1CJBA

Malarial purine phosphoribosyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
227
structure length
227
Chain Sequence
PIPNNPGAGENAFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYDIKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0 A structure of malarial purine phosphoribosyltransferase in complex with a transition-state analogue inhibitor.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords PROTEIN (HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE)
total genus 74
structure length 227
sequence length 227
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1999-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cjbA00
3H83A 4RABA 4P80A 2JKZA 1G9TA 1I5EA 1DKUA 4P82A 1A4XA 1O5OA 4LYYA 3EFHA 1I0IA 5JSQA 4P83A 1DQNA 1UPFA 4RADA 3MBIA 1D6NA 5HIAA 2XBUA 1A3CA 1A96A 3GGCA 1G9SA 4JLSA 3NAGA 1P19A 1FSGA 1A95A 1HMPA 4X44A 4QYIA 3HVUA 4RACA 4P3KA 4OHCA 5ESWA 4PFQA 5BQOA 5KAMA 2JI4A 4RQAA 1L1RA 5IPFA 4RAQA 5E38A 4WMLA 1PZMA 3GGJA 1I13A 1P4AA 3ACCA 1VSTA 4M0PA 2JKYA 1LH0A 4S2UA 2FXVA 3OHPA 5KAPA 1XTTA 1P17A 1XTUA 4RHTA 1DQPA 1TC1A 4P81A 1UPUA 5BSKA 2PS1A 4P84A 4KN6A 3KB8A 1QB8A 4RANA 1P18A 1WD5A 4LZAA 1ECBA 1XZ8A 1STOA 1JLRA 2E55A 4F8EA 1CJBA 4RAOA 1GRVA 1VCHA 5IAOA 1A98A 3ACBA 4WN3A 3S5JA 4LYGA 1QCDA 2H07A 1I0LA 3N2LA 3LPNA 4JITA 4P86A 1O57A 5ESXA 4RV4A 2JBHA 4Z1OA 4IJQA 1DBRA 1ECGA 1VDMA 5K51A 3G6WA 4RHUA 4MB6A 4QYIB 1YFZA 2AEEA 1XTVA 2VFAA 3MJDA 3QW4B 1ECCA 1ECJA 4X45A 1UFRA 5EUCA 1ZN7A 1G2PA 2H08A 1G2QA 1Y0BA 3LRTA 1V9SA 1NONA 1DKRA 1Z7GA 1J7JA 1TC2A 2GEBA 4LZNA 4M0UA 1IBSA 4M0KA 2WNSA 5BRNA 5JV5A 2HCRA 1QB7A 3O7MA 1R3UA 3DEZA 2P1ZA 1BD4A 1GPH1 1ZN8A 2DY0A 5HKLA 3ACDA 3M3HA 3OZFA 4LZOA 4RHYA 4ZFNA 1HGXA 2PRZA 1QK4A 2H06A 1AO0A 1U9YA 1XZNA 5BQPA 1BZYA 1L1QA 1U9ZA 3OZGA 1W30A 3DMPA 4TWBA 1BD3A 1ECFA 1QK5A 2C4KA 1OREA 1I14A 2IGBA 1QK3A 4QRIA 2EHJA 1A97A 1ZN9A 2PRYA 3GEPA 1JLSA 4RQBA 4PAWA 1OROA 1QCCA 3DAHA 1OPRA 4FYMA 2YZKA 1MZVA 4RHXA 1NULA
chains in the Genus database with same CATH superfamily
4RU1A 3LI2A 4RXTA 4X6XA 1CP2A 4NTZA 1MF7A 1TX4B 2PZGA 1R8SA 4LSGA 3EVGA 3QTBA 4KHZA 4QHSA 5LQDA 2EL7A 1KEZA 1JQDA 1JXOA 1GITA 1MNAA 2GZHA 3D4LA 3SD7A 4H1WA 5J2UA 4WTOA 1QNLA 1N7IA 3KDAA 2OD9A 4GDMA 1YMQA 3QWAA 1YU6A 3LDHA 3ETHA 4X60A 3V4LA 1N5IA 2R1TA 3EVCA 4ID3A 5IKXA 3HGTA 5E6UA 3AJAA 4ZOLB 1H9CA 1D2NA 3ZZ1A 4GSYA 4TTRA 1CR4A 1QHYA 4DDKA 3IQGX 1YIDA 2AEFA 2IOFA 4IHJB 5EMJA 3DZJA 1TYDE 3B6MA 2NUBA 3QWHA 1P73A 1MAHA 3DBHB 3E82A 4AURA 2FMKA 4QOFA 3ZOZA 2CFSA 3OTWA 5F77A 1P9NA 3AINA 1AK2A 3SVZA 4F2DA 3A28A 5AVSA 2BUCA 3ZHTA 1PQUA 1VP3A 2XE7A 4MKXA 1JXQA 2FTKE 5FWXB 3OOYA 4CHTA 2X19A 4MJ3A 4PIMA 4C01A 1H5QA 3KUXA 3GMDA 4QYTA 1T2UA 5LD2B 4JI7B 1GG2A 3DVLA 4IOLA 2H11A 3NASA 1B0ZA 4B73A 2EEPA 2AKAB 2Q5FA 5BNIA 2HWXA 3PWZA 1AKEA 1V3UA 2ZYAA 5HBGA 2D3TA 3UPDA 4A16A 1RYMA 2C4HA 1SHUX 5KYYA 2Q6LA 4D9KA 4OLHA 2E55A 4MH0R 1K4KA 3I34X 3K3PA 1SQSA 4HJXA 2W2QA 3V8NA 4BU0A 5IAOA 4O33A 4IKPA 4PXAA 4EFLA 4JUCA 1F2TB 1TO2E 1B43A 2PFSA 3CXUA 4OFBA 3B2EA 4L4YA 4MB0A 1MP0A 4OGLA 1XK7A 4QULA 4IV0A 4Z8XA 4ZC1A 4CLEA 2BH2A 3NIDB 3MYRA 3G82C 4ENWA 1J8YF 5FNVF 4IDOA 3O26A 2P8JA 4IR7A 4GKKB 1E9CA 1XQ9A 4V0LA 4YAJA 4ESVA 4B3TB 1VOTA 3FUTA 1JKJA 4L02A 5A0FA 3B7PA 1UJCA 3PQ6A 5IYZA 3DEHA 4K05A 4W7IA 5ALMA 5HR5A 2MSLA 4BFWA 5JHHB 1N2OA 4RFSB 3CF4G 2PZBA 1SUFA 3NBYC 4EKDA 1VI5A 1U8UA 2YWFA 5EJ5A 4G4IA 4C7BA 1N6LA 1UEIA 2CLFB 1QZ3A 3CCFA 4B85A 2IVFA 3TO5A 3GCZA 2XVMA 3OEHD 1YS4A 2GAFA 1GLGA 1IDN1 1MMFB 1OA0A 1QH1B 2DY0A 3LUPA 3W3AA 4CKWA 1LB1B 1SKYB 3RKSA 2F4VB 3B82A 4DR3B 1Q5PA 1F2VA 3I9MA 4YAIA 5HKBA 3CA8A 4BB0A 5TF4A 1KAMA 2BHTA 2HO5A 3JVEA 4IJ5A 4FYKA 4INJA 1HKUA 4U2BA 1AO0A 3CF4A 1ZUNB 3CZRA 3BXGA 2DFPA 2FYTA 2P5YA 3VU3A 4CMAA 4DNXA 5EJMA 4ZVOA 4Q1CA 5IVIA 2A9QA 2AN4A 1IBRA 3QZUA 4JX8A 2H6EA 3MPOA 1T34A 2VDOB 8AT1A 3RI3A 5EKXA 3EPLA 4R1PA 3KQHA 1NW6A 3MTAA 4NG4A 4TTTS 4XASA 3GRYA 5A05A 4Y98A 3M3DA 5B7GA 5EJEA 4R5MA 2G06A 1KEEB 4HNGA 5IUNC 1ZVVA 1DJOA 1Z2NX 4JUIA 4LJKA 1EDZA 1LK7A 3E4DA 3QVJA 2O57A 1TYBE 2R87A 3H5RA 3ILHA 2GA9A 4IIHA 3AL3A 2OHJA 3AERB 4XCVA 2HADA 2AZMA 3E7WA 5CDHA 4IOMA 2J3IA 2XITA 4IIGA 5JFGA 2GXAA 1JAXA 2HCTA 1ESMA 5IDXA 3AHFA 3K1AB 1L7DA 1BX3A 4BN4A 4HDMA 5AMXA 1EGVB 1YRHA 3EPJA 4KK4A 4KXQA 4LF4B 1D2CA 5EHNA 3GGCA 4N0DA 2GEDA 1MAAA 4Q6BA 1AY0A 2W2LD 4AXBA 5KSOA 2I8AA 1YA8A 1E9DA 2CL5A 2NP7A 1ULAA 1Z33A 2Z2JA 1RHMA 4FS8A 5J4YA 3H99A 4LBZA 4XEHA 2ZQ5A 1L5FA 2OCDA 3BTVA 3GEDA 3KKLA 3STTA 1JBKA 4Q7QA 5BSGA 2WQ6A 3CTPA 4ZT2A 5K03A 3PDIB 2GN9A 4IGEA 5BV8A 2F64A 3RWBA 1SVUA 1QVZA 3MLBA 1F48A 4GW3A 3D1VA 3D9QX 2Y0BA 1XTRA 2IYEA 1O0BA 4MRAA 2QJWA 3CLKA 3EZYA 2BFAA 4OKSA 4L8WB 3D0QA 1U1FA 1FDRA 3I9V1 6REQB 4CKZA 1VLHA 2BFCA 1KI1A 1C4KA 2ZPUA 1G8MA 5BVHB 2R8PA 2VJPA 2WBLC 4N3AA 5CW2A 5EVJA 1VB5A 4I55B 4LQCA 1AU9A 4GFDA 1CLUA 5F51A 1YHZA 1GQOA 3L04A 5BVGA 5B6PA 4G0PA 3IJRA 3QVKA 4UHJA 1R4ZA 3LOPA 4FYJA 4X7BA 2GPAA 1JEEA 2QVYX 6LDHA 2QRZA 1KZ9A 3H2SA 4TTIA 2FPRA 3M89A 3KLMX 5E0OA 1GZVA 1IY0A 1V7CA 1QE0A 5F9HA 1QV9A 1CVIA 1N6PA 3JQQA 1NBWB 1ESDA 