1A97A

Xprtase from e. coli complexed with gmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
144
Chain Sequence
EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVAISSYDRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphoribosyltransferase
molecule keywords XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
publication title Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 144
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a97A00
5BQOA 1I0IA 1Z7GA 1OROA 4JITA 1ZN8A 4RHYA 5BSKA 1I13A 1DKUA 5HKLA 1BD3A 4X44A 1BD4A 2JI4A 3OZFA 1XZNA 1HGXA 3GGJA 1G9SA 2E55A 1W30A 1ZN7A 1G2QA 1QK4A 1P4AA 3NAGA 3ACDA 5KAPA 1P17A 2XBUA 4ZFNA 2PRZA 2P1ZA 1L1RA 4QYIA 5BRNA 5JSQA 4PFQA 5E38A 1I14A 3GEPA 3KB8A 1ECCA 3LRTA 1QCCA 4LZAA 3H83A 2JKZA 4P86A 1STOA 4KN6A 5ESWA 1QB7A 1TC1A 1DQPA 1XZ8A 1XTTA 4RABA 1QK3A 1G9TA 4P81A 4TWBA 3ACBA 2H06A 2VFAA 1CJBA 4RV4A 4WN3A 4RAQA 1QCDA 1ECGA 1A4XA 3G6WA 3QW4B 3S5JA 1A95A 3HVUA 1GPH1 1MZVA 5BQPA 1NONA 2EHJA 1DBRA 1L1QA 1A96A 1QK5A 1D6NA 4Z1OA 1PZMA 3ACCA 4FYMA 1GRVA 1A3CA 1OREA 4P3KA 4P84A 1P19A 1I0LA 4P83A 2YZKA 1A97A 1VDMA 4QYIB 1UPFA 1FSGA 1NULA 4RAOA 4LYYA 2C4KA 4IJQA 2PRYA 1J7JA 1VSTA 4LZNA 1I5EA 3M3HA 1WD5A 1U9ZA 4X45A 1ECFA 5K51A 1G2PA 1Y0BA 5EUCA 2PS1A 2IGBA 4PAWA 4M0UA 2JKYA 3GGCA 3DAHA 1ECJA 1JLRA 1ZN9A 4S2UA 2FXVA 4RADA 1P18A 3N2LA 2H07A 3DEZA 4P82A 1DKRA 1UPUA 5KAMA 4RHXA 1QB8A 4F8EA 2WNSA 1AO0A 4RHTA 5IPFA 4MB6A 4JLSA 3DMPA 2DY0A 5ESXA 1R3UA 4LZOA 1BZYA 3LPNA 4LYGA 5JV5A 3OZGA 5IAOA 1UFRA 4M0KA 1VCHA 4RANA 1ECBA 4RQBA 3MBIA 4RACA 1V9SA 2H08A 1IBSA 5HIAA 2AEEA 2GEBA 1O5OA 4M0PA 4QRIA 4RQAA 1A98A 3MJDA 3O7MA 1DQNA 1HMPA 1JLSA 1O57A 4P80A 4WMLA 1YFZA 4OHCA 1OPRA 3OHPA 3EFHA 1XTUA 1U9YA 4RHUA 1LH0A 2JBHA 2HCRA 1TC2A 1XTVA
chains in the Genus database with same CATH superfamily
5ARDA 1CRQA 1SBIA 1FJ2A 4B87A 4C30A 2NSJA 1M6NA 2FJPA 4ZP1A 1Y3FE 2A35A 3H4IA 4XARA 3HJGA 4X44A 2BE9A 1FPQA 2ATVA 2Q6OA 5K8TA 4CRWB 1GZDA 3RYFB 3WMEA 3PNQA 2HIGA 5B30A 1OZAA 2PH1A 2V54A 4MB2A 4HH4A 4KH1A 4URYR 3ZJVA 1SVOA 1LNQA 1QAMA 2XVMA 1NFQA 4CVNA 4QYMA 1Z4MA 4UBIA 4M7WA 3VR3A 4UCFA 1FOEB 3KZ1E 3VYTB 5GV7A 4C2UA 3G7NA 4YREA 3REGA 3G89A 3EUEA 3B1ZA 3MD0A 3MPUA 3H9BA 4W1PA 3IJEB 1ORRA 2ZIAA 2I1VB 3IPYA 1T5HX 2C29D 1IDN1 1A5BB 1NASA 1Z18A 5BO5A 3MJFA 2DY1A 2NO1A 3WNZA 2V0NA 2OHVA 4BXOA 2C5FA 2ZQYA 3ZUPA 4EI2A 2PRKA 1ZITA 1NN0A 1SIOA 1XALA 2XYVA 2R7LA 3HCOA 3I9KA 4IZIA 3K2QA 3KL4A 4US1R 1D2NA 1VJ1A 3FZNA 1N9GA 5DEOA 5AVYA 4NLLA 3EGIA 4KL8S 4BEJA 3UGQA 4C4AA 1PYDA 2QAGB 2DXIA 1HLDA 4MVJF 1IHPA 4YMUA 5F2EA 5LWHA 2JI6A 2PRSA 1P7VA 5JCJD 3SLKA 1UZLA 3AL3A 3OX2A 621PA 4BU0A 3QU7A 1JDSA 4PYNA 5IH3A 1L4GA 2UVQA 2WQZA 3P0EA 3ZU5A 4PAQA 2PKRA 4KOAA 4NZYA 3ZQ6A 3HCNA 3WMXA 2PGDA 3P9NA 4NNPA 3RSLA 5B5SA 1AOXA 2YZKA 3W0LB 2ATCA 2ZTMA 2VA8A 4RVGA 4WZBB 2OXIA 1U28C 3DDZX 4QTYA 4F4CA 1W6UA 3K6KA 4KN8A 1X0XA 2RIPA 4UAVA 1BX1A 2WJYA 4QGSA 1Y7IA 1OJLA 1SRQA 1XXHB 1DOZA 4CTKA 3CUKA 3IA7A 3S29A 1Y3HA 1EVKA 2CNDA 2NU6A 1F3LA 4JASB 1IG3A 4RSMA 5IKXA 5BW5A 2C04A 5EUCA 1V8PA 1E66A 1H8HA 1W76A 3CWQA 2QHXA 5JCOC 4NMLA 2QZPA 3IQZA 4YV7A 3ZGLA 1YDGA 3H17A 3PFGA 4TVKA 1AK1A 3ABZA 5KNDA 2EX4A 1JSCA 3Q9UA 2WLSA 3JQFC 5AKKA 3O4JA 4B47A 2C9OA 1ULHA 1BMQA 1A9QA 1Q19A 2QYSA 3ORYA 4Z4GA 2JLBA 4L8YA 5I51A 4LS3A 3RRJA 3TG8A 1BCSA 3CX4A 4H3VA 3WGZA 1TQ4A 3L6CA 1E7YA 3KDSE 1VJTA 1VHQA 5GVRA 1Y9EA 3FETA 3IMEA 4J03A 3MJTA 4CG2A 3MUOA 1B23P 1UZNA 5CT8A 5BN4A 1E4EB 3U7QB 2XCIA 4B74A 2VXYA 1QFZA 3DMGA 1DC3A 1DJNA 2EQ5A 4KPUB 3QA3E 3HYNA 5KVVA 4L8VA 5EE5B 5CLFA 1XG5A 3QMPA 1Q0LA 1TVKA 4Q93A 4YAUA 3U1BA 2KWIA 3ICWA 4PAOA 1N8KA 3OEYA 2V65A 3ZC3A 2WC1A 4JSYA 4PEVA 4PG5A 3KCQA 2Z1MA 2DQ4A 2LKCA 2WY2D 6NULA 2PGLA 4XQ9A 4HNUA 1U8AA 2PSEA 2K7FA 2GAIA 4J0CA 4JR0A 3PJRA 1NYLA 1EB8A 4HDKB 5K1ZA 4FFOA 3HB9A 2J9FA 1BOOA 1E2LA 3EXG1 1AK2A 1Z17A 2YWGA 3AF5A 1LLQA 1NQOA 3N8DA 4FCTA 4MGIR 4QXOA 3U4GA 3HJUA 2FH5B 4MQUA 1L6RA 1H8ED 1N4DA 1N8SA 1XZEA 3ENQA 4B4UA 1M8FA 1JE1A 2QG4A 3CRNA 1RAIA 2RIRA 3NI2A 5D51S 3AI1A 3EXHA 1SXJE 3JR3A 2HKIA 3A4IA 1Y1LA 1ZICA 4N7BA 4QFCA 3G23A 5FH9A 1Z0IA 4R1LA 2HO5A 2H9IA 4E5UA 3ZWNA 3CNEA 1ZQ9A 2R8EA 1ECCA 3LO8A 5EZYA 3WWDA 1C4OA 2PQMA 4BQQA 4Q82A 3JZFA 1EQUA 1UJ5A 5KYUA 4MW9A 5F23A 1NW6A 2ONYA 1YCDA 2C7QA 3FSJX 3GXBA 4II7A 5JROA 4ZQIA 1Z6TA 3PHJA 4D80A 5FUXA 1PJCA 4H7JA 3R4VA 1DRVA 3MGGA 1IXKA 2R68A 1XDBA 2QOEA 3OOWA 3AIIA 1O4WA 2FB9A 1HT2E 1K5HA 2XE8A 4FFWA 2VJOA 4V2IA 1CZOA 1V25A 2MMCA 2H7VA 1ADCA 1D04A 3CSDA 3S6JA 2BR3A 2C4HA 2QMYA 4GKJB 1Y98A 1JP7A 3GUZA 3HUEA 2OB1A 1H85A 5B57C 2FGKA 2JCVA 1MA0A 5IHXA 4RTOA 1QG6A 2A9VA 3STVA 3U7RA 1YE3A 1KYQA 1ZKDA 3B5JA 3E4DA 1KY5A 2AG5A 3KTAB 3MB5A 3HZHA 4PYMA 5AHKA 5B1SA 4HX5A 4B79A 3G5AA 3R3JA 5A1JA 5KWVA 4DR4B 4NG4A 4QL3A 4B2LA 1EJ2A 3VV3A 2GYVA 9ABPA 1UJCA 3LX8A 4KRFA 2NXNA 3F67A 3MFYA 3DNMA 4IMPA 2JCGA 3QVUA 3B8EA 2ILTA 3C41J 1X7WA 4I4CA 1K8YB 1RIFA 3BRWA 3K6SA 1ABEA 2JARA 1AKQA 1X0VA 2H11A 4W9RA 3RC1A 4PG7A 3ZW7A 3N87A 4IOJA 4UUBA 3E5NA 3WL5A 3CLRC 1NW5A 3OM0A 1JQ3A 1GUYA 2KBEA 2VBFA 