNAA 2H8GA 1T8RA 4E1VA 2P4SA 4R2XA 4P54A 2HWUA 4M7WA 3BL6A 4BMZA 1A69A 1T8YA 5CXQA 5F7ZA 1A9OA 4TS3A 1PR1A 1V4NA
chains in the Genus database with same CATH superfamily
5JS6A 3AONB 1QTNA 5GAJA 4XB6B 5F2KA 2G1PA 2J7KA 4TYMA 2BF7A 2DUNA 3UXHA 4AY5A 5L6MB 3CVWA 2NYAA 3GIDA 4FJ2A 1DTEA 2GEVA 3IHTA 4O4IF 1A9ZA 5LVAA 2ZBDA 1MZVA 2IXDA 4JVMA 4TXJA 1TKAA 4DPMA 3CWQA 1WV0A 4JLMA 1JI0A 2ZB3A 1LBTA 3Q87B 4X54A 1XRMA 2AEJA 4FI3C 1FW8A 2CZGA 2WPNA 4JROA 4U5QA 4Y6SA 3BG5A 2N1BA 3S0JA 3CNHA 2XWPA 5TT0A 3QUQA 2ZTSA 3KUUA 2W2OA 1X1CA 1T0PA 2I7CA 3NZEA 4QHSA 3D59A 4C1NA 5JJCA 2AKAB 4FSXA 4FXPA 3K2IA 1XMOB 2H65A 4KWHA 4INPA 2IQ5A 4N39A 3SHVA 2P2DA 4IDDA 3SSNA 4E11A 4ONEA 2IZ0A 4YCAA 4YJFB 1KA9H 3TH5A 3WLLA 1PR3A 4BO1A 5CA1B 4Z54A 1CNEA 1E2KA 2JGJA 2TMYA 4ARUA 4GG1A 3LZ6A 1AZTA 5BPHA 2K2WA 1ORTA 1V0JA 3FBWA 3PUZA 5IJ9B 3OQ6A 1YRLA 2J9ZB 3ES9A 1M6YA 3OT5A 4FE7A 5ESRA 3O21A 3R7SA 4IJQA 3OM1A 3A9WA 1CVIA 3HHEA 3HZOA 3LNTA 1UDRA 2FDXA 3T7KA 3HXTA 4Y18A 5C1IA 1M76A 1PJBA 4HEA1 2XY4A 3OOYA 1TYAE 1RXIA 2X41A 5B53A 3LX5A 2XYVA 3KCQA 3EQ6A 3CIOA 1NM5C 4Q7MB 3BRSA 3X1DA 3C6XA 5KIAA 1FQKA 5C34B 3SZLA 1P77A 3LW7A 4QPZA 4YPFA 3RBAA 5KYTA 5TVKA 2NUPB 2OHOA 2AHRA 4J6FA 4P5PA 2H9AA 1TCVA 3B6MA 4Y98A 2C5AA 1JEJA 4F8EA 3S29A 5HRCA 3OLWA 3MD9A 5KTNA 2R5FA 1XEWY 3QHAA 3TBKA 1VLQA 1OLXA 2QLFA 1B2LA 1BCSA 1TT5B 4H35A 1B2RA 4LOHA 3VR6A 3QRWA 3D0QA 5B6JA 4C6HA 1ORHA 4JLSA 3FLBA 4MMYB 1NL3A 4DM3A 1KZ1A 3DZGA 2C2YA 1KNQA 1KYVA 2W4MA 3E9ZA 2KPOA 1AUXA 3L6OO 3ACCA 3PX3A 3WBKA 4DGSA 2JAPA 3B53X 2MHCA 1IOWA 4MTLA 4PG8A 4QDOA 4RL6A 2BTEA 1CR6A 2HF2A 2PX3A 2OD2A 4TTVA 3ZGNA 1RMYA 4ZZ0A 1AHIA 3NXSA 4DNFA 3ANLA 3K6SA 2P65A 4ZYYA 1V8OA 4MRAA 2I71A 1RJWA 4JJEA 1JLMA 1K5HA 1YR2A 2LDXA 4TV9F 5TQVA 3LC0A 3K96A 3DYVA 3LY5A 4QVGA 3GXOA 1Q6YA 3LK6A 3DV0B 5M04A 3AEUB 4CF4A 5EY5B 1WZNA 4YRJA 4P3YA 1NW5A 1ENOA 3KZ1E 5GINE 2CMFA 4M8KA 4MARA 2VAMA 3KOWA 3T5BA 2OBBA 2ZT6A 2G76A 4M1YA 4JQOA 3AJDA 2WM8A 3FNIA 4RAQA 1A27A 4QD3A 4N8DA 2WHXA 3UFXB 2E4ZA 3IOEA 3BGOS 5JUWA 1L8AA 1T5OA 1VGQA 2HHLA 2VDNB 3AH8A 3N7AA 4WBNA 1AU9A 1GQOA 4JFRA 4BFTA 4E7PA 2YJNA 4LXIA 4MTCA 2WM3A 1RWQA 3CUVA 4NHEA 4Y1RA 4F5ZA 2ODNA 5FCDA 3AVYA 2Q6VA 2RGGA 1N2OA 4YDQA 3U19A 4PYIA 1JHOA 5KTYA 2I03A 2BPOA 3DPIA 3PQ3A 1M0SA 4J0DA 2YUIA 4BLOA 10MHA 2GBPA 1H9AA 2AOXA 3L1IA 3EHDA 3VO1A 3O92A 4RTSA 4E0BA 1ID8A 4ZEOA 4UOQA 4HDRA 3STHA 1RXVA 4L9RA 1W4LA 3T3DA 3VKUA 3VR6D 2PBZA 3BSWA 3ZGVA 5LLTA 1JEYB 1G8SA 2X7HA 3OSZA 4HATA 3HO8A 3VDNB 1LBHA 1BVUA 4FDTA 4MV0A 4OP2A 2V74B 1MPTA 4BAGA 3RC8A 5THXA 1NUUA 4HBZA 5EXTA 3W5UA 1T2NA 2RK3A 4JLDA 5DZSA 4OD0A 3S2UA 1ZMRA 1K6JA 3CF2A 3IALA 3OM9A 1ZCAA 2V58A 3I6QA 3DEZA 4YX9A 3JPYA 4WL0A 5ITVA 2RCNA 3A0RB 4BFLA 4TQ9A 2ES4A 3G8DA 4LJ5A 4URZR 3KHUA 3UJDA 1GTJ1 2CW5A 2ZAMA 3B9PA 5DHAA 1JHUA 2WFLA 4MVJA 4Z9AA 1JFSA 3OFJA 4Q18A 1M2NA 2ATXA 2OVBA 5LA6A 4YMVA 3EXEA 3FOZA 4MV6A 1M6NA 1R6XA 2JLZA 1NMYA 2F1IA 1J20A 3O31A 5GM2A 2P9QA 4L8YA 2EZUA 2CUTA 2HSDA 1NLZA 2VDUE 2DU8A 3P9ZA 4TXMA 4ALJA 4DTIA 3QJGA 1P81A 1I14A 1BG6A 1R1DA 5HQ3B 4RY8A 1O96A 5KPJA 2PZBA 2R2AA 2Q50A 3DBRA 3KE8A 4JH0A 3ER6A 4P4UA 5ALKA 3VVBA 1Y4UA 1VJRA 1E2JA 1W94A 4YP9A 1MH9A 4X71A 2O8FA 3GZNB 3KBBA 2Z30A 3CLVA 2IUTA 3CRVA 1S5PA 1T3LA 3IPRA 1W7AA 3D54D 5BT9A 3DFIA 1M1ZA 3N7UA 3SFVA 3KLNA 2CDRA 3ICOA 5B2ZA 3V8MA 4A03A 1THZA 3VDRA 4YV7A 4RF4A 1X1QA 3F8WA 4K2HA 2PUJA 3QPAA 2HD4A 3BFKA 5FL3A 1KBQA 1R9MA 2X8BA 5IANA 3GRPA 2IXAA 1I8TA 1J8DA 4MCIA 3UMGA 3QMPA 4JOSA 1MVNA 3WLQA 4MS4A 4BMNA 3ET4A 2JCBA 2LCIA 2ZJ7A 3ZIAA 3M9XA 1OB5A 3IVAA 5HILA 2REXB 5EHIA 4CIVA 2GMWA 5IWCA 1LPNA 4PM4A 5LIRA 2NZUG 3RWMB 4A0HA 1DBQA 3BHMA 4QBIA 1KSHA 2FB9A 2GHIA 3QOYA 4RLHA 3WXBA 3O9VA 3GA7A 2DF8A 3V2UA 3TBHA 4DV4B 4PQFA 1YQ9A 2UUPA 4LKRA 1POXA 1TTQB 4H4EA 4DY4A 5KJFA 1GARA 8ADHA 2FGJA 1ZUIA 3AYZB 2XEXA 1A2QA 4LNHA 2I9KA 4MVJD 3LECA 3FR8A 3LKVA 4MDEA 3AJEA 4M9QA 4DMHA 1HDCA 2BFDA 5H9WA 2GN2A 2Y1DA 4ARVA 1QVVA 3CF4A 3M81A 4Y3UA 2RB5A 2R60A 5EP2A 2C5HA 5HUJA 1V16B 3GOHA 5L6LB 2PT5A 3R4VA 3TLKA 1P29A 4BNNA 3K0FA 4C03A 2HT1A 1W93A 3NHBA 4EH1A 3HCBA 4OIMA 4YI5A 4NJMA 2ZRIA 3ZWBA 1YZUA 1XTRA 1ZUNA 3CNNA 1X94A 3U7JA 4BQPA 3HTXA 2ZK7A 4KNYA 3E3OA 3Q7PA 4KGDA 4NQZA 1JI3A 4PG6A 4NCKA 3V7NA 4BLTA 4BO6A 1CDZA 4LZJA 4C7XA 5C37A 4KAFA 4QQ8A 5IT5A 2VWGA 3QI7A 4RHTA 4QXMA 3NXKA 1OZFA 1AUOA 2PSJA 4TLCA 1TD9A 3DQQA 3OZUA 1Q2XA 4I9HA 4A1FA 3CINA 4OLJA 2GO1A 4M1MA 1JG1A 1O77A 3KQNA 1KAQA 4Y2QA 5BSKA 2XCIA 1EX1A 2CVFA 2A35A 1WS6A 2O6HA 3BSSA 4G4GA 2R6CA 4CMIB 3LT2A 3IVCA 1GQFA 1XU7A 3HVIA 3INNA 3I34X 2LWIA 4M2LA 4OEHA 1XA4A 3WQQA 4E33A 2BGWA 1P3Y1 3F67A 4PBRA 1V43A 1T25A 2FFQA 2PLNA 2RI0A 2ZJAA 3BEOA 3OH8A 4YUYA 3UG6A 3ZIAD 2GD6A 3FYHA 4K8OA 3UAWA 3WHPA 4MINA 