1CJBA

Malarial purine phosphoribosyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
227
structure length
227
Chain Sequence
PIPNNPGAGENAFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYDIKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE)
publication title The 2.0 A structure of malarial purine phosphoribosyltransferase in complex with a transition-state analogue inhibitor.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 74
structure length 227
sequence length 227
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1999-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cjbA00
3MJDA 1WD5A 4WMLA 1PZMA 1ECBA 4P84A 1V9SA 1OROA 1P4AA 2HCRA 3OZGA 4M0KA 4RQAA 5JSQA 1GPH1 2JBHA 1G2QA 1P19A 2GEBA 1G2PA 2PS1A 2H08A 5KAPA 3MBIA 4RAOA 1TC1A 1W30A 5BRNA 4M0UA 2JKZA 3N2LA 1ZN8A 3LRTA 1J7JA 1LH0A 1FSGA 1DBRA 4FYMA 1L1RA 5IAOA 2PRZA 1Y0BA 1XTUA 3OHPA 1DKUA 2EHJA 1G9TA 1ECGA 4RANA 2C4KA 3DEZA 4LYYA 1ECCA 4RACA 2E55A 2WNSA 1MZVA 3O7MA 1VCHA 4RAQA 4P3KA 1XTTA 1Z7GA 1QCDA 2JKYA 1JLSA 3S5JA 4RHTA 1QB7A 4RHUA 1NULA 4WN3A 1L1QA 1VSTA 2VFAA 3LPNA 5BQPA 4LZAA 3QW4B 1A95A 2P1ZA 4LZOA 1QK3A 1A96A 4RADA 5ESXA 4QYIA 1BD3A 1O57A 1I13A 1DQNA 1HMPA 3ACBA 4JLSA 3EFHA 2AEEA 1QCCA 5JV5A 1STOA 1UPUA 1G9SA 4TWBA 1BZYA 1GRVA 1I0LA 1QK4A 2H06A 4X44A 5BSKA 1P18A 3H83A 4RABA 1UFRA 4KN6A 1U9ZA 4P81A 4P82A 2FXVA 3KB8A 4RHYA 4ZFNA 1R3UA 2H07A 4MB6A 3OZFA 3DMPA 1QB8A 5E38A 3GGCA 5EUCA 4RV4A 1AO0A 1ECFA 1P17A 1XTVA 4M0PA 4JITA 1O5OA 3HVUA 3DAHA 4LZNA 1XZ8A 2JI4A 3M3HA 4LYGA 1UPFA 1QK5A 5ESWA 1HGXA 1U9YA 4P80A 1A97A 2PRYA 3ACCA 1A4XA 1A98A 5K51A 1TC2A 4Z1OA 4QYIB 1ZN9A 4X45A 1NONA 1D6NA 1I14A 5HIAA 4PFQA 4OHCA 1IBSA 1DQPA 1JLRA 5KAMA 2XBUA 1OPRA 1VDMA 1ZN7A 4RQBA 1I5EA 2IGBA 4P86A 4QRIA 4P83A 1OREA 1CJBA 3GEPA 3GGJA 2YZKA 4S2UA 5HKLA 3NAGA 4RHXA 3ACDA 2DY0A 1ECJA 1I0IA 1DKRA 5IPFA 1A3CA 4F8EA 5BQOA 4PAWA 1XZNA 1YFZA 4IJQA 3G6WA 1BD4A
chains in the Genus database with same CATH superfamily
4Q3OA 4RHEA 5AW7A 3OIWA 4JZYA 4D81A 1K68A 4ADSG 3KXKA 1DTWA 3PCTA 2AK2A 2P69A 4UEWA 4KMOA 3WG9A 5HUHA 3MYRA 5DP1A 2Z5FA 3TBHA 4HUTA 2PYIA 2VHYA 5K4HA 2YIJA 1F1JA 2PS1A 4NS4A 1CERA 2DR3A 2W6CX 3D02A 4N5DA 3JD2A 4D9BA 3FFTA 4BKRA 4WCDA 3LBIA 2QN3A 5TGZA 4AQDA 3SBEA 5AVYA 1ISJA 3OCZA 3ER9A 2OHIA 2ZYIA 2VQFB 4IHJA 4P4SA 5FUXA 4GM0A 1MJNA 1PJ8A 1VJTA 3DDCA 1ECCA 4X1IB 1V25A 2IX3A 4HX2A 4G5QA 2VP9A 4HH1A 3T12A 4K6OA 1L7PA 1WBJB 2C7BA 5I7OA 2DQKA 1TZMA 3RTGA 3FBTA 4K9LA 3O92A 2PMWB 4Q9IA 1MC1A 1JMKC 5BVGA 1L4GA 2OHHA 3R4VA 4CM1A 4Z8YA 1MMFB 1X86B 2VPPA 2DFKB 2IS2A 4O8CA 2W0SA 1OX5A 1UEXC 2GWRA 4HWOA 4DA7A 4F3NA 2GAFA 3UGKA 2PK3A 1XEAA 1JDSA 1RBQA 2EU8A 3AP2A 3CF4A 3EQ2A 2P0AA 2PH1A 2O5EA 2CBZA 1D4FA 4MULA 1ZSYA 3HEBA 4C2AA 1KO7A 4NXMB 2FY8A 4P31A 6REQA 3NHUA 1GAXA 5CYGA 2HX1A 3SS9X 5KUTA 4Y0VA 4LJAA 4XUGB 3RI3A 4AZ3A 5I8PA 1NMSA 1ZVMA 2I6SA 4L8VA 3F4KA 5JE8A 1P1IA 3UANA 4NG5A 2D2EA 3PWSA 4ZFNA 3UTCA 4Z9AA 1EP9A 2DETA 4A27A 3Q5EA 4LFAB 3HCAA 5DU2A 3DMPA 4AURA 3NONA 1JH8A 4K88A 2FG5A 5G1OA 2IV7A 4I3FA 3SNHA 4I8XA 3A6GA 4CKBA 1UJ5A 2H4WA 2VPZA 4DQXA 2AMLA 4FBGA 3RSOA 3EDYA 3VVBA 4YJHA 3CEHA 4JJFA 2R87A 4K7JA 4BGDA 4PZ9A 2JI6A 2WB2A 1L5HB 2H4JA 1SK9A 1DBVO 2FOLA 3PTZA 4BAUA 1ONPA 4CZ2A 2G72A 5K3FA 3GLVA 1A4XA 1BOOA 2OEPA 4P92A 3NQ41 4BLRA 4HDSA 4CU2A 4FHGA 4RQTA 1JAHA 5IVHA 3G2LA 1WHSA 4G9BA 4BX9A 1OU4A 1UWLA 4KVAA 1WNTA 2NVUA 4PYJA 1F6DA 4QTXA 1E7WA 2IGTA 3ROEA 3TZLA 4E15A 4EY8A 5D6OA 4F4CA 3L1IA 5J2UF 1YQWA 1L7MA 3BN3A 1SUCA 3AERA 3KYDA 4I1PA 1P3JA 1VL2A 2A94A 1XMOB 1UKYA 2F3PA 1PD0A 2RHLA 5TIIA 4I1UA 2P40A 3K32A 4R6XA 1IN6A 3E82A 2NUBA 1JB9A 3DLIA 3ZXUB 4C7BA 1TO2E 4HFNA 3VR5H 1J56A 1V35A 2F3SA 4UASA 4XFDA 1J2JA 3FTNA 3TLCA 5TMPA 3PVSA 3P71T 1SXQA 2MOKA 3FPBA 3V1KA 4BNVA 1XRSB 4HNHA 5DXFA 5BRAA 3SFTA 1JR3D 2ZT5A 5SYMA 4JB0A 2VPWA 1ZGHA 1XHFA 4X8OA 3WYGA 7REQA 4YRNA 3VOSA 3MA0A 2GJ8A 1Y89A 2XSZD 3KYCB 3O4VA 2X2OA 4YBRA 4ER7A 1G6OA 1U7UA 4P1ZA 1V3VA 4LK3A 1PN3A 3AUXA 3VZCA 1EH5A 4ZVNA 4DLBA 1UBLS 4FYYA 3WX0A 1YI1A 4MLPA 3GFRA 4IIJF 5JU6A 4DSNA 1J2UA 4BDSA 5IH7A 2E1RA 3LGAA 4H6PA 2HK7A 3UMMA 4LDQA 4OSPA 1T8PA 2OFPA 3VRHA 1ZQ9A 3E22B 4DUGA 1TECE 1Y8QB 2H3HA 2AJDA 4H7KA 4E5YA 1QWSA 1SXJA 2BKVA 5REQA 3C6YA 5I9NA 3B5JA 4YWHA 2B3TA 4ETMA 1NZDA 1Y0BA 4GMDA 1VHQA 2XAAA 4JI0B 1I3MA 1TT7A 1TUEA 3FPLA 4FYKA 3FKJA 1XPJA 1I7NA 1OBVA 4MVJH 1FDVA 4CM6A 4YAFA 2KHZA 3ND8A 2IHBA 4MUXA 1I4WA 1TLTA 1OBCA 3AH8A 1D6SA 1GM5A 2XJ4A 3IBCA 3EPPA 1K5GA 3D6MA 3D5QA 4RESA 1GGHA 4JNCA 5KQSA 1RAAA 5DN6D 1AU9A 5G3ZA 2FZKA 3U3ZA 5ALDA 4KYVA 4DN6A 3ICOA 4DNFA 4QNRA 2UYHA 2FSVA 2HNKA 5IJ0B 3VU1A 2EXXA 3IUSA 2YQZA 5ESXA 4NDNE 3R7WB 3GGPA 4IIVA 3VR6D 4AZWA 1CW2B 3RNLA 1RT9A 4JC5A 4U63A 3KUCA 2C59A 4RTQA 2ZIWB 3UIEA 1R18A 3T99A 1Z2OX 5DLQC 5I5GA 3KOMA 3GVCA 5EPUA 2PU7A 5KU1A 3MMPA 1F8UA 1GFSA 4J75A 5EXEA 4ABTA 3Q0EA 3P97A 3RS4A 2C4MA 5KHLB 1T8SA 1V9LA 1TZ2A 2OM2A 3BK2A 2ZXFA 4RHYA 1U3VA 2FWMX 3LY8A 4JI6B 1NBEA 4WLEA 3CGWA 2CL5A 2QZJA 2F1KA 4LRTB 4RGBA 3EGDA 1IJBA 3WKBA 2ZRCA 1J0BA 2HJVA 1QC5A 3O1IC 2WJWA 4GI3A 3C8ZA 