2PZLA 4OMDA 5AK3A 5F52A 3RH0A 1QKIA 1U0EA 4EEZA 5KJCA 4IM7A 5EIFA 3BILA 4RMNA 4RIIA 1PVVA 3MERA 1KYXA 4KVFA 2D7CA 2QTWB 3LGSA 4R3NA 3HCRA 4ES6A 2GDJA 4QQRA 1SBYA 4PNEA 4O4JB 3G0HA 4N8EA 2JAQA 1CR0A 5FIUA 1ADJA 5K0TA 3IOBA 3BWYA 4M1QA 1YMQA 4ZMSA 3V1MA 3VC7A 3C6YA 2X0JA 4C20A 4EL0A 4TSFD 3UV7A 3NKFA 2Q5LA 4X00A 4M0KA 3IDQA 4A5SA 4BEBA 2AL7A 3DD1A 1AG9A 4ZTBA 4Z8XA 1CHNA 3FTPA 2WUFA 3UMSA 4JJKA 5TPWB 1A4IA 1G60A 1RXSA 1XEWX 2P78A 2FWNA 3TLCA 3A6EA 5JYBA 5BNZA 3MTQA 4IEFB 1RR6A 5IEBA 3CT4A 4QZVA 3P45A 3NCTA 3OHPA 3CXRA 3AP3A 1CUAA 1POXA 1NNI1 1U94A 1ZG3A 3GW8A 2VRCD 3ZXUB 3W4IA 5KMGB 4I7EA 4JXXA 1ZMXA 3O3NB 3QE3A 3B2EA 1ISGA 3PTLA 4GFDA 2PMEA 1G5HA 2REQA 1UJ2A 2Q7DA 3WNVA 4R40A 2X4DA 4G37A 4MW1A 3SZUA 4H7PA 2F64A 5BYAA 2NTYC 1AV6A 1HZZA 4OKIA 1QGED 1JU4A 1F51E 2XWBF 3NOQA 2H1HA 1AD2A 1OH5A 1RDFA 1RJEA 4BRWA 1TIPA 4GOXA 4QYTA 2V7PA 4IILA 4NAVA 3WLRA 4EPTA 1ZVKA 4QECA 2IGTA 3RC2A 4PSVA 4COKA 3W77A 4IHJF 3I76A 3RC9A 2FSGA 1PV2A 4B73A 5I45A 2AMFA 4C07A 1L4YA 3E22B 1U7TA 2OBBA 2CHFA 2ORVA 5BSMA 4CQLB 4CIBA 3IPXA 3FUTA 1XCPA 3PJFA 1MOZA 1Z33A 4DLKA 2W2PA 4O2LA 3X1MA 1NAHA 1IPHA 2ZI6A 4MI3A 1ISHA 2HOQA 3SC4A 4UNQA 1WSDA 3V8BA 2A0UA 1JSXA 3JWJA 1I9CA 4EGQA 1DOAA 3E9QA 2OCBA 1I5OA 2V7GA 1FRVA 2O0JA 3KNZA 1JRLA 1ZESA 5DM1A 3FVQA 1TCVA 1XWFA 1UBSB 2XJ4A 3C7DB 3RWOA 3T9CA 4OXYA 2VJBA 1FXWF 4BV2A 2P9QA 2RG7A 1ZFNA 3E6AA 1QIKA 1NW3A 1P7YA 1RCUA 4EJSC 2J3QA 3BJRA 1KDYA 2IS6A 3TJZA 2BLNA 1NIPA 2W93A 2AB0A 2VJMB 2MSDB 3ADKA 4C4TA 1GT91 2QYTA 3KKOA 4CNQA 1CUVA 4QXRA 3MUFA 6PFKA 1MJGM 4I4TF 3GJ6A 4A8HA 4QE3A 4EJ0A 1KO4A 1H2RS 3G49A 2RGXA 1K5PA 1WDWB 2QTLA 3N6XA 4F6RB 4EO4A 3AM4A 3RVRA 2UYHA 1QLHA 5LDGA 1X1EA 3OTHA 4LHWA 1CIVA 5AKHA 4EHFA 3IR5A 4PFSA 4CM9A 4GWLA 4Q7EA 5HZMA 5CBKA 1KI6B 2WD7A 1NVTA 2IA5A 1VQ1A 1OF1A 2C8KA 2JVIA 3DF9A 3I1JA 4DL9A 2YYYA 1GY8A 3GA5A 1YZUA 4TKVB 3PRKE 2OPHA 2Q45A 4PQRA 1YB5A 1ST3A 5IBCA 2QRVA 3Q5DA 4TVBA 1Y7HA 1OLXB 2DTEA 2V8OA 3NEAA 2P41A 1WR8A 3LCMA 3QI7A 3W3AH 5JBIA 3TZLA 1OTHA 3U3KA 1BXZA 4KPEC 4R16A 1UBUS 2HM7A 3OAAA 4R41A 3N7AA 4Q3NA 4KN5A 3QKUA 5DYWA 4AKTA 5A05A 3BEDA 5J5CA 4OHVA 1AB6A 2AQ8A 4MX8A 3PHBE 2IYLD 3ZVNA 3TLXA 1E2QA 1QNLA 4QTZA 1PQ4A 1XYVA 1UKZA 3N58A 4AMZA 2RH8A 1NHWA 4RNDB 2EGUA 3GLHA 4UDXX 3THYB 2C95A 2YJ6A 3TSYA 3AETA 1AKVA 1VYTA 5U4QA 3HU1A 1KSGA 3HU2A 4FNOA 5F1PA 1M2VA 1VC2A 1YDEA 1W2HA 3MS7A 3RSCA 7REQA 5LFAA 5F3WB 2GMWA 1HPLA 1B7GO 1GARA 1KFBB 3NONA 4IKPA 1FU8A 2ZG6A 2GPWA 1J9GA 1T8TA 4HZUA 3SYLA 1Z7BA 2I29A 4TQ9A 3V34A 3AOEC 1A50B 1K3FA 3JVDA 4QUGA 4L57A 4BUJA 2P6UA 4HWSA 4BGDA 1BTOA 1MVNA 1P2VA 4KE9A 1FYVA 2XLBA 1MOQA 1OC2A 1KEUA 4I0WB 2BGRA 4GXTA 4WUTA 4YDSA 5DX8A 5AVSA 5B58T 5IX8A 1W5FA 1GR1A 1G3QA 4LBVA 4PZ0A 5AMXA 3MG9A 3ANYB 4EBFA 3B3QA 3AHFA 1SCQA 3KJZA 2C5HA 2QEQA 2O2GA 3EGXA 4MQFA 4DLRA 1XZCA 4BYMA 2FZCA 4DV7B 4WKPA 3R0XA 1E5DA 1NZDA 1FW8A 4BLQA 2IHVA 3ZBQA 1V7PC 1B8UA 4DADA 1QS0A 3RI3A 1GA4A 1NVFA 3JQQA 1E0DA 1XT6A 2G0TA 4RPIA 1DQPA 2QI9F 4Q1AA 4IHQA 4K1XA 5KHOC 2XZTA 2XD4A 4X60A 3T7JA 3ABRB 1W5EA 3GMTA 4RPLA 1R5JA 1T9GS 2JAHA 2D1RA 1NJGA 1ZXBA 2P5TB 3A2NA 4RV4A 3OIGA 1VKZA 3UH0A 4BJ5A 4FFVA 4KQWA 2RB4A 1F2VA 2R1ZA 3A4VA 4R1UA 5TT0A 3KR2A 3X44A 3PRJA 4L4YA 4QAQA 1Q0RA 4LE0A 3D4NA 5HIIA 3AL0C 4L9AA 4G5YA 5JDCA 2XUGA 1M2FA 3H6KA 2NVWA 1J9ZA 2O5RA 2QV7A 2YOHA 3DYVA 2PZAA 1JTEA 1SXJD 3GUYA 3IEIA 4K46A 3COJA 4EFNA 5B6JA 1GVNB 3GRAA 2J3IA 1R6XA 2WYWA 2XMPA 4MWZA 1A9PA 2M6LA 1M1YA 1TO2E 4XIJA 3CVUA 1XL1A 3Q5EA 1IOLA 1JVBA 4JBNA 5IVDA 4AMGA 3RODA 3WGYA 3T7EA 1SD1A 4DW8A 1PZFA 1DLJA 1H65A 3REFA 2QW8A 2XB4A 5AQ1A 4AULA 1GYPA 4MWTA 1USWA 3BWBA 4REQA 1L5GB 1G20A 2BFMA 1A5SB 1U31A 3BL6A 3N2ZB 3KSUA 1PGJA 2ZU0C 3OF2A 4G01B 4YUAA 5EIAA 2BCJQ 1N34B 1PEKE 2ZRDA 4NNJA 5T8KA 4HVLA 2C7RA 1NIJA 2H9AA 5I6DA 1QQTA 2W2OA 3KKLA 1YZHA 1TTPB 4M2LA 4E2ZA 1D0VA 2R8PA 1O94A 3QTBA 4I1VA 3KZMA 4CMKA 2HV8A 2GASA 1WMBA 1MH9A 4Y1EA 3ND6A 5FPQA 4YMWA 3NBKA 1NMQA 1WPQA 2DU8A 2P62A 1W9HA 4XGKA 3HZOA 1M2JA 5EINA 5ILGA 3R7SA 4BLRA 3H5OA 3FHOA 1T43A 4ARBA 5EJGA 5CH5A 4D9JA 3MLEA 1WZUA 1HE5A 3KALA 1FTSA 4Q3LA 4M1SA 5G0VA 4YP6A 2WWIA 1SOMA 4JDUA 2EFDB 5CUQA 3WLAA 3SE7A 2E49A 4PAMA 1NLMA 2EBWA 1L7EA 2MR5A 4GP7A 4V3BA 5CW1A 3KZNA 4DDUA 1W96A 4MQMA 4HOYA 3L8HA 1ORVA 1WSBA 1GIAA 3DLBA 1WM1A 4HDOB 4H6XA 4M9RA 5CH3A 2XE7A 2D5AA 4YDRA 5EZSA 1DPFA 1P4HA 2QG9A 3T5AA 5FFFA 4ER6A 3N2EA 1AA9A 1DC6A 4FBMA 3GCWA 2GPAA 3IQWA 3VSEA 2O7QA 3G2IA 1OTYA 3M6FA 4HJXA 4DA0A 2ST1A 3FPKA 2ADOA 1N0VC 1IAQA 1G8FA 1L5ZA 2VTBB 1LDEA 1QO0A 1T9HA 3K8OE 4G8BA 4GC9A 5CGZA 3N2IA 2ONKA 3VNAA 5AW2A 3WKBA 2QSZA 3EIFA 5HFJA 2DFPA 2X4LA 2HN9A 4DLUA 4PRLA 3PFKA 2IKQA 3NASA 2YXNA 3CGWA 1GNSA 2VK1A 4AP9A 4M9QA 4HDQB 3GARA 3W8FA 5ALSA 1HI9A 1K6IA 5JS6A 2JA1A 2GPBA 2WB4A 4FB4A 1YKFA 2BSAA 3MRVA 3H83A 4QTUB 1SKUA 5HKKD 3DB2A 1V6AA 1KZYC 3FFBA 3VMFA 5B7PA 5IK2D 1QXSA 4EAQA 2WHQA 3JASB 2XLCA 5ER6A 5MN4A 1JE0A 1U4SA 1F20A 3CUVA 4H08A 2GM5A 2Z8YM 1RPJA 4KMSA 4OF4A 4Y1RA 4D0SA 4CEHB 3NDRA 1QGDA 5L3QA 5J2UA 3ZHQA 3NVDA 5E6SA 1GQQA 3RVPA 4IFTA 3W5BA 2IYOA 1XZLA 1YZ3A 