1A97A

Xprtase from e. coli complexed with gmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
144
Chain Sequence
b'EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVAISSYDRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
publication title Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphoribosyltransferase
total genus 42
structure length 144
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a97A00
1GPH1 1DQPA 2H07A 1R3UA 1HGXA 4P3KA 2YZKA 2PS1A 1O57A 1P4AA 2E55A 3ACDA 1I5EA 3M3HA 1ZN7A 3LRTA 4S2UA 4P81A 4LYYA 1BZYA 1A98A 1G2QA 1OROA 2HCRA 2WNSA 3H83A 4P84A 5BQOA 4LZAA 4PFQA 3ACBA 1I0IA 4RANA 5JV5A 1YFZA 1VCHA 3G6WA 4M0UA 1JLRA 1G9SA 1STOA 4RABA 1MZVA 2PRZA 4RHTA 3OZFA 1NULA 1GRVA 5ESWA 1P18A 1U9YA 2C4KA 3OHPA 3ACCA 5KAPA 1P19A 5IAOA 1WD5A 1DKUA 4RAQA 4OHCA 1VSTA 1OREA 2EHJA 2JKZA 1DQNA 1QK3A 1TC1A 1W30A 2JBHA 2JKYA 1A4XA 1AO0A 3N2LA 1U9ZA 4M0PA 1CJBA 4X44A 4P83A 5ESXA 4P80A 1ECBA 1PZMA 2GEBA 3MJDA 3S5JA 4RV4A 1A3CA 1BD3A 5HKLA 1J7JA 1HMPA 3KB8A 4QRIA 3LPNA 3DEZA 4RACA 2VFAA 4IJQA 1UFRA 4JLSA 3O7MA 1ZN9A 3DMPA 4MB6A 4WN3A 5K51A 1UPUA 1BD4A 4P86A 4QYIA 4RADA 2H06A 5BSKA 1ECCA 1L1QA 5E38A 5HIAA 1I13A 1L1RA 3NAGA 1DBRA 1V9SA 4X45A 4WMLA 3GEPA 5EUCA 2XBUA 4RHYA 3OZGA 3HVUA 2JI4A 1A96A 1G9TA 1LH0A 1XZNA 3DAHA 1JLSA 5BQPA 1DKRA 1XTUA 5KAMA 4F8EA 5BRNA 3EFHA 4JITA 4LZOA 4PAWA 4RAOA 3QW4B 1G2PA 1A97A 4LYGA 4RQAA 1XTTA 3GGCA 4Z1OA 4P82A 1P17A 2PRYA 1QB8A 5JSQA 2FXVA 2AEEA 3MBIA 1O5OA 1QK5A 1D6NA 4ZFNA 1QCDA 1Y0BA 1QB7A 1QCCA 4FYMA 4RHUA 4KN6A 1VDMA 2P1ZA 1I14A 2DY0A 1QK4A 2IGBA 4QYIB 4M0KA 1A95A 1FSGA 1ZN8A 3GGJA 4RQBA 1OPRA 4LZNA 1I0LA 1UPFA 1NONA 4TWBA 1ECJA 5IPFA 2H08A 1IBSA 4RHXA 1TC2A 1Z7GA 1XTVA 1ECGA 1XZ8A 1ECFA
chains in the Genus database with same CATH superfamily
3AY7A 1KYZA 1FS6A 2SECE 3PKZA 3HEAA 4MIKA 4PTYA 1AUXA 1VLQA 1B6SA 2E87A 2OHGA 3ZNQA 3E35A 4JJ7A 1QAOA 3QHPA 2RSLA 5EE5B 4N6OA 2RHJA 1IZ8A 2Y0DA 1BXRA 1M2NA 3ROPA 3SYMA 1N5DA 4QD3A 5GWXA 1JKJB 4RWEA 1E3DA 1R4AA 3ZGYA 3VQTA 2Q27A 2VRBA 5FNVF 2VTBA 1VP3A 2WYWA 1XZLA 2IXGA 4R68A 4R2KA 2OE2A 3AR9A 3CB2A 3MWLA 3LNCA 3MTDA 3QV1A 5JPIA 1XOIA 4P32A 4EAQA 5AJYA 2AFIB 1R74A 1TXGA 3DB1A 4YJHB 2A7XA 1ZA2A 5EERA 4E1BA 4AJPA 5AD1A 3IUJA 4KUHA 4A8HA 5ESRA 3DE7X 5JQGA 5FR1A 4MQEB 3V7UA 3ACCA 5M5BA 5IJZA 4MNTA 4EB6A 1N0IA 2CMFA 3HFJA 5KTRA 3ADDA 3AJEA 1VSTA 3IQXA 3PRKE 3PGJA 1SELA 2XUIA 1G8MA 1KFJB 2ZUVA 1LDEA 4NE9A 4EO4A 1H9AA 4DANA 3A6ZA 4RVOA 3ZHZA 4EYKA 1VPDA 5HHTA 1I7QB 1OJ7A 1CIPA 4OI0A 4NK5A 4NARA 3LPAA 2QQFA 1UZMA 3IAS1 5KHOC 3DHWC 3E2PA 1QHSA 5LNK6 1B2RA 2IYYA 3WXMA 1YUBA 1PJ3A 2YS6A 1T9ZA 4GI7A 3HR7A 1P77A 4G1CA 5I9LA 4AMBA 1XU9A 4WUVA 3H87A 3F8WA 2Y2UA 2QRUA 1Y63A 2IYQA 3AUXA 3CM0A 3CR8A 4X1IB 1XP5A 3DEHA 3T7DA 3VYRB 4X20B 4AKEA 2YX1A 5HRUA 2NO4A 4KKXB 4GM0A 1KYTA 3KKMA 4QFMA 5DM1A 1E5TA 5C3UA 4TKVB 3NDRA 4JI8B 5E2IA 1HPLA 2QXYA 5HMMA 1NSFA 4AAYA 2HC9A 3EGXB 4N49A 1CP2A 5KYWB 4AIRA 4EA8A 1RXSA 3V6MA 4MV6A 1WCIB 2VAVA 3DMYA 3DPIA 5COAA 4JYZA 1RYDA 1HEUA 1QSGA 4MYRA 3WGTA 4BBPA 4R6XA 4K88A 2H92A 1I2AA 4QICA 2FHSA 1Z68A 3H99A 2PS0A 3NTQA 1IAVA 1SG9A 2J0EA 2ZSDA 4RPKA 5BUCA 3G0DA 2CK3D 4RZ2A 4PS1A 3H1EA 1FZQA 4WXHA 4KIFA 4YCJA 4BMZA 4G5RA 2WJYA 3X1XA 3CA8A 2GEJA 1UKAA 4H9GA 2Q07A 2RMKA 4FLFA 1NI3A 3BCUA 3WGHA 2FRDA 3GRPA 3HSYA 1M6NA 4FS3A 3WLKX 3VAAA 5E7QA 3X2FA 1S3IA 4LF5B 4PIMA 2BHSA 2DWCA 1BHQ1 3ETEA 4MR9B 3V4ZA 1UCFA 3DL4A 3JQ6A 2ZJ5A 2EBWA 3E4CA 1NUPA 4UHBA 2Q1WA 4RD2A 3RWMB 4D4MA 5A5DA 1DEXA 5EWLB 1U6IA 2E82A 2H2IA 3L0IB 3DA8A 3RVNA 3UPUA 8AT1A 1WW8A 4PO8A 4YB8A 2GNAA 1DIBA 2R62A 4FSXA 4O29A 2WV7A 3DF9A 4DLXA 3ZIAA 5ALXA 1NYQA 4UXIA 2Q29A 1V0JA 1C1HA 3K9BA 3WGLA 4F38A 4P7FA 1SD5A 2WF8A 1ZJZA 2O4CA 4C0LA 1WXWA 1ZR2A 3IFSA 4JLVA 4BQNA 1KKMA 4RGVA 2RB5A 4H1VA 1RLOA 3CRVA 1LA2A 3SIPA 5LWQA 5BQXA 1ZM7A 1C8VB 1FJXA 1SVNA 2G80A 1DE0A 2BR5A 3GJZA 3LKZA 2MR6A 5BXYA 2PKQP 2ZRFA 3M9WA 1LK5A 1R6AA 4ZEXA 4AYWA 3HU1A 5JV5A 4P7JA 1H3FA 4O4LB 2IUYA 4MUKA 3U9TA 1L4YA 1TEHA 5JQGF 3OZFA 1QM5A 4BASA 3GJYA 4YMTA 4WADA 4Z49A 1X86B 3NBZC 3R40A 2JI8A 3U4AA 3HBAA 4MYTA 4WFQA 4DTCA 1DAFA 3IXQA 5EP4A 2Z58A 3GW8A 2Q3EA 1MBZA 4FZJA 2PH5A 1E79A 2ZAGA 2Q7XA 1DTWB 3GXBA 4MYDA 1WCXA 3ER9A 4RAQA 5FADA 2DFKB 4QSHA 3SI7A 3K0EA 2NZXA 3L82B 1G5FA 2F8SA 1AZSC 1PFUA 3HPRA 4MHOA 4YP6A 1BGWA 3D7KA 3HG7A 4IIBA 3R8CA 3LQ1A 1P2FA 4N3CA 3U3ZA 2EQAA 2FRDC 5ICFA 2ECKA 3I9LA 2VSXA 3CIOA 4GI1A 4H0NA 1A9QA 3GRUA 1ZUWA 3ABZA 5AT1A 5H16A 1X13A 4DNPA 3WFJA 2V45A 3EVFA 4AJNA 5I4IA 2AQ8A 5KNCH 5HTOA 1LRKA 2JARA 1ATIA 4CMBA 1CSEE 1XTIA 2VRNA 3VI4B 3LFTA 3RM3A 8ADHA 3D6TB 4DJ5X 4Q1BA 2BEVA 2GZRA 1EX9A 5IAKA 2PTGA 4DLZA 4YDSA 1ORIA 2W2LD 4G4SP 3UT5B 2JGKA 3U39A 2QU8A 5M04A 2VZ9A 4TX1A 5JW6A 2DP4E 1M2HA 3SFVA 4IDNA 1Y48E 1HDOA 3BICA 3QBTA 4CR6A 1MC5A 3C8ZA 4R2HA 1WQ1R 4TQGA 2JLYA 5HKAA 5HFAA 1WXGA 3L01A 4V0LA 1KE1A 1OI2A 1PS0A 4RHEA 3FVWA 4Q6WA 3K70C 1YQQA 2VF8A 4FLMA 3VR5A 1WDMA 4L27A 3K70B 2QT0A 5BN5B 2RCNA 4MRRA 4PAMA 2PPVA 3OA0A 3P9KA 3QXXA 4MV3A 4J0GA 4U7DA 4BXOA 3DDWA 1H1LB 1ORVA 2CE7A 