1NW4A

Crystal structure of plasmodium falciparum purine nucleoside phosphorylase in complex with immh and sulfate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
243
Chain Sequence
NLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasmodium falciparum Purine Nucleoside Phosphorylase: CRYSTAL STRUCTURES, IMMUCILLIN INHIBITORS, AND DUAL CATALYTIC FUNCTION.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords uridine phosphorylase, putative
total genus 85
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nw4A00
3P0FA 3INYA 3TL6A 2A0XA 3KHSA 4FFSA 1PR0A 2GUWA 2HRDA 5K1ZA 1Y1TA 4LZWA 1ODKA 2AI3A 5EFOA 1XE3A 4K6OA 4P54A 1A9TA 3GB9A 1PBNA 1OV6A 3FNQA 2QTTA 1YR3A 5CXSA 4MCHA 1V4NA 4I2VA 2QPLA 5DK6A 1JP7A 3T94A 2ON6A 2I4TA 3DPSA 2OC4A 4JWTA 1NC1A 1T8WA 1OVGA 1VHWA 2A8YA 4BMYA 3DF9A 1ULBA 3KUKA 5EPUA 1RXYA 3SCZA 4QASA 4D98A 3PNSA 4JP5A 3PHBE 1Z5NA 1QE5A 3OZBA 3U40A 4DAOA 4PR3A 3ONVA 1FXUA 4YJKA 3OOEA 1Y1RA 1Z37A 1YBFA 4G8JA 4H1TA 1JDUA 4TTIA 3FWPA 1B8OA 4D8VA 1N3IA 1LX7A 4TXNA 1Y1QA 1V3QE 1U1FA 3BJEA 1T0UA 2I8AA 4G41A 1A9OA 5C80A 4F3KA 1SD1A 1NW4A 2Q7OE 1PR6A 3UAZA 3EEIA 4WKBA 2B94A 1V48A 3UT6A 4TS9A 4LNAA 2OECA 2AC7A 4BMZA 1ECPA 3LBAA 1JPVA 1RCTE 4TXHA 1ULAA 4KN5A 4U2KA 4EB8A 1JDVA 1JE1A 3FOWA 3FUCA 1V2HE 5B7NA 4M7WA 4G89A 4QAQA 4YMLA 3EUFA 3KVRA 5F77A 4NSNA 4EARA 5CYGA 4OGLA 2BSXA 1VHJA 2HSWA 3OCCA 1CG6A 3FB1A 1YRYE 4DANA 3GGSA 1SQ6A 1K3FA 4X24A 3O6VA 4JOSA 5F73A 3D1VA 3NM5A 1U1CA 1Q1GA 1PKEA 1T8SA 3NBQA 1LV8A 3UAXA 1B8NA 5F7OA 4DA8A 5IU6A 3P0EA 3E9RA 2AI2A 4QEZA 4QARA 1PK7A 1Y1SA 1Z5PA 3OZCA 3OZDA 1M73E 4D9HA 1A69A 5FAKA 1ZL2A 1Z38A 1RXSA 1OU4A 4WKPA 1ODIA 2XRFA 4D8XA 1JE0A 1U1EA 1Y6QA 3E0QA 4OF4A 1V45E 3KVVA 2A0YA 1ODLA 1LVUA 1U1DA 4WKNA 1YQQA 5F76A 3OF3A 3EMVA 4R31A 4BN0A 4TTJA 1Z5OA 5CCDA 4L0MA 4F3CA 2A0WA 5F7XA 4UC0A 1A9SA 1RT9A 4DARA 4DA7A 4ECEA 2QSUA 2IQ5A 4L5YA 1K27A 1CB0A 5CXQA 1Z33A 4YO8A 1A9RA 2PGAA 3K8QA 1C3XA 3PNPA 4PNPA 2RJ3A 3UAVA 1Y6RA 3KVYA 4DA6A 1RXCA 3LA8A 1PWYE 5B7QA 5B7PA 5CYFA 1SJ9A 3EUEA 4LDNA 4F1WA 3BSFA 5JPCA 1JDZA 1OTYA 1TD1A 4E1VA 2HWUA 5IFKA 3FAZA 3LGSA 1JDTA 2OC9A 3C74A 3PHCA 3UAWA 5EUBA 3OPVA 1U1GA 2P4SA 1A9PA 4OY3A 1RFGE 1T8YA 1ODJA 1NC3A 3UAYA 1PW7A 1I80A 2QDKA 4LNHA 5F78A 4MARA 1RYZA 5F7JA 4NY1A 3DJFA 1PR4A 4L6IA 4OEHA 1JDSA 4OGKA 5F7ZA 3K8OE 3QPBA 5ETJA 4TXMA 1A9QA 2QTGA 1Z34A 1RXUA 4YNBA 4RJ2A 4GKAA 5CCEA 4L5CA 4IP0A 1OTXA 2ISCA 4F2WA 1SD2A 4M3NA 4TYMA 4F2PA 3NM4A 1Z35A 1PK9A 2H8GA 4GMHA 3OZEA 1RSZA 4D8YA 4M1EA 1WTAA 1JYSA 4NS1A 3OOHA 1YQUA 2OXFA 4OJTA 1PR5A 4WKOA 1TCUA 3DDOA 3O4VA 3ODGA 1TCVA 1PR2A 3MMSA 4R2XA 4DA0A 4BMXA 1G2OA 3IEXA 3NM6B 3MB8A 3KU4A 1PF7E 1Z36A 1VMKA 2AI1A 1PR1A 1T8RA 1V41E 4GLJA 5B7GA 1RR6A 1K9SA 4TTAA 5KB3A 1OUMA 3BGSA 4MCIA 3BL6A 4TS3A 3F8WA 4LKRA 3E9ZA 3DP9A 4DABA 4TXLA 4QFBA 4WKCA 3ENZA 1TGYA 1Z39A 4QATA 4GLFA 2HN9A 1TGVA 3IOMA 4TXJA 4DAEA 4L5AA 1ZOSA 1VFNA 4R2WA 5I3CA
chains in the Genus database with same CATH superfamily
3P0FA 5DHUA 3GFFA 4ILKA 1S3SA 1Z2AA 2D1FA 1ORDA 3INYA 3RSGA 3LL4A 3ZE9A 4F5EA 4FW9A 2VDNB 5IT4A 5SYMA 5KNBH 2I67A 5AW6A 1DVRA 3PA6A 5DBIA 3NAGA 3RVKA 2ID4A 2OOSA 2I7XA 1GQOA 1Z4IA 3AM3A 3VC1A 4DBZA 1UDBA 1GZ3A 1J24A 1O97D 1E9CA 2FWJA 3CX7A 1J0EA 1ZW1A 2HJHA 3G7UA 5EP2A 3AR4A 4M87A 2UYHA 2IWRA 4LC9A 5EFOA 5EHGA 3TE6A 3ND6A 2R96A 4H1HA 3IE1A 4P54A 3TSOA 3FDXA 1AQYA 2HJSA 3PX2A 2I1QA 2EGGA 3QP9A 1SKYE 2AX4A 2W6MA 2B78A 1SWVA 1E20A 1YB1A 4UEOA 6REQB 4LFAB 3DZIA 4N5LA 2CEAA 2ERYA 1AMNA 5B5SA 1ZN9A 2R47A 4NJMA 3RUIA 3LHIA 2X2FA 2QTTA 1K5HA 2SICE 4KXUA 2GBLC 1YR3A 2EJVA 2F7SA 1Z6TA 3CLUD 1XMIA 2DY0A 4TUYF 2VIIA 3RHSA 3WLHA 1WD7A 3W2IA 2Q0SA 2W6OA 1L5YA 1CE8B 2JLSA 1L3BA 2YWDA 3OECA 2IH5A 3FTEA 1EJ2A 3IERA 2X3YA 3C14C 1USUA 1NKVA 4R01A 5ALUA 3S1AA 1RLMA 2C99A 3DPSA 2V1UA 4TMYA 3KXDA 4BLVA 1H05A 2CK3A 2V98A 1ST3A 5EMHA 5MGBA 2B82A 3SE7A 4JX9A 1R0ZA 3CXUA 1JA0A 2X23A 3DEHA 3GF4A 1SXQA 3AJDA 3I76A 2ENUA 1ZQ1A 1E60A 2PU5A 1VJ5A 1OZGA 4OLFA 1JTVA 1GXSB 5EMJA 4DCUA 4YLYA 1N5RA 1YQXA 4LDRA 1HF3A 1Y7TA 3ECAA 1BXZA 3AXTA 4KJZA 4EFNA 3P9PA 4ZVSA 3TG2A 4GX2A 4HDQB 3UCFA 1DOZA 4J0CA 4M0MA 1UWKA 4IDHA 4ZAWA 2ZRNA 1NF3A 4ZOLB 1W1IA 2FQXA 2RHBA 1GPH1 3ESBA 3RAPR 3A6PC 2JCGA 5A03A 2IHYA 2JI6A 3ZZMA 1DQRA 1P91A 2IP1A 3DCYA 3LF2A 4HGPA 5JCPA 1E94E 3QHPA 4TZKA 1B1AA 1V1RB 1JSLA 1X74A 3C3WA 5FFFA 4CEJA 1WNTA 2GPAA 2BMFA 1PD1A 3GLSA 3R5TA 1XTVA 2QAGC 4PNHA 1M5RA 2QN8A 3NHFA 3L5OA 4JJGA 2DBRA 1IHXA 2HD4A 3JPYA 3R7AA 4CKCA 2H2FA 2JLWA 1W2WB 4C6TA 3K0SA 2A1IA 2J3IA 4TXNA 2R7NA 2MSNA 2V4ZA 1UINA 4CQMB 4UCQA 5IARA 1Y1QA 4DQXA 5K3FB 3K32A 3ZJTA 2PTGA 3EMKA 3L8EA 3PXXA 1C9EA 3N3BC 3RJZA 3EK2A 1NSFA 1XRPA 1S7GA 1W4CA 4IILA 4IHJA 4YJ3B 5EWLA 3VPCA 2PUFA 4PANA 4BC1A 2MYTA 2RHHA 1HFJA 1T2DA 1ISIA 3NVAA 1JEAA 2QE7A 4UJ3A 2E5WA 4YH1A 3PWZA 1SOUA 1EUYA 4ND6A 2DWCA 1W581 2ADOA 3N07A 3SYKA 3UO8B 3N8NA 4TYQA 4KRGA 3Q85A 1FTYA 1CDEA 1QG4A 1YE3A 2HJWA 2GPBA 1BXRA 3RIGA 4QDKA 4KSCA 1JQLB 4M9XA 2YY5A 5JYCA 1FW6A 4G1UC 2BGJA 2O2DA 4DR2B 3K4QA 3M3PA 1UKZA 3LWZA 2W2TA 3GYGA 2WJ6A 3SJUA 5SZHB 