1VE9A 3IMCA 1QHSA 1O3YA 4JAVC 2KI5A 2CNOA 2LTAA 1NONA 1Q0UA 1DEAA 1QYVA 2ATEA 5KPJA 1ZD9A 1KNQA 3MCTA 3P9IA 3VYVA 4ZEVA 2HK7A 2LDBA 3KOWA 2P3OA 3HADA 1QANA 4TMKA 3IAS6 2XF8A 2YNMD 1JQJC 4C01A 3U09A 3Q7RA 3DLHA 1G38A 3KSBC 3S0JA 4O4JF 4H1TA 1U8YA 1MT0A 4Q4AB 2OFXA 3N8HA 1QYXA 5HPYB 4GWKA 3UWKA 2A14A 4BGEA 1HDIA 1EFVA 1LV8A 1M1NB 3FPFA 3HO8A 3CPJB 3S70A 3O8QB 4HXGA 1M54A 2I87A 5JDIA 5FQOA 4EYGA 1PG2A 3QJGA 4OQNA 2Z30A 1C3XA 2C2YA 3GT0A 2ZDGA 1ID1A 4YCAA 3M5DA 2O8BB 4GYYA 1EYZA 5KEIA 1G21A 3HV2A 3FWYA 2DHQA 2PMCA 3EE6A 4NU0A 1GZVA 3VMMA 3F5QA 2WFMA 1GG9A 2OD2A 4S1TA 1A2BA 3ESCA 1WVIA 2D54A 1EUDB 3A2LA 1RYDA 3GYBA 3V8VA 2ZJAA 1LI5A 4O29A 3FH0A 1JB1A 3EY4A 5BN3A 3DZDA 3DBRA 3NRCA 1N1EA 1W0JA 5CDTA 4NYIR 2BM8A 5E3HA 2DUMA 2J59A 2WKRA 4BMZA 3F6EX 2DPHA 1V96A 3U3OA 1FSZA 2IEGA 2IHKA 3CRVA 3KIPA 1XTQA 3RADC 1IBSA 2GI4A 3DEJA 4PLGA 4PXSA 2D6FA 3VI4B 4XTRA 4ZOLA 1TA9A 3RIXA 3ER9A 3BOSA 2CBGA 1M2OA 4WLVA 1X42A 3KLPX 3MT0A 4NU8X 5FOXA 4BJ1A 3HN6A 4FZRA 1F2UA 1K6XA 4YVFA 1PWZA 3VZSA 1FLDA 4NFHA 3ZUGA 1LPAB 5TS2A 1U8XX 4BCDA 5DU2A 4BWFB 4OXKA 4TWJA 2EZ4A 2D06A 1V5EA 1SU8A 4XXHA 3FJOA 2IKSA 2Z4RA 3E03A 3K9QO 1XMXA 4Y1GA 4ZODA 4MRMB 3CLSC 4X24A 3SHOA 4AX8A 1I24A 4DV1B 1G7RA 1OROA 3K96A 4D7AA 5LIRA 3H5LA 4FD2A 4RX1A 4QTXA 3D7KA 1N25A 4LXUA 2B83A 4L16A 4A2QA 2WJHA 3QSYA 4ARZB 3W8DA 3DFIA 1A1VA 1IY0A 2QL5A 5C81A 2XBUA 4I5FA 3FF4A 1X86B 4MB0A 4L4RA 1R9MA 3S2EA 3INNA 1Q0HA 3M4JA 2GVNA 3JQ7B 4KO8A 3MINB 3QWIA 4LMPA 4M8KA 5B12A 1IWPB 1V7QA 5E38A 1I14A 1E6EA 1T2AA 3E9YA 4RJ2A 3PPVA 3FWKA 1SXGA 5EXPA 4WFIA 2OV3A 5M3BA 1N36B 2XDQA 1FQJA 3WLPA 1G41A 1I6LA 3VH2A 1M67A 1T4DA 4IKOA 4X1KB 2VRWA 2WFLB 3DHEA 6YASA 2FP3A 2GZRA 4YC7A 3UK6A 1M3SA 4RKQA 2JDIA 1N57A 4EHDA 8AT1A 3E61A 3QFHA 5J4HA 3FDZA 5HJEA 1EM8B 1PKEA 5BW4A 1E1CB 1JHPA 1I01A 4KBGA 4LXYA 4S1NA 2X9QA 4BNUA 5CDUA 1N1GA 3E3MA 4KR6A 3EGOA 2EWMA 4M46A 5AM4A 4K6FA 4Y9RA 4LKOA 1L5VA 3JD0A 2FPOA 2XUZA 4KQGA 5KJ1A 2X42A 3V2HA 2A0YA 3QVOA 1ZX1A 1E3WB 2PX8A 2JASA 2WK1A 1O6GA 1RW4A 2XH8A 3MJSA 3NBYC 3WHIA 4ARVA 3ERCA 1YS4A 3GZNA 3AHCA 3V3KA 2JCSA 1GRNA 4R2KA 4CQMD 3GPDG 4QUEA 1MJHA 2PH7A 1OLSB 3U4MA 5EXXA 4ISBA 1RVDA 3JD2A 3U49A 1JZQA 4HWGA 2AEMA 4HXYA 4JUIA 4NJEB 3F96A 2YDYA 5D87A 3M9LA 3A1SA 1JR2A 3AWDA 3PWTA 4JU8A 5I8PA 4Z0TA 3QG5A 1U8UA 1C1XA 1RRPA 4L0DA 3GP5A 4IH4A 3TPCA 3W5HA 2F4VB 3IHLA 5DCYA 1TCUA 3WWPA 1R00A 3OJWA 4NYMQ 4PLHA 5H59A 4XTCS 2DC1A 1V4NA 4GR9A 1E62A 4LRQA 5KAMA 3K5PA 5D5QA 1NC3A 1BU5A 5IMBA 4E5DA 4QYSA 4C78A 1IUKA 3NXKA 4QVGA 4YS6A 1Z0DA 4DXAA 4G5GA 3GJZA 4TKZA 3KSMA 3VDNB 1P0CA 1KI4A 1W8DA 1C1HA 1RKXA 2ISSD 4HDSB 4D57A 4PYQA 4TMVA 2I2DA 4YIKA 3M6VA 1E4YA 5HIJA 2IYFA 5TJ9A 1VL8A 4EMTA 5IMSA 2V7QD 1A8PA 2EKZA 5GV8A 1BVHA 1XEXB 1M7GA 2ZR8A 1QR6A 2Q7OE 3W7VA 4FTWA 3IAS1 4TLDA 4D5GA 4CQJA 1LPMA 3PS9A 4CEIA 1PR3A 4X0EA 2JGKA 4D2IA 1JDPA 1Q12A 2CMDA 3D4BA 4LRUA 3DL2A 4NPCA 2Y76A 3PF9A 3SKXA 1ESNA 2FEXA 5AW7A 1ILEA 4UFOA 2BKAA 2HU2A 2WIDA 4KIJA 3G8BA 3H0CA 2NVUB 1U9IA 3RROA 3T41A 1ZJWA 4D4MA 5C53B 4LXGA 2XHEA 1YDFA 5FWAA 4RDHA 3UK2A 1EA5A 5BQOA 4HAWA 2CHEA 3MW8A 4D8XA 3RUPA 3G5MA 2R4TA 3D6JA 4GSKA 1Z0SA 4ZD6A 2PUFA 1E98A 2H7YA 1R0RE 3WHKA 1BDJA 4UMVA 5GTDA 1DG1G 2JI4A 1K2WA 4QGGA 4W7HA 4X61A 4YRQA 4K9LA 5F1OA 5FYQA 3UQYS 1IVSA 3MTDA 2X5XA 3O8DA 2W6JA 2ZRCA 3UBTA 5ALPA 4EG6A 5JJLA 3AGPA 3V6LA 3OKFA 2RG1A 4BJ6A 4BGUA 2PSJA 5EIEA 4B32A 1YCGA 2QUKA 1UANA 2OFOA 3PDWA 4BX9A 3KB8A 4AS2A 4XIFA 3LRTA 4L1KA 1JKMA 3BTOA 1FXSA 2MSEB 1ZMRA 2RI6A 2B3DA 1F06A 1STOA 1SWVA 1JWAB 2OORA 2ZJBA 3DP9A 1QE0A 3LSYA 1UR5A 3NANA 4UD6A 2NYVA 5K05A 3A3KA 1ADYA 1YJAA 1UINA 2FV8A 1NJ1A 2X7JA 3DW3X 3GRVA 3OZEA 4H18A 1T15A 3P2JA 1H0HA 4KO3S 3TNFA 4G07A 1ZGJA 4L27A 3F1LA 2P77A 3AF1A 5CVDA 2BPOA 5DW0A 4AB1A 2CL7X 2OBFA 1MZVA 2R86A 4CKXA 4GZ6A 5KNCH 5ECDA 5TSDA 8ADHA 1XTJA 4D9FA 1V5IA 3KYIB 4WOPA 4S24A 2Q5QA 1SKYB 2NMVA 2IP4A 2X2PA 2IBMA 4IPTA 4Q37A 5F5NA 1Z26A 2GJKA 5TMBA 3VHRA 1Y5IA 1C7RA 2BVNA 3HHEA 1SC1A 3OQVA 4JB3A 4JYMA 4PHFA 5GP1A 3WRWA 3H4VA 3ZU3A 3CZ4A 3ZCPA 1PT9A 1QP8A 4KHZA 1ETHA 4UQOA 3OSUA 4KDCA 3LDGA 4NR0A 3WRYA 1C3JA 4BO3A 5AVRA 7AT1A 4JX9A 4RS4A 1C7FA 1VFNA 4U2BA 1MG5A 2BRUC 2BHSA 4J0QA 1VIYA 2NV0A 4PANA 1HK7A 1YAHA 3F0TA 4N6NA 1A5ZA 4Y9UA 5TGZA 4F72A 2J41A 2AJCA 1ZVQA 3IR7A 3NTQA 4GMFA 3UXEA 3AJDA 1CV2A 1E0SA 2BKEA 1DJLA 2XX3A 4KU4A 4HFRA 3N3AC 1NURA 3GGCA 3R41A 1UDAA 4MVCA 2CJYA 3C7TA 4ND8B 1E2JA 1Y4AE 1A5TA 5CVVA 4E5SA 2W2MA 1FX1A 4U7HA 2H07A 2IHTA 5C9ZA 4BNYA 4BNMA 2O14A 4QUJA 4F7WA 1U2EA 2GA8A 3H42B 4LISA 3T7SA 1H4QA 2FF5A 3FRJA 3GQBB 3U1VA 1JYFA 5BR1A 3RS2A 3ZGXA 5JCXA 5LP6A 1BWRA 3GK3A 3BE4A 1DC4A 1KEZA 3IJRA 1L5HA 4WXMA 5BSUA 5L3SB 2Z1NA 4U2EA 3RE1A 1Q20A 4GKAA 1E58A 4ZCSA 3OA2A 3OZGA 2JGDB 4DUGD 2Y0EA 3CKKA 3DR3A 4IV8A 3TDMA 3WA6A 3WLLA 3B2NA 1DTEA 2RKBA 3R24A 1T10A 1L7AA 4NZNA 1PK9A 3FYCA 1SCDA 4LNHA 4OQFA 4XM1A 3CH4B 1BHSA 2A5FA 4OQEA 4PZ9A 1UMCA 2E89A 3TQQA 5DM60 4DLWA 1EK6A 2GEBA 3R3WA 4Y8VA 5EHIA 5FBWB 4X63A 3JQBC 5LYJA 5BOSB 5FX2A 1KERA 4GBJA 3UFXB 1E4VA 2LUOA 4MUYA 3K0SA 1H0KA 2HQRA 2VZ8A 