3L7AA 1I4TD 2OA0A 3RH0A 3HXLA 5BWNA 1O0CA 4B76A 3A04A 3ASZA 3JTMA 1T91A 1FRNA 3CF4A 2CBGA 3FBTA 3KDSE 3HU5A 4YFVA 1XRLA 3H2JA 4GMKA 4NZPA 4NZOA 3B1VA 4MYCA 3H6HA 3L41A 4CVNA 4JUCA 2DBQA 2PANA 2WDZA 3ES9A 2AF3C 2ARKA 3ORQA 1VLZA 3H7IA 1A0OA 3OT5A 1OAAA 2HQRA 4FHGA 4JK3A 2QNIA 4D3YA 4ZYLA 2KS6A 4MWDA 3IT3A 4CKZA 1WHTB 1N1DA 1WNTA 4LQCA 5DMXA 4DW8A 5TQ0A 5BNWA 1YB7A 4QG3A 1WMAA 2ATVA 3HACA 4J0DA 1K86A 3ZXXA 2A84A 1Q95A 4TTVA 4RSGA 4BGDA 2V65A 5JSZA 1YRBA 2D1SA 1DP4A 4LTMA 4C6HA 4BC0A 3VA7A 2CEKA 4NAVA 3CR7A 1O1YA 3QFRA 5B3AA 5DYYA 1ESMA 2IP1A 1NG9A 2QBYA 1RXIA 2YMMA 4H7DA 1H1DA 4ISCA 3S3TA 2BGIA 3KS9A 4GW3A 4HN2A 3G5AA 1TK3A 4Y6SA 5FNVA 1Z16A 4BMSA 3LVBA 3C1OA 5K5EA 2AJDA 5BMVA 2R6CA 2G70A 1TO2E 3EQ2A 1O2DA 2ZU6A 1ZN7A 3X0DA 1LFAA 3Q2IA 4RU1A 2ECFA 4QYWA 2HMAA 3BK1A 3GYGA 3OTQA 3RF7A 4ACBA 3B3FA 3ZCTA 2CVOA 4EKIA 4Y6QA 2B4RO 3MWGA 5GIPE 3SQNA 4WVFA 3IKLA 2HREA 2VN8A 1N2GA 4TMFA 1M1YA 3B8EA 2JJQA 1XVVA 3RC9A 3B9QA 3CLTD 3K1TA 4RKQA 3WLQA 3BMOB 1J7KA 2YS7A 3G8BA 2DH5A 1W4ZA 4D96A 4DDUA 2VDRB 2ZBVA 4BVBA 4TMZA 2CXSA 5KTKA 1BWPA 3S99A 3UH0A 3KB6A 1E2NA 1OLXA 4FN4A 3SU8A 4NG5A 2AX3A 2JGLA 2EW2A 3OBIA 1AA6A 2FX3A 2MMCA 3D81A 4ILEA 3I58A 3B6MA 3PRHA 2AG6A 4DLBA 2BCEA 3LSYA 4AQDA 4TV8A 2X7XA 1YL5A 3BWBA 5KVVA 3SZUA 5KJEA 3N8NA 3ZUGA 1IXYA 1SAYA 4QUJA 1QHNA 4IF6A 4KWEA 3F4BA 1UZAA 3R6GA 3EULA 1HSOA 2JFNA 3UJPA 5IVKA 3DNPA 3WK8A 4B6JA 3RJZA 1LW7A 1PHRA 3BMNB 5C80A 2IYAA 1FYEA 1BE0A 1LF0A 1EDDA 1OU0A 1NWHA 2J3IA 4XJXA 4RKRA 5JBQA 2FI1A 2VDNB 1L5SA 4HNTA 5CMLA 1DEOA 5B37A 5BSRA 3PGMA 1L7MA 4LX8A 3NW9A 4IS2A 1ZVKA 2VC2B 4E7PA 2GM3A 5ALSA 5JPDA 2XA1A 2ZQYA 1Q6ZA 2IYLD 4JL8A 5TPWA 5IH3A 3NXSA 2DBYA 1T3TA 1Q7RA 4BRWA 5K7SA 4L0QA 4PZPA 4XGIA 5BQPA 4RA9B 1H2ZA 1J9EA 1YKFA 3B1ZA 4QXQA 3WK6A 4BMCA 4CV0A 1ISIA 1L6IA 1PGNA 3GGOA 4YRNA 2O6LA 3R9WA 2QTRA 2UVQA 1WE2A 3B60A 3TAHA 4H7IA 3TOSA 3EXG1 4WCVA 1VMEA 1IM2A 1TEZA 1FA9A 5DV9A 2M1XA 4CCSA 2VI5A 2FPIB 3LLSA 3DWFA 4W63A 1M1YB 3T5CA 2Z2JA 1F20A 2OFOA 1YZUA 3KJXA 1KJZA 2J48A 3SQWA 4HEHA 1YK0A 3I37X 2HCTA 2I8AA 4GC5A 4TV9B 4F11A 1KF0A 1MN6A 1I14A 2WD9A 4KGZA 1Z6PA 3AM1A 2ONCA 1BS1A 2H52A 1YA8A 3LT4A 3PI6A 3ZDCA 1DRUA 2O1SA 3GFGA 2W2KA 1VG1A 4WX2B 3P9YA 1PGJA 1E62A 3IBFA 5A02A 1P91A 4AY3A 4BFYA 1VRCA 1WDLA 2MSNA 1HRKA 3L8YA 4TV8B 3B12A 3TBKA 2I6TA 3VKUA 3OA2A 1G19A 4UM9B 2XOXA 2O3RA 3IXLA 2B4AA 4X3OA 3UWPA 4AURA 3ZQ4A 2QIOA 1Z82A 3HJGA 4KTVE 5BMVF 3LO8A 3LPMA 3PFKA 2BGNA 4YN3A 5E95A 3PP8A 4YV7A 3LCCA 4ZO6A 3NGXA 4I81A 5K0SA 2PUVA 5JDCC 1HDGO 2BHTA 1M34E 3BWXA 5FOQA 1MJNA 2DWOA 3L79A 3Q10A 4TQUS 4MV7A 4YWJA 4NRDA 1QNFA 2VTVA 3L7NA 5U4XA 3DVRX 3GMSA 3HI6A 1PSDA 1SUEA 1Z0KA 1JJ7A 1UWKA 2CDRA 1WCV1 3QE3A 1J5XA 2R96A 1IWPB 4OJKA 4UFOA 3MT8A 1L5WA 5T6BA 5BWOA 4E11A 4L6CA 1Z83A 1CVIA 3SWWA 2R6R1 3LCRA 2TMYA 1DJMA 2RHRA 3U4HA 3KU1A 1R27A 4E22A 2VRCA 5KYXB 2A4KA 3KJQA 5AHRA 3PDWA 4ES6A 1PR5A 4IP0A 2RG1A 4HDAA 1QHHA 1V8BA 1EESA 4W5RA 4N12A 4AULA 1L5HB 3SFTA 3WGYA 1GAQA 2REQA 1P1KA 3EXHC 5FWDA 3VNUA 4UUAA 3GH1A 3EXHB 4B71A 1VLLA 2FMIA 2IEIA 3CX3A 3RFUA 5REQA 4YROA 4CM7A 1U8UA 1X94A 5BUSA 3EISA 4R1OA 1SJ9A 5KCMA 1JHMA 2XZTA 1VYVA 2ZFUA 4L4XA 3UFXA 4BFUA 5DHTA 3TNYA 3UENA 1ZGGA 2OZLB 2QORA 1M7HA 3CB4A 4BLPA 2QL7A 4OG2A 3BHIA 3IUNA 1XLVA 4KMRA 3D7MA 1TKBA 4JC0A 5JJLA 2XW6A 3L8EA 2P2DA 4LRQA 1A8PA 1V47A 1II0A 2Y1OA 4P1ZA 4W5JA 4E31A 1EJ0A 4LCBA 1WOYA 1SCAA 2ID9A 5LMUB 1SHLA 5AI8A 5F1OA 3TOXA 1QIDA 2C96A 5J4KA 1TIBA 1XPJA 2GF0A 4F1JA 2J0QA 2CLCX 5CYGA 4F4IA 4YPOA 1GR0A 2ADMA 4LTNA 5GVRA 1CEXA 3E0QA 5IAJA 4EF5A 2AW3A 3FGZA 3U31A 1T6NA 2G4LA 3R3JA 1ZU5A 3HDGA 4P4TA 4QOJA 4RPCA 1ZNYA 4G36A 4MJ7A 2GXUA 3JVDA 3KEGA 4K26A 3W6NA 5AESA 3M6XA 3QUTA 3W4JA 3R9XA 4K3UA 3OCJA 5C34B 5LZ5A 4ARBA 5BN3A 4OX9Y 3ZCQA 3QFCA 3OTOB 3UJ9A 4D02A 1LPPA 5DNDA 5FPPA 1N5KA 3U40A 2O8EB 5GTDA 3OZUA 4ND2A 3W3AH 3SNKA 3WYFA 2E48A 3IHLA 2EW8A 1N77A 4IGAA 2PUJA 4AZSA 5TEVA 3SVZA 5IANA 3TMAA 1NW3A 3CU5A 1KJWA 1H05A 2JCBA 1FDIA 2GWRA 3GCZA 4K6CA 4OXQA 3AY6A 4DDTA 4REQA 2REQB 4KVFA 1W2GA 1WHSB 4C5AA 1K75A 4BV9A 1YRWA 5K2OA 4CN9A 3HKBB 2Q49A 2JA1A 4M46A 4YMIA 5JANA 4AWXA 1KSJA 2XSZA 3GOHA 1TM2A 1T8SA 4XUEA 4XD2A 4RJJA 1ZI8A 3TD9A 3KSBC 3RS3A 3BHMA 3UNXA 1JKFA 2J7PA 2Z2IA 2VH1A 2VO1A 1Y8ZA 3HB9A 1KI6B 2ZT6A 1GU0A 2RIPA 4GXQA 3RRFA 1TU0A 3CKMA 4P84A 1EFPB 5A5VA 2X9VA 5I3CA 3FBGA 4GWLA 2HWUA 1FBNA 3RKUA 3SZOA 3L1JA 1K68A 3H7AA 2C95A 1BW9A 3IJ5A 4I19A 5A1JA 4XWAA 4TMTA 1RVV1 3R6LA 5BSUA 1QE5A 3JSXA 3LT2A 2Y1KA 4DCPA 3N07A 1Y1QA 4Q4CA 3TLCA 4WBNB 1OCEA 1LTQA 4KGVA 5HBRA 3RS8A 1C9DB 1QPBA 5JYBA 2H4FA 1GY8A 1PR2A 3ER8A 1YZNA 4DQKA 1GDTA 1S8AA 1GARA 5G2OA 4O2RA 3CUUA 1T2NA 2O2CA 4Q3OA 2FSGA 2CVHA 3SQXA 4N5LA 3PXAA 1TO6A 1UK7A 2QWXA 2I4NA 4ZOLB 5EWJB 4EAAA 5B12A 3TBHA 3D8HA 1GCGA 2XUHA 3QVLA 3E7PA 4Y6LA 2C7OA 1KO5A 1GAEO 2QLNA 2VDWA 2XCOA 3HJAA 3V8NA 3SMQA 1TJNA 2QMQA 3BIWA 4HQFA 1HYHA 5AR1A 2ISCA 3LFHA 3LP6A 5ILQA 1XCGB 2GKGA 4XYLA 1CUFA 3IQWA 3N8DA 1Q21A 2F62A 4F12A 4JC4A 1LDYA 2Q0SA 2BFDB 3N05A 2H0AA 3ENNA 3I9JA 5L51A 1JIIA 1YU6A 3QFFA 3CLVA 1DBRA 