5FR2A 3DJYA 5IVKA 5A05A 3VH4A 3W5HA 2X0NA 3HXLA 4H6VA 2Q5EA 1MA0A 3GAMA 3EVDA 4MWBA 4RGQA 4ZQBA 5GONB 1SOMA 3ZI7A 2F9LA 4GLOA 3ZCQA 2YJ5A 1KWKA 2EZ9A 3JSAA 3D81A 4XGRA 4HVLA 3GT3A 1N9KA 1ZITA 2H7XA 4CN9A 4OK5A 3GRKA 1JMVA 1CC1S 1RYYA 5JCOA 1K89A 2CKMA 3D2LA 4R8MA 3RLIA 4QBKA 4DA9A 3PYXA 5ICGA 4MI3A 1R74A 4EHLA 3RRNA 4CDGA 3R76A 3N2KA 2AG8A 1D04A 2XXBA 3HKDB 3NBZC 1PTJA 2KMLA 3P8ZA 4MA0A 4K88A 4BY9E 4TKUA 1NRWA 2GHRA 3ILXA 1F14A 3OEED 5BSVA 1NSYA 3A9SA 1W2HA 4YECA 1SQ5A 5ESXA 2UKDA 2Z1NA 1E6KA 1U0TA 4GRIA 3TD9A 1RQ7A 1VHLA 1M34A 1LJUA 2CL5A 3MYYA 2FLKA 3PNMA 4G5OA 4PNZA 4CLHA 3O47A 4EO7A 1IWOA 1AS3A 1IAVA 1W5EA 4YGXB 3SICE 5EGSA 5ISMA 2PX0A 4J1TC 1WSWA 4N0MA 1UR5A 5KKCA 1JPVA 3G6WA 4ZODA 4JI2B 3IAEA 4RA6A 4WXYB 4XR9A 2ZIVB 3EG5A 4ZJYA 1D5WA 3OU6A 3DMPA 3UMJA 3C7KA 4BNXA 4DDHA 4I1RA 4EITA 1A8SA 1DKNA 3NIGB 5AKJA 1OVGA 4E5DA 2HV8A 2QVCA 4RH0A 2Z4SA 3KB8A 3KXPA 2DLDA 2C59A 4N6NA 3BHIA 4DXHA 5LQJA 2Q7OE 3Q3EA 1I33A 1V1RA 3VR4D 4ETMA 3CWCA 2I3ZA 3OP1A 3IV6A 3IQXA 2YCLA 3NGMA 2A9RA 1AM4D 1DI0A 2VSQA 3EOBI 4N18A 4UDXX 4CU2A 3GLIB 1A9PA 2FOIA 2GBLA 1IZZA 2X7XA 1X7WB 4NMHA 3I9KA 2RH8A 1TMOA 3Q0IA 1YUMA 1KI3A 1SRRA 2WTBA 1RC1A 4RS3A 2FOXA 5F52A 5A9TA 3AERA 5TVGA 5KNCH 3T1YB 3N2GA 4E07A 3NRBA 2CNNA 4BGEA 3GP3A 3PT9A 3LMKA 1KYWA 2AX4A 3CBGA 5GV8A 4DKJA 4B75A 3RADC 1RWWA 1JFFB 2YZNA 4FILA 1FYFA 3WWPA 4MRVA 5J3JA 2X6QA 3TDKA 2R86A 2WKWA 3MJ4A 3IQDB 1BQ3A 4I14A 4LQCA 4PG7A 2ZRGA 1W6RA 4PZEA 5EE3A 1FYVA 3OE1A 2QD5A 3LUPA 1YVPA 1OV6A 4WXPA 4HHEA 4FFMA 3QMVA 1H93A 3NGLA 1N2EA 1C3LA 4UD2A 4EA7A 1GNPA 3UBMA 5ETJA 2MSNA 3BBLA 3A9RA 4R3NA 1KH1A 3F6CA 3LOUA 4R83A 4UREA 5T3UA 5BUCA 3E3NA 1ULAA 2ZT7A 3UWOA 3T4PA 3EZ2A 2BM8A 1HUQA 2J5XA 2W00A 4TSRA 3M2PA 4Z8YA 5TPWB 4NV1A 2FUCA 4NICA 3ZLBA 4TUYB 2JRCA 1J6UA 1KI8A 1SQFA 1X7YA 2O3TA 3UMYA 2GI4A 4K0KB 4A6DA 2EP7A 3RB8A 5CXUA 3ICPA 4AN4A 5ALQA 1OXUA 5JOQA 3C74A 3HDGA 2PJUA 2H4YA 4PVDA 3S1LA 1N6PA 1ZOIA 3M34A 5IKMA 3ASYA 4CQLB 1MHTA 3JS5A 1QIHA 1RYMA 4B85A 3MM4A 3KYIB 1KEEB 1UBTS 1B26A 2B1RA 3H2YA 1Y5NA 2FFHA 2GCIA 3LGAA 3SLKA 4NIMA 2HL6A 2F1JA 3LO8A 4P3OA 1PJAA 4CF7A 4HKTA 3ZKWB 1GDTA 4JA2A 1SIWA 5ELMA 3U4AA 3V97A 4GYKA 5EHXA 1PGPA 1Y1SA 1PGQA 1TLFA 2B2XA 1W36D 4FPXA 1UOEA 2WWYA 3EODA 1WHSB 3EFOA 4JUDX 1IBMB 4B6FA 1V3TA 3FGPA 2PANA 2HA3A 3TQQA 1G55A 4F21A 3JQ9C 1U2DC 3BN3A 1GPH1 1JDSA 5AHWA 4MWEA 5AOCA 5ERXA 4J29A 5JO0A 1T5SA 1WCV1 4L6AA 2NOAA 1SCNE 2IA5A 3THRA 3ADDA 2ZPUA 3GJ6A 1JA1A 3MLEA 3KZCA 3ZD7A 4YJ3F 2IOQA 1PQ4A 4IIJF 2NV0A 1X1DA 3CIFA 3HXQA 2ZJ3A 3WA6A 2F9FA 1F2DA 1E2NA 1LPAB 2M6SA 4AQ7A 1RM3A 1RBQA 1HT2E 4E2FA 3G02A 2REBA 5DK6A 4B6PA 4DAOA 4XLZA 3QX3A 4IRXA 4N41A 4ZEXA 2CC2A 2FG5A 3N8KA 1U11A 3IQGX 1N5RA 4OYRA 4XQ9A 4YT8A 4Z6KA 4TZKA 5KSWB 5CYGA 3HCOA 3QXXA 4OQ4A 2D2EA 4Y2JA 1X80B 7ABPA 1MQAA 3MJHA 2QPLA 1QGYA 3P27A 1NUPA 2GRJA 4A6XA 2IU6A 2VDWA 3FCYA 1A9XB 3PQCA 3RNOA 4QOGA 1SEPA 3GN1A 2R2GA 3RUPA 3N87A 2AJCA 3SXUA 2YY7A 3PF8A 4R9SA 1GSHA 4RVNA 4QJ5A 4OQZA 3MD0A 1KYZA 2P1RA 3EC1A 3HDHA 4E22A 2GVDC 4KPUB 4I6EA 2H2IA 3HADA 3AFHA 4WXRA 1OI3A 4EVRA 2W6JA 2HFJA 2PRYA 3THXB 2IOHA 3W2HA 4Z1MD 1CF2O 1Q1NA 1KEPA 2YINC 3ZGLA 1EINA 1RRVA 3MUOA 4L7QA 2ENWA 2ORWA 3FAKA 2AC4A 3FPHA 2D1YA 3GGJA 1EE9A 3NUZA 3HEAA 1AB5A 3AIIA 1CFZA 1YU9A 3D8BA 3ZVNA 4GLBA 1V11B 1GRQA 1P7WA 2HSWA 2ZYVX 3G17A 3T7RA 2AW3A 2GLXA 2Q0QA 4RPGA 3PPYA 1RP1A 2IY7A 5LLSA 4P32A 2PYIA 1W76A 1Z06A 1ZN7A 1PZFA 1AMUA 1KEUA 4GMFA 2Q2QA 4M99A 4Q4CA 5KAPA 3VSCA 4IFBA 3TIXB 4QT4A 5LMCA 1IN5A 1RMQA 2N47A 4CGYA 5JZVA 2FA9A 1YIOA 2YXBA 2PV7A 4U8GA 4UQPA 5AFSA 1WCYA 3PSAA 1L5ZA 2IHVA 1X77A 2B36A 4GMXA 4MUFA 3EMKA 3CNBA 1MNAA 3U44B 4LF9B 4U7PB 3RC1A 4C2UA 1F9EA 2Q28A 4BMDA 1CUYA 4WRRA 3PCXA 2WHQA 2XMCA 1VM6A 1YONA 3HA3A 2B2CA 3IUPA 4PG5A 1H4TA 5E4JA 3QWBA 3UQZA 5EZ6B 4F60A 3UCEA 4EY8A 3Q8MA 2QMOA 3JAWB 4LF8B 3SSOA 5U1PA 1G5RA 2QG4A 2BHSA 4OQFA 1W581 4XX1A 4ZT5A 3K9BA 5CDYA 1PT7A 1SVUA 3NHMA 4MW4A 4PN3A 5D51S 1OOEA 3X1YA 1Q16A 4MSUA 2W37A 3U7QB 2BYTA 1CUUA 3LUHA 3BC1A 5IC6A 3KQTA 4RNDB 3T99A 5JMTA 1G59A 4RK6A 1HMYA 1QH8B 1XK7A 1ZD5A 2HU7A 4I5FA 4B2PA 3C6BA 3K9HA 4G0MA 1J24A 2V9PA 4R1MA 2ST1A 1KJ8A 2W6JD 3ENKA 4M89A 3L04A 3W3ZB 1UPCA 5CB4F 3RYHB 2ZZNA 2W2TA 3GT7A 1XL1A 1WXHA 4L9WA 2ZWAA 5FTNA 4EHDA 2IKSA 3SC4A 4GMKA 2WKQA 5CVTA 5TQJA 4NBTA 5AESA 3K15A 1I4LD 1ZU4A 2CUKA 2GZ3A 3I3SR 3L7OA 4D8VA 3Q3JB 4P81A 1CP2A 3QU7A 1XCMA 2GSDA 1BU5A 3VC2A 4CG3A 1YULA 4RTMA 3AVUA 5IXJA 1O2DA 4Q9IA 2IWHA 5GY7A 1U3TA 2D0IA 3FMPB 3M5WA 4G36A 3GK3A 1JNXX 4M9ZA 1EFPB 2YZGA 3F97A 2Q1YA 3GUVA 3CVJA 1IVYA 1SKQA 1VJDA 1ZIYA 3JALA 2P2CA 4RXTA 2QXYA 3PDJA 1CT9A 3KAJA 4XWOA 1U7HA 4NX2A 1U80A 2I7TA 4QWWA 5LP6C 2Z4TA 3D3WA 4MH0R 4C0KA 4Z0PA 3CO0S 4YEDA 