2O3QA 3G0IA 1EHCA 1GUFA 3FKSA 3GZTB 2OAP1 4GOND 4ND7A 2ZB8A 1C14A 1KJWA 4KYTA 4URVR 2WSIA 1U9YA 3A10A 4TPKA 2IYQA 4I55B 4QIHA 4TXLA 4LDPA 2RBKA 4BN5A 5I9MA 3AP2A 3PE6A 4BO9A 1EVIA 1ZRSA 1A8HA 1GDTA 4EO7A 3W06A 4NFYA 3R7DA 1FFCA 3WGHA 4B3JA 3E5RA 3BICA 1IBMB 2PKYX 3DA8A 5EGSA 2ETXA 1IXSB 3GB9A 2J31A 4MI1A 1EVEA 2R7MA 3E1SA 1O6FA 4IP0A 4KB5A 3OPYA 1ETUA 4HDRB 5IUNC 3CVYA 2GCNA 4AYXA 2A4KA 1DX6A 1PTJA 3E9EA 3WGGA 3EDOA 4MOWA 4ZI7A 5BOVA 2FDCA 5REQB 1A2KC 1EMDA 1UIRA 2E18A 1X1TA 3DYIA 3E8XA 4WLNA 3UCEA 3BE8A 3DYBA 1BC5A 3CLSD 2V6GA 2FF7A 3H2YA 1ADFA 3G82C 4HEJA 3KR9A 4XI9A 2RC5A 1TMOA 1FC0A 1RHQA 4XLZA 2AYYA 2NZ2A 1MXFA 4P2GA 4ACAA 1SQGA 2UZ1A 2VHCA 4GM1A 6REQB 3TLYA 5B1HA 1XNJA 2GXAA 1K8RA 1WSAA 2OQIA 3R9IA 2GR9A 3UCFA 3WQBA 2BISA 2G40A 2AR7A 4EB3A 4WNYA 3UXMA 3AF0A 2MYTA 5DWVA 3WLEA 3Q11A 2ADFA 4AY4A 3NALA 2YRFA 3MJVA 3E8MA 2QJFA 3ET4A 1RZRD 1J22A 1RBZA 2JJ2D 1MAAA 3AF2A 4CCYB 3HI6A 1PZEA 2XUFA 4Q6BA 1DAHA 2QNRA 3D6UA 4RY9A 4RBNA 1E2FA 1NRXA 4XSHA 1SD2A 4OG2A 4ZAXA 4IJKA 2QT0A 2CV2A 2OCYC 3C16C 3GFSA 2XB6A 3SR0A 2C8VA 3VO8A 3WXBA 4I46A 4EIWA 4I2NA 2JANA 2VSYA 4DNXA 1NNLA 2EW1A 2RKWA 1CY6A 1F0YA 2REOA 3EDYA 2Q5FA 3B1JA 4CLHA 5KQGA 2IEDA 4ZYLA 3RWMB 2V3WA 5JVDF 1G17A 4H7KA 1MPTA 2Q4OA 4GP6A 5E0KB 3ZVMA 1Z6QA 2GCPA 2ZEJA 3BTUA 4HGPA 4I4IA 5SV2A 4HLUA 2FX5A 2FMKA 2PEZA 3IQDB 4PLTA 4KUHA 5TR9A 3UWOA 1K8XB 1U4OA 2GJAA 4WWHA 1G2OA 3I32A 2FWAA 4E0BA 3SHTA 1R3UA 1I5RA 1SQ5A 4LY6A 5B2ZA 2GN4A 2BI4A 2XW6A 5JRJA 1N77A 3HKBB 3FOBA 1TF2A 1XNQB 1GL3A 1M34A 1KEKA 1LNZA 1R6UA 2AF4C 1Y80A 2CLFB 4DMGA 1WEKA 5CK4A 2IHNA 1BVYF 5EZ5A 4ZAZA 3AZPA 3DE4X 3Q2KA 3WP0A 1C30B 3CPHA 3AHGA 3EXHC 4YRSA 5KNBA 1UBMS 5KWEA 3ZR4B 4IX1A 2H0QA 3EGDB 3M83A 2VDUE 4WMLA 1RQNA 2Q8NA 4D92A 2I4NA 4B3SB 2GKOA 1JHAA 2Q1TA 3C1TA 1VFPA 3EEIA 4XFJA 5HJ2A 3UZUA 1GA1A 3NX4A 4I81A 3FVVA 2A3RA 3C85A 3OM8A 5KKAA 3L01A 1I80A 1UDBA 4RXUA 2O1EA 3I12A 4PNHA 2B78A 1NVVQ 4UHEA 3ZCXA 1O77A 2YIDA 3BN3A 3LUBA 3OM9A 2AFHB 4FWIB 1I13A 4KV7A 5ALWA 4B6RA 3FB1A 1U11A 2X9LA 4YRTA 2GFIA 2XSZA 2HA2A 4UASA 5EUBA 2P79A 1E1QA 3TJRA 1JR4A 1P5RA 4YWHA 3VGJA 1G2QA 4AKHA 5C7YA 1PV4A 3OETA 5IAGA 4F6LA 2VDKB 3HBJA 2JD2A 2ASVA 3EYAA 3ILHA 2PWZA 3FG9A 5KAPA 1YNOA 1Y6JA 3EASA 4KXVA 3FBTA 4QARA 1J4AA 3HM9A 4IZ6A 3WQSB 2B82A 5JSQA 3A4YA 1IEQA 2Q4BA 4Y9TA 3UHOA 4G36A 1Z8HA 1KHHA 4UXJA 1L5RA 5CNKA 4ZHQF 5DBHX 3MXTA 4ZO8A 3A6PC 1WB4A 2C1XA 3O1JC 1KZHA 4OM7A 1TJPB 5INTA 2UXBB 3ZBUA 5KOHA 3WDSA 1U0LA 4O3MA 5JFGA 3CF4G 4QNNA 3F9CA 3OTOB 1NLFA 3O90A 4V1CI 2IP1A 3DFKA 1UT5A 1E3IA 1CRZA 2QNIA 4L08A 3WRXA 1WCIB 3MS2A 3PEWA 1C7JA 1GGEA 1U3VA 2AR0A 2TECE 3IPLA 1A4XA 1TK3A 2VDRB 3B78A 4WX2B 2YFHA 1M2NA 3FFTA 4YPVA 5A9SB 2VTEA 2P1DA 1C2TA 2GTPA 4YUZA 4A1FA 2HRQA 3QVJA 1F2DA 1MORA 2QVYX 4HRXA 3T0IA 3VU0A 1PJ2A 1U1FA 1AE1A 4R71A 4XLLA 2XA9A 1A69A 1LRKA 3BIJA 3Q7TA 1T1GA 3FGPA 2X8JA 3THOA 1YQEA 4PXAA 2XJ9A 2EIXA 5DOZA 2BTQB 3GAFA 3O47A 2ZRKA 2R1VB 1KBZA 1DIOB 5DEIA 2WHYA 4HSEA 1FFGA 3OPMA 2VJLA 3IQGX 3WGTA 3UOGA 3EEFA 1SBZA 4HMOA 2X2OA 2BEVB 3TZKA 1J2TA 4UAUA 2IZ1A 1ELOA 2WAYA 5CEJA 2BM9A 5I5EA 1R5OA 2G09A 3Q9SA 1YQDA 3NHAA 4F2WA 1NVAA 2PJZA 3EAFA 3G0DA 2OCAA 1GZ5A 2YWEA 2W42A 1CRWG 1JJBA 3SJBA 4U8HA 2AX3A 3WGIA 4FGLA 3LE8A 3OUZA 4GOLD 3UO8B 2UUCB 5C8YA 1IONA 3VKVA 2W11A 5IBRA 3KPYA 1HLPA 3SSAA 5KIAA 1UADA 3P2MA 1JHVA 2J0EA 3LF2A 1AGRA 1IY1A 2J3MA 2LXNA 3DQZA 3SC3A 5HBGA 2W5UA 2NADA 4P5PA 1UDWA 3CW2A 1FS6A 1TZKA 3R5JA 2CUZA 2D2FA 4OV6B 5AOCA 1V48A 1Q3KA 4G67A 1CDDA 1NT2A 3K0KA 1W0KA 5FA5A 2DRIA 1N7HA 5IASA 3HZRA 1P74A 4NJOA 4AWBA 1HZZC 4UVHA 4YRAA 4TZKA 1IZ7A 1LDBA 1P62B 1YR6A 2BEUB 4NOKA 1KQNA 1AHHA 5FHRA 2FK7A 5AVZA 2X2FA 4ASUD 1M5TA 3HTXA 2QT1A 3KUCA 5A62A 3WBKA 3P5BA 1JN0A 4EJSA 2POQX 1NBOA 1MLDA 3Q3HA 1I7PA 4L5AA 4KUGA 5ALKA 4W5RA 1NDUA 4MYHA 3TOXA 4X20B 3BCHA 1W4BA 2GZMA 3OECA 5EQFA 2J6BA 1CEXA 1X7YA 1YQ9A 3LQ1A 5TQ0B 4UEWA 3LPMA 4RVCA 4JLOA 2GTIA 2ZJZA 1BHO1 4HBZA 2IYVA 2COUA 4EY7A 4LBWA 3LGXA 3DONA 4J0HA 5JH7F 7ABPA 1PSDA 1QX3A 1A04A 5KU1A 2BFEB 3WQHA 4UCQA 1TD9A 1QTRA 3M6UA 3HXOA 5A9RA 2QZ4A 3DKPA 4D4JA 4HQOA 1XF1A 2X3UA 3DVRX 3H16A 5J63A 4MEBA 1CUEA 4ZAVA 3DBIA 1EZ1A 3KE9A 3UIEA 4AWAA 4YUWA 3TG2A 5JC1A 3S1SA 4I50A 3PVZA 5DM4A 1HUQA 1W25A 3VR3D 4RD3A 4D6YA 1P1HA 1NG9A 2CK3A 3CX7A 1LXCA 2ZSFA 1HLFA 4RJKA 2H2AA 3A3PA 2XT6A 1BWPA 2JJQA 2BFFB 1XTKA 2F1KA 2ZBUA 1GQOA 3PDUA 3RIEA 3WNQA 1JKIA 1FLAA 3G1WA 3LVQE 3WA7A 2EATA 4LWZA 2ZETA 1MZPA 1IOZA 5FPSA 1ZI9A 1R6AA 1K2VN 2AD5A 1M2KA 5EHXA 4Y2UA 1Y8ZA 4JI8B 1K4MA 3L93A 3RS3A 3ZWMA 4ABYA 3M4YA 1NP3A 2C2HA 1TA4A 2GJ8A 2GX6A 5EPOA 3CHYA 5HS6A 3UICA 2HJ9A 2XTAA 1GAJA 4NU6A 4LOIA 3RWBA 3MJHA 1F4LA 4AJIA 4CKWA 2ATIA 4KXWA 1ML3A 5EWLB 3QEKA 1Q2XA 3SP1A 3CZAA 3ZS8A 2ZBQA 4HC4A 3ZBPA 2FR0A 2JVKA 2QE7A 1V5GA 4TQUS 1JVNA 1PLKA 3K9GA 1FFXB 2EJWA 3LUGA 5KX5B 4EABA 2QZZA 4XDGA 4WKNA 2PH5A 5CBPA 3Q9LA 4Y1FA 3DMFA 2YJ3A 1ZMOA 1FBNA 1NFRA 4YT5A 3MAGA 1X13A 4XVUA 1UK8A 1V8FA 1D1TA 2R97A 2IFTA 2DFVA 1H8HD 2BH2A 1OXBB 2WJGA 3ZK7A 1H1DA 2JGNA 4LHEA 4LE2A 1X2EA 1LTHR 1SC6A 2ZT6A 3AONB 3ZE7A 