2GN8A 3C7DB 4XJVA 4DIFA 4BKMA 4V03A 4LQ4A 3KBOA 3DDUA 4TTTS 4L74A 3UMFA 1FFHA 3S4YA 1FBTA 3QVVA 2YN4A 3CY6A 3T5MA 4CLDA 1XZNA 1TZKA 3DV0B 4C5BA 2JC3A 5KSWB 3LC7O 4ARVA 1JKXA 4YJGB 4AO8A 2WA1A 1L4BA 3O75A 1F8FA 2DVMA 2HRDA 4EABA 2BSQA 1W4RA 4GBGA 4Y2RA 2R4UA 3RARA 3MS7A 2AN4A 2IWHA 4BMYA 2P7HA 1ZKMA 2J4FA 2PXCA 4JL6A 4MPRA 1NHWA 1UMDA 1NNI1 2GLUA 2WUEA 1W7AA 4ZEOA 1EUCB 1T9GR 3KE9A 4UBIA 4F85A 2YWDA 1CZLA 2PR7A 1S7CA 1ECLA 1QH0A 1RJGA 2FWIA 5CTAA 5JHGB 2JBAB 3QKUA 4S0XA 2JEZA 2C5FA 4B43A 3I4CA 4MI3A 5ICCA 4CR8A 3V8MA 4FMCB 2ODNA 4FCWA 4QG7A 5ADUS 3TR5A 2W2MA 2UYCA 1TK2A 2GPJA 4ZCTA 5I7OA 1A9XA 3KQYA 1I7DA 4DA6A 3OQNA 1VLVA 1GT91 2G25A 2ODPA 3GLHB 1U02A 1ZG3A 4REOA 2GHTA 3DM9B 4GT1A 3QE2A 5I5GA 4YR7A 2YHBA 3HO1A 3OM8A 2OZPA 2NVUA 2R87A 5HE9A 4V0KA 2C7QA 1SK8A 2Q45A 5H80A 1NT2A 2J5BA 2H9IA 3QVGA 1DKMA 4UOEA 1LSOA 3ZWVA 2IGTA 3AEXA 5DVZA 1NBMD 2ZUBA 4ER5A 3IV6A 4PW0A 4R31A 1AKEA 4F3KA 1GWNA 1YZYA 2P6PA 2XMSA 4IGFA 4F8JA 5ECWA 1JQKA 3JVEA 5AJTA 5D7BA 4V38A 1MABB 2BEWB 4H6PA 3V9AA 5AJHA 2R6JA 1KY2A 2VTKA 2C42A 3DMGA 1FFGA 3ZWKA 2C9ZA 2EYQA 1KKLA 1V1JA 1RQLA 3MLAA 4G5HA 3SSAA 2I6XA 2RK4A 2DHRA 1XVIA 1NN0A 3EZ7A 4W6ZA 3Q7SA 1GLVA 4H08A 1NASA 4GE3A 3IAAA 2DZDA 3DNFA 1NE7A 4RCYA 4ZOEA 5AKIA 2QW8A 4UHJA 3PC8C 3SXPA 1VIDA 3DXYA 3TOVA 4EG6A 4MI1A 5DLDA 4IUDS 5CBPA 5DGTA 2H1FA 2R66A 2BZ1A 2DFPA 3DW3X 3GFFA 3N86A 1CQPA 2Y1GA 3NS7A 1KEWA 3V3TA 4HT3B 3L1VA 2RGGA 3NT5A 1R6BX 4UPDA 1GNVA 1JQ3A 2WTNA 4F3RA 1J33A 2P9HA 4UTPA 2AUTA 5J58A 1OX4B 2AEJA 3KJFA 3LP5A 2CY0A 3HFGA 3JD1A 4QJ4A 5AKZA 3X44A 4W8HA 3UAYA 4Q05A 4AKTA 4AS3A 2D0OB 1SURA 4YAEA 1XKLA 1AVTA 2ZE8A 3D0KA 3H1AA 4G25A 3LNTA 1UT5A 1Q91A 4KK4A 3TQRA 1CU1A 1VJTA 3BK2A 4NMMA 2C04A 3FB1A 3FFWA 3MOIA 1SBIA 4S1WA 121PA 1ZJ5A 4JLSA 4MVCA 1IEXA 1LK0A 4RPLA 1EGMB 1U80A 2EL7A 2V59A 1YR3A 1SXQA 3H0KA 1UPCA 1E8NA 1VMDA 1XRNA 1DEKA 1NUTA 2DBVO 1FXUA 2QGNA 2FR8A 3I34X 1FX1A 4XVHA 5EXXA 3W6ZA 1DXHA 2CUTA 1V11B 5L3RA 2C92A 1RFLA 2PS3A 4HLDA 4UREA 3I9FA 3MWDA 5AM0A 2GCOA 4EI7A 1JR3A 4FOPA 4G2NA 2JIZD 4BNUA 3UOWA 1E1DA 2GEFA 1SU6A 2XVYA 4LZPA 4URHA 4X3PA 4R0VA 1WETA 2NXNA 2HEGA 2EU8A 3GNLA 4QHYA 4DWOA 4X62B 1EWVA 1A9RA 4U63A 3G1WA 2PU7A 3LYUA 4FU0A 1YD7A 3T5PA 4ZEVA 4XQCA 5TPZD 4DCSA 3CNBA 1ZITA 4E12A 4MP8A 2JCXA 5DLEA 5F7XA 1SKMA 1JQ5A 4B81A 2Z1NA 3NTRA 4F9EA 3JV7A 1UJ5A 1Z28A 1U5AA 3WY9A 4L5BA 2A59A 4JXXA 3KDAA 2B99A 3O3CA 4H15A 2JAQA 2P9FA 3C39A 3EWNA 4CV1A 1W4AA 2W6IA 5DW3A 1HO3A 2HA2A 3GA5A 4D74A 3OZVA 2QJWA 5CDSA 3V8PA 3EUEA 3X1KA 5ERYA 2J9XB 1TVCA 4R3WA 3OE4A 4OQDA 1Y34E 3RRYA 2APJA 5DK4A 5I5EA 3THOA 4KMMA 4LVNA 1KJ9A 2JIPA 2WF6A 4OHXA 5L8VA 1Y5NA 2VJQA 4FEEA 4ETNA 1DIRA 3T38A 5DGDA 5EUBA 4IYJA 1ZMTA 3C16C 4JJAA 2EF1A 1EJ6A 3IIIA 3OOWA 2DQSA 1L5KA 1PEYA 1I7LA 2H4HA 5AFSA 1FY2A 4PO1A 4FR5A 1DUIA 4KO3S 2EBHX 4X1KB 1ONBA 2FZKA 3QOWA 4YMSA 1FPQA 2NZ2A 4D42A 2I62A 4J2OA 4QAJA 4DV5B 2FR8C 3AONB 5DRTA 3V2HA 4PGHA 2P7IA 3ZQ6A 3PIRA 1QVZA 2VWHA 3CG0A 4DKJA 4HV4A 3LHIA 3PNMA 4LZAA 3Q3EA 2YHIA 3D4OA 1W6UA 1FTYA 2IVZA 3AW8A 4BCCA 1VCHA 3GLUA 4Y98A 3UOGA 1FJ2A 1QPGA 4LC1A 3I2JA 6ADHA 2IELA 1NXVA 3UG7A 1DG9A 1E1NA 1QG0A 3BGOS 4RGBA 3UYKA 3UK1A 1JUDA 1E96A 4IEIA 5AVQA 5KYTA 1E0AA 1C7QA 3DE0X 2QTBA 4ND8B 4R3NA 2ZSEA 1UDRA 2FF7A 3I6BA 4RK7A 1RBMA 3EGDB 5CXSA 5D5QA 4EUHA 5K4HA 5DEOA 3T9AA 4KREA 3OETA 1J8QA 4AJEA 3MERA 4ITVA 2G77B 3CYFA 3HYLA 4WD3A 2Y6UA 4MYHA 1X3LA 1FSZA 1FDVA 1DQNA 1LU9A 2P4HX 1R9MA 4WZAE 5EHNA 1DWOA 4JXJA 4PF1A 5FUMA 2VJBA 3J7AC 4FGKA 1XMXA 3C4QA 5F3RA 3SIXA 2XKKA 4CKCB 1MAAA 3WWCA 3VUEA 1G64A 3M4ZA 1GCUA 2VBFA 3IUYA 2AOVA 3R7FA 3RSFA 3CVWA 4J0KA 2I0FA 1XZIA 2OLJA 5HFNA 4DQVA 5U1PA 1A2KC 4K6GA 4YCDA 2KM1A 2XWBF 2WKPA 3AEQA 3ZPXA 5IDQA 4IX9A 2A33A 3P2OA 3KEQA 1G3UA 2W98A 3A7EA 3A9VA 3L0PA 3ZQUA 5J40A 1A69A 1IM5A 2BZSA 1X6VA 3CUWA 1NVTA 3L4KA 2XBLA 2RGWA 2LXNA 3IHWA 5KX5B 1I1HA 1ZJJA 1VBFA 4GKAA 1NF8A 2ZIEA 3T9BA 4F21A 2EX0A 4DA7A 1V8FA 2VPWA 3ROXA 1RZRD 1RPAA 3U4CA 2R68A 3LKBA 3OQJA 3RVDA 4J2HA 4JXZA 3BT7A 2YJ3A 5FBHA 3TG8A 3SC2A 2C3YA 4AMUA 3KTAB 3DAOA 2IIVA 2OFWA 4H18A 1T24A 3ORFA 1QH8A 3AFOA 4DQ0A 1TDJA 1KIAA 3P0JA 3E9RA 4JYMA 4TSFA 5IN4A 4LCEA 3RYTC 1ITZA 2LKCA 2C82A 3NJ8A 1D5WA 1M6VB 1VI2A 1J25A 3AGQA 1T4CB 3Q72A 5DSZA 4LMPA 3STWA 2WSSD 4YT4A 4DUZB 5F12A 4J91A 2EZ9A 4A2CA 3O1HB 2X5KO 1PNQA 4OU5A 1QK4A 4G4IA 4FZ5A 4YI5A 3EOZA 4YRFA 2YW9A 2BSXA 5CAEA 4TKUB 2BVNA 1P9LA 4K2HA 1YRAA 3FUTA 1ZOOA 2NO5A 4GO1A 3HB5X 4GOND 3SEAA 3FUCA 4KSBA 3T7IA 1W25A 2ODBA 3OH8A 4TKLA 3LDFA 3IVGA 5DXFA 3P5SA 4B5KA 4Z53A 3AL0C 1XV5A 3A6LA 5CJPA 4EW3A 1JB1A 1BJRE 1W0JD 3GAFA 3LVRE 3OFJA 1E1MA 2AH5A 4MQUA 3FSGD 1RWQA 4GD3Q 1R2QA 4OYHA 1TCCA 2W6JD 1BEUB 4LJLA 3KKOA 3Q1LA 5KDDA 4JB0A 5J4VA 5B6JA 3J81k 3VX3A 5FKJA 4CKWA 4WGGA 4PC1A 1EVYA 2OBMA 2OCLA 4DM7A 1RJWA 3MJHA 3TECE 1JEQB 2VBIA 4OLBA 2V03A 3B9BA 3FI0A 3I83A 5KJFA 5IJ9A 1C1DB 1M2FA 1N5LA 3H83A 3EARA 4DHEA 5HS4A 2P68A 3MMSA 3EVDA 2Q6IA 3PVZA 2QRPA 3UK7A 4LV8B 2VP6A 2WPNA 1F8UA 3EASA 4WLOA 2WB2A 3WRXC 4F7WA 1ETUA 1LJLA 1O95A 2VCYA 4KQIA 3TIVA 1LZKA 4GNRA 2XYHA 