4ZVRA 3L18A 2NO5A 4NAVA 1EJ2A 2C1XA 1ZM3A 2Q5FA 5G4KB 5CHEA 1FDWA 3KZXA 1HL7A 5AW0A 4A73A 3KYDB 4NMLA 4DG5A 2CLHB 4OVKA 3K1AA 3BZBA 3M6WA 1NQUA 3B3FA 1BAPA 3ORHA 2PGLA 4PW0A 1EP3B 2KW5A 2JGDA 4FFBA 2RHCA 4DJJA 2O7QA 3GVXA 2Y77A 1JFVA 5EMLA 2VHUA 3T9AA 4E2XA 4OM8A 4BV3A 3V8NA 5ICCA 1LW6E 3L0OA 5ALXA 3NONA 4I9FA 2VJKA 1AS0A 3BK7A 3KVRA 3GMDA 4OMCA 1AK2A 2CE2X 4XVHA 1MO5A 3WI7A 3Q7SA 1OW3B 2DUUA 4MKHA 4MYCA 4MRSA 1R50A 5KX5F 1Z88A 3T4XA 4WNCA 3FHCB 2D5IA 2WB4A 1RRFA 2WZCA 2JA1A 3WZMA 4XKJA 4DCTA 5AM3A 5J1SB 4KUGA 2M1ZA 3CNEA 4HRXA 4IV5A 1YMVA 3UYKA 1P5RA 3KC2A 5GQSA 5WRFA 1DJPA 2CFTA 3A3YA 3FOFC 3L7CA 4EFKA 2V8BA 1IK4A 1ADJA 2IX9A 2VXBA 3FNEA 4MULA 4UW9A 1UDAA 2GJKA 3LL7A 4XJXA 5A3VA 3RVJA 3V42A 4H31A 1M74A 3EIHA 5FKJA 2QE7A 2MCFA 3WADA 3OJLA 3ZI4A 4CODB 1QKKA 4HQFA 4BEWA 5FF9A 3FI0A 3HYTA 3P4YA 2HUNA 2RJ3A 1DBWA 2FUG6 1LX7A 5B5SA 2OCBA 1OXBB 5EQJB 2O23A 4HGPA 3PX7A 3B6EA 3H2ZA 1NBHA 1XVIA 2YWJA 3TMKA 2R8OA 1BX1A 5ALZA 5FI1B 1J70A 3AR3A 1EX6A 3S68A 1RSZA 2YZKA 2EJWA 3DZBA 4EUEA 4FFNA 5LYJB 2CN1A 2V6GA 4HAUA 4QQKA 3T1VA 4ZCIA 1RAEA 3OLZA 2ZU6A 4G86A 4CKBA 1ZEMA 1XMPA 5SZIA 4RYDA 4ZCSA 1NJ1A 2WJJA 2OBFA 4ZOLA 4HQLA 1SUSA 1K66A 1D8TA 2X77A 2NXJA 4YBRA 1HH4A 1L4FA 2J30A 5IBQA 1H5NA 3RVDA 3PCTA 3TW8A 3WISA 5ITZB 2AJ8A 1XVTA 1PVDA 1F2TB 4F85A 2WMDA 1K8ZB 1KE1A 4GXRA 5H7XA 2OSBA 2QUAA 4HQ6A 1RC0A 4I8DA 1VE1A 2COUA 4O1HA 4EKEA 1DBPA 3FB1A 4R0VA 1ESNA 2VL7A 1B43A 3K9LA 3K30A 1EDOA 1Z0DA 1Z6QA 2QVBA 3ECAA 3IJEB 4Z9BA 4ZCMA 4JJ8A 3OQ1A 2RIPA 1CS4C 3VNSA 2MSCB 3T5TA 1JTFA 4MP3A 4DFDA 2ZP1A 2PTGA 3WFZA 3I0MA 2VUSA 2JJQA 2XIJA 1VHJA 2WG0A 4PG4A 4W1PA 1N2ZA 3UMSA 2PA0A 5KNBA 4BXOA 3EVCA 3PUWA 3W7VA 3N7TA 2FMUA 4IJMA 4J0EA 1BU8A 3IPXA 4JJFA 4R3UC 3EMBA 4FFVA 4TMVA 3UOGA 2IS1A 1NC1A 1XMQB 6CHYA 1I4OA 4YLEA 3HNOA 4IM7A 2H4JA 1ZSNA 1II9A 1PDWA 4LHZA 4Q6WA 2QE7D 2WWFA 1U0EA 2OP0A 4Z9FA 3VC7A 1V6CA 1KI6A 2VUUA 3DAYA 3E5MA 3DL0A 2IZ1A 4G4JA 4CKXA 2XWJI 5LQRA 3GLHE 3GJ5A 3SZRA 3V7WA 3ZHYA 3A1WA 3KXKA 3CKKA 3IAM1 4D9KA 1U8CB 2HSEA 4EW2A 1DHTA 1IEXA 2F8LA 2PLAA 4KVGA 1VI2A 1O3YA 5BWLA 1OWLA 2SCUB 2GM4A 1QV7A 3W3AH 2I8CA 3HUTA 4Q3AA 2O19A 1KO8A 4KRGA 3WAJA 4DR2B 4N9WA 1JAZA 3NAGA 1HDYA 5G53C 3BERA 1Y42X 3HCFA 3FRJA 3QPCA 3R7DA 3RC9A 3W1WA 4QTXA 2PL5A 2QI9F 2YHIB 2WWHA 4ZIRB 1L5MA 2DPGA 3AY3A 3E22A 3O4HA 4D9BA 1NI4A 2DKNA 1QH1A 1ZH4A 1IY1A 1QORA 3AR4A 4FBGA 2VJDA 1NYRA 3JQ7B 3GQBA 3BF8A 3KKZA 4QVKA 2BJWA 4UBLA 1X8KA 1C0EA 1VSBA 4CLOB 2ZS9A 3SEZA 4AROA 1PV1A 1SOVA 2MYTA 1U3DA 5KTTA 2B35A 3I4LA 2QJTA 2WYHA 3C98A 1P2GA 5LFAA 4H17A 3GRAA 1CERA 2ONYA 1KC3A 3WXMA 3W5AA 1PJ3A 3R7NA 3UJ9A 4DKXA 4HDMA 4F6LA 3WLOA 1JIUA 3RBXA 1AB6A 4LZLA 4Y2XA 1U4OA 2ISQA 2PKQO 5D5QA 1T1SA 3RS8A 3LWZA 5KNBD 4FYMA 1R0XA 4RCVA 3U3DA 1XKQA 2A59A 3PXBA 2VRCA 5K3FA 5C8XA 1RCUA 2NACA 2O8EB 4US0R 1SGWA 2FZGA 3K0AB 4CKYA 1IBSA 4F4CA 2YNMD 1MIHA 4B46A 3AKZA 1E3EA 4QG7A 4R9UC 2DJIA 4R8VA 1UDCA 4GWGA 2M32A 1OLOA 2B8NA 2FPRA 2HCTA 3DKPA 5I4CA 3STVA 4DLPA 2K2QB 5COQA 3WLTA 3IYLW 2GJSA 5U4QA 2ZJOA 1H4QA 3IC5A 1ZD8A 2ZYAA 3NEAA 5EJ2A 4HSEA 1J2RA 3TL2A 1TA4A 3REFA 1WW8A 4KC0A 5AWFC 2PGIA 4DIFA 1FFBA 4BC1A 4ZQCB 4BQIA 1AS2A 3EQ9A 4WFIA 3V1UA 4ZC1A 2ACVA 1H3EA 2P6OA 3RYCA 1FP2A 4BN0A 4ECEA 1VRVA 4J0FA 1TQHA 1KKLA 4FLEA 4YO7A 5JI2E 3AW8A 2QRUA 5EINA 4Q4JB 3I0NA 4QUJA 2QLNA 4OXNA 4H7JA 4TXNA 1MJHA 1FLDA 4XEHA 1DAPA 5KJEA 3TLXA 4DA7A 1OAOC 3CQ9A 4ES6A 3SR0A 3MTIA 1WUTA 2JAOA 2BELA 3ZCXA 4V0LA 4DWVA 1V95A 3B3AA 3ND8A 3UK1A 5JS8A 4WGGA 3UATA 4PGGA 2A88A 2K7FA 4KP7A 1GKUB 2YZMA 1Z15A 4NONA 5BSEA 1Z5GA 4EHIA 2NV6A 4GIBA 4ALKA 5F7XA 5BO5A 2J0VA 3L4BC 4WBSA 4YQZA 521PA 2VWHA 3S2GA 4BLQA 5JADA 1ESMA 1TEZA 1TK3A 1WR8A 1QKJA 3F74A 5FBHA 3GJSA 2FKNA 3UGTA 4GKJB 2GAFA 3MRTA 2EZ8A 1CZLA 3SAJA 1FJGB 3OD5A 1U2TA 4RVCA 1RZRA 2HK8A 1DOZA 3IDQA 2OM6A 1J8YF 3DO5A 2VRCD 2X1MA 4JL5A 4PONA 3VTZA 2KE5A 4D5GA 5CFLA 5JATA 5LQAA 2VHYA 4RO0A 5A62A 3L1KA 1U1DA 5KZMB 4ZQEA 4XAQA 2J3QA 2ZANA 2V0CA 4M76B 1L5GB 3VH3A 4IGFA 1UPTA 3R7WB 2FFBA 2V4UA 4B9EA 8LDHA 2JIDA 1SN7A 3OJWA 1U7ZA 3KQOA 4RIGA 3PXUA 4ZT4A 3ENWA 4X61A 2HMVA 5FULA 2HU5A 4OQLA 2XCOA 3GLHA 3RCBA 4E12A 5JXIA 3OURA 2NYRA 2Y6VA 3RNLA 4V0SA 2XT6A 2UUOA 2JAXA 2CDNA 2EJCA 4RHXA 3RAJA 2ZQ5A 3V33A 4AU1A 1QO9A 3PNBA 1JH8A 4GICA 1SBTA 2DY0A 3FM9A 4WDQA 1Y6RA 2QRLA 3ZY3A 1VBFA 2VK1A 4JOQA 1DUSA 3KE9A 1GDDA 1A9SA 3BXHA 3G2PA 4ND4A 4OXIA 1RXYA 4U7GA 5K0EA 3O4RA 1DO2A 3QEKA 1GPBA 2V7EA 1ZQ1A 2ZUBA 3I5MA 2OXEA 3E0QA 1XRNA 2ON6A 3QEMB 3T54A 4A2PA 3DVAB 4OHRA 2YQZA 1T6XA 4Q4AA 1T36A 1H65A 4RPJA 1E9DA 3EEBA 4HZUB 4BMYA 1ND6A 3CONA 1C1DB 2NGRA 1DVRA 2R85A 2DVMA 3CZRA 3KIPA 3LQ2A 4HB3A 5DLQC 3WL4A 1CUZA 2NU9A 3WGVA 1A5ZA 4DBZA 1GEEA 1SK8A 3AFOA 3QLTA 4Z3OA 1PS0A 