1A97A

Xprtase from e. coli complexed with gmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
144
Chain Sequence
EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVAISSYDRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
publication title Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphoribosyltransferase
total genus 42
structure length 144
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a97A00
4RANA 2H06A 5KAMA 4LZOA 1XTVA 4P83A 4QYIA 2H08A 5ESWA 1DBRA 1G9TA 1QCDA 3N2LA 4LYGA 1PZMA 1BD4A 2H07A 4ZFNA 4KN6A 1ECCA 2C4KA 3LRTA 4QRIA 4WN3A 1WD5A 3DMPA 1FSGA 1R3UA 1GPH1 4RHUA 2EHJA 5E38A 1XZ8A 5JV5A 1W30A 1IBSA 2JI4A 4WMLA 1OPRA 1Y0BA 1J7JA 5BQPA 4JITA 1U9ZA 3NAGA 3EFHA 4M0KA 1HMPA 1TC2A 5KAPA 1QB7A 1QK4A 3KB8A 1AO0A 1UFRA 1OREA 1DQNA 1A95A 1VCHA 3HVUA 4QYIB 1P18A 1CJBA 1JLSA 1QK5A 5JSQA 1MZVA 2FXVA 1GRVA 1LH0A 2JKYA 4LZNA 1BD3A 3GGCA 3ACDA 1P4AA 1QK3A 3DEZA 4P82A 3MJDA 1OROA 5K51A 1G9SA 3H83A 4JLSA 1I14A 3ACCA 1QB8A 4LZAA 4F8EA 1ECJA 2AEEA 1NONA 1XTTA 2JBHA 2GEBA 1A97A 1I0LA 3G6WA 5BQOA 4Z1OA 1BZYA 2E55A 3QW4B 4S2UA 3S5JA 1P19A 1VDMA 4RACA 4M0PA 1ZN9A 1I0IA 4FYMA 4RQAA 1TC1A 3GEPA 1NULA 1Z7GA 1V9SA 4LYYA 4MB6A 3MBIA 1ZN8A 2P1ZA 4RABA 5ESXA 1ECFA 2PRYA 1QCCA 5BRNA 1P17A 1I13A 2IGBA 2DY0A 1D6NA 1O57A 3LPNA 1JLRA 4P80A 1DKUA 3O7MA 2XBUA 2HCRA 4PFQA 1L1RA 1L1QA 3OZGA 4RHXA 4RHYA 4X44A 3GGJA 5IPFA 4RHTA 1A98A 1ECGA 2VFAA 4RADA 1VSTA 4P81A 1YFZA 1ZN7A 4P86A 1XTUA 1G2PA 4M0UA 1ECBA 3OZFA 3M3HA 2JKZA 1A3CA 1STOA 1UPUA 1U9YA 4PAWA 4RAOA 3ACBA 4RQBA 4IJQA 5BSKA 2PS1A 5EUCA 4P3KA 4RAQA 3DAHA 4X45A 1O5OA 2PRZA 1XZNA 1A96A 5HIAA 1HGXA 3OHPA 2YZKA 2WNSA 4P84A 1UPFA 1I5EA 4OHCA 4RV4A 5HKLA 1DKRA 4TWBA 1A4XA 1G2QA 1DQPA 5IAOA
chains in the Genus database with same CATH superfamily
5FA5A 3M4JA 2BHRA 3PX2A 3X2EA 3C74A 1PNOA 3OX3A 3QI7A 3H11A 1QUEA 3O3OB 4L5IA 4R7GA 3QP9A 3Q1LA 1YK0A 1H4VB 3C45A 4JJ8A 1T9GR 4NTZA 3CZ9A 5AJTA 1B23P 2GARA 1WZIA 4Y18A 4ASUD 2Q5QA 1JBQA 5ADUS 3V1KA 2HRZA 1GCGA 3M0EA 3SMQA 4JQSA 5U4XA 1XZDA 1L1EA 2PS3A 2L42A 4G36A 3BIFA 4Q4AA 1NXXA 1C50A 4OLFA 4R16A 4RVCA 4FOTA 4CMIB 4RDXA 5L7TA 1JIXA 4ND8B 4JP3A 3HFSA 1KSGA 2WPNA 1BIFA 4CGYA 3KS9A 3P0EA 5EZ6B 1C1YA 1Z5ZA 3AX6A 4IFTA 4UDOA 2WI8A 4GXNA 4UEWA 3TSAA 2DLNA 4GX2A 3FDJA 4JOCA 3HBLA 5CT8A 4DAOA 1ENZA 3NNNA 3I4FA 4F6CA 3L8FA 1JQEA 4OL0A 1TJPB 5DN9A 1PGJA 4DA6A 2HMSA 5JSQA 1SZCA 1TQHA 4Z4IA 3G7UA 4BLTA 5HSGA 1DPGA 1I7DA 3SLKA 2Q1YA 3KU4A 4MGYR 3EVFA 4JI1B 4MCHA 2C5LA 1I5RA 2XRYA 4QU5A 4QREA 5DLPA 1KJQA 2CK3A 4YGYA 4UHHA 2YJZA 4P92A 3V4LA 4HV4A 1V8OA 1J21A 3UAYA 1DFHA 3F0TA 1CNEA 1S9HA 2B4TO 3JQCA 4IH9A 4MYCA 1E5XA 1MB3A 3GBSA 2Q45A 2XMZA 3K32A 3MCUA 1G8SA 2IUEA 3SFTA 3TR0A 3EIWA 3QU9A 2JH3A 2DPLA 2YXEA 4ZVNA 4KPYA 4O4HF 2ZT8A 4QD3A 3TSWA 5E4YA 3P9CA 3LP5A 5ALNA 4LZWA 1KIAA 4LHZA 2FZVA 3QHQA 4EGJA 2J41A 4L2IA 1U3WA 1RU3A 2JI9A 4P22A 3WYCA 4B32A 2ZIEA 1PVVA 3E5NA 1IEVA 1VP9A 2D3TA 1PEAA 2XZTA 3E9CA 4GMXA 1HK7A 2C4VA 4N39A 4RJJA 3V4VB 2V3CC 4EGSA 4EMBA 1VRCA 3GLRA 2FA9A 2QXYA 5TS3A 3RB8A 1Z56C 2R5FA 3N0XA 5F1KA 3KJQA 1SCBA 1IBKB 5EAIA 4Q00A 4E07A 1KPIA 2QK4A 2V5UA 2XTMA 3R5SA 5JMWA 2PZLA 3HBNA 1N6KA 2X3FA 3GPIA 4MW9A 1UIRA 3BA1A 4N18A 4RC9A 1KDVA 3PL1A 4HMQA 1YIOA 3YASA 5KOIA 4N7RA 4YQFA 5I3CA 1B0PA 1PP4A 3HV2A 3U7QB 3NIDB 3KM0A 3TLXA 3MPUA 4H3VA 1CB0A 1JSCA 2ZJFA 4TKUA 3WJ2A 2EGUA 2ZIGA 4QJ4A 4YH1A 4V1CB 4M1TA 4JC0A 2BISA 2RC6A 1Z08A 2E87A 4PTYA 1J2YA 3LHIA 3OQ1A 3I0ZA 4YECA 4KRXA 3ZWDA 4DJJA 1D6SA 2R7LA 3KK0A 3AO0B 3TZEA 4BV8A 3HKEA 4DCUA 3BMNB 5AJUA 4M9CA 4ISCA 4TLBA 5AVOA 4MIOA 1E2LA 1N8KA 1SKUA 1TEVA 4GFDA 4GOLD 4ADSG 1A2BA 3CPHA 3FOCA 3OT1A 4BVJA 1AUPA 5K3DA 1XEWX 2V74B 2W6NA 4RDCA 1A8IA 4KNWA 1IY1A 3GZNA 5JXJA 2I2AA 2QUHA 1OSNA 3NT2A 2V8BA 2R96A 4ALIA 4LXQA 3GBPA 4KJXA 2X22A 3H16A 4EKGA 2FGKA 4EUKA 1M2NA 2UAGA 3X1JA 4XDHA 4FMPA 4KWCA 3FRHA 4F4CA 4TYWA 1KZ1A 1LX7A 1ZBDA 4K86A 5JWRA 2ILVA 3KHKA 1W85B 2R00A 3ETGA 5I9LA 1NUUA 2B5OA 3CBGA 4DEXA 3T15A 3SKYA 3QVGB 1NW8A 2X76A 1W87A 3DVLA 3HCFA 4BRWA 3FNFA 4GXRA 4WX2B 3G0DA 3TL3A 1EGVB 1UDCA 4KSBA 3PFHA 2EHJA 2XIQA 4FWTA 3CLRD 3ZTYA 1KI7A 3DHVA 2Q27A 1JZQA 2VZEA 2WHPB 1U8TA 1OPRA 1RAHA 1W1UA 3KJGA 2V97A 3TVDA 5REQA 4CIAA 3V8QA 2IJGX 1Q7GA 3FLAA 1GTMA 4TYQA 1I51A 5FFFA 4IUDS 4LOHA 4EQZA 4TN5A 1GEGA 3GJ0A 4L4UA 4OUDB 4QVKA 3SYLA 1Z4IA 2E0IA 2PL5A 1Y3FE 3A2NA 3B6IA 2C9DA 2X8BA 3G3EA 1UBMS 3OQJA 4HS9A 4TKZA 3R9XB 1JDUA 2IITA 2Q4EA 2VSYA 5CK4A 3NG1A 2I6SA 4ER7A 2ZE6A 2L82A 3EVZA 3ZR4B 5TX7A 4F5EA 1IY0A 3H0CA 1UC5B 4OQNA 3WKEA 4B4UA 1Y6FA 5FI1B 5D7NA 3RT9A 1UP7A 5FF9A 5BXQC 1JT2A 3HVJA 3Q7PA 5K51A 2HU2A 1OJLA 2IWHA 4OMCA 3WGTA 4EL5A 4MCAA 3SIXA 3NYRA 3VTAA 3WYAA 1A77A 1GNQA 1UJ2A 2XAAA 4J7XA 1TECE 4J0EA 3KXKA 2VXCA 3R4VA 4UARA 4P93A 3BL5A 3VHLB 3AR4A 3F49S 2EHDA 5DBIA 1Q0HA 4NBNA 2A5FA 2P9TA 4B33A 5JS2A 2NUAA 4OFXA 4UMEA 4B84A 4QUGA 4BNVA 3QLEA 1SH7A 4D82A 3QFRA 5LJLA 3KSMA 4RPJA 1TYDE 1X80B 4UHCA 5G1OA 4BNHA 1J2TA 4IDQA 4JSTA 4R6XA 4RMJA 3DDUA 5JQGB 1S0UA 3CF4G 4BNZA 1QX4A 2DUJA 1L4UA 2CLKB 3NIFB 3RU3A 