1EDEA 1GJRA 1HFEL 5P8WA 1X7ZB 1YJCA 4GMFA 2VHVA 1N2JA 3DR5A 1OIVA 4RTNA 2G9ZA 4ECEA 1CJVC 3PCTA 2GBCA 3LLVA 1WWKA 5D87A 4NWIA 2I9PA 1T3ZA 1T8WA 5HKKA 4INAA 4J9UE 4QUHA 4JVLA 1KO1A 3DMNA 4RL6A 3D8NA 1RPJA 2PX8A 1NNUA 1NW9B 3A1CA 3HRIA 3KB8A 3IJPA 4TXNA 2JI9A 2HHCA 1ZMXA 1FJGB 1A88A 1NXTA 7REQB 3GEIA 3FDIA 2P6OA 2QYTA 1NXPA 1PU2A 3TX6A 4MLDA 4OA5A 4R51A 4D4JA 1ST2A 2YY5A 1BD4A 1U28C 3BGSA 1UP4A 2CKMA 3LBHA 1Z0FA 1YQDA 5FRDA 1OYOA 3UTCA 3WLMA 4DCNA 2B2CA 1XWWA 5TV2A 4DR4B 4PFJA 3OEEA 3N74A 2OHOA 2JHFA 3C3WA 3Q2OA 3GP8A 4MEBA 3G0OA 3EVGA 3K9CA 3AWIA 5ENVA 5EQDA 3SC3A 4KFCA 2IS2A 3J80A 1QC5B 3DAHA 2OYSA 1F2DA 1P8AA 3GT7A 1DKRA 4EHLA 1AHHA 5ALTA 1VIMA 2DF8A 3QLVA 1XDZA 4BBJA 3AKZA 1QP4A 3G9ZA 3GEBA 2X4GA 4DCVA 1NYLA 1XTTA 4K05A 4KGDA 5HJ2A 3OWHA 3ROKA 5AUQA 2OXIA 4C9BA 2QRLA 5FFNA 1YGPA 3NAMA 1MV8A 3NIDB 3SKVA 1IJFA 3AI7A 1DBSA 2P65A 3TMYA 5L45A 1VCMA 1VKOA 2QYSA 2VATA 1QB7A 1O95C 3QUQA 1DPFA 2P6RA 1PJTA 1ZZEA 4KXMA 3E05A 2O8CA 4RVNA 3NWPA 4C6SA 5JWRA 1BMDA 4M37A 1AKRA 4RZXA 1E9RA 1LS6A 2H18A 3DFKA 4WI1A 2BY4A 3Q5EA 4DLUA 1W44A 4OB8A 1KZHA 2GETA 2WAXA 3ONNA 4KPGA 3M1YA 1OBCA 3I8SA 1NDQA 3TO5A 2PSFA 1QYDA 1S5PA 1MR3F 2RAUA 3IIKA 4NPAA 4P58A 5TT1A 3KLNA 3KCQA 4AY6A 1IZ0A 3TL3A 3WRYA 4O4HA 5LLTA 2JIQA 1DS6A 4KRGA 5FLYA 5GM2A 2N0SA 3G2OA 3RWBA 2JFYA 2C9BA 4CR7A 1W73A 3OCWA 5IDYA 4HGOA 3M33A 1DQRA 3Q5GA 3DMTC 1XVTA 1D2RA 1P39A 5IK2A 1HDRA 1YOVB 1E0SA 5EN4A 3AP3A 1GRQA 1DC5A 3M3HA 5TGDA 3PSHA 3K6SB 3VV2A 3THXA 3LXMA 2I87A 1U2QA 3CE6A 1VE5A 2NVOA 4Y2XA 4AUMA 2CSXA 1EP2B 2YVQA 3B2QA 3WKEA 3EBLA 2I76A 4MRAA 2V7EA 5HE8A 1E3EA 3KHKA 3A4YA 1QH1A 1G5HA 1RQGA 2GN2A 3E9CA 3VU1A 1KO4A 1QYVA 2ZBPA 4G01B 1GPUA 3BE6A 1GZDA 3H65A 1GPNA 2DLDA 4DILA 2X8LA 2XRZA 2YZMA 2H4YA 1EKXA 1WABA 1EM8A 3Q15C 4G9GA 4P38A 2ODTX 2H17A 1CUYA 4V0MA 5CIQA 5ESWA 3R9IA 4QXAA 4C0SA 3CUTA 4DCOA 2RHOA 3ILSA 1JP7A 1CJMA 3QUCA 4KX5A 4N7JA 4O1IA 2CXXA 1ST3A 3DZFA 5HK8A 1ZBQA 1DKUA 5C5IA 4R71A 5HVNA 5IT4A 1H6AA 3DE1X 3E23A 2IYZA 3Q98A 1GPKA 3CURA 3UCEA 3BE4A 2XQJA 4F72A 3FY4A 5JZBA 4U3JA 1EFVA 1JIVA 4GP6A 4UTXA 1WKCA 4ZTUB 2LKDA 1NDHA 2KHZA 3A9CA 4DMFA 3QU2A 5FYQA 1H3EA 1DUVG 4HBZA 2V1XA 3C7KA 1IN7A 3JVVA 4I8DA 2P4UA 4ZT6A 2GILA 1S3SA 4FPXA 4IDGA 3RK4A 2EF0A 4YTEA 5JH7B 3IB3A 2P2ZA 2POCA 2UVPB 2VFAA 3N2IA 4X6YA 2NPFA 3PXGA 4ZYUA 2ZYTX 4MICA 3FPLA 1SU7A 1C0EA 3NBFA 1QHXA 1KARA 4G1VA 2VJOA 3ILVA 1J49A 1OUMA 5E38A 3ZHSA 2ZTMA 1COWD 2IC5A 3GOQA 1JDBC 5CLIA 2CL6X 1F0PA 1JDBB 4X95A 3FLMA 5L4NA 2FDXA 3OZGA 1W2HA 3UG6A 4Z2AA 3NEYA 1ILEA 4XZ3A 4DLRA 2RH8A 4QJ3A 2H63A 4JIMA 1MOQA 4BNDA 3O0DA 7AT1A 3WTCA 1ULSA 3CISA 4TRRA 1R8QA 1VHTA 5DE3A 3EVCA 4UPVA 3STVA 3QYAA 5ICEA 5IZCA 1QIKA 1VA4A 3N6VA 1QK5A 2H57A 1YB6A 3TKYA 3T9EA 1GG8A 1QYIA 1NJ5A 4NENB 4CKBB 3BTUA 2PYZA 1TQ2A 1X1EA 3LS2A 2Y76A 1PSZA 1TTTA 2GASA 4L5JA 4HTAA 3WIUA 1A5ZA 3V00A 4DR1B 2ZJ8A 3H13A 5LQCA 1X14A 2BGMA 2H5IA 4RTKA 2J5QA 1X8JA 3PQCA 1TLFA 1E3QA 2HFJA 3A6PC 4O4HF 5FPYA 4FFPA 1K9SA 3HCRA 1PEDA 1A9YA 3NBXX 4TWAA 3RYIA 5KKCA 4ML3A 1X1TA 1XMJA 1YVUA 1WSWA 1I1NA 4G1EB 3HCEA 1PVDA 1SKUA 5KJ6A 3MHPA 1VL5A 1YFKA 4EW6A 4GAEA 3UW1A 3A4MA 4KH0A 4KQ2A 3RRNA 1CRQA 4R0MA 4AICA 2NV0A 1JFSA 4KPFC 1WY7A 1P0MA 2BFBA 3WIEA 1EGVB 3R7AA 4HX2A 2MOKA 2GT1A 4QPCA 3BQNB 3EFOB 3PE3A 4FGUA 4OHWA 1Y7IA 1VHWA 1T4MA 3GCXA 3P0FA 1GQSA 6PFKA 3RS2A 4F4DA 3GGDA 1PT9A 5ICSA 2G4VA 5TS2A 2VAXA 1OWLA 4POAA 5C37A 2JD2A 4ZGWA 2VPQA 3BDIA 3CKKA 2X2OA 2I4RA 2VH2A 2VP0A 1Y6GA 1SVMA 1SBZA 4LCJA 1HT2E 4XJTA 5JATA 2OCDA 2FF5A 2MYPA 3W5VA 2A0FA 4YRCA 3RKRA 4Y6GB 3ZE7A 1NV8A 2QYOA 3UXHA 3JR3A 3CBQA 3ZY6A 2P6UA 5K3EA 3F5QA 5IT5A 4LHYA 2ZDHA 1MB9A 3OP1A 3PFWO 3FDZB 3FHTA 3CZPA 3DVAB 4LSMA 4EG1A 5CFRA 1SRRA 3GJXC 3BWVA 4OPMA 3S2YA 1YDEA 4FYWA 1SVWA 4LJAA 4IAOA 4E21A 4PRKA 4D80A 1M67A 3VGPA 5IKPA 1YR6A 4UXHA 2OEPA 1JHAA 1CY0A 2Y1CA 5TC4A 3NNNA 5F7JA 3ESCA 4GSYA 4WT7A 4MKRA 1GTZA 1E59A 1PL8A 2H54A 3OJFA 4B4VA 1KJQA 4DDWA 5H9VA 2GKSA 2IKQA 2GYYA 2P78A 3OWOA 2BBSA 1JJAA 3NR2A 4JB8A 1G21A 1WVIA 2G07A 3D1VA 3EVZA 2V3CC 3ANNA 1CQIA 4G0ZA 2FQXA 5EHQA 3DDSA 4BV2A 4EIWA 4YCMA 4R1UA 2H4WA 3TSWA 5BRAA 1E7MA 1OZHA 5LP6C 4CT4B 4TT3D 1KP3A 3EEBA 5LP6B 1FJHA 2FK8A 3LUAA 3DTVA 3ZBUA 3DKPA 3IALA 3LD9A 1O77A 4MWEA 3B6IA 1MHPA 5DTEA 4ZJUA 1BMQA 4MARA 4DUPA 2XAAA 4LX0A 5FH9A 2PA0A 2R4QA 3BC1A 2XUOA 2WZDA 3FVQA 5ER6A 5FEUA 1YS4A 2VQ3A 5EMNA 2R1ZA 1W76A 2E21A 4YAJA 4LF8B 2WDPA 2BTQB 3VRHA 1WPQA 3H4TA 4DLPA 3GGCA 1H85A 2JANA 1IL0A 1YV9A 3ZXSA 5KWSA 4P3OA 3PA8A 4O59O 2A9KA 2G1AA 2P9JA 4GUDA 1K7FB 1IONA 3G88A 1IHDA 4Z4EA 2GR9A 3HDTA 4LOIA 4R40A 3T3DA 1X9GA 3NWBA 3W7AA 2ZUTA 1E9EA 4DIKA 1RLUA 4RNDB 1IPFA 3JZAA 1N5RA 4BEVA 2VK1A 3Q9UA 4WN9A 2QENA 1SC1A 5LDGA 1T3LA 3UWDA 2DUMA 1KP2A 3NVMB 1L4EA 5CM9C 2Z5FA 4EVQA 1BC5A 1VI5A 5EHIA 4BQQA 2KSQA 1II8B 5EFZA 2PXAA 4E32A 1EGHA 2VNHA 2GPTA 3P9XA 4DIMA 1JDZA 2EFGA 4JJIA 4TTSA 2FPPB 5A5EA 1F2VA 2BFEA 3B8HA 2CFOA 3JATB 4U02A 3T0FA 1SOUA 3LI2A 2WVAA 4CPDA 4QTZA 4NCBA 1WU8A 1RACA 2NU7A 2DULA 3QVJA 1UEJA 1GPH1 3T3EA 1WZUA 4TRNA 2I1QA 3DZBA 4DUYB 3O7WA 