2IXBA 5AXCA 4IIUA 4BB5A 4C0LA 5K6TA 5KNDD 2J87A 3IVCA 3W5UA 3PK0A 4CU2A 1QWSA 3BMCB 5EI5A 1HOTA 3FA2A 1COWD 3KOOA 3WYAA 5IJXA 2ZJFA 3DAFA 3D3WB 4DIKA 5CFQA 4EUFA 4C3OB 2QORA 5K6AA 2Y9MB 4LF4B 5IH7A 2B8TA 5CA0B 4UEKA 3KU4A 1GNVA 1UBKS 3QFTA 3WQQA 1GUDA 1KH1A 4UREA 1P5FA 1XTPA 3CZ9A 2YQ5A 3NHPA 3KUDA 1CUGA 4I55F 4Q9LA 5B1DA 1SG9A 1PK7A 2BZ0A 1SUCA 2WMOB 1YS7A 3E3NA 3GFOA 4LRWA 4OFBA 4R05A 3WK7A 4IIBA 2B4QA 1YQGA 3C48A 4AMUA 3R5TA 2B1IA 4TTSA 4CBVA 1RI2A 4V0QA 3ZIAA 1W5BA 4DUPA 4X1YB 1WLYA 3OOEA 3VHQA 2QQEA 4ZHSA 3MTJA 2DT5A 3IE0A 3ECAA 5E7JA 1ARZA 1GAWA 3JTMA 2XCLA 1MC8A 3GJ8A 5TC4A 1ICIA 1F7VA 5HQ3B 2DHCA 2WEKA 1A98A 1E1KA 2OEPA 3WFZA 4ZCTA 1KI2A 4UTNA 1O57A 1RJFA 2GJSA 3ILSA 5IS2A 3QEAZ 2NUPB 3NG1A 4Y0VA 4P08A 2YYSA 3DS8A 2G8NA 2ISQA 2LV8A 1MEEA 3ZHRA 1S2GA 3AILA 3L7NA 1I8TA 1U9CA 2DAPA 2Z6AA 2W8ZA 5IULC 1KIMA 4JL8A 5DYIA 4HHEA 4C0BA 3A2KA 2KLBA 3KQVA 4O4IB 1SCIA 3OJOA 4GYJA 1VJDA 5MGNA 5K8IA 1Q57A 2WYUA 1L7QA 3TSAA 2WZDA 3G8YA 3BIFA 3GRYA 4RK4A 1C7ZA 3SC2A 2F4NA 1XZNA 1DJMA 4PBTA 1UZUA 3BXEA 4F6CA 1KAGA 1RRVA 1I32A 4KODA 5JD6A 4AIRA 1C9JA 5AW8A 2I2CA 1SXPA 4JY7A 1M1YE 2Y77A 2GN1A 5BMOA 5JDCC 2V96A 4ARIA 4Q02A 3TRHA 1E96A 5F7ZA 4HBGA 5LDHA 4R9VA 3ND5A 3RVLA 4EP1A 1A9YA 1KORA 1L8OA 1CUZA 4ESHA 3QVGA 4QPNA 1N5MA 3P4XA 4OXXA 1G20E 3KSZO 4ZANA 3U37A 3S55A 1UAYA 3EWAA 4FDMA 1TAUA 3ZZ0A 4YRLA 2PNFA 2PEYA 2DECA 3P2KA 2ZR0A 2C9CA 2ZRAA 2CDCA 5CX1B 1RJGA 3OURA 1E9VA 1OAOA 1RHUA 3DZHA 2F1OA 3L8DA 4ERXA 3JR7A 2R11A 1QR2A 1OYWA 3CUSA 1ST2A 4EY6A 1Y6GA 5B36A 1XRSB 1PYGA 2XQIA 3E15A 4JN6B 3VRHA 2WWYA 2X19A 4PFJA 4R0VA 3DHWC 5DHAA 1DEHA 2E3JA 4PG8A 4OQDA 4M49A 1O94C 2E4YA 1I4OA 1M66A 5FB3A 4C43A 2REBA 3ESAA 5C80A 4FS8A 1C9DB 1P1FA 2PV0A 4KX5A 1FFDA 4RC9A 2NQ8A 2H5IA 3MCUA 3LC1O 5FTJA 1R0BA 2GDZA 1CF4A 5E1DA 5EIOA 1AKMA 1GCAA 4QQ8A 3U4CA 7YASA 5I5GA 3KXPA 2UVDA 3EQ6A 5E2IA 4HNRA 3QF4A 5T6BA 1GZ6A 3BRWD 4K3UA 2UUBB 1JAIA 4B3RB 4M1WA 5LXTA 2AFIA 2N75A 1K3TA 2WTXA 5E8JA 2P0AA 1A9SA 1DX9A 5KBYA 2A1UA 2ECFA 5FBQB 1CS4C 5K4AA 2YY7A 1FUIA 1LNSA 1QO9A 2OK8A 3ADPA 1Y6QA 2H5JA 1FFAA 2IDMA 3AINA 3HFRA 4G2TA 3EEQA 4LSWA 3TBFA 3U48A 3RBVA 1Q6YA 4DLLA 1A88A 5CHYA 3C3YA 3KJQA 4HCJA 5U4XA 3HDGA 1M33A 1KMHA 2XMGA 5JG7A 4KWTA 5LA6A 3RTGA 2B61A 4E11A 2OHIA 3E7FA 4GVXA 3RTDA 2VTDA 5EVCA 2HGSA 3UJBA 3EBOA 3FUCA 3GBSA 5CB4F 3QPAA 3TD9A 4KFRA 3UFBA 4C4OA 2QN8A 1Q21A 4LZOA 2P2ZA 2Q62A 2VDWA 3CZPA 3QGMA 4MV1A 1K8ZB 3I04A 3KKZA 1NE2A 4FPXA 1BXGB 4OHWA 5IUKC 1O89A 2Z43A 3EY9A 3T9FA 4BASA 4YR9A 3PEYA 4JENA 2F48A 5CR9A 2W7TA 4PW0A 4QUIA 2OOSA 3I2FA 4A5OA 3HY6A 3QNWA 2IT1A 2QVCA 1N8NA 1TDJA 3K8QA 4G0PA 2G5CA 3KZXA 2ZRJA 3D43A 4U0KA 1G0OA 3COSA 4G0XA 1YC5A 2QD1A 1YBVA 4YV1A 3H2SA 3SBXA 3USES 1C0EA 5AK0A 5COQA 3ITEA 3PT5A 2C3YA 3OP1A 2RHRA 1HE2A 1FUYB 5G41A 4Q4CA 5ES4B 2FPWA 1LH0A 1NU8A 1SCUA 2GAAA 4UBNA 4AJNA 1G3IA 1O7JA 1NBWB 2HMTA 2R6ZA 1ZRNA 2CW5A 1G4AE 1C7QA 2FETA 1AUVA 1DZ3A 4L5JA 3VJMA 1D3AA 4C22A 3HPQA 1QLWA 3Q4GA 1CUXA 4ZDKA 1C8VB 2QRGA 1VPTA 4FOOA 4TV8B 1KPHA 4HB3A 2B36A 4LQCA 4QPJC 1R4AA 1L3CA 3FYUC 3O0TA 1RXYA 1NGSA 1T8RA 3LBFA 1G3MA 1NDHA 2QUIA 3GLFA 2AVNA 2R62A 1XTIA 2RHTA 3DEAA 2AQHA 4B48A 5LR6A 4S0ZA 2PSSA 3SHWA 2C5GA 2RARA 4MHTA 4IW3B 1RYBA 1M5UA 2JJ8A 2P9JA 4G41A 3X2FA 4XWWA 1GPJA 1U8FO 1EUCA 1WW8A 4TTVA 4J1TA 5BV7A 3SX0A 1X1SA 5GIOE 3U26A 1QC5A 2QIOA 4YCSA 3A1WA 3JYPA 5KTTA 2QGFA 1G21E 2ZRFA 3GEMA 1P2DA 3ACBA 3PFWO 4Z7NB 4RY8A 5JDIC 5C46F 2Q2OA 3GYGA 13PKA 2O7SA 3P0HA 2A5JA 4FZ5A 2O8EA 1ZM9A 4GPBA 5EHGA 5EVJA 3LC2O 2XOEA 5HMLA 1IUPA 1UZMA 5HCIA 4X9XA 2DFDA 2NU9A 4Q48A 4D0GA 2IYPA 1KDOA 1UPCA 4UBMA 4GKKB 4AI6A 3ZDQA 4U3JA 4G0ZA 1O87A 2E87A 3SC6A 4BNVA 4OB6A 5K0GA 3B6IA 1YDHA 1U2PA 1OTXA 1X8KA 1VHJA 3COWA 3Q0EA 2A9KA 2Q2QA 2OO3A 3OIFA 3PZBA 3V8QA 3N6RA 4TWIA 4KKVA 4CM9D 4ZYZA 1QRSA 3PR1A 1RQLA 4C6TB 1AGNA 4KQ9A 1UMDA 2CLKB 1Z5NA 1UPXA 4I6JA 4R6XA 1ADGA 3HABA 2GRAA 4Q3OA 3OZAA 2B30A 4IOMA 1QIMA 2SCUA 3EULA 2Z08A 3GP3A 4KG7A 4KSBA 2I4RA 4OUKX 2HWYA 1DMRA 1WMFA 3FYSA 2EKPA 2M32A 3VC1A 1BW9A 4B3XA 3I5YA 3SYMA 4QBGB 1OV4A 1DE0A 3P9PA 1UOQA 4UU1A 4ZCMA 5JHHB 5D3QA 1OFIA 3WJ1A 3OAAD 1KVTA 4OI0A 1E89A 2JFNA 4BE4A 4NBTA 2XIQA 1AHIA 4F3TA 5K8VA 1PZGA 1ZBDA 2R5FA 3NZEA 2PYZA 8LDHA 2PKEA 3TQCA 4DCOA 3SVLA 4Z4IA 2EJBA 4J1SA 2P67A 2QPLA 2HSDA 3MGKA 4XYGA 1NXVA 2O2YA 2QQFA 1X74A 1KAOA 3D7NA 1EHYA 4EK9A 2PXCA 1SQFA 3KZKA 4S35A 4BC1A 5FLKA 5FNVA 4X6UA 2R8ZA 2BT4A 4KFSA 4OH1A 4QRHA 1OBFO 2EJVA 1Q11A 3FX2A 3VR1A 4A2WA 3FOEC 4GP9A 4IMIB 5LQMA 2W6PA 3L0ZA 3UAYA 1PTKA 5ERGB 4DLSA 1TPZA 3C45A 1WBDA 1S96A 3DE3X 3EQZA 4OQQA 2HMAA 4GD3Q 2RHGB 5KYYA 2H4JA 4JQSA 2X76A 2E1PA 1SZDA 1KKUA 1KI3A 4BC0A 2JFPA 3JYOA 4Q00A 4DSOA 1ZSVA 1XRPA 2R4QA 4R9RA 4MKFA 1VA5A 3S8MA 4C9BA 3RAGA 3UWPA 1CF2O 1KE2A 4LNAA 4JA0A 2NZJA 1BDMA 4GSYA 4IMJB 4CR8A 1P3DA 4FT4A 4J8PA 1RQGA 2H3HA 3QVSA 4RL6A 1MC5A 5EXSA 5FEMA 4ZHQA 1EX7A 1X1CA 1Q0ZA 3ACDA 3LY9A 2I22A 1G6HA 4ZZ3A 5HK9A 4RV5A 3TF5A 1PBNA 2O8FA 2V98A 2ATXA 2PO7A 5I9NA 2FG7C 3KS9A 3M70A 1IN6A 1FFSA 3LPCA 4O2BA 4CM7A 4AJ4A 1RAGA 5KX5F 2WSBA 2AOXA 