2Z1MA 3GFSA 1DQYA 1KERA 4J1QA 2JCSA 3GGPA 5L95A 1NPTO 3H2BA 4HEA6 3GMTA 4EPVA 2AXQA 2GWRA 1C3OB 2NN3C 4JP2A 1W0JD 2YY6A 5HCIA 1KO5A 3AZPA 5DNEA 2AYYA 4Y2TA 5EPEA 4K9OA 4B7CA 3L7BA 3MGBA 4XM1A 3SVTA 1QGDA 3ABSB 1UIRA 1V39A 1OFUX 2AR9A 2J9XB 4XZ3A 4HWGA 4GSYA 4QG3A 1BC5A 4YIHA 1G8PA 3U49A 1I1NA 2JAHA 3UXMA 4D3SA 1ONSA 3UJ7A 4I9UA 3UV6A 1QVWA 4GXNA 1RZRD 5JE8A 2GGSA 1SD5A 4M0UA 1KEWA 5AI8A 5DBGA 3UOAB 2PU5A 1BO6A 2EFDB 2O8DA 3RHTA 2Q1UA 4GPTA 4EG8A 4EHNA 4EUSA 3DT8A 2D59A 4MUIA 1CY0A 2IS2A 1XZIA 3EASA 2GILA 1FJ2A 2A14A 1FBTA 4D2IA 1ADFA 4U0KA 2C8LA 4WH0A 5KQMA 1R4AA 1CJKC 3K05A 1WA5A 4QNNA 3WICA 1ODTC 2BSQA 2ERYA 2HGZA 2W2KB 4JP1A 3ZZTA 1HFJA 3ZGOA 2QM0A 4Y6RA 5DISB 2PUAA 5JS2A 2Q3CA 3AETA 1EM8B 3EQ2A 1N6KA 4XEUA 3DHVA 1US8A 2A58A 3W4JA 4EKIA 3HBMA 1CR2A 5GZ6A 4YFVA 2ZYRA 3C6YA 3FA2A 3HU5A 5HTOA 3OIDA 2Y93A 3JYHA 4OB6A 1XDBA 5AMXA 1QZTA 3QVSA 4HLUC 2Q6KA 3H97A 1IJBA 3LYUA 2CLEB 4ZGGA 5KYKA 3OCYA 1QHNA 1CUGA 1L7AA 3ITEA 1H3NA 1KDOA 3LPAA 5JCJA 4Z9XA 2Q0XA 3ANXA 6ADHA 1EM6A 2BFNA 2DRIA 4H4DA 3T9CA 1MNQA 1B73A 1P4SA 1ZVJA 2B78A 1T8YA 3MTQA 1SUCA 1ENPA 1UK7A 1G20B 3CW2A 1BROA 2BGRA 3G0DA 4BV9A 4L3OA 4MPTA 4ZALA 1N0WA 1X87A 4YP0A 1YIAA 2CDBA 2WQ7A 3OQJA 4WOPA 3MJFA 1GFZA 1YJ8A 3FD8A 3SNKA 4XSHA 5CDGA 4HNQA 2GDJA 4HVTA 2CVQA 2D1QA 2O48X 2ZYDA 4LC1A 4EMUA 4Q1AA 5HJ5A 4AQYB 3K4QA 4KFRA 1ES9A 5JZMA 3KELA 4EW3A 5TS3A 3M82A 3OFSA 5TIIA 2N75A 5L45A 2RGXA 4M0CA 2WYOA 2FUNB 3LXMA 1E5VA 4RCYA 4F86A 3NHKA 4YXFA 3U16A 1TADA 4CEIB 3K6RA 1M2VA 3ACDA 1XCOA 1J2TA 3PLNA 4ZI7A 3CH4B 1APBA 4YDHB 1H5UA 5HS6A 3EPPA 1E7SA 3ZWNA 4D7AA 1WX1A 4YAIA 2WJ4A 2YMPA 2XYGA 2G09A 2HA5A 2X2EA 3LUKA 5DNVA 3PFIA 5KYVA 2BL4A 2Q29A 3DAHA 4P7FA 1A1VA 5DGDA 3FOAA 2B7BA 4UTXA 1JZSA 1FUYB 2O5VA 2ZCVA 4DGQA 2PKWA 1PJSA 3UMVA 1CF4A 5COAA 1EVJA 5BV0A 1GADO 5K0TA 4LPSA 1J2UA 1DXOA 1WMBA 2H1CA 3FFXA 2IZ7A 2ZRJA 4Q05A 2P11A 3WE7A 1WABA 4QUGA 4UTOA 3TUZC 1K75A 2R8XA 1CQXA 2DFLA 2R5NA 3LKDA 4MAAA 1VRWA 3AW9A 1G18A 2QP9X 2AUMA 3D7KA 4K28A 5EZYF 1TCUA 3ADKA 1X3SA 3IQIX 3CSSA 3MS7A 5HIJA 5JCJD 4YRRA 5JJBA 1L7OA 3CN7A 4JUFA 4N01A 1Q6ZA 4N3BA 5EJ9A 4TKMA 4BKPA 3DMGA 3DD1A 1L3BA 3DZIA 5JPCA 4DV6B 1VE5A 2C9BA 1UFRA 5AK5A 3U4CA 5EE5B 1I01A 1FB5A 1NM5A 2QRVB 4MDHA 5B3AA 3S81A 2J8ZA 2UZ0A 2ECKA 1IUNA 2OK8A 4MB6A 4B71A 1QDLB 4GM0A 1M3SA 3PEWA 2BDEA 2HDWA 1SB8A 2VUHB 4ZTBA 4EUNA 3KQWA 1QRRA 1RIFA 4EF4A 4KXLA 3ZI0A 3LHDA 5IF3A 3ZHVA 4BFCA 3F4LA 1SELA 3JZDA 4YONB 1XKTA 4MGHA 3BXFA 1P61B 1Y5IA 4KHPB 5H3HA 5A02A 1KKMA 2Q9CA 1YB2A 3OX2A 2HCRA 4K0RA 4D99A 4F1WA 5FXMA 4G97A 4PFKA 4AUKA 1XWWA 5FOQA 3O8RA 5JAZA 2ZJBA 5K8VA 1L4EA 3DD5A 4FOLA 4BQRA 3DDHA 2GA9A 4L9AA 1PT8A 3DXFA 1ZVKA 4TTQA 3VZDA 3KBOA 2Q49A 1T15A 2GK6A 2HX1A 2Z2YA 3IBFA 4ZAWA 1AK1A 3L0IB 3RJTA 4U9IS 5IKXA 2HH9A 4NCBA 1FXWA 1MO2A 1LPMA 4KDCA 3CB2A 3ORFA 3DCIA 3QENA 3A11A 3E53A 3OO1A 2SHKA 2ZVPX 1QO7A 9ABPA 2UYGA 2XITA 4NECA 3HE3A 3QVKA 3F6RA 2RCYA 3Q12A 2EKBA 1YQQA 1Z2NX 1G2QA 2QXTA 4UCWA 4OUKX 1VG8A 2AG1A 1OFGA 2O3JA 1ZCBA 5K1ZA 1A8UA 1T0IA 2P67A 4E51A 4FFOA 5A5VA 1YA6A 1ESCA 2SBTA 4JHXA 5COBA 1Y80A 3SVZA 1F1JA 4NFLA 4B79A 4P7GA 1U1EA 1RPJA 3ON5A 2BM1A 3H3JA 4G1BA 1YU6A 2OCPA 4ENVA 5K8LA 3ZYZA 2EWWA 1IUKA 3NQ41 5B37A 5BN3B 2WF7A 4LY0A 2J5BA 1BH6A 1JHZA 2JNWA 1KMHA 2YOFA 2J45A 4LK2A 3GRRA 1OASA 3TGWA 1UFQA 3WK5A 1FXUA 1M8KA 3DYBA 3WLRA 3Q6MA 5A2GA 4KDEA 4MQ5A 3WRXC 2J41A 2BW0A 4ERXA 3TZLA 1HQDA 4D96A 4KWTA 5JALA 5BYJA 3KTAA 3SZGA 2IY8A 5AUQA 4K26A 2K7ZA 1J8VA 1V35A 4B3RB 2A1UA 4J4BA 1UXIA 3RS3A 3PU6A 1UBLS 4OCZA 2NSJA 1VYUA 1ZR4A 3TQHA 1IRIA 1WEHA 4JLBA 3C6ZA 1CPYA 3ZYCA 1QH0A 2YC2C 2NTJA 3LJKA 3Q7TA 5K3SA 4EECA 3VR0A 4ENTA 4DZRA 2QTGA 2ALJA 4ZKDA 1MRNA 2QNRA 3KU1A 1KEVA 4HDSB 2NU7A 3RRFA 3ZVMA 1RM0A 3O93A 3THOA 4OV6B 3L7YA 4WNAA 2WDZA 2HBZA 3D8NA 2GCOA 3MQ4A 3GEPA 5KDLA 5TGTA 3TB4A 3KLPX 4BO9A 5HM8A 2C2HA 1BHO1 2IPAB 5GIOE 1HBJA 2WOOA 3ETNA 3H9EO 1Z45A 4CM4B 1V5IA 3IUQA 1U90A 5FX2A 5BXYA 3ABZA 1FEZA 1QYIA 3IFSA 2YW9A 5KINB 5F23A 2CLKB 1Q0ZA 5EKTA 4X20A 1AHHA 4I50B 5KWJA 1UPXA 3KYCB 4XH9B 3KZKA 3U4IA 4F71A 3AG6A 3OPYB 1ACMA 5LUAA 4KFUA 1C9JA 1FMTA 2UZ1A 3BCHA 5DGXA 3RU9A 2CK3A 3TXAA 1L1QA 4LEIA 4QFMA 4J6EA 3IIEA 4NS4A 2Y1WA 4F2DA 3BD7A 3DOHA 3EXHC 1T9CA 5CIWA 3W8EA 4D56A 2WHPB 2AIRA 4LRTB 4F8YA 3PR1A 1TJ3A 1OT3A 1T4DA 2JEOA 2ZAGA 3HCCA 4PU0A 1N2BA 1VZ2A 4YRCA 2FQXA 1Z3CA 1KZ9A 3CUWA 4B7XA 1V48A 1OBVA 4TMTA 4B73A 3WDKA 3NBXX 1O5TA 3VOSA 5DVZA 3BJMA 5IJZA 1F1BA 3BWBA 3HWWA 1YA4A 4XQGA 3AIKA 4CCAA 4WINA 4ZOAA 4FN4A 4HD8A 4MR9B 3IKTA 3Q11A 5I7EA 3AUUA 4DV0B 3FWPA 3PTLA 2H16A 4HBGA 3WNDA 2JHAA 4MQBA 1KYTA 4H7EA 1GUFA 4YAFA 4UNIA 2Z83A 1OZGA 5DBEX 4C5AA 2X6RA 3BMCB 4P4TA 3PQ4A 2Z2JA 1BDMA 1TPYA 4BNWA 1R0SA 3GHHA 