3PR1A 5BSFA 2WHYA 5CIQA 5K5EA 2G8NA 3V46A 1UPXA 3AJEA 1Y9EA 2IHNA 2FSSA 1C9MA 4L22A 2PFKA 5IDVA 1TJYA 1JWLA 1RKXA 3GPDG 4HZIA 1NW8A 1KO1A 2R97A 5JT1A 5JY6A 4XB1A 4JY7A 3AU8A 4D8TA 2G0NA 1SEVA 2B4QA 4NBNA 5LA6A 8ADHA 2Z9CA 2N75A 5HUQA 2V7QA 3SF8A 3LBNA 2HLHA 3GT4A 3ICWA 4XB2A 5EFZA 3NHUA 3DV0B 2OCXA 2BELA 1VKNA 5JQWA 3AF6A 3D4NA 3FDJA 1JQLB 1IHOA 1IZ9A 4CQNA 4FD2A 3VPCA 3OFJA 2DBRA 4FDLA 1N2JA 5I5GA 5F3RA 3TR6A 1BN7A 4RIIA 3JASA 3ZW8A 2WABA 1H6AA 1HL3A 1O95D 2ZYUX 4O8CA 5IKOA 4X1YA 1Y1LA 3T9CA 3DLBA 4F6RB 3U80A 1G16A 2J9FB 4WFJA 4UBKA 4R1NA 1XKXA 2WU0A 1Z18A 2CLOB 4KZKA 1HK7A 4HC4A 4B34A 1DAFA 1QF6A 3WXMA 3H0KA 2C99A 3P71T 4ALKA 5KKNB 1FTWA 5IUKC 2G1AA 1VCIA 2O8CA 1VSQA 1Z12A 2JHPA 3KYCA 1Z5ZA 4H3VA 5IRCD 1RWNA 2B7LA 5EHZA 2V7VA 1MN6A 3PRJA 3QWIA 5BNFA 3CPSA 1OHHD 3IL2A 1I6MA 2ZBFA 3LQ4A 1CY2A 5C3MA 3SIPA 3F5QA 3C15C 1BEUB 1V95A 2ZWMA 4OFWA 4B9EA 4YJHB 3DR5A 4D9GA 2GCGA 4GC5A 3ZHYA 3URMA 1XDSA 2A9FA 3NDIA 1W4CA 1WE2A 3IIMA 1AGYA 2PWYA 4BRSA 2KPOA 2RH8A 1D1PA 1WVGA 3S5UA 2F8SA 1YC5A 2UZ1A 1SB8A 1N2CA 3TLKA 3SEAA 5SZJA 2WSBA 3YASA 1YV9A 3GUHA 4GX5A 2RC6A 3EPHA 3G9UA 3VU9B 2Y76A 5MDHA 3AVPA 3I5MA 1XRLA 2ABWA 3I0MA 3ZBQA 3I2JA 2J45A 4LFAB 3WWYA 3SKYA 1QH9A 4ND7A 4JVOA 4PLVA 3WTCA 1O0CA 1GPBA 1NLFA 1CUGA 2ERYA 2RBGA 5A2QA 1AUQA 3BBPA 3OZCA 3L7CA 4JCOA 2K2WA 2XBMA 1D4OA 2PH7A 3Q11A 1RAAA 2F1JA 4KB5A 2PS1A 5T57A 1UWKA 3BG5A 2ZJFA 2G0TA 5CAEB 5HGXA 2FMFA 2ZI4A 3MWKA 3UYKA 3HYTA 4KQ6A 1E2QA 1U0LA 1NJSA 4FEYA 4NICA 4WE3A 1W2GA 2I3GA 5E7QA 1CUZA 3T7CA 5BY2A 5HRAA 1G8JA 1EHCA 2E4XA 1S96A 1SMKA 2NYRA 4UBNA 2PMWB 2FE1A 4OQEA 4FT4A 1AXRA 4HH1A 4O59O 2LUOA 2V54A 1N0HA 4H0NA 4HGNA 5JS2A 5JBQA 5HCIA 1NWHA 2AFIB 2VCEA 4LCBA 4RZUA 4QNMA 5AJWA 4REOA 1KA9H 1JI3A 2IOQA 3TVYA 1NT2A 2FZWA 1GD1O 1XLTA 3DOCA 2JJYA 4HWPA 2XUOA 1XNJA 4G37A 4WFQA 1CWUA 3WP0A 4PYKA 2H4WA 2J6CA 2V8BA 5GMOA 1ZY2A 4IG9A 1UBNA 3RGGA 4D4JA 3T5CA 4AT1A 1C3JA 3B52X 4JEMA 3EMDA 2JH3A 3SK0A 4IGAA 4OLJA 2JJ1A 3AY3A 3MIZA 3ZK8A 4CKYA 3NAZA 1EXWA 3OQ6A 4WK0B 5DXJA 1MIOB 2O23A 3NKLA 3ON5A 4H18A 4M7OA 5HKKD 2P7IA 5FBQB 5A62A 1UC5B 4PNEA 4DV7B 3MTEA 3I8XA 4LY3A 1YACA 4Z3DA 3ZWBA 3WIVA 4I14A 2ZLBA 4LCJA 5LBUA 5IXSA 2BF4A 4JJKA 3WRYC 4QTTB 4D0GA 2XUHA 3FGPA 2WM9B 3UXYA 4BNYA 5DOVA 3QFSA 1K8XB 1J6UA 3ZS9A 1U8EA 3CX3A 1ZRMA 2WQ7A 2BBOA 3C6XA 2LW7A 5L6MB 2NSJA 3AKDA 3FM9A 3NDPA 1ZJ5A 1XTQA 1Y89A 4L76A 1Z88A 2QX9A 4NPCA 2WD7B 2EL9A 2HIAA 4U7GA 3ZX4A 5AI4A 2VHEA 4B3JA 3HNRA 4WGGA 1NBEA 1NF9A 1XQXA 2GPYA 4EMUA 1UJMA 1CR0A 1P5ZB 4HHEA 3RFFA 1UXHA 4MS3B 1DGQA 2M98A 1SVNA 3T3OA 1KQPA 1D0VA 3OICA 1IULA 1XD9A 2C8LA 3K1YA 3PUYA 2B6HA 3CNHA 4HN2A 4P80A 3WBFA 4BVJA 4I9NA 4JU8A 1QIEA 5DIZA 3DUFB 4F5ZA 5FFFA 5SZIA 2CZCA 5DSZA 1GYPA 1ODSA 4MB2A 4DZTA 1IOVA 1FZQA 4DBLE 5A3SA 2I7TA 1JNYA 1FVFA 2FN7A 4DKXA 5DNYB 1Y3IA 2IH4A 1CG6A 3PHHA 2J8ZA 1Y4SA 3GIWA 2E82A 3NVDA 1VG9B 2AZTA 2GLTA 4RK7A 1PK8A 3T7DA 1TI7A 3VJLA 4MCJA 4B6SA 4EY5A 1QRAA 2GBPA 1CRWG 5KTTA 3ROPA 1PW7A 4BNVA 4WZAE 2MOKA 2CNLA 3U3RA 3C5EA 2VJMA 3BERA 1WKBA 1T1GA 2JFQA 1O9HA 1NDHA 1QDUA 3UCXA 4HB4A 5C18A 5C7LO 1VHQA 2PN1A 2GETA 1XQYA 3HP1A 4MQFB 3WRXC 4J0CA 1K08A 1R1DA 4WKCA 2E4VA 1W5BA 3OFNA 4LXQA 3A70A 2GXQA 4EHKA 2ZXEA 1NQUA 4O4LB 5HOEA 1M0EA 5KNDA 3BRWD 3OKCA 4M37A 2FN3A 4YRQA 1J23A 1Y7PA 4PLHA 1QFYA 2HK9A 4RLQA 4EVIA 1I6KA 5FNVB 3PYMA 3SDBA 4P4SA 5KSWB 3CEMA 3JCZA 5IJWA 2FDCA 2FP4A 2B4RO 5F3DA 2UZ0A 5F2OA 3HDJA 2XKAA 3V42A 2DR3A 3QOYA 3UBTA 1Z5NA 3IQHX 5MGBA 2BVNA 1WZIA 3EG9A 2IE8A 4AZVA 4BNMA 5KDDA 1Y1QA 4YRFA 5JSZB 2IYTA 4CEHB 4QGGA 3ILXA 3H65A 3EGXB 3IOEA 4O1IA 5ALKA 4LA4A 4PZDA 2WM3A 3RSOA 3FWKA 4DNPA 4BO0A 2B69A 2J59A 2QVBA 1EZ4A 5AUQA 4D2IA 5BN1A 4BNIA 1N36B 2IOFK 1T9AA 3PJGA 4FNOA 2Z3VA 4JLNA 4FFDA 1YL7A 2XA2A 3TLEA 3G5LA 2JIOA 2QRLA 4A2PA 3DC2A 1RKUA 3O4IA 4NV0A 1XMJA 1DQSA 1JSCA 3DGEC 3QEMB 5JO9A 1ENYA 2ON6A 2PBRA 4M0UA 4ZDWA 1TC2A 1NT4A 3RNLA 4B6EA 1QQAA 4NCBA 4FIZA 2O8FB 2G0AA 2FOLA 2ZIXA 4BEBA 2CL7X 1RKBA 2AW3A 3DKIA 2DYKA 4LBYA 3EY9A 3PXDA 3WWOA 4RO0A 3OZFA 1XLUA 4LZOA 4NK4A 5TMEA 1OGYA 2UXCB 1DP4A 2KBEA 2OG1A 3RABA 5B55A 1USKA 3ST7A 2ZXUA 3L0IB 4ASUD 4EO9A 2PUAA 4V0QA 2J4CA 3NS7A 2H7CA 2JCXA 1AB5A 4GQAA 4M9SA 4MI1A 4EMTA 1ZDMA 3C2QA 3WJ7A 1QIFA 1S2DA 1T4BA 2DWUA 3L1IA 1F60A 1D07A 2V55B 2W2KB 5EZSA 1WCIA 2Z4RA 1SY7A 3FCUB 1L8AA 1S89A 3DTYA 4PX3A 1X92A 2YZ2A 1NBIA 4TLLB 2GM4A 4RCZA 4UPDA 3IPYA 4UU7A 5H0IA 3M9XA 4OJMX 1XELA 2C5FA 4H2DA 4BNFA 1NTOA 1OC4A 2BR4A 4KFTA 1JDZA 4MLPA 1I4EB 2QROA 3KVYA 4ND5A 1VG1A 3O84A 3PQ2A 4KTVE 1KARA 4L07A 4MXDA 4PSDA 4R8RA 3T1OA 4PC3A 4UVEA 1UBFA 1C1DA 4UM9D 5E3IA 1LDYA 5KTKA 1YZFA 7YASA 4Y6RA 1PQWA 3W9BA 1D2EA 1NYLA 1TIKA 3N0WA 2WJ3A 4LE2A 4PN3A 3TCNA 3IB6A 1AS0A 5JWHA 2GAOA 1KAGA 1E6EA 3KZXA 5E0KB 4RKFA 3NI2A 1X86B 4GGPA 4YRCA 3NHWA 4PPNA 5JXWA 1Y37A 1G2IA 2XHZA 3VMMA 4RDXA 1IEXA 3QLUA 4R68A 2VKTA 5LOVB 4KLNA 1V71A 4QQ8A 3EEQA 3F6PA 3WGGA 3OQNA 4R81A 5K8TA 1WBBA 2O2EA 1EESA 4QG7A 4EZEA 1FYXA 4LN1A 4DV4B 3TRDA 3PYXA 4CNBA 5IVDA 2IBTA 4NBWA 4OPMA 4JVLA 2WJAA 3B5JA 2WJHA 2GQ0A 4EO4A 3L7JA 4YCAA 5LM3A 2YWEA 3G2MA 1A8IA 