1JEEA 1OR8A 2XQFA 3JYHA 4Q39A 1AHPA 1CZNA 3NM5A 3OIUA 5CM9C 4Y9DA 3M6MD 4DQKA 4YYZA 5HXAA 3I2IA 5DHPA 5AVJA 4TTIA 1C9MA 1EFPB 4GW3A 3R9KA 3TXXA 3Q8KA 1K9VF 2OXEA 1Z13A 2C0CA 2VP4A 2QK4A 3IAM6 2IXGA 3PEUA 4W99A 4EY8A 4PZAA 3HVRA 1C3LA 2HB6A 2KYRA 4P4NA 4ZV7A 4PO9A 4P2BA 2FTKE 3VU3A 1D2EA 4QVIA 3IUBA 3RS7A 5A3VA 4Z1OA 4ZYWA 4FFSA 5JAZA 2ZI3A 5GONA 4F4IA 3HBFA 3OLQA 4HWPA 3K09A 5EMLA 2RK3A 3FYUB 3STTA 1X9IA 2I2XB 5CA0F 4ENUA 1I2CA 2WUWE 1OU0A 3VR4A 3U7HB 2PGNA 1A97A 2UKDA 5AI4A 3CRZA 4Z7JA 1HNWB 3RKUA 3RVBA 1NM5C 3NAQA 5A6SB 1NW8A 3TR5A 1KR5A 5LDDC 4D0RA 1DXQA 1TTHA 1LKZA 5JQGA 4DZRA 1B42A 3ROKA 4YIHA 3DL4A 3O31A 2VRNA 1E8DA 3C0KA 4MCAA 4OGWA 4YJHB 3NORA 3SSNA 3ZYCA 3PPXA 2FAXA 1G8AA 4NESA 2FW6A 4G89A 5F1KA 1KRWA 3MJCA 2VO1A 3KVYA 3CRRA 3T9BA 3U61B 5CA1B 4I1UA 3S1AA 3Q3IA 5L6LB 3NOXA 1MKYA 4MKGA 1DKRA 1KI8A 2RHHA 2NO7A 4NBRA 3CM0A 3KB6A 1JUDA 1O94D 3VI3B 2ISCA 1PYOA 2RDMA 4CODB 2HF2A 1W4ZA 4X93A 3T3PB 1U9IC 3KFLA 2K87A 3QYAA 4ZK2A 4M7OA 4NULA 2GD1O 2R3SA 2XITA 1Q1QA 4ZC8A 4QO7A 4LWPA 3K8YA 1QG2A 3ZD7A 2P69A 3CBGA 4O4IF 3JQEA 2O3RA 4TV9B 4UQPA 2ZCUA 5DOVA 1VJCA 3QX7A 4BLWA 1R8QA 1HURA 4ZU1X 5TE9A 5A4FS 3LL4A 3TQHA 4TXHA 4KJZA 1XELA 2FSUA 2AC7A 4CEJB 5G1NA 4KWIA 2RHLA 3LH5A 2EAUA 3QIAA 4MVJP 4TKUA 4CCAA 2SBTA 1S8FA 5ALNA 1ZOOA 5FP0A 3SE0A 2VAMA 1DG9A 5JXGA 2VOJA 3CNQS 5HRUA 5E1MA 4RWZA 2RMKA 3FTDA 3Q88A 2V7VA 2H1CA 3DF7A 1QGUA 3ZEAA 4LHZA 5B7NA 3V4RA 2HRDA 3QM1A 4JBYA 1MMFB 4Z9XA 2LIPA 2YZMA 1CDEA 3T5TA 4XQGA 5DN6A 1XLTA 3S2FA 1YTLA 2D0DA 2P7IA 4XJVA 4WA8A 4NCHA 3OZIA 5DYYA 3W8RA 1TUBA 4AZ0A 4QPZA 3M2PA 3R9XA 1K89A 1QO0D 4BQFA 1V71A 1X6VA 1Z63A 5KCZA 1GR0A 4EF6A 2QKYA 2XRYA 1JHUA 1NI3A 5CIQA 3SOPA 1V16A 3G9QA 1ZGGA 4PCUA 2GAFA 3G5LA 1X1RA 5CTJA 3EZ2A 3V2UA 3OCUA 5ILQA 4B7UA 1O08A 4W6QA 2M6KA 3QK7A 2BDTA 3V1KA 1G8PA 1GFZA 2FUEA 5EZQA 5DJ5A 4BRZA 1WV1A 2HCFA 4Q01A 4G8CA 3PE3A 4Q66C 1ZYUA 4YONB 2WVAA 3WKAA 5A03A 2L69A 4RZSA 3TPFA 3QPCA 2XPCA 1ZVMA 4YJFA 4M8NE 4XUGB 3JVEA 4D3ZA 1X80B 1QONA 3WRYC 1KIFA 1WTAA 1ZSYA 3B12A 3H6HA 2C77A 4I1YA 2G4CA 2YJ5A 3KYBA 1THMA 4RQTA 1R2QA 5HF5A 1ESDA 2HT6A 5D86A 3BWMA 4UOQA 1Q7EA 5BY2A 1ZDMA 1OWOA 4KI7A 3HXPA 3D4PA 4KGVA 1QORA 3AW9A 1GPNA 4EUKA 4ITVA 1Q5PA 3QW4B 4M8LA 2YXEA 1ZJ5A 2ZFUA 2ZUVA 2NAPA 3BTSA 3IIMA 4UNNA 1AUXA 4E31A 4EVIA 5K03A 2ZREA 4HLCA 3LTEA 4V02A 4BNFA 4UTXA 5FTMA 1PJTA 1IXRC 3ZDZB 1XD2A 4N5LA 1VYUA 3IIJA 3QU5A 1QDLB 2K2WA 4NSNA 2CE7A 1J42A 3DEKA 1GAXA 3ER6A 3R6GA 1YVPA 2EG9A 4ZXPA 2ASEA 2RGAA 2ZIUB 3TEJA 3ZJUA 1IVYA 1DKMA 3EA0A 3MJRA 1SVLA 4AQDA 4CFYA 5JYDA 1YB6A 3HJAA 3LRPA 2G1UA 3WJ7A 4RM2A 2P90A 3EVGA 1E5XA 4LFBB 4A6XA 5ESRA 4DF3A 3I6YA 1V95A 4IG9A 4IFEA 5FTKA 1RAEA 2GCOA 3NEYA 4RTPA 2WIKA 1IATA 1V3TA 4WBSA 3QWHA 4AMBA 4MR8A 4F4UA 2WHPB 3I01M 4BAZA 1KZ9A 3KWJA 1OYOA 2DBQA 4YRGA 2Q3BA 2PUAA 4URXR 2IYRA 3KYDB 4KE6A 4B4VA 1MB2A 2WJPA 4XB2A 4RLFA 3ODGA 3RIYA 3A7DA 2EF0A 4TM7A 4BMSA 4L4UA 2FQYA 2Q4DA 4FC6A 2O6HA 4PINA 1C4WA 1RQXA 3IAM1 3CE9A 1M6YA 1UF9A 3DBHA 2HSEA 3ZWVA 5BVHA 1ENPA 4D6XA 1W0JD 1LDNA 4DT1A 1JV2B 1PNVA 1VB3A 1DAFA 3KDAA 3MGAA 4C76A 5ITZA 1ABFA 3RLIA 3SZGA 4ENPA 2J85A 2BBTA 1JKJB 3HJHA 1RWNA 4F4HA 4LIPD 1QPBA 3SIXA 4HGNA 2WSSA 4B85A 1WUIS 1GO2A 4RANA 5E4FA 3U80A 1CRPA 4OA5A 4TV8F 2IZ6A 5DNUA 3U13A 4P31A 2GM4A 1OVGA 2PUJA 4FUQA 2H17A 3H2HA 4M0PA 4N3GA 1JEQA 1Z4QA 4S1PA 3RVSA 1YS9A 2F59A 2IUTA 3L0PA 3PEEA 1EWTA 2X4IA 1C29B 1W6RA 3OZUA 1KJNA 4TL8A 1LS6A 3O92A 1U2DA 5TMEA 1TEZA 2O1XA 2E21A 3SF8A 1SUIA 4DDHA 3ZYZA 3T1HB 5L51A 2A4MA 4HRYA 1MO2A 2QB5A 4A0GA 4XQ0A 5GQSA 1ZH2A 4JUDX 1ZJYA 1NJ8A 1T0UA 2PAAA 1FQWA 3CB4A 3LT2A 4JC8A 4BMDA 3RUEA 1QMPA 2NXCA 1HE4A 3B1WA 5CHEA 4A2PA 2ZWMA 3ZU4A 2B5VA 3DBLB 1ZJ6A 2AYZA 3HCEA 3T1YB 4KQJA 1FJHA 1XQVA 3Q1LA 2PRZA 4KQKA 3ZTWA 3CRW1 2C58A 4ETMA 4D45A 2O2EA 4KCGA 1PJ4A 3GJ4A 1MQ8B 4RMGA 1DWQA 4HYTA 4YNBA 2I1QA 4BQOA 4RCYA 1V1RA 4Z54A 1E5LA 2ZPUA 2OG2A 1AMOA 4R8SA 2IYSA 3FCOA 5DDIP 4OATA 1KK3A 4A0SA 4CF5A 1SUDA 2GJ9A 1NC1A 1UJNA 5A71A 1T1JA 1OI2A 3VDXA 4AZTA 2JDID 4QUDA 4NJMA 3H1FA 4MVXA 1BDHA 3FLBA 3HJNA 3GFPA 3ND7A 1UDRA 4QUHA 5IEJA 2O2HA 3ETGA 5TEWA 3K0CC 4BVBA 2IF2A 4LRXA 5E9QA 2O59A 4DSAA 3C87A 4D3XA 3HWWA 4N0MA 1NNSA 4LV6A 2XYGA 1WMSA 5FBLB 2D1YA 2WE8A 4KDEA 2HRRA 2NZUG 3VZCA 4GDFA 3BGWA 2AF3C 2P6OA 3TNLA 1A96A 5TS3A 1PS0A 3BXHA 3GCZA 1KEWA 3H19A 3K0HA 5DBEX 2NPOA 2W98A 3IT1A 4IRMA 1C3OB 3IXMA 3ZI7A 1T8PA 4HDMB 4BNDA 4EMSA 3RNLA 3ORFA 5H0IA 3PEFA 4JJIA 4W8HA 1M34E 4CDMA 3D0KA 4GICA 3A32A 3F3MA 2H8GA 3A37A 4WASA 3UHFA 1TMGE 1Y8QB 2WYOA 4JMLA 5KYVA 4A03A 1XO1A 2MR6A 5LOVB 5FWNA 3BK2A 4DXDA 1S4QA 2FUKA 4DMHA 2VLIA 5T7BA 1H2XA 5JEEA 4B76A 3RTAA 2DWOA 4IV0A 3MHTA 2ZB3A 3UHPA 3OQJA 3RK4A 5A5FA 5G4KA 1F6DA 4G1EB 1PU2A 2OFFA 3I09A 1GT6A 2Q5IA 5KVSA 3DOCA 4FS3A 5JQWA 4X7RA 2BEJA 4B40A 3NHLA 2NSDA 4NS4A 4B34A 3A1UA 2D5BA 2DHRA 3BEOA 3E2MA 2X13A 3ABSB 1E2KA 1PJLA 3KZOA 3LY8A 4NZPA 1T9AA 1Z28A 3BWVA 1DFIA 1O8BA 5GY7A 2PUWA 3TMYA 1FBTA 1EFAA 4FILA 5AW9A 3QPUA 3VUFA 5K3OA 3W2IA 3LO5A 1XCJA 3GJSA 3MOSA 5MN6A 1NNEA 1I6KA 1TOAA 2P75A 5IJ9B 2WG0A 