1CR2A 1BDJA 2BI8A 1BFUA 2WFAA 1JQAA 5FKJA 5HRUA 1CZLA 3THWB 1C41A 1HTWA 1HETA 5CVDA 4O1IA 1RM5A 1RYDA 1DDIA 1A97A 4II3A 3K1TA 2MSDB 4PGHA 3N53A 3QJYA 5FFNA 1RRPA 1XC7A 1E3IA 1YJXA 1W4CA 2VAPA 3O75A 3TJMA 3A11A 3P1JA 4MRRA 3O1JC 1NXPA 4L6IA 1VMIA 2NW6A 4LOHA 1LSSA 2QP9X 1L4FA 2ZTVA 2JEYA 3TTYA 4EMBA 2IYXA 3JAMA 2ORIA 4U7DA 4HTFB 5DX0A 3D8UA 3WLIA 3PC3A 2B35A 2M32A 1SC4A 3S1LA 1ILEA 2WJPA 3F74A 4LE0A 4BASA 2D8AA 2NPOA 1JZTA 4A3SA 3FDZA 3KEQA 1Z22A 2YCBA 1OXMA 4KSCA 4UBJA 4K1XA 4XM2A 1YKGA 5KNCA 4YCSA 1VPDA 5KYXA 3LUHA 1ULBA 4AO7A 4MMXB 5IXJA 3OJWA 2I1VB 5D51S 5K6AA 1R0SA 1U3CA 3EWNA 3IO3A 3JD3A 4Y2HA 3RHZA 2VQ6A 3ZCVA 3V9AA 3S55A 4DCGA 5M2QA 2CVZA 3BZUA 4DG8A 1SG6A 1V1MB 3FDFA 1W7AA 1WUTA 4DIBA 3S40A 3C4QA 4H1HA 1R4MA 3MPUA 3GCWA 5KJ1A 2EFCB 1XTRA 3WZMA 3TM5A 2GAOA 1G8FA 2XLBA 4HH0A 2I91A 1NLYA 1SIBE 3ZBQA 1NUHA 2X22A 1DKOA 1Y1LA 1ZG3A 1VYVA 5FUWA 3VPCA 2XB6A 3UPUA 1NRWA 2QSZA 3N2LA 2AN9A 1EVEA 3KWJA 3GMDA 1E3LA 4A7PA 5CCEA 4YQZA 1T24A 4IGEA 1V5GA 4ZCLA 4GYWA 4JLBA 3L7DA 2ZE5A 3RIEA 1T2CA 1V16A 2LWIA 2X42A 2QAGB 3T7AA 1NIJA 2QIOA 2WNSA 2YXEA 4U8HA 4D4LA 5LQDA 1DZ3A 5DBOA 3BWXA 4HQFA 4WINA 1OQAA 2ADOA 2XRMA 2B8NA 2QN8A 3IKJA 5DHSA 1JKXA 4HMPA 1BE1A 2PL1A 2XRYA 3ONFA 4O3MA 5K05A 4MWTA 3GNLA 3C7AA 1RLIA 3FTQA 2Q41A 4IOKA 1CUFA 2B3DA 3LCJA 4UQPA 4NU5A 2YV5A 5EJ6A 3F5SA 1X7WB 1ZINA 3MOGA 4YO8A 1A7KA 3I72A 1SCAA 4JP1A 3ZQKA 5BN3A 4KLNA 3OTWA 3IMGA 1L8QA 1VL6A 3GL9A 3QV1A 2RGBA 3THYB 1T4GA 4BLWA 3JQ6A 5BWBA 3C4JA 2FHSA 3UWOA 3TE6A 3DHEA 3PI7A 1GQOA 2DP4E 1GQSA 2OHXA 5HFJA 5J1TB 2GRUA 1M8FA 3JVUA 2E2WA 2H4FA 5DNEA 2HMWA 3FVVA 3OIYA 1XRQA 4MPRA 1KRWA 1UC4B 3LY7A 2PZGA 2DBQA 3CPHA 5C37A 1DBWA 1JKIA 1L2TA 3AY3A 1UMDB 2GZDA 1EFHA 1T34A 2HIGA 3IOYA 4NBTA 4QYWA 4DDMA 4DDVA 4AS1A 4QT0A 1BVRA 3ZXYA 3AG6A 3FMVA 4OHVA 5JSZA 5ESRA 5C1OA 1EDBA 4CDNA 1ZGBA 3KQUA 4FYWA 4A8PA 4P93A 3ABIA 3TD2A 3NTLA 4MDYA 2W48A 3IAM1 4CFSA 3EXHB 3R3WA 1JIXA 5DXJA 1X7XB 1KXZA 3JWIA 3L0BA 3DOJA 3F5QA 1M2JA 4H08A 3IEMA 1D6NA 5B30A 3V7NA 1CZOA 2V7WA 4JEHA 1GAJA 1BJKA 1NU6A 1GYPA 1N57A 4Z9FA 4WCFB 1HT2E 2WIJA 2W2NA 4JU8A 3CLRC 2ZJ3A 2RJOA 3ANNA 1D4AA 3EYWA 4PX2A 3ZHTA 4NE7A 4OXIA 5JIBA 4WXEA 5HQTA 1WIWA 4TZTA 3VC7A 4EDFA 3ABRB 2CYCA 3QPWA 4EGAA 5HFNA 4J4TA 4B2LA 4K9RA 3UAWA 3LZCA 5JQGB 4YPVA 3CBQA 3DQQA 1LZKA 3VGJA 2WZDA 1NJ1A 3WBJA 4TT3A 2XAUA 3IIMA 4K5QA 5A4FS 2O2IA 4ZI7B 3D5EA 1DRVA 3FNIA 3T5DA 2QGZA 2W2TA 4FYHA 2YBDA 4QBTA 5DHPA 2C2KA 3WWZA 1NMQA 1K4YA 5DW0A 1AOXA 2XB8A 3EMBA 5DEOA 4Z7OB 3ZLBA 3H6KA 2O2SA 4N5HX 3VR5D 3SF8B 2P9YA 4GR4A 4JA0A 3FCEA 1J23A 3WJAA 4F9EA 2W7TA 2O05A 3VNUA 1GTL1 3R6GA 2V3WA 1E4YA 4FGUA 4PZYA 4URZR 4W9NC 2NUPB 1ZJWA 1RZ3A 1XHEA 1E3MA 4S1TA 2I6UA 4TRNA 1U6KA 2LUOA 1BEZA 3NRBA 4UFNA 4L5BA 3SDSA 2HWUA 3LLCA 2CB0A 2W4MA 5C2JB 1W47A 3Q3HA 1L7OA 2WD7A 2D7JA 3M5DA 1N8SA 3PKJA 4MX8A 3QE2A 3U17A 1SULA 2R96A 5JISA 3BX1A 1EGAA 3EYAA 3L8FA 4G25A 4HG2A 4WGGA 3U49A 5JI2E 1KVRA 4AIRA 1V45E 3T7EA 4ML3A 3C3CA 3ESAA 4XGKA 3STHA 4ZIRA 3DGEC 2W90A 2YVKA 2HT6A 2R5NA 1L5OA 3BKXA 4TLMB 2CKDA 2DHCA 1GG5A 2VPXA 5EZYB 4XGIA 3R0XA 3TR0A 3NNNA 5KNDH 4MVJD 4WACA 1NIPA 3L7AA 4FCCA 4H6WA 2NOAA 3RG8A 1ZA1A 3PF8A 2QXYA 5DT2A 4YC7A 4G5HA 1TU3A 3ZWNA 2XCSB 4QNMA 3CNNA 2PWBA 1EKXA 4J0EA 3KSMA 3ANMA 3GW8A 2V74B 2FN4A 2ZRBA 3H2IA 5CLQA 3VVCA 4D3YA 5AESA 1N4DA 2I3AA 1XMJA 3H9BA 1O89A 4OBBA 4C88A 1KYYA 1G20A 2B34A 4GL4A 1RI3A 1GTJ1 2ZB4A 4NX2A 3IMEA 4RABA 5AHRA 2OFOA 2E5FA 3A9VA 3QKRA 3N70A 1ITZA 1Y4DE 2FDXA 1BKYA 5KNCH 5L6LB 2J1LA 3ITNA 5E7IA 2F3RA 2BZSA 4R98A 2QW1A 3A06A 3LVQE 5FPPA 3MHTA 1Y42X 5IAAA 4S3MA 1A50B 4FFDA 1X9HA 1S2IA 2FMIA 1Y5NA 2V6BA 3KD2A 2Q4EA 4R40A 1CUBA 3WL7A 4I4CA 3P96A 4Z49A 2AI1A 3OFND 4ZT5A 3GU3A 1OJ7A 1S8FA 2JK1A 3N59A 2V0CA 4PFJA 2Q4RA 3TEJA 1SCDA 3NM5A 4CGYA 1N0WA 1YIDA 4RHCA 4ZAWA 1L5LA 4EYGA 3PXCX 2BPOA 3SIRA 2W6ZA 2CXUA 4CMIB 4PICA 2PZLA 1F48A 4A6PA 5DFAA 4UQOA 3R7NA 2C54A 3EGWA 3NIDB 4BCDA 4TV8A 2CBGA 2PS9A 5GAJA 2B4KA 1Y7PA 1YRBA 3L4SO 4S2UA 2H1RA 5LBIA 2QN9A 1W5SA 4D9NA 1UC8A 1XD8A 1YO6A 5HQJA 3UKDA 4QDKA 2H92A 4RHXA 4OQXA 3KE8A 1TPZA 3I1IA 3LIPA 3AR2A 1PR6A 2AFVA 3DL7A 5ER9A 3AWDA 4E5NA 5DB4A 4UU0A 4W5QA 4GDMA 4RA9B 2PO7A 3ONDA 3PG5A 4M55A 5JLJA 3HRIA 2JIOA 2P6MA 2WE8A 4LNHA 3P2EA 3U9SA 1X9IA 3FNQA 1QDEA 2HHLA 2NSDA 1ZI8A 3QSGA 4L28A 1G3UA 4HDNB 4N82A 4ZPJA 3T1YB 4MWSA 2H0AA 3U48A 1HTBA 4C78A 1EXNA 2DSNA 1FP4A 1W96A 3PPIA 3R3SA 2Q8PA 4JMLA 3T3HA 3V2GA 3ZK8A 4CG1A 5BSHA 1I6MA 4OD0A 4QASA 4CVNA 1G2QA 4B3HA 2VBIA 1Q0RA 2YYZA 1JR3A 4FYIA 2V7TA 3NTXA 4MWOA 3HJRA 1QQ7A 1KOGA 1BJTA 3HO6A 3RWMB 3K96A 4JLMA 1J07A 1K66A 2VDPB 5AXDA 5SYNA 5I6DA 1CUIA 1W85A 2VK8A 2YYAA 4NTZA 3SLRA 4RE6A 3SS7X 2R2GA 2LTAA 3QBVA 1XQ6A 5AJUA 2C4UA 5JVDB 1ND5A 1RHUA 1R9GA 2ORED 1SG9A 2HEIA 4Q3LA 4TQGA 2CC2A 4ARBA 3D0QA 3QFCA 1PD1A 4B44A 3HWWA 1WBBA 1J7KA 3U0VA 4R3NA 3DMGA 1HDIA 4QTTB 3RABA 1PE0A 1USUA 2C8VA 1JEYA 4KFCA 5T57A 1EM8A 1QR2A 1FK8A 3AFHA 2Q4TA 4NAVA 1ISHA 3DS8A 4Q4LA 1E1KA 3PBKA 4H0NA 3PEWA 4A8HA 4BO5A 4EMTA 4X63A 3W6OA 2VP3A 1MT0A 3K1AB 1FFHA 1VKRA 1N7GA 4EHNA 3F6EX 5JRJA 2ZE8A 