1A97A

Xprtase from e. coli complexed with gmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
144
Chain Sequence
EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVAISSYDRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphoribosyltransferase
molecule keywords XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
total genus 42
structure length 144
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a97A00
2C4KA 3O7MA 2AEEA 3OZGA 3S5JA 4WMLA 1BD3A 1Y0BA 1ECFA 2PRYA 3GEPA 3OZFA 2JI4A 1ZN9A 1XTVA 4JLSA 1NULA 1DQPA 4M0PA 4M0UA 1L1QA 1O57A 1ZN7A 1QB8A 2GEBA 2JKZA 1J7JA 5KAPA 1ECJA 4RV4A 4P81A 2E55A 4LZNA 4P80A 1G9TA 1OREA 4RABA 4MB6A 3QW4B 2YZKA 4P86A 1DKUA 1P19A 4RQAA 1QK5A 1U9YA 1AO0A 5JV5A 3NAGA 3H83A 4IJQA 4RHXA 1P4AA 1R3UA 1OROA 1ECGA 2VFAA 4RQBA 4S2UA 1VCHA 5BRNA 2JBHA 4RHUA 1TC1A 3MJDA 1G2QA 4F8EA 4RAQA 1A98A 1BD4A 1UPUA 1I13A 1NONA 1YFZA 4FYMA 1STOA 1XZNA 3ACDA 1U9ZA 4P3KA 3LPNA 1VDMA 1XZ8A 2XBUA 1UFRA 5JSQA 1I5EA 2IGBA 1XTTA 1LH0A 1QCDA 3DEZA 1D6NA 1W30A 1XTUA 1I14A 1A96A 4TWBA 5ESWA 3DMPA 4ZFNA 1I0IA 4QYIB 1ECCA 4P83A 1A97A 2HCRA 4WN3A 4LZAA 2H07A 4JITA 4KN6A 5KAMA 3EFHA 1P18A 3KB8A 4RADA 1GRVA 1UPFA 2JKYA 1QB7A 4LYGA 5EUCA 1ZN8A 2EHJA 5BQOA 1JLRA 2H06A 5BQPA 1A95A 4P84A 1V9SA 2WNSA 2P1ZA 1L1RA 4OHCA 4LZOA 1A3CA 1WD5A 1DBRA 1P17A 1FSGA 5BSKA 2FXVA 3GGJA 4P82A 3ACBA 3HVUA 1IBSA 4RHTA 2DY0A 1HMPA 1GPH1 1QK3A 1DKRA 4RACA 3ACCA 1QK4A 3N2LA 1BZYA 3OHPA 1TC2A 3GGCA 1HGXA 4RAOA 4Z1OA 3M3HA 1A4XA 4QYIA 4RHYA 5ESXA 4X44A 1G2PA 1OPRA 1O5OA 5HIAA 1DQNA 5HKLA 4RANA 4X45A 5K51A 3DAHA 4PFQA 2PS1A 2PRZA 1G9SA 4M0KA 4PAWA 1MZVA 1JLSA 1Z7GA 4QRIA 4LYYA 5IPFA 1ECBA 1I0LA 5IAOA 2H08A 3G6WA 3LRTA 1QCCA 3MBIA 1PZMA 5E38A 1VSTA 1CJBA
chains in the Genus database with same CATH superfamily
4OGWA 1XMPA 3FRIA 5CA1F 1DPGA 1UZAA 5CXSA 1LPNA 2CCGA 1LSJA 1CP2A 2E0IA 3PLNA 4QUIA 5HCUA 5A4FS 2C7PA 1G8AA 3N28A 3UA3A 4BHTA 4ARCA 3HFGA 5T4HA 1KI2A 1MNQA 4L8YA 4C14A 1UBTS 3QKIA 5GTDA 1JILA 2DLNA 2EQAA 3H2YA 4FIDA 1ZQ9A 3K8ZA 1JTEA 1UKBA 1YZQA 5CVDA 1FQKA 1QRAA 2BBWA 3BREA 4PZCA 3GW8A 1D9ZA 3FBWA 3CUEF 2CJPA 4CKWB 4J4BA 1H1TA 3H4VA 1EWRA 1TMKA 1RKUA 1M2OB 5CX1B 1ABBA 1BVRA 3LDFA 2IDMA 4RQAA 1NVUQ 3JZFA 1TU0A 1VJRA 4E07A 2X2OA 4F84A 2WP8J 3B85A 4MCIA 1G3UA 1G8SA 1BXKA 2QU8A 3JYPA 1BE6A 5JCOA 1P4AA 2Z2ZA 4O59O 4NARA 1N5DA 2ONCA 4KLCA 3AUAA 1LDYA 2IITA 3VVCA 1VBMA 4W6ZA 3PGMA 4P92A 1TF2A 2YV5A 4DG8A 2ERXA 1GUDA 4KXMA 1P7PA 3GP3A 2OE2A 3NAMA 1EUZA 5CFQA 3SQNA 5JBQA 1IRXA 1KMHB 4EA6A 5FTKA 1ZINA 2RE8A 3RC3A 3CNEA 4JBXA 1CWUA 1FPMA 2R5FA 4QAQA 5KNCD 5LP6B 2QLTA 2ZR8A 5TJHA 2EF1A 4X64B 4OYHA 1XXLA 4L4SA 5B36A 1IN7A 2FWIA 5T8KA 3LO8A 2H8KA 3LCCA 5TMEA 4CN9A 5ESWA 3GA5A 4HQKA 4L07A 4XUEA 3HKCB 5DASA 3FNGA 3HXTA 4ZI7F 4M3NA 1HNWB 3KR9A 1KOJA 3EC2A 1G8JA 4KBGA 4LE1A 5KSYA 5KX5A 2H1OA 3KSUA 3DMGA 2XUKA 4UTOA 4QJIA 1C3OB 2BGTA 2ZYDA 4UOEA 4J03A 5LQAA 3I8SA 2HX1A 1X1DA 1K7EB 1W5FA 3B1FA 3CJRA 4C0QC 5KTKA 2P1DA 3ZWPA 1NXWA 3CCBA 5T57A 1IY8A 2YIMA 1E3LA 1H2XA 4BQNA 8ABPA 5JJLA 2CXNA 1M1YE 1SIUA 1C30A 1XZCA 1QHEA 3F6EX 1WHSB 3P71T 5DGCA 3ZE0B 5GGYA 2XHEA 3PFBA 5EZ5A 2HREA 1YGPA 2QX4A 3H5NA 4TLDA 4ZO8A 3T7JA 4FEAA 3WLHA 3EJWA 2JRCA 4RLSA 4Z51A 3FCYA 3OAAA 3IAM6 2HB6A 2GFQA 5K3BA 3CX4A 3AT1A 3E22A 1UZMA 1T0UA 3IUSA 3T54A 1FUYB 1ID8A 3HJRA 5HDBB 2VDJA 1PJAA 3EGIA 4X1YB 4RBNA 1BAPA 2ZVQX 5CB4B 1ZMRA 4Z4CA 4HDRB 4Q0MA 3UYLA 4WXEA 1OFIA 3NXKA 3E8MA 5CCEA 5JLAA 2I6FA 2PL5A 4AJNA 1XNRB 2C20A 1UAYA 5ITVA 5LNK6 2FSSA 4DL9A 4MOWA 2VF2A 3R2JA 3ZNNA 3BVPA 4O4HA 4ZOEA 2G77B 3PWKA 2PS1A 4TUYA 5F4BA 4DWJA 1GTVA 2Q21A 3VA7A 3ANYB 5TMPA 4DG9A 4NCHA 3DC7A 3N0RA 4V0OA 5GM2A 1A9QA 2ZJFA 5TIIA 2VWGA 3MOIA 3Q72A 5I7WA 2ID8A 1T9ZA 3GLHE 2WTMA 2QAGA 1RXSA 2I9KA 4CT4B 1WXFA 2VA8A 4HEHA 1BGXT 1AD2A 5HTOA 4PNEA 1XIVA 6NULA 2ZZMA 1NOKA 2DECA 5COAA 1ZJJA 4OSEA 1N6RA 1E58A 2P62A 2A0KA 2G1UA 2IE8A 3EQZA 3KX2A 4FDMA 4K6FA 1H94A 1ISSA 4MIYA 1UK6A 3SX2A 2EYUA 3E9QA 3IQEA 4CF4A 3ETCA 2NQ2C 1UKVY 1OW3B 1CRZA 3EPJA 4LN1A 3K0SA 3HP4A 3D8UA 5AM5A 4BLSA 2ZI4A 5I6DA 2XDQA 1B0ZA 1QQ5A 1KMCA 2TRSB 2YZKA 4TZTA 4U2KA 4YCBA 2IRWA 3ZEIA 3ZHOA 1JDZA 3GEMA 4LRQA 5BT9A 1PVDA 2POCA 4L50A 2F4NA 1XTSA 1E9BA 1W9MA 1EGAA 2JIBA 4M1SA 1MC8A 3GCGA 4Y2HA 4DOMA 4XCXA 5CH3A 4RCVA 3MWYW 3UKDA 1YMUA 1AKEA 5IUNC 1P1FA 4NESA 4PHHA 1IZYA 2QV0A 4ZAVA 3ZLUA 2EYQA 1OT3A 1I3KA 2YJGA 4ZVOA 4EBFA 1JLLB 4MS3B 1FFCA 2O4UX 2XCOA 3HC7A 5LLTA 3R3YA 1PNQA 2VBFA 4A0SA 5IZCA 2XCLA 2EZTA 1PJRA 1P6XA 4L2IA 4BVJA 5NULA 4KNYA 2F3SA 4M2LA 4BO1A 2ZT6A 2Z04A 3G0BA 4XCQA 4XIJA 1GM5A 2ATIA 1UZNA 2YQZA 4C2AA 3V7FA 5EE5B 1QHHA 4LHWA 4X71A 4QASA 5C46F 1GR1A 3ZCVA 4BTVA 1HNXB 4H77A 1GG9A 1ZKMA 3ET4A 4J3NA 3MBKA 1Z5NA 2QL7A 3B6KA 1X3SA 3H2KA 3KQQA 3OH8A 3LUBA 3PPIA 2ZSDA 4DT1A 2VKTA 1VL8A 2DBRA 1R7RA 1VTKA 3MOSA 1J0AA 4FBMA 4HOYA 4RMJA 5KAMA 4EJ2A 5LOVA 2FUNB 1HI9A 4FLFA 1G1MA 3PX2A 4FINA 4MRNA 1CUWA 3NCHA 4RSRA 1MRNA 2D0PB 4GC9A 5TY0A 2CK3D 1UC5B 2OUKA 3AL3A 4CQMD 2HLNA 1PRYA 3BEDA 2PG3A 2XNDA 1L8AA 1HLFA 3V3KA 4CYMA 5LD2B 1RXCA 4ZVVA 