3O94A 1PI3A 3WLOA 4ZMRA 2VNAA 5A4KA 3L1JA 2BSXA 2JLRA 1BHQ1 1M6HA 3PUXA 2QA5A 4K3UA 1TTTA 1DXQA 4MVCA 3ZHQA 4OK3A 1Z0FA 2ZTLA 3FIJA 5EZYB 4EECA 1JLRA 4KSYA 2IU3A 4DL9A 1GRVA 4JA2A 1AJEA 3LNTA 3P5SA 3HJHA 4IDQA 2OPHA 3IESA 5BURA 1ZI8A 1NSFA 3MJRA 1F4LA 4MPTA 5BOVA 5IABA 2VP4A 3MJ4A 3WGVA 3AUSA 3ZDXB 2QP3A 3KWMA 1WCXA 1M6VB 1NYQA 2FN9A 2FPSA 4KQEA 2W42A 4NMWA 2E4WA 1Z2DA 2WK1A 3GCDA 3K5HA 5FLXA 2VN8A 4D8XA 2A33A 2O3UA 4NJEB 4RZSA 1Z4LA 2Q1YA 5PGMA 1ECCA 1DRWA 1M5UA 1J22A 4X45A 2D74A 1O3YA 1P0FA 2JK1A 4L6IA 3CJRA 4G5GA 4L72A 4GM1A 4HATA 4CDRA 1Y0BA 1KR2A 3PC8A 3WIOA 2R85A 3LHIA 3NKVA 2AI2A 3KNZA 3V4VB 1NP6A 3VUEA 1HE3A 5FUQA 4A6DA 1X8KA 3G0HA 5HGJA 4ARBA 1Y1PA 1PE0A 4GR5A 4HWSA 3SZOA 3NGXA 4NHOA 5HKLA 2CB9A 1EXDA 4XGRA 2QTMA 3THWB 4C2AA 1BWQA 4JI8B 4K8RB 1U3GA 3P9NA 1X87A 5ALGA 2GVZC 1G8KA 1JVBA 4U2EA 4CI9A 1K1EA 2XNCA 2AMFA 2V8OA 5AHKA 4DJJA 3ZHRA 4XGIA 2GFHA 3C3KA 3EEYA 3LQYA 3HR8A 4LZLA 3PG5A 1RPNA 1B8UA 1ZXLA 2D2EA 1GGHA 5I3CA 4MROA 4UCXA 4OO3A 4DFDA 5L4LA 1U1CA 4BN5A 4FW9A 1A04A 2FMHA 5ALRA 3AY6A 2XUPA 3LCUA 3KTAB 3LLSA 5JYBA 5DGCA 1KS9A 3NIBA 1US8A 4BLTA 1PJBA 5TC4A 1E2JA 4CM6A 1NULA 4KR9A 2BBSA 1SIWA 4LJ4A 2NNLD 2VQ3A 3ABOB 2COUA 2HLDD 3V8BA 4AWXA 4PN7A 5HRUA 4Q7LA 3CH7A 3ODGA 3P2OA 3RYCB 4DIMA 3AIKA 4LX8A 2A9PA 5B7PA 1H2EA 1QGYA 1RTTA 1OXUA 4JLUA 1QONA 2I3AA 2QN9A 1ODCA 3PGJA 5JSQA 3U44B 1R6XA 3R5TA 2QZ4A 4M2LA 3CLVA 5I7SA 3B70A 5HFAA 3WMRA 5TB5A 4YXWD 1N7GA 3ZK9A 5ALLA 4DCPA 2GYVA 4DQLA 4HNQA 4FK8A 4M6WA 2NYAA 3GLIA 4MQ6A 2JB9A 1I4DD 1O2DA 3VKUA 5EKTA 1EE2A 5CCBA 1GDTA 1L5WA 2ZB7A 5FWDA 1ADFA 1R0RE 4GX1A 3HCRA 3MCUA 5FFMA 5F4ZA 3OU2A 2QT1A 5I9LA 3FCAA 3PQDA 1Q84A 4W1QA 4QPCA 3SS9X 3H3FA 3KQLA 4TXHA 2VPTA 3U4DA 1X80B 3GP5A 1K8QA 2YC4C 1U5BA 2SKCA 2VWQA 2GAIA 2ORYA 1PJTA 2WAAA 1EUZA 1Q20A 1OA1A 3N2YA 3P20A 3L4EA 4GNRA 2HNBA 3EFBA 2JAOA 1NJ6A 4EG1A 2PCLA 2ESRA 3ZCRA 3MYYA 2R1VB 3IAAA 1K7YA 1QMGA 4FE7A 3OWOA 3KXKA 2DFNA 3E81A 4ER3A 3QEBZ 4P98A 1E18A 2ARKA 4TV9F 1UJBA 4FR5A 2WT9A 4R9RA 2QX4A 3LU1A 1CNEA 2J0SA 2BMFA 4FP9A 5ESRA 4J07A 1EFTA 2JAQA 2NXWA 2LE0A 2ECOA 4CMIA 4K6CA 1BMQA 4ZVNA 2Y1WA 1N4DA 1NP3A 2FW1A 3GFOA 4X20A 2R8XA 3SDSA 1YS6A 3NANA 2ZE6A 1BHJA 2G71A 4OBBA 1A4UA 5G41A 3U6KA 3BFXA 3COVA 3ONWA 3ECSA 1O4VA 3MWFA 1WPQA 4KAJA 1IIRA 2C20A 2X13A 3QHAA 1CEYA 1Y82A 1SHJA 4R8MA 2PUJA 1XWWA 3NOOA 3WYEA 4RFVA 2PGOA 3WIUA 2XMSA 5COBA 3D2AA 3QI2A 1JZQA 5LLDA 2R8BA 1X7WB 2CHGA 3GGGA 1KNQA 5YASA 3FROA 2BONA 1GSOA 4XIJA 5JS8A 3BCUA 2FSIA 2I8LA 2ZVJA 3H11B 2J08A 1E2MA 3OM0A 3K8QA 3KQVA 2JEOA 1QIIA 3ID6C 3N7UA 5FTWA 5DBEX 1OYVA 1XZFA 3PD0A 4KQHA 2Q6TA 3TQTA 5JWOA 1W52X 3HKEA 1IHYA 1V11B 2I67A 4N8DA 4QBKA 1MRSA 4FZRA 3ROXA 5I4IA 4PLTA 4D4HA 1QFZA 2K7FA 4D6YA 3LL4A 5CT4A 3RVDA 3SXPA 3WFJA 2HMAA 1MJGM 3NXSA 1G21E 4NY1A 1ZGJA 3PS9A 4I9GA 4OOEA 3C39A 3ZZUA 1QCYA 3TGPA 3DFFA 2FW7A 3A1UA 3QU5A 4G4JA 3U81A 2YWJA 3WI7A 4L5YA 1COWD 3CGWA 3ESZA 1R3DA 1AHIA 2PMCA 1JDNA 3AWIA 2JJ2D 5FTMA 5DLYA 4WLNA 3LYHA 3BWXA 1MQ9A 1UPTA 5B3JC 3ZD7A 1DBIA 2LDXA 1UAGA 2WVJA 4HMPA 4IO0A 4Y0NA 1JYSA 2GF0A 3A6ZA 1XOIA 2PU7A 2QTWB 3IUJA 4I5GA 3X2EA 3F2IA 5A3JA 1UXJA 2IH5A 4P83A 1MDFA 4CMJA 5HBRA 3GLFA 1UPFA 2F1IA 4RADA 4S1WA 2MMGA 4V24A 2ZT7A 5FL7D 4BWFB 1ZNZA 4DZRA 1A3CA 2I7CA 4GAEA 1CR1A 2SKDA 3AONB 3KU4A 5DE3A 3UH0A 1JIKA 1MO6A 5TMBA 3WYNA 4U5QA 3KYIB 2WJWA 3CR3C 3GLRA 4ZYTA 2JGEA 1KOFA 1ST3A 4Q7EA 4RYDA 1AD2A 4UVDA 1I4OA 1Z22A 1DPGA 4HI0E 3BTUA 1HI9A 3HZOA 3BEOA 1FTYA 1MABA 4KJZA 2A78A 1QS0A 5DYWA 5B58C 2FEXA 4QA9A 1QP8A 1WTCA 3QK7A 2NU9B 5ITZA 3U37A 1AGNA 1J24A 2BEVB 2XPCA 3LHSA 4NU5A 4R2WA 4DUZB 3IVXA 4M46A 4QXRA 1GT91 1Y3BE 4O02B 1ZOPA 3DDNA 2GYYA 3GEIA 4K9LA 5TS2A 4DLBA 4EBBA 1P5JA 4GOND 3T52A 1K7CA 4MR9B 1T8RA 3MMZA 4GOOD 4WBNB 3FYUB 3WL5A 3M83A 3O82A 4GM4A 3DOEA 5EQDA 1EP1B 3W77A 3O3CA 4OGGA 1WB5A 3QLEA 4YLEA 2JATA 1SHLA 3H1AA 2VRCA 4YPVA 3QKRB 4X93A 2W6CX 1WU8A 4C4OA 3UHAA 3AF2A 4O08A 5EZYF 4AYXA 1W46A 2JFHA 5TPWA 3FZEA 2C88A 4UOQA 5AFSA 5AVXA 1ZH0A 3L0OA 2JIPA 1X7ZB 3L92A 3DG9A 4ZHQF 4XFKA 3VPBA 1KI6B 2VH5R 5EYPB 1DCFA 2GX6A 3KT3A 2Q2NA 5AK4A 3NTQA 2PJDA 3GMIA 3KSAC 3LC1O 5DZSA 5AHOA 5FF9A 1WZCA 1XUOA 1KYVA 4IVPA 1AZTA 3GLHB 5JCOC 2ZYSA 2JFBA 2XDAA 3KYBA 1DKRA 4Y2HA 4CR7A 4KQGA 4ETWA 3ABRB 3F49S 4MMZB 5LJIA 1NW7A 4EG0A 3FKSD 2FNAA 2QR5A 3B9RA 5EP3A 1RRPA 3W8RA 1K7FB 3CUSA 3O7MA 1J9ZA 1Q2XA 3BGIA 1U8AA 4DMGA 1BYUA 2AXNA 5AIBA 1PFUA 1SXJD 4UBJA 2ISSD 3TMKA 1MGPA 2P1DA 3CJTA 1PZNA 5CBKA 2I7DA 2NTYC 5J1TB 3VJRA 5JAOA 2CLSA 1IJBA 1D2MA 3RU9A 5D51S 2IZ5A 1QRTA 1SQ6A 2A1TR 1J2EA 1RYHA 3KJEA 4JMPA 4IP0A 2WG1A 3DOUA 3N8GA 4B40A 1TM7E 1RBZA 1X1DA 2H2IA 3EVEA 1CZKA 2IP2A 3CKLA 1YULA 3H86A 4J1SA 1NXSA 2J0EA 2ZULA 3MBKA 1EWTA 4RF3A 4Y2SA 5HQJA 4US0R 3MTGA 2WDZA 3MG9A 1HO3A 4FMCF 2ST1A 4LGYA 5FTJA 1IN8A 3FG9A 1C30B 3NRBA 1ZH8A 3EGDA 4NG5A 3VR0A 5I7RA 5KNBH 1UEJA 4JJAA 5AI0A 1MC1A 2ZM6B 2CN1A 2CNBA 4OQLA 1KE2A 3UENA 4GS5A 3VVCA 4M83A 3K6SA 5T6MA 3S2SA 1VCOA 4QBGB 1C14A 1BNCA 3MS7A 4JGIA 1DEAA 1I7SB 3LWNA 4AZSA 3MJCA 1EK2A 2NXCA 2QL7A 4MV0A 3FOBA 3LF1A 1Y1RA 3MN1A 3HCFA 1CBUA 2OQ2A 3LVQE 