1YB1A 3ZS8A 2O54A 4BQOA 4D9KA 2WTAA 4EMBA 4WA8A 4EYSA 4NCJA 1R5NA 2GMWA 1M3SA 1LLQA 3MTBA 5CB4A 2PMWB 4IR7A 3KOOA 5U4QA 3RIGA 1EVIA 3JWEA 1VJ1A 3CX4A 4PE5B 4G0WA 1PX2A 2QI9F 4GI3A 2XUPA 5LJLA 5IC6A 2VXYA 3TB4A 2C2OA 4A0SA 5ARBA 3ZZMA 1PFVA 2HSGA 2BLLA 1YTLA 2NUPB 2H2WA 3MILA 3G5MA 3LVFO 1Z6XA 2OXCA 3NUGA 3RVOA 3TM4A 3NZEA 3OMXA 5JG7A 3QU4A 3W9SA 2YVAA 2B78A 4UXJA 3ISVA 2I78A 4OHOA 4HAYA 5ILGA 3V2UA 1WD5A 1B76A 1GPLA 2RBGA 5F7ZA 3L7CA 4GWGA 1V6AA 2OAEA 5BMOA 2JASA 3PLRA 1TKCA 4OAPA 1YDHA 2MSKA 2CEAA 3KOWA 4FKBA 4M0PA 1EEXB 1IHXA 1LB1B 3WGZA 2G0TA 1HNXB 3HK2A 1K7CA 2Y77A 1VMKA 3PLAE 3QTBA 4JBXA 5ES4B 1ZWLA 2PX6A 4QRIA 3SYTA 5FOUA 4D0NA 4GPD1 1NN1A 2IEYA 3OU7A 4OFBA 1KAHA 3NBAA 2J6IA 1VJCA 4QOEA 3AEKB 3VNSA 4ARAA 1QVWA 5GGYA 3HKCB 5JS8A 1BS9A 3AJ8A 3KQQA 2AHRA 2IUTA 5JYCA 4AY2A 2IA5A 1DU4A 1E1CB 1OLSB 4B7AA 4RTQA 3HCAA 2CUNA 2YDYA 3UF0A 1GVHA 4JODA 1IY9A 4K9PA 2QB5A 4Y67A 2PQ0A 2B6NA 2WY2D 2EAUA 3TSAA 2FKNA 4IGKA 4NSNA 5TS3A 1LH0A 2BGJA 2JH8A 3U6KA 1G18A 9ATCA 5CDFE 1TM1E 1MAUA 2FSVA 1KA9H 3DHVA 5FULA 2XRYA 1PJAA 1ZY2A 3PUYA 5ENZA 1IZZA 2PRJA 1Y8QB 3C14C 2FWAA 2D2IA 3UWOA 1WUTA 3B51X 3IERA 3TZHA 1KY3A 1O9HA 4I5IA 2Z30A 3GZNA 5CGQB 5JCXA 5KDOA 2UZ4A 3D8SA 4PNEA 2H5LA 2NQ8A 3L1UA 5CG1A 2ZM5A 4YDHB 5JNLA 2TS1A 2VT7A 1TYBE 2X15A 2P2YA 2RI0A 2YOFA 2E89A 3PHIA 1L5MA 3TZQA 2FWNA 2OZEA 3IOMA 2W71A 2Z04A 2WINI 3BQMB 3GLFE 2EZUA 621PA 2PQMA 1U2RA 3KKQA 5IF9A 1A95A 4PG6A 5EKSA 4RQBA 2WLTA 4NE7A 5E9WA 5SYNA 4DXAA 4YRSA 2ZJ2A 4LKOA 4FFBA 1R88A 1T5OA 4D0GA 4K9RA 3TTUA 1KQGA 1ZPDA 1JWAB 3MMPA 3MGKA 5EJ6A 1FYVA 1OWMA 2BJHA 2PEZA 1M7BA 4DKXA 1YS1X 1ECFA 1AK1A 5JS7A 2HA5A 4RIGA 3TEFA 4ESVA 2FEKA 4C2AA 3LBYA 4MKGA 5K99A 2Q28A 4GVLA 2AFRA 5CB4F 3VZQA 1BMTA 2PUGA 2ZI6A 5JFOA 1ZDMA 1I7NA 1RRKA 3DONA 1Q0QA 1CY4A 3T95A 3E9YA 2W8ZA 5EE3A 3OX1A 3V1UA 3JU3A 2HHLA 4C6RA 2HR1A 1REQA 4LK3A 3Q0TA 3FWPA 4WRRA 2KLBA 3NRCA 4ZC1A 2NSJA 3OEYA 1BMFD 2FRVA 3O4GA 4GLFA 2BTEA 2VF7A 4KZKA 3ZZ0A 4HEA1 3B7PA 3R23A 4OUDB 3BMCB 3CGGA 2X3YA 4V0QA 1P2DA 2FSVC 4R1NA 3OKAA 1MIOA 2XIJA 4KAFA 1NMSA 1Z06A 3KV3O 3QWFA 1UFKA 2PA3A 3COPA 4XQ9A 3O95A 2O8FA 1W0KA 2FFRA 3ORSA 1A4UA 5JFTA 3I1FA 4N18A 2ATIA 4OHCA 2O1XA 2XJ4A 2QR5A 1U0NA 4QLAA 3BM5A 1DC7A 3FRHA 4MIOA 2JFUA 1SXJE 5HRAA 3EYWA 2BGRA 4RV4A 5HQ3A 1OZFA 2C9OA 2A86A 2G8NA 2IZZA 3OM1A 1C3OA 4QEKA 4U9UA 3VZDA 1UBEA 3WLSA 1KQFA 1Z9BA 2PO5A 2XDQA 4X1YA 3H9EO 1ZESA 1X0XA 4MKZA 1JIXA 3Q9NA 4CYMA 3JPYA 4HGQA 4C6TB 3AEUA 2AJCA 2G9NA 5K51A 4FC6A 3OKCA 4BNGA 2CLDX 2W6CX 2E4XA 3RBVA 5BSKA 4JLAA 2WR8A 4RV9A 4BQRA 3AFIA 3U5TA 1ZRHA 3FMVA 4Z51A 1NI5A 3CVYA 4JLKA 1G6Q1 2YIVX 3FAZA 3V4SA 1NBHA 3BXFA 3CWQA 2FK7A 2WWWA 2VJPA 1CG6A 3H9CA 1Z36A 721PA 4HS4A 1IHYA 2Q2QA 4JKIA 4U7FA 2PVPA 2XVAA 3MC1A 4R7TA 3PNVA 1SZCA 5DBGA 4QPNA 1AKNA 5YASA 2HK8A 3WNQA 1PWZA 3WYAA 1NLUA 2YXBA 4UHCA 2X0DA 4B34A 4FJ0A 4FT4A 3VAZA 1UBGA 2P40A 1JH9A 2X8JB 5KHLB 2XYVA 3AT1A 3RAEC 3TW8B 4BFXA 4ZFNA 3WQBA 4C4PA 5A7HA 3C8MA 2G0NA 5AXCA 4WASA 2HKIA 5EIOA 4ZT4A 5JSHA 1H8EA 3DBOB 4XQEA 2RBEA 1D2HA 2A5GA 3D02A 1BU8A 3K4QA 2OG2A 3Q3IA 3QU5A 4WBXC 1O8CA 1KK2A 2F8MA 5E7MA 5DIFA 1WP4A 4KLAA 2QTLA 1LDBA 2X9LA 2ZBUA 3C43A 2JFFA 1SOAA 4BX3A 1TUBA 2Q1XA 3ETGA 3GGJA 2OAP1 1ICEA 3IP1A 2WZQA 3RTBA 2XOKA 3M5DA 3PJFA 2GJKA 4M8KA 5ECYA 2FEXA 4RMJA 4F6RA 5IJ0A 2B1RA 2A5YB 4I08A 4TLEA 3KNZA 3O2SB 4WK6A 3LA6A 1ZL0A 1Z39A 2I3GA 4FC7A 5EUQB 4YAGA 4HOYA 5DX1A 1PJZA 5F77A 5CH8A 1IPHA 1TK9A 1Q0UA 4EO7A 3U4GA 3PYXA 5FO0A 4UJ5A 1OWPA 3TSCA 4RD6A 1U0RA 4HDRB 5IF3A 5HGJA 2L82A 3FJ1A 3OTWA 3PBKA 3UAVA 3P19A 3ZU2A 4JGGA 1LNZA 1US8A 1YQGA 3BCHA 3RADC 4CRWB 4YEDA 3B53X 1LDNA 2IY7A 2WP0A 4AMZA 1LPAB 1Q20A 1SC4A 5TT0A 1GTL1 1LPOA 1YK1A 3RSZA 3ZDQA 4O3MA 3WLHA 2CDBA 1OYYA 2JLAA 1VJ0A 2ORIA 1R0ZA 5KI6A 3RYCA 4S24A 2I33A 4W8GA 3SHQA 3O2JA 5LZ8A 2NZWA 2A8YA 2QN1A 1SOMA 1PJSA 5B7QA 4K6OA 3L6CA 1ISJA 2MYUA 2WT8A 4KUGA 5J2UB 3OQIA 2CHFA 4GOXA 4Q21A 1MAVA 2BHNA 2F48A 1DV1A 1XTPA 2FWMX 3AH8A 4QXPA 1PR3A 1JHOA 3O5AA 1DAKA 2XNJA 4RD1A 2DHDA 4F3YA 3FPBA 2Y27A 1SMKA 2ZQZA 4GICA 4WY2A 3E48A 3Q3GE 1JLLB 1DX9A 1GILA 1QG2A 1R10A 2EFJA 3LLUA 4KW7A 1C0PA 4NL4H 3C6MA 2BGWA 2MWMA 5JDIA 3C5CA 4NMLA 2X22A 3F6PA 2JJ1A 2ZJZA 2XXAA 3H6KA 3PE6A 4HLUA 4DNFA 3CW8X 2O2IA 1BO6A 1NF9A 2AD1A 1BVUA 2QD3A 3PJDA 4JXKA 4PCUA 5FFFA 5KSPA 1D1SA 1QGOA 1XEFA 2ZB3A 2GBFA 3O9VA 2WWHA 3CIFA 2D1YA 821PA 4KVZA 2C8LA 3ZJYA 5CLLA 2OQRA 1H0KA 3TSYA 2X8BA 3S68A 3ZBTA 3R6DA 1GA4A 4ZZ3A 1LPMA 2DFLA 4LF7B 1F48A 1FTQA 3WP0A 4MW2A 1HE4A 2IY9A 3UHAA 1VCNA 2OOSA 2VF4X 4PAQA 4RTJA 4W5QA 4TTRA 3NNSA 3I53A 2FUEA 3NX4A 4AKSA 2GNPA 3EPKA 5H7XA 1VBMA 2PJRA 3HGQA 4XA8A 5KJ1A 1CY7A 2X5XA 3DD1A 2Z2YA 1Z2EA 5JY1A 4BO7A 2H2AA 1ZQ1A 2IEAA 1UC5B 3GGSA 4PY2A 1P2TA 3LCUA 2HT1A 1H65A 2AG5A 4Q93A 4FS8A 5HJEA 2A9QA 2HPZA 4OKNA 3NDIA 3BXXA 3TQFA 4U7TB 4WZBE 4NU6A 3VH4A 1EGQA 2HT6A 5JCJA 3RYCB 4YAUA 5F2OA 2CXNA 3PJGA 4WOBA 3TIIA 1SHTX 3H42B 4MR7B 1L3BA 2B25A 3DG9A 4MUYA 4PONA 4C7JA 2H29A 2ZKIA 2GHIA 4NXMB 2E4AA 3PXDA 4J3FA 3LY5A 2XY4A 4GOMD 4R2LA 4ZVMA 1D2CA 1YVEI 3GIDA 