1A77A 1AZTA 3WRYA 4IDCA 2XI4A 1MG0A 5E95A 3KQKA 4UHFA 4TWAA 1SBNE 1QX3A 4E22A 2JZOA 1PJSA 2PRJA 3EC2A 4PPGA 5K8IA 5AK6A 2WPDA 4JWTA 4MYSA 4F0JA 2DBVO 4CCAA 4Q0MA 1RHMA 2ZIFA 2D5BA 1MEOA 4EVSA 5HHTA 1DQNA 4QUEA 1FUYB 5LMUB 5DN6A 1QMPA 3TAXA 2YHSA 4EPWA 3ECSA 1ZEMA 1XNGA 3M4XA 2RK3A 2ZJ6A 4Y1FA 3ZLTA 1WKBA 2WT4A 4B09A 5IANA 3PJRA 3C7TA 1FYDA 1U90A 1Z6GA 3UMBA 1RPAA 3VR6A 2X1MA 2GRJA 2AJCA 3VJKA 4C89A 4E0BA 3CWQA 3L0SA 4LXQA 5AOAA 1EUDB 3GMIA 3RKSA 1Y6FA 3EA5A 4WTOA 1VG0B 4FFOA 3VNQA 2QORA 4U9UA 1YJCA 1IPFA 1RRFA 1CY4A 4NQZA 3RJZA 4D9HA 2AEFA 3GPIA 5HKAA 1WZUA 4IJ5A 4OP2A 4UZFA 1XDWA 2HF8A 4UCFA 3AVTA 4WSOA 1H4VB 3QEAZ 5EHZA 1I1HA 3JYPA 3PHHA 4NENA 1E2NA 4MW0A 4FFBB 1CLEA 5DYTA 3SJZA 1DJLA 5AW6A 3HU5A 5EP4A 1PGPA 3GUUA 1DG1G 4K9QA 1A2QA 3HNPA 1XTQA 4FXOA 1F7UA 4B2PA 1ZN9A 4QBGB 1CLUA 2HWWA 3I2GA 1YQGA 1ILWA 1VYTA 4RCVA 2FOXA 4WXRA 3HKCB 1RXSA 4S12A 2PX4A 2QK4A 3GRVA 3OY7A 4QUAA 3I01A 4U7FA 5KOHB 4Y6RA 1S02A 1SHLA 1CJBA 1PTJC 1R3DA 4HLNA 4Y98A 1K97A 1Y1KE 3CUYA 4NONA 5C46F 5L4LA 5LA6F 2QI9C 4NMWA 4AN0A 1K7FB 3KR9A 2NN3C 3EG9B 4ZHQA 2J3QA 1XZLA 2ECPA 1HDOA 2TYSB 4GEKA 4WEOA 5EESA 4XX0A 4CIXA 2J5RA 3TZQA 4AYWA 5ALFA 3LC7O 1OIVA 1V26A 2QM3A 2XXJA 4KITB 5L6MB 3ITDA 1QIDA 2HOQA 4RVCA 2G1PA 2BM0A 3VO2A 1N3YA 1Y81A 1BWPA 1MH9A 2PX6A 2QYTA 3R6LA 1DRKA 1YUNA 3OZGA 3RIYA 3HXTA 4V2UA 3E9QA 3RC2A 1J5EB 1NI5A 5DBIA 1PVVA 1K7CA 2Q46A 4DV2B 3DTVB 5J4HA 1E8DA 2DH6A 3J81k 1BH6A 5KAPA 3GUVA 4MV4A 2VH5R 2LR0A 4P4LA 2X0FA 5IXSA 3KPYA 4PZLA 3SD7A 3BWDD 1QYRA 1NXVA 2BKAA 4TM7A 3RT1A 5BY2A 1K8ZB 3DOOA 5EP3A 4WD3A 1Y7TA 1EX9A 2EDAA 2Z9CA 2JI9A 4MP8A 4IW3B 5DX1A 2X9GA 3KOOA 1U2GC 1AX9A 3ZY4A 4BQNA 2P5TB 2ZQZA 3PHIA 4GQIA 1QPGA 1I7DA 1RM0A 1VL1A 3WYBA 4E2WA 1DO2A 1M1NB 2DFNA 1Q6ZA 5THXA 1JIJA 1ODKA 2IF0A 4MVXA 1JHPA 2JCGA 2ZW9A 4F2DA 1O8BA 3CT4A 3QA3E 5FUBA 1HYHA 2Q6KA 3B85A 4R1PA 4GXRA 3QEOA 1J90A 5BNFA 4YCMA 2W6ID 3I2YX 2F1RA 3PR1A 1PYGA 1VE9A 4IH9A 4Q9LA 2ID7A 4JYZA 1TCVA 2WRZA 4U5XA 3Q1LA 2FCRA 2HCBA 3IQXA 3KL4A 1TTTA 1UEIA 5EIAA 2VT3A 2Q1UA 4QQNA 2HCTA 2QTRA 2HFJA 2ERYA 3PGVA 4PYMA 3HKBB 1I6WA 2GH1A 1H05A 3OMLA 5FQOA 3AFIA 4I9FA 2GVDC 1UPXA 1KPHA 2X40A 4O2AF 5KNDD 4XSVA 1UJ4A 4M99A 3QOFA 4B3JA 3QJ5A 4MUNA 3DKVA 4M0DA 4BJHB 2XW6A 3MJ4A 2FJPA 5BQ5A 1JQBA 1H0RA 3L5KA 3RG2A 2B30A 1PQ4A 1Y9AA 2R25B 2ZTLA 1QANA 3GFOA 4BLUA 1EBUA 4YJ2F 2I6QA 1T43A 3MT0A 4R9VA 4RUKA 4F12A 5JCXA 3AGQA 3LS2A 1JJFA 2XYGA 3VPBA 1KI6A 3FR7A 2F43A 3QOXA 4ENVA 1IXKA 5AM3A 1AKEA 3RARA 3CEPB 3DAHA 3LQ2A 5HA5A 5GV7A 4W5TA 2XIJA 1ZCJA 1DINA 2AW3A 3LPAA 2BM1A 4I0WB 1Z82A 1N8TA 1ZCFA 2RBGA 3NVAA 4HB4A 1Q11A 5B55A 2IITA 4O2BA 2Q4BA 4R54A 4FLFA 3OE1A 1KO5A 3K9FC 2O8EA 1ZUNA 2FP3A 2VRNA 4N0EA 4N9WA 4N76A 4X45A 2I99A 2BHLA 3DPSA 3O94A 3QWAA 4JLUA 3SLGA 4E5DA 4DJEC 4CIAA 2KM1A 2GXUA 2HTEA 4Z4IA 3L6OO 4CMJA 2BMAA 3ENKA 2CUKA 2F64A 4U7HA 4BUCA 3OQBA 2RHJA 4FGJA 1W88A 2ID9A 2EGGA 2NSLA 5ALIA 5G41A 4AAYA 1MO2A 3BB1A 1KYQA 3AL3A 4ZEMA 3GZNA 4NZMA 1M83A 1AGXA 1H8ED 1CP2A 1TPYA 4OQNA 5DGIA 3A6DA 1IBLB 3A6KA 2CDNA 2Y68A 4D9GA 3EWSA 2QUZA 3NVKI 1YCDA 3CX4A 3IGFA 4ND8A 5HM8A 1HE4A 4DB4A 4L76A 2QR2A 1AS3A 3BXOA 4G26A 5JDIA 2FPMA 1PL7A 1CY2A 1Z06A 2P90A 3H1TA 2GN8A 4G07A 4M53A 1P5RA 4NZOA 2O8VA 4U7GA 4CM4B 3BF8A 1BHO1 3DDZX 1VHDA 3VPDA 2QBYA 4N8SA 4QUKA 1YVRA 3CISA 4DLRA 1LBTA 5C18A 1Z08A 3GEDA 5E4FA 2N9UA 4OXQA 4OMDA 5JSQA 1UXJA 1T2UA 2MINA 4HDAA 4Z4FA 2HQSA 4QARA 4DWWA 4MUJA 2VQEB 2QG6A 3DGFC 1QO0D 4LJKA 1EB9A 1LRJA 4HH4A 1YI0A 4KQJA 4UE3S 3RKUA 3VR5A 2TMKA 1WB9A 4ER5A 2WF6A 1E2DA 1S8AA 1L8AA 2PSEA 3FHOA 3HY6A 4WT7A 2Q5EA 1JQEA 1UK7A 2GGSA 1JEAA 2JVKA 4L0QA 3U3XA 3WQRA 1Z28A 2FSFA 1SC6A 3MWLA 2INGX 2YIDA 3Q6NA 1T6BY 1PDOA 4MA5A 2XWBF 3C97A 1FF9A 2J7KA 3SE0A 3DEZA 3E9ZA 1OZFA 3AESB 4AM8A 4IYRA 2LXNA 3FUTA 1BA3A 4MVJG 1X7YB 1FYXA 2BMVA 4FE4A 4K3VA 2CJYA 3WKCA 1AY0A 2J3LA 3GJRA 3QE3A 4ZVQA 4CODB 4WNAB 3WB2A 1P1HA 2PPVA 4V02A 2JLVA 2ZZNA 2BE9A 3GJ5A 1Q2XA 3MWKA 3ZLVA 1GPJA 3SEZA 5ICMA 2XB4A 3W5BA 2F17A 5EKDA 4NCNA 1X7DA 3AXTA 1XXHB 4BVBA 3GJYA 4I6JA 3SNKA 4YLEA 5F98A 4EI2A 4JQSA 2CNWA 4MVJA 4B43A 4ZO9A 4ZYXA 4KUHA 3HA3A 2HMUA 3I61A 3HJTA 1J2EA 1GL3A 3PPXA 3W7BA 1MO5A 3OUTA 4YN3A 1GQQA 4I81A 3KQWA 3K2QA 4AMVA 3INGA 4YAUA 3QE4A 2AFHB 1C4XA 3KSZO 1CQJA 1HQKA 1N77A 2IYAA 3NJ8A 2VDWA 4K6MA 1HM5A 2WYIA 3FXAA 3GJ7A 1ZGGA 1NUAA 1JFFB 3ZKWA 3NKFA 4M7OA 2GVZC 3KB2A 3UCEA 4U2BA 3DZDA 4N01A 1EFVB 2IS1A 4ID9A 2HYDA 2XF8A 2XUZA 2X6QA 4X1KA 1VJ1A 2ZDQA 3WK4A 1JSZA 4MI6A 4B3XA 2QV0A 1WP4A 1H8HA 1QUFA 4JC8A 5EZQA 5FI3A 2P5SA 1RD4A 1D2NA 2HREA 2FEWB 3CN7A 5D3QA 3VU9A 1KMMA 4AW9A 4MGEA 3RLIA 1AGNA 3SIWA 4D8TA 3CNEA 2C7OA 1I2ZA 1XTKA 2FPGA 4GYKA 4L4SA 4AZVA 4NH0A 1PR5A 3F67A 3QE0A 2OKGA 1H5QA 1YE8A 3PTLA 3OFNA 4JSYA 4OB8A 5TGTA 3UAZA 3ZWAA 1FMTA 3MT8A 4OM8A 1VGRA 2DT5A 1RACA 4KBGA 4D8UA 1Z39A 3P0IA 3KLPX 2EEZA 1RWXA 3G8BA 4L8LA 4NZZA 4YCBA 5K4AA 1B6RA 4IF4A 1DO0A 4V1CB 2AXPA 4X85A 3MINB 3G5TA 3PE4A 1WW2A 2HSWA 4HFMA 2C5LA 5HKLA 3TOZA 1LGYA 1LJLA 4BYGA 4DDWA 1ECLA 4I5EA 1U2PA 4ZARA 1KS2A 3REOA 1Q83A 1TADA 5IKXA 1QPZA 3D3WA 5EERA 2FPPA 