3UHJA 4CCAA 1MX1A 4HLUC 4RHTA 1XJCA 2VPXA 1EX1A 1SMKA 3HBLA 4XJTA 1WE2A 5D3MB 4ZVLA 3W1VA 5K8IA 1DIOB 3UV7A 3RS5A 3NDIA 2V54A 4OLJA 3KJEA 5LMUB 3R5FA 3EZNA 1A4XA 4HGQA 2I6XA 2ZPAA 4YI5A 4AUNA 2ADMA 4YAUA 5BVGB 1PS8A 4E1VA 1LKZA 2QSYA 2GM9A 2FP3A 1JYFA 1E1CB 3JASA 4R2KA 4CM7A 1KDVA 4JQSA 1NW3A 4CTKA 4M1ZA 1NMQA 1NMEA 3IHLA 1V41E 1KO4A 1PI3A 1BWPA 4BMPB 2A5GA 2OXRA 2NT4A 3OX1A 3VH2A 2G7MC 3QQPA 5CA0A 1B8PA 1DO0A 2D7CA 2EL7A 2Q9CA 4FWBA 4KGDA 3UIEA 1PWEA 1CIJA 1KJWA 4J3FA 4NG5A 2GTPA 1M83A 4D9NA 2R65A 2HSGA 1XZQA 4YJ2F 2QLFA 2BFFA 1V8BA 4RZHA 1G7RA 2VK1A 3RANA 1PDOA 3EW9A 3U09A 1PFWA 4N39A 3KVNA 3A2LA 3Q40A 2QSZA 4JLNA 4RGBA 4UU7A 3AR7A 2WNHA 4N0EA 4AO8A 5AVWA 3NTOA 3L01A 2OPHA 1V9LA 4DUGD 1NAIA 5I8ZA 4E09A 1L7MA 1VKRA 2B0CA 3H9GA 1BVHA 1HORA 1OIWA 2CL5A 5DT9A 5CITA 2APJA 3LG2A 1LTHR 1II0A 1XU9A 2V6MA 4J2HA 4M38A 3LPAA 3ZW8A 4CLXA 5F73A 1YFJA 2PH1A 4ILEA 3UCFA 1Z15A 3I2KA 3ZD9A 5FFNA 1O9GA 3ON5A 2JCBA 1Z35A 2AKAB 2H1FA 2IPXA 2FPPB 2VUSA 3ADDA 3EMDA 4KXXA 5TGZA 4B44A 3KB2A 4W1RA 4EUSA 4Z2YA 3L7MA 1IY1A 1F9EA 2ASVA 2VYVD 3H2JA 4XDGA 4B75A 4ZVPA 3O8CA 1E2QA 1FZQA 3SCZA 2Y9PB 1GQOA 2AKYA 3O0TA 1XZNA 5TR9A 1CY0A 4TSFD 1RDFA 1U5AA 1H23A 3ILHA 4Q3OA 2P77A 1W6RA 4YR9A 5CCBA 1VCNA 2IPOA 3ZHZA 1MAAA 1HRKA 2GD2A 4D0SA 4PYLA 4TWIA 4EG4A 4O6VA 1C0KA 1M74A 4YREA 1MNAA 1THTA 4GMXA 1QX3A 4QGAA 3ZUGA 5CRIA 4DIUA 1QYDA 5CIYA 3CURA 1NFFA 4S1TA 1K3UB 4MUFA 1K9VF 3H1GA 4I6GA 4EENA 1O95C 3V00A 1EJ0A 1RADA 1ZD3A 3OZRA 3THXB 2MYTA 2ODNA 4P7FA 1XMQB 5JH7B 1D1PA 2PYDA 1GNQA 4RM3A 4DNPA 2EHJA 3S2YA 4C1BA 1ZLXA 1YS1X 3J7TA 3UY4A 2BDEA 1NMXA 4I4CA 5BPHA 1U1EA 3L7OA 1PD0A 1P75A 3QJYA 2YFKA 2XB4A 3HKDA 3FKSD 3JQ9A 4HMOA 2CSXA 3G5TA 1GAWA 1TVMA 1WNTA 2C5HA 3OOJA 4QELA 2VXOA 3BWEA 4Y2GA 3SAJA 4CIWA 1O97D 3B3JA 4DVJA 2IP2A 2QUHA 4MK4A 4UNQA 2BFOA 3B1JA 1MOPA 2COKA 2NACA 2JK1A 4ECEA 1DRUA 3ESDA 3TGPA 3UW1A 3ORRA 3A6LA 2AI3A 2GERA 1B7GO 1E98A 4JD5A 1VC2A 4YJFA 1VL5A 2R66A 3NEAA 5G0TA 5IT4A 5ALEA 4HX9A 1K0UA 3OEEA 3X1MA 4HLQB 1CT9A 2BUCA 2OBYA 2VNHA 3W3AA 4GF5A 5SZJA 4ER0A 4L08A 3NDRA 1PT9A 1TO1E 3CGWA 3H99A 1FF9A 2C1ZA 4IZOA 2F7SA 4PINA 3TUIC 3KG2A 3FYUC 1O0CA 1VHQA 4DZRA 5HS6A 1Y1QA 1JZTA 1W2HA 1YHYA 2VI5A 4CMCA 5MFPA 3D4LA 1XPOA 1ZAKA 5DYWA 1EIZA 4P36A 2QW1A 3CLTC 4Y1GA 1LZKA 3DUWA 3R4VA 1I94B 2MYPA 1WUYA 4Y6QA 4WMLA 3HDVA 3KXLA 2MSWA 2G0AA 1Z8DA 2XUQA 5CDYA 2HRZA 1ZUHA 3GZNB 4P5EA 3U9SA 4C6RA 4L78A 4XGNA 3I9JA 4TL8A 4O4JF 5H02A 1TA0A 4AK9A 1RD4A 4LXQA 1WP4A 1OKKD 1U2PA 3TD9A 4BNNA 4BWGA 2YXNA 4IDGA 2K87A 2A4KA 3IT1A 3Q8LA 4XVRA 5A3QA 2P8SA 4ZQHA 3NNNA 2KMLA 2ZRGA 3UJPA 1MVNA 3L3BA 3T7RA 3IMGA 4MX8A 4NU5A 2OC9A 1JSRA 4Z0HO 2XWPA 2YC2C 4DMMA 4CKWA 3NDJA 2R4TA 1BW9B 4RF2A 1CVIA 5FBLB 5LD2C 2VIIA 3BILA 1GQ2A 4BL5A 2D1YA 3BIOA 5AW5A 3ZCRA 4DFDA 4WACA 1E9CA 3WJ2A 1UJBA 3QITA 2PVPA 1NURA 4U39A 3ABQB 1V47A 3OETA 1QG0A 4US0R 4Q37A 2BFCB 2HQSA 3MJRA 1IQ0A 5E1OA 4AXXA 1KYWA 1QOQB 2CBZA 3RVBA 3KO8A 4UAUA 1V1JA 1YZLA 2OCBA 3AM4A 4GR4A 5IEBA 1H1LA 1OFUA 3RUPA 3N8HA 4LGVA 2ODTX 3UWMA 4D4GA 5I45A 4DB2A 1KDOA 1UMKA 4Z7JA 1HEYA 1ANKA 4A6DA 4BMOB 1GPBA 5IC6A 2VCEA 2GM3A 3DYVA 2NO4A 3LLUA 1MGPA 1ML3A 1XCJA 3NIBA 3QE2A 3OLZA 2E6UX 2REQA 1MXFA 4GOKA 1T4CB 5I9BA 1A96A 2W6CX 1O3YA 2WFLA 4WFJA 3O4FA 2IZ1A 1WZ2A 1RHQA 2GI4A 3DMPA 5JWOA 1U0OC 3BXPA 2AIRA 4LOJA 4RTSA 1RIIA 1HT3A 3EISA 3O7WA 3D54D 2DH6A 3WLOA 2F43B 1PT7A 1UJ5A 4BFZA 3BB4A 1LNZA 1RVV1 2PLRA 4K9NA 4TKUB 4Z3OA 1E3EA 1YAJA 3RTDA 1SOUA 5TSDA 3OUTA 4N0QA 1ORVA 3AHGA 5PNTA 1JQJC 3ICVA 4G5FA 4WKCA 4AZ3A 3DFZA 1SCJA 2ORYA 2WNSA 4M76B 2LZ0A 4QG3A 3C8UA 1JPUA 1EK0A 3NVKI 3U4GA 5K9ZA 1R4MB 3W77A 4MZXA 3Q7RA 5AOAA 1NJSA 1QIDA 1E0JA 5BYKA 1LI7A 1MD9A 4TXHA 2NV0A 1DZIA 3ACBA 4CLOB 5J2UB 2HEGA 4YR7A 2IU3A 3FHJA 1ENYA 1DKRA 2N47A 4EF4A 5LVAA 3DV2A 3OJOA 3F78A 4W9NA 2XEXA 3STTA 1HL7A 5K03A 4IDEA 2ZRAA 3G5MA 3F6BX 3O3MB 1PNOA 5B2FA 1UC8A 4C1NA 3KOMA 3LUHA 5F52A 3HXMA 4RFSB 1U28C 1NN3A 1XWFA 2IUEA 1E1MA 2H2WA 4GOOD 4HN9A 4Y0NA 4YCCA 5CD9A 3TZHA 4MR9B 4AP5A 2X86A 3G0DA 2WHQA 4DJ5X 1WVIA 3GDHA 4FT2A 4OK5A 4CEHA 2HO4A 3UTCA 3SD7A 1Z3CA 1XDBA 3AWDA 4LYAA 4OHVA 3FUUA 1NW5A 2X7JA 3EGWA 3EUEA 4MS1A 4UUNA 3RRFA 4KEAA 1KQGA 1Z74A 4QBIA 1IULA 1PTJA 4C4XA 3WGVA 4BVHA 1J1UA 2TECE 1YBHA 4HBGA 2IP1A 2EFDB 3Q5GA 1FU7A 1P4GA 2XH8A 2YHIB 1R5JA 1Z4JA 3A6KA 1NQOA 2XNHA 2AX3A 3K70D 4JC5A 2Z4RA 3P9YA 3T3OA 4GLBA 5CH5A 5IF9A 5KJEA 4B3JA 3OZAA 5CFMA 3DO8A 3H1FA 4P80A 2JHFA 4UMDA 2WHPB 2P27A 1K6IA 5I4KA 4J9UE 3Q3JB 4M55A 3WSVA 4JFAA 3U1TA 1T1EA 2L17A 5KVSA 1WA5A 4GKBA 3KTOA 2XQJA 1ZH6A 4B7ZA 2J30A 4ROSA 5C4IA 1GNLA 3C43A 4WNIA 1CJKC 1T10A 3REGA 3W9UA 4EYKA 1FTGA 3RAJA 3KTAA 4UM7A 3TUZC 3OQMA 1YL5A 5TQ0A 1HTTA 1P5ZB 1V2HE 4GM0A 3KL2A 4L5CA 4PSKA 5C80A 3KETA 2I91A 1R27A 2GX6A 2X8WA 5CXUA 5FJIA 1Q20A 2QL5A 2C8LA 3QLJA 8GPBA 2D4HA 4G89A 3A3NA 1FDOA 1QR2A 2C4MA 2X4GA 3AMVA 4RZQA 5BXYA 3AEUA 3OJEA 3W6OA 4QXPA 4URUR 4UBKA 5CBKA 1TADA 1YFZA 4FYMA 1LWNA 5T67A 5ADHA 2OSVA 3JV7A 3FLMA 1K98A 1HZJA 1R66A 2W2LA 3FSGD 4IIJA 2HQBA 1FFGA 1UF9A 3IUMA 1NM5C 3MW8A 2DCUA 3IDZA 