4ZCQA 3UTCA 2ZJ0A 3LCVB 3IXLA 3OSZA 3FYDA 4P4GA 3M6IA 5FO0A 3QHAA 1BC5A 3HA5A 2SKDA 4EFLA 3V1NA 1VHWA 4JP1A 1B74A 4D3ZA 1KOJA 1WDTA 3U16A 1U99A 2LIPA 4RVDA 4DR6B 1EFRA 1M6WA 3TZBA 3V8MA 4TV9A 4C3ZA 2CJPA 2W83A 2OXEA 5E1DA 2NXEA 4YRDA 4CT0A 5IJZA 1RWMA 4XZ3A 4QTXA 3T7DA 1EUCA 1HUQA 2H2HA 5JNSA 1K63A 1RQ7A 5CD9A 1EE9A 1VJRA 2DVMA 4LJ4A 1P8AA 1U7TA 3MWEA 4BX8A 2B0JA 4C0HA 4D42A 1Y8ZA 3K5HA 1E3DA 1H8EA 1Q3KA 4XXHA 4TS1A 1PFUA 3A28A 1R0ZA 4MW0A 3A2LA 4Z2YA 1EP2B 2P67A 5TE9A 1U2GC 4PO8A 1YIDA 3BKXA 2J0UB 4E1BA 3WGMA 4JI5B 3JSXA 3GJQA 3K1AA 1ESMA 2QGNA 4DHEA 3PQ5A 3QXJA 1AKVA 1P0QA 4LMRA 4RV4A 2R3SA 4UM5A 4X62B 3NBQA 1MV8A 5DSZA 1PIWA 4RD0A 3BHMA 2G4LA 4CLXA 4A26A 4FOSA 5JZOA 1FFXA 3SM9A 4IJ6A 1US8B 2EP5A 2JC3A 2VQ6A 4IMRA 4J16C 1VLZA 1HY3A 2BKXA 1JIJA 4H0FA 3IUNA 2CK3D 1SD1A 4RCYA 5KSOA 4Q3OA 5K9ZA 1G8PA 2RGNC 4HQLA 2H1RA 3AOGA 4K8RB 1ORDA 4WGGA 3L02A 1G21B 1NE2A 2IHJA 2IYZA 5K0GA 4BWGA 3PENA 5ITZA 1MC1A 5J3JA 5E4JA 3DC2A 3B1FA 3FR7A 1CDEA 4WESB 5D7BA 2J5XA 3D0RA 4EHIA 1SBCA 1EINA 2D74A 1WRBA 2I55A 2OENG 3EEQA 4OBWA 5CT5A 5BQFA 1GGKA 1XTPA 2I80A 4QQFA 3VZDA 3H3JA 1MENA 1ZIXA 4W7SA 1RRGA 1EDZA 4TS3A 2R6FA 5B30A 3A6PC 2IYXA 2C98A 2Q0QA 4Y6LA 2YKGA 3WLHA 4KXYA 2CE7A 2EU8A 4UNNA 2ES4A 5DPMA 4BAGA 4HF7A 3CMMA 1SXJC 3AEKA 3G8BA 5E9AA 4HG2A 1B8NA 1TNDA 2WK1A 4PQYA 3M3DA 5DU2A 1WDKA 4N5LA 4AWXA 4WXRA 4WBNA 4ECEA 3F71A 3OIDA 1U1EA 1ZD9A 4KAAA 5FBRB 3GUYA 3TH5A 1C8KA 4PSUA 1F5NA 3CR7A 2PUEA 3FLBA 2CHVA 2E4UA 2CDAA 3FY4A 4QICA 1NNI1 2Y68A 4Q4LA 4AYWA 2HSJA 1ZM7A 4PW0A 1RE1A 1TC1A 2QD1A 4XJSA 2JLAA 3AP1A 2OD9A 3CB4A 1E63A 5KNLA 2JFNA 4RM3A 4EBBA 1XZJA 1DJPA 4UPDA 4WACA 2COUA 2XV1A 3GMDA 3KUUA 3R77A 4U2FA 2D5BA 2CXSA 2NOAA 4HTAA 1VE5A 5FTJA 1B8VA 2XA1A 1KFBB 3PDUA 4HAZA 3A7DA 3B6ZA 3MG9A 4HP8A 4UTPA 3I9NA 5LU8A 5G0SA 5BSMA 3RS5A 3TX6A 4BO6A 2GWHA 1LZKA 1KVQA 1GWNA 3ICCA 4IHJB 4GF5A 4ZC8A 3K9GA 5LVAA 2Z08A 4FW9A 5JDIC 2NXJA 2VYNA 3OAAA 4IAOA 5CXSA 1P2UA 3EQ9A 3D31A 1Q74A 4M36A 5LYJF 2ZCVA 5DRTA 5SY9A 5J5AA 3ZKWB 3R41A 3TN7A 5EP4A 2Z56A 3CF0A 4GEKA 5DSXA 2CVHA 5EWMB 3BCUA 3H2GA 7ABPA 2RHCA 1I24A 2GETA 5EUCA 2HC9A 3HRKA 3S1LA 4RAQA 3SZMA 5F2NA 1WX1A 3O21A 2MYTA 4I5FA 5EPOA 3G13A 2XUZA 1OLXB 3LQYA 3E7XA 3QMMA 4B6PA 4IDGA 5FX2A 4F4HA 5MFPA 1ILEA 4QRHA 3O8RA 4NESA 4F91B 2IYRA 3DUFA 1P1IA 3PT5A 3DZFA 1NUSA 1VG0B 2O2DA 3SM3A 1XJ5A 2OGSA 4I55A 4J0FA 1EA5A 2G25A 4IO1A 2FOXA 3U1TA 4B09A 5J5CA 2J6IA 4ISBA 5FWXA 2OP1A 2JGLA 2Q5CA 4K9MA 2WJ4A 1P2VA 1RWPA 2HQSA 2C4MA 5LQNA 2C7RA 1XMQB 5EE9A 1HRKA 4Z7QB 4A2WA 3OFNA 3I34X 5KS2A 1YDWA 1KU0A 1P60A 4FLEA 1DEHA 1K2WA 3AY0A 3LPAA 4Z54A 3W6PA 1UINA 4K9PA 1W4AA 5KI6A 4KIUA 2AG6A 3C6QA 4BO0A 3DMGA 2G77B 2AN5A 5F3DA 2V7UA 3EGDB 5KOYA 2QNRA 3JVDA 4RHUA 3DL0A 1F8GA 2HF9A 2O5RA 4L85A 4MS3B 1DXQA 1WDLA 3OQVA 4CHTA 5E9JA 4RVFA 4M9RA 2XPCA 3V7NA 4QDKA 5A4MS 4LF9B 2HJSA 3I2KA 3ILSA 1IBCA 3EIOA 1I3MA 3SD7A 4JYMA 4B3GA 1H4TA 1F1BA 4EGAA 1GTSA 5EXXA 1BROA 1VYUA 3QBJA 1QE3A 4WFJA 4MH0R 1EWQA 3B1ZA 2EEZA 4WADA 1SB8A 3KXDA 1G63A 3COVA 2WA1A 3SVTA 4XM1A 3DZCA 1FSPA 4D4KA 1APBA 3ITEA 3D4OA 2I2DA 2GEVA 1GPDG 4R9NA 4ALLA 2QRMA 3IEMA 4X63A 4YTEA 2YQ5A 2P9YA 3RH0A 3TDKA 1UBTS 2WTEA 2IHYA 2XNDD 3CVJA 4QAJA 4E5VA 5CVDA 4KP7A 1CEEA 1QWOA 2EQAA 3Q9UA 3OIGA 4AWAA 1T8TA 3IIKA 3GJ3A 5BN4A 4BL5A 2A5YB 4XB6B 1N78A 4JXJA 2CE2X 3T5MA 4RTRA 3U40A 1EFRD 3ZTTA 4YMIA 1H6AA 3AG6A 4HEQA 3AEQB 1L1FA 3GLGE 1WNFA 4TLAA 3D1LA 4W6QA 4U5XA 1S8NA 4DEVA 4O4IA 2CLDX 1AKRA 1XV5A 2PZAA 3ONDA 5SZHB 2YVUA 4E21A 5C5EA 1O96A 3D59A 4EHDA 3OZEA 5G53C 4EW1A 4TVOA 1WEKA 3ZJTA 4ZODA 4IVPA 4XRGA 3QMVA 5J2UA 4FYXA 4K28A 3LOUA 4IGIA 3QU5A 4J0CA 3STWA 2Q5OA 3AETA 3AJ8A 3CZCA 1QANA 1FA9A 5YASA 1ZC3A 2VQFB 1UEIA 1EDEA 1RD4A 2DM6A 3DT9A 4N0MA 3DBLB 4B3JA 2D6FA 2F1HA 5JD4A 3SEQA 2REQA 4S12A 3PE4A 3C16C 1HDEA 1XX6A 2O3TA 2IV3A 1YRHA 3N2GB 5L3VA 1AC5A 1R4ZA 1RAGA 4B8YA 4D3SA 2QN9A 4K2AA 2ZK7A 2B4QA 4B3MB 3D8BA 3UEOA 4ZALA 2B21A 1V1RB 2H9YA 3H2ZA 4MGHA 1ENOA 1V37A 2SKEA 5AJVB 5A0TA 3ZHTA 1K6XA 2P0YA 1QFXA 2GWRA 1NX6A 1AKNA 2ZJZA 2ZU6A 4UU7A 3IB6A 1R9NA 4N48A 3GX1A 4UMVA 3ISTA 3OM9A 2QDXA 2VDQB 1J39A 2VTBB 4JMPA 2O3JA 3EZ6A 5DLEA 4JB8A 4CE6A 3CWZA 1W4BA 1Q77A 1JVNA 1DIOB 1CEYA 3T3OA 1X86B 2YWXA 4EHFA 4TZKA 1ODIA 1VZ2A 2DR0A 1PEDA 1YI0A 3DMYA 4RIHA 1UPAA 3SBDA 2V45A 3QPDA 3FWHA 4GR4A 4WNIA 3NH9A 2B82A 5FI5A 5FOXA 1VRWA 3P2JA 1UJNA 3QYAA 1EFTA 3JD2A 3KZXA 4MA5A 4MQEA 4V0OA 3UAWA 1DEAA 3IXQA 3ADPA 3QUCA 1K06A 4ENTA 2Y4NA 4PLWA 1CPYA 1VLHA 2F9MA 5FV7A 1E64A 1P5RA 2ORYA 4PZCA 5KSWB 3UBTA 3IPLA 3I53A 4AJPA 5CDTA 3L7OA 4ITUA 3S68A 2H2AA 4MGZR 3GWGA 1FMJA 4G5RA 3GIDA 4RMIA 4F1KA 4PG7A 4ILKA 4ZT3A 2H7VA 5A9RA 2E4ZA 3MGGA 3QPCA 1G4HA 1QV6A 4TUYF 1DUIA 5HCUA 2CXTA 4DMHA 3HO1A 3MS7A 1K7YA 1ZLXA 3UA3A 3CM0A 5D00A 3CW2A 3UK2A 1UQRA 2P9CA 4LKRA 5EKUA 4ZHQA 1ZYUA 3SC6A 3K72B 4W1SA 4WEOA 3LBYA 3K9HA 1XOIA 2POQX 3VKFA 2WZDA 1ZVQA 4LAFA 4OXXA 1EVLA 1M74A 3G9QA 4IGAA 1Q1ZA 4GGMX 4ZRMA 1PS9A 3B5EA 4X6UA 4QEKA 1E6CA 2GT1A 3D3WA 2WLTA 1DO2A 3B1YA 3EZ7A 5FWAA 1AHNA 1OROA 3ZH2A 4AMBA 1BE1A 2VF8A 