3VBEA 3IEKA 3D43A 4TTQA 4TS9A 2ZRBA 3RU3A 4BMPB 4ZYTA 1DIGA 3H6KA 2PLWA 3VZBA 3PIIA 2YJGA 3NHRA 3QW2A 4FEYA 2WG2A 3U37A 5FUXA 4H08A 1NW5A 4YXWD 3LQ2A 3TN7A 2EFCB 2FOIA 2J31A 3K09C 4U2KA 4YRQA 1DPFA 1F38A 3PR1A 4HQ0A 4A2PA 4KPEC 4FILA 1MZVA 3DOCA 1EUQA 1X9GA 4EJSC 1U5AA 1V2HE 2IXBA 2C00A 4G23A 4Q66C 3K70B 3PGKA 5HTKA 1T4CB 2ZB8A 2ZR0A 3BQNB 4CQLA 3T3OA 1UPUA 2JGDA 1EEXB 5G0TA 1GAEO 1QYVA 4A2QA 4DIFA 1K8RA 3WGLA 1HDXA 3DE1X 5AI8A 3EY9A 4E5NA 1ZAYA 4AJNA 1HEYA 2HSGA 1W5SA 1G59A 1QO0D 3NG1A 1EK5A 4NSNA 4K3UA 4AO7A 3I2HA 4EARA 4X66B 2BSXA 5K3FA 4LZZA 4BGUA 2PKQO 1Q6YA 2PX3A 2ZQZA 1P5ZB 1TZCA 2C4NA 2Q4RA 5TRTA 4KYTA 1CG6A 1DC4A 1U0JA 3HPRA 5L3SB 3FB1A 5KCMA 2DWQA 3A9CA 3GJXC 7YASA 5IH7A 2JG3A 4BO7A 1X15A 3X1YA 2R6DA 4L0QA 3PJFA 3GC6A 5CG2A 2UZ4A 1KORA 3GCDA 2OGTA 4LVNA 3TQTA 2I34A 4LQLA 4BASA 3M2TA 1RP1A 2AFHE 3CBGA 1AGYA 1ENYA 1JQJC 2BI8A 5COQA 2GEUA 5B2FA 5B4UA 1X7ZA 2WUFA 5L3SA 4IJQA 4YONB 1NIJA 3CB2A 1LV8A 2CHVA 1B8NA 2Q5HA 3QUSA 5JD3A 4C3VA 2VAXA 5LQDA 3AZQA 1T2VA 4G5XA 4YT5A 5AJYA 3IALA 1NBOA 3AL2A 3IQEA 4MRVA 4ER3A 3UB2A 5TQ0A 3A6JA 2P8SA 5I01A 3TLCA 4M21A 4J75A 4QARA 1VA5A 2V0CA 4YJGA 2IX9A 3F6EX 2P2ZA 2ZSBA 3PUKA 4EI8A 1GXSA 1E6LA 4I4TF 2W6QA 4BE9A 1JPJA 4QGAA 4JI8B 4AF6A 4ESOA 3OZGA 3PF8A 5C7OO 4NESA 1R50A 1L8XA 1QYIA 1E1QA 4YUAA 3LDFA 1M8FA 2PIAA 5FBLB 2FZGA 3FPLA 3K05A 4RLQA 4EECA 5A04A 5EHZA 2I62A 1R6TA 3LM8A 4IUBS 2C2WA 4D92A 5FBQB 3H6GA 1TQDA 2WWTA 3GFSA 5IXYA 3BRCA 5FOXA 1EUZA 3IA2A 4M0LA 3LW7A 1Y4UA 4LXIA 4X8MA 5EERA 3DFMA 4JC4A 4M8SA 1ZXXA 1VBFA 4OV6B 1SUBA 4DIUA 2BHRA 1ADBA 1EJBA 4IGFA 4MVJP 1ODTC 5F76A 1B43A 3VU0A 5IKXA 4BN0A 5DIZA 4CW7A 3PTZA 1N25A 1OH6A 5HK9A 5ANRB 4ND8A 5KPDA 1D4ZA 1KJJA 3FMFA 3L07A 1MOZA 4RV4A 4EUKA 4DUZB 1EDDA 4KOEC 1ETHA 3GOQA 5EUMA 1TF5A 2ZROA 3WHLA 5I9BA 5CFLA 2ZAYA 4COOA 2Q62A 4OMUA 3PFIA 4MPRA 2A9JA 3QVXA 4CYMA 1EE2A 3IPRA 3OD5A 4WNAB 1H2EA 1SNYA 1UP6A 2FR8C 4KFCA 1QH1B 1Y34E 3KKOA 2IHUA 4NFHA 2JFOA 4QYWA 1EWVA 3NALA 4C21A 3ZCQA 3OE7A 3EIHA 2CUTA 2YDYA 4FFPA 4ND7A 1K27A 5LZ4A 5LVAA 2ZBQA 1CB0A 1R74A 3UGKA 1T4BA 4BFYA 5JEDA 5J2TF 1PQ4A 1RWXA 2EDCA 2G6BA 3AF2A 4ARBA 1Z33A 2XHEA 2AL7A 3PL5A 5ER9A 3EQ6A 3ACBA 1FUYB 1C3XA 3N7TA 5LXTA 5H83A 2ZEJA 3EA4A 3IVRA 2O19A 1E9AA 2ORED 3ENWA 3AUKA 3WLEA 1EE1A 2HRQA 1PDWA 3TB6A 1Y6RA 2II6A 4FDVA 4HZUA 5IAKA 4DG5A 2PUBA 4DA6A 3FCOA 3K7EA 2HR1A 3C4QA 3DWGA 1AKVA 1M8GA 2AVDA 3I73A 5IAOA 3THYA 4PGFA 2MSCB 3NJ8A 5FTJA 3D1LA 1R8YA 1W88A 5CIQA 3HJTA 3NASA 5DTQA 1MA3A 1ZOOA 2QY6A 2Y6VA 3DD1A 4C2TA 1BMTA 3OZFA 2EU8A 2PVCA 4XOUA 3VTZA 4ON9A 1CY6A 5SICE 2ZUBA 4UPEA 2PZFA 3HEAA 2P5SA 3KQMA 2FN4A 2RGGA 3P9XA 4JGGA 4BFWA 4FQ8A 4WOJA 2GXQA 3CLSC 1DBIA 4NYMR 4XASA 1XTZA 1ZESA 1YI8A 3IBGA 1O8CA 3LHFA 4I8DA 3ZX5A 1U3FA 1YD7A 4WLEA 1IG0A 2LIPA 2R1VB 1JG1A 4H1UA 4FJ1A 4E33A 1PV4A 3TW6A 4MWDA 3L92A 4GZMA 4AVYA 3AF0A 3BRWD 3GUCA 2XMGA 1U4OA 3GL9A 4QTXA 1YGYA 1YZYA 4QXQA 5ESDA 3TNLA 4RDXA 1ZBDA 1JEQB 3MGKA 3ONDA 2DQSA 2G77B 5BYJA 4X90A 4JI3B 3CKMA 1XDWA 3LQQA 4DXHA 3RWMB 5KS2A 3D8RA 3SHTA 3LCJA 4W8OA 4AS1A 5JBIA 1Q3HA 2HSJA 5AVVA 1QKKA 2RHMA 4XM1A 2IYRA 1U3GA 2HBQA 3TZKA 5DULA 4YGYA 1GCAA 3BAZA 3AR8A 4Q4JA 4X0EA 4AN4A 1A4IA 1EK1A 1N2BA 5CNKA 2X7XA 4W9NC 5F78A 3RYIB 1RMQA 3T5DA 1XF1A 1N2EA 4RHXA 2CBGA 2FUEA 3F3SA 3NWEA 4W82A 5COAA 3SZ3A 4B83A 4LX0A 3HY6A 4NJMB 2W0MA 1VB5A 5B64A 5IYZB 4BQSA 3CRMA 5BR4A 2F55A 4RUKA 2HDWA 2QVYX 3GJ4A 4ICIA 1HE1C 2EL9A 3I1JA 3F5MA 1U9CA 5DHAA 6REQA 3B6MA 3TQFA 2PGLA 3ZDAA 2R8YA 4IGAA 5HJ5A 1T3HA 1XDGA 1BN7A 3B5IA 3JD0A 1SCDA 4EJSA 3EXHB 4FGZA 1RIFA 3A06A 1FS5A 4QRDA 2PUCA 4NBLA 4I9UA 1GTL1 4KQGA 2IEAA 3K9WA 3WK6A 2YCLA 1ESCA 2Q4OA 3C3JA 3HKCB 1QK3A 1M2JA 2A0KA 1ZRMA 3K35A 2Q2NA 1F48A 1GUZA 3KJZA 3GFRA 2JVKA 4ZVQA 3RREA 5KU1A 3AMVA 4MGHA 2I2CA 3TL3A 2HB6A 5FUWA 5DFAA 1U2RA 1DV2A 2CHGA 4HDCA 1XEFA 2YQZA 3L49A 4DMUB 1GZSA 1PK9A 2OCPA 1TOAA 3NORA 4FONA 1IN7A 1S0UA 5AM0A 5BSEA 5FWAA 2XA2A 1DAEA 3CNBA 4WGFA 1JSZA 1YR2A 4DMCA 4YRNA 3WLAA 5FPSA 4KGXA 2D74A 1HY3A 4KMOA 2E37A 3HR4A 4TLCA 5TJHA 2GLUA 1T5HX 2ABWA 5AKZA 5HKLA 3OCYA 4G84A 4TV9B 4H0NA 5H82A 4XW2A 4F45A 2OQVA 1G6Q1 2FAXA 2HYDA 3AOEA 1BQ4A 1JMVA 3ND9A 3RQIA 1G38A 1PZHA 3H9QA 4EFMA 2E4XA 4KLAA 1EA5A 1P4JA 2EF1A 3K0KA 2FUKA 2G7MC 4UHBA 1AN0A 2D3TA 1N6IA 5ADHA 1Q6ZA 3H86A 4OUDB 5DM2A 2V6FA 2P68A 1KDPA 3ILVA 4A0GA 4DMHA 1BW9B 4WKOA 4HGOA 2PZ8A 2ZSJA 3Q41A 4CI0B 1C3OA 2VLIA 3NATA 4JXKA 4N01A 4ZJYA 2HLHA 2OILA 3PYLA 2K5UA 3GLUA 4NJOA 5BRNA 3I2YX 3GAMA 3EWAA 3HKBB 1T2EA 2RHGB 4RABA 4ZI7B 1YB4A 1JIXA 4J2TA 1GOTA 4E5KA 5E1DA 1W0KD 3FXAA 3HB7A 3GRZA 1R9MA 1YZFA 3AONB 3WYBA 1KY3A 4N5HX 2Q5EA 4RWEA 1O2DA 4EKYA 5AVUA 1P1BA 1JKJA 1Z36A 2FNAA 2ZYHA 2VZ0A 3G89A 1SXPA 2OXCA 1E7SA 3A6GA 2BZSA 5TVGA 1NQWA 1K9SA 2G76A 4TTAA 3KUXA 1IJFA 3IO5A 1KJIA 3RHFA 4B3RB 1P6UA 1E2JA 3PC2A 2Y99A 4F0JA 1JAYA 3Q3JB 2ZU0C 1HKUA 3TF5A 4DMKA 2Q49A 5TSDA 2Y1OA 3K6SB 5BVGA 4EHBA 3ITNA 5DMXA 5I7HA 2ID7A 3H4TA 2NVWA 4R9NA 3R9KA 3IR5A 4US2R 4CEIA 3NGLA 4DV3B 4RD1A 4XCQA 1VE1A 4LEIA 3ADOA 3WI7A 3IOCA 2B2XA 2DFVA 4A9AA 4AY3A 5CPFA 1WX1A 