4BLPA 2CXSA 2OUIA 3AEXA 3MT7A 5H81A 1TU4A 5HS6A 2JI4A 3L6DA 2UYYA 1HDEA 1S5PA 1L1RA 1EFUA 1XEWX 3JARA 4PTYA 4OGWA 5DO9A 1A8HA 1WCWA 4JJ7A 4AY4A 1M66A 1YRLA 4D44A 4ZVMA 4G5SA 3BB3A 3KWLA 4BNDB 3M5PA 3UCEA 1CEQA 4UEOA 3UT6A 1PS0A 1UPCA 4MIYA 4RKYA 2B0CA 5FJIA 3TR5A 1U2GC 4U63A 1RDFA 3RK1A 3SC2A 5JJCA 1J0CA 3FF4A 4MUAA 4NJOA 4YP5A 1P81A 3O03A 4E5MA 1N6NA 1A7KA 4KE7A 3O8LA 1Q0SA 4ZRNA 1DBPA 2BRUA 1AKNA 2LDBA 3FYSA 4HNAA 2J5BA 3KR1A 2DTXA 1S8AA 3ZCVA 3W8NA 3F78A 3A14A 2IWRA 4CIVA 3UJHA 5CD9A 1WCV1 3KEGA 5LB4A 4PXYA 3ER9A 4HQOA 3S99A 2JLXA 1LPNA 3IQZA 4LF7B 1HE4A 4HDAA 4HLCA 4B9AA 4O4IA 5DGDA 1TTPB 2FSVA 4JR2A 5EE0A 3G2JA 4KJXA 4DAEA 4YBRA 4AZWA 3IEMA 2FDRA 3N53A 1A9QA 2WP8J 2ODAA 3KBBA 2GPJA 4FHFA 2SHKA 5FOTA 3J81k 1RC1A 1SOUA 2R6HA 4LOLA 2I03A 4HDSB 3WB2A 1XVUA 4V0NA 5DTQA 5DW0A 1YK1A 1MCZA 1NRWA 3ABQB 1LD3A 3F46A 3HBJA 2WY2D 3STVA 4Z4QA 2XAAA 3L7BA 2Q3BA 2ZQYA 3L8ZA 1K66A 1XYVA 2HCBA 2XCIA 4MV5A 4EFKA 1OVGA 3CX4A 2NUTA 1FE8A 4E4YA 3SWWA 5J23A 1IN7A 2N46A 4ZN6A 2JK0A 4R1QA 2PQ0A 3TW8A 3N2EA 4RHYA 3PGLA 1JHOA 4NH4A 1T36B 1N9GA 2QK4A 2H1SA 3E9RA 5EP1A 4GM0A 1DJMA 4MGYR 2P9FA 4GR9A 2PX8A 4B3CA 5IJZA 5HF6A 2C03A 4LG1A 4DA0A 3ZH2A 2KLHA 4HK4A 3U4GA 4ZQFA 3HK2A 1CY1A 2AR9A 4RIGA 1Z3IX 4U9UA 2MJLA 3AJDA 2G4CA 3QUCA 4WZBA 4XPIA 4DJFC 2A67A 3VUFA 4LNHA 4V38A 3W6OA 3NWOA 3VDMA 4B5KA 2PAAA 4GQBA 2ZWVA 1XZHA 1KMHB 1Y7LA 1XZQA 4PAMA 1E7RA 2ILVA 3RYIA 2DPGA 2EBFX 1ORIA 1ZK4A 2ZIVB 3DNPA 1RPZA 1TDJA 2TSYB 3I8SA 3VSCA 4XCXA 3O0TA 2D59A 3IP3A 4BE4A 3O1JC 4FX2A 1A4RA 1S02A 1YC2A 2CYBA 3KOOA 1W7AA 5CFOA 1PYDA 5BSMA 3U49A 2ZTHA 2G6BA 5LDDC 5ECWA 5KDOA 4KU4A 3KVRA 1NR5A 5LQJA 2BGGA 3CEJA 5TLSA 1PK9A 1MLDA 2W90A 2VH2A 3TPFA 1OC2A 2PHZA 4QFDA 2DETA 3R7WB 2C54A 2R65A 4BB9A 4C08A 1PO7A 1QGZA 5DX8A 4OSEA 3SSOA 3UPUA 3ZDDA 3ROEA 4BZZA 1T9HA 2I4NA 3BIJA 4MVWA 4D56A 4DA6A 4X41A 3ZE6A 4KOEC 4RMJA 4G67A 3B13B 3BK1A 1FA9A 4P7FA 5KJCA 3EX7C 2PT5A 3GLQA 3T1VA 1IQRA 2BKVA 2G3YA 5EPUA 2AXQA 1OJ7A 2W4IA 1AX9A 1WMDA 2H1HA 3LVFO 4IPTA 2OPBA 4JN6B 4KO2S 2IW1A 4JK3A 4XUGB 1CHDA 1L7RA 5CX1B 3NX4A 1TU0A 2ES4A 4F85A 1TM2A 1EX7A 2QNBA 4Q19A 1BE8A 3GELA 3MWEB 2V6GA 2NO6A 2C2XA 5DCWA 1C3EA 1KYXA 3ZHVA 2EW2A 2O8NA 3UICA 1MU0A 2ZZKA 4BVLA 1OFIA 1E2IA 4IEEA 2P2CA 4HD8A 3P2KA 2YMQA 4D3YA 3IAFA 4HGOA 1P4RA 3DHVA 2JLYA 5HF5A 5LWHA 4WVFA 3T7SA 2LRHA 1KDYA 4CFSA 4UATA 1KJJA 2XUKA 5E1DA 5I9MA 4XYGA 2OB1A 3SZ3A 2P9HA 4LJRA 1K7SN 2PRSA 4U7PB 4XJXA 5HF8A 4YCMA 4IJQA 1EWYA 3Q3JB 4RLSA 4KPYA 5F73A 4JXKA 4W7SA 4B35A 1LI4A 1QWSA 1SULA 3NNDA 4C3VA 4EGAA 4JBIA 1RQNA 1F0PA 2ZI5A 1YFZA 2HHCA 4Y0VA 4UE6A 1WL8A 5JDCA 3A3PA 2X9LA 2OFOA 5DBHX 3CN9A 1PG2A 1U3FA 2QMOA 2XBLA 5GONA 4IMJB 4PO1A 1U2DA 4AC9A 4WEOA 1HTTA 4KPFC 4PZLA 3TE6A 4N3CA 1V9SA 3K9CA 2IS1A 2PMDA 4GGOA 2PS3A 4MI6A 5JOQA 1CZRA 1NNI1 3UC5A 2ZB8A 3I5UA 1R74A 4OQDA 5AM2A 2I6FA 2F9FA 4LBVA 3DL4A 1SKAA 1ZMTA 1MZPA 1YQQA 2YDXA 2PG3A 3TRKA 3HJAA 3E58A 5LYJF 3JWEA 4GXQA 4F7DA 2FKAA 2PEZA 4IYRA 5TEVA 2QVXX 4L0QA 5AQ1A 4I50F 1JEAA 1KK3A 2FEMA 1XZAA 4PSKA 1ZI9A 1LRJA 2OZKA 4K88A 5JNLA 4OXIA 5M29A 1M10A 4EYOA 2WZCA 1PFWA 3ZK7A 1XZNA 2AJTA 3VPGA 1A0OA 1A5SB 2V7TA 1E5LA 2ZIZA 5T4FA 2QQ5A 1YJAA 3A9WA 4I81A 3ER6A 5E6RB 3ZHSA 3M4JA 3ZCTA 4AKIA 4IIVA 4RD3A 5JRZA 1QSGA 2JRLA 3G5AA 4IFBA 5FUXA 2FXIA 3TXYA 1W5SA 1NC3A 2XCUA 3AHJA 3N2NA 4MI3A 5KZMB 3PVZA 1DT3A 2VSYA 3U0BA 2JI7A 3BFKA 3DXFA 2B7CA 1IUKA 1FNDA 4KYTA 1PV4A 2RI0A 1SD2A 4JDPA 4DDHA 2EFEB 2BFNA 1EFLA 1IEQA 1XFAA 2JNWA 2PZMA 3EQZA 2P9BA 1V1JA 1XNHA 2ATCA 3ONEA 3W8FA 3VZDA 1P3Y1 3PJRA 5BPHA 2Q5OA 2R7AA 2H0AA 3CR8A 3HP4A 4HX2A 4PPGA 5FWXA 5ALHA 3CC8A 2MINA 5IC5A 3WJAA 5AVTA 1KYIA 1U7PA 5FA8A 2YVQA 2GHRA 4YP9A 2XRMA 5ER9A 5ALFA 1MR3F 4A92A 1L5ZA 3IT1A 4G1MB 2J32A 1XEXA 4K26A 1OGIA 2G8LA 4CI0B 3RC7A 5A9SB 3U7GA 1L7OA 2YHUA 3ESYA 4I4NA 3KK0A 4XGKA 3ZWDA 4F7WA 1LCIA 5DASA 5IMBA 5IXJA 3U7FB 4L78A 2O14A 2P40A 1E1CA 2C3YA 2XSZD 4JEUA 4JI2B 2WUFA 3FNQA 1FXUA 4HEJA 2LVBA 2V4MA 1QGUB 2JI6A 3DE7X 3I9LA 4AAYA 3IOMA 5CJPA 1IN5A 1B14A 3BMOA 3LA8A 2DPXA 3P0FA 3BHJA 4MLCA 2GUGA 3GNSA 4DIBA 1KJYA 3ND9A 1Z4KA 4LJAA 1BVRA 2WFLB 4O4JA 2YW9A 1M6EX 3ZTTA 1P2SA 1X1TA 1ZD1A 3I1JA 4GOXA 4YP1A 3L46A 5C8YF 4AKSA 3IEUA 4RULA 1NU6A 1AK1A 2KWIA 2C07A 4RANA 3FOEC 5ALTA 1GTSA 2Q27A 1QHSA 3N28A 3OLZA 2JEYA 3ANTA 4IICA 2HKIA 5CG2A 3NH6A 2HEGA 5H82A 5B57C 2DSNA 2G70A 1IPEA 2XD9A 2RGEA 4OA5A 4RFSA 1T3GA 2WWXA 1QYCA 1JEYB 2QN2A 2Q21A 3RTEA 1T0JB 3L05A 1R6TA 1J0BA 1IJKA 1HE8B 3C8UA 3FD8A 4B3IA 4J7XA 1QQ5A 4RMGA 3KWFA 2AX4A 2Q1UA 3GI1A 4N3BA 3EASA 2WOOA 3LCVB 4P3YA 3SR4A 3W6PA 1XDDA 1UP6A 3R0IA 2WUEA 3BXEA 1JAZA 3KTOA 4MOWA 4MIOA 2UUAB 1LJLA 3ENKA 4BMYA 5FWAA 1XTIA 2Z2KA 4EELA 1H2AS 2JJ8A 1B2RA 1BW9A 5GV8A 1GTL1 1V1RA 1NP7A 1RXYA 2D1RA 3EGEA 3OQIB 1R8XA 1YR8A 3LC7O 4S1OA 2B1GA 5C1IA 3TWOA 5G02A 5E3HA 5GJBA 2RGBA 2BRUC 4JELA 4KPGA 2OAGA 4G8DA 2FRXA 3PK0A 4LECA 2P65A 4P7GA 4P53A 4ZVQA 3P0IA 3DP9A 3RBZA 3ZCPA 4H7PA 1AM4D 4Y6OA 2ZYTX 3A04A 3PDJA 1P6XA 1HGXA 2R8RA 2GWRA 3GN1A 2P2SA 2PKWA 2PRZA 3M6AA 3PXXA 4FSHA 3VO2A 1I8TA 3F6CA 4ABYA 1E2DA 1GDDA 3WDLA 3SZLA 