4Y6OA 4HSGA 5HDBB 1GQ2A 2PA3A 2VYVA 4XLLA 3L7CA 4IFBA 1BVHA 3VR5A 3TVYA 1VA5A 1YL5A 4IH4A 2WG0A 4RD1A 2QGFA 2FDCA 1T5SA 4F8EA 3OPYI 1JKIA 1BKSB 2CKMA 2WJZB 2G6BA 1YZNA 4DCTA 2AOVA 4YV0A 5FD8A 1MV5A 2X58A 4HNAB 2HHLA 1MEEA 4Q24A 4QHTA 5L7YA 4AJ1A 3HVIA 2DQZA 3NKVA 2J4CA 4JHLA 4D8WA 4NV0A 4TLMB 4OO3A 2YMPA 3VR5H 5B1IA 5JPIA 3GNQA 2O8VA 3K0KA 3N5CA 4GKKB 1YZVA 3JZMA 1DJOA 1N6OA 2BCGY 1TVMA 2WJGA 3C8HA 3A9UA 3CNOA 3E84A 4NFSA 4PBSA 4YHBA 3O1HB 3E22A 4Y1GA 1CRQA 2YZ7A 2GFHA 5AUQA 4D92A 1IQUA 1DC5A 3B89A 3CW8X 5LQRA 1F6WA 3DO8A 3LC0A 1FFDA 4QARA 3HFGA 1FJXA 1BJRE 5I7RA 3TLYA 4A36A 3OFND 1GN8A 3KAJA 1ODFA 2CXNA 4CV1A 3DHWC 3EY9A 2W8BA 1ZCZA 3CFYA 4PGHA 4MYRA 1VGRA 2HJWA 3VPFA 5CDYA 2O8FB 5AVTA 1NYLA 1MZPA 3K0AB 2YJ6A 2P35A 1ODCA 2QOEA 4N5MA 2B0CA 4JVLA 2VSXA 3DLBA 2WD7B 2BGMA 2NYVA 1ZOOA 3KOXA 1EX6A 1PFQA 1AXEA 4QDZA 4UVDA 4ABYA 3MVEA 4RTKA 3R5KA 5I7FA 2R1TA 1BYIA 1P44A 1IRIA 1I7LA 1SOWA 3IRVA 2B92A 2NU9B 3TK1A 3PEEA 1XSEA 2QMUA 2GN6A 2J31A 4IQ8A 2LRHA 4XAQA 4R1LA 3FI0A 5DSTA 4ZKDA 3EXAA 3OHPA 1YZTA 5MF6A 3U13A 4LOIA 4WQMA 2PCLA 2ZBPA 2QRVA 1KJNA 1XHLA 2GR9A 4MWBA 1OX4B 2CVQA 3CRVA 3W2HA 3ZS9A 4AMGA 4UU0A 3BREA 4XR9A 4C0XA 3KTAB 2I3BA 4IUYA 3KJXA 1K7FB 3H18A 3SFZA 4OGFA 5GJCA 2C0CA 4EFKA 2PQMA 4DEYA 3ADCA 4HH4A 1M1YA 3ZDDA 4E5KA 3C3DA 1OFUX 4QOHA 4WN3A 4EJ2A 1A04A 1JIVA 2NNLD 1T35A 3KYCA 3FVVA 4BKPA 4D5EA 1CY4A 2YMQA 4LVNA 1BXGA 2CBZA 2BGJA 1G3MA 2ANBA 1BE0A 2FU5C 3HY4A 4QPCA 3T94A 3E4DA 2Z2JA 3S29A 4K5QA 1GFWA 5PNTA 2JFOA 1IUNA 3PE6A 5HF6A 1Q17A 3U4IA 4R40A 4UM9B 5ES4B 2I2BA 4B4KA 1A72A 4CEIA 5DM1A 1QFSA 2AR0A 3C7KA 1A5BB 1PUJA 5M5BA 3FMIA 4JJFA 4MK4A 1N2CA 3A9RA 3JQDA 4L08A 2JFWA 2IUUA 2R751 4GD3Q 3KVYA 5K6RA 4KR0A 3GCWA 3T5BA 3GJTA 2EX1A 1WZNA 1CJBA 1M2OA 3V7FA 4IQ4A 2CMKA 1ABFA 2C20A 1H66A 3ETCA 3HHEA 1SGWA 4M21A 4KR9A 4BVEA 2VOJA 2QW0X 3AHDA 3GD7A 3O2SB 2GTHA 3OFVA 3R5FA 3G5UA 1SC6A 2E4YA 2R7AA 4FSHA 4MARA 2DG2A 3AH8A 2KBEA 1WPGA 3AVUA 1PU2A 3R7DA 3STUA 2A94A 1R0KA 2CB0A 5AI4A 5AHRA 1INLA 4IDBA 4L51A 3VAYA 4D9HA 3T9EA 1J20A 5ER6A 1VSUA 1X1BA 2XYRA 3B3JA 3GDOA 5HJ7A 1NVXQ 4IDHA 3PL5A 2OCKA 4QPPA 1A50B 3UT0A 3CONA 4REOA 2P2DA 2QG6A 2C4NA 2ZRDA 4YCCA 1AK1A 1ULUA 2A0UA 3ROZA 2WIBA 4PRYA 4N6NA 2J3MA 3WIEA 5AW4A 3V7YA 3KKPA 5FADA 4DTIA 1KEVA 2ZYHA 1VPLA 4D74A 3E3OA 1UKZA 2WMOB 4C0JA 3PUXA 5JECA 1N5DA 1FXSA 2D13A 2F67A 3DVSX 4QYTA 2WSIA 1CJCA 1A5SB 3BSWA 3DKIA 3N0WA 4MKIA 4DKXA 1U2GA 3NP9A 1PTKA 2J6HA 5P21A 4FYVA 4J75A 3D54D 4Q1DA 5BR7A 1A5TA 3M4ZA 1VLJA 4EFDA 3M5PA 1G0NA 3WMXA 4KACA 4C9BA 4YDSA 3I28A 5KPJA 1NPDA 4OB6A 1C9EA 3M70A 1HA3A 5C4IA 1G5IA 2H4JA 1CR6A 1XTJA 1KNQA 1BH6A 1LPSA 2NO4A 2VL7A 3HUDA 4JBGA 2AFHB 4PS0A 3W2TA 4CF5A 1Z5GA 3OLYA 4CNBA 3KR2A 2VTVA 4J16A 5C7LO 3I04M 4RLHA 1UM8A 1UMDB 2Y3IA 1WHSA 4MPJA 1KFJB 1UPCA 4TKVB 4H60A 1MRZA 1RAFA 2YNMA 3HCNA 4EBFA 3TFOA 4ZQIA 4MW6A 1QHNA 1O54A 1V9LA 1QVZA 5T6MA 3BH0A 4R3NA 4U2EA 1E5LA 5D1NA 5EYPB 3RI3A 1HBJA 2MT9A 4BLVA 4OF4A 2FPWA 2ZEJA 3AKYA 2Z1MA 4KVZA 5LOVF 5AI9A 2ZXEA 3DGEC 4KVAA 1ZH4A 3AY3A 3GDHA 3KOZA 2B36A 2C0QA 2FRVA 3IBGA 4RMGA 1Z82A 2F3QA 2HK6A 4BXOB 1KJ9A 1DFIA 1NBWB 3HY6A 1CS0A 4HOYA 4LRXA 5EFZA 1HDRA 2QAJA 5CTAA 3DP7A 4J4TA 1H93A 1RFLA 3L8GA 3F2IA 4E4TA 1ZO8A 4HRVA 4PX3A 1YUMA 5KNDH 4MNTA 5TPWB 4D6PA 5B4TA 3WNVA 4OLBA 1QH8B 1JYEA 1C8VB 1IIBA 3GJSA 1A1SA 1E7WA 1KO7A 3GEDA 3AQIA 1IBSA 3DWGA 3QA3E 1UBOS 5D87A 1SXJA 3BCSA 3RCBA 5CB4B 1N5IA 1SWVA 3BHIA 2H4FA 4GZ6A 4JXXA 3H5LA 3L0CA 2JFXA 1VM6A 1GA4A 1ZMRA 3JASA 1FVHA 3WG9A 3LWNA 4DYDA 1U3TA 1XAHA 5BP7A 4BJ3A 2BP7B 2PWZA 2OFFA 9LDBA 3SJUA 3NHMA 3PWTA 4DAEA 2EJWA 2WFLB 3SEZA 1BU8A 3OLCX 3H5RA 3CUWA 3X43A 1RZRD 4C2BA 1SQ6A 5A9SB 1UADA 1PZHA 2EFCB 4YROA 5DX8A 4ZEVA 2F8TA 1HT2E 4JR1A 4JLVA 4J43A 3T1NA 4Y8VA 4OSPA 2FUCA 4YAGA 1E1LA 3ORQA 4S1WA 3ZLTA 3CZ5A 2Z58A 2W6PA 5DHAA 5A06A 3MF4A 2R85A 1G7CA 2ZANA 1F7UA 3IUYA 3SSAA 3DKRA 2YINC 2PGJA 1UAGA 1X13A 2R6DA 3IIJA 4L0MA 4V2IA 3UK7A 1DAEA 1E5QA 1GYRA 3QUSA 4BASA 1YDEA 4CFSA 1QVAA 4H7HA 1RHKA 4RQAA 2EZ8A 4G63A 2IHKA 1MUUA 4I1SA 3I72A 4C1BA 2JJ1A 4GMDA 1OVGA 2ZSHA 4ZMSA 2C07A 4TTPA 2VPQA 1JGTA 3SXPA 1CRWG 2G0TA 4BB6A 2BHNA 4DQVA 5IDVA 1CY7A 3KQPA 1LNSA 4FCTA 3SYNA 4F5ZA 3E7PA 3AU9A 4TXHA 4X7BA 3S2ZA 2XMBA 1E2EA 3WB1A 3WLFA 4FQ5A 2HSZA 4V2UA 3HZOA 1YHZA 3WDMA 4B3TB 1G8KA 4CHGA 1ZMTA 4RHXA 2I99A 2XWSA 3AUTA 2OQVA 1NP7A 4F11A 5KTKA 1N8TA 2DPYA 2YBEA 5HP4A 1N5JA 2ZTSA 4CW7A 4Q5IA 5DIZA 3ROGA 4DW8A 3BGWA 4FM9A 4OHMA 2Y1DA 1P1JA 4GSLA 4UTRA 2QRJA 5ALPA 1EM8B 2HNBA 4FMDF 3N7AA 3HUTA 3HXPA 4RZSA 4HDQB 2CV0A 2BKVA 3CZRA 4YRSA 2O1WA 3EDRA 3AJ9A 2OGUA 1TQ4A 4Q9AA 4PZAA 1GNVA 5KMGB 4L5YA 4C78A 2FSIA 4JYCA 3OPVA 2YY6A 5JWHA 1W73A 1SC9A 3F4BA 1QP8A 3AESB 3EIUA 2GB4A 3NGMA 3DOFA 2ZJ7A 3SYRA 5HIAA 3B82A 5I9NA 3D9QX 3SVLA 4DR7B 3GJ7A 2NSDA 2HT1A 3VNUA 2VZ9A 1ANKA 3GROA 3SK0A 3HYSA 1TQ8A 2C1XA 4BFZA 4HNVA 1EIZA 4WNYA 1BG6A 4KO8A 4LEIA 4PG6A 3IEXA 4G0QA 3GA0A 2VUIB 4NV1A 3RUFA 3U7IA 1XVAA 3H97A 3MT0A 3MMXA 4GI3A 1UK6A 2A0WA 4DR4B 4JSRA 2NYUA 1SUSA 5HF8A 3ZNQA 5KHOC 1HQCA 5JNTA 4J1SA 2AKYA 