4WOBA 1OXBB 1BVYF 1TGVA 2V7EA 2XZDA 3OVMA 1G66A 1QG6A 3E27A 1Z47A 1PWXA 1Z88A 4WINA 3LIIA 3PQ8A 3W77A 2J0QA 2VR1A 3ELDA 1VDZA 3ORSA 3QU7A 4O2BA 4Z8YA 1VL1A 3E3AA 2FPOA 5ALQA 4YPVA 2Q4TA 3PL1A 3EBOA 3HWSA 1V2GA 2P9CA 2ZS8A 2PAAA 3N8IA 4HWKA 3MILA 4QEKA 5BVHA 2ZSHA 1JG3A 2DUJA 4YAUA 4TT8A 621PA 1N2CA 2ZR9A 1C80A 2PK3A 3MOGA 2J45A 3NBAA 2A0XA 5MDHA 5CFPA 2ZFUA 2DUNA 5C4IA 3IDZA 1REQB 4HUQA 2PUGA 1GPJA 1IE3A 1UL1X 3BIFA 1JKFA 2EX1A 3DGEC 3AX6A 5KSZA 2HRDA 2FFHA 4LZWA 1RYHA 3UHAA 1DIRA 1GFWA 4AWXA 1S1CA 4EY6A 3OMXA 2GPJA 5JS8A 1H2XA 1NHWA 2WT4A 3NO4A 2DWUA 4N4AA 2YFQA 4OHUA 4PNEA 3WRVA 1QOPB 2GR9A 3T3MB 4D41A 2CCGA 1FYXA 1ZGHA 2EYQA 3C5WP 5LQKA 2QVCA 1KPIA 4I99A 1KI6A 5LL6P 3ANXA 2WU0A 4D79A 5JO0A 5GGXA 2RD2A 2O2XA 1Q7CA 3T0FA 5EXEA 1UPXA 4JVMA 3WV4A 3AHFA 3VYVA 2Q5FA 3UUFA 5EMMA 1P2TA 2DF8A 2HV8A 4B40A 3L7AA 4XEUA 1G1MA 2C57A 2WWWA 3TIGA 3CNQS 4JZKA 4V0ME 3BIXA 3LWDA 1C50A 1IIBA 1QR6A 4RF5A 3UMFA 4P92A 5IT9A 1BCRA 2EJTA 4IF4A 4LWQA 1H6DA 1V3UA 4RVFA 5ALWA 2ONZA 4H1WA 2WQ6A 4L8GA 1LPOA 3DTYA 3EZYA 4RXTA 2RFLA 5CB4A 4D4MA 2QLBA 4FLEA 3UMMA 1JQKA 2P1RA 4PG5A 2B3DA 1U65A 4FMBB 4XEHA 3KQYA 1LZKA 4WNIA 1TA0A 3KFLA 4IIJF 3BK7A 1X7YB 1FFAA 1G5FA 4PC3A 4BJ6A 1DDGA 2AN1A 3UT0A 4Z7OB 2FZ4A 1RXYA 1VFPA 2CLKB 2N1BA 2F1IA 3I5XA 1O96B 1QVVA 3AR3A 4KP7A 1QGDA 5FPYA 3R0VA 4EBFA 4MV9A 4X8LA 1A5AB 1FOEB 3E15A 2O7RA 1BQ3A 3RFCA 2QTHA 4FFLA 3TDNA 3PNSA 4N6GA 1GEGA 1M74A 3JWGA 1O6BA 3U4MA 3Q6IA 1ZXLA 1Z8HA 2CLSA 2WW8A 6ADHA 4U39A 4HN9A 4ALIA 4EW1A 1J8FA 1M7BA 1XVAA 3BHIA 4AQ7A 3D4PA 3KU1A 5KOYA 3FETA 1I7NA 3FFTA 4PBRA 3EIEA 1RHJA 1EVLA 4PQGA 1CYEA 5D3MB 1KHHA 4MRPA 5DWVA 3RFVA 1QHIA 3V97A 1E2HA 2PFKA 2WHPB 3Q2KA 3YASA 5I8PA 2BZ1A 1ZX1A 3B3JA 2WINI 3N87A 1XZQA 5AXAA 1Z9BA 4PFJA 4KVAA 1JI3A 3G82C 5JNVA 1GPWB 4DDKA 1WU7A 2ZAOA 2UDPA 4GKBA 4YRBA 4GMFA 4BO3A 1Y9EA 2XBMA 2QRJA 2CV1A 1GGFA 3FBTA 4N3NA 5AW7A 5DK4A 3LYUA 3UK6A 1ZN8A 1TEHA 4OJMX 1UMCB 4XDZA 4BJHB 4UTNA 4G41A 5FULA 3L43A 4G01B 1JG4A 2BFNA 3LX5A 4UREA 5K51A 2XTNA 1SHZA 1D8AA 4M38A 3VSCA 2ECFA 3DQZA 3K2BA 1PG2A 4XRGA 2CZGA 4K2HA 3WKEA 3SVLA 5U1PA 5F3WB 1AM4D 2LP4Y 3QITA 3CCBA 1CUGA 1D5CA 1UKBA 2WFZA 1GRCA 2RHJA 4RQTA 1MVOA 4AXXA 3LRXA 2AUTA 3H83A 3WY9A 4ZYZA 3KR1A 2BEUA 1KP2A 3DBRB 3UAZA 4R2KA 1IHOA 3M7IA 4P3YA 1FP4A 1J97A 4UHDA 1RFLA 2ZRMA 3M0EA 1WW3A 3QF4A 1R4MB 2QN2A 2ZRLA 1DO2A 2XB6A 2IIQA 3ROTA 4DTCA 1BE1A 2V0NA 4KR2A 3WLLA 4N9QA 1DPGA 3HK2A 1ECPA 1TMYA 2L17A 3HWRA 1COWD 2JH9A 3IDFA 4LDAA 1J23A 1V8BA 1CZHA 4PBTA 4X91A 3KQUA 5JYEA 1MTZA 4TXHA 1RVDA 1KGSA 1NVGA 1JH9A 2PPVA 1HYBA 3CUUA 3Q0TA 2GBGA 4FDLA 4ARZB 4DSUA 1D2NA 5B3LA 3IRVA 1M6NA 3WDSA 4UTPA 5YASA 3MXTA 3SIRA 3STXA 1E9DA 3KJXA 1AS3A 2HMUA 2OHHA 5B57C 4N39A 1VG0B 3FMPB 3BRWA 1AB5A 3N9IA 3NXSA 1MC1A 2C78A 4LQDA 4XFDA 5HIIA 1DAHA 1MOQA 1ZI8A 2C4VA 3B5EA 1BYIA 4ALKA 3HZHA 1UXOA 1XJWA 3D6JA 3EBLA 2O6LA 1UKVY 1UQTA 1X1AA 4G0UA 2A5DA 3JQEA 1E0AA 1WP9A 3R3UA 2WD9A 2R6AA 3DLTA 1LLQA 1RYDA 4US1R 1SVKA 1XZBA 4JOBA 3LECA 2V8OA 4C3UA 2XY4A 2R0QC 3RYFB 1RQLA 1P0FA 3FY4A 4KTTE 3ENKA 4PHCA 5C7YA 1T2UA 2WLTA 4MRRA 2LW7A 1IUKA 1M67A 4X6YA 1ZUD1 2WTUA 1HM5A 3NUZA 1DELA 3A1VA 3C2QA 5D3MA 3ZDYB 2X5KO 3ZXYA 5G0UA 4AZ0B 1JXMA 3M4JA 3ZTTA 5K6TA 5U9CA 2Y76A 4BUCA 4FWTA 2JI4A 1AY0A 2C5EA 2XBUA 4RCVA 1HZZA 2WUVA 2JGFA 3R6TA 3LUDA 3ADDA 2WMNB 4YT4A 2ZB2A 4LOAA 3UIEA 2AEMA 1MG5A 1G41A 3RJ9A 2Q3BA 1BQEA 2PQ6A 3N2NA 4XQEA 4HH4A 5GM2A 4AFNA 1DQZA 3IKMB 2AI2A 2ZM6B 3EJ6A 4JK3A 4B7XA 3GJTA 4MUXA 3RTEA 3TX6A 3DE3X 4FJ0A 3BRSA 4DEXA 1QYRA 4CTMA 4KYIB 3P52A 2MYNA 3RFXA 4R71A 1QOZA 1E2PA 3S5JA 1DKLA 3TQHA 4ZDJA 3T5PA 3IUQA 4Q3AA 3KEMA 1F2TA 4WCFA 5AW2A 3ZWPA 1G2IA 4DJEC 3UEOA 2KS6A 3EGEA 4LRUA 5JCOA 4DCCA 4MRSA 4EZEA 1IUPA 1OU4A 3A6ZA 3A1EA 4QVGA 4QVIA 3CJQA 5JZBA 2R5FA 4L4SA 4X00A 2REOA 4U7TB 1NTRA 4XWTA 3TVDA 3ZLTA 1NXXA 1E4EA 3BTUA 4XJSA 4LYJA 2YBDA 2PVSA 1YQWA 4JC5A 1VL5A 4NCHA 1LSOA 3DD5A 1HT2E 5JDCA 2CMKA 4GGMX 4ZP1A 1VJ1A 3ABOB 3IRUA 4LDZA 2YH2A 3TAXA 4E7OA 3RRXA 1W94A 2ZJ4A 2AJBA 1DJQA 3C8MA 2QN9A 1S3FA 3G59A 2VUIB 4BVBA 1JEEA 1PX2A 2CL7X 2BF7A 2IF2A 3UWPA 5LSAA 5BMOA 2EWMA 3W5UA 3AFOA 2Y1GA 2DULA 5DLDA 3Q2OA 1JHDA 2JA1A 3BWEA 3O8QA 2JLZA 1P2BA 2OGZA 5LZ5A 3IIJA 3OPMA 1Q19A 3KR2A 4U2BA 4GXQA 4Q4HB 3K70C 4JYMA 4QUDA 1AV7A 3TTUA 5F2KA 3U7RA 1NQTA 2J85A 4YAJA 4BRWA 3KWLA 5B53A 1PL6A 1W8IA 4AZTA 2B34A 4Y6LA 1DWOA 1HGXA 1NULA 2O23A 2CBZA 3N58A 3GRUA 2QTBA 3VMMA 5BY2A 3AUYA 3HFJA 3I3OA 1E7YA 4X1OA 1UC4B 2NOAA 3KQQA 5HJ2A 2WMOB 3IIEA 4DT1A 3E7WA 8ABPA 2PGAA 3K8QA 1Z18A 4PN3A 2XCIA 1VC2A 3RRZA 1DEXA 2XVAA 2AEEA 3RT7A 4Z99A 1EUCA 1D2AA 5D5HA 4PZAA 5HUJA 3MJVA 3QX8A 4LV8B 5CFRA 2EAUA 3BWYA 1BD3A 1RKUA 2BONA 1O54A 3QWHA 3VR1A 2X15A 3V3KA 2RGCA 4FJ2A 2G8NA 4OPMA 4WXRA 1SVSA 1VG8A 4RVSA 1YH3A 2A35A 3GFGA 3V7NA 4BEBA 1CR2A 5DM1A 4BU0A 4YDQA 4QA9A 1BDBA 2C5AA 2Q27A 2BLLA 3LVFO 4JOCA 4Q12A 3BFKA 4Z3OA 4CGZA 1ZK4A 2G8LA 4TKZA 1JSRA 4O4LA 3NETA 4UZFA 4EHIA 1LEHA 4IXWA 3UCXA 5KYGA 2DZDA 4E1VA 5CD9A 2WMDA 3TCKA 2JK0A 2NZJA 1EVJA 3AOEC 3D7NA 3NVMB 3RIYA 3I6ZA 1A04A 3UM9A 4RK7A 3UTCA 