4Z1MD 1M6YA 2ID8A 4HWKA 3DEKA 1M8JA 2XYHA 2A35A 2P4HX 3BIXA 2EYUA 3FMIA 3NJRA 1I14A 3P9YA 2VUUA 4HDMB 4PQEA 5I7UA 5IUJC 3UK6A 5KHAA 1F0NA 1VMIA 2K87A 4PLWA 5CB8A 6ABPA 5DJ5A 4TZTA 4Y9SA 4NAUA 2DQYA 5FL7A 3OSZA 4YAGA 4RTQA 4URXR 5CLGA 1HH4A 5FR2A 1EJ6A 4J49A 4ZCPA 4MGEA 4CCYB 2AVDA 2Q5EA 4YN3A 2ONKA 2MYUA 4ZO6A 3GFGA 1N8NA 1OU0A 2ZIEA 3C16C 3M1LA 4XSGA 5C4IA 1RNLA 1TIPA 2HMVA 3EZLA 3LKBA 4J4HA 4XJTA 2EFGA 1NVAA 4F2WA 1LSJA 3G5UA 2XKKA 4YQZA 2Z8ZA 4MV4A 1CDOA 2Z1NA 3ZOKA 1CE8A 1QYDA 3C6ZA 3JR3A 4P1ZA 3OE5A 3W90A 5HUHA 1N2HA 3N8DA 4V3BA 3U40A 5IVPA 2FEWB 5AR1A 3QE0A 3KWJA 3AP1A 3USCS 4AMZA 3CX8A 1QFJA 3U7QB 5F2EA 5JHGB 1E69A 1PIWA 3C70A 2Q50A 4L85A 2BFCB 4ENQA 3ZXSA 3WWDA 2O7RA 4NK5A 1DKOA 4EJSC 4IUBS 4GMKA 4PS1A 3D7SA 4G56A 1L4KA 1HA3A 2ZE8A 5CDTA 4H3HB 3TUJC 1R15A 1HOXA 1YJ8A 2XMGA 3QXGA 4H0CA 4HTFB 1GV0A 4IINA 3ROTA 4HEA1 1BCRB 2PLFA 1TD9A 3X1WA 5CYGA 3Q8KA 4H4CA 4N01A 1T91A 2OEPA 4GO1A 3GJTA 3SNHA 2B5OA 1MB2A 2Y4OA 4NJMA 1TM1E 2BN4A 4Y2TA 2AA3A 3LQFA 1OTHA 5AM4A 5KQGA 3UXMA 3LV8A 1WHSA 5L9AA 3JQ8B 4R3UC 1E3MA 2DXIA 1TCBA 2RSLA 3HA2A 1KBOA 1WJGA 1Y1SA 3ETGA 1HDZA 1QG6A 4AJ2A 4E5PA 2C97A 4HLDA 3JQ9A 5T4BA 2OBNA 3X1KA 4NABA 1GXSA 3LG2A 4K81B 3S5JA 1M34B 3K35A 4JLKA 3KQTA 1XCBA 4W1RA 2ZJ2A 3UV6A 3FRIA 3OCXA 4CNQA 4FT2A 721PA 2ECPA 2FX3A 1VIDA 3WQSB 1BOFA 2Z5VA 2O5VA 1XJ0A 4TROA 4ER5A 5AKIA 1UPAA 1U5AA 2DBQA 1PNOA 3JQ7A 3EARA 1WW8A 4JJEA 2G9UA 3FBGA 4Q7KA 1FJXA 4H1UA 3VPDA 1HORA 4UAGA 2R86A 3UAWA 1DU4A 1FUUA 4EUEA 2J3LA 2I29A 4GHWA 2HRBA 4JEIA 2HF8A 4WXHA 2RCYA 4COOA 2J9GA 3TG2A 2NQ8A 4KWEA 5H3HA 1SVOA 3GC6A 3PRHA 2K4MA 3RS5A 4ZEWA 2D2IA 1G60A 1C0IA 1E94E 2Q41A 1P0MA 3SR0A 4M8IA 4JC8A 2D2VA 2BZ0A 1Y6QA 5B3LA 3NHMA 4YY3B 4NULA 3IPCA 3U4HA 4JZKA 3RRFA 4UHFA 3WKEA 1XU7A 4XM1A 4O0MA 2COEA 1QHEA 3FN4A 3GUYA 2AR7A 3EZ2A 3TMYA 4ZODA 2CSUA 2O4UX 3BIOA 3WL6A 1CU1A 3MTIA 5BQPA 4HUQA 4IDHA 1C7IA 1OBHA 4I50B 1C8LA 3ZKWB 4DLNA 2C8VA 3DOFA 1Y33E 4DM7A 4HB2A 2HIHA 3CURA 3OPXA 4LWOA 5KWIA 4YXWA 4XKJA 4JBYA 5EMMA 4UUMA 4GI3A 4G1FA 2JLVA 1RI4A 1XGKA 3C5HA 4QATA 1RWOA 4UULA 4PRLA 4B5LA 2UUPA 1RMQA 1VLQA 2H2FA 4MV6A 2P5TB 3DOHA 4KZPA 5KYXB 2A4MA 4JS0A 3DMTA 3NM5A 1U99A 3R9IA 2O1EA 1HT2E 2XYPA 2JH8A 3ANNA 1SFRA 4C0KA 2OQRA 2JIZD 1A50B 2VHZA 1Y5RA 1M6NA 3PR2B 1E7YA 1NI5A 3E5MA 1JQJC 3I6BA 1PZGA 4BX8A 2RGAA 3MCWA 3BM5A 3VU0A 1DXYA 1EIZA 1SUDA 3FMGA 1IVNA 4HGQA 1DFGA 1E1QD 2BM0A 3ORSA 1P62B 2GK4A 4E15A 2IXFA 4XW2A 5GM1A 3K96A 2OWDA 4FGUA 4KUEA 4NWIA 4P2GA 1CJSA 1OZAA 3NYRA 4FBGA 5E7MA 3V34A 1DX6A 3QVUA 1T5LA 4XRRA 2P41A 3HSYA 5CT8A 1FDOA 1XZBA 3STYA 4EPRA 4YV1A 1R4NA 2JIBA 1AQ6A 1P4HA 2LXNA 2VTBB 1BN6A 1N6IA 2OYSA 4XVUA 1THTA 5AI5A 1PHPA 3HCOA 3VTZA 4XARA 1RR6A 2NWQA 3HJUA 4UFOA 2FOIA 2J9YB 4E32A 4PHFA 5DNWA 1RBQA 2D06A 1EPUA 1FDSA 2XECA 5BQXA 1GUZA 3HACA 2Y99A 2O2CA 4Q9HA 5T3UA 1AKTA 4CEIB 3X0DA 2H31A 3A3OA 2ZE7A 1R2QA 4B47A 4D9NA 5EIOA 1P0PA 2P5UA 2P0EA 5IBCA 2BGWA 2KMLA 3QV1A 4IDCA 1MENA 4YP7A 4UAJA 1M9NA 4X3PA 1DC4A 4B6PA 2Z9BA 3WGYA 2IFTA 3ACBA 1JU4A 2QTHA 3BSYA 2JZOA 4B2PA 4B6FA 1U1GA 2EIHA 3I30X 2BEKA 4QLBA 2BHRA 3R7NA 3ADCA 4PZCA 4D8YA 3DHNA 1W8IA 2VTKA 3N87A 2PL3A 1VSBA 3DFIA 3FIUA 3TEFA 2Q8NA 1TRHA 2AFRA 4R6WA 4LGVA 4XM2A 4RTLA 2V74B 1IMOA 1FMJA 1KVSA 3OEED 4IAOA 4A73A 9LDTA 1M1YA 2PUCA 3IAXA 3WLNA 2C2KA 3EHEA 1D04A 3OY7A 3NC4A 2QX6A 2LD4A 4X6LA 5IJ9B 2EJCA 2RARA 2Z2YA 1CUCA 4U6QA 3PXEA 4M9ZA 2FPMA 3SLRA 3B9PA 2ECQA 3Q2IA 3UB3A 4ADSG 5C35A 2H08A 3FLMA 16PKA 2B2NA 2A0WA 1E3WA 3RS3A 1IHDA 1L1EA 1L7PA 2WNHA 5LXTA 2L69A 4JOQA 4LSMA 1TM3E 1RQPA 3GA0A 3ICVA 1GQQA 3DVSX 2CBZA 3TIGA 1F3LA 3THYB 1OFGA 3T4UA 2D1QA 5BORA 3VH4A 1H0HA 3EAGA 4J1TA 4RD6A 1UWLA 1NJ2A 4PR0A 2CFOA 1XQ1A 1EBBA 1RT9A 3LXXA 4GICA 3LUJA 3WO0A 3LYUA 3CGGA 4QOEA 4UDYX 4D0SA 3RYCA 1WUHS 3BYZA 2C4WA 4W1PA 3R7BA 4B2LA 4GBMA 1VECA 1U9YA 1CUDA 4YGXB 4YCLA 3UMJA 2Z6AA 3CXRA 3LRXA 4ACAA 3DD5A 1R10A 3CKMA 4KR7A 5C80A 3NIGB 2ZS8A 2XB8A 3C7KA 2O1SA 3WICA 3P7MA 1RACA 1IBMB 1LZKA 5G0VA 5JJIA 1W76A 1XVVA 4TT8A 5MGNA 2M1ZA 3QJ5A 3TW0A 3B5EA 5KYGA 2BGIA 3ZY4A 3DAHA 3U61B 4RD1A 2YZKA 3P1JA 1OLSB 1FFCA 3JYLA 2GN1A 3C6YA 1C7QA 1W93A 1W0KA 1WP9A 4FR0A 4OHVA 4IQFA 4UDOA 3V32A 1TADA 2QW1A 5B36A 3LA6A 3KZMA 3EFHA 1FLNA 1JRLA 3OJ0A 1V37A 3ENQA 4WQMA 3BE6A 4JQSA 4MQFA 1YDWA 3ZLUA 3R3ZA 5EHXA 1TO6A 4K6MA 2ZJ6A 4QQFA 3U9LA 4KYVA 3DEIA 4UKDA 3HZHA 3I4LA 5IZCA 5EEGA 1VYVA 1J1ZA 1Z2AA 5K6AC 2FZLA 4FFMA 4EB6A 2HR1A 3DQQA 3X43A 4YX9A 4QYIA 5EJFA 1ORRA 3H5TA 4YGYA 5AICA 4NAVA 1RZVA 5ESWA 5KOJB 4OQ4A 4P4SB 1D0SA 3ZWCA 4F1JA 2FGJA 3V6MA 2FP4B 4ISBA 4UOEA 1ZM7A 1S7GA 1NVVR 1DDIA 1U3UA 3NT2A 1N6RA 3Q8WA 1YDMA 3W3ZB 3V5NA 3MHTA 1Y80A 1FPQA 1SA0A 2XT9A 5J3JA 1BX0A 1XMIA 2QG9A 5F3WB 3LY9A 2PQ2A 1DXHA 3TXAA 2Y71A 3WE7A 2OV6A 1UBOS 3D0OA 4R83A 4EQZA 1SUPA 1PNVA 2E37A 3BHNA 3ZWKA 1YB6A 5HZGA 2HJSA 1K5DA 3HYNA 2HF2A 4DMUB 3IO5A 3WB1A 1K8RA 2IYRA 3JR7A 4C7OB 1K8ZB 3HWSA 3P2YA 2C0QA 4KO8A 2QV7A 2GMWA 4MKZA 1KY2A 1LSOA 3KL4A 1KP3A 2VJCA 3E7XA 3QEMA 3ZGXA 1Y3AA 3CZAA 2QUJA 5EOVA 1CUSA 2QVCA 4U5XA 2FK8A 2ORED 4YQFA 1OKKD 2NPFA 1A9OA 1TK3A 1WZNA 