2PD6A 1FX0B 3ESXA 1J0EA 3F9IA 4WFKA 1NYQA 3C8MA 4GSYA 4L8GA 2OCBA 5D5HA 4BGEA 3S8MA 3OJOA 4ZAZA 3T6KA 1L9KA 2CCJA 6LDHA 3ZHYA 3I6QA 5JXIA 5KOJA 2XUQA 1W44A 3I9MA 3KFVA 4O4IA 1XEXB 1P6XA 5L3SB 5H8WA 1FUUA 5JANA 4M8NE 2QXTA 4OL0A 4R2IA 4UOEA 1FJGB 4MPDA 4QEDA 5CBPA 1VHLA 2ZWOA 2DJIA 3F2IA 4NBLA 5SZHB 3RS0A 3ZUGA 1VZ2A 1EXMA 1JFVA 3DBLA 3WNQA 4RO0A 1XCMA 1TXGA 3WV4A 2AC2A 5CD9A 1CJTC 2DUJA 3I5AA 2VZ8A 5AO9A 3SR4A 3W5SA 4KIUA 3U6KA 5FV7A 4FGKA 3V7UA 4B9EA 5A4JA 4MW2A 1OV6A 3KPUA 4JX8A 4EUEA 3I52A 2J0VA 3FCCA 4CLHA 4ZAVA 4BMYA 1ONBA 4DIDA 1G5TA 1P77A 4HGRA 1SXJC 2IQ5A 1L5QA 4PF1A 4YDSA 5TR9A 1RPJA 4N5MA 1JGTA 4LQLA 3GLHA 1QYWA 4MCJA 1VMAA 5BW6B 4BQEA 1E2IA 1T9BA 2YUTA 4RA6A 4QEZA 3CIOA 4C22A 1JDZA 5IH3A 4CLDA 1DXOA 1PBNA 2G08A 3MGKA 1J70A 3OPMA 4DRXA 4JFRA 3ELWA 1BHQ1 2JLYA 2H29A 3KJQA 2NMVA 1VGQA 3L43A 1ZXLA 5HF9A 3AQIA 4AWAA 1W0JD 5FWNA 4FKMA 3L4JA 2EYUA 1YBAA 2BDUA 3WADA 1JQDA 1PO7A 4E12A 2WTNA 4IQ0A 4RVOA 4GLLA 2FSVC 1SCJA 2P8SA 2QVGA 3EN0A 3C3EA 2GBFA 3PDJA 5GONA 1IUPA 4UEQA 2ZQYA 3GN1A 3UW1A 4UAJA 3P9IA 3TQCA 4RZ2A 2PJRA 1AZWA 2XBLA 5FBWB 1KK2A 3HABA 3JARA 4AN1A 1K8QA 1G8YA 1Y82A 1G63A 4CM7A 3TLGA 4H60A 1R27A 3HCOA 2BM9A 5A3RA 1YFJA 4LG1A 3TRJA 5I7UA 3N2EA 3YASA 3T15A 1MB4A 2GN1A 3WWCA 5MN6A 3KEFA 5A5DA 4WBSA 1JAIA 3KXIA 5EFZA 4IIDA 4L75A 3F96A 4LE1A 1ZHOA 2G8NA 1PR9A 4F5WA 3W2GA 2A9QA 2KX7A 4D79A 1KEUA 3PDUA 4KQKA 5DLDA 2B2NA 3WGVA 1VFPA 5EIBD 5IHXA 4NBWA 4HZUB 1F17A 2I7VA 1YZQA 3FGOA 1GR0A 5TT0A 2JIZD 2BF4A 4DC9A 4ERNA 1M73E 5BOSB 1AMUA 1K8XB 1FDWA 3AKDA 1M8GA 1QQ5A 3LQRA 3Q15C 3ODGA 4UMDA 4F85A 1NVXQ 2YYYA 4GM4A 1TCAA 4FN5A 1RM4A 4MDHA 1TC2A 4PC1A 5K51A 2FRDA 1VSVA 4MPPA 3N2YA 2ECQA 3FZYA 1O2DA 4WY5A 3REQB 3OJ0A 2CNBA 4MV6A 2IK8A 4Q7JB 3X44A 4A6DA 4PEVA 3E5NA 2FLWA 5FBZA 3NCTA 4IH4A 1VCMA 5ELMA 3F5DA 4RZIA 2GJ9A 1ZGJA 5CNKA 3SYRA 4XW2A 3KDAA 3K71B 1NXSA 3GB9A 4L50A 3I05A 3UFXA 1CRQA 4NS1A 3BMNB 3JATA 3TUZC 4QJ5A 4YEDA 1DKRA 2H2FA 3KKPA 4OAPA 4DXAA 1YR3A 4GOKA 3FOWA 5A71A 5LJIA 3OOHA 3STWA 4O4JB 5EJEA 1KKMA 2BAGA 3UYLA 3HYLA 5JO9A 5FPQA 3GIDA 1CNMA 5K6AC 1FP6A 5IASA 4UM7A 1YS9A 5GMOA 4K28A 4GEGA 2I7DA 2O3TA 3NC0C 3LUGA 1N6IA 1ZH6A 2PLWA 4L8FA 4B45A 3HP7A 4N3BA 3RSFA 2WM8A 2Q9AA 1PV1A 1Q57A 3OWOA 4TROA 3TTSA 2QP4A 4A16A 1QF7A 2P9JA 3LYUA 1JHYA 3C98A 4MS4B 2HR1A 3ECAA 2ZZMA 3RYFB 4IV5A 4Q7LA 3GVIA 5THQA 1L3CA 3X2EA 4J90A 5JDCA 2GLXA 2PEZA 4NJMB 5AHKA 4E3ZA 2P3SA 1N2ZA 1VMKA 4PFKA 3UV6A 5ITWA 3AEUB 1P72A 621PA 2RAUA 5EN4A 1L5GB 4OLHA 4ZYYA 1SUAA 1BXZA 3MIIA 2YHIA 3CJQA 4LV5B 2PVSA 3TX2A 2NO0A 4PSUA 4UHCA 4W4TA 4GOND 1OXUA 5CB4B 2RGDA 1GEGA 2Y99A 4O4LA 4LMBA 1R74A 4ASUD 1RQNA 4R71A 1N33B 3LGSA 4EIWA 1CVIA 5F5LA 4LRYA 4P3KA 3WDSA 1BVHA 3G8YA 5I45A 5IBCA 2MTBA 3LUBA 3OM1A 3R5HA 5FWXA 4Q4JB 4ZVSA 2GCIA 1R6BX 1VM6A 3ELYA 3X3HA 1GYRA 3T1NA 1QAQA 1QVVA 2A5YB 2UZ3A 1DCFA 3OKFA 4W1QA 4IQ8A 4TTPA 1T1JA 3LDUA 4NXNB 1LA2A 2A7XA 1ONNA 3Q9NA 2W6IA 1VP9A 2D1QA 2XR1A 5C34B 3BT7A 1C7ZA 3JYHA 2DZDA 4FX2A 2MYUA 4HVCA 1TQDA 1AUQA 2PZ8A 3KHTA 3WMWA 1G1AA 1R0CA 1OWOA 3TTTA 5I9IA 1ZD1A 3REFA 3SQLA 1G5IA 3ZDXB 2UUOA 4MP3A 2QD2A 4Z0HO 4AKTA 1NQTA 4YX9A 5J23A 4MK4A 1OI7A 1P6QA 5KNDA 2PUDA 2IV3A 2W70A 3IUYA 2O0KA 3GG9A 3QLEA 2FPSA 4I66A 4HLCA 2IS4A 1O94A 3EY9A 4R7TA 2XNJA 1VG9B 3I2HA 4JZKA 1KA9H 1XRRA 2AOWA 2VDMB 4EELA 3TLJA 2BGUA 3PXEA 1BS2A 2VP5A 3OSUA 4G9EA 4HZGA 3FUXA 2IW1A 3I9V6 1EQAA 3MCTA 3F7OA 2P1RA 4A2PA 2E1PA 1VIDA 1ZONA 2VT6A 2ZWIA 4G63A 3KQQA 2EEPA 3VNSA 2JFBA 2I7XA 2N0SA 2A0WA 2WZQA 1E7SA 2XQGA 5BSMA 1P8JA 3ETLA 4IS3A 5M3BA 1EE2A 3HKDB 5BRJA 2BN4A 1A8HA 5DIFA 3U2QA 4YJ3B 3KYIB 4QHYA 2Y76A 4Y6OA 3H6HA 1KMHB 3J7TA 4J2HA 1ZPDA 4EHDA 4WBNB 4UM9B 2XMSA 3DP9A 1JDTA 4IIJA 4ZQIA 1J22A 1B7GO 1W9MA 4P5EA 1GTVA 4R8MA 4KAAA 5GZ6A 3VZQA 1I30A 1YDMA 3ZWBA 4U9IS 5BT9A 5BWCA 4MAAA 3OIDA 2X3FA 1E2LA 4PCAA 5UKDA 4LXTA 2UUAB 4A0HA 3KJXA 2QRGA 3TFWA 1D0SA 1H8EA 2CV2A 2YZNA 3KWMA 2CLSA 2X7HA 2IEIA 3O6VA 4OLFA 3IEIA 3KVOA 1E2PA 3MK31 4V0ME 3GD5A 1CY8A 3W5JA 4EZBA 4TSRA 2NTNA 3UMGA 1GLNA 4YUXA 3N75A 1KYWA 1Z75A 3IEUA 5FUYA 1A69A 2ONCA 3RFFA 3SU8A 1ORDA 1YZNA 2R8OA 3CMCO 2Q1YA 1KI8A 3EEBA 1R64A 4G0OA 5I48A 4Q15A 2F00A 2IVZA 4FMBB 3TECE 1U99A 2NUTB 2IU0A 4CM5A 4YR9A 3F6RA 3W9SA 5HKBA 3DV0B 3RHTA 2FDCA 1NWCA 1SZDA 3BM5A 3LCRA 1HQDA 3A2MA 1IHOA 3EUAA 2Q9UA 4J94A 4JUIA 2FZ5A 3PUXA 3G17A 5EPEA 4Q24A 3TCNA 1SZPA 4DZRA 5TY0A 2PGOA 3TI9A 3AFMA 1R0YA 1QO0A 2OO3A 3CF6R 1KP3A 2ARKA 4C1NA 2I55A 3TXYA 1JDBB 1UINA 2PAAA 3LXMA 2IRWA 4GNRA 4OXRA 4WLOA 2I87A 1AV6A 1E3WA 3LH5A 1K6JA 5JEEA 1W46A 2ON6A 1XTIA 1Z0UA 4H1TA 2VF2A 4WOBA 4W99A 4OMCA 4EEXA 3KTFA 4EFLA 5KYNA 1A2OA 3DLPX 3NHPA 4KVGA 1N34B 1ZL2A 4AICA 5AJWA 4EKGA 2JNWA 2B98A 2C03A 3QF4B 4E94A 3KQVA 4W5NA 3BICA 2PMDA 1NXQA 1LY1A 3PQDA 1I1QB 2WV7A 4KSBA 4RMIA 4UBNA 1N9ZA 1ORVA 1I1OA 1XB2A 3HA2A 4HEHA 1EVQA 2LCIA 3MLAA 4BP3A 3T54A 4DYVA 1X7ZB 1VHTA 3D2CA 4WVLA 4UUAA 5EJIA 3SEQA 4EGJA 4F2PA 3ZU5A 5TE9A 4RV5A 5EMKA 3EFHA 1Z5NA 3GOQA 4F2WA 4YDQA 4BQOA 3MTGA 1E5XA 3R6DA 2QRJA 3H2YA 3H8SA 1EVZA 1XMQB 1TRKA 2W43A 3UCXA 1F0YA 2BKXA 2I1LA 1FYWA 