4HJRA 4M7OA 2O59A 3IAAA 3ETCA 3SYNA 1ZRNA 2VYVA 3R0IA 3P2IA 4BB6A 1I94B 4H59A 4WFJA 4FYWA 1L5HB 5AK3A 1G4UR 1X38A 4YT5A 1J42A 5DIFA 5DKFA 5CFQA 4N1AA 3ZE0B 1W49A 3KEMA 4ESOA 4YK7A 2W70A 4DCVA 3AJ9A 3MUEA 4HWTA 2R68A 1XCLA 4UEJA 1WCXA 3HYCA 5CGQB 5JVDF 5D3ZA 3NR2A 5AVJA 2G71A 3EIUA 4V2UA 4UMFA 1V9LA 4KI7A 2QPAA 3TE7A 2R1TA 2Y68A 3D43A 3QNUA 5EP4A 2GZRA 3ZXYA 4A15A 3BWYA 1H4VB 1VCNA 5JJ5A 3PHJA 2CJWB 3DMTC 2VOJA 3LQKA 4UUQA 4X5OA 3TLMA 2O0LA 2PX2A 4GFDA 4YGYA 1XMVA 4Y1FA 4C5BA 3OMXA 4CR6A 3WYGA 2WWTA 4X1YB 3JR7A 2J59A 1UZAA 2CK3D 5D5HA 1LLDA 2BM9A 2OHFA 4CM1A 3DEHA 2EW1A 3KEGA 4IZOA 3NASA 1PG0A 5F35A 1EWVA 1TQDA 3OM0A 2O50A 4D8WA 4GOLD 4GO1A 1AH2A 1PZEA 1PS9A 2QJOA 2R00A 3TLYA 5AIBA 3N1UA 2XCLA 2J7PA 2ONJA 2WWVD 4F6CA 5IX8A 4CM8B 5DMXA 2GJ4A 1CZRA 2ZQYA 2GETA 4QLOA 4QRHA 3U9LA 4NYMQ 4X41A 4EGSA 1MO3A 4AG3A 4RMHA 1E6LA 4BE7B 1USKA 1E59A 3H18A 3KR0A 3OWOA 5AJHA 1U3UA 1XEXB 5A5DA 3KJIA 1XX6A 1I7PA 4QGAA 2ZR8A 4RVGA 5H68A 4MPJA 2YXEA 1TZMA 2P78A 2BMJA 2OK7A 2ONCA 3AR8A 1AXRA 1OA1A 3K8YA 3O7WA 1H8HA 4GZLA 4Z86A 2WYUA 5BSUA 2CXUA 4NH0A 4OHOA 4UNSA 3IT3A 3HU3A 5FLYA 1KL7A 4Q7KA 5F3WB 1CUDA 1ETHA 4A0QA 3T0FA 2BEUA 2JLBA 2PZMA 3KLBA 2VYVD 5CLQA 4F6RA 8OHMA 2Q5JA 3RVQA 2VQFB 4AJNA 3WC4A 1TMYA 2B30A 9LDBA 4MKIA 5IW8A 1Z2OX 1BFUA 1QYDA 1A5TA 3VKGA 1XZJA 1KVSA 2MSKA 2X0IA 4WA7A 4AJ2A 5JC1A 3OCCA 2D4HA 3GH3A 2DHEA 3RRJA 3A2KA 2B25A 3MMZA 5F9FA 3HZRA 3E8XA 3TRDA 4BNTA 1KY5A 2GLUA 1L4YA 3BTSA 1AX9A 2YN4A 3EZXA 1YR3A 2IPNA 3EX7C 1MLDA 3PHHA 1R6DA 5IKPA 1CULC 1YQXA 3LOPA 4L74A 2DBZA 4N65A 4UNPA 3SQOA 4L0DA 1L7RA 3UEOA 4J1TA 2NVOA 4WBXC 1YBVA 4QNRA 2JLAA 1SBCA 2A33A 1KFKB 1NVUQ 1VGVA 1ZO8A 2BFEB 2DH6A 5IJXA 4MVXA 4NYJQ 1E2BA 1N5OX 4LOAA 3TJRA 3P45A 4Q4HA 2J7PD 1EK6A 3KQPA 1Y5RA 1J00A 1UODA 4N54A 1VLJA 1ZYUA 2EDAA 1KS9A 2R48A 4M0EA 4OBEA 4Q3NA 2BEVB 4N5LA 3WYEA 4D8YA 1U5BA 4NVRA 1Q0TA 1CUAA 3OZWA 2BM0A 4PO1A 4PQGA 2GOYA 2QRMA 1ZHHA 3QVWA 1BMTA 3DMNA 4HSGA 1DX4A 3L7MA 3V1TC 4JI5B 5IU6A 2VJMB 6REQB 4ZPXA 3EGCA 3ZK8A 2PUDA 3LM8A 1H8HD 3GOQA 2XOEA 3JD4A 4BLRA 3EPLA 4C3VA 5DTQA 5HK8A 1WQ4A 3FSGA 3V1NA 2VP2A 5K0FA 3SVLA 1AGPA 1J90A 3MBKA 3TVTA 3ZWMA 1G8AA 3OQMA 1Z18A 3Q2OA 1JWBB 3LUBA 3GP5A 3CISA 3EVEA 5AO9A 1JR2A 4D6XA 3NYRA 1Y3CE 1C7IA 4PIVA 3K32A 5LBIA 3KFVA 4KFTA 1B6TA 2IV7A 4FM9A 1UPUA 1K3FA 3K16A 5EE1A 2AOTA 2ZSUA 2AK2A 1SVIA 4KO8A 3EBPA 4C4XA 1JIVA 5ALSA 1VA4A 3LYLA 3LXRA 3MLAA 4NYMR 1Q7RA 3INGA 1S1MA 4PTLA 5JSZA 2WHRA 1JE1A 3L8CA 3NDJA 1OF1A 1VDZA 4IVRA 2WJZB 2DBRA 1IONA 1TGYA 1VSUA 3NPAA 2DH5A 3RTBA 1WUHS 3W4KA 4TYYA 4MRMA 5EN4A 5BQXA 2CF6A 4EX7A 1TNDA 1GUDA 4KO3S 4EI7A 2VJBA 4WLVA 1QRDA 2WUVA 3O26A 3UVEA 1GNVA 2A92A 3IVXA 4MGYR 3G2IA 3M3DA 4IO1A 3DSRA 4CUZA 4A16A 1ZOOA 2CEKA 4NNPA 1MB2A 3QLEA 4Z0TA 4RZSA 4NBUA 2QTBA 4OKIA 1P4RA 1VJ0A 4OQXA 4TN1A 1P4GA 4HDKB 5AM2A 4IYRA 2Q4EA 5M29A 1R00A 3R5TA 3HM9A 2P0YA 1N78A 4DQ0A 1SCJA 2XHZA 4N5NA 2C2GA 1WVIA 3L4KA 2WJYA 1LRKA 2JGRA 1KAEA 2H4WA 3SKVA 1Q17A 3ZDFA 2DP4E 2Q21A 3U0VA 2CLCX 2QT0A 3B1KA 1GQQA 1L6IA 1QZ3A 2G5PA 4L75A 4FNOA 1JB9A 1S1CA 1YE8A 4JV5B 3VTFA 1U0NA 3P94A 4NQRA 3TR0A 4QM6A 5FEUA 1NIJA 5H81A 1I32A 1U2DA 1REQB 2OORC 1RLIA 4RLQA 4ZIRA 1RNLA 1WW2A 2Z43A 4XSGA 1N6IA 1CHDA 1XTIA 8GPBA 5CFNA 3FSGD 1M2KA 3P9NA 2VYCA 1B23P 1HQYE 3TTWA 3N0RA 1EUYA 5B7QA 3IL2A 1ZESA 4J2HA 2V7XA 4V1CA 4G4SO 2OBLA 2E4WA 2QMQA 1PFWA 4OJKA 4QPJC 2QW1A 3QFFA 4L0MA 4NYJR 4NZMA 5IXSA 1X0XA 1P19A 4DC0A 3EZFA 3C85A 3H4TA 3P0JA 1SUIA 4JVSB 3FDZB 1Q1EA 3EWIA 2HHAA 4NLLA 3N2YA 3IAS1 3S2IA 1E18A 2GHTA 4PYRA 1XZMA 5CP8A 1OXXK 2XE6A 1EVYA 2P4SA 4PRZA 3WP0A 1QZUA 3A9VA 4YUZA 4Q3OA 1M6VA 3I4FA 3WL5A 5L3ZA 3NWJA 3V4LA 1UFKA 3M5PA 3NRCA 3GLRA 4CNBA 2QR5A 1M0WA 2P9EA 5LU9A 1TIPA 3NG1A 2Y05A 4JS0A 4PLTA 4HX5A 5F7ZA 1F17A 3T1OA 5JECA 3QG1A 2WVAA 4CIBA 5K6TA 2I54A 1V4NA 1TB4A 4A26A 3OJFA 5AUPB 5KO2A 4IRMA 2OQ2A 5ESWA 1OI4A 1Y6QA 1CHNA 1SXIA 4LV8B 4ZHQB 5AVOA 3CM0A 3U3OA 2WJVA 1LWNA 3D4IA 2QTAA 3AM3A 2X13A 1E2FA 3JVDA 5EYPA 2PKCA 2EX1A 1IATA 2HJRA 5JQGA 1KWGA 4K6GA 1EMDA 3JVIA 2BDUA 4YIKA 2QUHA 1I6MA 1OBFO 1PCXA 3OCVA 1D1TA 3AB7A 3EAQA 3QE0A 5EIBC 3TSWA 4JA0A 4AZWA 1Q0PA 1VE7A 4XLLA 1DIHA 3JASB 5FWXB 3A6PC 1ZJ5A 3U4HA 3H8JA 2ZI7A 3IBGA 1DAEA 3IUBA 1N7HA 5P21A 1W85A 1FFXA 2QAIA 2ZAYA 4PCUA 5FFFA 4ARCA 3W5DA 3DOEA 4BUZA 1DWUA 1JRLA 2VH5R 3GEDA 1A2BA 4EATA 5LZ4A 3VDQA 4LNUB 2NU8A 2NTEA 2AEEA 2GZMA 4UNRA 1TZJA 1J1UA 1DJNA 1FFSA 4LYFA 4S0ZA 1GR0A 2C88A 2MYNA 3EH1A 3UUFA 4FNGA 1EFHA 1QANA 4IWYA 2FG6C 1G64A 3H75A 4KN6A 5D87A 3WL8A 3AFIA 1O97C 1V8BA 3DPSA 2FVYA 4MVJF 5D8DA 2PT7A 5CB4B 1ZDMA 1C0KA 4ER6A 3PFCA 5L40A 1D0SA 5LA6F 4I8XA 3G7NA 4JMLA 2R8BA 3D7SA 4KXUA 4TRMA 1ZKDA 4P0QB 1D4AA 5CPFA 3HJHA 3NNNA 3T5AA 4U9HS 2JPDA 