2JAUA 3OECA 3FOZA 2I91A 1DARA 2CHEA 4FW8A 4NYMQ 1XEXB 5COBA 4JLNA 4YDQA 1AKQA 1SXQA 3WL6A 1Z5UA 4E70A 3DV0A 2HU5A 4K88A 1WIWA 5JAZA 3C98A 4E5PA 4YUZA 5CHYA 1M34E 3S0JA 2D2XA 1D07A 2PN1A 4HB4A 3PGMA 3SSMA 5SZKB 1YSCA 1G5HA 1XMIA 3MJRA 2EX4A 5TPZA 4AJIA 4XWOA 1DRKA 3O8BA 3FPFA 5LQUA 1NVTA 3RHSA 4NDZA 3LDUA 4D4GA 4WJLA 1KQ3A 1R00A 4OUDA 1UM9A 4BNNA 3PGA1 4ZYYA 1M0WA 1R88A 4RELA 1Z35A 1T34A 4U0KA 3ICQB 2RKBA 1QK5A 2QT1A 4F5DA 3BAFA 1B6TA 2XF2A 3HI6A 3FRJA 3NTOA 5H68A 3DBVO 4LZNA 2QP3A 3HWWA 5DNWA 2HA0A 3U7JA 2NV0A 1QTNA 4NPAA 1LDMA 1KTIA 1M1ZA 4LTNA 2WTBA 3IE2A 1BH2A 3DLAA 6NULA 2JIPA 4QYMA 721PA 4LZAA 2IVZA 3ZD9A 5IF9A 2VUSA 3UF0A 1M7BA 4G8CA 1L7EA 2PXHA 3F6SA 2OGWA 2Z5FA 1WF6A 2C2XA 3ZGOA 1G8MA 1YZGA 1F2VA 1KHHA 3EDYA 1GL7A 4O1IA 1XXHA 3ORHA 2GD6A 5IARA 1ZK2A 3LCUA 2DE0X 1GL6A 4M7PA 3A4LA 4LYYA 5L40A 5PGMA 1MB2A 4QJ5A 4ZAYA 3GL9A 5IYZB 1RM4A 2E4AA 4RA9A 2WHYA 2C61A 3COJA 5KX5F 2JLZA 3LK7A 1D1PA 3T61A 1X1DA 4IDNA 4MWSA 2DYKA 5ALFA 3HQ4O 2BL4A 5DTQA 1QXSA 1B6GA 3ZPXA 3K70C 2PXCA 3DKVA 1CU1A 3CRMA 3ZBTA 1RYBA 1ISGA 5GOTA 4DSTA 5JTTA 5MN5A 5KDLA 1FNCA 2QD5A 4CL0A 1BFKA 4ZVKA 3VJRA 4A0FA 4R98A 2R4TA 4E5MA 4ND1A 5A2QA 1RRMA 4NG5A 1NVEA 1A2KC 1E1QA 2I2CA 2OAP1 3TW6A 3W4JA 4V03A 2J45A 3Q3GE 2AEMA 4DV4B 2MJLA 1GQRA 2C83A 1Q21A 1RRPA 3A3PA 3NBMA 4N5IX 5EIHA 5TEWA 4X0EA 3RIHA 4AUKA 1KK1A 1IHUA 4P3KA 5JQGF 2ZYGA 4O1HA 1SXJD 4S1OA 4OIFA 5F33A 2VDOB 1GZ3A 1EVJA 1T9DA 3DZBA 3KDSE 4JR0A 3CKLA 1NQOA 4FMCF 2YOHA 4Y0AA 4BC1A 1J00A 3MINA 4R31A 2BI4A 4R8MA 3I9FA 5JAHA 4JI0B 1X19A 2ZUTA 2JGAA 2QB5A 4RYDA 4W5JA 4G84A 3F6RA 1NJ6A 3VSEA 5IJ9B 2SKCA 621PA 5EJ9A 2CVPA 2W6OA 5EPEA 2KYRA 5E2BA 3SC4A 3Q0EA 3UHJA 3WJ1A 4ER6A 1GU1A 4HQOA 4TVBA 3VZQA 4Q7QA 1G9TA 2QQ0A 5LA6B 5T5QA 3MT7A 4OJQA 1US8A 4M1SA 1FQOA 2ZRHA 2XVMA 3OJEA 3ZWNA 2WILA 3FCUB 4TMTA 2PSFA 2TMYA 3GYGA 1KMHB 4DPKA 4H7JA 4ZO9A 2WJAA 5K20A 4A73A 4A9AA 4LBYA 2G1AA 4ZTUB 1ZQ1A 3WLPA 3SHFA 1CYDA 4CEJA 1FDOA 3QG1A 3QVJA 3U3MA 1GSHA 4FJ1A 1QLHA 2VP5A 1JBKA 4BB5A 3F7TA 1NASA 2PEYA 3KKKA 1I2DA 4IO0A 3OX2A 3H6KA 4NCXA 2F3PA 4D6XA 5AM2A 2PMBA 4EEZA 2QAGB 4JI3B 1ETUA 4BX0A 1YE5A 3ZXUB 2JJ1D 4HUQB 4N3BA 3TXXA 3AY7A 4JNKA 4KXMA 4JC8A 3ECCA 4J7UA 4M8NE 4NBKA 5BV2P 3HB0A 3KQTA 4ZT5A 1FFSA 2R84A 4TXJA 4EI9A 5BV8A 5EHZA 3W5BA 1G20B 5GIOE 1N2BA 4UEJA 4B3BA 5D3ZA 3T4XA 4LF7B 2AZXA 2JKYA 2QTFA 4DMGA 3K6SA 3S2IA 2HCTA 4QQRA 1YTLA 3HY3A 3K0CC 3WTBA 4EY8A 3ILHA 4ZK2A 5GZ3A 1LQ2A 1RXVA 3I2JA 1V4BA 4WZ6A 3R40A 1R6UA 5HGXA 3MCAA 2HFKA 3PFGA 4KYUA 5JZMA 1X74A 1MOZA 4I4TF 1E9FA 4YAUA 3A6LA 1CP2A 1EFDN 1A97A 4PONA 3ZW7A 3JD0A 5F9MA 5IDWA 1BN6A 4FGJA 1SUIA 5HFJA 1XLUA 2CCKA 1HZJA 3LKBA 4EA6A 5AHKA 1XI2A 1YNOA 2O19A 3NVMB 4MR9A 1MJGA 4IQGA 4WNAB 3SJBA 1O77A 2IYUA 1GCAA 1YU9A 1KFKB 3QEKA 2B1GA 1THTA 1ZS9A 2UZ1B 3V1LA 4ZA2A 4B80A 3FTDA 3ST7A 3QX3A 4PZLA 2OCPA 4W9RA 1UWVA 2A35A 2P7IA 3IV9A 5CNKA 3RTCA 3PA6A 4NECA 5EQDA 1Z8HA 2YJGA 3AB8A 3IL2A 2PSJA 4DYHA 4CMJA 6REQB 4ZV9A 1SUAA 3G79A 4HR7A 2IF0A 1NF8A 4M0LA 2UVPA 2ZM5A 2HCJB 3H2KA 3W6ZA 1I94B 4N0DA 2ZYUX 2CBGA 3AOEC 3LTEA 4IHJA 4QEDA 5HQJA 3GWZA 2C2GA 4WN9B 4DY6A 2WYHA 3HU3A 3M6MD 3ONFA 2O9JA 4DS3A 2FMTA 4FDVA 3VVBA 1HO3A 5CIQA 1HSOA 4J0DA 5EWMA 4Q9IA 1VIDA 1CR2A 2BFWA 4RHEA 3SDSA 1BDBA 1J97A 3ZHYA 1QNLA 4N65A 1LXCA 3EG9B 3P20A 2C4WA 4Q1VA 4WGFA 4D2IA 1NDHA 2QM0A 3BMCB 2I4LA 3BRQA 1RQ2A 2JFBA 5TGZA 5TPZD 3I83A 5BT9A 2JG3A 4TTAA 3IAM1 3JZDA 3THRA 1XPJA 2FQXA 1CR1A 2NZ2A 4FZJA 4MQFA 4K0KB 3LBIA 4GC9A 4OHCA 4JJGA 5ICFA 3LPMA 4YJ3A 3AJEA 4HFMA 4NWIA 5EE3A 1PYOA 2C9YA 2XUJA 1EFUA 1NM5A 3FG9A 3GQVA 4FXPA 3H2JA 3AJDA 3L0YA 3EUAA 4LI3X 3QBDA 4EHKA 1PZNA 4XYBA 3OWXA 2AKAB 1GPAA 3W3AD 5FAKA 4ED9A 5BSTA 2BT4A 1CZOA 1RI1A 3P96A 4HRYA 4OP1A 4EJSB 3HJRA 1I0ZA 2H52A 4UE2A 521PA 4YJ2F 1L6IA 2HRBA 5DHQA 2BH2A 1J49A 2J48A 5D6OA 3KXLA 3OCZA 3W9BA 1KH1A 3IAAA 5H3LA 2PUCA 4JEMA 2Z3ZA 4S1PA 4IH1A 5LUBA 1ZK4A 1HDGO 5F77A 4PZYA 1MAAA 2PO7A 2DY1A 2D62A 3FNEA 1A7KA 5I9IA 3ANNA 1UMBB 4HYQA 3EXIA 4J3NA 5BN3B 4JUAA 1LB1B 4L72A 4HATA 4ESEA 3ZU4A 4BQNA 7YASA 2OP0A 2FFBA 3UUFA 3O03A 1J8VA 2E5LB 1EDDA 1Q22A 1IAVA 1DCMA 4ZZ0A 2Y2UA 4BRUA 3PUYA 5L3SB 1LH0A 2XCUA 4XIJA 4IVRA 4BVKA 3IO5A 4FGWA 4AY4A 5BN5A 4OIMA 2LCFA 3GBVA 1R64A 3AF1A 1MKYA 4BCBA 1EP9A 5FQOA 2BEWB 2I1LA 2B2CA 3HRIA 2ATVA 2HMTA 3FYUB 3A4NA 4A0QA 4EITA 2YCLA 2OAQ1 5HHTA 1X87A 1O6ZA 4B6SA 2VHEA 2R8RA 1E1QD 1I2AA 3AEYA 3WI7A 1O87A 2NQ2C 4G37A 1NMXA 3K5WA 1XWFA 1VPVA 4CM8A 5TRTA 1JAHA 3HCWA 5T7BA 4DJDC 4Y9SA 1ECFA 2VSFA 2Y92A 4E22A 4KL8S 4V24A 4MV4A 1HPLA 4FB5A 4NAUA 4F06A 5CJ2A 1U0OC 4QIHA 3O2QB 4Q1CA 1OTYA 1JLRA 1U2EA 3CH6A 4JGGA 5C31A 1M2VB 1UEJA 1GOTA 1PJZA 1SVWA 1MH9A 3N2NA 1QQ7A 2YY5A 3IGFA 2DBRA 1HG1A 4BFLA 1TA9A 3AEUB 2DQ4A 5ALEA 3N2GA 5DO9A 2GS9A 1DCTA 4OQZA 2P68A 2WDZA 1W8IA 5CFMA 3E2MA 3GEGA 4RHCA 1BXKA 3QVTA 1TA4A 1TFUA 1WKCA 4J7AA 4NE2A 2IS2A 1VB3A 2YJ5A 4H6VA 1SZDA 3VGPA 4PM4A 1QYRA 4IXMA 4QNNA 1QP4A 3CGWA 3U7GA 1RAAA 1C81A 4CDNA 3PKIA 1ESCA 4AD8A 1SMKA 3K9WA 4G1VA 4MHOA 5A6VA 1OLSA 4XR4A 1FBNA 1HOTA 1NSTA 1KA9H 1XTBA 2ZKIA 