5L7WA 4DV4B 1AUPA 1RM5A 3IAM6 5CB4B 4BUZA 4PLGA 3T9BA 4NDAA 1DX6A 4EG3A 1RM3A 3BGDA 4F85A 2ZT6A 3T52A 5H9WA 3SXUA 2UVPA 3UAWA 1I2ZA 1UBCA 1Q0PA 4UVGA 3OPVA 5K3AA 1CJUC 4RZUA 1O0SA 4CMBA 4RLHA 1NATA 3FHJA 1A9PA 3OM1A 4YCBA 4DQKA 2H3EA 3H9JA 5FBVB 3U7GA 1DSSG 1FP1D 3BMNB 4OHXA 5AVJA 1WMFA 2PUAA 4LSZA 3PQ4A 3SDSA 4HLUA 1I9GA 3MGBA 3SEZA 3OO1A 2CY0A 5B1DA 1MX3A 3OU6A 3KZOA 1R18A 4Z9FA 1DIOB 1MORA 1ZJ4A 4PU0A 4E1BA 3RIHA 5IMSA 1UAGA 1E6UA 3G2HA 4J3JA 1XZDA 4J1NA 5A71A 1B14A 3OOYA 1Z3CA 3M6FA 1RJWA 4ZI7A 5A0VA 1GUDA 1KK3A 1O6GA 1GVNB 1Y5LA 2WZCA 4Z0HO 1ZGBA 1VECA 3P2JA 5AVOA 3W3AD 4ZTBA 3ZU6A 5LR6A 1BKDR 3A14A 4L28A 4QDOA 2CLLB 5FO0A 3HJGA 1VE7A 3E2MA 1Y3CE 2WD7A 3A1TA 2F3RA 3S68A 2YKGA 1ZCJA 2GT1A 2FHPA 2C03A 4Y1FA 1HXHA 2NSYA 4UDXX 3AW9A 4RHYA 3OIDA 4CDGA 5KNCH 4N12A 3A0UA 3BEOA 3AM4A 1HEIA 2DH5A 3F4BA 4O4IB 2OCLA 4MPDA 2BGWA 1YU6A 1C14A 1WUTA 1UXKA 1YBHA 1Z63A 2UXDB 5FXMA 2C8KA 3WYAA 4I4TB 3Q7SA 3QGMA 3WGYA 2QBYA 1YSCA 3D8BA 1DEOA 3GZNB 4FDUA 5LD2B 1SCIA 3NOXA 3WWPA 4CIWA 4XX1A 5EE9A 3KXPA 2WYUA 1L4EA 2XE8A 1KF0A 3QPWA 3I0ZA 3FNIA 2ZIAA 4URWR 2ZBFA 1QFSA 1H2WA 5BWBA 1IOWA 1OU0A 4JNCA 5JJIA 5KWVA 4WEQA 1BXGB 4G0XA 3VU8A 2HA0A 1WR8A 1XKXA 2O7QA 4INZA 4XB6B 2R6GA 1QCDA 2ANBA 5CLFA 5K2OA 1OJLA 2VNHA 2LTAA 1Q7TA 3OZEA 5F23A 3HH8A 3VNVA 2CNWD 2GKSA 4D8YA 4OLBA 1EG7A 1P7WA 1KARA 5DWDA 5DGIA 1EFKA 3CE9A 4PG4A 4LV6A 1G1AA 2YWBA 3QXJA 5AK0A 1SUCA 1ECCA 2MWMA 1SULA 2OO3A 3PYXA 1TKAA 2P9GA 4JBNA 4OBXA 5ALLA 3T3IA 4KO8A 1UJBA 3FKSD 3HDTA 4PLFA 4BO2A 2RHRA 5IAJA 2O3SA 1B6GA 3BF8A 2RHDA 3VKFA 1KSFX 2FA9A 1PR5A 1LBHA 1J5PA 3T4PA 2XCLA 3WBBA 2FXVA 1G20A 5ALMA 4P81A 4I1UA 4BFCA 4R2JA 4C4RA 3MCWA 2TRSB 5HW0A 2GM3A 2IUFA 2O7SA 3GV0A 3P7MA 4D56A 2GYVA 4EFLA 1YR7A 2BLNA 4R4JA 5KTYA 1KEEA 1B6TA 3IEXA 2P6RA 3MB8A 4CU2A 2HA6A 1A3CA 4QNMA 3SMQA 4YHHB 1SG9A 2M6LA 1DFHA 3AFIA 3VSDA 3TSYA 1BVHA 2AOVA 4HG2A 2ZWOA 2A30A 3FPCA 4ISBA 3H1EA 4K8RB 4Q5IA 2R68A 4FI3F 1UMBA 3O5AA 4Q9HA 2BFFA 2QRMA 2A67A 2OZKA 2D2EA 3O4HA 2I4LA 4MCIA 1NI5A 4KO2S 4P7FA 1Q0SA 4LC1A 3WYNA 2XYHA 3RVBA 1SU4A 4UAVA 4GMKA 4XIIA 2Y9PB 3NBKA 1KH3A 3HDGA 4AKTA 3LV8A 5ESWA 4LF6B 3AVWA 4KV9A 3CVJA 1A7AA 2PL5A 1FVXA 4MB0A 4XD2A 1GA6A 2RKOA 1D2CA 3A4YA 2C9YA 1SUAA 4JP3A 4B2LA 3A2LA 4MUNA 4DDVA 5I45A 3G2NA 2DHDA 2FGKA 3OIWA 3AR6A 4TLMB 2NXNA 3COJA 3FR8A 1JIIA 1YS6A 2BUBA 5D3ZA 4MCAA 3GA7A 2HV9A 1E69A 5THXA 2Q6OA 5HGXA 5EN4A 1ZH6A 3ZTYA 4BOYA 4FLMA 1CT9A 3L2OB 1TCAA 2WYVA 4F96A 1H3NA 1ZOSA 2DJ5A 2F1KA 4QELA 1ZJYA 3BMOB 3VYTB 5LYJB 3E7XA 1VYHA 3A2MA 3O91A 1CP3A 3DKVA 3SE0A 4EWLA 1HA3A 1RZRD 2I80A 1IATA 4MVYA 5ILQA 4OH1A 3EB9A 3PFFA 4V2UA 5EWMB 3V80A 4A26A 4DGQA 2BGIA 1GU7A 3ZDBA 4Z6KA 3DL0A 3PZBA 1OIXA 5M3BA 1A5TA 3UB3A 2HSZA 2AE1A 1Y37A 1SY7A 2IBMA 2C2KA 1DT5A 4AP6A 2NTEA 4XCXA 2CVZA 4IRUB 4J16A 3DPIA 3RFTA 4LZOA 2A5GA 3AVPA 3GPBA 3SF0A 1PE0A 3CX4A 4YGXB 5B30A 2OCXA 1PGJA 1JZTA 3HGTA 2C2GA 1QANA 3TH5A 1UANA 2YY6A 2RAFA 3PSHA 3QEKA 3DAGA 4HGNA 4ALJA 2Z8XA 4Y2VA 2SCUB 4MAFA 3G9TA 4LYGA 3B6EA 5GVSA 4N76A 3EPHA 2B0CA 5IYZA 3TVTA 3SJBA 3WBJA 1FFYA 5TMBA 2CL0X 1TPZA 1XNJA 2A5LA 2GNAA 3TXAA 2CHEA 2Z30A 3GHHA 3R0QA 4I5DA 4P2GA 4Y2SA 4CI9A 2ZSIA 3ABSB 2QW0X 3THWA 1WCYA 3N5KA 4KIFA 4D0SA 2NN3C 1EXNA 4KN8A 4BVGA 4R40A 1V96A 4I1RA 1HT0A 1YZQA 5EMLA 3J7AC 4BDSA 2GXUA 2H7VA 4RYDA 5FTLA 2GN8A 2ATXA 2VH1A 2VEDA 1R5JA 5AW3A 2RHOA 1IQ0A 2HBYA 3DO8A 4L57A 4Y7DA 2FPMA 3TFOA 4B3SB 1GFZA 2IZ0A 2XUKA 4K6GA 4HO1X 3T7JA 3S2ZA 5DN6D 1EESA 1LSJA 4C1BA 4GFDA 3OCVA 4CM8B 1PFWA 1LY1A 1AKMA 4BJ5A 5HTOA 4II2A 1VHWA 2DBYA 4F60A 1JIQA 4R41A 3UWSA 3RDPA 1B7GO 2RGXA 3DMRA 5BMVA 1YVUA 4LBZA 5EPUA 4LECA 1U9ZA 2HH9A 2QYHA 5ITZB 1BOFA 1AC5A 3J81k 2CMDA 3HUFA 3V8NA 1ONOA 4QASA 2LKDA 1QQAA 1RQRA 4HRYA 3FKJA 4RORA 5JH7A 4FCVA 2DQ4A 2AOXA 1C7RA 3BCHA 1AKYA 1JLLB 2H31A 2QXYA 3NH6A 1HLFA 4TMXA 1HL7A 3DL4A 1U90A 3I5YA 2FU5C 1T43A 4AY5A 4NHEA 2XXAB 1W1WA 1EINA 3E05A 4XVRA 3SXPA 1Z0KA 3PITA 1BJKA 4RS3A 2DERA 3EZNA 2BBTA 2LBPA 1LBSA 4LVOA 5GV7A 1X0VA 1UOQA 3MRVA 1DEAA 2XUGA 2OY0A 2YRXA 1L7VC 1UKYA 4UCXA 4HAYA 4V2IA 4CKBA 1ZCFA 1EP3B 3V1YA 4KQHA 2AOUB 5BV7A 2UYYA 1FS4A 3B13B 4QBIA 4KXFB 4TX1A 1GG9A 3AEXA 4BKQA 4DSOA 1XEWX 4IKPA 5IVIA 5K3EA 2XQJA 4MQMA 4JXZA 1JAHA 1G8YA 2WPDA 1AF7A 4UM5A 3RC9A 3RRMA 5BWOA 1JEDA 1PN3A 3CUWA 2FPPB 3JVEA 4IIJA 3ILYA 4QUAA 2ATEA 3U7QA 5BN4A 4XD7D 3JZIA 4UNIA 1I13A 2FUG1 3D6FA 1S5PA 2AZ4A 1IBKB 4YJHA 3SFZA 4NOKA 4M2LA 3LA6A 4GM0A 2HT1A 1NLYA 3N05A 5KOJA 3E1SA 4G2NA 3F5FA 2YMPA 4LF9B 3DFIA 1U6JA 1PR6A 1Q15A 4HNTA 1ESEA 2QMZA 2BOVA 4LF8B 2N46A 2B8WA 3QVOA 1Z08A 4FT4A 3ABRB 4M9QA 1II9A 2FPKA 4RBNA 4A27A 2NV6A 4CT0A 2JI9A 1TLLA 3QI2A 4MNTA 4RH3A 2A6PA 1TZ2A 1ONPA 2Q7XA 4S24A 2YJTD 3DOHA 1N0VC 5B1HA 1D04A 2H2GA 2TMYA 1WF3A 2ZS7A 4DBLC 3HY3A 1F7VA 1JPVA 3AFGA 2CDAA 3L82B 1OB2A 1FQKA 1HQYE 1SZPA 3FBGA 4EPTA 1N32B 2A1UA 4KVGA 4H4CA 1C7IA 3QK7A 3TXYA 2FLVA 4CMIA 1U4NA 4EB6A 4GEGA 1K63A 1SC1A 1WMAA 3CW2A 1WXWA 1L7QA 4F91B 1XFAA 3RU7A 1SC9A 4X1YB 3WISA 3WYCA 3W1VA 2B4KA 2X2EA 1GLVA 1OXUA 1Y7HA 2GLXA 3G8CA 4QAQA 2H7YA 5EKXA 1NOKA 1KOGA 