1NRXA 1R0WA 4NATA 1N8TA 4PPNA 3DTYA 4EF5A 2YRWA 5BNTA 3TPCA 1F3LA 2UDPA 1DBWA 3HI6A 5D1NA 3FYUB 2Y76A 4CTOA 1FXSA 1QHHB 2ZYRA 3ER9A 4J76A 1ONSA 4JEIA 1P62B 3DVAA 3HADA 4F11A 4F7WA 1YJQA 4H4EA 3A27A 4CKZA 4JITA 3LW7A 1RYHA 5BSTA 3S8EA 3OPXA 5GQSA 2J3HA 2PWYA 3KQHA 1J9EA 1SZDA 1M8PA 3HMQA 4F96A 2WSSA 3WC4A 1WCIB 1XUOA 1DTWA 1OFHA 5BUSA 5JJIA 2X9QA 1R16A 3FKQA 2GO1A 4F71A 1U98A 1MXHA 5A62A 1V3VA 4LOHA 1KP9A 5FFFA 2W2PA 3L1VA 3D3WB 4KO1S 3TSAA 1P17A 1YO6A 4WNYA 3U4AA 3ZWOA 1C5KA 1JR6A 5AK3A 3OQIB 3PKZA 3JQQA 3DZHA 4R8MA 3F5DA 3I2FA 1SCAA 3H5RA 4TMFA 1T13A 1UQRA 2WWTA 3UUFA 2HQRA 3M6XA 4FN5A 1ONNA 4KDCA 2QD3A 4MI9A 1DQZA 5ADUS 1U8ZA 3HBJA 2NXNA 4RZSA 5HFNA 3WGYA 2WQ6A 1TIKA 2EX0A 1S2DA 5K0TA 2A5LA 4EKYA 1CP3A 1UIRA 2B1JA 1KZGB 2OV3A 2R48A 1Y6QA 3L0DA 3ECCA 2PO7A 3MXTA 3FI9A 4NECA 4Q7JB 5CLJA 4DUZB 1K68A 3ZDCA 4YRCA 3CKYA 3C4VA 3RSGA 3L0OA 4JASB 3QH4A 2Q6LA 4FFBB 4KPUA 2RMKA 2FI1A 5AKLA 3VKVA 1Z36A 1J7KA 3BRWA 3GVCA 4KDRA 2P7IA 2RCNA 2WYIA 3GK3A 4Y1FA 2VF5X 5JAQA 2YV4A 8AT1A 1UOEA 3IB6A 2BM8A 3WJAA 3C8HA 1IHUA 3R3SA 4E03A 4HFMA 1I7DA 4BQRA 1F5SA 2I2AA 4DY4A 2OGTA 4FE7A 2QN1A 4V38A 3WTCA 3J81k 1K5DA 5JO0A 3KOZA 3WDKA 3CUVA 2V8BA 5F3WB 1Q2XA 4JJ7A 4DPLA 2XE6A 2GJ4A 1L8LA 4UE3S 4Q7EA 2DU8A 1E8DA 1EJ2A 1C29B 4LY9A 1UXOA 5HZMA 1ETUA 2A9PA 2W6ID 2PY6A 4JJZA 3UUGA 4ACBA 5HR5A 4C7VA 3HDQA 1CY4A 1AXRA 5DN6A 1OTXA 5HBGA 4P4TA 4LA4A 2DAPA 1OZHA 1E63A 1GKKA 2P3OA 2W6MA 2YXEA 3I34X 4HRXA 5G1NA 4B79A 4EW2A 5AHRA 2V7PA 3TJMA 3OZEA 4MQBA 3JQ8A 1QMGA 2LD4A 2X0IA 3MMZA 3NYWA 4WAUA 5D85A 4RYLA 4X3PA 5HRUA 3BJEA 1J2JA 1AZSC 2JBHA 1BOOA 2JGLA 2W98A 4KH0A 1A2QA 1F2TB 1CRPA 1T9DA 2NXEA 4AN0A 4HR7A 4BE4A 4CBVA 3JQ9C 5IUKC 5ITZA 2QTLA 2YJ4A 3K6RA 1M8GA 4JJGA 4HWTA 3TRKA 4RIHA 2NN3C 3BMXA 3S8MA 5JASA 2GN9A 2V74B 4C0KA 4XWTA 1QGED 4NR0A 4R8LA 2HSDA 1X8JA 3UB3A 5JTUA 4LX0A 1RC8A 2PO5A 3I9MA 4DSNA 4EM6A 1CJCA 3WGUA 3SKXA 4A27A 3COZA 4W8HA 1P1KA 3QV2A 4FTWA 1X7ZA 1EXNA 1Z6XA 1C1HA 1JR3D 3H3XA 2M6SA 4G1UC 4RPCA 5AUPB 1KZ6A 5LU8A 2X76A 2O1WA 1KI6A 2Q4DA 2JBWA 3EEIA 3MQFA 4LYEA 4NE7A 1GAXA 4ZT4A 1OGJA 2WTEA 4LZAA 1ICIA 1GCIA 4ENUA 4NABA 1LK0A 3ZZ1A 5LOVF 4M8IA 4YPFA 5K8TA 1UM9A 5KSZA 2YOHA 5L40A 1F48A 1T36A 3TKAA 3EWIA 1OV4A 1WUJS 4IGIA 3BGWA 3BULA 4FFBA 2X58A 1LLCA 1SWWA 3UXHA 3FOCA 5CEFA 3RVDA 5AVJA 5H9VA 3IT2A 1KI9A 2GJAA 2WTXA 4R9VA 3S3TA 4GS5A 1WJGA 3OTHA 3KLMX 3PHLA 3QFCA 3UXYA 4NXMB 4Y2JA 1SFRA 1QYIA 2Z1NA 1SUSA 3U39A 3ZW9A 2JASA 2P35A 2JVKA 2Q1WA 1RXVA 1HFEL 3O4IA 2VTBA 3SKVA 1QK4A 4K6CA 3TIIA 1LI4A 1OPXA 3KB6A 4ZD6A 4BO3A 4D79A 3HFJA 3ESXA 1OSNA 1JKJA 1U9JA 5HG0A 1ZVMA 4NG4A 1QCZA 3U1BA 2C3MA 2ISCA 2E5WA 2VWHA 4C08A 1E79A 3NHAA 2XQFA 4DSZA 5DXAA 1QFJA 4RTOA 1K63A 3VRHA 2J5QA 3IA7A 4EARA 4DANA 3NHLA 3HVIA 1YQXA 5E0KB 5K45A 4ZEVA 3O8OB 3RRMA 4X97A 5LQNA 5KPJA 3U19A 3ZWVA 3CUKA 2F90A 3C6KA 3TLGB 2HGSA 3C0KA 2WW8A 3VNBA 2KS6A 2H63A 2OT3B 4I14A 4NEHB 4R7GA 1PQ4A 4IKEA 4RA9A 4WKOA 2CZQA 3OLCX 1XZHA 2OYCA 1QFZA 5A9TA 1OBFO 3CB4A 1OA0A 1UQTA 3W05A 4CKEA 5TPWA 2JIOA 2PD3A 4FYKA 4H18A 3B53X 5M34A 2BD0A 3BYZA 3IJ5A 5CXQA 2AMVA 2XTJA 3TCKA 1W36D 4FHGA 621PA 2A9RA 2JH8A 2CV1A 5KWSA 1PNRA 3S4YA 4BBPA 4GYJA 4J4TA 4EJFA 4NSNA 5FUQA 4C7OA 3DMFA 4IIJB 3A28A 2P9FA 5JPDA 4OUDA 3HKBB 1E6CA 1PR3A 2P2SA 4II3A 1FS5A 5ICGA 3H4MA 5KNDH 4FE3A 2Q9AA 3V97A 3VYUB 4RKQA 3ZKWA 4FB5A 4P54A 5HIIA 4Z7OB 4MQ5A 2C9ZA 2ZAIA 1AZWA 3ILVA 2OMKA 1ZICA 4TZKA 1WU7A 3L5OA 3U7JA 2JEZA 1R18A 5EWJA 1P1JA 2HA4A 2JRLA 4WJZA 5ALIA 4ETNA 10MHA 2A84A 3KYCA 1GTRA 1T4DA 3VR6H 1DL5A 3PCXA 1IB6A 5A04A 4TZ6A 3X1WA 3DXZA 3NALA 2FRDA 3ZS8A 4V0RA 3KE9A 4O2BB 3UFBA 4TXLA 3NYRA 5ALSA 1XN1A 3MERA 5I7EA 1U8UA 1KDTA 2XKJE 3P9RA 1DJNA 3PEFA 4U8GA 3GA0A 3T7KA 1XLTC 4Q1EA 4MP3A 1Z6GA 3OZUA 4LQCA 5FWYB 2F9MA 3V1YA 2P30A 1E6MA 4DR7B 1JKXA 1LDBA 3FIJA 5EIHA 5T3YA 3TIGA 1A9XB 3WFJA 3D5TA 4V3CA 3V4FA 3UJ3X 3AOGA 1TYCA 1FC0A 1ZOPA 1WG8A 4IXWA 3UUWA 4YRMA 2ZZNA 1I0IA 1ADYA 2DR0A 2IIQA 5KX5B 1C7FA 2Z4TA 5KMGB 3NOQA 1CZUA 3E9CA 2HJSA 3RW9A 3VO8A 3TM5A 3ELUA 2FB9A 3ETHA 2CW5A 2OGWA 4OJTA 4BNFA 2XLBA 4ER5A 4D25A 4GM4A 1HTWA 2B1IA 1TEXA 5HUHA 3JAWB 5ITSA 3REOA 1B23P 2ZI5A 2XB8A 3MTAA 3QA9A 1TYDE 5LYJA 4D7AA 2WE8A 5ALLA 2EDAA 1YKFA 4BO9A 3M81A 4RA6A 1TKRA 4XQCA 3UUEA 4LOLA 3RLFA 4X1KA 1WXGA 2WIKA 4FXPA 3OFJA 2RGNC 1Z29A 5BSUA 3UKJA 5AW0A 3DBLB 4K3VA 3RYTC 3MTQA 3T8YA 4PGHA 1H2RS 2XE4A 1OHHA 1ZJZA 2M6RA 3R24A 2YN0A 3E5MA 4P53A 4MHOA 1SCQA 3AIMA 5DFAA 1G8HA 5TEVA 5SY6A 1CF2O 1LW7A 2PV0A 3KZVA 7MDHA 2KHZA 3LP5A 3VU9B 2A67A 3Q9LA 1XDZA 5AM2A 1A0OA 3AEUB 1Y7IA 2HWYA 3F2IA 5BRAA 4K3UA 4YAGA 3QI7A 1NBMA 1HDEA 1M10A 1US8B 2AEJA 3V55A 1TIBA 3S1LA 3FCUB 1IBRA 4TTRA 1DAPA 4WLVA 1XHLA 3DT9A 3FHLA 1O54A 4G09A 1XQ6A 2RHWA 3CVXA 1N3LA 4JU8A 3RS9A 4ENRA 1EFRD 1NVDA 1Q1GA 3G0HA 5EVCA 1CJBA 1XVTA 2H4XA 2SICE 4BKUA 2O57A 3AB8A 2EIXA 3USES 2W2KA 5E4TA 1ECFA 4O4LA 5LUBA 2R6AA 3EPPA 2G9UA 2O1SA 3G17A 3Q9SA 3SBOA 5FORA 1Z7BA 1PUJA 1UAGA 1EBFA 3PGVA 4KPYA 2JZOA 4POAA 1P2FA 2P6RA 1M73E 4Q9NA 4PICA 3U49A 1IM8A 1YZNA 4H0NA 3RVLA 3BF8A 1FCJA 4ARZB 