4K9DA 4V0ME 2O8FA 4NONA 1XKTA 3SHFA 5E7JA 1Z74A 3PC7A 2OO3A 2GBFA 4LHVA 1E4VA 3HP7A 4H1VA 4LDNA 4ODIA 2YV1A 5AKEA 3UMVA 5I7EA 3H05A 2NG1A 4RK4A 3G9TA 4DRXB 2J9RA 1Z83A 4BZPA 1LX7A 1O5TA 3PICA 3THSA 3WMWA 1QTQA 2E49A 2AEEA 4RGBA 3D3EA 1U28A 2B30A 4X0EA 4DADA 3EZ6A 2X5OA 2Q7DA 3P9KA 3DZHA 3I3SR 3VR5D 4PGMA 2VPQA 5LD2C 2AG0A 3GRVA 4DLPA 4MUEA 4TMTA 4YMUA 2O3QA 1X14A 2ZIUB 2ZXFA 3C87A 3DQPA 3OKAA 3OM9A 3K30A 3LXUX 1O94D 2EP7A 3FR8A 1AZLA 1G7CA 1T6ZA 3G1UA 4FCTA 5FTKA 3TNLA 4BQSA 4CLDA 2OCIA 4B6OA 4D0NA 3IMCA 5DRTA 3FW1A 4S12A 3W6NA 4YRNA 5IH7A 5JW6A 2BL4A 1EUQA 4B3MB 3HDYA 1NUHA 3OZ7A 4B7XA 3X1XA 3ZVLA 2DP4E 1V3QE 3M1IA 9ATCA 1EK0A 1WXFA 4OHZA 3ZGZA 4MV3A 1RJ9B 2YXLA 3ONFA 1SIOA 4YYZA 2PWPA 2HA0A 1T4CB 1ZM3A 2VYCA 2RKWA 4KFRA 1KSHA 2LIPA 4OH7A 2FZVA 4JLPA 2YY5A 4D4MA 2V6IA 3WGMA 4MP6A 2Q1WA 3BL6A 3DWFA 5GTDA 1KI3A 3R9KA 4L9AA 3CF0A 1E32A 4IKEA 1G0NA 1G9XA 3PDUA 2HSJA 2R2AA 1E3QA 3QW2A 2AFHA 1MT3A 2RMKA 1OYWA 2XT0A 3H9QA 4IOJA 4AKTA 3G1TA 3RU3A 3RSCA 5AW7A 5HNKA 1SU6A 1YBAA 2OSBA 1THZA 3EMKA 1MC5A 3V1MA 2EBWA 3VNSA 4N7BA 4EUSA 5LOVA 1WIWA 1IJEA 1YFLA 3TSAA 2B6NA 3TDNA 4TXNA 2FZ5A 1MPTA 3DBLA 2ZDGA 4IZHA 2L2QA 2ODNA 3G89A 2I6XA 2P7HA 3EA5A 1EDOA 1L7VC 4JODA 4MCIA 3BIFA 4YO8A 5LJLA 3BGDA 2Q3EA 1PYGA 4DR7B 2ERCA 1KY5A 2E5FA 1VIVA 4WY5A 4X1IB 4U9IS 4FFOA 3GP8A 1Q17A 1OBVA 2A3NA 1P3DA 5FL3A 1OFVA 1T6XA 1K3TA 1O96A 2C9CA 3LMKA 3OIGA 4JHXA 5KAMA 4EPTA 3SYRA 1XF1A 4EP1A 2Z95A 1A2QA 3RVSA 3AYZB 3ORRA 4Y9TA 1GA1A 1HY3A 1L9KA 5I4KA 1P1HA 2CE7A 2GPTA 4MQEB 2X5XA 4N5MA 2GRUA 2REQB 4QDXA 5AOCA 3HE3A 4WKOA 2A0FA 2UV8A 4I4TB 4P34A 4EGFA 1CJVC 4X00A 1MW8X 3JRWA 3M49A 1Z7YA 4PQFA 2DRIA 4UD2A 3VAAA 3PSHA 4KUHA 4NJEA 3M33A 4CR8A 1G6KA 2QLBA 1MB0A 3DQZA 4D9CA 3OPYI 3LY7A 3L8CA 5A71A 4LHXA 4OHOA 5DSXA 2BFFA 3LWZA 5F1YA 4PLPA 5J2UB 2OFFA 4D3ZA 1CS0B 2H1OA 2RHBA 3ELBA 2A5LA 4M1WA 1EA5A 3O3OB 1JR3E 3MRTA 3PNPA 3S44A 4NXNB 2W2PA 1P4SA 1EWQA 1U0SY 4BFSA 4PYRA 5IULC 4KFCA 1AHNA 1N92A 2WPDD 2FSHA 1D2HA 1NVEA 1V7ZA 1XCOA 2Y1LA 3GEHA 4IZIA 2NT3A 2QMEA 2A59A 3P0JA 3HEAA 4FMPA 4MRNA 3E05A 3K20A 5ETJA 421PA 2O5CA 1UMDB 2QAGC 3S1SA 2GJKA 1VGVA 1GAWA 1M3SA 2YXNA 6NULA 5JZVA 4IJUA 3H2BA 1YVRA 2HQSA 4F38A 4DXDA 1JVSA 2ZROA 2YWDA 2R47A 3PUJA 3QUTA 4LXIA 1BAPA 1JHQA 2WAOA 4KR3A 5I7OA 4MPDA 2Q5QA 3WSVA 4DHEA 3GDHA 4P32A 4BQFA 3QQPA 3RS8A 1WPRA 2PMKA 3G9XA 3DYBA 4OQZA 2ZSEA 4TQUS 5EJIA 4RTNA 4ZDJA 2OP1A 2PM8A 1FMTA 2DU8A 3UT5B 2QZPA 3C3EA 3RFVA 2W2TA 3AR7A 1D4AA 2GXSA 2A30A 4L5JA 4DNOA 4L3WA 1EFRD 4EW6A 4LYAA 3IBYA 2O7VA 1A7UA 2OP0A 4H17A 4JCCA 2CLEB 4XWYA 2BP7A 1MAVA 1DKNA 1W44A 5G1PA 4LDJA 3RTAA 3I12A 5GINE 4M98A 3OJFA 4EGJA 5MN4A 1RIFA 1IEWA 4O2LA 4QFCA 1NN1A 1JB9A 1K3UB 3GGOA 5LB2A 3W5JA 3U9SA 1VI2A 1B2LA 4GZ5A 2PR7A 4ZQEA 2EQBA 3EPRA 3GJSA 4AX4A 221PA 4ZI7B 4Y6LA 3AKZA 4YXFA 4Z9AA 2HJ9A 5D3QA 3O47A 1P2TA 3NVMB 3C3AA 4R40A 1XU9A 4MW9A 3CONA 1YUMA 4M6WB 2AOXA 4GWGA 4XGNA 1UZAA 2CVFA 3Q85A 1NIPA 1JWBB 4ZCRA 4R3NA 3KSRA 3QKUA 1IVYA 4MW1A 4RD4A 2I4TA 3I72A 1Q12A 3PQ7A 4IEFB 3F1KA 4BLSA 5IYZB 1ZNXA 2ZTUA 4FFVA 5LNK1 4UTVA 4TRMA 2BFBB 5DHFA 1SD1A 4CCWA 4X62B 2C2WA 4FJ2A 4A8JC 3MT8A 1E61A 1MJNA 2C5GA 2X0IA 3E7DA 3FCYA 3LPMA 4R51A 3BA6A 4RVDA 3RWOA 5JPDA 3G8AA 3NU1A 5FPKA 2D5CA 4X54A 4NU8X 3NAGA 1FP7A 1ABEA 3MS4A 3EMBA 4CKWB 4KXYA 1QH1A 4JLWA 3ZVMA 2WB2A 4QU9A 1BVUA 1I1NA 4G97A 4GYWA 4AO6A 1I2MA 2R1VA 1T5BA 4ITUA 4KTTE 2J6HA 4GMFA 5ESDA 1JL3A 1U65A 1XAHA 3HQ4O 5E9AA 1Q0QA 2CLKB 1R6UA 3F8TA 4PZZA 4RJLA 2Y6VA 3LKVA 5AKJA 5GOZA 3SSNA 1I13A 1R8QA 1H1LB 1ODIA 1NLMA 2O52A 3DXYA 4KDRA 4XYMA 4ARAA 5AVRA 2MSEB 3IAS6 1SZDA 1PVDA 5J2TB 3QU7A 1DDGA 3BOSA 2ZRMA 5L3QA 2J31A 3OTHA 4CMIB 4RJKA 1PP4A 4L7VA 4GZLA 2Q3JA 4JA0A 2IU0A 2DH6A 4V03A 1EAYA 3IDOA 1ZW1A 3QFHA 2YHAA 4BJ1A 2V1UA 1EFVA 1P18A 5KNCH 5EXEA 2FN8A 3SBOA 5LFAA 3H1FA 1U9CA 1ZVJA 5FH9A 4YUVA 2ZAGA 4G8JA 4AM8A 4D9EA 1XHLA 4Z86A 1GCGA 5M34A 4GZ6A 3RC8A 1JFFB 1RFLA 2FETA 1TL7C 3OIUA 4XVCA 2VEOA 4UZSA 3TCXB 4LC9A 4DQUA 3CEAA 3QVTA 3SKXA 2WPDA 3LO8A 2A7XA 2W6NA 3G0BA 3KJQA 1OBCA 3C4JA 3QTTA 1NM5A 1SCIA 3MUEA 4KYUA 5FBKA 4CBVA 4Z1OA 5BUSA 3EK2A 2P91A 2WWYA 3H3XA 4YUAA 2GDJA 3L8EA 5L3VA 1H3EA 5BW6B 3HGMA 4AKHA 3KOZA 2JIQA 1GUDA 5D1HA 1NURA 2HPHA 3JX9A 4LXGA 2O5EA 2BBWA 4QU5A 5KCZA 3LQQA 3L77A 4ENPA 3EVZA 5KVCA 2JFPA 5C8XA 4FSXA 5HJEA 4RKRA 1R0LA 4TLEA 2PSSA 1NASA 2Y1FA 3Q41A 1L4EA 2H1CA 2X2PA 4Y2VA 4EHNA 5IHPA 4BFVA 3U19A 1P91A 1CS4C 2YH2A 2DFKB 3R3UA 2FEPA 2JI9A 1AA9A 5F9FA 1CLEA 1XRPA 2GN8A 2ENUA 4OJTA 2XYGA 1V5GA 1F4VA 1JW9B 4HXYA 4EYQA 1EVKA 3V7NA 4U7FA 4AL4A 2WSYB 1GA6A 1S2MA 1G19A 4HAZA 3U09A 1L1QA 4W99A 4TTQA 2E3JA 2X77A 2ZM5A 2EIXA 2G67A 2PXCA 2C2BA 3KLBA 4RYLA 1QV7A 2XUGA 2ZBRA 1ORVA 3PSAA 3HM9A 3HKBB 3HXKA 2ADFA 4DE5A 1ZBQA 1I2CA 1W6RA 3CBQA 4LJSA 4BCBA 5DHSA 5FBWB 2BISA 3TG8A 1M2VB 2AR0A 3DE4X 2XUFA 4OL9A 4ROSA 5F35A 2G08A 4LYYA 2EFYA 4C22A 1SR8A 4DMHA 3PUVA 3PC3A 1J2TA 2NU9A 2X4GA 1PKEA 2XUDA 3AZOA 3K73O 3LCRA 3N6VA 5E6SA 5B2ZA 1EUDB 1X7XA 1K2VN 1G7SA 5LA6B 4XX1A 1IN4A 1E9SA 4K1LA 1KYTA 2J4DA 4YJFB 3OIDA 1Q6YA 2XGJA 4C87A 3QLUC 4M8LA 4MR9A 