3A4LA 4YQFA 3AVWA 2ID7A 2Q9AA 2HGSA 4EY7A 3H1GA 4EDHA 5JDIC 3IAFA 4X6LA 1SHUX 3SHWA 3X1MA 4HLUC 3F1KA 1Z4JA 4O33A 2ZUFA 4M1SA 2DTXA 1EP3B 1T8YA 3U7GA 3DMRA 4IHAA 4QBKA 4P35A 1N2CE 2R8XA 5JD6A 3K2EA 1I4OA 4DLNA 1NMZA 2CFSA 4R8LA 1NJFA 1W85B 3V1YA 3VZRA 1QLWA 3CBGA 3UT0A 2KJQA 1ZVJA 1IHPA 2OBNA 3LPCA 4HUJA 4KSYA 4MQFA 4QUDA 4QLBA 2FLKA 4E3WA 3ZDRA 1P1JA 3OZRA 3AJ9A 1HY3A 1UT8A 2XQGA 1NM5A 3UV7A 5BWCA 3VNQA 4F9GA 2GZSA 3W2TA 3LKVA 3FOZA 3OCUA 2Z0MA 2JIDA 1WB4A 1WXQA 1LGYA 2EX1A 1NA5A 4BO1A 1POWA 1Z29A 4W7IA 2YV4A 5ADWA 2C4KA 3RC7A 2DQYA 3P52A 3ZN2A 3W34A 1EDOA 1MEJA 3OHSX 3QPBA 1AA9A 4MKFA 3IAM6 4AU1A 1Z5VA 2DC1A 4MITA 3AB8A 3FHJA 3SSMA 3FAKA 3RVPA 3V4VB 5B3JC 4URUR 3EPLA 4K9SA 2GARA 5FD8A 4FFNA 5TMEA 4D8WA 1TM5E 1T9CA 1YSCA 2FXIA 3I6ZA 1QBGA 1YUNA 3AKEA 1N7HA 1KZ7B 3ZWYA 4FR0A 2X3UA 1MT0A 1ZJ4A 3X2SA 1PL6A 1X8LA 3KHTA 4B3CA 4B09A 1SWWA 3MB8A 2PT9A 4TYWA 3WHPA 1XTJA 3JASB 4Y9DA 1V95A 2ZT5A 3ZVMA 2J3MA 2OQVA 3EGEA 3N53A 1J00A 1B1CA 2PZMA 5KEIA 4HMPA 2IYSA 1FP4B 1HYEA 3OTIA 3RASA 3Q85A 3E1KA 2OZVA 1F9EA 3GCWA 1XLTA 4D9NA 1IHUA 1EK6A 5L7TA 2JBWA 3L4BA 3AFGA 5FTLA 1XMQB 4M0MA 2NUTA 4XRGA 4BIMA 3HGMA 4YAFA 5F4ZA 1Z35A 3C8DA 1JE1A 1P5RA 2A4MA 2QR2A 4LRSB 4WY5A 4E2WA 4F93B 1CW2B 5B36A 1YDGA 2RKOA 3RUEA 3IP8A 1T36A 1Q3KA 2BF4A 2HK9A 1QP8A 4IY1A 4KV7A 1SXHA 4K81B 1PDOA 3O83A 1YJ8A 3CXUA 3VBEA 1A9TA 1L4HA 2FKAA 5EIAA 5CBKA 5LMZA 10MHA 3ZJVA 2HRZA 1NM5C 2WTEA 1VL6A 2X9NA 3SLGA 1B73A 5GZ3A 5K09A 1FQWA 2CXQA 3LH5A 5GONB 4BHTA 2O2ZA 3G7NA 5C46F 2PBLA 4LVCA 2CUKA 4BX0A 3IQHX 2VZLA 4PQGA 4XOUA 3HA7A 3NLLA 4C0WA 3EF0A 4PZZA 4QYIB 3RGGA 3D4BA 3ANTA 5EZQA 4DMHA 5LQJA 4MDFA 1T5LA 5AK3A 5CT4A 3FJOA 1RYBA 1HLPA 4DM3A 5CDGA 5K0FA 1OX6A 1X19A 3IOEA 4C21A 1XZFA 2G6TA 1NONA 3KHSA 3LBIA 2PWAA 5GZ6A 3VR4D 1U6JA 2VKQA 4DG8A 4ZXFA 1JSZA 1TC2A 4PPGA 1NTOA 1P45A 3RSOA 1XAJA 1HT3A 1RWVA 3D0QA 4I1VA 3UIEA 1WLYA 3ZLBA 2IHKA 4JC5A 4JNKA 4W9NA 4YUYA 4M21A 1SQSA 4B2PA 4IDHA 1PR4A 3IT0A 4BE9A 3G59A 4EZEA 3L84A 4JLOA 2LTAA 3DPUA 5F1KA 3I61A 4ZK6A 5E9QA 1NRIA 2V1UA 2BFCB 4YVFA 1ODIA 3KL4A 2ZRPA 2GAOA 5FWYA 3IUMA 4HTFB 4AP5A 4P0PB 1ZO8A 1G2QA 1XLTC 2VNJA 1CS0A 4GNKA 4LZZA 3L4BC 1MQ9A 4MAMA 4QWMA 3NO4A 2YYZA 2EG9A 1PDVA 5BOSA 4DC1A 3ITNA 1Q0SA 3CS3A 1Y4ZA 3NC1C 2UU9B 1Z5WA 1OI3A 1SBCA 4D0LB 3PPYA 5L3SA 3X43A 4ZYZA 4GOKA 3WAGA 3KQLA 1B74A 3V80A 4PG5A 3R3WA 5T8KA 2H7CA 2IYVA 1DAGA 3BGWA 3IEVA 1UBOS 3BGDA 2UZ3A 2GX6A 3D6MA 4RMHA 2FOXA 3FZNA 2C2XA 2HADA 5C1PA 2AFHB 2B7LA 4C4SA 3IEXA 1GFWA 2AYYA 3EEIA 1M76A 5J2TA 3MS2A 4B8ZA 1LNQA 3EAGA 1JTEA 2PYDA 1HE1C 3FHCB 3U62A 4BE4A 2ZIXB 3R0QA 1SUFA 3W04A 2QV0A 1O94A 5FOXA 2DGDA 3QNMA 3NHZA 1DXQA 5LQNA 2P6MA 1C2YA 3NC0C 4YRLA 2XB6A 1Y81A 3KKLA 1ZP6A 3EH1A 4ZQCB 1Q2XA 1ZEMA 2ASVA 3OJCA 1VGQA 2J0UA 3IP3A 3BTSA 4F1WA 3OIGA 1Z3CA 3N59A 1B8PA 2BLNA 2VUSA 1GGJA 3DAYA 2GK4A 3IL2A 5KOJB 4QGBA 1MGPA 1PS9A 2BBWA 3FLEA 3QX8A 2RH5A 3L0SA 5TQJA 3I23A 2JDIA 4PLVA 3VOBA 4HCJA 1NVDA 3R41A 4WJZA 3S6JA 1KI4A 5JS2A 3UANA 5IMSA 1X1SA 4W9NC 1RYZA 3CEPB 1YDMA 4PLGA 4GDFA 5FPSA 4N39A 2OCGA 1P60A 2W4MA 3MRSA 4ZMSA 3QF4A 4GMGA 2KYRA 3IH5A 1LBIA 3HJHA 4F3NA 1TEXA 2QR3A 3LCMA 2XUQA 3LGXA 1RNLA 3D5QA 3M9XA 4FEAA 3GVHA 4IO1A 4O2AB 4P54A 4CCYA 1H8HA 2NN3C 2VPYA 3A28A 2C2MA 1EE1A 1GG2A 3N3AC 4GPIB 1WRBA 2WVHA 4KXQA 1JTFA 3ZDFA 4BNMA 3G68A 3R74A 4DMUB 1E1YA 2XMGA 4FWTA 1Y7TA 4EWLA 1S96A 2DXIA 1RC1A 3JYHA 2XYPA 5CIYA 1MCZA 2GZMA 1PW5A 5FL7D 1SD1A 3SXJA 1NVAA 1NZJA 2ZRAA 5KYNA 2OVFA 2J41A 4MH0R 5JECA 2GZ2A 4ZT5A 5A0TA 1A1SA 1FSGA 1ZN8A 2H2DA 4EA7A 1FLNA 1W47A 4QECA 4O4JA 5EJ9A 2QLBA 1VPLA 4ZO4A 4OGLA 4QM7A 1O94C 1QYXA 3R1IA 4BKOA 4YCAA 1GOTA 2W4QA 2CLLB 4C07A 4D8XA 3U7FB 3ZDYB 3T12A 1KJYA 5LD2B 4I3GA 1QIGA 5A0FA 1LF5A 3NHRA 4IFBA 3TL6A 4MULA 2BM9A 1Q3TA 1AZWA 3O73A 4BECA 1MTZA 1IDN1 4PRYA 1I3KA 3KZVA 4RL4A 3B36A 4TVKA 2QN7A 5T4HA 2VHEA 3R75A 3V4PB 3ZIDA 3QRWA 4E7OA 4JA0A 5KNDD 1SUAA 2GEVA 3QJ5A 2QZ4A 4RSRA 3K5PA 4FOLA 3PXEA 1A76A 1BQEA 1L4KA 4C1NA 1OH7A 4CEJA 5CYPA 3QY0A 4XWOA 1M6WA 5DRYA 1NVVQ 5KVSA 1H66A 3OMWA 4GPEA 5HBGA 1RLIA 4YXWA 4C0AC 4CGYA 5CB6A 1GTJ1 4DG5A 5I7VA 2JIOA 2HHJA 5LFAA 1M74A 3ABSB 1AN9A 3KVOA 4L8VA 1WBJB 4GPAA 1JEEA 2VIIA 1UIMA 2H1LA 3AHJA 4I55A 3S5UA 2ZE7A 3ZG6A 1T0BA 3C8UA 3LUDA 2GI4A 1AV7A 4ITRC 2AMLA 4BNWA 5J2TF 3HXPA 4K46A 1FQOA 4AJ4A 4LYJA 1MW9X 4C4TA 5FJIA 4E5DA 1ZCBA 1Y3CE 2QM7A 5CITA 1JHXA 1LD3A 1A9PA 2O8BB 3GQBA 3MWEB 2VKTA 4S0ZA 2OKCA 2WAMA 3OFNA 1EWYA 2LBPA 2EERA 3FMFA 2PEYA 1CE8A 2FEWB 2NZJA 1KC3A 2WKSA 3C41J 1I2BA 3BEDA 4JJ4A 4KQ9A 3CGWA 4RYDA 4Q00A 4A0RA 1I8TA 4CQJA 4EJMA 1G2IA 4ER6A 3BSWA 3OSZA 3FOEC 3TSZA 1XKTA 2WHYA 1C4KA 1D0SA 1QNLA 3G49A 4EQ6A 5BWMA 2QD5A 1JHZA 3AUFA 1QTRA 4R8KA 5LIPA 4S35A 4OP3A 3QG5A 2HX1A 1CUBA 4MO9A 3L8DA 3CLKA 3D6AA 1GU1A 4PBTA 1EUDB 5D3MA 1X7YA 2GJ8A 4D9MA 4ZKEA 3U7RA 4JBGA 5GVSA 4FYJA 4DLVA 3FTCA 3PPXA 3P0RA 5DNWA 3BJEA 3O8OB 3BMQA 3RAPR 3D7LA 1K8QA 3I52A 1PQPA 4ZU1X 1AO3A 3UK2A 2A0XA 2VEDA 1DCTA 3SIWA 4LDRA 2I2CA 4JHXA 4LWZA 3LIIA 4LZOA 3ELBA 2IYEA 2FA9A 3EBOA 4HB4A 4UVDA 1ZLXA 5ALGA 3UGKA 