3U6KA 5CDSA 3A6DA 3OZDA 4D9GA 5C8VA 3ML1A 2X5JO 3F90A 4KX5A 1X1QA 1OF1A 1UFVA 1XCOA 1SHUX 4K05A 4A26A 1KVQA 3F5QA 5D01A 4AXBA 3WWPA 3TE6A 1R0KA 4UDXX 4AULA 4PIVA 4CM1A 3GLHB 3QVSA 4RMHA 4X7MA 4CV3A 5F77A 4Q9LA 3WAJA 1KYXA 4CMEC 2AH5A 1OLSA 2D7JA 3ZHSA 4HGRA 4COKA 4EGCB 4RA9B 3L7DA 5LYJB 3STUA 4BKMA 1NBOA 4L85A 3EBOA 3U44B 2D8MA 3TL2A 3AVYA 1KGSA 2OMEA 2TYSB 4YCDA 5FV4A 1ZSYA 3C3MA 3CZ4A 2HD4A 5EAIA 1FZTA 2WD7B 3FG9A 2IHUA 1BXRA 4K2HA 1C9EA 4RS4A 1UBSB 3STYA 2J0UB 3KU4A 5JDIA 5C53B 5F4ZA 2EG9A 3FCCA 3O2SB 3KJIA 4OF4A 3OX2A 1FMLA 1W5EA 1UJCA 2YYSA 4GPEA 1C4WA 5ECYA 3V34A 3V8PA 2N3ZA 3M5PA 3ZY6A 1OZ0A 4G24A 1XCBA 2Z43A 3UJ7A 2Z2KA 3ZD8A 3WMXA 5FLYA 3ZZ0A 3A7EA 2VT2A 4DYDA 1APBA 2UUOA 1UMBB 5ILQA 5ICEA 3RUEA 4FHDA 1ITZA 1H4TA 4C43A 2P2DA 2YX1A 3A36A 1M1YB 3LDUA 4UAGA 4RVFA 1CB7A 1R00A 4IQFA 3VKUA 1B14A 4R2LA 3I37X 1TYBE 2GK6A 1OD6A 1Q3HA 1QG2A 3M33A 1SBYA 1LS6A 2O1XA 1MB4A 3KD3A 3HQ4O 1IBSA 3ZIAD 3N7TA 3SX4A 4C29A 1QWSA 3ZD7A 1DOZA 1VE7A 1DHTA 3HSKA 4B0OA 1C0LA 1OBHA 4YRAA 2AOWA 2IZZA 3OHPA 4QRDA 3DPSA 7REQA 4UJ5A 2PTGA 5BW4A 3FM9A 2AR9A 3L93A 2Y0EA 3C1OA 1ZPDA 4U4AA 1G20E 1VQ1A 2GUWA 2J31A 2AS0A 3FNIA 3ND9A 5E6UB 1V71A 2WV7A 3OCYA 5FNVA 5CDFA 4C04A 3EGEA 4OCZA 4KN9S 3HBAA 4XWKA 4RANA 1BHSA 1I3CA 2ZYHA 1LDEA 2XRZA 1Y1LA 2B94A 2C59A 2X7HA 4RFVA 1PSDA 4U7GA 4WH0A 5DTRA 4EW1A 4JLWA 4DNOA 2NSJA 2ODBA 5AW3A 3IQXA 8ATCA 1QCCA 3BL8A 2EU8A 1J0BA 4RDCA 2Q3BA 4XA8A 4E12A 4BBJA 1KR5A 5K4GA 3ZWBA 1GV0A 1T2CA 3TOXA 1PT6A 2I22A 2AEEA 3GZNA 3NIFB 4LECA 2J9XB 1GPNA 2X6QA 1CUXA 3I5UA 1Z18A 4HYQA 4NZYA 1TIPA 1UKYA 1Y8RB 4MV1A 5E1BA 1F0YA 1DADA 2JLWA 4LOIA 3DE5X 2IXTA 4BXOA 4YDQA 4OGGA 2FTKE 4KJZA 2E4XA 1PZNA 4LVOA 1OJ7A 2HN9A 2I34A 5E8JA 2VLIA 1R3DA 3N2ZB 3VPCA 3M9LA 1YDFA 3QK7A 3QF4A 3O74A 2IBMA 2G9ZA 4X00A 2C7QA 1TJ3A 1X15A 1EP2B 1QS0A 3GLKA 3SS8A 2VPIA 3BA1A 2XCIA 1E9FA 3TZKA 2B83A 1S8AA 3DVQX 4Y1RA 5FL3A 4R40A 4E4TA 3CE6A 1QV7A 1IHPA 2P9JA 3EODA 4ZQBA 4BMSA 1DC3A 4R9NA 2ZWOA 1ISMA 4FC7A 4JYBA 2GNPA 3WQSB 2I4TA 3I8OA 2W4IA 3JWGA 4M9ZA 1V3UA 4L4UA 4OQXA 3DHYA 2IZOA 4WKBA 2V1XA 2OYSA 1X70A 5AKIA 2G80A 5C8DA 1B1CA 4WXHA 1DO2A 1JG3A 1H0SA 2H85A 3PD0A 1SVUA 4I4TF 3ZBPA 1BD4A 1EDDA 1L2TA 2YHSA 2ZRLA 2W2KB 1GEGA 1TFRA 4R0VA 4Y9DA 5EP1A 3ZIDA 3K6JA 2HRQA 3CPEA 4H7JA 2WTNA 3FH0A 3WHKA 3M6FA 3DMYA 1XZ8A 4LTMA 2AFIE 1UP4A 4AJOA 2WAYA 3SDBA 4XOUA 3ZGNA 4RLHA 4U7HA 2Q9BA 1FMCA 1XA3A 1E1QA 3QFRA 4L6IA 1TU3A 4ZOQI 1DUIA 3IVCA 5DX8A 2I6UA 4QOHA 3U7GA 2QZ9A 3GFPA 4CG2A 5JXHA 1V1RA 2YZ7A 4L0DA 4QTXA 4X93A 3I64A 1E60A 2J1LA 5C5CA 4LCEA 4MV7A 1EUDA 3E3OA 3JYHA 3ESAA 4M0MA 3GLHA 1NUQA 1OX4A 2QP9X 2UZ1B 2Z8YM 3K2QA 3KT3A 3NATA 3E48A 4KXWA 5JARA 1EFRA 1YZUA 3B1KA 3AINA 3WL3A 3AV3A 1PZHA 4G5RA 1NVEA 3OF2A 1XNJA 3N59A 1QBGA 3OPYB 5ICCA 3ZE2B 2O8FB 3ZWNA 1XF9A 4F8YA 2WZBA 2REXB 3HKBA 1RI5A 4XPIA 5DLQC 4RK1A 4N9WA 4DLZA 4V1CB 2VZ9A 3PXAA 5TJ9A 1U8FO 2GN8A 3P0FA 5AVVA 4IBOA 5LP1A 1Z63A 1D2GA 3WLAA 4C5BA 1VLHA 3MCVA 2E9SA 4FCTA 1DRKA 5F9HA 1L5GB 1CF4A 2YHAA 1XQWA 1FTNA 3CZ9A 2Y6UA 2ICAA 3T3EA 4DSAA 1QIKA 5DNVA 3UWSA 1GQRA 3STVA 2BBTA 4QHTA 1TD1A 3P19A 3QVLA 3LX8A 1F8GA 4ARIA 4V0LA 5ALZA 5AYVA 1C81A 3SKYA 1MABB 1P4JA 4S05A 5HKLA 2YYZA 2BEUB 4ND4A 3GLFB 1YS4A 4H31A 2H11A 2PRZA 4HJRA 4ESEA 3ADCA 1HQYE 1KI8A 4ALLA 1QH1A 5FI3A 4CCSA 3WSWA 3G1UA 3DBHA 2VK4A 4AUEA 1CHDA 2J3KA 2VS1A 4XOIA 3SXPA 5C1OA 2OCLA 4Q7MB 3W5HA 1I2ZA 3EPRA 5AOCA 4HRVA 5P8WA 5CYGA 3PP8A 3H2GA 5FCDA 3WDSA 1FYVA 1E1RD 3IQGX 1X92A 2C04A 1UBNA 2JAQA 4G26A 2HYDA 4ZAZA 2PGAA 5ARDA 1GR0A 3GNLA 1S2IA 3LY9A 3CEHA 3VR0A 4CM9D 1DBPA 1O6GA 3CLKA 4TWJA 2FPGB 5ADWA 2R11A 1PJQA 1Q95A 3X1YA 5LQJA 1S02A 2B34A 2ZRCA 3ANTA 2XE8A 3P9PA 2J3DA 1QOZA 3TLAA 3Q8MA 4RHCA 3ZI4A 4Q1AA 2PA3A 4D6PA 1IPHA 1MQSA 2XNSA 4KH1A 5KYNA 5CYFA 2R8PA 4B8ZA 4J0CA 1SXQA 3RU2A 4K88A 2ARKA 3B51X 3ELBA 1E3DA 1F4LA 1X8XA 4JKIA 2JLUA 1B1AA 3JAWA 2YXDA 3U13A 1NDHA 5BN3B 1OTHA 4RV9A 2XT0A 4HK4A 1KVRA 2Q2WA 3VMMA 3RTCA 1LLDA 3KAPA 2IIBA 2JHCA 3MT7A 3T7TA 3DW3X 4GDFA 5ICMA 2EGGA 1QO9A 2R751 4QQ8A 5KYWB 4M8NE 1HDZA 2KSQA 3K30A 1H2WA 2WJWA 3UJDA 3UT6A 5LKRA 2XBMA 1KH3A 1WABA 4PO9A 3RHZA 2FQ1A 4D3XA 1FNCA 2PZFA 1R50A 3D6NB 4LE2A 3JAKB 2DR2A 2QMQA 2ZWPA 3U4HA 2Q27A 1DIAA 3U9TA 5AVRA 1CUHA 1E6EA 1VXRA 4GZLA 4PLZA 4JI4B 1SB9A 1K08A 3I28A 4YQEA 1FDVA 3T9EA 3QELA 3VTZA 1TNDA 3P9QA 2O54A 5AJWA 2NYRA 4NH4A 3T7IA 1IXRC 2O50A 3VAYA 1NHWA 5FNVF 1EA7A 4TOIA 4TQ9A 2RAUA 2W6JA 4KXYA 5KDLA 3VZDA 3B7PA 2R1UA 5AK4A 3NIWA 3PICA 1D2NA 1TO6A 1SBNE 2WM8A 3AJEA 2ID7A 4MH0R 3B6EA 3C7CB 4RUKA 4GNKA 1WETA 1USKA 4ZYWA 2FYTA 3C8MA 3A9CA 3RS0A 4JB2A 4PEVA 5KDDA 5AJZA 5B58C 1YZKA 4TTAA 3ZVRA 3MHPA 3N8KA 2GAOA 1S2GA 1K97A 4RZIA 1ZNYA 3E4CA 4BNLA 3U5TA 1ZYUA 3M6IA 2EKBA 4KNWA 2IH4A 2XB2A 2NZXA 1JW9B 4N0PA 3IBTA 4WA7A 4D3YA 4IXMA 2BEKA 2F1IA 1V5WA 4EKIA 1JEYA 1IK6A 4GPAA 1M5TA 5FUVA 1I2BA 4NS4A 1TGVA 3S68A 5ILGA 4D8UA 1NWCA 3PFNA 4RSGA 5HX7A 3DMTA 1AQIA 5DX0A 1B93A 1YNOA 3FLEA 4OLHA 2B8WA 4PSVA 4EEXA 2FPXA 3DOFA 4Y6LA 3PJDA 3CZ5A 3RVSA 1Y9AA 2XYPA 2P69A 5B4VA 2KI5A 2ANCA 3RI3A 