3OQBA 4FKZA 4ENQA 1Q11A 2R97A 2GHIA 1O97C 4LJ7A 3E5MA 2H57A 2J3JA 4J7CA 3DMFA 1B93A 1XG5A 2JBWA 5C32A 2WNSA 2KI5A 1PJTA 4I3HA 4DNFA 4PO1A 1EE2A 1N3BA 2XMPA 1XEAA 4HWKA 4L4SA 3U7RA 1MEJA 5ALVA 4FPXA 5B4VA 3B7GA 1KYWA 2ERXA 2OWEA 2V4MA 2ZJYA 3NHBA 3Q4GA 2X6QA 3PHHA 4LMBA 3A14A 3ZQJA 4YWJA 1D0IA 1SAYA 2AMFA 3DAFA 3ZU5A 1MIOB 3NOVA 3PU6A 5E3HA 3AVXA 3L4SO 1R16A 2OUKA 5HJ2A 2FE1A 1MH1A 4X1OA 1WD5A 1HEUA 4B81A 4PXSA 2X1MA 4CV2A 2CSXA 4LMPA 5CW1A 3OURA 4YRZA 4XFKA 5AW9A 2JLRA 1PGPA 1WMEA 2NZUG 3HUUA 1RBQA 2ORIA 1J6UA 2CXPA 3DTTA 1FFAA 1SU4A 4MKXA 5DYYA 4II7A 4JJ7A 2DU8A 1KMCA 2FZKA 3PB3A 4OGKA 1L5GB 5JCXA 2R6AA 3I5XA 1K6MA 4X3CA 1XQVA 2BFEB 2JANA 1W76A 3LUJA 4KQEA 2JGRA 3C6KA 4JT4A 5JNWA 2XJ4A 3W5CA 3B2NA 1C2YA 3RRMA 4EVSA 3TLGA 3EVCA 2AFIE 1NZJA 4L57A 1JBEA 1GQFA 4QYIB 4UQLA 3M49A 1QX3A 1KAQA 3HCBA 1ZUD1 2FXVA 3N2IA 1U0RA 3R3HA 4DJFC 4UOQA 1KDRA 2DFKB 4N4AA 3ABOB 3Q5EA 1XNGA 3G5AA 3IP7A 2G09A 3NYQA 5AW0A 2P1RA 2JJ2A 3LUHA 4PYQA 5ALXA 3ZWVA 2HA7A 4JZKA 2R1ZA 3ZDAA 2RARA 2JGNA 4HO1X 4Q9LA 1NN0A 1WZCA 3PPVA 1BS2A 4JAVC 4YMHA 4P4NA 1CR0A 1E79D 1XTTA 1QZXA 4KMOA 4ZI5A 4C6SA 4QJ3A 3G02A 2DB3A 4Z4HA 2FZ5A 2PGNA 2FWPA 1F12A 3C7CB 1I0IA 3UMCA 1EVZA 1OU0A 4DCGA 5C37A 2A7XA 1EFPB 5DWVA 2RG1A 1CUAA 4MYHA 5EHXA 2QX9A 1XAIA 1MB9A 5CDUA 2FK8A 3VFDA 4ZTBA 4FSXA 3RYIB 1KOGA 2AMYA 3BKWA 5KQSA 1PT8A 5L6MB 2BRUA 3B2QA 3HP1A 2ZBFA 3I2HA 4J0IA 2VJOA 4BNKA 4DIOA 1WE2A 3V55A 3Q3EA 5CLHA 3AM5A 1W7AA 4KH1A 3Q3JB 4C6TB 1TZMA 2IE0A 3HNOA 3C8UA 1X7WB 1N25A 2V6FA 4IWYA 1CY2A 1TJNA 2FF5A 3ET4A 2F9FA 3EVGA 4QDXA 1WTAA 3AR6A 4M3NA 5KQRA 1UBGA 4XFDA 5E7MA 2WWXA 3FSGA 3L8MA 5AT1A 4INAA 4FR5A 2Y1GA 1TE2A 4C03A 3FYTA 1ADCA 4ARVA 3E9RA 1JL3A 3HO8A 4FILA 1ID1A 5B6PA 2YS6A 2JAOA 2LIVA 2R68A 3R76A 3RTGA 3TTWA 4YIHA 1SU8A 1U4NA 4P1ZA 1HORA 1TL7C 2F62A 5JASA 1HFJA 4XW2A 5GADl 1BS1A 1IPHA 1LS1A 2GBLC 5EJEA 4QPDA 3I32A 3QE3A 5E0KB 2EYUA 1RYMA 3LUGA 1W88A 3JWEA 1ORRA 3PWKA 2NXNA 4IG9A 4ENPA 4GO1A 1KDOA 3VX4A 5CH5A 2YV5A 5E8RA 5ERGB 1NJGA 4LA4A 1KHTA 4HCJA 3QPAA 1KY4A 4C4ZA 1FFGA 4FNAA 3K2IA 2W6JA 4MIKA 4OHXA 2ZULA 5JRZA 1ULZA 3RKRA 3MHTA 1WZ2A 4YUXA 3ZC3A 2F1JA 3VYTB 3KE8A 3KELA 3NEYA 3WQQA 3T6KA 5AVSA 3PFIA 1NXVA 1AUQA 4Q7LA 1P31A 2CF5A 4NPHA 1SBQA 4HZUB 1RJEA 1R6VA 4GZ5A 2ZB8A 4KHZA 5CURA 1WPXA 4DCNA 1MORA 3O8QA 4EO9A 3B5JA 5J9FA 4F12A 1NDQA 2UUCB 5HJ5A 3R6DA 2XWJI 3JYHA 4OHZA 3M82A 3QFTA 5NULA 3L07A 3OM8A 4AF8A 4A91A 3E0QA 3WL8A 4BQRA 2PE5A 4FJ0A 2IKQA 3GT4A 4NF2A 3B1JA 1D6MA 1FRZA 5E9WA 2H65A 1E2IA 4B75A 1RI3A 2CLOB 2C3YA 3G2OA 2Z4RA 2DUNA 3DMTA 4DJAA 2OFPA 4TSRA 4DUZB 4Q34A 1T2FA 1RWWA 5FFNA 3M7IA 4XVHA 3ER9A 3HU1A 3S40A 1MF7A 1FX0B 2A4KA 4I4LA 1L7BA 3BB4A 3JARB 5EVJA 3EQ7A 4FJ2A 4IDPA 1F9EA 1DAOA 1NVKA 4LGVA 4MUYA 1G98A 4A0SA 4S1VA 1YDGA 3QVXA 4ZQCB 3TTTA 5GGYA 5BSFA 4K6OA 4RTPA 1D2RA 4OQMA 1XVVA 1PZGA 2A9VA 1XTIA 2YRFA 3RYFB 1AO3A 3VA7A 4IUCS 2I4TA 1HDZA 4PCAA 4KXNA 4XPIB 2EXXA 2FLWA 2WWGA 3FPHA 4UXJA 1EWTA 2EKDA 4IILA 4P4UA 2D4AA 2XB6A 3ZDEA 2WIFA 4G6ZA 4P2GA 4ZDIA 4JYZA 2DPGA 3KFVA 4PY2A 3UV3A 1L4KA 2E55A 3QVSA 4UDXX 2VHQA 3NDRA 3UXHA 3K0FB 4DWJA 1DG9A 3HB4X 4RZ3A 1SBTA 1IONA 3P2YA 1MAUA 1Z7GA 2Z1DA 5AK4A 4D26A 1SKYB 1C1XA 1BWSA 4NVRA 4YUAA 2XQKA 4PLTA 1Z7WA 1T8YA 2DHDA 2K7FA 1K5HA 1K7XB 3TNYA 1SBYA 2CT8A 2WNHA 2IGBA 4V3BA 3KE9A 5IP5A 1ZUNA 1J8DA 1I9CA 4JVMA 4RY2A 3JRNA 4BX9A 5C5DA 3AIKA 3MTBA 1VMEA 3GLTA 2H11A 1DKUA 1WA5A 3UOWA 2OC4A 4CU2A 3UJ7A 3HGQA 1KS9A 1U5BB 1H2ZA 3J7AC 1FJ2A 3L6DA 1C7FA 1EK6A 1FVOA 2BM1A 2YYYA 3G8YA 3DBRB 1U3FA 1Z0JA 3IMKA 1NJSA 4W5QA 4Y0VA 2VWGA 3D4IA 2QYHA 1ODJA 2PXAA 1MA0A 3KU1A 1GFSA 2CMDA 3IR6A 5IDYA 5EN4A 5G0VA 1LDYA 3BXPA 1O94C 1T8WA 1UBRS 3B6KA 2AS0A 2YXBA 1R0SA 3FBGA 3GZ4A 1ZKMA 3VJLA 2FKAA 4N0PA 4P5PA 5THQA 1A9XB 3SXJA 4F7WA 4YCNA 2MMCA 3OT4A 1CFJA 3C5HA 3MD0A 1CVLA 1Q0PA 5H83A 4TKVA 5K05A 3ZCRA 2HW8A 4TQUS 1JKJA 3MWLA 2H48A 3OP4A 3MPOA 5B6JA 1O6BA 2G80A 3RHTA 1GG5A 4L02A 3DA8A 2I4IA 3AR3A 4P84A 5EYPA 5EZYB 3CX3A 5B2FA 1NYRA 1PR5A 2K4MA 2XTZA 4FGSA 1L4MA 2Q3FA 1Q83A 4CKWB 1E1MA 5U1PA 1G17A 4P0QB 5E0OA 3AHFA 3D64A 3ADOA 2AJTA 3EY4A 3H5WA 2Q1SA 3K8OE 3NBZC 1E3JA 4GIBA 1EVQA 3AV3A 4OK3A 2DT8A 3WIBA 2IPMA 5FCDA 1KI2A 4G89A 2G9VA 1OYVA 2J33A 3AUSA 3D8TA 5CFRA 1K6IA 4TWAA 1GFZA 2QN2A 1H2AS 3SHOA 2X9VA 2XUGA 3Q7TA 4RGBA 3OJXA 4AYTA 2C58A 3BB1A 5TPWA 1HE1C 2DLCX 3DB2A 5JI3E 2GRAA 3HDTA 3H9BA 3I4CA 5KYNA 1HC7A 2A9FA 4GRDA 1IB0A 1V3UA 1UZUA 1KQPA 1VJTA 4X8MA 4Y1RA 1H6DA 4D81A 2ZI6A 1PL0A 1REQA 3HJTA 2BJVA 4GRIA 3A25A 1IY2A 3GOQA 4OQPA 5FNVB 2OYCA 3T35A 3WQBA 2WG2A 4MUMA 3EQ8A 1AO0A 4V0NA 3K4PA 1JEJA 1T6XA 3UCXA 4OEHA 1QG4A 3VU1A 2FSPA 3ANXA 3IRUA 2R7NA 3A4IA 2WFLA 1N2SA 1KI8A 3HJCA 3KKZA 4LV6A 3T7RA 2WTXA 1SVSA 5KYXB 4CG0A 3ISVA 1H2BA 2V7VA 4A1OA 1DBQA 2RHHA 1RLJA 4FZ3A 2WIJA 3EBPA 1YIAA 1PGOA 2O4UX 1PT6A 2HPAA 3GXBA 3MERA 5IZCC 1PYDA 3C0KA 3NHYA 4I9FA 4BFWA 1PDVA 1M2WA 3JATA 1NAHA 1F4LA 2XWQA 3BJMA 3L6RA 1PI3A 4HLQB 2E37A 3C43A 1V1MA 2IYLD 3TW8B 2PRKA 4OXQA 2NU8B 1MO2A 2F4VB 2HF2A 5KVCA 3Q8KA 4QUEA 4Q6WA 3FSGD 3ZDQA 1QIMA 1UC9A 