4IHKA 2BUAA 4XLLA 4UMFA 1UZUA 3HZZA 3FA2A 2WJ3A 1XDUA 2QP4A 3KC2A 4WKGA 1YKGA 4R0NA 4FBLA 2AX4A 1K8XB 2O2EA 2Z5GA 3NJ4A 5K0NA 2DKOA 2EXXA 1J5PA 4TL7A 1P1RA 4J7XA 1AGRA 1J8FA 1YBMA 5F23A 1PZGA 4QARA 1Y6RA 4E0BA 2R8PA 1JQDA 2EJUA 2Z3VA 1JQAA 1PHPA 4O4JF 1X15A 4YY3B 4J76A 3QP9A 4DB4A 1EFDN 1N9GB 1V3UA 1Y3FE 1YQXA 2X42A 3B5IA 3N58A 3VR2A 3VJKA 2OV6A 1USVA 2WUVA 1ZH6A 4D98A 2YV3A 3H3XA 1VPVA 4P33A 2PT6A 2QQ0A 2X4DA 3NXKA 3TD2A 3BPSA 4JOSA 4HQ6A 2UAGA 5DKFA 3LF1A 4K9MA 1IBSA 2IY8A 3ESZA 3ISJA 4IQFA 1ZGCA 4G09A 4MWZA 3AR3A 3EDRA 2I2XB 2GPWA 1K27A 1Y8RA 2DOKA 3K16A 4FB5A 2WU1A 5ELMA 4YMHA 4TYYA 1R6TA 3MWJA 4CL2A 4G5SA 5AKJA 1Y9DA 3QFHA 4LGMA 4OSPA 3K4PA 1PBTA 2Y0CA 2BMEA 2P3QA 3NIGB 1UFQA 1LRJA 3K8QA 4CL0A 3D3WA 3SDZA 1AS3A 2PZLA 4I55F 3GEEA 1JR2A 2WFZA 4QGGA 1XAIA 3FIUA 4FYKA 3DHNA 5AKHA 1X7YB 3ACBA 3VO1A 1BHJA 3RSLA 1S8OA 3HGTA 5J1TB 1G20A 7ADHA 4UBKA 4MMXB 1RI2A 4RABA 3L77A 2IX9A 3T61A 1SM4A 2J1LA 2VSNA 1TF7A 3ROGA 1WVMA 4WZ6A 4C7VA 4EX7A 1ZNZA 3EY9A 1H2YA 1ONNA 3KB1A 1G42A 3LUCA 4MWGA 4LA4A 1Q5PA 1UJMA 3U4MA 1HE2A 5FWXA 1XT6A 5FBQB 4YP0A 4UAUA 2AYXA 2CMGA 4A10A 5SZIA 1VCIA 1JHVA 3QEJA 1Y33E 5CNIA 2FTKE 1W30A 4LHWA 4UW9A 5CX1B 1AO0A 1VIVA 3DWEX 4MRMA 1J39A 3EA4A 1GDHA 2XEXA 4N0MA 2IIQA 4PC2A 2Q41A 3PDCA 2FWRA 4RJ2A 3UV6A 4BFZA 1G4UR 2GUGA 1A3CA 2VUUA 2ZB4A 3VJMA 3ODGA 2HLPA 3P2IA 3UC5A 5L53A 3DP7A 1R00A 3HNOA 1SBNE 3QV2A 4I9GA 3ZGOA 5KQGA 4ND3A 3PZBA 4LNUA 1TEVA 1E9AA 3D9QX 3E3NA 4NC9A 4OBWA 1HLFA 1FU4A 4C20A 3DHYA 2IYRA 4QHSA 5EKUA 3CHYA 1XD8A 2WIGA 3CF2A 4LWQA 5LYYA 3OIWA 3ND5A 3T5AA 3UMYA 3RIHA 1ADFA 1DDGA 4FB4A 1QU2A 3MPUA 1MDFA 1E4EB 1QZZA 1Z8HA 3I1IA 4NV1A 1CTQA 1GKUB 2A9PA 2GBLA 2R1VA 2IEBA 3D2BA 3HVUA 4L6AA 4PYOA 5I8WA 4KAAA 2VPPA 3FN4A 4CMHA 3BK7A 1KH3A 3SKXA 4MAFA 1KXJA 3NYRA 4F96A 4EITA 4A91A 4LK2A 1T4DA 3AETB 3TIGA 5LL6P 2OPBA 5DBEX 4J3JA 4DM4A 4ONEA 4CEIB 5BSGA 3QZUA 2F1HA 3JQ7A 5JPCA 1UM9A 3VYVA 2FR0A 3L0ZA 1SCBA 2GJSA 1O5OA 4YJFB 4AJHA 4B44A 4ETMA 4XWWA 3GLGA 4DIEA 1ZKDA 1ZXBA 1RJFA 4GGPA 1ZK4A 1QE0A 1LNSA 4CM8B 3EGOA 4TMXA 1P6QA 5C9ZA 4IUBS 1WMFA 1DUSA 1KC1A 3UFBA 1NN5A 4G23A 1HEIA 5ICGA 3HCCA 1XD2B 4F2WA 3IDQA 2JEOA 2OV8A 3B85A 2B8TA 3TLZA 2HA0A 1ZICA 2AKAB 2ZYRA 4ENTA 16PKA 1GA1A 1AS2A 1QZ3A 1DZIA 3DZJA 4BO6A 3EC2A 1MUUA 2ZBRA 2DCMA 3QLEA 4UJ3A 3L6UA 4S1NA 1T8UA 1LCIA 3LX5A 3EIHA 1SUDA 1VSUA 3ON5A 1YBVA 3PEEA 4N5MA 1IEWA 3RWOA 1RC0A 1CUUA 3GP5A 1NHGA 2A1UA 3MUFA 3ICVA 2E1PA 4A6PA 3WYCA 1A8HA 4HJRA 2O52A 1N7JA 3ASYA 4XGNA 3LPDA 2WJ4A 3K6KA 3T4UA 4FE4A 4MRNA 5DHRA 4CLRA 5CYFA 3IA7A 2H11A 3STHA 3HXQA 5AW4A 1EWRA 1H2XA 3HEBA 3P9QA 2VHTA 1WO8A 3ZIAD 3ELWA 1O58A 2W0SA 3NMUF 1TGVA 2GBLC 4MR8A 2IYPA 3IV7A 4K0RA 4M36A 2B35A 4UE6A 5TMBA 1H4TA 1XYVA 3NNDA 5DM4A 4RC9A 3EZGA 1V71A 3ZOKA 5B2EA 5LM3A 4OHYA 1KRWA 1W59A 4BFWA 2YFHA 1CDZA 1Y1SA 2XB8A 1KJNA 1GRVA 1KYQA 2ZM6B 3EQ7A 4JIGA 2C2ZA 2C78A 1KSHA 4HNQA 3W05A 4G26A 1NW6A 1MO3A 4MUIA 3VR6A 2FZWA 3UICA 3KALA 4N6NA 4O6VA 4X00A 5D5PA 3QVMA 4L1KA 4XTRA 3PQFA 3PWZA 4HNAB 4TYPA 3ZC3A 1GV1A 2C8JA 4GYWA 3IO5A 4OGGA 4X61A 1L7AA 1ZM2A 2ZRIA 1G7SA 4XUDA 5FOVA 3KQUA 4XD7A 4E51A 1XJCA 3ZD9A 1P2BA 1GVNB 1PBNA 1C30A 1E79D 4GEKA 4U5XA 2C59A 5DIZA 1L4LA 4LHVA 3ZYZA 3H1FA 3FZEA 2HLNA 4Y18A 5D86A 2MCFA 5ITZB 2C7VA 2BMJA 4MUEA 4D3SA 5FF9A 3C6YA 1GG5A 2DERA 3CXRA 4AQYB 3ENQA 4HEJA 3OQ1A 3EZNA 3GN1A 3LPLA 4Q0MA 3QM1A 4DEXA 4RULA 2R1TA 3EODA 3L6DA 3R5TA 3U37A 1FVOA 5B6IA 3D4IA 5D3KA 4BQSA 1ZW1A 1BDIA 3T3NA 2OY0A 1OQAA 3DGEC 5FAXA 3FSGA 2WMDA 1AXEA 1IG3A 1DO0A 3A4VA 1K0FA 2FGJA 2ABWA 4IILA 1TTHA 4ZHQB 1ORHA 5DI9A 1K1EA 1ZAKA 3EEFA 5KOHA 2R9VA 1J09A 1LWNA 2BUBA 3N0XA 3BF7A 5LB2A 3HY3A 1JVNA 1OBVA 2QTWB 3AEZA 2PKXA 2A78A 1N6LA 1KEEB 3DUFB 4MGEA 4YT5A 4C05A 4D81A 3HXTA 3K6JA 3N8IA 2YKGA 3QEMA 3K0FA 4QUIA 5CRIA 2EVWX 2G5PA 2O3QA 3ENZA 1D6NA 5K8JB 1D09A 1W9MA 2IF0A 2JFHA 5T3UA 2NTYC 4HDMB 3PG5A 3PQEA 5THQA 5HX7A 3EXEB 5DSXA 3VR5D 1K0UA 1VMAA 3JQ8B 3FVTA 4D4HA 4DJTA 1QRTA 3F5MA 5JMOA 1U2EA 5C31A 3T5GA 1JG2A 3UT6A 5J9FA 2J9FA 4MGZR 3DYVA 4QQ8A 3HBJA 1R0YA 4R1LA 1OFHA 1E32A 1C3LA 5KUTA 5H5JA 4WE3A 2VJKA 1U7UA 1UPAA 3HA2A 3I39X 3OPYA 2XMQA 3OFVA 3QSGA 4HH0A 4ON9A 1W34A 4MINA 3I2KA 1OPRA 1RYNA 1QGYA 1XZBA 3UHFA 4EB8A 5IC4A 2PUTA 2DBRA 2RBKA 4XIIA 3RF6A 5FLKA 3ADOA 5KC8A 5DNYB 4HEQA 4HKTA 1WF3A 3GNSA 3CJRA 4IUYA 4MS4A 2XIQA 5ELLA 1M2OB 2HMTA 5L6LB 1RXUA 4ZT3A 4PG8A 2UUPA 1G41A 1KH1A 3HYSA 2XCLA 3JQGB 4HH1A 3AVTA 2ZE6A 1XIVA 2Q21A 2B9VA 1KJIA 5FUBA 4QGSA 1ZD1A 2C9YA 3LZ6A 3DE6X 2Z8ZA 5TX7A 4FSDA 1XALA 4M1ZA 4ABYA 2R84A 3PDUA 4NZZA 1XYGA 2GRJA 4PLWA 2VK4A 3MCTA 2JJ8A 4YA6A 3I6MA 3HYNA 4YECA 1K3UB 2AIRA 2AOXA 3KELA 1U9CA 2AK2A 1JMYA 3B3AA 3KLMX 4LXTA 1M1YE 3M4JA 1UBSB 4XGQA 1B42A 1T1JA 4JBHA 3AUAA 3P20A 1X70A 5CVEA 1GCOA 3OURA 3IS3A 4HXGA 3AVVA 1LRLA 4Q18A 3FFAA 4L6IA 4WLNA 5EIEA 1OLUA 2NO9A 3EMBA 1OZ0A 4DC0A 4RY8A 3RGWS 3BD7A 5J3JA 4IQ4A 1PEKE 3DJYA 3BRCA 3IEPA 3GL9A 4P7BA 4Y3UA 3UAOA 4BWVA 2WVJA 3B1KA 1OR8A 1WXDA 2LV8A 2CCKA 3GT0A 4QPJC 4ID3A 3KWMA 3AHDA 4OO3A 5E1DA 3GZJA 4D79A 3SJZA 3B7GA 4HD8A 1CUHA 