2TSYB 1G4HA 3BS4A 4IDQA 4FHZA 2PL9A 4Z3DA 4IW3B 2MHCA 1AQ6A 2AN5A 2VYND 3QVJA 4HBGA 2HLNA 4A03A 4E07A 4ZJPA 1J8MF 5HR5A 1KZ7B 4NZNA 1KFKB 2CUKA 3M3HA 2JFGA 4EQ6A 3K0BA 1YONA 1NJGA 3EZXA 3KKLA 5DNDA 1T8TA 2K6GA 4HNSA 5K3CA 3EVBA 3KT3A 3PGMA 1Q84A 1WEKA 2QMUA 1KOJA 3ITKA 2QT1A 3GGSA 2VP3A 3BD6A 4JB2A 1Y6JA 3KKEA 2O05A 4TL9A 1RLIA 2GYWA 1MRSA 4ZI2A 5L8VA 1PUJA 4AZ3A 4AX8A 3K72B 5A02A 1ODSA 4S1PA 1VBNA 3P45A 4FFOA 4MWBA 3IHKA 5E4JA 1O7JA 2JH8A 5LQAA 4ZA2A 3A6KA 3CX6A 2VPQA 3PKZA 4MROA 1RLTA 1RQ7A 2J6CA 3FN4A 4XIGS 4IQGA 1M7GA 5KWEA 4A4DA 3LCRA 4MYHA 1V7QA 3DTVB 3I0MA 4R2LA 1E1CA 2YQ5A 1NYRA 1GDHA 1LPNA 2ZRHA 5AW1A 1UK7A 1KERA 3BXPA 4S2UA 5ITZA 4EB6B 3BMXA 1VPWA 1FQJA 3GCZA 4B4DA 1QB8A 3KQSA 4ARSA 4MRAA 2H2WA 3LCMA 2GN4A 3WL6A 3VOAA 4ARIA 1E6MA 1IHUA 1OX4B 5HX7A 5IJ9A 2M32A 4RVCA 4RLFA 1VSVA 1Y6QA 3IUMA 1PQUA 4HDNB 3GCWA 2Z2KA 4L8WB 5BSTA 1XZPA 5K99A 3GLGB 1V45E 2DFLA 1MFPA 1J2YA 2O5CA 5DGDA 1O6ZA 3DBHA 3V4PB 1M1XB 1L5SA 1Q0UA 3ZVKA 2YFKA 1SU8A 1Z7EA 1F60A 3WJ7A 1QB7A 3IHWA 3ME5A 3D3EA 3E5HA 3CR8A 5LDDC 3AHDA 4MYCA 1FDOA 1WZNA 4ZC8A 5K09A 4F3CA 3AUJB 1SUPA 4ZCMA 4TTRA 4UD6A 1FMTA 4WAUA 5EXXA 1L5KA 4KKVA 3ANTA 1WZ2A 1TKCA 3EMDA 1DEKA 2P27A 1XVUA 3IELA 5GQSA 4Y6SA 4BLOA 3KXKA 2FF7A 1HR0B 3TUJC 2GM5A 4BZQA 1IC6A 4EPRA 1K7SN 5KMGB 4JLUA 5L6MB 3H5RA 4BNJA 2YHIA 2QJOA 4ZI3A 3ABZA 2WR8A 2P2SA 3FFWA 2Q99A 4RQAA 5FUYA 2I4NA 3L6DA 4R1LA 5BQOA 3WWZA 3FWZA 1UFVA 5HKOA 4N7JA 1KVQA 2GAIA 5TEWA 3U3XA 3ZY2A 2OFFA 1OLSB 1WVMA 3HUUA 2OFPA 4FN5A 4B2YA 2CFSA 4CG1A 4C22A 1RU3A 4ROSA 3B7GA 2WWXA 4K9OA 2V6JA 4Z4GA 3H97A 2IU6A 1B6RA 1R8SA 2W4MA 4NC9A 5IHXA 1LKZA 3SC4A 4UPDA 4J03A 4DLRA 3G5LA 5KDOA 3ZCVA 4EPYA 2P9EA 2QJRA 3BDIA 3C5EA 5J9FA 2IXDA 2GHRA 2GO1A 4EYSA 1P1CA 3MMXA 3TTYA 3FYTA 2Q3EA 1FVHA 1V4VA 3J81A 1EA7A 1YL6A 3ZIUA 4BNDB 4CUZA 4ZXPA 1RWWA 2IL1A 1EFUA 4WLOA 5EXDA 4DYHA 1K5GA 4H1VA 4MEJA 4YC7A 3CIFA 4R2MA 2ZQYA 2Y0CA 1LQTA 1SHTX 2F90A 1KH2A 1YR9A 2F1HA 2UVDA 4IIDA 2ZXFA 2CNWA 3CC8A 3I04M 3R3YA 3RSHA 5BMVB 1M72A 5CGQB 5U4QA 5TT1A 3BJMA 2Y1EA 1ZGAA 5HCIA 3ZDCA 1BE8A 4HLDA 1G9XA 5ER6A 3WMRA 3E3LA 5H8WA 4M8KA 1CDDA 3ITEA 3STVA 5KTPA 1G5PA 4OHRA 3COSA 4MV3A 5BO5A 4XTRA 4ZCSA 3D7SA 4DWVA 5BXYA 5CT8A 2EKPA 1IULA 1AS2A 1EUDB 1ISHA 2QTVB 2UZ1B 3SQWA 2Q9BA 5EZYA 2JGEA 1U7PA 1XTIA 1MEOA 2JBAA 4JLVA 2PH7A 5D2CA 4KIJA 4DTIA 3BWMA 1R10A 4FP9A 4C4SA 2HMAA 4IO1A 4KEAA 1UOOA 5BYBA 1PL7A 4GPD1 1LI7A 1RM4A 1SC6A 2DHCA 2A2ZA 4H18A 2HCTA 4PO3X 3B48A 2Q0QA 1LI5A 4GPZA 4QE3A 4TUYA 4X71A 1XRLA 4G0QA 5DGHA 3ELUA 3U1TA 2XUPA 4L3OA 4JVSB 3UV7A 3WZLA 1BMDA 1JR2A 1E6WA 4M98A 3OJ0A 2VPXA 1B15A 2EZ8A 1NI4A 3LDGA 4LYDA 2SCUA 2Q0HA 4BZXA 3GGGA 3GMDA 1A7JA 1FUIA 2BKUA 3MOSA 3GA0A 1L4UA 3D1JA 1NWCA 221PA 2R4QA 2FN8A 2GCEA 4RPLA 4BB5A 5HF8A 3ROXA 2Y1KA 3QF7A 1UKEA 4Q93A 2GPTA 4DCMA 4EY4A 4RWZA 3QPBA 3ZDQA 2W9XA 5E7MA 1AA9A 1TL7C 2I2FA 3NPAA 4TXMA 5DPMA 3AY6A 4WXHA 1Q0LA 4UMVA 3FJOA 4MW4A 3QY9A 5DTMA 2XZLA 3L7CA 3LT5A 4JVNA 4RJ2A 3G2JA 5IW8A 3D5TA 3FYUA 1UIMA 3QXSA 1GADO 4DNFA 1E3QA 3JWPA 2BWJA 4A73A 1DKRA 1GCGA 3AEZA 4R5HA 1ZP6A 1QH9A 2ICAA 5L3QA 2N42A 1YKFA 2OD2A 3X1KA 1E1LA 1MX9A 1N1GA 3KVOA 2FZ5A 4TSFA 1RLJA 1EDEA 1XCPA 4OCZA 4ZO6A 4X9XA 2CD9A 3H1BA 4DB4A 4X8OA 4DMMA 5ICGA 5DKFA 4M22A 1RMTA 2QPTA 3GIDA 1XU7A 3FGOA 4GIBA 3MB5A 1KU0A 2D1RA 3AU8A 5AIBA 3K94A 5LQRA 3E81A 3HA7A 5JD4A 2XQFA 5AW9A 2WUEA 2ODPA 3SVTA 3UH1A 5EXTA 1IJBA 5FWYB 1ECJA 4YCAA 3VC3A 1GDTA 3H2SA 4HDAA 3QH4A 4KN6A 4HPXB 3K2IA 1PHRA 2PZJA 2XV1A 4WBNB 2FFAA 4U6SA 4ZEMA 3ZKWA 1G5RA 3OOHA 1ZGGA 4QL3A 2IEIA 1HBJA 4W1SA 1YOVA 2C7PA 3LYLA 4MRMA 1AMUA 1ZZGA 2FR1A 3BTVA 4KQXA 3VX3A 1T8UA 4NOMA 1IDN1 2QNRA 4OJTA 2JLUA 4ND4A 1IB0A 2QUZA 3GFQA 3NHLA 4JN6B 4NYIQ 2GAAA 3H9BA 3GLFA 3GROA 3A25A 5C51B 2OK7A 1VIDA 1VOTA 4DV2B 4AQYB 1P5FA 4EF5A 1GA4A 1LF0A 1SH7A 3E9QA 4FR2A 1NT2A 4P3PA 1LCIA 1AQNA 1MHTA 1BEUB 4DA0A 1QZZA 1J1IA 1FX1A 2MR6A 2OZLB 1Z56C 1YUBA 2P79A 3NM6B 3EGWA 1X8LA 3KU4A 4DQVA 3WL5A 4KDFA 1P7CA 1XK6A 3N8KA 4MP3A 4IUCS 2YMQA 3KR0A 1JNXX 3G8YA 4URYR 4P4LA 4R1QA 3NHKA 4ED9A 3R9XA 5ITSA 1G5IA 3EFEA 4EHDA 2R9VA 4FGWA 3CEJA 2J0EA 1K5PA 1E66A 2XAUA 3A70A 4BB9A 3EVAA 1CTQA 1G3MA 2RGWA 3LYHA 3M9LA 3QEJA 5HXAA 3BG5A 2M2IA 3M81A 4O5OA 4HRXA 1IN5A 1T9GS 2NT3A 1T10A 3OLWA 2EWVA 2O8NA 3F5SA 2D13A 1ZMOA 3LUHA 4X61A 1Z68A 1B6SA 4OI2A 4S0XA 1ZUIA 1JEYB 1T9CA 1YZLA 1L2TA 1FFGA 2FSHA 4N1AA 3AM5A 1T35A 3KKNA 3KETA 1TGYA 4JV5B 3T5BA 3MJHA 4JBHA 1WVIA 4AROA 3L7LA 1G60A 1JFTA 3OQ1A 2OEPA 2J9FA 1VBMA 4EDHA 5CCBA 4QLBA 1LC3A 4QT0A 2VKTA 3N8GA 4O4JA 4KPFC 4NKRA 2MYUA 4K1XA 1C81A 3OBBA 2ORYA 4N03A 1SOWA 3HRKA 5T4BA 2I91A 1YQDA 1V6SA 2FY8A 3GP5A 2VYVA 1OSNA 3ODPA 4GI3A 2W48A 1WUHS 1IJEA 2R7MA 4I5IA 4MO2A 3CVOA 4BNLA 4MWSA 2AC4A 3H2ZA 1W6UA 4KBGA 2O8BB 1NVEA 3GEEA 4RZSA 1J7JA 1ISGA 4G2TA 1P44A 3FYHA 4CIDA 2EYUA 2QR5A 3EZ9A 2UUCB 3KFVA 2MSLA 5HJ7A 4Z4EA 4ID9A 4NXNB 2BY4A 3Q9UA 5JNRA 4PICA 1IN8A 2BR4A 3FMVA 2NPFA 5EGNA 4PGHA 1I0IA 1XI2A 3R8CA 3QJ5A 3ZHVA 3K0EA 3ZI0A 3D2CA 3GRCA 3DMPA 4DDHA 4OFWA 5HIKA 4NCBA 4P82A 1JR4A 3L4BA 4DCSA 4YT8A 4D0NA 