4XD7D 4BJ3A 4TVOA 2I78A 1EGMB 3C1UA 4E5KA 2EL9A 1EU1A 3TLEA 5I8PA 3SNKA 3CRMA 1ZGBA 4NJOA 4UTPA 6AT1A 3AR2A 1E92A 3B1VA 4V0KA 3AF4A 3AKZA 4Y2PA 4I99A 2I7TA 1OAKA 3PD1A 1RBYA 1A76A 2XYQA 1K8XB 2WPNA 4Q16A 2D06A 2JPDA 1QPGA 3RIGA 3KYCB 4PAGA 2YHUA 1BCRB 1S5PA 1LF0A 3T61A 5IJ9A 3AONB 3HN2A 1VFPA 4YCJA 2B69A 4R3WA 3JALB 4UDYX 2CXRA 3NM6B 5EI5A 5BORA 1OLUB 4PZEA 3MJTA 4N5IX 3H19A 5CW1A 5B2ZA 3LFHA 3LSYA 2O8EB 5K20A 4Q6BA 1GGHA 3HDYA 3UBTA 4TN1A 1U2QA 3BQMB 1HRDA 4MP8A 5JRZA 5IS2A 1RW4A 4UTNA 1TJ4A 3N8DA 4RF4A 2XOKD 3EA0A 1NXQA 3CZQA 3IBFA 4XQGA 1Q1EA 1YMQA 1TZMA 1Z2AA 2FQWA 3K1JA 4KIGA 4OHMA 4TUYB 1ZR4A 2R7NA 5CT9A 2JANA 2IXFA 1UJNA 3ECSA 3G49A 3KQWA 3KWJA 3PPXA 4AUKA 1ZH8A 4BVKA 3N0TA 3JZIA 1YQEA 3ZU3A 1UBLS 4KPEC 3HU3A 2YCLA 5HZHA 5KZMB 4ISBA 2A0WA 1NQTA 4G9EA 5HFJA 3DZBA 3SFTA 4PQEA 4BB6A 2EV9A 4IQ8A 1AXEA 1AHIA 3ESBA 3G8CA 2YS7A 3GJ5A 3U3MA 1VBKA 2E5FA 4JJIA 5JHGB 3GRUA 5FOUA 1SR8A 3D6MA 3UJCA 4F72A 2JLXA 3A04A 1U3CA 3O8OA 5JISA 1NW7A 3UK2A 3QSYA 3FDZA 1E9EA 1E4EA 3HKEB 5JJ5A 3TQFA 1D1TA 3A1EA 3LKBA 1M5RA 3U7RA 3CXUA 1VDMA 3ZLBA 3EXHC 1CE8B 1BX1A 3C3BA 1GDHA 3AERB 1NJGA 1KEUA 2A0XA 3IUPA 1DELA 4KQKA 4OXQA 4P2BA 3UA4A 1XTUA 5I9NA 4JXZA 1R9JA 1JAXA 1DJPA 3L8MA 4RK4A 1U2DA 3N3AC 3FI0A 3JQ7A 2ZDHA 3Q11A 4F3TA 3EZ7A 4DKJA 4UXJA 5ALFA 3QXCA 1FP4A 2Y2UA 2W8ZA 1UWLA 3AYZB 4RZXA 3KLOA 2VYNA 3RC8A 1ZRNA 2W58A 3FKSA 5DM60 1QB7A 4IF6A 1C0PA 5G0WA 1E3WA 4ZPJA 4D46A 4LJAA 3VC2A 1ZONA 4TQGA 2DKNA 2NU7A 7ABPA 2ACEA 3PC3A 2AFRA 5JOQA 2NUBA 1Q0PA 3EF1A 3DEKA 4LHVA 3TLJA 2YBDA 3K7EA 2ZR9A 3CO5A 3WGNA 3CYFA 1YI8A 4WEOA 4UBLA 2JATA 3AF1A 2AUMA 4KVFA 4Y6PA 5C35A 4FZ3A 3ITKA 4MWEA 2WSBA 4XZ3A 1SOWA 4EYEA 4J16A 4DXAA 1E1DA 2C88A 5H82A 3QWHA 4AY5A 1NVVR 3D8HA 3EGVA 3N6XA 4R8KA 4A0GA 2QWXA 2J9GA 4C3OB 2JHAA 4DLAA 2NO1A 4B85A 3L07A 3OOYA 1Y8ZA 2QD5A 1I2MA 1VDZA 1WBJB 3QV1A 4X61A 3UBMA 4Z4FA 2QKYA 5AMXA 2OHJA 4UEWA 1Y7TA 3RC2A 1V8DA 2AK3A 4BTEA 3ZQUA 2A30A 4QBHA 2G08A 5D00A 5G4KA 4DCVA 1TDJA 4MO2A 3GPLA 4YUAA 1M2NA 5IABA 3DLIA 1ORTA 1WV0A 2SNIE 3E9DA 4HQ0A 2OP0A 1IUOA 1M5UA 4HAXA 5TF4A 2J6HA 1EFLA 3C7DB 3EVEA 3OZGA 3QFHA 3VJLA 4CLOA 1T29A 2SKCA 3ZCUA 2QRNA 3K53A 2NMVA 4M0CA 3ZGVA 1MC5A 2H51A 2Q5LA 2P9GA 1E9RA 3OE4A 4OUDB 2IHKA 1RHKA 1N6IA 1KY2A 2OHGA 2YWGA 4D9BA 1GO2A 1QE3A 2ZQZA 1ODIA 3EQ9A 4ZCIA 4JYPA 3W3AH 2PJZA 2IYQA 3VYWA 3QU4A 2XI4A 1OI3A 2ESRA 4DY6A 3EEOA 3Q5EA 4Q19A 2H4YA 4HH1A 4CR8A 3PEUA 1AKVA 4NZ9A 1TJYA 3CB2A 4ENWA 2CJYA 1Q6ZA 3NGMA 2IKSA 4HEJA 4U02A 5CVVA 4AIIA 1B2LA 1IONA 2O7RA 4JU9A 4M98A 2B9EA 2NPOA 4DV6B 1LPMA 3LGSA 3NBQA 3V1LA 1MENA 3V33A 4DJDC 1DXHA 4L15A 4HDKA 4XXHA 1NVKA 4J6FA 3TZQA 2WTAA 2ZYWX 3LWNA 1XDGA 3QPWA 1ZUD1 2QK4A 3OZXA 5J9FA 1S2LA 4ZGWA 1R9NA 4PFKA 2E7ZA 1I6LA 2Z8ZA 4GI2A 3MMNA 3QIAA 3VSEA 3DZCA 1L7BA 4JXXA 1GY8A 2C97A 3FYTA 3LK7A 4PC3A 4HDSB 3HU5A 2Q3HA 3QPBA 5JI3E 2HDOA 1IY9A 1TAHA 2PT7A 5HZKA 1ZK3A 5JNTA 4ZCLA 2IS2A 2WMOB 3JQBC 4Z4GA 2H6EA 4R98A 2FAXA 3K9FC 1GGKA 1NVWQ 4IDAA 2LCQA 1CR0A 3BTUA 3S2IA 2X8LA 4I7EA 2C4HA 2CL0X 1N2BA 1RYMA 3LIIA 4EA8A 5L3SA 4UZFA 1AS3A 2V7WA 3SEAA 4DC0A 3NWOA 3WRVA 2PYZA 4XWOA 1C2TA 5EXXA 2JJ1A 2VQFB 5FA5A 4BLVA 5CEEA 5KO2A 1DKPA 2CHVA 4JAVC 3M6VA 4JBIA 3AHFA 4LGYA 3VPDA 3R0ZA 1A7AA 1DIBA 1PR5A 4YRNA 2CXTA 4EGQA 3K70C 1PX0A 1Q2UA 3DGFC 3VYTB 4QBKA 5JD5A 1WEKA 1TKBA 3DO5A 1NOJA 4UAJA 3MTJA 5CIQA 4YDRA 4WK2B 4D99A 5B7QA 1ZITA 5EWJB 3RBZA 3Q10A 3V2GA 3OE1A 3FOZA 3MYYA 3SC4A 3TD2A 5GJWC 3U5ZB 4BATA 3PFFA 4DARA 4CXMA 2J0QA 1PK7A 5E9WA 2D1QA 3AO0B 3KWMA 4URZR 3NHMA 4IDNA 4KUGA 1MW8X 1H85A 4CT0A 5ANRB 2W2VA 4XPIB 3HRIA 3PDJA 3P20A 4HTFB 3ZYCA 3C15C 1C1XA 3DL2A 3ED1A 2JGFA 1R8YA 3O21A 4JUBA 4EFMA 5KQGA 1OLUA 5G1OA 2WYHA 2XDWA 3PGJA 1AMUA 4QU9A 3LLMA 4RENA 1T2FA 3EPLA 2DCMA 4ABYA 1WXHA 3T5PA 1RAAA 3O8NA 2ZZKA 1ZHHA 4INOA 1AXGA 5NLLA 4BFXA 3E9NA 1QG6A 4MLCA 4F7DA 5CB0A 4L57A 3PQ3A 4M6WA 4C4SA 1K92A 4O25A 2R8XA 3NVDA 4MKHA 1ZRMA 1AURA 2HM7A 1RE0A 3HJAA 3ITDA 4U9UA 4WK6A 4ZYTA 3SZ3A 2BKVA 4ND1A 4DXHA 5BYBA 3WP0A 4RNDB 1ENPA 3C4JA 3DG9A 5AVKA 3PUZA 5GVSA 3PPWA 3DJYA 1GNSA 3KB1A 4FP9A 4AF6A 3D6AA 3FR7A 3I23A 3ZYZA 1G5HA 4DRYA 3K09A 1IY2A 1L4BA 1WW8A 2NZYA 1K9SA 3GYGA 4HWPA 4TVBA 1G5FA 2HBYA 4J7CA 4CM5A 5BW8A 3WAKA 1ZN9A 1LU9A 2YWJA 1W93A 2Q99A 5JBIA 1CC1S 3ELWA 5JROA 5K5EA 3R6LA 4QBFA 1Z82A 3ET5A 2Q3CA 2GXSA 5CIWA 3I9NA 1EDBA 3VHLB 3WYCA 3JD0A 4KAJA 3WDLA 4R1UA 5IF3A 5AW4A 2DT8A 3K1TA 4OJMX 3EH1A 1U9IA 1SVIA 4JODA 3HZRA 3M1AA 4CQMB 1ISJA 1U0SY 4G4JA 4HTAA 4MAFA 3CZAA 4US1R 2H4HA 3BJZA 1Z2PX 5AW7A 2FMIA 2OQ2A 3QHAA 3BE6A 4FEYA 4NRDA 1LLUA 2YWBA 4HAYA 3FNFA 4HRYA 1YIOA 4B8WA 3FHOA 3HJGA 2QG6A 3STHA 1MN6A 2XIJA 1GRNA 3JD4A 1K7FB 3PC2A 3R9KA 3V48A 2HO5A 4R71A 5K8VA 3CVUA 1RHUA 1KH1A 1MTOA 1Y89A 4J90A 1WQ3A 3UXEA 4X3CA 2AEFA 2GR9A 4KGZA 4Y2UA 3TRHA 4II7A 3U3DA 4W8OA 1ZOSA 5J63A 3PE6A 4PXAA 4KL8S 1KEEA 3AP1A 2IYTA 2Z58A 4OGFA 3WLSA 5JTTA 1NPDA 4OJYA 4J0DA 4OQYA 5DE3A 5ER6A 1EDZA 3TO5A 1U5BA 3CFYA 3GJ7A 4DLYA 4QOIA 3S70A 5KKCA 3V4VB 2PLNA 5F7ZA 1U28A 3OWOA 4FOSA 2VEOA 4YMLA 3DTNA 4LV6A 3UK1A 1JEAA 1UDWA 