1RTTA 5DHTA 1TQ8A 3IUMA 4H2DA 4EP1A 2YINC 4EJFA 4YXWD 1WCYA 3OCJA 2BGKA 2CGEA 3ZWOA 4BU1A 3K0EA 3WK6A 3GPBA 4IUBS 4YT5A 4G0VA 4KGXA 4LXXA 5CDHA 1F9AA 2WZBA 4PSVA 4WASA 3ORYA 2NTVA 2OO5A 2A9KA 2NO4A 1RPTA 2VOEA 3H2ZA 5B1SA 3ZCRA 4RWZA 1IWBB 3VYUB 2SECE 1ZKMA 1IXSB 2OWDA 1XLUA 1CFZA 2WSLA 1GP2A 4I50B 3GYGA 3MN1A 5EZSA 2XE4A 3KKLA 4J0IA 3RVNA 3TG2A 4HWGA 1WCIA 2DTDA 4TZKA 4LZJA 2W98A 1JBQA 1NA5A 4TL9A 3N2ZB 2VDKB 4ZJPA 4DV4B 4DIOA 2A33A 3T3MB 4LOKA 4C5CA 1JLRA 1ZGZA 4MKXA 2PH7A 3GG2A 4GXNA 5K0EA 4MKFA 4WN9B 3WK9A 3AOGA 1IVYA 1WVIA 2Q3EA 5LPNA 2G40A 3HB9A 3NBXX 4Q4HA 3M1AA 1ISFA 3BMCA 5E9JA 3C70A 5HPYB 2JBWA 4YRSA 1B0AA 2PL9A 4UAGA 4MQ5A 2ZE7A 2H9YA 5DCYA 1SUDA 3EWIA 4RF2A 3LBNA 5H02A 2E21A 1Q95A 2B83A 2QT0A 4MKHA 1SBCA 1EFUA 3LF2A 2J0SA 1PIWA 2IUUA 5A7FA 5K8TA 3D7SA 2V03A 1J9EA 3MJDA 4MICA 2O7SA 4H6VA 4S0XA 4P84A 4B3CA 3ZY2A 5FADA 2AUMA 5B6IA 1XZAA 3KQPA 3DFKA 1WVMA 4LPKA 3G2MA 4UUOA 4CETA 3ILHA 3V2HA 3GQBB 4R8RA 4AJPA 2FYTA 3PHBE 3SZGA 5D1HA 5IAKA 4JYBA 3LVFO 1Z62A 2NACA 4BO8A 2WAYA 4I8DA 4TYPA 4JJZA 3K9HA 3WLQA 1S4MA 2C5FA 2Q5IA 2X7XA 4FM9A 2HQOA 3RVSA 3ZLJA 2H18A 2YH2A 1AXEA 3NASA 3TGPA 1YV9A 1C29B 5DSZA 5EMMA 4U6NA 3Q8LA 1NYLA 4NRDA 3MT9A 1YU9A 4G6ZA 1Z2CA 4HY3A 4QBIA 1ULAA 3F3YA 3JQQA 4JL5A 4KR7A 3MWJA 2H7XA 1KSFX 1GKKA 3W79A 3W2FA 2D0PB 3VHRA 3WRYC 3EQ8A 2IBTA 2WG0A 4NPAA 1MJGA 3FGPA 1Y6ZA 2I54A 3QUSA 5ALGA 3Q4GA 3U80A 4I9UA 1SG0A 1QIMA 3EXEB 3JQRA 4M38A 2ZUSA 4C04A 4QYMA 4TLBA 2YR0A 2ZRPA 1FE8A 1CUYA 4O6VA 4A8TA 4B32A 3PWZA 3GFPA 3QKUA 1W0JA 3NRJA 5D85A 5AK4A 1JZSA 5A5EA 2QRHA 1CS0A 2QN7A 4HX9A 2UUBB 5I4CA 2EKLA 1OAKA 1RXCA 1E2UA 1G9SA 3L6BA 1Z0IA 3JAKA 4BGVA 1UCFA 1I2MA 1P7VA 2GCNA 2O57A 3NNDA 5BVHB 3QTBA 1NBIA 4L74A 1BG6A 4WLUA 3RRYA 5HQ3B 2JGDA 3UAVA 5C7YA 1H6CA 4U02A 1JYEA 3O2NA 3PFFA 1LSUA 4Y9UA 5KMGB 1G16A 2AN3A 3OTQA 2WQZA 5IJZA 5MFPA 3GT4A 5A5VA 3PQ2A 4MS3B 3TNYA 1GGKA 2VRCD 2XB9A 1OTXA 4PQFA 1R8QA 1K08A 4R7GA 4KPUA 5BV1A 1TK2A 1E94E 4B75A 2B94A 5A3JA 1R7RA 1JFSA 5SZKB 2H4XA 4UBMA 1IONA 1V37A 1R0WA 2MJLA 1PU2A 1SB9A 1IXYA 4LJ9A 4A82A 3FOAA 1YB6A 2JIZA 4O2AB 5ER6A 5JNUA 1T91A 5EZ6B 5AVWA 4F1KA 4BFTA 2R9VA 3BMQB 1V47A 1IOWA 2XADA 4LJSA 2B5VA 2REXB 2V54A 1L4BA 1I3LA 3KKOA 1UT5A 1OB2A 1KH2A 4BEVA 4ND5A 2VC2B 1YGYA 2QE6A 2GK3A 2ZDHA 3UOGA 4YJ2B 4ARAA 4YHHB 2ODPA 2PLFA 3VZBA 1CRPA 4D4MA 5A05A 3A0UA 5F2EA 3ZIDA 4I4TB 2VYQA 5IJXA 4JKOA 2ECFA 4E70A 2P79A 4FYPA 4KWEA 2F67A 4PYLA 1W4LA 5DTEA 1P60A 2VK1A 4RGYA 2OZLB 3LJKA 5EFOA 2J3JA 5J5CA 1OGYA 3AL2A 3SVLA 2XZDA 5P8WA 2XWQA 1PSDA 3I4CA 5CB6A 2I4LA 5EHIA 1M2WA 1NE7A 1ULHA 3A14A 3IT0A 3L04A 3RTDA 4BNJA 2LE0A 3C87A 3M4ZA 2YS7A 4ZQHA 3WIVA 2RKBA 3GBSA 1R00A 4S1NA 3EFBA 4TWZA 5GY7A 5IMBA 1M76A 2OECA 1KFKB 3SCZA 3K16A 1MO4A 2B9EA 4P2BA 2OV1A 5COAA 4FWIB 4Z6KA 1C4WA 1C30B 5KJEA 1MV5A 5FPSA 2AOTB 5KZMB 3MFQA 3V4FA 2FPIA 2GK7A 4IHAA 1R9NA 3VZRA 1SUPA 1DZIA 4Y2GA 4M49A 5IKOA 1NZFA 2Y27A 1HLGA 3A36A 5HRAA 3U1BA 4KAXA 2GSWA 4TXJA 4OHPA 1UQRA 3D0RA 3FHCB 4ZCSA 4P0PB 3V3TA 1J8VA 1LVGA 1TM5E 2NU9B 3L5OA 5LP6B 1PJCA 1OC4A 1QHFA 1EX6A 4IY1A 4PYNA 5JJIA 5JYEA 4BFLA 3EDRA 3WKAA 2QZZA 2ACEA 2E82A 2PSSA 3PGXA 5LIPA 4GDFA 3NHJA 1VE7A 4ILEA 4KQFA 4CR8A 1XAGA 2R1VA 5IAJA 4NYIR 2YJGA 4KGZA 2Q2VA 5A2QA 1E9DA 2RCYA 4ZICA 3SC2A 3LP6A 5DHFA 2XQVA 5HEKA 3RK1A 2X86A 4OEHA 4YTEA 1L1FA 2FEXA 1GITA 2NNLD 5BQFA 5JRZA 1LDBA 2DUUA 4M54A 4P4NA 4KMRA 1P91A 4LVUA 2A5JA 4G65A 4CQLB 2OCAA 1M2GA 1Q1BA 1T4CA 4HAWA 1J1UA 2QW0X 1I0ZA 4Z4QA 4B83A 4EL0A 2CVQA 4RFLA 1QUEA 3UY4A 3I01M 3P45A 4LTNA 1PJ3A 3KB8A 1YQEA 3FTCA 3I62A 5BSGA 3AU9A 4QDUA 4NHEA 3K05A 1Z6TA 1NAIA 2ZJYA 5B36A 1RLOA 3GGCA 2XD9A 4HF7A 2QQ0A 1F0KA 4EZIA 3WA7A 1MOQA 1YUMA 2ZB2A 1LNQA 3BD8A 5LYJB 1FDRA 1DWPA 4REMA 3WDMA 3VUEA 4HC4A 5JZMA 2REBA 3E9NA 4OIFA 3VHLB 1HTTA 4GMFA 4JK3A 1N6LA 5CRIA 1UPFA 1YRAA 2VVTA 3OO1A 4DEYA 4EENA 5EIEA 4BX8A 2D5LA 5JZBA 1P0CA 1VLLA 1YZVA 5A06A 4EF4A 3VJLA 1QFXA 1XN1A 2OG1A 2X4LA 1JAYA 4YJKA 2P2NA 2RHBA 4FNOA 1X77A 4BMPB 1XUOA 2IC5A 5H9WA 5IZCA 1PR3A 2HIHA 1OZAA 1HDZA 4FTWA 2V58A 4HYYA 1R5JA 3BH0A 4AP5A 4BFVA 4NAHA 4PIPA 1JPUA 1P4GA 1TTPB 1S8OA 2VDQB 2ZR8A 3FI9A 4KJXA 4WH0A 3A1FA 1CNFA 2LDXA 2YRXA 2P78A 2IIVA 4LKRA 3JWJA 4I46A 3NHYA 13PKA 2PWAA 3HUTA 4YFVA 5ALNA 4C0SA 1TKCA 3OECA 1TJNA 1IB6A 2VJYA 3JYLA 2DQYA 2R751 5L3RA 2UUPA 4JKIA 1OD6A 4RKYA 2J48A 3EGXB 4NKRA 1II8B 2E18A 3UB2A 5JDIC 2UXCB 1BRTA 5ALYA 3TBKA 4XDGA 4XPIB 1TYEB 5I3ZA 5GJVC 4HV4A 3BB4A 3UJ3X 3HXPA 2K6GA 1YSCA 3ZGYA 3HSYA 5JW6A 1IVNA 1YWGO 2A1IA 2NLOA 3MMNA 3TZ6A 4XVCA 1P1BA 3OPXA 4JJKA 3SFVA 2QMEA 4LZZA 1N4AA 4EKNB 1LQ2A 4ZN6A 3R3UA 2REQB 4I8IA 5CBKA 1X74A 5DWQA 1KI1A 3V8PA 1FTNA 1PX0A 2XQIA 2CJWA 3TEMA 1KJIA 3GJ4A 4OV6B 1M6WA 4UTOA 1WY7A 5EIXA 3S1AB 4BS9A 2G5CA 4I08A 5WRFA 2VTDA 4GC9A 1V7QA 4AKEA 1KWKA 1C0IA 4F45A 4EUFA 1FRQA 1DIAA 5DNWA 3PCRB 1IUNA 4C7OB 3B3GA 1JG2A 2LCFA 2O07A 2OILA 4CEHB 1DKNA 3PHLA 4HX5A 1R9JA 2BFEB 3ZJYA 4DARA 1ZLYA 4LHZA 5TLSA 1Q0ZA 4U6SA 3T5MA 2OHFA 3ORQA 1WMDA 1DC8A 4G0XA 1RKBA 4D97A 4JQCA 2P6OA 1IEXA 4I6GA 4UMVA 4B1FA 5AFSA 2O8DA 5FX2A 1Q7CA 5KKCA 1IIRA 