4HWSA 1KY2A 1OLUA 2W93A 4OGKA 2EKDA 1L2TA 2DBVO 3LUAA 3EDOA 5A3RA 2XBMA 1LRJA 1JG4A 4FS3A 4H3KB 4UAGA 5YASA 1W46A 4AC9A 4BX9A 1ZR2A 3HO1A 1UP7A 4ZRMA 1DRJA 1M1YA 5IKOA 1GWNA 3ZHUA 1CY1A 2ZYHA 3W6UA 1W48A 2HJVA 4YJ2A 4L5BA 3FNQA 3HGQA 1QK3A 4CMGA 4H1HA 2X3UA 4F56A 4K6FA 2UUCB 1HDXA 3AESB 1RLJA 4OAOA 4ZAYA 3WHIA 4CQMB 2F8TA 5E6RA 1GV0A 1XXHE 2QTVA 5BN5A 1QGUB 1XD9A 1QG4A 5ADUS 1SBNE 1IHPA 4LDRA 2X5OA 4D79A 2C9YA 1ZD2P 2ZXEA 4OBXA 4B3XA 2Z8ZA 4F3NA 2V45A 1QIEA 1U1CA 2NO9A 1GTZA 2IZ5A 2YICA 2CJXA 2ZREA 3F7OA 3OZXA 3P9YA 2JBWA 1IXRC 3CRQA 1E7MA 5FORA 2EKPA 4DMRA 2GB4A 1QPGA 1FDRA 1MF7A 4KYTA 5HF6A 5LDDC 5U4XA 1Y3FE 2EG5A 4KXXA 2QWXA 5E2IA 2X40A 1Z33A 4FMCB 5IM5A 1ZSYA 1WZ2A 3M1IA 1RJDA 3HJRA 4BMVA 2D2FA 4B0PA 3AFNA 2CMHA 4G0UA 2OO7A 3Q9SA 1JN0A 4X1IA 4IV0A 1MO4A 3OAAA 4N7RA 3G68A 4B3TB 3ZHCA 3IAM6 5LP6A 4XPIA 3QQ5A 1PFQA 3M0EA 1PW5A 3SLRA 1V7PC 5DSXA 5KX5B 2CXSA 5I9IA 2PFSA 3KAQA 4XIGS 2V9CA 4FX2A 5CVUA 3JU3A 5A4IS 4ZVPA 5FTLA 4MJ7A 3VYUB 3FR7A 3GT0A 4TXLA 3SMVA 2GHQA 4D6PA 1P6QA 2B1JA 1I0IA 1RYDA 2I1LA 3F4BA 1EXMA 1FA9A 3HKCB 4Z51A 2OV6A 4WK4B 3PEYA 4QQRA 4YMWA 1J7JA 1O6BA 4BCBA 1KZYC 4FUQA 3PEEA 1I6KA 3PUIA 3ONFA 2FW1A 3HCPA 1CP3A 3F6EX 5LJIA 4FK8A 1ID1A 1Z4IA 3HBAA 4QODA 3VKWA 2IYUA 2N46A 2Y66A 1I10A 2VNHA 3IXMA 1J8QA 1FQWA 4IKEA 4U1RA 4X8MA 3C6MA 5D3QA 4BRWA 4YN3A 2GF9A 2QXUA 1VYVA 2EJTA 5DGCA 1TC2A 3RT7A 1LF5A 2E6UX 1HKHA 2GCPA 3AEKB 3GUUA 3TSOA 2FSSA 2FRXA 2FX5A 4N0QA 1JQAA 1EZZA 1RTKA 3SDSA 2C4UA 1XZFA 2XKAA 4RFSA 2GAAA 2PFGA 3VYTB 2JIPA 1VHWA 3C3KA 2OB1A 1USVA 2XZTA 4A5OA 4G0VA 1UKBA 1Y8CA 3ICCA 3OPXA 4ZO8A 3WJ7A 5CPBA 5HIIA 3KP1A 3FF4A 5ALNA 1RM5A 3L07A 4DYDA 3ZWQA 5AW6A 1NNI1 3MCVA 4DEXA 4RY2A 1XTZA 2BKAA 1ZH6A 2J0UA 2V96A 4PC6A 4RH3A 2OO5C 3G8YA 4KN9S 2X22A 5T4BA 1Z7YA 4CKEA 2PUFA 4M9RA 4TT3A 3I76A 1NT4A 3HMKA 4D4HA 1G1AA 3OFKA 4G81A 3UA4A 4NP6A 4E3WA 1Z7WA 2NXEA 3OAAD 2AMYA 4ILEA 4PX3A 3CE6A 4N4AA 3W77A 4DMKA 1WUYA 4AURA 3LY9A 2AN1A 1IC6A 4XWWA 4XXHA 1ZXXA 4RGVA 4WZZA 4HFNA 1RACA 4L28A 3KXIA 2PUTA 4PZDA 1VGRA 5BNWA 4MDFA 1MMFB 5DCUA 1WB9A 3AXSA 2MYPA 3EUWA 2ZB2A 2YWGA 3PNOA 4OJTA 1R9GA 2V6JA 2BSAA 4HWKA 1KFEB 4BQQA 1KJIA 3B6IA 4Q9KA 3R20A 3OWXA 3OZFA 4CETA 1JIXA 1S8OA 3K1ZA 4PVCA 2EEZA 1N1GA 3L8MA 4GLLA 4JLAA 3S70A 3WLFA 2PTHA 3KR9A 1Z74A 1ECBA 1H9CA 2B21A 3D7RA 5KWIA 1JLKA 5E4FA 1NBWB 3MRXA 1SCBA 3Q6IA 4QTYA 1LXCA 1G41A 4FDAA 2WQ6A 3OBIA 3NIDB 1B8PA 5C81A 3TD2A 3UXEA 4UM7A 4KUEA 2QUKA 4YUWA 5C7IO 1Y9JA 1JG6A 2L82A 3EXFB 3QWIA 4OSOA 3LQ4A 1WSDA 5T64A 6YASA 1NXSA 4GQBA 4DR5B 1OJ7A 3X1ZA 4YJGB 4NY1A 4WWHA 2AA3A 3CX6A 1KAGA 2BGIA 3MELA 3VJLA 4EP1A 2VT3A 3HCWA 1YTUA 4AD8A 4DLYA 5IVDA 4G5GA 2A0KA 4U63A 2IH4A 1T8WA 1Z7EA 4PLGA 2CUNA 2XXAB 3EFBA 1R6AA 4MO2A 2ABWA 2J85A 5LOVB 3O8DA 2ZCUA 4FE3A 1QP0A 4G5XA 1NSFA 4TT3D 5EMKA 1ODCA 2QTHA 4LJAA 4CW7A 3F1KA 4B4OA 3W34A 3RRMA 2H06A 3Q98A 3VPSA 3RU7A 4CKZA 4C0LA 4A91A 1DAOA 1DO8A 1F06A 2BFPA 2GFQA 2AYXA 4WEQA 3B6ZA 3P0EA 5DT9A 5E2AA 4YRNA 4D0SA 1GPWB 1VLMA 3MF4A 5K99A 2IYOA 2B7CA 4JVOA 2ZQZA 4IIDA 2V6FA 5L3QB 1XSEA 4Z49A 1QWOA 4FSDA 4DA6A 5HF5A 3WYAA 3VVMA 3M6IA 4WVFA 3ZJYA 2WU0A 4BKOA 1GITA 4D0LB 4YVFA 2I6UA 5HSGA 4BOYA 3BWXA 2GD1O 4KAJA 3LLVA 1QBGA 1WQ3A 5SYAA 4O02B 2XF8A 2C84A 4KWCA 4I5IA 2R8YA 1Y4DE 3KJEA 3NORA 5GTDA 1Y81A 4RFVA 2HADA 3MWDA 2F48A 3NWOA 3OC0A 3TDMA 1EK2A 2IUSA 3QF4A 3MNFA 3DVSX 4OB8A 2JD1A 1R10A 1CU1A 1HE4A 4KR2A 4PS0A 3MERA 4I36A 2H08A 4IH4A 2Z5GA 4FHGA 3KB6A 3IEVA 1TD1A 1JG7A 3FCUB 1U3GA 1WG8A 2C94A 4Y2VA 1DAIA 5EJMA 3AVTA 3OMWA 1MX9A 3L8ZA 2AYZA 1HLPA 5T4EA 4HFRA 4DY6A 1DOHA 2OCLA 3KJFA 4YAWA 3VH1A 1Z4NA 5BVGB 2FPXA 1RKBA 2OD7A 4O5AA 2HZBA 4O0MA 1FE8A 4M0DA 1N3LA 1RWMA 1N3IA 1RZUA 1G63A 1XD2A 2ZIXA 3C3WA 3G2HA 4NCJA 4O4JA 4PPGA 4XIJA 4L3WA 4DA8A 1C29B 3M9WA 3L4JA 5JJKA 2WF5A 4MUKA 5E3JA 1XRRA 2XA9A 2J9GA 2RHJA 5DTMA 1B15A 4B5LA 1KQOA 3G13A 4F3YA 2Z6QA 3LLUA 4FJ0A 1S7GA 5K8UA 2Z58A 1TQ2A 3DBHA 4JUBA 2C2ZA 3HPQA 4MEBA 3T5GA 3BH6A 3AIMA 5CTAA 3ZQ4A 4A4DA 3HNRA 4IXMA 1OC4A 1NF2A 3ISVA 3B1FA 2ZPAA 3DKKA 5JDCC 3H2GA 2OLEA 3GXBA 3H5VA 3L7AA 4HF7A 5AVSA 3DZFA 5ALGA 3R9KA 4UU0A 1P72A 2DX7A 1CUHA 3LDGA 3GJYA 4Q9DA 4I9GA 5AXBA 4LWZA 1JIIA 1AUVA 1PLJA 3CCCA 4MS3B 4BLSA 3UGKA 1OAAA 2WFAA 2ZTMA 3KR2A 2OR3A 3D8TA 3RUIA 1EXVA 3PR3A 5KOYA 1OH7A 1Z0FA 3DOIA 2HDNB 5A4MS 1OAOA 1Y82A 3RF6A 4ZTZB 2HQSA 3VC1A 3FZGA 2H7VA 5AW7A 3U3XA 1W0CA 4ZXFA 3ASUA 3GLUA 5ENVA 4E2YA 1GRCA 3H83A 4K9PA 1BGXT 3KR1A 2EWMA 1Z8DA 4G9BA 1FLNA 2AEMA 5IBPA 1KXJA 2Q7DA 4AM8A 2JD2A 3NBAA 4W6QA 3AK4A 5ALIA 4B32A 3EULA 1Q7EA 2KQUA 3T5MA 3L4BA 4RE6A 3RJ9A 2IP1A 2NVBA 3VZBA 4A10A 3DE4X 4QHTA 5GOTA 2D13A 5ALEA 5AVRA 3TCKA 4Q01A 5KKAA 3MC1A 3CCFA 1WD5A 3W5JA 5LDHA 3KUCA 2PGOA 4MUXA 2OHIA 