4L3OA 5DWQA 2B4YA 1L7DA 4D4MA 1EDOA 3WZLA 1CRWG 4LC9A 1RWOA 3I9OA 3KXPA 4RADA 1P18A 3B6IA 2JZCA 5T64A 2P9YA 5FEMA 1US8A 1BEEA 2I3AA 4KO3S 5DRYA 5A71A 1UT6A 4B3RB 4P7JA 4BCBA 2FHPA 5KNCH 4KXLA 4R1TA 13PKA 1J8YF 1YR3A 2GVNA 1QE0A 1B42A 2OL4A 3D0OA 1LBIA 1MV8A 1K3FA 1EX6A 2HA0A 2KBEA 3T1HB 2BEWB 4LVUA 1U80A 4RVOA 2JA1A 4ROTA 4M87A 4MCJA 3OC6A 5ICSA 1A71A 3THOA 4LGMA 4G23A 3KBBA 3PGKA 4GI3A 5H80A 5BOSA 1Z34A 5HKBA 3QUAA 1IHOA 2PUEA 2FEKA 1IXSB 3K94A 1EQUA 3AVQA 4JDPA 1GZ6A 2REOA 4PYJA 5JSFA 2W2QA 2OHOA 4J1NA 2YJTD 3I2JA 4R1QA 5SY9A 1PGQA 1T3HA 2FZCA 2QG4A 3BEOA 4ISCA 4WN9A 5EIAA 1U1FA 4Q7KA 3RWOA 4RXUA 4OU5A 4Z0PA 1WBDA 1VMAA 4TX1A 4W1PA 2OYRA 4YIHA 2RAVA 1D03A 1X19A 4MZDA 2IHBA 2RH4A 2ZSUA 1UBKS 3Q7PA 4KYVA 5IBRA 4S0ZA 2D2EA 7ADHA 1NBME 1IG3A 1RKQA 2LP4Y 3G2MA 4DBLC 4E94A 1U0HC 2XA2A 3IPYA 3VOTA 2ZWIA 5BO5A 5THXA 2FGKA 3A2MA 3GPCA 4FHEA 3QA3E 3GXOA 5G1PA 2DFTA 2JS7A 1EXWA 1BJTA 1HDXA 1P5JA 3LOQA 5LDHA 3LLSA 3ZZMA 4OI4A 1MZPA 4DS3A 1EG2A 2IXEA 1KO8A 1IOZA 1NRWA 2ZJ2A 4OI2A 2Q8PA 4A15A 2RHTA 3CH4B 5EZYA 3KIPA 5DMHA 1JFFA 3FRJA 3G68A 1YJBA 3AETA 3P2JA 4L4RA 1COWA 1S96A 2GYUA 1JE1A 3RUFA 3G85A 1O95D 4AECA 3PT5A 4K8RB 2GEDA 4HNTA 1UWKA 2XTZA 2ZIZA 4O1HA 1SO8A 4MB6A 4D02A 1M1ZA 3LHDA 2ZU6A 1OFUX 2A9FA 2PUVA 1KY3A 2WAXA 4FN4A 4I50B 4JUCA 4PNZA 5KYUA 2VRBA 3H5LA 2F9FA 2OV8A 4XVCA 3EAGA 4NZZA 3B8HA 4ZARA 4KMRA 4OXRA 4BLOA 1R4AA 2EJWA 1KP3A 2Q1YA 2GJSA 4FOTA 4LJRA 1C8KA 2CFOA 3W1WA 3EPKA 3CZRA 3BF7A 5KI6A 3HJUA 4DTCA 2Q7DA 5F2NA 4KR6A 4M0EA 1NR7A 3RJ9A 1CR6A 1GNVA 3PR1A 1QH1B 4FONA 1PL8A 5DIZA 1YSCA 4ZAXA 3JTMA 4KQIA 4KYTA 1EP9A 3HUUA 1WCV1 1AKYA 1KORA 2A3NA 4MITA 3NTVA 2FWMX 4C2UA 4OXNA 4U2EA 5SICE 4PGGA 4KXNA 1DUSA 4B3DA 3PL5A 2R7MA 1AX9A 3SICE 1B4DA 4Y7DA 2OO3A 3OF3A 1GU1A 1R0LA 4OAQA 4XB1A 2JLBA 2HHJA 4MYHA 4TS1A 1GSOA 2FN8A 3W5VA 2MDTA 4QUKA 3WHPA 4DG5A 1HG0A 1LQUA 4B43A 1CUBA 4II2A 4QIHA 5JNWA 1NG9A 4IG9A 4DLKA 3WMGA 3PSHA 4YRRA 3RGGA 4BP8A 2CLLB 4LRWA 4EZEA 1R4ZA 4RX1A 3UWOA 3FFWA 4KK4A 4ZO6A 4MLZA 1BXZA 3TCNA 4F3CA 4XYLA 2WAMA 1F14A 3ZHBA 1CY6A 1X94A 2FX2A 1EM6A 4G0QA 4K8OA 2RKWA 4P8RA 4EDFA 4FJ0A 1UPTA 2FPIB 1ZCAA 4MVYA 1FUKA 4KLNA 5DB4A 5IC4A 1RRVA 3DTVB 4WCFC 2ZYGA 1JPVA 2Z4SA 2M6KA 1VLQA 3ITEA 3RDPA 1JAYA 3UK6A 1PJZA 1AU9A 2FW8A 4LFAB 1GRRA 3N2IA 1ZOLA 1LA2A 2G36A 4IJWA 4BN5A 2DQZA 1Z4KA 4E3ZA 3LTNC 3D1LA 3X0DA 3T0IA 2JJYA 3S29A 1Z0JA 4YJKA 3QWAA 4QTUB 3ORSA 2O5VA 2BGUA 1CUEA 5H3CA 5IKXA 3LYLA 2CV0A 5C7OO 1X7HA 2QTGA 4EY6A 4PHGA 3DBRA 1UP6A 1J4AA 4EZBA 1DQNA 5DWVA 1IXYA 1L4FA 3C16C 4R2JA 1CRLA 1MA3A 1QRRA 2XUZA 3WRYA 3LBIA 4LOKA 1LEHA 2P11A 3EG9A 4OQNA 4PSDA 4W63A 4BFWA 2Y77A 1QP7A 5T6MA 1SKUA 2X0KA 5CNKA 3UVEA 1UQUA 3NG1A 4LQ4A 1YR9A 1DEAA 5E9AA 2FG5A 5CB8A 1KIAA 1QYVA 2P2NA 2UZ1A 2W22A 5E38A 5JVDA 1K7CA 5FNVB 1EK1A 5JW6A 4DR6B 2C4KA 1YJCA 3ABSB 3HDHA 2P3LA 1NLYA 3OMWA 1W0CA 2RIRA 5IH7A 3H3FA 1ZM4A 2EQ5A 3MA0A 4YCMA 2CY0A 3HCCA 3PUXA 1FMFA 2O14A 5REQA 1IATA 4L3WA 4IHJB 4U9IS 3BZBA 2R8ZA 1S9HA 3BMNA 4IRXA 2GEBA 4QTTB 8LDHA 5FUWA 1SQFA 2FR0A 4CF7A 3GFOA 3FMGA 1QPZA 4IGAA 3B9PA 3PJFA 3K8QA 1SUDA 3OKPA 2OV4A 3QVUA 4FFPA 1GN8A 4JOSA 1T15A 1S4QA 3FRHA 4JT4A 4IDDA 3KJGA 4V3BA 1JSCA 3OLQA 2PSFA 1D4FA 2QIOA 4BJ1A 4FNGA 4CRWB 4M22A 4D0NA 1S9DA 5JNUA 3BG5A 4M8SA 2IOYA 1W34A 2V5AA 2ZSBA 1OC4A 1YE3A 2ZRNA 3ESYA 1C30B 1NVXQ 4DDTA 5EVJA 3AL0C 5ALYA 5HA5A 1TF7A 2HJVA 3JQCA 4TTPA 2GZRA 3CLTD 1PFQA 1D2MA 1WTAA 1GQYA 4V03A 2IYZA 4G37A 3TI7A 1XRMA 5HMMA 1KNQA 3MJDA 2Y67A 1NTOA 3VU1A 1M2VB 3QEOA 3FE2A 5FOXA 3S1AB 5BSWA 3VSCA 3W1EA 5JNVA 5JSUA 1ZD4A 2JI7A 2BPOA 1CDZA 5AJVB 5TX7A 2ZRMA 4BDSA 1Y8AA 1ZW1A 2CJWB 2XT9A 1VLLA 2WYUA 1DEKA 4CQNA 3WI7A 1WB5A 1E2HA 1LNSA 4X92A 3DVSX 5CA0F 4B3TB 1RQGA 1UEIA 3RVQA 2ZKLA 3WLTA 4ZTUB 2RH5A 5J1TB 5IJZA 4YMSA 2P4EA 2XLCA 1SXJD 3E0XA 2IPNA 1P2DA 4ITVA 2ILTA 3DP9A 2XQKA 3OBIA 5AI0A 2P65A 3NTUA 3QE0A 2FEXA 5EXSA 4ENSA 3A2KA 5CM2Z 3FF4A 4LJYA 2AG1A 4NFYA 4WGGA 5IUJC 1W47A 1J49A 3P45A 3U80A 4QYSA 3PKIA 4ZGBA 1WXQA 1YR2A 3MUOA 2XCRB 2VK2A 1G41A 1H05A 3C87A 4HSEA 1GN9A 2EJTA 1R9GA 5LXTB 2GPBA 3OIWA 5FHQA 4Q01A 1RWKA 4N7RA 2EBUA 1W73A 1E3MA 5BWBA 2C9OA 4MTCA 5JAMA 3TZEA 4JC0A 4EMTA 2FDXA 5ALGA 4GSYA 5CB4F 1XLVA 4H60A 2NGRA 4MV8A 3ROTA 2XBLA 3N0WA 1JG2A 2Z6UA 3EMVA 4RHEA 4X5OA 3O4GA 3WV5A 3WWZA 4N54A 1PR2A 3CR8A 3K05A 3NBAA 4K1XA 1R8QA 4QG7A 5DBEX 3EZGA 2OGUA 3OX4A 2QS9A 3R5JA 1FJGB 3DOJA 3LUPA 1PSZA 2Y1CA 3BHJA 4BFYA 4C6HA 5E9JA 1Z8FA 3EXAA 3H8VA 3ONDA 3I52A 3V5NA 2Q07A 2J3IA 1YOVA 3HUEA 3WK6A 1N0HA 2G76A 2VWQA 2PUWA 3A1CA 3K9BA 3PKJA 4ADSG 3CVYA 4XEHA 3A05A 3IYLW 1ETHA 4BN0A 1PTKA 3ZWAA 4AQDA 5C52B 4MS3A 5JJCA 1Q7RA 1FP2A 4I55F 5LC1A 2I66A 3MBIA 5HKOA 3N7UA 3KXKA 5I7HA 1NF3A 1P2SA 4R2IA 3I4FA 4JGGA 2ZANA 5BYJA 3MWDA 4DYVA 4WECA 4CWAA 1TCUA 3R41A 3OJFA 1TZCA 3UV6A 4KIUA 5A4JA 4F3NA 1VYVA 5IVHA 2IEBA 1BQEA 1U94A 2HYIC 3AP2A 3OY7A 1OJLA 2RG1A 2ZRFA 1CR2A 5HBRA 1DDGA 4MSUA 4RVDA 1Y7HA 2V5VA 4HWSA 4KX3A 5PGMA 3FSEA 1IBKB 1WKBA 1VKOA 5BWNA 1JI3A 1TKCA 2E55A 5K6AC 3N58A 2BTEA 2BP7A 1Y4AE 4OKSA 1LBSA 4WXMA 1VKNA 