1K6IA 2LRHA 1DU4A 3IMCA 1MQ8B 2XLCA 4QOJA 3OKFA 1ZGZA 3OE4A 3PNQA 1WSWA 5F33A 2FZKA 4WCDA 3FVVA 3ON5A 2GKGA 5K1ZA 4ANFA 4Y1EA 4TYWA 4XA8A 5DISB 4XH9B 5SYNA 2QMHA 3U3DA 2VUTA 1XE3A 3EDOA 2PS3A 4WFIA 2TECE 4BVFA 2XNDA 1M10A 3DCJA 4LTDA 1OXKB 4FHCA 1ZXBA 1SU6A 1XX6A 3OMLA 1U6KA 2IDMA 4RL6A 2BE7A 2W4IA 3I23A 3LS2A 3T41A 5CVDA 2DKOA 4O2BF 5T8KA 1MT3A 3HO8A 1EQAA 3S4YA 3PE6A 1IXSB 1ZM4A 1BS9A 4HYYA 2AR9A 4OA8A 4US0R 3I5UA 4C3OB 2I65A 4M55A 4B6QA 1JVNA 2PY6A 5DHQA 1YCDA 4HFJA 4DIMA 2HIGA 3RYCA 1DB3A 1L8LA 1XCMA 1I2AA 2DUUA 3MRTA 3P94A 4TL8A 2W6ZA 4X84A 4IYJA 5TS3A 3TLGA 5A5VA 1GQQA 2JFQA 1X80A 1BWQA 1TJ5A 4XWAA 1NBWB 1SG0A 1NMSA 3I34X 1E5LA 3A1WA 5CH3A 5IKPA 3DW3X 1V1MB 1U28A 4LBWA 5D5QA 2AX3A 3A4NA 1FNCA 1O08A 3Q3HA 4C29A 3FB4A 2G9RA 4DA9A 1U7ZA 1FDIA 1QTNA 1T13A 4JLJA 3OAAA 1IJKA 1P45A 2BCEA 4IXNA 4E15A 2ZRFA 1MABB 1JVSA 1VPVA 1XVLA 4J0JA 2XNSA 1I10A 5GPBA 4K46A 3WO0A 2Q6IA 1VZ3A 4WOKA 2Q1SA 2HF8A 4UEQA 3P0IA 5JSYA 3E9MA 3IP7A 4JODA 3IURA 3PD0A 3IQXA 4F2HA 2HQ1A 2JS7A 4ITUA 3QMVA 4YREA 1GN9A 1JX6A 4MA0A 1I3NA 2A59A 4X6LA 4BBZA 2H11A 1G3IA 1G6KA 5EVJA 4HS4A 4ZC1A 5AI5A 5FX2A 5KQPA 2VNIA 3I8OA 3A2KA 3Q15C 1T9AA 3N28A 4GSYA 4NI5A 4AYWA 1KEPA 3ZJ5A 4MWTA 3X2SA 2Q5QA 3MS2A 3QPAA 5FP0A 3UN1A 3D7LA 3ROQA 2O5EA 5CHYA 1B0UA 3ENQA 2M1XA 1BVRA 2CLOB 2GRUA 5E2AA 1KAGA 2ETXA 3FTDA 3R7WB 2XUDA 3FJYA 3GZ4A 2WSYB 1WZIA 3AF6A 4B3GA 5GOTA 3GH1A 2IZOA 4YDRA 1FFCA 1UR5A 2P5TB 2FG7C 4XUCA 1V39A 1K88A 4J3NA 5J5AA 4Q3EA 4LMRA 4UFPA 1L5RA 3UA4A 2QRQA 1JSXA 4INJA 1TUBB 5TVKA 3CH4B 2G0NA 5AK5A 3PCXA 2NG1A 2WZQA 1JHVA 3DFZA 2H4ZA 4X92A 1ZL0A 5DDIP 5F1KA 2TMKA 3K8ZA 4PHHA 4WZAB 3DOOA 4MYUA 3ZJ4A 2DLDA 2YUTA 2Z9DA 1GL9B 1RJ9B 1Z17A 1ODCA 2J41A 2O2IA 2VUHB 3EZGA 3HJHA 3I9OA 3PHIA 4RU1A 2VHQA 1XNHA 1A9XB 1C4KA 3G2KA 4L0DA 3C3BA 3DC7A 2DEUA 3GN2A 2YOFA 2BFWA 1F2UB 2YZNA 3PGJA 4YI3A 2HQBA 5CBPB 3IUJA 1AN9A 4Q1CA 4ZAFA 3WIBA 4ARZA 4Y98A 2IHTA 4IINA 1QK4A 1DC5A 2DFNA 2Z8YA 2G5TA 3NC1C 4E46A 3ROPA 4LF4B 4NU6A 3OF2A 3SWWA 4BNZA 2PDAA 3GNLA 1ECGA 3WWYA 4PZLA 3FZQA 1N5LA 4D3YA 4JEHA 2BTEA 4O2AF 4DG8A 1GPKA 2X8BA 2CDNA 2UV8A 1V48A 4HB4A 5PNTA 3CMCO 3EDRA 4PAMA 3UFXA 3TCNA 4BGVA 5KCZA 3QF4B 2X8AA 1LDEA 2MOKA 3AO0B 3UFXB 1TX4B 4JZYA 2JLQA 2IYSA 2BH2A 2QXUA 2H1WA 3AK4A 1ULAA 4JY7A 4YRFA 2JFXA 2PLNA 3HYSA 3K31A 2PFSA 4HAIA 1MB0A 3OUUA 4X7BA 3KEFA 1UXIA 5E3IA 3VMFA 5TPZA 3WGUA 1JJFA 4WTOA 2HOQA 3CBQA 4RH1A 2LPMA 1U31A 3VJLA 2XBLA 2I03A 3FI0A 1L9KA 3X2FA 4H35A 4BC0A 1Q0TA 1M2GA 3OHMA 4D9GA 3T8YA 6CHYA 3JARA 1P74A 4B6GA 3H3JA 4OREX 3IQGX 1TKBA 3M6WA 1QFJA 3O4FA 3V3TA 1WDWB 3O8NA 1TUBA 3D6TB 3ORHA 3MAAC 2Y0EA 3OCCA 4HTFA 4J4HA 5AK6A 2CMFA 5DTEA 3W34A 3TW8B 3WLIA 1EGHA 2EG5A 1AB6A 1R66A 4ZEOA 4D02A 1YHNA 2HO4A 1CEXA 2IKSA 2R79A 3AR2A 3Q0EA 4KE6A 5DT9A 3RT1A 4HD8A 4RMGA 4FCCA 1WSDA 1DWPA 4QYSA 3JAMA 3EX7C 1D6JA 4QFDA 1ZRNA 4Y2PA 3RC3A 1NMQA 1Z25A 2ODWA 1J09A 1T8SA 2Q3DA 4ZT7A 3R7BA 1XNQB 5LP6C 3SLRA 4G5RA 1P2FA 2W6IA 3ZE1B 1VMIA 1GZ4A 2D3WA 2GVZC 2XWPA 4RA9A 4YDSA 1CIPA 4JROA 4ZOAA 2COUA 4DUYB 5I4IA 4P1ZA 2YWEA 2IYZA 1RWKA 2VS1A 5ARDA 2N75A 1PK7A 2QRVB 4EPVA 1NJ8A 3JQ7B 4RIEA 1Z2OX 4FFNA 1U0TA 1U2GA 2DU8A 4UATA 2K2WA 4AI6A 3R6WA 4LNUB 4NEQA 2O07A 5JADA 1M73E 3CF4G 4JCOA 4O08A 5DB4A 1XCLA 2BL4A 1GYRA 2GH1A 3E5MA 4KLZA 2YR0A 4GUAA 4MKIA 1R88A 5EPOA 3MAGA 2O5RA 3KL4A 4LJLA 3TDKA 2VJMA 1QCZA 1DDOA 1ODIA 4AM8A 5FPTA 1V1MA 3VR6D 4G5YA 5FB3A 1TJ4A 1JKIA 4JFRA 4EMTA 2AMJA 3U7JA 5D87A 2ODTX 3KVVA 4RKWA 3V1LA 2VP0A 4EAQA 3QYFA 3ZJVA 1DRWA 5K0BA 5L51A 1NW9B 2IY7A 1EHIA 2GA8A 3ID6C 2ODQA 4HEA1 4MPJA 3WIEA 4JWKA 4LKOA 4B4OA 1U1DA 5AJXA 1A2KC 2ZE7A 3O8CA 4C7VA 4LJ7A 1HI9A 2XDQA 1M0WA 3A9UA 3DFKA 1DIBA 3OFKA 1E89A 4QYXA 4W7HA 4EG8A 1KYWA 3UW1A 5JWRA 1JMKC 4J6EA 5TV2A 1YMUA 1LS6A 4UC0A 1RIIA 2EFDB 1LNQA 4NG4A 2I9KA 1TC2A 1GQYA 1VZ2A 1A9XA 2MCFA 1KAQA 5LWQA 1YJCA 1K5DA 1NMXA 1U7WA 1XQWA 2J7KA 2VI5A 1PJRA 2IIPA 3A37A 3FNEA 3VM6A 3ZD7A 4E13A 1WHSA 4D4JA 4C04A 1SO8A 4YUVA 2WJZB 4DRZA 1PJ8A 3O2NA 3P9KA 3GPDG 2OO7A 5JDCC 3VNBA 5HJEA 1XJCA 2QD4A 1E5XA 2A9FA 3OQOA 1SRQA 1XD9A 1YE8A 2CVQA 4EBBA 4ND3A 5EHIA 5BSUA 2PV0A 2WTEA 2UZAA 1SKUA 4F71A 3CRVA 3WHIA 1R4AA 4ISCA 1FB5A 1ZNQO 4RKRA 5M34A 2NU7B 3PNPA 1EM8A 1E0KA 3ZV5A 5DCUA 3EUAA 4BQFA 4OXQA 4R8KA 3UAVA 4BQRA 4ZYYA 2PUVA 3RTGA 1T9KA 3ICVA 4BNYA 1GNRA 4RHUA 5EHXA 2GERA 3KVYA 1RKQA 2IVFA 5CA0A 1SQGA 1XCJA 3URMA 2QROA 3OPXA 1RAIA 2VYQA 3EFOB 1VKJA 3D8SA 4RJJA 5B7QA 1P80A 1WOMA 2C98A 5CNIA 1QE3A 5DYTA 4MZXA 1NJFA 4KE8A 2SHKA 3PHGA 2WV7A 4O4JB 2DTEA 4LDQA 1VKRA 1E5DA 1BA2A 3ZY5A 1IXRC 3LUPA 4X60A 2IYEA 1V16B 3JQ8B 4GL4A 1OTYA 2PMDA 2QD5A 3H3FA 2PMCA 2VPTA 1C9KA 3PFGA 4N18A 2WVHA 4W5WA 2NYAA 1B8PA 1YMVA 5DU2A 4EI9A 1AKWA 1NDQA 1VPLA 5JPDA 5JR3A 5J2TA 2MYPA 3T7SA 3E9CA 1FJGB 3L7BA 3MXOA 3JQFA 2VHWA 1U3UA 1UQRA 1RBZA 1NRJB 2H5LA 2X7JA 4LZNA 4G4GA 5EMNA 5LBIA 4PZYA 2X40A 4EVIA 3L0SA 3JSXA 4AMVA 2PYDA 2GJAA 3PLNA 3SOPA 1SXJA 3HL4A 1K1EA 2YHBA 1N5DA 4FX5A 5KI6A 1RFGE 3EQZA 2AJLI 3CZ5A 2GA9A 4DV6B 1T36A 4U8GA 5TE9A 3INGA 1EVKA 2GETA 1P60A 4J07A 4TS1A 3DKKA 2PT6A 2OMKA 