4CLHA 1R50A 2NNWB 3ASZA 4CF6A 2XTJA 2Y0CA 1RLMA 5CFZA 2AI3A 2XE4A 4DZZA 1AMOA 1VCMA 2YIVX 5EXXA 3KTFA 4A0GA 1YR6A 3ANMA 1X7GA 4B2IA 5ARCA 1BS2A 3BK7A 2ZUCA 4U7HA 4B17A 3JVDA 4X1YB 2JJMA 2RHDA 4F6RA 1E99A 1HNZB 3A4TA 3QVGA 1AMNA 1DWQA 4WZZA 1TQ2A 3C24A 4DLXA 1NNSA 4RH1A 2PKCA 4Z4GA 3B1WA 1CUHA 3IPAA 4A15A 1TUEA 3U13A 5EE5B 1FP2A 3PGVA 3I2KA 1I9CA 1UODA 1HDRA 1QYIA 4P3NA 4EHHA 1SKMA 1L5SA 2J3EA 4ROTA 4A8HA 3OCVA 1OBOA 3KYCB 4I4TF 4A03A 1HQCA 1DQYA 4JJIA 5BSRA 4JT2A 2X4LA 5HJ7A 1Z2EA 3VR4A 5K6AA 4NBKA 4KXNA 4PPFA 1TAUA 1CUIA 5IZ4A 1ZHHA 3E3NA 1A9XA 3PHJA 1F2UA 2O1XA 2XWBF 2QB5A 1DIHA 1EAMA 5CEFA 2H9YA 2IYYA 3RF7A 3HUFA 1PNQA 1ISHA 3K9NA 1IFXA 4MEJA 4NENB 5L3SB 4ALJA 1HZZC 3EIUA 3LE8A 2RJOA 3QBVA 4TV9B 1M1UA 2ZU0C 1VKJA 3EOBI 1OPXA 2A1IA 4YWHA 1R37A 2PS0A 2Q4TA 3U3DA 3MJFA 1QHHB 1U2EA 2CJWA 3RASA 2EW1A 1OX5A 5BWBA 2PXHA 1UBSB 3LIIA 4PX2A 4DMFA 4AJ4A 2KSQA 4W5JA 4WUVA 1FRVA 2CXXA 3HUUA 3K9WA 3QNUA 2OXTA 2C96A 2LP4Y 1RRKA 3BXPA 4I9FA 3UQYS 4A7PA 1H2YA 4FEEA 5HIJA 3EF0A 5B4TA 3CNEA 4CM7A 4ER7A 3A7DA 1B8OA 4LK3A 1TKCA 1TA9A 2QT9A 4BFTA 1BKDR 3GJRA 1THMA 3HVHA 3OIFA 4PZ9A 5KTOA 4FVTA 5A7HA 1GPMA 1ST2A 3VZSA 1BKYA 5JAMA 3QMPA 2CGEA 1HLDA 4YV0A 1UZNA 4XX0A 4AXXA 1DZIA 2Q5LA 1X70A 4P6VF 3S3TA 4RZ2A 4P2BA 5CNJA 3M4NA 4Q9IA 1DO8A 1NZDA 4BO7A 3T9EA 1KIMA 2F9MA 4YJGB 1ZVMA 5C1PA 3ETNA 4QTXA 2JZNA 2P6RA 2H4FA 3OCZA 4ZAWA 4ZTUB 5AVVA 1W5TA 4MX8A 1XLVA 5DM60 1VLLA 2X7HA 3FJYA 4MUYA 4FW8A 3S29A 4C6TB 2Z43A 5EI5A 2JKZA 1A5TA 2P9EA 5DIFA 1OH8A 1ZO8A 1KKLA 2GBLC 3RJTA 4AKEA 1OV4A 5KTRA 3CH4B 2A0XA 1U3VA 3KXPA 5TMPA 3KR0A 3T9DA 3UK7A 1KVRA 1QOPB 2AX3A 4WY2A 3WKAA 1NQ5A 4YMGA 2VS1A 1QF7A 5DI3B 4TRRA 5JH7F 3FHTA 2YWRA 1DQRA 3BQMB 5F5NA 3TJRA 3NDJA 4TYWA 3CIOA 4DLKA 1D2RA 1P19A 4PBSA 1A95A 2E48A 1TA0A 3AVOA 4TT3A 3OOSA 4N03A 1W49A 4EW1A 5D1NA 1TVKB 1NBME 2BWJA 1P29A 1MGOA 1T0BA 1YI8A 3PLNA 2A9OA 3ZE1B 1B6GA 2VA8A 1II0A 5HE9A 2J9XB 4D4KA 1PR0A 3DE0X 4GPIB 1P5FA 3GZ4A 3RU7A 4NDZA 2NZUG 4WZ6A 2G28A 3QHQA 4Z4IA 1VPEA 4WEQA 4CV1A 4OQFA 3L43A 1EWKA 1LH0A 3W5SA 4YDHB 4LWQA 1FX0A 1Q2UA 2BFMA 4PICA 4AB1A 4BKQA 2WZQA 3M6IA 2W71A 4O4IB 4NECA 2ZIGA 3KTDA 1ADJA 3UG6A 3TSWA 3OUUA 2PUVA 4LQDA 3U1VA 1AS2A 3VR1A 5I51A 3WA6A 1SUIA 2HO4A 4C0WA 1H0SA 4NESA 5LUBA 5ICMA 2ZUTA 2CLMB 3QLVA 3FSGD 3ZIUA 2EZTA 1MJ5A 2XHEA 3OD5A 3MJTA 1STOA 1TIBA 3VPFA 4FOOA 2XB6A 2BT4A 2DLNA 4R1MA 3WIDA 4P58A 4P33A 1NMQA 2YMPA 2PQMA 3UAXA 1OASA 1S9HA 2CCJA 5HMMA 3SHWA 4CTJA 4MPJA 5KYUB 3N2KB 2POQX 2JIDA 4HJRA 2ZR7A 4M21A 4V2UA 5EA2A 4TM7A 4C0QC 2I78A 1O57A 2HREA 2WTEA 2NUTB 1LFAA 2OFXA 5IEJA 2I2BA 5C0OE 5K4AA 1YHYA 2QP4A 1GUFA 4KXVA 3EQ6A 1Z08A 1CDZA 4F11A 2JCYA 4CIBA 4JI3B 4LQLA 5JASA 5JNTA 3CW9A 2WD8A 1H3FA 1ZUD1 2DUJA 2PGNA 1EVZA 3DNFA 3GY0A 1UBCA 5JS1A 3D5TA 1Q6ZA 4TPKA 3KEFA 4E31A 1UQRA 1MX3A 2BZSA 4D1YA 3CE9A 5I4CA 3MW8A 4FHEA 5BRNA 2X0FA 1SPXA 1W94A 3RARA 5KKAA 4ARIA 4Z4EA 4BO1A 3WG9A 2VRBA 2PYIA 4DSTA 4DCSA 1M8GA 2ANBA 4G5OA 1L4BA 3VR3A 2L18A 4O5AA 3RYIB 3TPZA 1T2VA 2V4UA 2WT4A 2ATEA 2WJ6A 1V0JA 3K4PA 1CR2A 2H51A 5IU6A 2JW5A 3C5VA 4OUDA 3C7AA 1E9AA 4R2XA 1OWMA 3H4TA 4WCFB 4LRYA 1WZEA 4TL6A 2Q3CA 3DZCA 3C5WP 3I37X 4HF7A 4FFBA 5LZ7A 4B1FA 4Q4HB 4B6QA 1FNNA 4RVUA 5A06A 1DO2A 4BY9E 4F5DA 4NBSA 1LV8A 3F6EX 3BMQB 2R8EA 2DH5A 4G65A 2WJIA 4MW2A 5AHWA 2GNAA 3GEPA 2HJHA 2QI9F 3PFWO 1M7GA 4IVRA 4E3WA 1GTRA 1RLTA 1TZJA 1YK0A 2JDID 4JBGA 2FQXA 1AZWA 5LYJA 3ZXYA 3L82B 3FE2A 2UZIR 2VPZA 4W9MC 4NDAA 3PZBA 5LZ2A 1FDWA 4QOJA 1M8PA 4YRLA 4JVMA 2I2WA 3BMNB 4KGVA 2ZRPA 3DMTC 4D5EA 4LZJA 1TCAA 2VZ9A 4G23A 4OJNA 3ZQ4A 2VK1A 3QPVA 3E5RA 1S3GA 3RVRA 4D45A 2WF5A 1H4SA 3VNVA 3IIJA 2IX3A 1JH9A 3VHXA 1T2CA 3QUAA 6Q21A 2JLCA 4XXHA 1EVYA 2QW0X 3QG1A 1Q3HA 1Z17A 3W2FA 1ZSYA 3HXQA 5GPBA 2RGRA 1PUXA 4DQVA 3UO8B 2IPMA 3C1TA 4DWJA 2VVTA 2BAGA 3FOAA 1OI3A 2IX9A 2JGJA 4S3MA 2BKAA 2H9IA 3X1YA 4BX3A 2G07A 4DF3A 621PA 4WZAA 1YUBA 2JKYA 5CNKA 4DILA 1KJNA 4BATA 1LPMA 4IVQA 4C05A 4JXJA 2JG3A 2BE7A 2PL9A 3ZE0B 2AHOA 4M7WA 4Z0HO 4CKXA 2BTOA 5L53A 2VTVA 3H2YA 3EULA 4H77A 3LQ1A 3ZNNA 1JDBC 4Y1RA 3SN6A 4LRTB 3PU6A 4A9AA 4I0WB 4LUCA 3WMXA 3S40A 3VM6A 4A1OA 4F2GA 1G59A 4MKFA 1W73A 3UTDA 1B93A 5T67A 4D4IA 2DX7A 4NVRA 1A98A 3I52A 4UE3S 3V7YA 3FSJX 3TBFA 3L6EA 4GMXA 1VJ5A 1HSOA 3OKFA 4O1MA 5L7YA 3TDKA 3HADA 4N3GA 1SCJA 1P5RA 2AOUB 4MTLA 2ZRNA 2IITA 3KFXA 1GGKA 2IIQA 1IONA 2EJWA 3H75A 3LECA 4HXGA 2XCLA 1YQTA 4OV6B 2HRDA 5KTYA 4FUTA 4G1UC 4MRMA 1FB5A 5K0BA 3CIFA 3LT2A 2ZRKA 1RJEA 3SYTA 1A4IA 1XMSA 1L4GA 5C37A 2C83A 3QXHA 5JCPA 3W5AA 2J0QA 1KXZA 3ORFA 1QBKC 2EZ8A 5B1EA 2VP2A 3O3NB 3EEFA 3GG9A 5IN5A 3GJ0A 3L9XA 5FWNA 2JHAA 4FI3F 4IO1A 4KAFA 4AJ1A 1RP1A 1SUSA 5DLEA 3HYLA 1BJTA 1R3UA 3DVAA 4E30A 2WVGA 1IUNA 3NEJA 3F73A 1V25A 3ZDBA 3LLCA 1G41A 1QIKA 2EG9A 4L6AA 5AVUA 5JS7A 3SFZA 1GCUA 5FEUA 3PV0A 2C1XA 5EZYA 2JIRA 4WN9B 2E85A 2HDOA 5ALDA 4U7TB 4DBVO 2W9XA 3NT5A 3NHRA 1KMMA 3HCWA 1LJUA 1I1OA 1OREA 1Y8CA 1BJRE 5ERXA 1AKMA 3OJWA 3QU9A 3KS9A 5LWQA 3BGVA 3D81A 2O7NA 4KIGA 1M73E 2HFKA 2P4EA 2GGSA 4FIDA 1NOJA 1S01A 4GP9A 3HB7A 4QYSA 1N2GA 4RNDB 3UYLA 4WERA 2HWUA 1JMKC 3I4CA 