3EGCA 1HLPA 2IHJA 1WMBA 1HURA 1OXKB 1P19A 2FPSA 3PGXA 3GUYA 3QMWA 2B8EA 2NTNA 4F2HA 4P38A 3NR2A 1N2XA 3ABIA 4J49A 2C94A 4PPGA 4TT3A 3NBXX 4GRIA 3L79A 3N9IA 3VZCA 5IYZB 5HRAA 2C7VA 4Q9AA 3EJ6A 1EG7A 3CY6A 5HQ3B 4WBSA 2ECPA 4GEKA 1M3SA 5EGNA 3O3OB 4RHUA 4KWHA 3KLNA 4Z9YA 5HQJA 1UXKA 2CB0A 2ZE7A 3Q1KA 3ZLJA 3P27A 2UZAA 1AM4D 1VE1A 2B4QA 4IDOA 4QXMA 4F3KA 1ZNQO 5C5DA 4HSGA 1P7ZA 4JZKA 3RTAA 4N41A 3E70C 1W85A 3K0KA 4YDHB 2H2AA 2GQ0A 3BD6A 2WKSA 3CLSD 1NUPA 2KLHA 4BMYA 2O8FA 2FSFA 2BKEA 2NU6A 3L6EA 4TUYF 5FI5A 4BYGA 4HDRA 4AG3A 1MX5A 4RSHA 4ESHA 3BRQA 4H3VA 2AMLA 3MBOA 3NBYC 2WIJA 3O6VA 2CNKA 1JI0A 5JJKA 1BN6A 5CDUA 1H9BA 1A4IA 3T9BA 3MUNA 3SLGA 1KC3A 4BJ5A 2HMAA 1OC2A 1U0GA 1Y8QB 3EFHA 5AI4A 3DAOA 3SXUA 3PEWA 2NTYC 4I5EA 1VIAA 2ZKIA 3I83A 2A1IA 2WJAA 4I9NA 1OR8A 1N5JA 2E4ZA 3L7KA 4P3OA 2EC5A 4BNKA 1A27A 1QHSA 1X1EA 1XL0A 3RYIB 4DBVO 3DZDA 1ZM3A 4HEA6 4ZVTA 4LFCB 3IP8A 4NNOA 2I1LA 4QQKA 2CJWA 4MQUA 2W70A 4TL7A 3DKKA 1RCUA 3EVZA 3R3UA 4AD8A 4AICA 1Q6YA 4K6MA 5ALJA 3OIUA 2UUCB 3GF4A 3BXHA 2YVUA 3LP8A 4WOPA 4F4IA 2HXYA 1ZVKA 4Z49A 4KLRA 2EX1A 2WUFA 2WG0A 3RRJA 3COJA 4F3YA 3AVWA 2F9LA 3SZGA 5AQ1A 1HKUA 2BGMA 2X9VA 3FGZA 3OM1A 3TLCA 3GMTA 3SMQA 1Q77A 1Q19A 4EPRA 1KS2A 2UXDB 1D6SA 5EQDA 4BZXA 4GOJA 2ZVPX 3SR0A 1N9KA 4DREA 3WLQA 1RJEA 1U0LA 4M8KA 1WQ4A 1OWOA 1HH4A 2FN7A 4G9GA 4TSFA 5L7TA 5IPFA 1I0LA 1I01A 3L7AA 1XWIA 1EGHA 2P2GA 3NWEA 3QPUA 4DNQA 5TPZD 1B0UA 2H5JA 1I4TD 4L7VA 3L4BA 4UCXA 1SXJA 3TZ6A 4BLRA 3SS9X 2Q3MA 1QRDA 2EW8A 2X9LA 1ISRA 3GRCA 2MR6A 2XECA 4NWIA 1MC1A 3RUIA 3AESB 2P5TB 2CLIB 4IUBS 2H00A 5LZ8A 2O3TA 2V6BA 3TXXA 4OJNA 1K0FA 1BU8A 4B3IA 2Q50A 1HK7A 3ADOA 2EIHA 3OFVA 1EVIA 5ELXA 2QGFA 4RD6A 5J40A 1O03A 3FSGA 8OHMA 1AGNA 2O2EA 2YJNA 5KSWB 2P2ZA 1W52X 4LDAA 5LQSA 3QEAZ 5LZ9A 4OX9B 1ONBA 3G89A 5CD1A 1E9AA 1PW5A 4QBGB 4UHBA 1HNZB 2EJVA 1YZGA 2FSIA 2B3TA 3OFNA 4LQDA 2AYZA 1H93A 2BEUA 4HI0E 1QIJA 3OTQA 1QTIA 4JI1B 4KFCA 2D2FA 3CNNA 1KXJA 4JKYA 5ARBA 5DULA 3FOEC 1UAAA 2GSWA 3NCTA 5SZKB 4OD0A 3RNLA 1W0KD 1TO2E 1ZL2A 4KV9A 3UMRA 5JQGF 5ALHA 2ZP1A 2QJFA 1JIQA 1F6WA 5E6SA 4P0PB 4M49A 3Q6NA 5T41A 1EMDA 2Q5CA 1L4MA 4QWMA 3V4ZA 1QOPB 5AM1A 3LOUA 3L7JA 3L7IA 2O2IA 1WZUA 3H8WA 4EI9A 2Q0XA 2QMYA 2ZBGA 4NEQA 1DEXA 4P35A 4NPHA 3MGGA 2Z5FA 7GPBA 2PUCA 4FGSA 1WDWB 4WL0A 3UAVA 4M9UA 2XAUA 5LXTA 1O6FA 4IJVA 2J3EA 1M2HA 2Q3EA 3EVFA 2RHMA 2XBUA 3F4LA 3I5YA 3RVPA 4LWPA 5MHTA 4GMFA 5D1HA 1AQYA 2DH5A 1XG5A 3ASZA 3LF1A 4DM7A 5C81A 3MGKA 2FEOA 2XQGA 3PRKE 4QFCA 5DCUA 4MR8A 1VSUA 3ZHXA 4BX9A 4GP6A 4UHCA 4DGQA 2I5PO 1GNRA 4ZAYA 5B6JA 1XRLA 1V3QE 5A3SA 4A2PA 2ZBRA 2VVTA 2O19A 4J0FA 2A1UA 2FX5A 1XHFA 1EUQA 4YC7A 1NXXA 4TMYA 2DPYA 4ABTA 3I53A 4OHCA 2BSXA 5D5QA 4Z1MA 1THMA 4BNDA 2J9FB 5JSZA 1FVXA 2DWPA 4XEUA 4JUFA 2D62A 4ZKEA 2ONYA 2L18A 2O8DB 4OOEA 3ZWXA 2NUAA 1GUZA 5DCYA 1E2BA 5TQ2A 4QBTA 1KOLA 3B6MA 2XUFA 1NFRA 4QJ3A 2BFDB 4S0XA 3EDCA 1BGWA 1YRQA 1U7PA 3KS9A 2A9JA 1K6MA 4P3XA 4UVIA 4X3OA 3ZQKA 5EIXA 4KREA 4M99A 2EFEB 2WD9A 1SJ9A 1VGQA 2QM7A 4DV5B 5I01A 1XXHA 4QPZA 1U90A 3GRYA 1U8TA 2BN4A 2GETA 1ZH2A 3KNZA 2XIQA 5EKDA 4PLPA 4EG3A 3UJ8A 4X45A 2IDZA 2AJ8A 3FTNA 3P4XA 4D3DA 1EXMA 4DJJA 4JI3B 1NQWA 2YKGA 1IOLA 3WK7A 1NI4A 5BT8A 1Z7GA 1Y5IA 1ECBA 1KS9A 4ZOLA 4ZPXA 2DMRA 2H08A 5ALPA 2NTVA 2YY5A 2XUPA 1DBIA 3OEHD 1E64A 3WYAA 3L0CA 5DMXA 1YVPA 1L0BA 3QYFA 2W48A 4E46A 1RWNA 2R8BA 1MB0A 4PFSA 5A2GA 2HAEA 5E1DA 3D3NA 3L92A 3LUAA 3J80A 1NMZA 4GPIB 1XCPA 4MDHA 4N18A 4P4GA 3RV4A 2X5NA 1ISIA 4DT1B 5J2TA 1PFYA 2XYGA 1OZGA 1TT7A 3T3NA 4L4YA 1YRBA 5A06A 3WKDA 5MDHA 1B3RA 3G3EA 4YFVA 4H1WA 3VGJA 1D6JA 1H5QA 1HC7A 4NKRA 3OIFA 3Q88A 5F76A 2UYOA 3IVRA 3O93A 1S6YA 4G0YA 3WNCA 4GW3A 2HCBA 3MD0A 4HNQA 3L43A 2GXQA 4KRFA 2HIGA 4GSLA 1Z07A 1ZMTA 3B12A 4WBNB 1MJHA 1BS1A 3OVMA 1XE3A 4DADA 5BP7A 2YZGA 3KUXA 4E1BA 1XU7A 3GR6A 4GIBA 1GA4A 2JVJA 2OOKA 4PW0A 3WGQA 4B4OA 4RETA 1JLLA 3ZCTA 2F4VB 3HM2A 3LCJA 3THYA 3IAAA 5JYDA 4WPGA 3VPAA 4WFKA 4BGVA 4DHEA 2EKZA 1PAUA 4G1BA 4TSKA 2YFQA 4GE0A 5KYKA 1EVJA 4R16A 3V8NA 3KVOA 1M7BA 4J94A 5IDXA 4ETWA 3E7FA 1RLTA 3OJLA 2I2XB 1FK8A 4BC0A 2Z6AA 2XZTA 4PBTA 2GAIA 5DYTA 1E62A 1VB5A 3RFXA 7YASA 2R4UA 1G2OA 5EGSA 2BOVA 1OYOA 3E23A 3LL4A 3B3GA 1W88A 2A88A 4M1QA 4QPJC 3OLYA 5SV2A 5GONA 5BR7A 3QBTA 5EWMB 3L7BA 5K0NA 2P8JA 1TTTA 4Q39A 3PRYA 4XSHA 5KTNA 2WOOA 3HRHA 1MKYA 3QX3A 5I5GA 1Z88A 4FHCA 1M6EX 3A32A 3C41J 2DHQA 3GJ3A 1SUPA 4FUTA 4O4LB 1I4DD 2PD4A 2ECOA 4NU8X 4X6XA 4R6WA 1C7RA 2WU3A 1WM1A 2O59A 3Q7IA 3R3ZA 4I5IA 2CYCA 2J9YB 1WW2A 2ZJ4A 1C7ZA 3HO8A 3TIFA 2W4MA 4FLMA 2Q45A 4NULA 3GPBA 4MRAA 3NM5A 4UE6A 2ZJ0A 1ZBQA 5CYPA 3GYBA 3RQSA 4BVLA 4LC1A 5COQA 2VNKA 4MRMB 3VI3B 5J2UF 1ZUIA 5DEIA 4ONEA 4Q4AB 5DOVA 5KOJB 2EFCB 1CUUA 2WBLC 1P8AA 2WPDD 4PHCA 4QQNA 4CODB 2PUBA 1JB9A 4EW3A 5L53A 1GWNA 2VQ3A 4ERNA 1QFYA 3AJ8A 1QZXA 3G8BA 3G13A 3W6PA 4KQ2A 2C4NA 3RTEA 3PWSA 3HMKA 3IGFA 1T8UA 4PNHA 1E59A 2GHIA 4HX5A 1KPGA 4GOMD 2BE9A 5EZQA 4K81B 2YUTA 4IH4A 2Z2IA 2CLMB 4MUXA 4DIBA 4XYEA 1Q22A 1OMOA 3F5FA 5FYQA 1MJGM 4EL5A 3LX4A 4NYIQ 3W7BA 4EG7A 1IAQA 3P8ZA 2PQ6A 