1YU6A 4KQHA 1M6YA 3KZMA 4FOPA 1CUUA 1TM4E 3BXHA 3UJ9A 4YRJA 5EJ7A 1VE5A 3U81A 5D5PA 4A0RA 2O8BB 3P2IA 4ZMRA 1DG3A 3ZQUA 4R0MA 1WAMA 2XZLA 5JBNA 2Y92A 5CA1F 1P7PA 5LQAA 1X7HA 2FVYA 2NUAA 3QMVA 3H9GA 4CMHA 1PJAA 1Y1RA 5BURA 2A3NA 3R3YA 4K6KA 1CHNA 1ORRA 1YZHA 5GPBA 4XRRA 3WJ2A 1T4BA 2VHZA 1HE3A 2BI7A 3Q3CA 3R76A 1FTGA 2C82A 5IBQA 4AZSA 2Q50A 1EBBA 3DAPA 1H2HA 4BX3A 4RS4A 4WKNA 3LT2A 2CUNA 1YCHA 4KOEC 1YK1A 5HZGA 4B4WA 4DBLE 2HHAA 2YNMA 2LBPA 5LA6A 4BP1A 5AD1A 2LKDA 5BSWA 1XNHA 2FFRA 3G5UA 3GVHA 1MRNA 2UDPA 3CLHA 3OLVA 4EQ6A 2BFBA 5ICCA 1U9IA 4L8WB 3TIGA 4JLWA 2GB4A 4YXWA 2I3ZA 1AF7A 1E20A 3ORSA 3O0DA 3TLAA 4EG6A 4AQYB 3M83A 2VPYA 2CV1A 3D7MA 2WJHA 3JV7A 1F0PA 1YD7A 3F3KA 1LXCA 3BC1A 4LJ4A 1V39A 1TMYA 3CC8A 3JWGA 4GGPA 1PGNA 3CE9A 3SZMA 4CG0A 3O3MB 3TDKA 1TUBA 2FWNA 1KSGA 3K9WA 2FNAA 1B0UA 2PL3A 4G1MB 3AVOA 5TMBA 1P2SA 1TMOA 5LUBA 5LQMA 2JAOA 4F6RB 2OQIA 3O47A 4OUDA 1G7SA 1NX9A 1BN7A 2BFCB 2DC1A 3QA9A 1GDDA 2W8BB 4KDFA 1GTSA 4LXGA 3V33A 2FOIA 1F8FA 1U1EA 4CIDA 3B9BA 1LK0A 2PV7A 2L42A 2ZSHA 3G85A 5ARDA 2DLDA 5KQRA 5LMCA 4PG5A 3ZJUA 1OXSC 1EHYA 5AW0A 1SWWA 1KYVA 2I2WA 2QVLA 3BL5A 1VLMA 5A9SB 2N47A 5DK4A 4MUEA 5KVAA 3RVPA 3J81A 2AF3C 2J9RA 2RC6A 5CEJA 3SOZA 4OFBA 2Q1WA 4KXXA 2VTVA 4Y2QA 1VPVA 2QDXA 3HRKA 4QSHA 3ZTYA 3R7AA 4CG3A 3USES 3C5HA 2V0NA 3T7RA 2H8GA 4LSZA 1XRJA 3LPDA 4XE5A 3GWGA 3TLEA 4D9KA 2O50A 4X3PA 4BNHA 4BVFA 4F2HA 3FFWA 2QOEA 3JWPA 2JKZA 3DKPA 3GLRA 1RI4A 2H2AA 1WQ3A 4V0NA 5AVQA 1VSUA 4MZDA 1TJPB 1NXOA 3NCHA 1AD2A 4X1IA 3Q72A 5J59A 4QM6A 1B3RA 3L1JA 4J0CA 4ZVRA 2NO1A 1Z8NA 1IXZA 5AYVA 1G0NA 4CHGA 5J4LA 2Q99A 3OIVA 4ZEWA 3RBXA 1CDZA 3DAOA 5FTWA 1QONA 3FLEA 2WAAA 2XGJA 1Z6YA 5FYDA 1AQJA 5ECWA 4R9RA 4YREA 4WFJA 1T2FA 4S1WA 3U7QA 1MLDA 1O6CA 4FZ3A 3HP1A 5LQUA 1IY2A 1QTIA 1Z2AA 3S99A 4CLRB 3B3AA 3LPLA 3ICWA 3MUOA 4HKTA 1EFLA 4BNWA 2IYFA 2G9ZA 3FNFA 2EL7A 2YBEA 1EFKA 4EEKA 3SXPA 5I01A 2XYVA 3EE6A 1AURA 2QIPA 5K0ZA 4IEEA 2PA0A 4HLQB 2C5HA 1JXQA 1SBQA 4DSUA 1J0DA 3EQ9A 5L3QA 1U2RA 1U3GA 2BELA 1PS8A 1PDWA 2A30A 2ZETA 4ZQBA 4F7WA 3RAEC 1SC3A 6PFKA 1A88A 4G8DA 3T5AA 4GI1A 2MU1A 1DTSA 2ZRQA 2IZ0A 2DLCX 4TYWA 4DB2A 1WZCA 1P18A 4GP9A 4XOIA 1Y1SA 3DF9A 1YHYA 2ZB7A 3PE3A 2V6MA 2K7ZA 4RTLA 4BHTA 2RJNA 4U39A 1NF2A 1O08A 1EUQA 4DC1A 3QELB 3EF0A 4IMIB 1Z07A 1V8OA 3HN7A 4FCVA 3ICEA 3ERCA 1OY1A 1QB8A 2PUEA 5TF0A 2J32A 3QKIA 4E1BA 1ZESA 5EHNA 1YKSA 3HWX1 1L5HA 2NVBA 1JWLA 1ZUIA 1EFCA 1KR2A 3F4LA 3FCXA 1O97D 2JI4A 1Y8RB 2IOHA 3NYWA 3DBHA 3KJGA 4UULA 4EUSA 1CUGA 2OLKA 3KZ1E 3N2KB 4G5YA 3VKFA 3S8YA 1W0KA 2WU4A 2UYGA 5ALLA 1UDWA 5EMNA 4K9DA 4M9XA 3L77A 3CX7A 4IRXA 4BRZA 4HBGA 2AX3A 4XDZA 1T8YA 4IRUB 3ZNQA 4AF7A 1CRWG 2G4CA 2FRDC 3S44A 1L4KA 1LPOA 2EJWA 2IPXA 3EZ7A 4C43A 1LSOA 4GI2A 5GTDA 3E9YA 1U7ZA 2HK9A 3D6NB 4P7GA 5BMVF 5JJ5A 3CLUD 1BGXT 3FETA 3RW9A 1W36B 2ZI4A 5H80A 4CTKA 4RJKA 2V96A 2MR6A 2QTAA 3RYCB 1AF4A 1OFGA 1ZOSA 1RIIA 3DO6A 5E2BA 3TLMA 2Q45A 3V7FA 4BTEA 3PXBA 1A9TA 4N49A 4ND2A 3TKAA 1KAHA 1TYDE 3JVIA 3NP9A 3WB0A 2KI5A 1VJCA 1V48A 2R6AA 3VKWA 2QTWB 4DNPA 4NNJA 2MT9A 2MSEB 3HJCA 4JI5B 2BGMA 4V1CI 1XDSA 1OPXA 5ARCA 1L5WA 3ZZ1A 3KYCA 4BZPA 1NQXA 2IYPA 1DTEA 2XKJE 3CF0A 1CF9A 2I8CA 1UM8A 2VUUA 4GGMX 2JGJA 4NCBA 2W42A 4NPHA 2VUSA 3R7BA 2UVPA 1UJ6A 5AVZA 4X1YB 3GF4A 4N6OA 1WXEA 2VA8A 1DS6A 2AMFA 4K05A 5I7VA 2E37A 3B13B 2ZSUA 4GKVA 3SS8A 1PT7A 5KYGA 5JDCC 4M8SA 3KPVA 3N8HA 4QOFA 1JEEA 2JAQA 3EBPA 4NK5A 2HC9A 4MCIA 2MWMA 4I55B 3LWDA 1DBRA 2HHJA 5ALSA 5E3JA 2YJ4A 1P8AA 3K15A 3ASYA 5GINE 4QVIA 2EG5A 3R3VA 1E58A 2XT9A 3BWYA 4QRHA 3BJZA 2AR9A 3UT0A 1FTYA 5G53C 3T5PA 4RSMA 1JPNA 3O8CA 1WO8A 3FFXA 1KK1A 2JRCA 3IS3A 4FGWA 4MYRA 5I7EA 5KJFA 1T9KA 1BSVA 1X3LA 4WZBB 3ZNOA 3A6LA 3TTVA 3H0EA 3BEDA 2QAJA 4BQPA 2DT8A 4R9NA 1F1BA 4QXPA 1ZM2A 5J40A 3NHZA 1W2HA 3JAWB 2AFIB 5LQJA 3HM9A 4X24A 1FSSA 2OO7A 4RZXA 5IM5A 2TMGA 1QRAA 5FP0A 3QYPA 3WL6A 1DAPA 2XT6A 3LK6A 1J2TA 2EBHX 4OQLA 4R41A 2XQFA 3IT2A 1R8JA 1GL6A 1NJGA 4BQRA 5EJMA 1KKUA 4FVTA 2GYYA 3A9CA 3ETEA 3GQVA 4ZOLF 4NU0A 5KWJA 1PYDA 1QZTA 5KSZA 3CY6A 4L4YA 1BNCA 1FY2A 5EQDA 2ICAA 2W6QA 3CWCA 3ONVA 2IXBA 1SBZA 1NBME 4OYLA 1UH5A 1RWWA 3KJHA 1IVSA 2W2KB 1D09A 4AJ9A 3OCWA 3TDMA 1KH1A 2WU8A 1Y6QA 3L2OB 2PS3A 3ZEIA 1O94C 1REQA 5FLXA 2OSVA 3HBMA 3THWA 3ZGZA 3S4YA 3UT5B 3EVAA 5EJFA 5G1PA 3W3ZB 1OH6A 3E61A 1KSJA 2PUWA 2VWQA 4INZA 1A72A 4EFDA 2WWGA 3LBAA 5CVJA 3CIFA 1SXIA 2IOQA 5AW3A 4LJLA 3ACCA 1NJSA 2VUTA 4NMMA 1C5KA 5I51A 1A98A 2W6JD 2GN9A 2PKQP 4Z1OA 5F9FA 4FDUA 1NLUA 4JT8A 1L4NA 4HTFA 1XD9A 2WD8A 4IXTA 2WKPA 1X87A 4D98A 4PNEA 4X6UA 1O5TA 4HGPA 1W4RA 4EYKA 1I36A 4DQ0A 1BWSA 3L84A 4UQLA 1WBDA 3NIWA 1IN1A 4EG1A 1JDJA 3UF0A 5TGDA 1R5BA 1XA4A 1E89A 1OUMA 2FWAA 2FKNA 4MV1A 1U02A 5CJJA 1WR8A 1UXGA 3GROA 5EKTA 4DM4A 1YQQA 1RHJA 1UZNA 4PWZA 2CLDX 4G0ZA 4NYIQ 1OAAA 4WXMA 5SY4A 3RRMA 3DTVD 1IY0A 3OJEA 1H1LA 1NMXA 1V1MA 2PGIA 3R2JA 2CLMB 4TL7A 2CJXA 2ZB8A 1AA9A 1UKEA 2IBMA 3I6MA 1GPNA 3DVSX 2DU8A 1JLKA 2R00A 3PT5A 1G55A 4TYNA 4OQEA 4IVQA 4E1AA 5KTPA 5LOVA 1BDHA 3KVVA 3EHDA 1VLZA 4KLZA 1RAFA 1OIXA 2FAXA 1LJ8A 1EVIA 1KMNA 3LCMA 3DKKA 