4US2R 2R6CA 2CXRA 5DCYA 4KI7A 1Y63A 3KOOA 4A0HA 1BRMA 1RP1A 1JVBA 2FI1A 2GCNA 4Z51A 1W48A 3AUFA 3CEPB 4UJ3A 3I9KA 1HE2A 1KEPA 3MN1A 4KZPA 4MVYA 5H02A 3LX4A 4FOLA 3ZLUA 3MOSA 5L51A 4XUCA 1ZH8A 4Y2XA 1QIHA 3SZGA 5DLYA 3RIMA 4Q0MA 4JN6B 3OU6A 5DLDA 4BVBA 4PYJA 3LPLA 3FUTA 1UBKS 2K5UA 4Q4JB 4DMUB 2H4YA 2BF7A 3VSBA 3QVUA 1OAOC 1RCFA 2OMEA 3FKQA 4KYVA 4A7PA 4DUYB 2B4AA 1LBTA 3KPYA 4A03A 4ZN6A 2CJXA 3HYTA 3L8YA 2WSMA 1H5UA 4EUEA 4KQCA 2WYVA 3AJRA 4ZKEA 3JW8A 1W94A 1E92A 2IOHA 4B0PA 4ZCMA 5ISMA 4CKEB 4MUIA 2W2TA 2PMCA 1DAMA 2PGAA 1YBMA 2RHOA 3GY0A 4W7IA 2QTNA 1GAXA 2VT3A 1F14A 1FMTA 5ICGA 2NG1A 4KXUA 2OBBA 4PC3A 2F1IA 5EZQA 2BGGA 5IT5A 1NI4B 5DHRA 2QN3A 1Z7YA 5HUHA 2HBZA 4YP9A 5SY4A 3GJYA 1IUPA 3D6HA 5TY0A 2CLHB 4MV3A 2B6NA 5AKYA 4MA0A 3IHKA 4Q4HA 4QPNA 4UHJA 3VTZA 3OIFA 5LSAA 4EB3A 4MUJA 1KI9A 5BVHB 5JNVA 5B4UA 2ABWA 2E5WA 1KMNA 3D7MA 2QIOA 3A2MA 4WOBA 1JYSA 1JALA 5FR2A 2FWNA 1KQOA 3EXFA 1W59A 3JY6A 5T64A 1TJ5A 2CFTA 4B2LA 1RRCA 2RKWA 1QAOA 4JT9A 3AF4A 4BMNA 3U0VA 1DXHA 1H9BA 1L5SA 3WO1A 3A27A 1T2DA 5I5GA 3T3PB 5KAMA 4QODA 1JHPA 5TLSA 4RU1A 2O8NA 1DHTA 3EZ2A 4LX0A 4DCCA 2AB0A 2QI9C 1VECA 4OXNA 4BNDA 2AD5A 4I6EA 1S9DA 4HNGA 3HLYA 1VP3A 3GUVA 2BFAA 3CXRA 2ZUFA 3T06B 3ADDA 1NPTO 1ZQ9A 4XB1A 5DBEX 3C24A 4EPXA 4QTYA 1WVGA 3U9TA 1RNLA 5JV5A 3K70D 2KX7A 4RIGA 1SELA 3PVCA 1V3TA 3ICVA 3H4VA 1XA4A 3CVUA 4ZI7B 2OV3A 1XJQA 2C2BA 4NJMB 3LFHA 3N2YA 2JEZA 1CUYA 4FN4A 4J0QA 5KYKA 1SVOA 1K08A 1R6XA 5ICEA 4RZQA 3ANYB 2OG1A 4ZC1A 3G7SA 2OXFA 4PPNA 4ZREA 3ZZUA 3GD5A 2A0XA 1CLEA 4G5FA 1G6KA 4Q1BA 4YN3A 4EQ6B 5KYGA 2WTUA 1EQ2A 2IEDA 1H2HA 3DCNA 4HLUC 2FP4B 3ACDA 1CF9A 3O8OA 1OWMA 4CKXA 5IHPA 2ZRQA 2WF5A 2XVZA 4C0AC 1FDUA 2NSHA 2PVPA 3NPMA 4S1NA 5IBPA 4XWGA 3SNHA 2OM2A 2B3DA 3N3BC 3RSOA 3LD9A 1FF9A 4WCFA 4IHQA 1QH1B 3TDMA 4EUSA 2OSBA 1Q6ZA 4Y6PA 1V96A 2BEUA 4EG7A 4AQDA 1ZMBA 1GKUB 3U62A 1H94A 3NEAA 4HMOA 4C05A 2IP1A 5HIKA 5K8JB 3SQXA 5EC8A 3VPDA 3H5TA 3FCAA 4AAYA 1Z2PX 2RGGA 3M2TA 4GXTA 3OZSA 2JJYA 2JZOA 3U4MA 2IYQA 1NBHA 1X7XB 1Z5OA 4CKCB 3L43A 1CHNA 4DIBA 1WCWA 4F04A 2P9HA 4KI0A 3EWIA 2GBCA 3L3BA 1COWA 4ZHSA 1JPVA 2J9RA 3Q98A 1TQ6A 4PRZA 4BMPB 1OF1A 2I9PA 2ZYSA 3H3XA 2AN9A 1PFYA 2YIJA 3VVCA 5LZ9A 1NVVR 1D6NA 1JQ3A 2QLBA 3ABZA 1RP7A 3JD4A 3U3RA 1PKXA 3S2EA 1LJ8A 3VZSA 1UBLS 3H9GA 3O7MA 1SOVA 3OKCA 3W2FA 1L7PA 3MK31 1J25A 4BFSA 2NVUB 3R09A 1N8SA 3ZQ4A 2VA9A 4C4OA 4ZZ3A 1RPNA 3DXYA 4INZA 3L0OA 4EA7A 2ODQA 1E2NA 1YS1X 2VPYA 3E1KA 3I01M 1MN6A 3KJFA 3VOSA 1O58A 1XU9A 3J81k 4F3TA 1WXHA 1IZ8A 2WA2A 4NCIA 4QULA 3UIEA 3UJAA 1DIGA 3E03A 2PS1A 1XL1A 2R5WA 3FUCA 4YLEA 2R8OA 5SYMA 2XIJA 5ICMA 5IYZF 1OFHA 4PNHA 3A04A 4EI2A 1XCOA 5EWJA 1Y4ZA 3ZWCA 4MUXA 2HK7A 2TS1A 1QMPA 4D02A 1E9SA 1P72A 3G2IA 4LHYA 2QSYA 5AM1A 1MFZA 2UDPA 3O2NA 3HL0A 1FP1D 2LZ0A 3NJ4A 4RLFA 5F4BA 1TRKA 3SE7A 3ZWQA 4E94A 5KYYB 1RJWA 1Y5NA 3GG2A 4NU6A 2ZIFA 5ECGC 2QY6A 3DYVA 5JCJA 3WDKA 1GM5A 5AOBA 4KR2A 5ILQA 1P1FA 3RRYA 4V0RA 3Q8MA 3U4GA 2IP4A 2QX7A 4BO5A 4Z9YA 1W5SA 2R6GA 5CPBA 5EJ8A 1ZUIA 2C4KA 1B3BA 4DADA 2F48A 3IP3A 1ZMOA 4Y3UA 3OO1A 4K46A 1GPH1 3BRCA 1RJDA 5HCIA 3CTPA 4JBYA 3TZKA 2KHZA 3EWSA 2C7VA 2D1TA 3KKQA 3LXMA 1C4WA 2VKTA 4LG1A 4P4TA 4TMYA 2PX2A 5IAEA 3KYDB 5ETJA 3SYTA 1PSZA 1QPGA 1WQ1R 2WSSA 3PJGA 1AQNA 3HH8A 5JYDA 3C1TA 3ZH9B 4DQLA 3T4EA 1JDNA 4QHYA 4WEQA 2FP3A 3QXHA 1ESNA 1KMQA 3CHYA 4CCAA 1PD1A 2JAWA 1J8MF 4IXNA 3O8NA 5FUXA 5FBKA 5FTWA 4RETA 1YFJA 3KQWA 4HUQA 3UJBA 1DAKA 1NN5A 3EIXA 1C9MA 3DDZX 4DZRA 3P9PA 4C88A 1MT3A 3A1EA 3RGWS 1UFOA 4BNTA 2Y77A 2VHJA 2VH2A 1PBTA 3HRHA 4XI9A 4TSKA 4BTVA 4TROA 1KZYC 2C94A 5DM60 4MKFA 1L5ZA 2YWEA 1SXHA 4K2HA 3URMA 3NWBA 4FVTA 2F64A 1UP6A 2X9NA 3JXEA 3PQFA 2FVYA 4O2LA 4HNHA 4BNYA 3WFIA 5HKOA 1GPKA 3EIQA 3TIIA 2V8OA 1D2HA 1EJ6A 1VE6A 1NKSA 1VSVA 2DFNA 2PLAA 3S99A 3FVTA 4MI1A 1JEQA 1QZTA 1PWHA 2OFXA 3QW4B 1NBMA 4HX2A 4IQ0A 4O63O 5JJ5A 3MQ4A 1FUEA 1LPMA 1OLOA 3LYUA 4GYJA 4C30A 1HT0A 3K2BA 1X8LA 4D44A 5DTRA 1RLIA 2XUAA 1E3SA 3NHAA 5AJXA 1RHMA 3NUZA 3TIXB 4UNIA 2AXQA 2UZ1A 4MEAA 3CG0A 4MUKA 4OQLA 2VPIA 3T7JA 1M5RA 2CWDA 4ZAWA 3O26A 1MHPA 3EH1A 1WU8A 1YASA 3MQFA 2GBLA 2RGAA 3IOCA 3K3PA 3C3KA 3PF8A 3MFQA 2DLDA 2MYUA 1L5MA 2B35A 1R0CA 4OU4A 3CX4A 5EERA 4DXDA 4EF5A 4EY4A 4ZVTA 4H08A 3DCIA 3UWSA 5K0JA 3WKBA 1VLQA 3CVXA 1J5EB 2XBMA 5DGTA 4MVXA 2R44A 3GAAA 3PC8C 1DQYA 4OPMA 5EZ5A 2XCOA 2AXPA 1KIFA 1D6JA 2W2LD 4Z3DA 2IU3A 2QRUA 2QUBA 4MV1A 1E2PA 1RI5A 2PBFA 3WWYA 5IT9A 2X6RA 1NLMA 3FKSA 2HDOA 2PHZA 4XASA 1KY5A 2IU4A 1YB4A 3TLJA 4GKVA 4B34A 3CTMA 1BHQ1 2O0JA 5K3AA 5KVVA 3H1BA 3Q0TA 5FUMA 1GDDA 2BONA 3AU8A 2VRNA 3KQKA 1T26A 2N75A 5BOVA 3PUWA 1P0IA 2OQIA 2R66A 2ZWVA 1WL8A 1UPFA 1ZJ6A 3CUUA 3FLMA 3UFXA 2X8JA 3VC7A 3ZGVA 3L7MA 4TKMA 5GM1A 4DHWA 3T5PA 3AI1A 4FZRA 3VHXA 3VR2A 1ZMXA 5JAOA 3IC5A 4JUCA 3ZIAA 2UV8A 5ALUA 4NHOA 4A8HA 4WFQA 1UFVA 2XGMA 4ZHQF 3D3QA 4FFBA 3HDGA 4AKSA 5LQMA 1Y3HA 4QOJA 3EC2A 1TVKA 5FJJA 4F7DA 5A1TA 1P77A 3K31A 1SXGA 2D0DA 3OQHA 4DLWA 3KT8A 2GFQA 1EQAA 5FJIA 2ASEA 1LA2A 4YRRA 3DONA 1PQ4A 1YCFA 1QIGA 3VZCA 4Q9DA 4OHKA 1M6VA 2BWJA 5AH0A 