3MWYW 3PQFA 5F5NA 5AJZA 5C8VA 5FBRB 5FOQA 5K8UA 4MARA 2FQ1A 3JS5A 1TEXA 2FJUA 3UGQA 3COYA 5I7UA 3C6YA 4KQJA 3TR5A 4YP0A 3FSEA 2W90A 3ITDA 4G0OA 3EZLA 1M54A 1DFGA 2C9OA 3C4JA 1P4AA 3GWGA 1YNOA 5CG1A 1JDSA 1WABA 2AK2A 2FPRA 1QCYA 1V35A 3NHBA 3RUAA 1R16A 2I4MA 2WF6A 4GGPA 1EB9A 2CF6A 4NX2A 3S2SA 3MRXA 1DC6A 4TKVA 5IABA 2AQIA 2HLPA 2XVZA 4R9UC 4P35A 1N7JA 3TRFA 3TSAA 3WL8A 2FR8A 3AL3A 1JLRA 4XTCS 5CIWA 2Y27A 4KAAA 3VNRA 4KQEA 1G9TA 3IHLA 4WJZA 2PGXA 4GKAA 1M3SA 4YP5A 1N6KA 1D6MA 1BDIA 1UBRS 4H27A 1Y98A 4D6PA 2GFHA 2DUMA 3T34A 1ZU5A 3NTQA 1JHYA 4NRDA 3WVNA 2WZBA 1OTXA 1RWOA 4MUAA 4Y2YA 3WIUA 1E3MA 3NS7A 4UVDA 2HSEA 2WMYA 3I30X 2FG5A 2IYQA 4LJ5A 4E22A 4S1WA 5ADVA 4KXXA 4F5YA 2G1AA 1ZK0A 2HA4A 3N3AC 2GJKA 2NV2B 4MKZA 2X6RA 4FR5A 3SR0A 4JL5A 1IZZA 4RVOA 2R3SA 4LYEA 1V7CA 3GR6A 3LSYA 4FYJA 1MO4A 1RE0A 2J9FB 3AVTA 1RSZA 4F3NA 4IHJF 1U3VA 1X7WB 4RGQA 4R7ZA 1J9ZA 4J0QA 2Y2VA 2H8KA 4AQDA 3LP5A 2BZGA 3HYCA 1KDTA 3MFYA 4XLLA 4YRDA 3GWZA 4HX5A 3ZKAA 1RWPA 4INAA 4UBNA 1VSUA 4QGBA 5CNMA 4FE7A 3IE0A 2PVPA 1D03A 2VRCD 4G1MB 4PIPA 4UHKA 5ILGA 3VPSA 1WBDA 1QGUB 4L7VA 1CUIA 2IHVA 2SKDA 2Q1TA 2C0PA 2P9JA 3PNOA 2HK8A 1UT8A 4DJFC 1P2DA 2IP2A 4JSTA 1RTTA 4UVEA 5IC6A 2ZSFA 4S1OA 4YBRA 5L3ZA 1FXSA 4G4SO 3M3DA 3W9UA 1DXOA 1Z2CA 3BX1A 4IWXA 1RI3A 4XB2A 5CTJA 1QQTA 2Z98A 4O2RA 5L4SA 3VVLA 4O8ZA 2F9FA 5CLIA 5LU8A 4HXFB 2PUHA 2VDLB 3VNAA 2J9XB 5JDIC 3OZ7A 1TECE 3IAS6 5K20A 5H7XA 2BFBB 4LGCA 2RJNA 1VCOA 3CZQA 4HGYA 2QQEA 2XIJA 5FORA 4BLPA 2WABA 3LY7A 3T9AA 4W4TA 5EGSA 1S96A 4KHZA 4M9RA 4CM6A 5JCJD 2VT2A 2A9QA 1SC4A 1OYWA 2Q50A 1UWCA 3H2HA 4WDQA 1PJLA 2G9NA 4DC1A 3M9XA 1OUMA 3L7DA 4MVJG 1OIWA 3G9UA 4ZCPA 4AKHA 2BMAA 5JXHA 3TEFA 2ZBUA 4HWTA 4FWBA 2R1VA 4IH9A 1V43A 1ESDA 1PV1A 1RABA 2CXOA 2L19A 4O4IF 1HH4A 1WUJS 1XDUA 2QRGA 1XEAA 3AKYA 4M4SA 2VF4X 1BWRA 4HXYA 4V3BA 3WZMA 5CM8B 4DM3A 2C77A 3NU1A 5T8KC 3B9RA 4EGSA 5JY6A 3JVVA 1E2NA 3OPNA 5JSFA 3VHXB 3TTTA 1X92A 3NEJA 4IVNA 1Q14A 4RFVA 3H8SA 3QVVA 1IPHA 3P71T 3W2EA 1HKHA 3MLEA 2KX7A 2R5WA 3IOMA 4UXHA 3HDYA 5ALSA 4OGGA 1ZISA 2XB4A 5F5LA 1Y4DE 1ZVMA 1YVDA 2Q5OA 3H8JA 4KQCA 3S7ZA 3I12A 1XCOA 2O50A 2ZYDA 1V9LA 2NUTA 3SC3A 5E4FA 3GMIA 3CMMA 3EWSA 4N8SA 2OAEA 3G79A 4K86A 2FWIA 3KPJA 3T7RA 3JYPA 2P0EA 1FLVA 2BGMA 4QDTA 4MJXA 4JU9A 3L6CA 1UODA 1L4NA 2EEZA 1TM1E 2W93A 2ZREA 4XJTA 5TPZD 4ND5A 5KYXA 1ETUA 2Q8PA 5BT8A 3P9NA 2J09A 2D06A 2DQZA 3ER9A 3ZK8A 3WGVA 4BLWA 2VAPA 5FI0B 2B2NA 4BVJA 2J48A 1FLDA 4CHGA 3KKQA 2GM9A 3GXBA 1E3TA 2POQX 2Z4SA 2AI3A 4J0EA 2A57A 2P41A 4OYHA 1PTJC 3N2KB 4LI0A 1IY2A 2XKAA 3V1KA 1KYIA 3IMKA 3OIUA 4OIMA 3TQIA 3DOJA 1A9TA 4D4IA 5T4HA 3HVJA 2B6NA 1XZHA 3HO1A 3QV1A 2BEVB 4KMSA 3CRRA 3L1KA 3GN1A 4HXGA 1TCCA 3HLTA 4M1ZA 3LKVA 3U4HA 3GGDA 4EY8A 4BEVA 1U9IA 3QUQA 1YQTA 4PX2A 1NNLA 4EMSA 4U7JA 1P7ZA 4KLCA 4PE5B 3BXOA 4C0XA 1C9NA 1RXEA 3OEYA 3QKIA 1P39A 1ZK3A 2Z3VA 4M9SA 4D9EA 4G07A 3PGXA 1ICIA 4B47A 3O9VA 1PWHA 1BEZA 3COPA 3A6FA 3SZGA 4YP1A 4QTUB 2F8SA 3CXRA 1Q44A 2QAGA 3T9CA 1UM8A 1XA3A 1XN1A 4XWGA 3SGLA 3WWCA 8OHMA 4OJKA 4HBZA 4ENQA 1AXGA 1JEQA 1EUDA 1PSDA 2UZ1A 3FTCA 1RLUA 3IOYA 1L7PA 4XPZA 5AM1A 1KZYC 3N7AA 4R8LA 5I7WA 3HGMA 3EVDA 3F73A 3PSAA 5ERYA 3S3TA 3HFGA 4CLRB 1UM9A 2XSZA 3NJ4A 1KY2A 1VIMA 4MW7A 5CXXA 1A98A 3VTFA 5FLXA 4GWGA 4ZGGA 1JYFA 5KHOC 1G4AE 4MUKA 1YZVA 2F17A 3NDIA 5AKYA 1C30A 1ARZA 2YZ2A 2ZR7A 4G24A 4MVXA 4ARAA 2B2CA 1WCIB 3BSYA 3MWJA 3MQFA 4DIOA 2AXNA 2I8CA 2EW1A 1ZH8A 4KDRA 4R0NA 3H75A 2B8TA 1SU7A 4X3PA 1OYOA 3MCUA 5TC4A 3GT4A 1CUJA 4RZ2A 5HK8A 1ZM9A 3FUUA 1JILA 3SD7A 1EMDA 3BSSA 1XRSB 3ZZ1A 4G81A 4CN9A 1R8QA 1QV9A 3O92A 3IIKA 3V2IA 2VSYA 3OU2A 1PQWA 4ER0A 1FX0A 2CSUA 2EFEB 1RYFA 3PJGA 4IFEA 4YJKA 5BUSA 1R8XA 4RPJA 3PF9A 4LOLA 1R5OA 4D96A 1Z13A 7MDHA 1PNTA 2WU8A 3D2LA 2XWJI 2IODA 4H4DA 4K03A 4K26A 5F1PA 5J40A 5A3RA 2QL7A 5LXTB 5EQFA 4EUSA 1VP3A 1PDOA 4KJXA 1P4RA 3ZJUA 3PDIA 3L5KA 2QLTA 4P38A 3PQ6A 4CV0A 1EB8A 1YR1A 2VYCA 4OUKX 3ASVA 1LTHR 3MWDB 4QRIA 3U6BA 4Q21A 2VBCA 2BYTA 1E1NA 3ZDXB 1IEWA 4B0PA 1V3QE 4TTTS 2F4VB 4RJLA 1H0KA 4IXMA 1NY6A 3RCBA 2BUAA 5HKKA 2WA1A 5C0OE 2BTOA 4ZO8A 3UWDA 4DXDA 1IOZA 5AW0A 1K8ZB 2C59A 2IE0A 4BKOA 5AUOB 3KZKA 4YUZA 3MUEA 1XG5A 5IAGA 4HRVA 1N6NA 1DBSA 5B1IA 2MSKA 4F3KA 1V5FA 4ND8B 4EVRA 1YRAA 3RRBA 5I7RA 1XT6A 3PXAA 2Z8ZA 1CRWG 2VH5R 3DHNA 1CNMA 3CYFA 2KBEA 4OHYA 1QP7A 3R0IA 2IW1A 2IXFA 3H3XA 2O59A 1CDZA 3NP7A 1ORHA 4KXQA 4QQNA 1DS6A 3I01A 3TLYA 3R76A 2EARA 2Y8EA 4GECA 4WNYA 3W90A 4F7WA 5M04A 2RHCA 4MXDA 3CKYA 3HUEA 4B34A 5A3JA 2XKBA 5L95A 4MTLA 3BGVA 3VO9A 4HDNA 4PC1A 4RGBA 2I3GA 2QB5A 4FMDB 1GLGA 1QMGA 2X8WA 4CTNA 3CPSA 5ELMA 4CF4A 4ZO4A 3EOZA 4UNRA 3W5BA 4HRAA 4WLFA 2WUDA 4M8IA 1OOEA 1G5TA 3DVAA 2OHVA 4EABA 4ESEA 3KB6A 3ICPA 2GCOA 2VDQB 1X7DA 4DYDA 1QGED 2FSGA 2XB9A 1GNSA 1Z6GA 4Q3CA 4I8IA 2CXQA 3O8OA 5AKIA 1ZUNA 4G67A 4NECA 3U6KA 1GJRA 3B5JA 3UY4A 1FXWF 3I9V1 4IIVA 4G3XA 1CNEA 3M82A 2IHBA 5AXCA 3VISA 1XD8A 1NDHA 3C7TA 1G17A 5HVNA 5IVPA 2RKWA 3AJEA 2WVGA 1NT4A 3OIGA 1ZOLA 2O0MA 3OJCA 4NBUA 5CYGA 1O94D 1DC8A 2OM6A 2YV1A 3U0VA 1VJCA 1U02A 4OJQA 2EFHB 4QXMA 