4KO2S 1A8UA 2BP7A 2FSFA 4AXXA 1DL5A 1J39A 1BDIA 1Q83A 2CVPA 3LL7A 3BIXA 4EYKA 2OMKA 3HJRA 2RI0A 2IOYA 1U6IA 1IQUA 3MBIA 4TT3A 4WY8A 3CIFA 3VOSA 2WSLA 3OLWA 2WF5A 4AKGA 4DC1A 1R4MA 1DQSA 4XX1A 1QAOA 2DZDA 3KHSA 4YMHA 1UPAA 2C5LA 2VF7A 5EIXA 1XCGB 2O2SA 2AG0A 4DQLA 4ANFA 1E9DA 2CDRA 3BHJA 4PLWA 1DEKA 1P6QA 4UHCA 3A3NA 2VWHA 1T91A 2VHVA 4B6QA 1FDVA 3M6XA 3II6X 4XGNA 3AVUA 2FXIA 2VXOA 1MQAA 4DIDA 4PC7A 4D3FA 1RAHA 3TE7A 1THZA 4HGQA 1TEHA 3OIWA 1NSTA 5G02A 4EZIA 3EC2A 3WRXC 2JHPA 1DKUA 2Z2IA 1CUBA 1N2BA 1QOQB 4RZ3A 2W6JD 3SJUA 1WX1A 2ZI4A 4ZIRA 2KHZA 4CQMB 2QTRA 1M75A 3NT5A 3VR2A 2PX4A 3IALA 4LF9B 3WTCA 3TM5A 2HF8A 4R5MA 1FTWA 3N76A 1QHHB 2PR2A 4OX9Y 1QRAA 5P21A 4EFDA 5K45A 3KETA 1IJBA 2EEZA 1J1ZA 5CYPA 4UU0A 5IKEA 4WFQA 2P6PA 4GECA 4BCBA 4ZJPA 1CE8B 2V0CA 3DLTA 2QMEA 3EZFA 3IPCA 3GGPA 3OZVA 5IU6A 2ZJ8A 6GPBA 4LHSA 3ZVKA 1Q3HA 4JLAA 3F2IA 5JJBA 1M1ZA 4Q05A 1KBQA 3CR8A 3U3RA 4QKQA 3WNDA 2CLSA 5T67A 4DIFA 5CX4A 3W7BA 5F9HA 5IKPA 2FOIA 3ZQJA 2CNLA 2MSLA 1YBAA 4RKFA 2GHQA 2XCTB 1QP0A 1L8XA 4F56A 1UC8A 2WFAA 3ZQKA 4WN9A 2CJPA 3RJZA 3ITNA 2DBYA 1R88A 5HTOA 2Q2VA 1D6NA 1ZIPA 1J1UA 4M88A 3F6CA 4O08A 3A0UA 3A1VA 3UK0A 3D3EA 5TT1A 4KPGA 1U1EA 3GXOA 1B6RA 2AGVA 5DHQA 4UM8B 1UUFA 2BFCA 2PZMA 3KYCB 1ZMTA 1YGPA 4R8RA 1XUOA 3K9NA 5B58C 1V35A 3UNXA 3BHIA 3KCNA 4WINA 3WICA 4WY2A 4QHTA 3MWEA 5AFSA 1TM2A 1U6JA 2WF8A 3HSYA 4XYLA 1THGA 1IJFA 1BCRB 2GLUA 4MWOA 1YVEI 1EXVA 3BBLA 2IH4A 3T99A 3G8AA 1YZTA 3NTLA 4L6IA 1JAXA 2A84A 3HA3A 3IQFA 3KAPA 1NVEA 2P65A 2Y92A 2W2KA 5T64A 4BO7A 1QU2A 4S2UA 3ZGOA 2DQZA 4DCVA 3MRXA 2WAXA 5E7IA 5AW4A 3F6SA 1M83A 2QYHA 3SM3A 3I23A 3VKGA 2ON6A 1SHLA 2AI2A 2ZSEA 1QB8A 1QH1B 3MQ2A 3PUVA 4GNKA 4MIEA 4RDIA 5LJIA 1QGZA 3KKEA 4O4LB 3N0TA 2VPZA 1PL0A 3ZDXB 3RLFA 1CS0A 3ZWCA 5HW0A 2HK6A 1DNPA 3WL6A 3RM3A 5ELMA 3V3TA 4PRZA 3F5MA 4D9HA 2JF0A 1FVFA 4US2R 3CLUC 4HAOA 4NCXA 3WAKA 3LS2A 4YRNA 1TK9A 5EG5A 3P52A 4M0MA 4U02A 5FHQA 4HD8A 5DV9A 1H1LA 2FW1A 1WU7A 4W8OA 3EDQA 4EM6A 1NR7A 1IJEA 1C41A 3FKSD 4HN4B 3ESYA 1BMTA 1LLCA 1W1UA 2EKDA 2PBRA 4TRJA 4F3YA 2ZULA 3V2GA 3EFHA 5CCXA 1ZN2A 3A9UA 3KJFA 2JG3A 2JIMA 1ZU4A 2BI7A 4G5HA 4KFUA 3GZ4A 1FVHA 4FI3F 2L18A 4JNKA 3VSAA 4FD3A 2I1LA 1SOWA 5IFLA 3KDPA 1P9NA 4EFLA 6ADHA 3DT9A 4KQCA 5IKOA 3LXUX 2Y1GA 1FMCA 1HQKA 2GF9A 3E2IA 3B85A 4FNAA 1FP1D 2WJWA 3GC6A 1V3UA 5HKBA 3U60B 4A0QA 4QJ4A 3WS7A 3JARA 3V4FA 3LQ4A 2CT8A 2Q0QA 3ETJA 1I7NA 4LVOA 5H80A 1TJNA 2GILA 2MWMA 4IF6A 1QK4A 3OOHA 4A8PA 2FKNA 3T7CA 1ZVVA 4OK5A 4YCBA 2P11A 1OX6A 3JQAA 1HG1A 2PBZA 1YB7A 1VPLA 3AFNA 4I1RA 3D6FA 4S0XA 2P9BA 1PN3A 3V42A 3C14C 4I99A 2P2DA 3LNCA 3PNLA 1JH9A 3E23A 4FONA 1NQTA 1VI5A 2XA1A 5K3FB 1EWKA 3ILXA 1WXWA 4OQYA 1CB7A 1I2MA 1XFAA 5AYVA 2C1EA 2DE0X 3U7JA 1TM3E 1Z5UA 1T5SA 2QR2A 5DTMA 4YCCA 2PR7A 2KX7A 3RUFA 2ZBEA 1RE1A 2AD1A 4KFTA 5IC5A 4BX3A 4M9SA 2QQGA 1EGHA 3H4MA 5BT9A 1T6XA 2C54A 2XADA 3AGQA 4UBLA 4INJA 3T1VA 3KL2A 2ERCA 3DPUA 4ZMBA 2ZRGA 2CF5A 3QOFA 5K0LA 4X8OA 4HH0A 1GKYA 1DTSA 2A0XA 2XKJE 3FDFA 3GLTA 4P3NA 5AIAA 1DTWB 2BZSA 4PHTA 1B15A 3B53X 1W5TA 4KQIA 2C2XA 3W6UA 3I2GA 2GN6A 3GJ5A 3EGWA 2ENWA 1XU7A 3BYZA 3KPWA 5IDXA 1SUPA 4Q1CA 5TGDA 3LI2A 2R96A 2NAFA 3OG9A 3STUA 4QAJA 4EMUA 3SKYA 4EG5A 3REQB 4YRKA 4BHTA 5EP4A 3CUEF 3EVAA 3UWSA 3TECE 4MQLA 1EGMB 3EZNA 4GXNA 1RHKA 2Y1WA 3RVMA 2C2BA 4BWGA 4AF7A 4NKRA 1L3BA 1NJ5A 4MR9B 4YECA 5CAEA 3CMMA 3H1AA 4NZZA 1Q92A 1R0CA 4KWHA 5HS4A 2O05A 4WZAA 2R1TA 2WIBA 3NJRA 3UGKA 3FPHA 5BSFA 4EEXA 1KY4A 3OPQA 4RFSB 5FWDA 4EF4A 4KDFA 1KIAA 4ZQEA 4C4YA 3UGJA 1HA3A 3SLGA 3JRWA 4L4XA 3VVMA 2YV1A 3LJKA 1PR0A 1FP4B 4UBJA 4D9KA 4K0RA 1E3QA 2QPOA 3ZJYA 1XVLA 2BJHA 2ZCVA 4RQBA 1ZC3A 3HLYA 2AOUB 5KNBD 1W59A 3DXXA 3RFTA 2QF7A 2DGDA 4D4GA 1OJ7A 5AVQA 4DLTA 1ZO8A 5H68A 3RNOA 4IIDA 1LFAA 2GO7A 1ORHA 1CY0A 6LDHA 4FCWA 1QQBA 1X77A 4PX5A 4EARA 3EARA 3PT9A 2H18A 3USCS 1IB6A 1R6BX 5KC8A 1H6CA 1D0SA 1VXRA 3EAGA 3G9TA 1W5SA 3PNYA 1TCBA 1UM9A 2FDRA 3EUAA 1F8UA 2LDXA 3LQYA 4W1RA 2FZGA 2XSZD 5A9TA 4GMKA 5BV1A 1E1QD 2G17A 3ZDRA 3O95A 2GZSA 2I1WA 5T41A 1PNQA 3PQ7A 4CG3A 1IOWA 5ALQA 3ZD8A 3DSRA 2OSBA 3CVOA 1ID8A 4ZO9A 3NAGA 1WO8A 1CWUA 2BGTA 2OV6A 3LUAA 3DMYA 4A36A 3NKVA 3DXFA 4M4SA 2R65A 3NP9A 3WLFA 1XZBA 2HWKA 1ACMA 3HR4A 4FZ3A 3GEPA 5H7XA 5IJ0A 1SC3A 3AKCA 3F5SA 4MDYA 5SY9A 1BWSA 1US8B 1WB5A 4R8LA 3EXIA 3L4BA 3HO6A 2W2XA 3CYFA 5CIYA 3OJLA 2Z0MA 1YZLA 3QH4A 1YI8A 4P7JA 1UFQA 3HCCA 3SD7A 2OUIA 3ZWOA 3ZZNA 3AF4A 3B1XA 1J0BA 3R0JA 4CM6A 4FGZA 3TQFA 3ZV7A 8ATCA 4NYIQ 5AK6A 1KAHA 1GWNA 1GL9B 2IYUA 5KTRA 1JQKA 1H2AS 1DI0A 1JQAA 2NV2B 2Q6IA 1B41A 3K1JA 4OJTA 2JLWA 1IHXA 1MFPA 5CVCA 4EQ6B 1CF9A 1DBRA 1NU6A 1W75A 4Z1MA 4JLVA 5IXSA 3KQOA 3MQFA 2VQSA 1EJ6A 2VPXA 2EQBA 3DPIA 2ZIEA 4M6WB 4DWWA 4JBHA 2BCEA 4FSDA 5D7BA 1KXJA 4CM4A 1RYFA 1D2HA 1LY1A 3FNQA 3FPCA 3LWNA 1UPFA 2HD4A 3IGFA 4JWTA 5ALGA 1OGJA 3WJ2A 4A8JC 2I0FA 2NV6A 4R2LA 4V0RA 4H1HA 1ULAA 4Y2TA 4GL4A 1UK6A 3U3MA 5K0SA 1JU3A 4JFAA 1IK6A 4DUYB 1MO3A 2FDXA 2QLJA 3VA7A 3OQOA 1Q0TA 1D7OA 3CR7A 4JSRA 1XTSA 3TM4A 4TYYA 3VX4A 1WOMA 1LB1B 2VAXA 2EFHB 1OXVA 3FW1A 3ZDCA 