3R9IA 4X62B 4XFDA 4E1AA 4CCWA 1KETA 3PZBA 4ACAA 2ADOA 5TVKA 5JS6A 4X90A 1AK9A 1JJVA 2HBRA 2RGWA 3NIGB 3AF3A 5CT8A 4LXIA 1ODLA 3AETB 4D8XA 4GT1A 4DRXA 2VF7A 2BFFB 4QM6A 1XRJA 1KRWA 2X5XA 3D7RA 2PR7A 5D3QA 4CR6A 3CLUC 3Q2KA 4G0WA 4KGXA 3L0IB 2BYTA 1RJFA 5K3OA 2PS3A 5E4JA 3UG6A 3AU9A 1PVVA 3ZDFA 2B1RA 5CFZA 5IM4F 1G5RA 1DQPA 2J7KA 5BQXA 1CVRA 2HIMA 5K3AA 2HK9A 3WYBA 3GMDA 4R2WA 1L5QA 3D81A 3FR8A 4BWFB 3G59A 1DV1A 5B1SA 3OQ6A 4PYNA 3PLRA 2V3CC 1XP8A 1JKJB 1BGVA 2J09A 1BKSB 1R12A 4RGQA 3A0UA 2VWPA 3NEPX 3COSA 2Y99A 4I66A 1ND6A 2QTNA 2YASA 3DLHA 5CTJA 3PJRA 5JADA 5KWJA 1E0AA 2VP3A 1OGYA 1H65A 2VDPB 4BNZA 2OFXA 5AVXA 1Q0ZA 1Z6QA 3T35A 5GZ1A 3BXZA 1AQJA 3IP9A 3L7CA 4N0DA 1Y7LA 3E1GA 3IKLA 2OILA 4UNPA 2XADA 2BVNA 5D5PA 1FVOA 2Z2JA 3CJQA 3G5LA 3ISVA 1JGTA 1G2QA 4F12A 3OUZA 2NP7A 1H4VB 2FFAA 3S5UA 5CTAA 5FBHA 4LF8B 4TTSA 4I9UA 5DTEA 3IMKA 1CXZA 3SZUA 4A1FA 2L82A 3IC5A 1UT8A 4P3KA 3JVEA 3K1YA 1XX6A 4KQEA 4MCHA 2I7XA 4L5IA 4MPRA 2FPKA 1O95A 1E94E 1EVZA 3GT0A 3CF2A 4BX2A 1GG8A 4UJ3A 2OGSA 1USGA 4N49A 2VJNA 1GFZA 3PFIA 4NAHA 3MMSA 2AXPA 4R5MA 4TWBA 5FWXA 4E88A 4NJEB 1JX6A 1TMYA 3QBJA 1N2CE 1GGVA 5M3BA 3H04A 1FE8A 1KRHA 4IIXA 5DRTA 3TNFA 4PV7A 3AG5A 2XTNA 4WN3A 1FSFA 4IWNA 4YUXA 4I9FA 1QV6A 1WDTA 3JQGA 1XLTA 3E2IA 4H6WA 5EE3A 4M21A 2I4RA 2WF9A 3BERA 1JLRA 1B74A 4HDNA 3WIEA 1PZXA 3AEZA 2J3QA 4QT4A 1GNTA 5F1YA 3QUQA 5EYPA 2C5FA 2DBZA 4KQ6A 5FOVA 2PZLA 3IOYA 3N8GA 2CUNA 2VR1A 1GZSA 1KBOA 3AHCA 4FZVA 4AT1A 1RTTA 3R0XA 5KVVA 5K3EA 4OK6A 1GPDG 3MPUA 2Q8QA 5DSXA 3AW8A 2QRMA 3D6FA 1R74A 3A06A 3LVFO 3Q41A 4KMOA 2V9CA 5DBGA 4QHSA 5AI9A 1QIGA 1SHZA 5IVPA 4AJ4A 3HR8A 1EFHA 4B4VA 4HB3A 1J0DA 1AF7A 1GXSA 1H2EA 1CQWA 1D0SA 4TS3A 4PX9A 4J1QA 3FDZB 2BJWA 4FEGA 3E53A 1Z12A 3PPYA 1O8BA 3R75A 1SNYA 4TTQA 4G4GA 4DMGA 4JL8A 3B2QA 2HJRA 1VI6A 1XD2B 3GRFA 3BOSA 3F6CA 4DCNA 2MSDB 3ZV5A 3DM5A 3N74A 1RIFA 2FHSA 4EG8A 1A8UA 2VRWA 1HE5A 3WQRA 4AKSA 4BO0A 3PGA1 4BAGA 3BWMA 2X0JA 1JSZA 1JEYB 2PKCA 3FVRA 1TW3A 1E1KA 1WHTA 2NUTA 1UBFA 1YS6A 1KWGA 2ZI7A 3GN2A 3N75A 5L4NA 1QV9A 3OOWA 4G56A 2A8YA 5K2MA 3RSSA 4DR3B 2H4ZA 2QR2A 4E51A 4JBYA 3ZZNA 5IVIA 5IKEA 3RUCA 1YOBA 3TDMA 4B3GA 3CF4A 3B36A 2K7ZA 1PS9A 3FTPA 1TLLA 3LI2A 1AS2A 2DOKA 1UFOA 3HWWA 3D7KA 4Q1VA 3H9EO 5D5HA 1YB7A 4A5OA 5F78A 4KWIA 2CFSA 1Q7TA 4Q15A 1W2WB 2EGHA 1A72A 4LE0A 4ZQIA 1J23A 2F1JA 3O38A 2GAAA 2B8TA 3F1LA 5IJ9B 3GNQA 3ND5A 4EABA 5FJJA 1D6MA 5FUXA 3K2IA 4QYTA 5EJ4A 2VFAA 2RCYA 1W76A 1YU6A 3C98A 3GAFA 4UU0A 1X2EA 3T7DA 4N5NA 2O8EA 3C3WA 2XAAA 5CP8A 1VL1A 4ENQA 1HZZC 3F8SA 3NHJA 3R0JA 1JF8A 1LTQA 1GPAA 3E5RA 2TS1A 1J07A 3INGA 2I76A 3IB3A 4P4SA 1I13A 5EP2A 4CG0A 3O03A 1T3ZA 5LL6P 1UJMA 1OIXA 4UCWA 3ROZA 4ZHQF 5IMSA 2YWDA 3KSZO 3IKMB 4FX5A 4UBOA 3VHQA 5AJTA 2AFIB 3X44A 5GJCA 5HPYB 2EZ9A 1LH0A 1VKHA 3PUYA 4B5LA 1WMDA 2KQUA 2FPGA 1H5NA 3O3CA 1VJ0A 2K4MA 3P0RA 4J9VA 4L5YA 4L8WB 4CF6A 3AC0A 1C3LA 1CZKA 4AM8A 1NI3A 1VBFA 1G4AE 3K4PA 2G3YA 1IG0A 1LV7A 4L16A 4QUEA 5HXAA 2X41A 5EIWA 1D04A 4LYGA 1POWA 3N07A 5AKGA 1LVGA 2HK6A 2ZIUB 5DTJA 3T1YB 1V9SA 1YA8A 4J7AA 4K9SA 5BR8B 1JALA 1W4ZA 3C45A 4OHKA 4Y2QA 2GF9A 3U7HB 1C9JA 1LK5A 1YJ5A 2DWUA 3WLFA 1XTZA 4YHHB 3QFTA 1EKXA 2GZMA 3IDFA 4BAZA 3KQVA 4RGVA 2PEYA 1KWKA 4LBVA 4YP5A 5DEOA 3OFKA 3K1AB 1E79D 5AKXA 3ZR4B 3WYEA 6ABPA 2OA0A 1W1IA 2B5VA 2M1XA 4H3KB 2XSZA 1F2DA 3H16A 4IVRA 1IK4A 1RQ2A 1YK1A 2FZGA 2OV1A 3HNOA 1TRHA 2NSHA 4EPVA 4L4ZA 4E6PA 1F2UA 2R6ZA 4TXMA 1ULAA 2R4QA 3TQCA 3F8WA 3UWKA 3FSRA 3B2EA 4D57A 3KL4A 5EWLB 3I09A 3HA5A 3JWJA 3PFKA 4CLRA 3AI1A 5HKAA 5MFZA 4OQFA 1KJJA 3I4LA 1L4EA 3MB5A 4PBRA 4N40A 3ROEA 3ELDA 1I7LA 2ZI6A 4LDJA 2JEOA 1DAKA 1I51A 5F2KA 2L0XA 3R20A 1G9SA 5U4XA 3TKYA 3TXYA 1V26A 1E66A 1PV1A 2VT7A 4PX3A 4V2UA 4YJGA 2YUIA 3TSOA 4JGBA 4QPCA 3TBKA 3VJMA 1J8QA 5AW6A 3FPAA 1Y9DA 5LXTF 4EFNA 1TUGA 3UMVA 1G4HA 4LTNA 3OM0A 5CVJA 2I3BA 3DTTA 2RH8A 1W49A 2RK4A 4KE6A 4QQFA 1NUHA 3I9V6 2W2MA 1GHTA 1G8PA 3LJKA 3A70A 1YF3A 3CHYA 1R6UA 4NCKA 2HA2A 3V80A 1C7EA 3IJRA 2RHRA 4JFRA 3DCYA 5T4FA 3SEQA 2IUUA 3A3KA 2HRCA 3P9ZA 1Q7EA 1JIJA 2EG5A 3FTQA 1CFJA 1GAEO 1RI1A 1DFGA 3OQNA 5AKYA 2AOTA 3K4QA 5IYZA 4FM9A 1B6SA 1OAOC 5E7QA 1P7YA 2FOXA 1PFKA 1YASA 4MPDA 4ZT7A 1VG1A 4X1KB 3EXIA 1OXBB 3UF0A 1ZO8A 4CMIA 4RFLA 3PHHA 3VPXA 3G9ZA 4YV7A 2XCQA 1L9XA 1A9ZA 1JG6A 1JPNA 1KH2A 2GO7A 4FCCA 5HJ2A 4B2PA 4C7XA 4G5HA 4UUMA 3HEBA 1YA6A 1VYUA 1CSEE 2NO9A 4M86A 3TZBA 3Q98A 2QHXA 3VDRA 4AKIA 4QSHA 4R3UC 1RWMA 5I3CA 2ZAOA 3GOQA 1SQSA 1DCMA 3D5EA 3NHRA 1NUSA 4QDZA 4GYKA 4UARA 5J4LA 3EULA 3MG9A 3GWGA 4HJXA 3BHMA 5IJ0A 1A69A 5LZ5A 4A2WA 1QVAA 5LZ2A 4HXYA 3V2IA 1R10A 2DQYA 3EZ9A 4MV0A 1Q0UA 1R2QA 3JYOA 4LWQA 3W3AD 4LHYA 3CT4A 4HQ6A 2VQEB 2IE0A 3JARB 3PX7A 1YE5A 2ZJZA 1VHWA 2UV8A 4C5AA 2JFBA 1M34B 4MV9A 1IEVA 1BE8A 2IYUA 2IYVA 1L7QA 3CRVA 3HCDA 5EKUA 3NBMA 4JP3A 3URKA 1NV9A 1CV2A 5FO1A 1MB9A 1Q1NA 2QAIA 4WY8A 3FPCA 1FU8A 3GRZA 3VOAA 4XWWA 4LY6A 2P9ZA 3GJYA 4NOLA 4O0MA 4CGZA 4B87A 5CFRA 3SZRA 2PWPA 1BH2A 3KB8A 4J91A 2QG9A 3LUDA 3KLBA 3PUHA 4G0MA 4NJMB 2UYGA 5JG7A 1EPUA 4PRLA 4Y0AA 1U0FA 2WIBA 4D9C