3BIWA 3P9XA 5JO9A 5AKXA 3F4LA 1BN7A 1YONA 2VP9A 1DS6A 4QPZA 2ZRPA 3MJTA 3T4UA 1I33A 1QFZA 2HDNB 4R2JA 4ZDWA 3WS7A 3RS4A 2EFYA 3F5SA 2AXEA 4WBXC 2H29A 3TL6A 3HVUA 1O5IA 1VCHA 4DT1B 3LJKA 3QNWA 2IXTA 3D4PA 3SWWA 1MO6A 2QR5A 5FTKA 4CG3A 2E4VA 3WB2A 4KFSA 4KIFA 2V7EA 3QUTA 5BUQA 1IM5A 4O4JA 1N36B 5T4EA 3P2OA 2W2KA 2Y99A 3HM2A 1O97D 5FLKA 4FX2A 4U63A 3EGOA 2CLFB 1YH3A 1SXPA 4DM4A 2NVOA 5CB4A 3H4MA 1UAAA 1W4CA 1Z37A 2X0JA 5CNIA 5DULA 1GTL1 2OZLB 2XTNA 4BX3A 4ECAA 1E3LA 1AUVA 4KK3A 3DMNA 1G2OA 3BJEA 3BGIA 2BBTA 3OQIB 4HQ0A 9ABPA 3LQKA 4D0RA 4LWOA 4DBZA 3W06A 4PE5B 1YJBA 4B9AA 4QOFA 3RC2A 3RVRA 5AUPB 4DKJA 4HTFB 3WYGA 4FDAA 5HVNA 2UKDA 2B30A 1USVA 2WKPA 2WM2A 1L5WA 2H9IA 1M8FA 3BVPA 3UQYS 3TF5A 1EYZA 1SBZA 2LR0A 4CF4A 4OJNA 1XMVA 2X0KA 1JLLA 1O94A 5JSZB 5CEEA 3RNLA 4BATA 4EHLA 5CLFA 1V6SA 4O33A 3FCEA 3GMSA 3OUTA 4UAJA 1TVCA 1FFYA 4FYPA 1COZA 1VQ1A 1LNQA 5TQ2B 3BMQA 4LECA 1W29A 2RHRA 4NMLA 4F4JA 1Y7IA 1EUYA 3AEUA 1N2OA 1OC4A 2WTNA 2C0PA 1UZAA 1CZRA 3EVDA 2DX7A 3L79A 2JCBA 3UJ3X 1BHO1 4B3DA 4F21A 4RUKA 3B52X 3R7AA 1K7SN 5CXXA 1RQRA 5KOHB 5CRIA 4BJHB 1GV0A 1XRMA 2F2TA 1R5OA 1SUFA 2XNCA 3NTVA 4NV3A 4UUOA 5FOWA 5B5SA 1HX7A 2BFBB 2P8JA 4LRUA 3R9WA 1XCMA 2VDJA 4MS4B 2A1UA 4BV9A 1AJEA 1YR7A 3E4CA 2OHXA 1Z4NA 2I54A 2D06A 3CNBA 4LJKA 3HDVA 3K30A 3SIWA 3ELDA 4MO9A 1E4YA 1PFVA 2ZUWA 2GK6A 4Y1FA 3V7UA 4UULA 1Z12A 4BKUA 2HRQA 5CH8A 4CQMB 2AI2A 1DX9A 1QZUA 4IIXA 4IIJB 5E8JA 5C8YA 4AZ0B 4Z99A 4TVSA 1GA1A 4LF6B 4CTNA 1NBAA 2VP0A 4L9SA 3D1JA 2GYYA 4TL9A 2DUWA 4V0QA 4EPRA 3K70B 1PWXA 1R0RE 1Z15A 2FEPA 3DE6X 3E5HA 4QECA 3UY4A 4OA5A 5BN1A 5FBHA 1ZICA 2CN1A 5KHAA 4XFJA 5CLJA 5JO0A 1EK5A 3FMFA 3KTFA 4WASA 2QL9A 3L05A 3B1KA 1T3SA 1IL0A 3OZTA 1QCDA 3NBUA 1NHWA 4ZFNA 1PT5A 1DAHA 3ESRA 4TPKA 5LXTF 2Z2IA 4BVGA 3UWMA 2P9QA 3VKGA 2E89A 4IDCA 3A6DA 4WECA 3FPBA 4OYLA 1LBSA 2CY0A 4X9XA 3G8AA 3TD9A 1KI6A 2J5RA 2Q5IA 2WAXA 3E27A 2FR8C 5IZCA 1GKIA 3UG7A 3OMWA 1SPXA 4DJ5X 5C81A 1JKXA 2C8LA 4YP0A 3RRFA 2YN4A 3HGTA 3PWZA 1VKHA 5EINA 1NBMD 2D59A 5J43A 4D97A 4HYYA 4CLRB 5FTLA 3E8XA 1C7IA 2D4HA 2O2CA 4H7PA 3MELA 2J59A 4X54A 5KTYA 2FN4A 1CQIB 4OGWA 2QLFA 2BFEA 2VJKA 3V8PA 1FUIA 2HJ9A 2Y1KA 5BR1A 2RB5A 1JHZA 1GR0A 4BU0A 4LF8B 1P3JA 1MRNA 2HADA 1JHDA 1K92A 3NNDA 1UBNA 4FBLA 3PC2A 4J49A 4L5AA 3MAAC 4NYJQ 4X7PA 1K68A 1ML3A 4MUHA 1KMMA 1B00A 3FNHA 4KQHA 1LFAA 3WP1B 1NJFA 3WRYA 4BZZA 3AGPA 4B74A 1XPOA 4JKOA 1NQ5A 4JI7B 1CNFA 3AFIA 2QQ5A 4K26A 1I4WA 3P45A 5GWXA 5A6SB 5C4MA 2DEUA 1LKZA 5HA5A 1MLDA 4PCLA 4GPBA 1Q44A 1Y1SA 4JLOA 2H4HA 1DE0A 3H0KA 3LC7O 3AL3A 4HDOB 3KFXA 3KKMA 3DE2X 3O0DA 4M9ZA 3RU2A 3UW1A 4DMMA 1ECJA 3GNLA 5KWSA 3DLHA 3GT0A 4NR0A 1MD9A 4UAVA 4CODB 5AVZA 5IXJA 1QU3A 2GN9A 2VP3A 3BMOA 3QXXA 4Z4EA 1F17A 1P4GA 1KK0A 1RLMA 4DA8A 3VSDA 3HCPA 3K9NA 3KB1A 4JLUA 1YI8A 4R2WA 3UWPA 3FKSD 1J23A 2N9UA 1WB4A 3FTQA 4MVJG 2UXCB 2GPNA 4L6CA 1Q84A 1LSUA 1LV7A 2VDRB 3DMRA 4K6FA 1J07A 1NW9B 4RF5A 1ZC4A 5ESXA 5K8TA 3V2UA 5JFTA 3OLQA 1IVSA 1OIXA 2GPWA 3CH7A 2XUPA 2C4UA 1XMPA 1F8YA 2R8YA 1GNRA 1NP6A 5KJ1A 3VR2D 3GCDA 4C7MA 5BURA 1MB4A 5AVUA 4WCDA 4EI7A 1DPFA 5IU6A 2VKQA 2VRBA 5HDQA 1R4NB 4AZTA 4KPUB 3SQMA 1SJ9A 3C5EA 1XMSA 4HQ6A 2ZUUA 4RF2A 4EABA 4CUKA 1NJ5A 4OXKA 4XE5A 3ZJUA 3L49A 1ZINA 2DKOA 1YQQA 2MYPA 4C01A 3VOTA 1RVV1 3AY6A 4R7TA 1YB5A 1KDTA 3NEJA 2G04A 3QKRB 1U28C 5ALOA 2MINA 1YC5A 4A4DA 2HMVA 4M49A 4RAOA 5KNCA 5EJ4A 3RSZA 1YO6A 2W2QA 2O7NA 4H77A 1GSIA 4NABA 1RRFA 4HWPA 3A36A 1C4KA 3HLTA 1P2GA 2XITA 1KH3A 4Y30A 3PXGA 4JGIA 1G7RA 4D80A 1LFDB 4GP6A 4M0MA 2PSHA 3H75A 3QELA 5JARA 1ZXLA 2UYYA 2YC4C 4JLKA 2QPOA 2ZYRA 3L77A 3UXYA 5A62A 1V95A 4IDDA 5CM9C 4F2HA 4YT2A 2CF6A 1F6BA 3FMPB 4AN4A 1GPYA 3JQ9C 5KNCH 3ROEA 3HK2A 4JENA 4UAGA 4V0MA 2JHFA 2XF8A 3WBFA 2VAMA 1W49A 4FFNA 3WKDA 3DAPA 1Y7LA 1NSFA 4EA8A 1S4MA 2D00A 5KWVA 5J2TA 2E7ZA 3VC2A 1HFKA 3OZBA 4MLCA 3VHRA 1XTSA 3MTQA 3RUEA 1SUPA 2IY7A 4RSGA 1R3UA 1X1SA 3DW3X 3P9ZA 4HLUA 2V9PA 3RQSA 3PUVA 1E32A 4GLFA 3SBEA 4DQ0A 1X3SA 2WT4A 5K1ZA 1QFMA 4MAAA 3EUWA 1A2QA 1GRNA 3VU3A 3QEJA 4EAAA 2H1FA 3I9LA 4EPVA 2J9FA 1CNMA 3BJZA 4FDLA 2C03A 4HDCA 1A5AB 1QP0A 3MD9A 3KWJA 2ZQZA 3G89A 2PIDA 4X93A 3UC9A 4BZWA 4CMBA 2RKOA 1OREA 3FLEA 3HCDA 4BQOA 4L0DA 4KDEA 5CVJA 2V5VA 2V9CA 4K9NA 2UYOA 4LYJA 3FM9A 3ZLJA 2FPOA 4F4FA 5L3QB 1O94D 5AKIA 2ORWA 3GLUA 4HHEA 4RE5A 4G4JA 1CEXA 4NOJA 1IN5A 4X3PA 3ZZMA 2PGXA 4I50B 3A37A 1CUHA 1H8HD 3Q40A 3GFRA 2ZWOA 1EXNA 1OH7A 4PAOA 1XYYA 3NHWA 4H1TA 3E70C 3EF3A 1J99A 1WXDA 1T43A 3QENA 3L8HA 3FJ1A 2P3OA 4H1VA 5FBZA 4B3HA 4FE4A 3RVQA 1GKLA 1JTEA 2WF7A 1UMCA 1QGZA 1EFVB 3ETHA 3E3LA 1Q0UA 3PNSA 3PTLA 4R4JA 4CL8A 1HE3A 4LWPA 1NATA 3D0OA 3K9CA 3T9CA 5L45A 2AQHA 2QIPA 5DW0A 4XB2A 2OBYA 4C2UA 3JTEA 3ORFA 2A9PA 1JT9A 2NACA 3IULA 2AJLI 1Z5WA 1VL1A 4U2KA 4OQEA 1GU7A 2ID8A 3FFAA 3C97A 4NQRA 1P91A 1U8ZA 4D0GA 3BORA 2CL7X 4N3AA 2XZLA 2GNAA 1T9HA 2OGTA 4G5YA 4US1R 2V98A 5FBWB 5J23A 1U98A 4I5EA 5C2JB 1E4EA 4X44A 1TZCA 2X5OA 5F73A 5I4IA 1OWOA 1KK2A 2EATA 2R0QC 3F8SA 4L3WA 1DBPA 3WA6A 2CJYA 4N1AA 2FW8A 1LTHR 5EXPA 3VPGA 3NVDA 3PLNA 4YRKA 2NV6A 