1R9JA 1NXWA 1NBIA 1P9LA 4JZKA 1LW7A 1XQYA 3MCAA 4KXFB 4EUNA 3OFNA 4GQIA 2O8DB 3SS7X 4HDNA 3CX6A 2FXVA 5BYJA 3HJFA 2R87A 4EFMA 2EW2A 2F43A 5DK4A 1PT5A 1N9ZA 3V1NA 4MO2A 3K7EA 4H2DA 1ODFA 1HKUA 2YZ2A 2CLLB 2NSLA 4KRYA 1RKUA 1W0KD 1XK6A 5C8XA 3V7YA 5JYCA 1E2HA 6ABPA 4XX0A 5JNRA 2CCGA 2B8WA 3WYBA 1W36D 1NXXA 2H29A 3A26A 3ZI0A 9GPBA 2XWPA 5AKJA 1QH8A 2OVBA 4KUEA 4CV1A 3GLFE 2F9MA 1H3NA 1WU8A 4WESB 1NPDA 1JIJA 2AXQA 2HI0A 2P27A 1P2TA 4N3AA 4TZTA 1HETA 4DG5A 2X1MA 5AT1A 2QWXA 4IDBA 4CV3A 2I6TA 3ZK8A 4MV3A 5KYXB 1N5RA 1WTCA 5AESA 1KAMA 4DG9A 1C50A 2VBCA 2HNKA 3EUWA 5TRTA 2ORYA 4EW3A 3SLRA 1B2LA 1QUEA 2VCYA 4N12A 2Y1DA 4CI9A 4I9HA 3BB3A 4TYMA 1TD1A 4FOPA 1JSRA 2W9XA 5KQLA 4CM8A 5F73A 2CD7A 2CXQA 4J1TC 2JAUA 1T36B 3SJZA 4CR7A 3CUYA 1FS4A 4LZPA 4DCNA 5F4BA 3CLUD 1N7IA 2W6NA 4M1TA 3IP5A 2FZ4A 3C24A 1XAIA 3ADDA 4DJEC 1KEEA 1G5PA 1PT7A 3LKDA 3MIIA 4IHJA 3GEDA 3ZTTA 2FMFA 2WBLC 1VECA 2GN9A 3ZW8A 1UM8A 4MS4B 2CK3D 3KUUA 3GJQA 5I01A 2JAOA 4INPA 4K3VA 3AXTA 2Z57A 3D7MA 3KJXA 4XJTA 1JG4A 5T4FA 2XDWA 4O2AB 3M1LA 2CZGA 2JFGA 3QYFA 3VH4A 5EP1A 1P31A 1RRKA 1NXQA 1V6CA 3ANXA 4K6HA 3K30A 3GBPA 4IGKA 3JTEA 3WE7A 3QX8A 1X9GA 3UW1A 2ZM5A 4D81A 1NAIA 5JS2A 1KL7A 4PN7A 5JECA 1Q1BA 3LYLA 2ZWIA 1QB7A 1Y8CA 2B1GA 2OPBA 2VT6A 3BFPA 4AM8A 1W1IA 4KTTE 2FWPA 2LD4A 5HF9A 1E8MA 4AY2A 3E9CA 4JR2A 5D3ZA 3SQOA 1KRXA 1CJBA 5DZSA 4WXHA 5KSPA 4BMOB 3IFSA 4Y67A 5ECYA 1WULS 2AX4A 2OFWA 1Q95A 1IZYA 2YN4A 3QFCA 4IWNA 4NI5A 1LU9A 1QPZA 1VL6A 4TYWA 2QE7D 4JI0B 2WSYB 4D26A 3LFUA 1Z29A 3L7DA 4Q47A 4C7OB 1LDYA 3G0GA 1L4KA 2MDTA 2R1UA 3B2QA 3QU4A 1XA0A 4I4TA 1XKTA 4P3KA 5AH0A 3TKYA 421PA 1DIBA 3KVRA 2O57A 5D3MA 4O4LF 1II8A 4K0KB 1FVXA 3E5HA 1CJUC 1W94A 1L4BA 4DSTA 2HR1A 5JW6A 4FYIA 1NVBA 2H1FA 4BZQA 4S05A 2A5LA 3JYQA 2WJJA 1RRFA 4U6NA 1ZL2A 1NSFA 1GGKA 3C7CB 3FCCA 2MINA 4R1TA 5A04A 2IH5A 2LP4Y 5AW1A 5FUWA 4C0AC 1FTYA 2AWNA 2BHLA 3U4QA 2BGNA 4FKZA 2NZWA 2WP0A 1W73A 1JFFB 1T1EA 4LZLA 1EUZA 1RT9A 3C70A 3KJEA 3PA8A 4AG3A 3QOXA 3GMIA 1ZR2A 3EIOA 4O33A 5LD2C 3G8CA 4MWGA 4OP2A 3U62A 3TZCA 4IEIA 4E22A 2X9GA 4L73A 1OXXK 1DWOA 2WNSA 4FCVA 2B4YA 2A57A 2CUNA 2RGNA 1I2ZA 1SKAA 3PICA 2YMMA 3QX9A 2CMFA 4ZVRA 4Z3DA 4BDTA 1I94B 5CB0A 1JHOA 5I7EA 1JDZA 1R50A 1NN1A 1SVUA 2D7JA 1JVSA 5IVIA 3ZIAD 4A8JB 5A4MS 1H66A 3E82A 2PUVA 1W88A 3KQPA 4P7BA 4EI7A 2X4GA 4RACA 1GGNA 5CM2Z 1TCCA 3A9WA 1FDWA 2IRWA 2W58A 3DLAA 3UBMA 4BNIA 5JISA 5K20A 4D1YA 3B82A 1IBKB 2I6GA 5SZHB 4D9IA 3H9QA 3HS3A 3OIDA 4OVKA 3B20A 2ZIXB 4Q7QA 4H3SA 3TZBA 1MW8X 3M9WA 3TRFA 4QOGA 3DO8A 3OZCA 5LBIA 4IGIA 1MDFA 1GDDA 4RKYA 1FTGA 2MT9A 3GLKA 1IMJA 3RRFA 5FFMA 3T3HA 3WLSA 5U9CA 5KREA 5CFNA 3K5IA 1PQPA 1OLUB 1MX5A 5IM5A 3INYA 3A1FA 2DULA 5FTNA 1F8FA 1SM4A 4RHYA 2AWOA 2QAGA 5TMDA 3AFMA 4HT3B 3GFQA 3QFSA 1JI0A 1GPYA 3V7WA 4ZZ1A 5C18A 3WDKA 4J90A 2AZXA 3ETLA 5JR3A 1NA5A 2IY7A 3PJGA 3FFAA 4MWCA 2NVBA 4M55A 2R25B 3NUZA 1DO0A 3BX1A 3W5JA 1Q6ZA 2R85A 1R0KA 1VG9B 1WXEA 3FKQA 3G13A 4R2XA 4DLBA 3H9JA 1IUNA 4FWBA 2O52A 3N8GA 4YK7A 4WZBA 2MYUA 5CJ2A 3RK0A 5DBIA 1ISIA 1Z2CA 4OYLA 4KLAA 5CLGA 3VTFA 2I3GA 3KOXA 2BSXA 1VYHA 1XXHA 4MHSA 3OM1A 4ZVQA 2PNJA 2R8XA 1FW6A 3O4IA 3URKA 3QUQA 3ZXIA 1QTQA 4MZXA 1CUIA 1BKDR 1EGAA 1RD4A 3VPDA 3PNKA 1YRAA 2JB9A 1B6GA 1I30A 4P4LA 1RC0A 2DYKA 3B7WA 5DTQA 3SEFA 4DTIA 1O8CA 2GF0A 1X38A 3IO5A 5FADA 5AUQA 2CF6A 1YVUA 4L3OA 3M4NA 4UU8A 4YYEA 5ILOA 3VVBA 4KMRA 2EFYA 2HHAA 5LKRA 3H2JA 4FYYA 4J6EA 3KBOA 1MFZA 1XSEA 5TB5A 3JQGB 4ENTA 3TVYA 3EEBA 3LPLA 4EA8A 1AXRA 2X2EA 3FVRA 4Q9DA 2VSNA 3C8DA 3N70A 3OT4A 4EJFA 1NOJA 2ZXEA 3QTTA 4N3CA 3CKLA 1DAPA 2AG1A 5J47A 3ESZA 4LSZA 1CVIA 1P19A 1EE1A 3UMMA 1UQTA 3EPRA 2ARKA 4PNZA 1SFRA 4V0KA 2NM0A 2CFOA 1CQZA 2A78A 2ZJ0A 4Y7DA 1EEHA 2V5VA 4G4GA 5J1TB 3T15A 3VU9B 1E4EA 3U7QA 2VP0A 3BAZA 2HJGA 1J0DA 4WOKA 3L2OB 5JHGB 1PHPA 3H9CA 1V43A 4RM3A 3QMWA 1F5NA 4AX4A 4Z99A 2WWTA 2CZCA 4KPUA 5B3LA 4RTQA 2CL0X 2H2GA 1K75A 4OU5A 3TTXA 2HLNA 3PDCA 3ELWA 4ZVNA 4DILA 3FOZA 3WC4A 1N75A 6Q21A 2VAWA 4NU5A 2ZSAA 3DXZA 1K97A 4M7RA 3PX2A 2Q0SA 1FMJA 4QLBA 1ZN9A 5BRJA 4HSGA 2YWCA 2W6ZA 1BQ3A 4DN6A 3AW8A 4JBWA 1S8OA 4HDKA 1KFEB 3QELB 1H2FA 1ZH8A 2CN1A 4GMXA 4L74A 4KI0A 5FI1B 5JAUA 2C83A 3LU1A 3EZLA 2CNWA 1BDBA 1XLTC 2PUHA 4Q18A 2EDAA 1Z6YA 3KWLA 4QM7A 2C5SA 2KS6A 3GLGA 2G67A 1S2OA 3DMHA 4P7FA 5EXEA 2HK9A 2R6DA 3IDAA 1MABB 2C0PA 2R44A 1YZVA 3EJ6A 2HLHA 4OUDB 3N07A 3WK9A 4RVDA 3RIHA 2L42A 4B2YA 2AEEA 3PPWA 1L7PA 3CZRA 4N7MA 1G7TA 1PFWA 5EMNA 1EVJA 1XWWA 2C9MA 1X8LA 1Z16A 4GBMA 3HSSA 3DTYA 3NHYA 4GKVA 4ZT4A 1E18A 4HB4A 4IJMA 5BNFA 3HXTA 3RAFC 4NBLA 4E03A 4RXTA 4H1WA 2WICA 4LSMA 3HSKA 4AMVA 1C7IA 4KO4S 5ALJA 2W6QA 3HEAA 4DBZA 4QBIA 5HQTA 1P0MA 3A04A 4B2PA 1KQFA 3GLUA 3PGVA 2OHXA 1R0LA 5AW0A 4EF5A 1ZNWA 2CNKA 1DDGA 1JDNA 2YFQA 3PVSA 4MP6A 3V4SA 5B7QA 1TJ4A 1N8TA 4P4GA 1FQKA 4HMQA 4FOTA 1Z2DA 1DCFA 1UBTS 3M1AA 3MYYA 3RRMA 3W78A 3ZGVA 1UAAA 3IDFA 2P68A 1TQ6A 2E55A 4CYMA 3G9UA 1J2UA 4HK4A 1SCAA 2ZB2A 7ADHA 2WM9B 2XMCA 3C3DA 3KBBA 1X7WB 3GY0A 3IV6A 3WV4A 3ZVLA 3SHQA 3KTAA 3SS8A 3N28A 4FMDB 4QA9A 4NV0A 1A7UA 3PB3A 4JGGA