2HTFA 2QVYX 2R6GA 4NV0A 5CW1A 1UJBA 1W581 1QO0A 2FX5A 5FT9A 1U7DA 1QF7A 2FVYA 4IEFB 2PYIA 4CI9A 2C4NA 3W78A 1DTEA 1UQUA 1QIHA 3O94A 4IDFA 4FQ7A 5FDFA 1CQJB 1ZK0A 2FOIA 4WHMA 5TGZA 3RAJA 3UMRA 3WB1A 3KEMA 4DDMA 3L43A 3DT8A 3LUGA 1VB5A 1OE0A 1UQTA 3PVCA 1FP1D 1RHMA 1X1BA 3SX2A 3LCVB 4WJKB 4AUKA 4BMDA 1KO7A 1AXGA 1PLJA 1T15A 4EUFA 3IQFA 3IVCA 1MPXA 4EO9A 2ATCA 4WDQA 1X0VA 3WX0A 3AHHA 1V16B 3AESB 3INNA 2ZR0A 3TI9A 3R7BA 2ZSIA 2QGZA 3MGAA 3KO8A 5K3BA 4EHBA 1KDRA 2OYRA 4PZDA 1UFVA 3EYAA 3PHBE 4JFRA 4O4IA 2YVLA 3AOEA 1L6RA 1NV9A 2AOUB 1RWPA 2QVCA 3BSFA 3LIPA 1WY5A 4FONA 5TQ2B 1IMOA 4AN0A 1E2QA 3CVJA 3IEIA 1H5NA 4I50A 1IB0A 5L4LA 4WXYB 2X40A 4B3DA 2NP6A 2ALJA 4UBJA 4A8PA 4M76B 4A2WA 4YJ2A 4MB2A 1NQAO 1FS5A 1RVDA 2HL6A 1OIWA 1TAGA 3PU6A 4OB6A 3V1NA 1SQGA 3AJDA 3ZI7A 1DFHA 1B16A 3ID6C 1YZGA 4JT9A 5DCUA 3AERA 3P9RA 1Q7GA 2PX0A 1YQ9A 2NV2B 4OX9B 2H1WA 2QPAA 3F6SA 4LW8A 2I66A 4I1SA 4YRPA 1CX9B 2P1ZA 4CU2A 5BVHA 1QFSA 1P9OA 3Q8KA 4UTOA 2AF4C 1D7OA 1U0OC 1VC2A 2JRCA 5A9SB 5BR7A 2O05A 1VKRA 4D9FA 3HUEA 1HOTA 1SUBA 2DJ5A 3H8SA 3ZWPA 1ETHA 1EXNA 2QN3A 4LHZA 3SF8A 5AVTA 1VYUA 1B3BA 1WJGA 4CMJA 2GEDA 2J30A 4LOKA 2WJZB 1BAPA 2PKQO 4U2KA 1DC8A 3HNRA 3WTBA 1QO9A 2AN1A 3VHRA 5KQRA 4X9XA 5LC1A 2B1IA 2OV4A 3NH6A 4P2GA 5GMOA 2ONJA 4EQZA 2ZUEA 2DM6A 1QGUA 3C3YA 3JD3A 4QYSA 5DWQA 2BEKA 3LHSA 4OI1A 2IS4A 5AOAA 2NZUG 3T7SA 1B14A 2BPOA 1DELA 5DFAA 5FCDA 3DDZX 4PYQA 4ALKA 4EHFA 5CG2A 3EWIA 3SX0A 2X0FA 1Z56C 1XF9A 1SRQA 2E55A 1ZRNA 3QPAA 1Q6YA 3QVOA 3TZBA 4EJSA 1EVKA 1ZJYA 4O1MA 1SUPA 5CUQA 1UAGA 2YOGA 4JP5A 4YAWA 3SY8A 5IHPA 5KMGB 1Q16A 1Z13A 2XWSA 1FMFA 4YQZA 3R0JA 3LWDA 1ZGJA 3B48A 5TF4A 3SQDA 4I2NA 3AOEC 2HZBA 2WP8J 4WESA 2O4UX 3TCNA 1I0IA 4CM3A 3AB3A 4II2A 4GECA 3LK6A 4JWTA 3LO5A 2AE1A 4N9QA 4O8CA 3F1LA 4UAVA 4FFRA 1N6OA 4N3AA 2I2FA 3EFBA 1BYUA 4AW9A 4IS3A 1QQAA 1IG0A 3QTLA 1M5RA 4YJDA 1NQXA 4J1TA 3WNDA 2AA3A 5JNUA 1RQNA 2WEKA 2AOWA 4D43A 2D5BA 3L49A 5E2AA 4MIEA 4ZJYA 5CFMA 5EJ7A 3JWGA 4MS1A 5GIOE 2E2WA 2ZJOA 2J9GA 3ZY3A 1RCTE 1YMUA 2IFTA 4G4SO 3AERB 4MEJA 2OCBA 5BO5A 3HKEA 1J20A 2JLUA 1CIVA 2FMKA 5KKAA 3UUEA 3FDXA 3ITDA 1F7UA 3CEMA 1SNYA 3HA3A 3IPYA 1AKMA 1P1FA 3L7DA 3DF7A 5D84A 4BKPA 3OZXA 1Y3BE 4DDHA 1E9DA 1NJSA 2WFMA 4NI5A 2CZGA 3ZCUA 2I03A 3USZA 1GNPA 1SHZA 2JKVA 2ORED 2VRCD 3CCFA 4FW8A 4I4TB 4M7PA 4N82A 5CVJA 2OQ2A 2G4CA 3TS1A 1F0KA 4MKIA 3A70A 3I42A 2V7QA 4KB5A 1U2DA 1HE8B 2NLOA 3PNOA 2D00A 1CY2A 1QYRA 4DR6B 4MUGA 1R1DA 2VT6A 5AH0A 1N3IA 1IWOA 1T3SA 2PUWA 3DMPA 3E0XA 4GMDA 4LMBA 3HADA 4O4IF 5AKYA 5JZOA 13PKA 4M0DA 5EGSA 2WTXA 3WJ7A 6NULA 4X7BA 4MVJA 1VJRA 2PGLA 1YMQA 4I50F 5SY4A 3ANSA 4DB2A 1LC3A 4RF4A 3BWDD 5MF6A 5B1HA 3FPAA 3P45A 4IPTA 4YJ2F 4EJSC 2J0SA 3C5VA 1CNFA 2FW0A 5B53A 2QRGA 4QBTA 2PUFA 5CHYA 5AXAA 1O8BA 1TPYA 2QMYA 3PXBA 4ZI7B 4EB0A 1JPJA 4E1VA 1SOWA 1XF1A 4F4FA 2OGZA 2EW1A 2GFHA 1QFJA 2DQKA 2I4TA 2PGIA 5E1MA 5GINE 4H7EA 4I1IA 3QU7A 4FIDA 1UBUS 2P3SA 2R1UA 3NWEA 1VG9B 4S2EA 4HF7A 4HPXB 5CEEA 4TSKA 3GG2A 2K87A 4GBJA 3RVJA 3S2FA 4ND4A 5U9CA 4NLLA 3FPJA 4NOJA 3UB2A 4O2BA 4B6SA 2XF2A 1SEVA 5CT8A 4BUJA 1JEYB 3WDKA 1SG6A 5THKA 3DDHA 3HCBA 3BL5A 2FN7A 2YN0A 1UBRS 1AY0A 1ND6A 4BP1A 4MVJP 4V24A 3ZX5A 2QX8A 3N2ZB 1ODJA 4X7MA 1OY1A 1YQTA 4RTSA 4BVAA 1CR1A 1AHNA 4JU8A 2I2WA 1Z0SA 3TQOA 1I6LA 4WAUA 1JGTA 3STUA 2HPAA 2ZSUA 3B1JA 3EUAA 1JSRA 3THYA 3WGUA 1JDPA 1SVKA 1HQDA 2G0AA 4INPA 2GRAA 1DBQA 2QZJA 3KFVA 3L7OA 4MWSA 4O1HA 4QDKA 1NNEA 4EF4A 5IDWA 4GL2A 4R2MA 4RTMA 2LDBA 2PV0A 4M0LA 1RXVA 1J22A 3I6QA 2FN4A 3FNQA 1MKYA 1YASA 2B4QA 3K96A 3M70A 1ZK1A 3EVBA 3OZ7A 1F3LA 4M8LA 3CUEF 3SXUB 1GXSB 4QXOA 3STXA 5LQRA 3TNFA 5F9HA 1PJCA 2X19A 3JY6A 1QRDA 2FPGA 2TMGA 4MGKR 1MORA 3OJEA 5CNKA 2KLHA 4IZ6A 2G04A 2NO7A 3GMIA 3KRTA 4IIJB 1GGFA 2ERXA 1QRAA 2G9UA 2XSZD 3U9LA 3FOWA 5AQ1A 1OU4A 4BNKA 4Z54A 2Z9BA 1DT3A 2WD7A 3KZNA 1M75A 3A6FA 1JHRA 2NIPA 3OFSA 4GQIA 4LJ4A 2J7PD 3BTVA 1YBAA 1K8YB 3DGFC 4S12A 5DGIA 4HQRA 5KQPA 4MHTA 4K0KB 2P8SA 2Z8YA 3TLGB 4X97A 4RFSB 5I7WA 1R6XA 4L28A 1PV4A 1X2BA 3SYRA 3DE3X 1Q15A 3GLHE 4FFVA 4AO6A 1W87A 2ST1A 4OU4A 3GPBA 2JAOA 2A57A 3K5IA 1ISPA 3LBAA 4NBUA 1T1RA 1VP9A 4OA8A 3M2PA 2I4OA 3ED5A 1RZ3A 2B5OA 3ABRB 1QDEA 3MJCA 3NHUA 3Q6MA 4GGOA 3PDIA 4YK7A 2HSZA 3L7BA 2GPNA 1G6KA 1M2VB 1JPVA 2P75A 2N75A 2VP4A 4X8OA 3U44B 1GM5A 2F6RA 2FZ4A 3A1DA 1KVSA 4CIVA 5K6RA 5JZMA 2BMWA 2YC2C 1SBQA 2V7PA 3DWIA 3VISA 1CR6A 5C5EA 1DBPA 1Q14A 1KZ4A 3PEUA 2WIJA 1U6KA 4RA6A 3RHSA 2YH2A 2ZB8A 1Q1NA 2ZPAA 3BX1A 1VG0B 4RVUA 4TWZA 2ZXUA 3C3CA 4E2XA 4E70A 4MVJF 1JA1A 1KU0A 1LLFA 1DKNA 1BWSA 2Q8QA 1P1CA 1JHQA 1CHDA 2QDKA 3EZ2A 3IURA 1V5EA 4FHZA 5HZMA 3LYAA 1SHKA 1RWOA 4M9QA 1O7JA 5E6RA 1M73E 2Q5JA 5G53C 4X85A 1F4PA 4L51A 2EKDA 2C0CA 3EN0A 5JVDA 2FCAA 1SIWA 3CWZA 3H3JA 2EIHA 4C7BA 1YI8A 1I36A 1GYQA 3IAXA 2GVDC 3Q7TA 2BE7A 2OCAA 1ZCFA 4FFLA 1J56A 4RZQA 3TJRA 3JQRA 3QWAA 1KR2A 1OWOA 4HVAA 2P2CA 1GNRA 3M1AA 1SBYA 3D43A 1QE3A 4BMNA 5EYPB 3GEHA 5DJ5A 4B80A 4GYKA 5EJFA 2WAAA 3H86A 1NQTA 3ND6A 4FCVA 2Q9UA 4NOKA 4AMYA 4R5MA 3V5NA 1HK7A 1ND5A 3IUEA 3VU9B 4OQEA 4D9GA