1U1IA 4PV7A 3SXJA 4FKZA 3N3BC 1EZ1A 1Z16A 3OIYA 4IRUB 2C3YA 2JKYA 3I2GA 4WLNA 1HETA 4ZVOA 3RIMA 5DGTA 4INJA 1H6DA 2DAPA 1AV7A 1RDFA 4JBHA 2Z9DA 3DXYA 4NU8X 4YQYA 1RQRA 1XZ8A 1MC4A 1KAMA 4MHTA 1MP0A 1RI3A 1PNOA 2CNWA 5EC8A 1MEOA 4BGVA 3DE3X 1SO8A 4EQ6B 3O0DA 3FYDA 4FZRA 2C7GA 3E6AA 5L7WA 1GEGA 2XB6A 4WD3A 3UN1A 2OFPA 3V80A 2ZE8A 4B83A 5IM4A 1JAYA 3KZVA 4EJ0A 2JFQA 1UMCB 2R1ZA 5KEIA 3S40A 3BA1A 2XA1A 3OM8A 3AOGA 1GNSA 4R6WA 4S2EA 3I9JA 4GGMX 5DDIP 3KWFA 3GFPA 4RPKA 6LDHA 3IP9A 3N75A 2D2VA 1AZLA 1DRUA 2QYHA 2HLPA 2NQTA 3BFVA 2X19A 3GJXC 4U7FA 4CM7A 2B4RO 5AVYA 5EJGA 3NTLA 2VTEA 2BR4A 2ZU0C 5DLPA 3ZY2A 1X74A 2PH7A 3F9RA 3KSAC 2Y71A 2OAP1 3OE7A 4EHBA 4RULA 3THYB 1BCRB 1Z4MA 2ZJ4A 1G42A 3E5NA 3FMOB 4UQOA 2P9TA 4V39A 5GM1A 3WQRA 4C7MA 2J4CA 3K1JA 4I5DA 2FPPA 4YHHB 3B12A 4QEDA 2ZAOA 2P90A 3G6KA 1W73A 2V03A 2OV2A 2HLDA 2ZATA 3AVVA 3LIPA 2D3WA 2WMYA 1ISPA 3OJOA 4IJVA 4Q21A 4UAVA 5FQOA 2V7GA 4D82A 4XQ0A 1YFKA 3WIVA 3WKBA 4AZ0A 3V4FA 1XCBA 1G21A 1RT9A 3DYIA 2IU4A 1JBEA 4YDSA 4P33A 3R4CA 4MUBA 4BRUA 4RF2A 5AVWA 3EDMA 1SPBS 3MJDA 5CJJA 2O3SA 4L4RA 2Q7XA 5CITA 3K0KA 3U7FB 4C43A 2HC9A 4IJKA 1BVHA 2X7JA 4X60A 4ZU1X 2XECA 2VJLA 5E2BA 4OXKA 1HX7A 4I4IA 1KY4A 2D1FA 3P0FA 4JC8A 1N6RA 4EO4A 4JXXA 1VJTA 2XR1A 3PD7A 1L8OA 4OJMX 2BBWA 3TXXA 3C15C 1T0BA 2Z3VA 2P8SA 4M1OA 1XL0A 2CNWD 2VJAA 3QH4A 3EOZA 3V48A 4IDNA 4K6HA 1EE2A 5K3EA 1R6UA 4NBVA 4IAOA 1IWBB 3H5NA 4UOEA 5JZOA 5C3UA 3ILHA 2FW9A 3RVNA 1Z83A 2G9UA 2JIMA 4RK0A 3AUFA 5FHRA 4GI1A 3K71B 5KYXA 1FTGA 4J2TA 2JLSA 3WLMA 3VXKA 1LI7A 1FMFA 5B7PA 1P2SA 1T4GA 1UQUA 2QLMA 4LMRA 2CV2A 5KB3A 1PEYA 1DZIA 1FX1A 1QV9A 1X8JA 3O8QB 5ILGA 2P68A 4ZYVA 2UZIR 2ZROA 4N3NA 1DOAA 2XB9A 4P54A 3G0OA 3O5AA 3QKRA 5KNCA 2OZKA 2VS1A 3NCHA 1UM9A 1WU8A 3BJZA 3OE7D 4HLUA 3CPJB 4LRSB 3W9YA 3GQVA 4BCCA 2DECA 1HWYA 4P3XA 3TUIC 4A2CA 3DTVB 2Z08A 4R7ZA 2W0SA 2RHOA 4E1VA 1VHDA 4NWIA 3R5FA 3ZK7A 4F04A 5H5JA 1PRYA 4LGCA 3K8QA 2J0SA 1JDTA 5DV9A 2AMFA 1FDVA 4QUIA 1F2UB 4C0QC 2HLDD 1HYEA 1P7YA 3KQMA 4W5RA 1I4TD 4RM3A 1G19A 1CY8A 4I99A 3PQFA 3RQSA 5AJUA 2ZE7A 4GL4A 2Q6TA 1H8EA 2YH2A 5JFGA 2CXOA 2JLQA 3KOMA 3ZGXA 2A0XA 4TMKA 3ZTWA 2JFBA 1I7SB 4FCVA 1FRQA 5DM4A 2C42A 4NG5A 1TJYA 1V8PA 2JARA 3PFBA 1WEKA 4QU8A 5CYOA 5CAEB 3RU3A 5LZ2A 4GECA 1T2AA 4I1VA 1BXZA 1RHQA 3QVVA 3BDAA 4I66A 4KIJA 4RZ3A 4RBNA 4UCQA 4AN1A 1IHOA 3DXXA 3QU5A 4YYZA 2V0NA 1XTUA 2ZYWX 4P4SB 1DJLA 2PRIA 3SSMA 2O8CA 3T8YA 3GARA 3QTTA 1AQIA 1BKYA 3T95A 4D25A 4ZVTA 1RIIA 1FTQA 1P1IA 3BIFA 4JEUA 5C7YA 2A0WA 4W6ZA 1DXQA 3MCTA 5FNVB 1NW9B 5DF1A 1E9FA 3O1LA 3ROPA 3S8YA 1W25A 3IE0A 1GKIA 2VDQB 5JZBA 4WKNA 4YV0A 5L4NA 1OMOA 2IBSA 2IIBA 2JAQA 3AJRA 3CFYA 3RUAA 4L15A 4AWXA 1CQIB 3SK0A 1T10A 3HU1A 1Q15A 3O8OA 4TZ0A 3QJYA 3VR3D 2WG1A 3IJPA 4L4YA 4XIYA 3EGVA 2PKYX 1KJNA 3LDUA 5JSYA 6NULA 1NVKA 3EDCA 2ZRNA 4MQEB 1SVLA 4KE6A 3R5SA 3BIWA 2NZWA 4MVJI 1JHQA 4KN8A 3PL1A 4ZOLF 5J5AA 5KNCD 1AUQA 3ETEA 1Z35A 3HUEA 3W9BA 1WMSA 4B8WA 4G0WA 3VKFA 4PINA 5FBWB 5JXGA 4OA8A 2XMGA 2W2XA 2H1VA 5CVVA 2XRYA 1JAIA 1O58A 4R7GA 1D2MA 1S2NA 1L1RA 1G7CA 1UBOS 3D6UA 3DCYA 3LWNA 5JAPA 3D3KA 2WU3A 5ILOA 2CB9A 4NZOA 4XCVA 2WNIA 2R1VB 2BMWA 4MYDA 2C4KA 2F1OA 2VK4A 1JQ5A 3PC2A 4MPPA 1H8ED 1L4UA 2PX4A 4AJIA 1EA7A 4FMDF 3ZN2A 4LWQA 3QKSB 2AQKA 1JBQA 1YZQA 2BFCB 2ACEA 3E7DA 3WL3A 1SG0A 1Z4PX 1EAYA 2I3DA 1GLVA 2QUBA 4G5YA 3WJ1A 4B8ZA 5A1TA 3D6NB 4OGFA 4P98A 5T3YA 2W6IA 3LX6A 4G26A 3UCXA 4D41A 3NU1A 2R7NA 1YS2X 3W7AA 1JQBA 4EEZA 2NUTA 3T4UA 4DCJA 3ZCSA 3O8BA 3ABOB 1DDGA 5G41A 1YCGA 4IZIA 3R8CA 2QJRA 3C3CA 3FLAA 1A4UA 1FPMA 4M0PA 4E5MA 1AGYA 3TNDA 1UBUS 4OATA 3LG2A 3AZOA 4DPLA 5CLFA 3EF0A 4URFA 2X1VA 1JVSA 4YRMA 1CX9B 1CS0B 2EFJA 3B1ZA 3DKIA 4JQYA 4WZAB 1D9ZA 1WU7A 1V1JA 1X1TA 2C0QA 4H3HB 2WKRA 4KACA 5DWVA 2ZXFA 4N12A 5B57C 1A8HA 1WXGA 5B4VA 2FK8A 3OETA 2V7VA 5REQB 1J97A 5A0VA 4I55A 5B1YA 2PMKA 2CE7A 2WFZA 2PX8A 2VPPA 1TTHA 3USZA 2OC4A 4EPRA 1ZD9A 2HRRA 3A9UA 3WGUA 4IKPA 2PH1A 3D6VA 4ZEMA 5B7NA 5AI0A 2A2ZA 5D84A 3N05A 1CSEE 1LPSA 2UYOA 4BQEA 3ZGYA 1T9GS 2ZSAA 4ALNA 5JFTA 2PWAA 3SNHA 1KXZA 2HF9A 4YACA 5F9HA 4JL8A 3OQHA 3ROMA 3RRZA 1IM5A 1X1SA 5CEJA 4YJKA 1M6EX 2B9EA 3LHFA 1CWUA 4UEWA 2XQVA 3L0PA 4RPIA 3FETA 3Q5EA 4JLVA 4LYJA 1JPUA 2O54A 1Q19A 2PKRA 2W2QA 2IV3A 1YZKA 4GXQA 1FTWA 1GRRA 1ELOA 4Y7CA 2NXWA 1T35A 1QK4A 4RPHA 2DGDA 5IJWA 4W5NA 4V38A 3GAZA 4N7MA 4C2BA 3BE6A 3HJBA 3L0YA 5THQA 2Y4NA 1LPPA 2W6ID 1J07A 3PNLA 2EOAA 4GP6A 2XUOA 4ZV4A 1ZN2A 2B8EA 2E4VA 1IJFA 3BPSA 5GWXA 4AJ9A 1RXWA 1W5FA 3G49A 4LJ9A 3PBKA 1C3EA 3KPUA 1CQZA 2OXTA 1YZNA 4WSOA 3ZXIA 4QLBA 1UXJA 2WMNB 4BGIA 1PFVA 1SJ9A 2GPSA 4NARA 3V2IA 4YCCA 2A4KA 1E0SA 5FPYA 4XW2A 3ZIUA 4UVEA 5HKKA 1FSFA 1KI1A 1QK5A 1U0OC 2CSUA 5DYTA 1A5AB 4AJHA 