4YAOA 1DV1A 1RXUA 2GJ4A 2OP0A 1HH4A 5E8JA 3TTUA 1ADYA 1YQUA 4CXMA 2XD4A 2QY6A 4JHLA 3T3EA 5G02A 6Q21A 1G6KA 4Y1RB 1VI2A 1Q21A 1NBAA 2YC2C 3HI4A 4LEIA 1ZD3A 3BORA 3ME5A 3FPGA 4ZVMA 3WBBA 5JH7B 2XVZA 1XTPA 5FPHA 5A9TA 1ZSVA 4URXR 4K46A 2JAWA 1SKYB 2OSBA 3DTYA 5DO9A 5SY6A 3WAJA 2ZJZA 3FY4A 5C51B 5JCJD 4AJHA 1T8RA 2ONZA 4OGWA 5AHWA 2C9ZA 5JPDA 1D2MA 4JI8B 1NUUA 2EJTA 4TZ0A 4D4GA 1F3OA 3ROPA 4H27A 4IX1A 2RI1A 1Y4SA 3CN9A 3ZHZA 1F8XA 4XWKA 1KP2A 2GTIA 5CVVA 1HFKA 3QU4A 5BV0A 1TZCA 4G0YA 3WLPA 1HT0A 1U0JA 3T3DA 2FKAA 3WYAA 5H0IA 1K4KA 2I5PO 1PWYE 2VAWA 4JBIA 3OFSA 3THYA 4PRYA 4FW9A 1Z4JA 1C9MA 2XDQB 1FVOA 2YY6A 3V4ZA 3HDVA 1U8UA 4M9CA 2JBAB 3T3IA 4MR7B 4RX1A 4PIVA 2FMHA 1THZA 3IIJA 3F1LA 5SY9A 3CPJB 3BGDA 1RU3A 2FJUA 4PW0A 3W3AH 4BKQA 4F46A 4Z0PA 3D3QA 2HKIA 1DUSA 2QG4A 4M98A 3W04A 1THGA 1NN5A 1UMDA 2VI5A 2IHJA 3G8AA 3SLKA 4MNTA 2NSYA 4JLJA 3K1ZA 4WJLA 4KYTA 4OBWA 4EARA 2P7HA 1JU4A 3FDIA 3W8RA 2XTJA 4BIMA 4F4HA 3K0FB 1Q1AA 5ALVA 3AVQA 3EXHA 3P2YA 1K7YA 1U94A 3A4LA 4PG7A 1FRVA 1X7XA 2O3SA 2OO5C 3MJRA 5ISMA 2QHXA 3BGIA 3WLFA 3H2GA 1ULTA 3B1KA 1AB5A 2E6UX 4HPXB 2M1ZA 4RPCA 3ZV3A 4IRMA 4FT4A 5CT6A 3FTFA 4XWAA 2QN6A 1UJNA 1LKZA 2M9MA 1EUCB 3AJEA 5AI0A 1J8FA 1U3WA 3ADKA 1XEWX 2FPXA 3WLJA 2X14A 2H1SA 4WNCA 1SQFA 1E4EA 1RSZA 2B4RO 5JASA 3BF7A 1QE3A 2B61A 4L22A 4P4TA 5TARA 3WQHA 1J1IA 5U4XA 5CA0B 3BWMA 4U2CA 1NMYA 2VEDA 3QUAA 1NVFA 3A1TA 1PK8A 2TECE 4GI5A 3PFNA 3PV0A 3VC2A 4ZYUA 2KPOA 2AMVA 2PFSA 2QPTA 3KAPA 2EBWA 3N2NA 2DERA 1LVUA 1VCNA 2F3QA 1N6OA 3OLCX 4H35A 4XEHA 4WECA 4TUYF 1KYTA 2ZU0C 1PFYA 1CVLA 4ZREA 4KO8A 4FP9A 2NZVG 2ODEA 2P27A 3WIUA 2HQRA 2GFHA 2D5CA 3AMVA 2WYUA 4FWBA 3RE1A 4OH1A 4UVDA 4BIIA 1K2VN 3HV0A 3UV3A 3TIIA 2GLTA 4OQ4A 3QNMA 3K9CA 2NUPA 4A26A 3PJGA 1ZUD1 1ZWLA 3M3PA 2C5SA 3FB4A 1DAOA 1C1DB 1FTSA 1C7IA 2P67A 3PHCA 2ZQ5A 4GZ5A 4AQ7A 4LY0A 3FWYA 2FG6C 4H3KB 3DWGA 4L5JA 2QUBA 3DEKA 1CVRA 4EPRA 3SDBA 3JQAB 3TSOA 3GFBA 5HOQA 3HWSA 3OE4A 3PQ7A 3QKWA 4UXJA 4BO2A 2Z3VA 1TAHA 3SP1A 1PRYA 3M2TA 3KETA 2ZITA 1UBEA 3PX3A 2Q3MA 3KTDA 4BEWA 1TQ2A 2CMDA 2H2WA 5EZYA 3HXMA 2WTEA 4MP6A 3BXPA 4IFIA 4R9SA 3W8EA 5BN4B 2ISSD 1DBSA 2Q3FA 3N3AC 2V4ZA 4I1VA 1HT3A 1AKNA 4UBIA 4MGZR 1GDHA 4AF8A 3ZXSA 2K2QB 3G9XA 1Z0DA 4ZV9A 1ZK0A 3F0TA 1II9A 3KQOA 4HZIA 4ZJUA 3FAKA 3P9PA 4KU4A 1AO3A 5BWLA 5KINB 1PYOA 1DARA 1ORIA 3WWEA 1V71A 1JT9A 1EB8A 1LCIA 3ONNA 4ZALA 1DPFA 1K0FA 4MRMB 1T5OA 3VYRB 1TYCA 3LHIA 3WNDA 2P75A 4KE8A 1USIA 2V6JA 3IQFA 4FIDA 5JO0A 3B3FA 1SCIA 5DGHA 3PJFA 4MQFB 1AKTA 2OGWA 1FDSA 2X5JO 4DIKA 1D1PA 2YWGA 4OHWA 4Y6QA 1QTQA 1EA5A 1S2OA 3RFUA 1PZGA 1CP3A 1Y8AA 1Z6QA 2ODBA 1US8B 2FLVA 3DULA 5BSUA 4FR2A 1R8YA 2O2XA 2X0JA 4LWPA 4ZP1A 2XBMA 5AW1A 5BN3B 3CLVA 2JI8A 3B5EA 5AICA 1S8NA 5FDFA 4QQFA 1MD9A 1NR5A 3RFCA 2MR5A 5CVUA 4D0GA 2PXHA 1JA1A 1K27A 1NI3A 1YACA 3LK7A 3KKQA 4IZHA 2BZGA 4FSHA 4W1RA 5FLYA 3WYFA 3H5IA 5HIIA 4KXWA 4CTNA 1E3QA 4JCCA 3IP8A 4CMIA 3EZYA 1MB3A 1G98A 4KX5A 1DKMA 5EIBC 1E0JA 1LK5A 5GVRA 1NKVA 2P4QA 1DO8A 1M2EA 3BWBA 1P29A 4UNQA 5C31A 1ID8A 1WMSA 2IZZA 1USKA 1MP0A 2BT4A 3F9RA 4EF5A 1MUUA 1M34E 2O2HA 4Q3EA 4Q39A 4WXYB 4DV3B 2BF7A 5D7BA 1ZJZA 2WIBA 5CDSA 4ZYZA 3SICE 4PHFA 2OA0A 1HLFA 1PNOA 1Y3HA 2OD9A 3NXSA 5AXBA 4HDMA 1P1KA 3EGVA 2CCKA 4A8JB 4UPDA 4C1BA 2BEWB 3Q5GA 3GFGA 5LLTA 2HBYA 4FFWA 2P0EA 3W2HA 4O0LA 4L8YA 3AM4A 2G4VA 1LV8A 4L51A 1JBEA 3W8DA 4HDNA 4BDTA 1XN4A 1UOEA 1JYSA 4HMOA 3RLFA 2ATXA 3VZSA 2FSGA 4DUZB 3ZY6A 4JI3B 5EQJB 4N48A 1Z8HA 4BVGA 1TKAA 1HDCA 4JYPA 4DILA 3ZD7A 2NO5A 5CNIA 5TT1A 4RH0A 5LQCA 3GNQA 3L7IA 2Y0PA 2G76A 2HA3A 2GT1A 1RMYA 3TSYA 1XPOA 1QPBA 1XAJA 4Q4DA 3O31A 1Z4QA 3DDNA 5H82A 2Z2YA 5IFLA 4X62B 1NKTA 4X20A 3QVGA 3I23A 3L07A 2MDTA 4RAOA 2ZAMA 3D8TA 4HGNA 4WGFA 4V0QA 1EP1B 3N87A 3UXHA 3CKLA 4C6RA 4Q9NA 4DJDC 4COKA 1VPWA 1WMEA 1XV5A 4B0OA 1GV1A 1R16A 2C29D 3P2KA 4HT3B 1DWUA 3HMQA 5K3SA 3RVMA 2IYQA 4M8IA 3W2EA 1KR5A 1G9TA 1XRNA 3I9OA 1XZPA 3S2YA 4LC0A 3NIBA 3TTWA 5D3MA 4WOPA 3IBTA 3ZWMA 3DNPA 1RWQA 1GZSA 1LWOA 5CDGA 1BH2A 1I1NA 1SCBA 3EGIA 5CM8B 3ZZTA 4ISCA 2V4MA 5JWRA 4MV5A 3H4MA 1GUBA 4BZZA 2HJ9A 3E35A 1PJTA 1T4MA 3KLOA 4UVHA 4XA8A 3OM9A 4E1VA 4HDRB 1IEWA 1Q91A 2GPYA 1TU0A 3T9DA 2FWBA 4MTCA 4BCBA 1JIVA 2G9RA 2EF0A 1KZ6A 1CEYA 2XMDA 1OXKB 4ABYA 3PFBA 1P4HA 1ZMRA 1HR0B 2ZEJA 3IELA 3QF7A 1W2WB 2O7NA 4MOWA 4FJ1A 2JRLA 1XLVA 4JVLA 1JKFA 4CKBB 1EUDA 5KC9A 1HL3A 1K06A 1T6YA 1G18A 2GWHA 1OA0A 4TQAA 4CM9D 3L0DA 2R7LA 4GPIB 2WM9B 3UH1A 5GADl 3G5AA 1VG8A 4CV2A 5BR1A 1XTJA 1C8LA 1XCGB 2EP7A 3GCXA 4GPEA 4L2IB 2HLDD 5BV7A 1KZGB 1IDOA 4IWNA 3DDOA 3OP4A 3W3AD 3QVSA 1VLVA 3LECA 4CV0A 5KYWB 1ZBQA 1Q19A 3KHUA 2YXDA 4M0EA 5HDQA 3BRSA 3EK2A 1GCIA 3SM3A 4N5NA 1U0BB 4CF6A 4U4AA 2E89A 5HBGA 2FEOA 1SIUA 1ZISA 2EX0A 2NYUA 2YMMA 2TMDA 1ISIA 4M6WB 4PAOA 4UJ5A 1FJ2A 1N5OX 5SZIA 3TIFA 3TNJA 4FX5A 1V3UA 2HU7A 3RJTA 3TXAA 3D4NA 4HGQA 3HH8A 2FEAA 3PICA 3D8NA 3VXKA 1KEEA 1PJBA 4H3VA 5IN5A 5IZCC 5KOHA 1U3TA 2OFWA 4AO8A 1KOJA 3VTFA 1CKEA 4XYMA 2RONA 1E60A 1DXHA 3OH8A 1YL6A 1B76A 2C96A 5LXTF 3CUEF 3D6AA 4A23A 4ZTBA 4Q3AA 4JOBA 5DV9A 3EG9A 3ADBA 1SQ5A 2IPNA 