3BE4A 3THOA 4BNKA 1IBCA 1K63A 2JFGA 4FOTA 5NULA 1H1TA 2IUFA 3ZS8A 3JQCA 5A6VA 4HDKB 5INTA 2NTNA 1ZW6A 1SBZA 4EPWA 1POXA 3KB2A 1CERA 4HGRA 5IDWA 1TEVA 2BDEA 1E5XA 2GN0A 2WEKA 1L4UA 5K4GA 1IUPA 4L2IA 2BM8A 2OHIA 4US1R 1U2SA 1S7CA 2VJYA 1CC1S 13PKA 3OJCA 4QBFA 1OXTA 2B4KA 1DMSA 3I73A 3QUSA 1YL6A 2ZRFA 2IHJA 4EATA 2IY7A 1YB7A 4DEVA 1GZ3A 1C81A 1HMPA 1JHAA 1KO4A 1ZK2A 2WJVA 1NVVQ 3BL8A 3KX2A 4QXPA 1KZ4A 5JZSA 1YZVA 3I5YA 4PFSA 4WNAB 5EE9A 4DIDA 4DR6B 1V8ZA 1REQA 2MTBA 5EKSA 8LDHA 1E58A 5K8VA 3L06A 3VZPA 4N1AA 2JGDB 2B34A 3A6FA 2PKQO 3R5HA 5FXMA 3W4JA 3PDWA 4RQUA 5FLKA 1FYWA 2R1UA 2YICA 4L28A 2ZAYA 4P5EA 4RKEA 5ERYA 3OU7A 2YWXA 3B1JA 4JBNA 1O0SA 4Q16A 3W1EA 4ZAZA 3H2IA 4HSEA 2IVZA 2UXBB 5AJYA 4PCUA 2WP0A 2J3KA 2R8OA 3LUCA 1D4FA 3AFNA 1W4AA 3L0PA 2DR0A 2CNWD 5CLLA 3W04A 3LBHA 1M2NA 1N7JA 1CNMA 4MDHA 1PWYE 1Z07A 4MVJM 4X85A 3VR6H 2IP1A 1KF0A 1W4ZA 1WMBA 3T7JA 1PR2A 4BMNA 1Y3CE 3BCSA 3M5CA 4TKZA 4LDAA 3TLXA 4JYCA 3CLUD 3WLIA 5H4GA 4KIWA 3IELA 3W3AH 1QCDA 3AM1A 3DF7A 4UC0A 4ZCLA 1YDGA 2BKEA 4N3NA 1Z56C 4MQUA 4OFXA 4PAOA 3H0CA 1A88A 1WB6A 1G3IA 1RWVA 4KI7A 4ZMSA 2QLJA 1P7ZA 3AH8A 2VNHA 2XDQA 1SXGA 2WU8A 4I99A 1NVWQ 4X91A 5HM8A 1E6UA 4HVTA 3PIIA 5E2BA 1KEWA 2F2TA 4L27A 4B8WA 2REOA 2HMSA 5C5EA 4AJNA 1AUXA 1EX1A 2C2GA 1A2BA 4EF4A 4ZT4A 1B42A 4B4WA 1K6MA 1N8SA 1GRNA 1YDEA 3L0CA 5K0JA 5FNZA 1LBEA 4PXSA 4S24A 1UKEA 2J3QA 2OGTA 5JISA 2NN3C 2OXFA 4HDOB 4CMGA 1IE3A 3H5LA 5CVJA 1FFDA 5SYMA 1UT6A 1D8TA 2OKGA 3K9GA 4HB3A 4ZOLA 5I9SA 5IVKA 1NMEA 4OP2A 2QYHA 2JVIA 4M0FA 2BHSA 4Q1AA 4PC1A 3Q3GE 1XIVA 2OENG 2V9PA 1V5FA 3EZ9A 3CM0A 2C4UA 1I3OA 3FSRA 3LAWA 4FDTA 2CXRA 3L0BA 4MYTA 3JD2A 4DCNA 1EX6A 3NC0C 1X9GA 3HN2A 1PS9A 4HRAA 3IVGA 1QYWA 5FFNA 1F7UA 3OHMA 1MOSA 1KJZA 2EVWX 1TZ2A 3E0QA 3W9UA 1VG8A 4G26A 1Q16A 2BFDA 1YS9A 3ROZA 2VL7A 4IIFA 1IM5A 5ARDA 2HBQA 1QIMA 3O2NA 3PNBA 2WMDA 3COJA 2ZYHA 1RYFA 2MR6A 1C3OB 3ED1A 5EJ4A 4PHCA 3ABSB 3KQKA 2JLQA 4LFCB 3E8SA 3JWPA 2ISCA 2ODPA 3QBTA 1FP4B 1J7KA 2ZFUA 3FUWA 4UBIA 2ATIA 1KFKB 4RWZA 3G0OA 2QM8A 4H3SA 1CUEA 4HTFA 4EYEA 1EE9A 1A2KC 3HWX1 2NSLA 1BCRA 2Q8PA 3EVNA 4R9UC 4U6SA 3TL2A 3UXHA 4BO5A 4ZVRA 5GJCA 3IVAA 4WLVA 4ZI7F 5DNVA 1H6CA 2KM1A 1Y6RA 2YS7A 3KKKA 5U4QA 3GN2A 3AX6A 1UBTS 2GPBA 3GJZA 2FSPA 4KQMA 4E07A 3UWMA 3FI0A 2V7EA 2PANA 1W88A 1X7WA 3UVEA 1QJ4A 3M1AA 1D6MA 2XWJI 1WBDA 1AIPA 1CFZA 4QDZA 4O3FA 5FOUA 4JB0A 4BAUA 5DEIA 4GSKA 1L2TA 3DM5A 1QMPA 3OETA 4CQMB 1QX4A 2AQIA 3OT4A 1FDTA 3IPXA 4MR7A 1QP7A 2UXDB 2PY6A 4YJ2F 5CLIA 3CUVA 2VWHA 5IWCA 2ZBUA 3INRA 1WZUA 4RJ2A 3K70B 5DLDA 4EG3A 3T5MA 3U39A 2NTJA 1N78A 3NFRA 4X84A 4D79A 4EVQA 4EFNA 3PLAE 1R9MA 1MKYA 3VR2D 4V0OA 1XTUA 3A11A 5F2NA 5HK8A 2QRJA 2LIVA 2Q3FA 4P81A 3TZEA 1JQEA 3FPGA 4KQ1A 4GIBA 1LK5A 2W58A 5EE1A 5BT8A 4NZNA 3H18A 1E1NA 2XGGA 5C8YB 3Q7PA 1H65A 3W7AA 5IKEA 3KQNA 1KJ8A 1F8YA 2C7GA 2H07A 3C74A 4HQKA 1DAIA 4CKEB 5F78A 3DL2A 3OTOB 3GRKA 4JI4B 3DOIA 3K53A 4BO4A 3HNPA 2G9NA 2IU6A 3AKEA 5C9ZA 1HKHA 1FFGA 1VMKA 2ZUFA 1PU2A 4M9UA 4GLBA 1G1AA 5JZ9A 3VC1A 4EX6A 3G8DA 3GRZA 3UT0A 2WTXA 4TMFA 4F9TA 4E2XA 1JFSA 1AKQA 3RQSA 3AO0B 1NRXA 4W4TA 3PHCA 2YS6A 2IPOA 1S2NA 4HWTA 1JUDA 2DBZA 4F1WA 2F3UA 4F3YA 2H5LA 3TCKA 1BWRA 1MX5A 2RGXA 4BU1A 1A9YA 1EMDA 1KMQA 3ZI4A 3FPKA 3GFFA 4DSZA 1CY4A 1MABB 2GESA 2I4RA 3IQWA 4B8ZA 3CJQA 2DPYA 1H05A 2E7ZA 2M6SA 3SMQA 3ECAA 4D9IA 2ZBVA 3NHLA 1SBTA 1TQHA 2OM2A 1EZZA 3IUQA 3OZEA 4HWGA 4MAMA 4F84A 3H9CA 4RGQA 1CD5A 2YIMA 4ZO9A 4TXLA 3KAKA 1OAOA 2P1RA 1PL6A 5CA0B 3D8NA 1TJ3A 4KO3S 2O0MA 3K09C 4L3VA 3TIIA 4E33A 1OXVA 4R2HA 5ALIA 1OGJA 4WBNA 1NKVA 4HBGA 5AI9A 2F90A 4J2OA 2MIIA 1A7JA 4D97A 5A5DA 1QK4A 5CEJA 3BWCA 2LZ0A 1BE1A 1QR6A 4QWMA 1EZ1A 5LQUA 4JYZA 2W6MA 2A5GA 4G0YA 4I4CA 1UFKA 3HR7A 2WWVD 1ICIA 3MTQA 5LNK6 5EUQB 5FDFA 5E2AA 4H9GA 1R0ZA 1F06A 4PTLA 3UANA 3WVNA 2XF8A 1E92A 1JT9A 2Q2WA 3GUUA 3PQFA 2WJ4A 4NR0A 4HLUC 3GAFA 2FQYA 1FSFA 3FDXA 3ML1A 4IXMA 3CTMA 4N18A 4D3SA 5GVSA 4P0PB 3PWSA 3AM5A 1ZA2A 3BMXA 4JUDX 3RS0A 4JP2A 3UTCA 4N6GA 1GLNA 4WK4B 1FQOA 3M6LA 3UQZA 3V7FA 2QTRA 3WFZA 5HOQA 2AH5A 2ODTX 5K3AA 1RP7A 3GZTB 4K9PA 4ITVA 4M88A 5LZ8A 2HQBA 3BXHA 3PXCX 5JAIA 4TLBA 4NSNA 2VHWA 2BD0A 1MA0A 1V6CA 1VKZA 2BEWA 2WI8A 3BRSA 3M81A 4W82A 3I61A 1IXSB 2XUQA 3L84A 5FP0A 2XQVA 4O4HB 5K3FA 5HPYB 4QOHA 4M1OA 3KPVA 3FBWA 1RXEA 2H4HA 4CEIA 4U1RA 3V1LA 2ZUEA 1W5FA 1U31A 1AF7A 2VSQA 1ATIA 3AUXA 1Q77A 4B4VA 2KE5A 3OCCA 1L8OA 1QIJA 3ETDA 5JNUA 3GLUA 1Z5UA 4TV8F 1JKXA 2P62A 3QWBA 4LEIA 3JQEA 2Q9BA 3N6RA 3O1HB 3WKDA 2YJ3A 5ER6A 3ZQ6A 4MW0A 1HMYA 2X2EA 1GPYA 2HLDA 4N5IX 2YMLA 3NCTA 4HX5A 1KK1A 3DMHA 3CUKA 2QVZX 1OY1A 3TIXB 1VE1A 3D1JA 3UCFA 3K15A 2JVKA 4D3XA 4E46A 1ZIOA 4E12A 3N0XA 2VDVE 3MINB 3TD9A 3K94A 3R8XA 1Y6JA 2NADA 3QOWA 4ER6A 1T2DA 4YRRA 4BMSA 1M1YB 4IQ8A 5E8JA 2YXPX 2D8AA 3CO5A 5FPTA 2HNAA 3OO1A 1FTQA 3FNFA 3O2JA 4OQPA 2IXEA 5BUQA 3TUZC 3CQ9A 3HCBA 4Q6WA 5C4MA 3IILA 3PNLA 4DLRA 5KINB 1ZCBA 2CEAA 1D7OA 3K1JA 1F9EA 1JU9A 1NN3A 1XWIA 3ZE8A 1NW3A 4J0QA 4PZ0A 5CU7A 2FVXA 3NP9A 1EP3B 1QQ7A 3NONA 3EZFA 2JBHA 1N3BA 2DWCA 2GEKA 1SCUA 4XQEA 2BM1A 2NYVA 4BUJA 1RE1A 3HV2A