3SC2B 3B7PA 4RF5A 4P31A 1M2GA 3ZIDA 2VTBB 2HRDA 3FNRA 4Y9TA 5FJJA 4X93A 2WVHA 3A4IA 3AG5A 2KJQA 3SIPA 2P5TB 5BV8A 2G77B 3I01A 3PX2A 4QGBA 5IT9A 1GU0A 3RC7A 4JLPA 2C07A 1EPUA 3II6X 1P5HA 5EMNA 1LJ8A 5FNZA 4B6GA 4BQOA 1OX4B 4C22A 1ULSA 3ITDA 3VBEA 5IH7A 2P9GA 3ZHTA 1ZRMA 4UMDA 1EFUA 1K7YA 2OZLA 3DL2A 4O4HF 3TFQA 4BNIA 3WZ2A 4NCHA 3R0QA 4QDJA 1NOIA 2AT1A 2PL3A 2WMOB 1XC7A 1DC6A 3VDMA 3R40A 5JR3A 4G1VA 1I30A 1RKXA 1T43A 2Q9AA 3I32A 3RTDA 2GSWA 2PZGA 2J9FB 4IDCA 1U2SA 1I6LA 3F78A 4O33A 3WMGA 4WN3A 4CMJA 1U9CA 3ZCUA 4BWGA 3RTEA 4EL5A 3C8UA 5EWJA 5HPYB 1GZ7A 4KVZA 4G8DA 3EXHA 1N9GB 4MV9A 4IO0A 4ND8B 3RWOA 3ZQKA 5CD1A 1I1HA 2X9LA 1V7CA 3JQAA 3GFGA 2VUTA 1M72A 1B8OA 4GOOD 5IVPA 2OV4A 1DO0A 3L84A 4KSBA 1NBIA 2P2LA 1SBYA 1T9GR 5EVCA 3VO8A 5DTEA 1UBRS 2TMGA 2CV0A 2QZZA 3D0RA 1PJ8A 1ADGA 2SKEA 2VEDA 1Q0UA 3H0KA 5FHQA 5JVDB 5BQFA 2WTAA 1XPRA 2QTZA 3GVHA 3UW3A 1MOZA 2ZIWB 1IRXA 3O2QB 1TL7C 1JDUA 1QVAA 5CURA 4QASA 1QYCA 3REGA 3TNLA 3RGGA 4E21A 4L73A 5K5EA 2Z4RA 3KS9A 1U7TA 2VKQA 1KZHA 5HKKD 4ZK6A 3VI4B 1ZAKA 1JR6A 1C1XB 4DNOA 2LNDA 5CVJA 1BE8A 3LO5A 4FEYA 4X1OA 3PJFA 1YB5A 1MB9A 1DXYA 4HXYA 1JJBA 5H3CA 1GTL1 5MGBA 4ANFA 1QU3A 2FSPA 3OIWA 1MENA 1VZ3A 2DPMA 4XX0B 4MQMA 4D0RA 3RRBA 4ZDIA 5C2JB 1CZKA 1HZJA 2OAGA 4YCDA 4MX8A 4M22A 1DKPA 1ISRA 3C3MA 4PWZA 2QN9A 2NYUA 4IHJB 3BDIA 4WLUA 1WUIS 2V97A 3FYUB 3M6LA 1P7PA 1YTLA 2A4MA 3BILA 4JUCA 2NVWA 4KW7A 4Q9JA 1DZ3A 1A04A 3I09A 3D31A 4UHKA 4ZVSA 3DMTA 3EDQA 4PAOA 2QNIA 1M2FA 2L69A 4C0HA 2H1OA 4RACA 4WKPA 4JEHA 4XYGA 3NNSA 1J33A 5ALWA 2ZW9A 3HA7A 4BUJA 1GOTA 1QIFA 1TT7A 2IS4A 2AOVA 4FYPA 5CDUA 4D26A 2RH4A 4C3ZA 1FDUA 4FNMA 4IDFA 2DQKA 3QZUA 1D6NA 4C6TA 1E3WB 4X1KA 1HRKA 3OZRA 3TE6A 3UFBA 1M7BA 5L3RA 5DYNA 3JQAD 4RDIA 1D1PA 2OYSA 4GC5A 1CUIA 1G9XA 3U7HB 1MAAA 4PHTA 3AVOA 2XADA 3JQ8B 4OGLA 1W0KA 3RG8A 5H9VA 3EC7A 4ABYA 3GV0A 2W6ZA 3OOSA 1JHAA 2IHJA 3IBTA 3UHOA 2ZWPA 3LC1O 1WLSA 3WL6A 2WVJA 3FLEA 3ZKAA 5MGNA 1U0GA 2I99A 4HL6A 3SE7A 4M1EA 1KU6A 3B1YA 5IUKC 4M9SA 1BMFA 3TI7A 2Q4RA 4BNDB 4CFSA 4YV2A 1XRPA 3OQOA 3PQ6A 2Q27A 1CRQA 2GM5A 3WGQA 3K31A 2BISA 2H4FA 5J63A 5JRZA 1L8LA 1FMLA 1YDWA 2AJTA 4G2TA 1EA5A 3GJ0A 3T3OA 3JD0A 5DOVA 3K5PA 3TKYA 5AKHA 3PP8A 1A8IA 2GCEA 3MLBA 4XPZA 1YFZA 2XCRB 4KREA 3KSMA 3EPJA 1RS0A 3LNCA 2ONKA 1E89A 4NOLA 1P9NA 2YRWA 1NJGA 2FQ1A 2O8VA 2H07A 4WKOA 3FUUA 4L6CA 1C0LA 1OHHA 3PI6A 4LSWA 5HBGA 1X92A 3PXGA 5IJ9A 4W1QA 4EGCB 4FWIB 3QFHA 2A0FA 1PV2A 1L8QA 1T2UA 4J43A 4WT7A 5ELLA 1IUPA 1KJYA 3JD2A 4N0PA 2VJPA 4YMIA 2I6TA 4DNPA 4U7DA 3LUDA 4X85A 2R7LA 2Z8YA 1CV2A 2ZTHA 2OECA 1BWSA 3HDQA 1IIRA 3KUXA 3MILA 4PCVA 4H15A 2RC6A 1DWQA 2ZUTA 4ZKEA 2OCGA 3W3AA 4ZYLA 1WV1A 2GFHA 3VU3A 5AW1A 2G5TA 1ZQ9A 3DNPA 2CBXA 1DUVG 4BVBA 4N9QA 1N0HA 3RKRA 2NUPA 4CL2A 4PC1A 2RGDA 4G0NA 1XD8A 2W8ZA 1G66A 3K2BA 1C14A 4HK4A 3BWDD 1FIUA 5CJ2A 1GZ5A 2O8FB 1KSJA 4KGVA 4KO2S 5AR1A 1PE0A 1G3MA 1FMJA 1TT5A 2JKZA 4C78A 1TAHA 1NT2A 1W0KD 3TR5A 1SU4A 1ZJJA 2ZWMA 3DFMA 3CKLA 5FUVA 1E0JA 4DLSA 5GZ1A 2JC3A 2QRHA 4QARA 2I4TA 4DYHA 1E96A 1T1JA 2JHCA 4P22A 4QJ4A 4RZIA 5FB3A 1LS1A 5FIUA 1C7JA 1SUFA 1FOEB 4GE0A 4F4IA 1BW9B 3LT1A 2AZXA 2O2SA 2WIKA 1BTOA 2C9ZA 1Q7GA 4WZBE 4B8YA 4R41A 1BMFD 2PZKA 2C78A 4WY8A 1JTVA 4EF6A 2BFBB 3VH2A 3NAMA 3FKJA 3O73A 3UXYA 1E1MA 1JQLB 3PJGA 4TTIA 1Y5LA 4V0OA 4COKA 2P9JA 3NNDA 4XYLA 2QW0X 1QS0B 1MFPA 4UARA 1HFWA 2QRQA 3R3VA 3IILA 4O1MA 4OGGA 5HCUA 3AHDA 1CETA 3DV0A 3JQ6A 3FROA 3AEUA 4GX1A 4B82A 4UHJA 4B6OA 1UKVY 2AH5A 3L6EA 1Z5OA 1DELA 1E1CB 3VNBA 7MHTA 1NXVA 3ISJA 4FS8A 4DLWA 5K8TA 3GGOA 3NUGA 3OIGA 2WF6A 3BZWA 5FLXA 1WPXA 1OLXB 1OHHD 5HIAA 4RVSA 2FV8A 4A36A 3D6AA 2O8BB 1ONPA 2XWSA 1Z12A 3LD9A 4U8HA 4B3JA 3UFXA 1DX6A 4S1TA 4Z4IA 3IQZA 2OQVA 3SS9X 3VJKA 4QDTA 3T4EA 2QG9A 4DYVA 3LS2A 5CK5A 5JYCA 4N0DA 5AJTA 1WL8A 3OG9A 2HOQA 4X6YA 1UQTA 1GZHB 4MUJA 4AIIA 4ZO9A 3KV3O 1M2WA 3W3AD 3L93A 1ZBDA 3QKIA 3ZX4A 1ECCA 3BH7A 1DNPA 1JTEA 2OWEA 5I9LA 2X4IA 3B9RA 3NLLA 4YI3A 3U62A 5CFRA 4KR6A 2EFEB 1I4EB 4JELA 2EW8A 4ZQGA 4OFZA 5CFMA 1NBOA 1Q83A 1EUCB 1J21A 3RFFA 1KHTA 4J0GA 2BHRA 3VPXA 3AB3A 1JEYA 1YCDA 1XZGA 1GD1O 1YZYA 5GJVC 4DN6A 4PEVA 2ID4A 3C7AA 4XCXA 5C4GB 4LECA 3WBBA 3QYPA 4LZOA 1GTMA 2F4NA 4WFKA 3EWNA 1HEIA 3HB1A 1GUYA 2OORA 2O3RA 1HKUA 1C7RA 1DAFA 1D4ZA 4MRPA 4NCXA 2PRJA 4BPRA 1DAGA 1U98A 3E7WA 4LPKA 4ZOBA 2EHDA 3B78A 4AIRA 2VDOB 5M2QA 1BS2A 2OLKA 2WWIA 2NT4A 4MQ6A 1LLCA 2ZJ5A 1VE9A 4II3A 3MN1A 3EZYA 5K20A 5LD2B 1SOAA 3CWZA 3R77A 1PL7A 2XUJA 2H8GA 4LNAA 3WX0A 2YDYA 4BZPA 4MLDA 5BMVB 3KKEA 1E1KA 1XZCA 1DV2A 3NHJA 5TDHA 4AO8A 4A8PA 4K9MA 2W58A 4WJZA 2BV3A 4CTMA 1FXWF 3ORRA 1MV8A 1QO0A 5CA0B 1FX0A 3RDPA 2E5WA 3MINB 3ZWOA 4WMLA 3AF6A 1EWQA 4RV4A 4YMSA 3TZHA 2Q3LA 1P5ZB 2GPNA 4CTKA 1YXMA