4F84A 5BPHA 1KBOA 4C4AA 4FYIA 3EK2A 4HNQA 4NJEB 3T12A 2QV7A 1BAPA 3PFCA 1L5VA 1GUDA 1UPUA 2QZJA 2FHSA 1L4GA 3MJCA 4NENB 5CM2Z 2DMRA 2MOKA 1HLFA 4GKAA 1DUSA 1DX4A 4QLBA 2GASA 5A4FS 3GARA 1LTKA 1AA6A 4NH0A 1G5RA 1VA4A 3U3DA 5IC4A 4QWWA 1KIMA 1QVVA 2IW3A 4IM7A 4IJUA 2ODPA 1SCIA 5EUBA 4K9OA 2PJRA 5C8VA 4RKWA 3OE7D 3ZD7A 3U7FB 3OCXA 1PT9A 4ZOAA 3DWIA 4S24A 1Z9BA 3GLVA 5B55A 4LIPD 4F2DA 3DD5A 3ZVMA 3RC7A 5EJ5A 1D2CA 2OKGA 3UICA 3G9TA 1Q1NA 1BMTA 5THKA 1R0YA 3AR2A 5F4ZA 3QBVA 4LJAA 5E6RA 1SHLA 5BMVB 3NWPA 2J87A 1IXRC 4GRAA 3HLKA 5L95A 3N8KA 2G9ZA 3QOWA 5C7YA 1Z75A 4G0NA 3GQBB 2ZIZA 1C3JA 4FBMA 3I5MA 2ET6A 3MLEA 4U3JB 3A6HA 1ENYA 2B8WA 3QG5A 2FPPB 4TWIA 4ZAGA 4D9FA 3DNPA 3ZHRA 3SY8A 4DDMA 4GI2A 1XHEA 1E2KA 1X7YA 4H18A 3MSCA 4H17A 5C8DA 3W78A 4C6RA 5EZYF 2FZ4A 1QB7A 2XR1A 3T9DA 3V9AA 1ZN2A 1RZUA 1GILA 1GPJA 3PCRB 1D2NA 4HRAA 4G8DA 4NOKA 2V54A 3KP1A 1J0AA 3SICE 5IULC 1LU9A 5KYXA 4RTJA 1RE0A 4EB6A 2HQRA 4LZPA 2P40A 1DTSA 4XUDA 3ICEA 1YFKA 4C04A 5BOSB 4NICA 4B6RA 3THOA 1I2BA 3B53X 3NM6B 3NOXA 5JVDA 1WUIS 1V5WA 2FZCA 4XGKA 2PUVA 3R7SA 4Y67A 1JE1A 2PLNA 2CWWA 5IUNC 3I8SA 4ACBA 2ZUVA 3ZE0B 1YB7A 1K1EA 2Q1TA 1RQGA 2G1JA 1U6KA 4WOJA 3ILXA 2QZZA 3QE4A 2X9QA 2ADMA 4HFRA 5GZ6A 1DC3A 1JVSA 1GQSA 3BXOA 1ZIYA 4F86A 3FPLA 1LS6A 5KNCD 3DEHA 3PC8A 2VAXA 1KRXA 2O8DB 2LTAA 2E18A 2NO9A 2ERYA 3NT4A 3OVMA 3ZCPA 4YV2A 1T1SA 4UUMA 4ALJA 3OHMA 1Z4JA 4GZMA 4EKNB 2QL5A 3TD2A 3MS2A 3JWGA 1EEHA 1NMYA 3KZNA 4MV9A 5JBQA 1DLJA 1EGHA 3IAEA 3ML1A 3DVRX 1CJVC 5C1BA 4Q4JA 1NX9A 4W8GA 5ER9A 5JJCA 2XRZA 1Y42X 2YFKA 1HZZC 4D9EA 1JDTA 4PWYA 4RM2A 2JGFA 1MT0A 2C2MA 3X1KA 1TT5A 2Q2OA 3WWDA 3F73A 2QBYB 2O23A 5ADVA 2O7SA 3SFVA 1N9GB 1WCV1 1ISJA 2D54A 1Z2NX 1T4GA 5ADWA 1JAIA 2OG2A 3H4TA 3QVWA 1CG6A 4XJXA 2H1WA 1M34A 3H9JA 2PWBA 2XVYA 1NL3A 2Z6AA 2R60A 3D43A 2EJCA 1R6AA 1BCRB 1QGUA 4L07A 3ZHZA 3GMTA 2AGVA 4CEHA 4Z1MA 3FETA 1NI4A 1VE7A 3EFEA 4LHVA 2BYTA 3WZ2A 3C3JA 4LPKA 4YQEA 1W96A 1BFUA 4OLJA 2ZVPX 1Q14A 2XQFA 4KG7A 4PZ0A 4PZ9A 2L2QA 4UTNA 1ZNXA 3PUJA 2PNJA 1EXDA 2FUNB 1SCQA 1NC3A 3H17A 1FZQA 4UUQA 4AKIA 4F72A 4KXQA 1C3EA 4I1OA 4CR7A 1BCSB 3DEJA 4OX9Y 4PGMA 2BMVA 4PIVA 4L5JA 4W1QA 3C8DA 4RPCA 3ZDCA 4YMTA 3MM4A 4WIAA 1H5QA 1J22A 4NFLA 4ZAFA 1XTQA 2X8LA 4DY4A 3AM1A 2IS6A 1C30B 3ABQB 3I64A 4KO4S 3RTEA 3A6KA 3U1VA 2J6CA 3ZD8A 4J8PA 2Z5GA 1E2QA 1JFLA 4PF1A 5EKSA 5A3VA 5LBUA 1UZLA 2BFDB 2PYZA 1MP0A 5DK4A 2QMEA 1AUXA 4OB8A 1V11B 4M38A 4CG1A 2HMYB 3JQAD 3RIYA 2GN0A 1PK9A 1CE8B 5CGQB 4PHHA 4RLQA 5FYDA 5AVXA 1GIAA 5ALRA 3PHLA 1TZBA 1FEZA 4MPRA 4G0PA 2H1VA 4QBFA 4M7RA 2Y93A 3AWIA 4EQ6A 1X9IA 3NFRA 3H4IA 2X0NA 4LKOA 1EZZA 5GV7A 1XPRA 4Q48A 1FP2A 2YHBA 4K6KA 1I6WA 3J80A 5B2ZA 4JP2A 1QZ3A 1ILWA 3TZ6A 1CERA 2G4VA 4WWHA 4BNGA 1CJKC 4FYYA 4OMDA 2I7VA 1ZEMA 2FOLA 4OI4A 1HNXB 4OJMX 4DPMA 4O8CA 4F71A 2QZ9A 4OKNA 1NBEA 2FRDA 2YVQA 3BQ9A 2LNDA 5CAEB 2ZIAA 4FQ7A 4KVFA 2VRWA 1IN6A 1T10A 1T0BA 3KHSA 3RSCA 4DCSA 4ZI7F 5DLQC 3L0IB 1F2TA 2J5BA 1TZKA 3OZXA 4RDIA 3RADC 1YVRA 5DTIA 2TYSB 4W99A 1PO7A 2C42A 3MRTA 3KHTA 4HDMA 4I14A 3WLAA 4MCJA 5JY1A 5HX7A 4K9RA 1PJCA 5LP6C 3ZGLA 1I01A 3KOUA 5CJPA 2UUPA 3EXHC 4CKBB 1JEYB 4Q16A 1F20A 2Q2VA 1I4LD 2ACVA 3UAVA 1P45A 4C4XA 4L4RA 4I2NA 5KSZA 3FRIA 1VPWA 1H0KA 1MABB 3JYNA 4PXAA 4ZIRA 1E8NA 1QHHB 1FYFA 2HCRA 3L5OA 5AJHA 1ISIA 4G8BA 3EDMA 3QUAA 4ZZIA 2VJBA 4Q19A 1W0JA 5CT4A 5EMHA 1UXKA 1W47A 2QY9A 2W2VA 3HJHA 4CCYB 3VYSB 3R3ZA 4KQ6A 4OOFA 1GUZA 2HJGA 1GZDA 2OBLA 3OWHA 4UW9A 4PR3A 1KZ9A 2I3GA 4AMVA 5I7HA 2HMUA 4M1KA 4G85A 1QGDA 1VDZA 2FFAA 4QXMA 1SHZA 5E95A 1PT7A 4LCEA 1GZ7A 4OQXA 3REFA 4J4BA 2BGKA 4PO9A 3NUQA 4GPD1 1DKMA 3CO0S 3GVHA 2FSUA 1KGDA 4DYVA 1U0BB 2RH9B 4P53A 4I5IA 1RJ9B 4YACA 2OV8A 3K1ZA 1Z0FA 1YMVA 1NY5A 1TJYA 3A6FA 1EQUA 2JHCA 4TQAA 1BX0A 2C29D 4Q3EA 5LMUB 2Q6TA 1GCIA 3DF7A 4JBHA 3PQ6A 3LO5A 3FSRA 1ZRNA 2G8LA 3HG7A 3WL5A 5LQJA 1HH4A 4W5HA 4PPFA 2OO5C 3KC2A 1SVUA 4Q15A 3N87A 3SZ3A 1GT6A 4BP9A 2ECPA 3E7WA 4QYWA 1H2YA 1GZ5A 1UZNA 1T36B 2NT3A 1W0CA 2B7CA 3F3YA 3P9RA 1CUDA 4RTOA 4BOYA 1GITA 1KYZA 3DE4X 3EEBA 1CUGA 3RHFA 4UPVA 3G5TA 3IP6A 2PU5A 3AHCA 2OZPA 5B3JA 5DYGA 5DNCA 4X1IB 1UWLA 1SVIA 4AJ9A 1EP3B 3PUZA 3NDBB 2Q07A 2O8EB 1WXFA 1WY5A 2XKAA 1UJ4A 2AHRA 2EZ4A 4HXEB 1J42A 1I6KA 5C5IA 3BPSA 1J9GA 4O4LA 1P1RA 4HDNA 4AIRA 4A6DA 4R0MA 1BEEA 4HXYA 1XZHA 4JY7A 2VJLA 1VIMA 4OBEA 1C9YA 2EGHA 3LCCA 4JEHA 1LK7A 1HT1E 5CM8B 3PRYA 1Y1PA 4AF7A 4B2PA 4H3SA 2B5VA 5CNMA 4D99A 1GTZA 3WHLA 4MPDA 1F4PA 4D7AA 1HMYA 1EEXB 2OBFA 3GPCA 2Q4BA 3REQB 2RDMA 1GL9B 1J0XO 1YMUA 2P4QA 2XD4A 4A23A 1ONBA 4AC9A 2COKA 5AW1A 2OV6A 4YPOA 3D4BA 4YEDA 1NURA 3O0TA 2EAUA 4Q9HA 5AUNB 5T67A 1LSOA 2R62A 3FVQA 5AI8A 4W63A 4I9NA 1JQDA 1SQSA 5AK3A 1R0XA 1ZVJA 2Z43A 3VDXA 3N7UA 4AS2A 1N1EA 3RJTA 2Z4TA 4EG5A 1U02A 5ALHA 3TQRA 3KB2A 4RBNA 4RABA 4Y9TA 2G36A 1U28A 1J5PA 3K09C 3WGZA 5HXAA 4E12A 2WD9A 3G2HA 1D0VA 1KETA 3AKEA 1OLUA 4KAJA 3QPWA 4MUGA 2IV7A 2X3UA 3ASZA 3CF6R 3E7FA 3M5CA 3OETA 3QLTA 4JBWA 1MDBA 5JJKA 2R9VA 3LLUA 4DA9A 4N8DA 3ZWYA 2IXFA 1JG7A 3EPPA 2VJMA 6AT1A 2D7CA 2J9YB 3V48A 1E2FA 2OAEA