3I52A 1GUAA 2AOUA 3EULA 3GDFA 3MWDA 2DWPA 2I78A 5TDHA 4JFAA 1P3DA 2AN3A 5B2EA 3H5IA 4MQBA 5IKEA 4PTYA 5FD8A 5AVYA 1KQPA 3IR7A 1V3TA 3AQIA 3JYQA 4LWPA 3SYLA 4CEHA 4JLAA 3RUCA 4CRWB 5L7TA 4CEHB 4Q0MA 3FRHA 2GAJA 2ZPUA 3LDAA 3W5CA 1H5QA 4ZAZA 3TQQA 4YN3A 2JKZA 4KQWA 3HTXA 4EQ6B 4O1MA 5UKDA 1XQ9A 4ERXA 2P2NA 2JGMA 3ZWCA 3W6ZA 2YXPX 4Q16A 4ZWNA 3WMGA 2JJ8A 2H63A 3ZUGA 1JHRA 3SQLA 3PUXA 3UOGA 2VF2A 2VNJA 5AKKA 3TOXA 3WP1B 2BGKA 3ESZA 4OMFG 1Y4SA 2JFPA 1JW9B 1GU0A 2JGLA 2VLBA 3KUCA 3EQ8A 1FP6A 5DYNA 2PBRA 2PGIA 3QBEA 1CR4A 2Y1LA 4RPHA 1RI5A 1WVGA 2KE5A 1RBQA 1OXXK 3ICOA 2IVZA 4IDCA 3K20A 4MVJF 3OT4A 3DXXA 3PE4A 2A1UB 4N6OA 2AR7A 2FSIA 3N76A 3DVAB 3WQSB 4ND2A 2XQIA 4B79A 3TLMA 3OE7D 2R2AA 1O8BA 2I7CA 1N78A 3EDYA 2XRFA 1IMJA 3V8QA 1L7XA 1YRHA 3SK0A 3AWIA 4IV0A 1GITA 4BFUA 2LWIA 2QEQA 1HYEA 3W2GA 5A4IS 4CF7A 4U9UA 5LP6B 1D1PA 2HGSA 1S9HA 1NUHA 2HU2A 2XF2A 3ILXA 5GJBA 2IYOA 2IEBA 2J9GA 1B0ZA 3ZE7A 2Q07A 3FH0A 4AKGA 3ESCA 5CLGA 2OB2A 2JIZA 4CUKA 4TV8A 4F4FA 1V95A 2OLEA 2QUBA 1YQQA 2C0QA 3OF3A 4R83A 5ALOA 5HFNA 2Y0BA 1G7RA 5I51A 3THWB 1OY1A 2X0EA 3RIXA 4KR3A 3GEPA 4JIGA 4CL2A 3P2IA 5LB2A 4AIIA 1OI7A 4DREA 1U5CA 4FR0A 3LTNC 1THMA 3FHCB 2H1SA 5COBA 1YRWA 4EY7A 3RGWS 4Z53A 2JIBA 4B9EA 3V4VB 5JW6A 5GZ1A 3DZDA 2OP1A 1K0FA 1DQSA 2FZWA 1M76A 3GLIB 3EVNA 5CP8A 1U3CA 4HWPA 4G4IA 3N2KA 3CZ9A 2IH2A 1BIFA 1UIRA 2AKYA 2DMRA 3WSWA 1DRVA 3RUFA 5J4YA 4FYKA 2ZT8A 2G04A 2JGIA 4LJSA 4TS4A 3HR7A 4MVJH 4RS4A 3HKEB 5EJ6A 4FEEA 4P7BA 1HDOA 3ZY6A 2CCKA 3GOHA 1OFUX 5IRCD 4JDUA 3N59A 4J94A 4L3WA 2C7QA 5C8YF 3D0KA 4EF4A 5JISA 3GNTA 4QOFA 5J2UA 1D1QA 1HQCA 1UQUA 5KTNA 1CRLA 3OKPA 4EAAA 1Z74A 5FDFA 1Z62A 4V0KA 1NMYA 1P8AA 1SK9A 3DMGA 3HZRA 2CDRA 1OH5A 3RU2A 4GKVA 1PI3A 1QIMA 1DAOA 4LAFA 4AKIA 2IPXA 1LJ8A 3CM0A 5CYFA 5IC5A 1F8GA 1UDCA 4DLUA 1K4YA 1O95A 3PGLA 4LDNA 4QQFA 4F3RA 2C96A 1ZGJA 1ISSA 2WJVA 2HHHB 3RG8A 3BSFA 4U8HA 4R98A 1Y3HA 3LUAA 4BX3A 1RKBA 1UZAA 1PJ4A 2RI1A 3FWNA 3ACDA 4MR9A 2ATVA 1CS4C 1Y5IA 3B36A 4DA4A 1SB9A 5LIPA 3FMIA 5GZ6A 2HREA 1U0GA 1USVA 2GZ3A 4LC0A 2B61A 3OEED 4KVZA 4Q1EA 3REOA 3TMYA 4CDRA 1U7OA 4EGFA 4GOJA 4BLTA 5IFKA 1NUTA 2QU8A 1UBUS 2VHZA 3AFNA 4PO9A 2QN6A 4OQDA 1B0AA 1UJNA 1XRJA 1NN3A 3OOJA 3LGSA 4DIEA 1M1NB 3NXKA 2J4DA 4QGHA 3DVSX 4KWTA 5MHTA 1NBEA 4Y30A 1OKKD 2B9EA 2FEPA 3BXXA 3O90A 3WKCA 1GGMA 5IUJC 2P4SA 1EXMA 3D8HA 2J3EA 3L7MA 4JJZA 1J2UA 1MPTA 1OHHD 1OROA 1YHZA 3MCZA 3DBIA 4UHEA 4Y2UA 5MGNA 3B12A 3EAFA 4P4GA 1ODJA 4L4YA 4OHWA 3ZBPA 2GD2A 3K2QA 4J0IA 5JMWA 1K9VF 2KJQA 5JSHA 1KEEB 1I51A 3CE6A 3NP9A 4PVDA 2JCXA 2Z08A 4Z9BA 3GLIE 1Z0ZA 3C3KA 5EIFA 1R4NA 1P1RA 2WYHA 4RVGA 5IG2A 3E9DA 3FGNA 3FI9A 4BKMA 2B7BA 5IPFA 3U1VA 3LO8A 3VR4D 1QPZA 3V6MA 4G5OA 1EGQA 2DQYA 3UG7A 2P7IA 4BHTA 3EAGA 4ZDKA 2JIDA 4ZAXA 5DIFA 1GVHA 3KOZA 2OFOA 5K7SA 3AF1A 4DV0B 2PKEA 3QSYA 2FMTA 1KEUA 5IDXA 3KIPA 3G8BA 3GIWA 2PXCA 2X0FA 5F7ZA 4D74A 4LY6A 3L06A 1Y8RB 2OK8A 5JPIA 3QU9A 5A9TA 3MTQA 2GHTA 1PFGA 4IHAA 4LIPD 1TAHA 3SR3A 3HDHA 1QX3A 1OR8A 3QIAA 3WKBA 2I7DA 3BCSA 4RK1A 1Z8DA 2J6HA 2HJVA 2P35A 3AHEA 2OV2A 1SWWA 1MVNA 2BRUA 4JI1B 1NV8A 2WWYA 1Z8FA 3HU1A 3N86A 3ZCXA 4B7ZA 2G08A 4FFWA 3H1FA 5AICA 2YCBA 2GZ1A 2L69A 2PO7A 3GVHA 3IBTA 4WVLA 5KKAA 1MAAA 2ZZMA 4F2WA 1LF5A 4BB6A 1QK5A 4OSEA 1F3LA 1DADA 2H0QA 2VA8A 3M6AA 4A16A 1ZC3A 4MKRA 1D09A 1I7DA 1IOVA 1R1DA 2WKSA 2ZWVA 1FP7A 1E9EA 3EXEB 3G1WA 3OZTA 1J0BA 4Q9NA 5IM5A 5LYYA 5KNDD 3BCRA 4I50A 2DKNA 4UQPA 3GY0A 1IL0A 4ATNA 4QNNA 3ZDDA 4DDMA 4E5DA 5F5XA 4Q03A 4DNXA 1Y5NA 4OFXA 4EA8A 1KJWA 3BKXA 4K9MA 5D6OA 1P6QA 1P1IA 1H9AA 2JAWA 2WJHA 4QUJA 1CIJA 2NT4A 3V9AA 4C4PA 1U0NA 3E8SA 5L45A 4N48A 2IPLA 1YRBA 2QSJA 4QHSA 3QKWA 2VNSA 5G41A 2IA5A 4XFKA 5EXPA 2OHXA 2OXFA 3QNWA 1J1ZA 3OESA 1PT7A 3GJ0A 2YWXA 4KMRA 3L05A 3O47A 3RUDA 5C81A 3SDBA 4K0KB 2WD7B 4MOWA 4TWBA 3FDZA 4LHXA 2ZM5A 4RAOA 2OXRA 3HCOA 4IRXA 4EYGA 1MRNA 2NNLD 4B4UA 3EQ9A 3OZVA 2JFVA 4GLOA 4D9CA 1PZGA 4IS2A 3WRXC 1U2GC 4I81A 3ONWA 3ZHSA 5JD6A 4UM9D 2YWGA 4M1TA 4Y2TA 3X0DA 4D7AA 3PXEA 4ZQHA 2PLFA 3K09A 1DLJA 1G7TA 1QS0A 1W30A 2BEJA 3H5NA 4JXJA 4WRRA 2WJ3A 5DGCA 3HCRA 2QTAA 3L0OA 2UUPA 3GK3A 3SHFA 1ZBQA 3JALA 2O2JA 3OQ6A 5NLLA 5DM60 2YNMD 4LWOA 3WTBA 1FSPA 4IZ6A 1NE2A 1IUNA 1S4QA 4DLVA 1ELOA 2PZMA 1TDJA 4X1IB 5BPHA 1DCFA 5SZIA 5HYVA 4D3ZA 5FT9A 3WOVA 3H65A 4S3MA 1CV2A 3IKLA 4NV3A 1D2EA 1URPA 3BL6A 2Q2OA 3OHPA 3O31A 4TS3A 2MIIA 3R3HA 3TBKA 5IDQA 2FP4A 3F8WA 5CDFA 4UVIA 5KYKA 3U09A 3SM3A 3SKXA 1R5BA 2V03A 3BB1A 5TPWB 4P53A 5JLAA 1LNSA 4CIVA 2R4UA 1G8GA 1CQIB 3E84A 4R7TA 5HSGA 4BXOB 5AOAA 3TYXA 4RM3A 3DTTA 1FZQA 4D44A 5HIMA 2P6MA 2V5UA 3LPLA 4MGKR 2Z2YA 4RE6A 4DKJA 1G7CA 3JQ8A 1V16A 3L1JA 5H4GA 2VTDA 5BT9A 5SV2A 4N0DA 1CB7A 2HA5A 3AHCA 1WZUA 3CCFA 1P29A 1OAKA 1YC2A 3DMDA 4EFDA 4BWGA 2WJIA 4AG3A 2F3TA 1ZCAA 1T6ZA 3SC2A 1U0FA 3RVMA 3UATA 3EGIA 4YS6A 3AF5A 3V1TC 1NBMD 1LK5A 1ZAKA 5EG5A 5ADUS 3ZY3A 1KVRA 5EUCA 3KKKA 2GN9A 1RPAA 1IK4A 2OCIA 5KDDA 3Q3VA 3G0CA 1HORA 3BBPA 1X2BA 2Y66A 3F78A 2NAFA 1XLUA 2OD9A 2Q9UA 2Q3JA 1E92A 5G2OA 3K96A 2AXQA 3RWOA 3D6NB 4IUDS 5JZSA 3T3PB 2C92A 1GUYA 1QP0