3T41A 1U0NA 2YS6A 1GA6A 3KPWA 4ZI5A 3C6KA 3KWFA 4ZI3A 1IU9A 1BGWA 1U81A 5BW8A 5M5BA 3L4BA 4TWRA 2ODTX 2XCQA 1YC5A 1ONSA 1KYXA 3BD6A 4HDQB 2Z9DA 4ME6A 1CB7A 4XVHA 2JHPA 4QPZA 2ZUBA 3PQ3A 4CR7A 3KP1A 1ZBDA 3ORHA 4C6SA 4FEEA 1N2CE 1OBOA 4YRCA 1O0SA 3NTOA 4KOAA 1OYOA 3Q9UA 4KFTA 3TX6A 1ECBA 3DTVA 5TNXA 1SC1A 3IJRA 1V9SA 5I7SA 2B6HA 3NHWA 2PGNA 3DT6A 3MWEA 4MRSA 2XGOA 4RXTA 2J45A 4EX7A 1T9DA 3IALA 5DSTA 3FLMA 2XH8A 2OPBA 3IURA 3WKDA 4JEIA 4B3TB 2X5XA 1CF4A 2QRUA 1EINA 1BYUA 2H08A 3RV3A 5A4AA 1FXWF 3I9KA 1X0VA 3EJ6A 2QG9A 5JNLA 3H2JA 3OEEA 4KYUA 4FUTA 5FUMA 5DI3B 3HJUA 1U5AA 2I2CA 5IAGA 1ZLXA 2EWVA 3OQIA 2EV9A 4DLAA 2A5FA 3W5IA 1CC1S 3DE0X 4C08A 2BR4A 2CXPA 2R7KA 3MC1A 3ZZNA 4IEFB 4N3AA 1YNSA 3AY6A 3H8VA 5HF5A 1NQWA 5B57C 1IB0A 3OU6A 3A9UA 3SZUA 5K09A 3C7DB 4P35A 4D8XA 3U62A 1MQ9A 1CUXA 3CYFA 1G8GA 4V03A 4JR2A 3VGPA 4IXNA 4MGYR 4RLSA 5JCJA 5KDDA 2EFYA 3A27A 2VZEA 3V97A 1FEZA 3C3YA 3MSXA 1U7OA 4N03A 1BS1A 5EHGA 4BL5A 1O95A 1GXSA 4JP8A 4ZWNA 4WZAE 1P5FA 4F6LA 3R20A 1H42A 4ZCMA 2IYUA 2GD2A 3GGGA 4Y1EA 7GPBA 3V4VB 2QL5A 1Z63A 1DVRA 1IEVA 3EVFA 4ENSA 1COWD 1CR4A 2OENG 5H59A 4RYLA 5H9VA 1HK7A 1KK0A 2GYVA 1QV7A 4YPFA 3SQDA 4XYEA 4RPKA 2XTZA 1B8OA 4FYXA 2VJMB 4RWEA 1FYVA 2P2ZA 3WO1A 3U4HA 2HZBA 1W5AA 1YB2A 2C42A 3PVCA 3R9XA 4G4SP 1XJQA 4M1QA 3QG5A 1J06A 4FD2A 2DQ4A 4EYQA 5D3KA 1FDIA 2J0UB 2V9PA 1E18A 3F2VA 3OY2A 4JUBA 1HUQA 2HF7A 2XE8A 2YNMC 1JAZA 4QUHA 4XUCA 3VR1A 1YZFA 4MUIA 3D8SA 3STVA 3DMRA 2JEZA 2EHDA 2Z1DA 3I28A 1B3BA 1H2EA 2XA9A 1U9IC 1CYDA 3H8JA 3HB5X 4ZQGA 4C0LA 4ZYWA 1IHPA 4IDFA 4UM9D 2NX2A 4YRFA 4CV1A 2D2VA 3B1FA 5T7BA 3KZKA 5C4IA 4E21A 3DUWA 2YKGA 2HDHA 3I34X 1TM3E 1MRZA 1XZBA 3B8EA 2GBIA 3U40A 3FPCA 1HQCA 3GV0A 5TQJA 3ZHQA 2J0QA 2Q2QA 4LY9A 3C14C 1X42A 1AN0A 3G2PA 3HXKA 5A2GA 4WA8A 1RP7A 4AB1A 4C06A 3SQMA 2H11A 2FWRA 3G5MA 4CIBA 4RDIA 3UUGA 1EZZA 3K0AB 1NW8A 3BJEA 3TB6A 1JHRA 3W7VA 2YV3A 1JSRA 2PUGA 2B5OA 5DTQA 2HRQA 4P54A 4KC0A 1QRDA 4C07A 1FNDA 4G1EB 3HXQA 5JAOA 4F8JA 2E4WA 5L9AA 1ADBA 1XDUA 3L1HA 3HZZA 1J09A 4JIGA 1E98A 1M3SA 2PPLA 3L05A 4OSOA 4ARZB 4CM4A 1E6CA 3TZBA 2V0GA 4DR6B 2PO5A 5LUAA 4FK8A 2RSLA 2NYRA 1GJRA 4E09A 5AW8A 5KWSA 2QLLA 3GLGB 4EA8A 2H31A 2C98A 4N0MA 3DBIA 2RI6A 2WKWA 3IOEA 5HP4A 4GSLA 4I14A 2ESRA 3KRTA 2I7TA 2GD1O 1YAHA 2HA4A 1R4ZA 3F3MA 4GPTA 2O19A 1Z7EA 2BGIA 3K9QO 1IATA 2FPLA 1JG6A 4L3WA 3UB4A 4BMDA 5JADA 4LF7B 1G19A 1P2VA 1MF7A 4M0UA 3EODA 3LUJA 3IP9A 2GHIA 3M7IA 3LYAA 4QC2A 5BUSA 2GF2A 3J80A 1QYIA 4K9OA 1M2OA 2DKFA 4IHJF 4JOCA 4AKGA 2ZSBA 3ZQ6A 4IILA 1E1QA 2P77A 3IV9A 3G49A 4NULA 4XYBA 3DXFA 2CDAA 1H6DA 3CZRA 3TW0A 3VH3A 4D0RA 3FF4A 5ITSA 4BPBA 1SVKA 1UIRA 1XAIA 4M21A 5EIWA 4EKYA 4ZK2A 3OPYB 2WHXA 3RRZA 3SYNA 5ARBA 3KOWA 4BNGA 4TLLB 1V3TA 4J7CA 4CN9A 1JFLA 1U0HC 4CKWA 3UHAA 3EUEA 1L7XA 4OO3A 2QMHA 1QQAA 1QHHA 1ODLA 2WWIA 1SVWA 1EDEA 4M7PA 3G8CA 3VU3A 3RIXA 4A0SA 1IJKA 1AK2A 1VRCA 1XU7A 2QX4A 1NF9A 5K2OA 2WQ7A 3CVWA 1GT91 1HL7A 3PGMA 4Q7MB 3L3BA 5DNVA 1G7RA 3WY9A 3LPCA 1A0OA 3IDOA 4HSEA 4JBLA 3EZ2A 3LWNA 2BWJA 2XXAA 4QYXA 1UQUA 5IFKA 4CFZA 1EFVA 1ODCA 3G82C 1JT2A 4HNAA 4YLGA 1QRUA 2XUDA 3PYMA 1U8XX 4R1LA 1X1BA 3S6JA 1EWYA 4ER6A 1VC2A 1S9DA 3WGHA 5CFPA 1SOVA 2BDTA 2C0PA 1U0LA 1HOXA 2PV0A 3A1SA 3D8HA 2JGMA 4HNGA 1JXMA 1F2VA 1I8TA 4UE2A 5LB4A 4Y6GB 3MW8A 4PG6A 4AECA 2WJAA 4JQOA 2NGRA 3BCSA 4G81A 3RC8A 2G28A 4B46A 1MVLA 3IT3A 1YCGA 2CK3D 5J47A 3Q5DA 3IUQA 4RKQA 1DCMA 2FFHA 1S2DA 3BD9A 1H2BA 1GUFA 1RHRA 3GH3A 4E5SA 4RJIA 4C7OA 1GTMA 2FUNB 4HN2A 2Q3BA 3C5WP 1Y7LA 4QO8A 1N5RA 4X6XA 4OREX 2CNLA 4NCAA 4XXHA 4H4CA 2BEVB 4WK0B 1FRZA 3U7HB 1MIOB 3A1UA 1F12A 2XBUA 3HGQA 1LI7A 3RVJA 2BFFB 5A4DA 4H9GA 4P86A 1HSZA 2YWRA 1RWMA 4KO1S 2CLHB 4LISA 4PRZA 4A10A 2JEOA 1RWOA 2PSHA 3KUKA 4GIBA 1U1FA 1UDRA 1XR3A 3IMKA 2GN2A 1S2LA 5CH3A 2CLFB 1G1MA 4PPNA 1SZJG 2PSDA 1Z26A 3QWHA 1Q16A 4XCVA 5CPBA 5LZ7A 4AJEA 4QLBA 2IT1A 1JI3A 3RJMA 3HDHA 1D5CA 3PEUA 5L3SA 3WGJA 4JODA 1MC5A 1XEXA 3FMPB 3N6RA 3ENZA 4BVEA 4IGFA 3SI7A 1Y34E 5K45A 4GP6A 2PKRA 4BO9A 1NF3A 1KEPA 4BKOA 2PWYA 3LQ4A 2PMFA 1PL0A 1V9CA 5AVSA 1P5ZB 1ZDMA 2HF9A 3FRHA 3GC6A 2V7GA 1N3IA 3G68A 1EJ0A 3ORRA 2HT1A 5E9WA 3R0JA 2AWOA 4DRYA 3NGXA 4KAJA 1S6YA 4MWDA 3EBOA 1NOIA 4E08A 3V46A 4B74A 2VO1A 3EIHA 1I7SB 2QRZA 3F5FA 4ZO4A 5ERXA 1P1CA 5EKXA 2DLNA 1I3NA 4RLHA 3E70C 4LJRA 3AY0A 4NFYA 1P9LA 4OX9B 5ADHA 4ZEVA 1ZHHA 3HCRA 4Q6BA 4C5AA 1Q1GA 1L4LA 5E6RA 2EX4A 2DOKA 1MFPA 3L41A 1SB8A 1PHPA 3NDRA 5DN9A 1MA3A 4PYQA 2HMYB 2R79A 1EQ2A 1Z2DA 3JQFA 5DPMA 3OLQA 5FBKA 3LCCA 2ISCA 2CMFA 4OGFA 2B7BA 2OL4A 3ZHUA 1FNSA 4HFJA 4H1WA 2WFMA 5C8ZA 1A1SA 1E1DA 4XR9A 1LPNA 1S1CA 1ZY2A 2ZFUA 5CVEA 2KWIA 2CB9A 2V7UA 1QB7A 1R88A 2ZULA 3VR2A 4X66B 5T8KA 3EEQA 5KC8A 1OYYA 2O5CA 4YRTA 3UUEA 3ZVKA 2IDJA 2NXEA 4OJTA 1UBTS 1Y7IA 4JXJA 1PVDA 3THXB 1DIOB 1EQUA 1HORA 4KHZA 1GD1O 5DNDA 5KI6A 2O20A 1YASA 5HZKA 5A04A 2YL2A 5HTKA 1WA5A 5G0UA 4DREA 3DLBA 4PIMA 1TK3A 1TW2A 3F3SA 4V0LA 1GTRA 1JLLB 3ZD8A 1DG9A 5L7TA 5JTTA 3TSCA 3PUKA 1Z4LA 3LE8A 4ESVA 2QVCA 4X44A 1FLVA 3ANTA 5AOVA 4R2JA 5EVJA 1EGVB 3HC7A 5FPTA 1C81A 3R3HA 3H75A 3BMOA