1CJBA

Malarial purine phosphoribosyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
227
structure length
227
Chain Sequence
PIPNNPGAGENAFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYDIKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE)
publication title The 2.0 A structure of malarial purine phosphoribosyltransferase in complex with a transition-state analogue inhibitor.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 74
structure length 227
sequence length 227
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1999-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cjbA00
1QK5A 1DKUA 1IBSA 4MB6A 1O5OA 1XTUA 4JITA 4LZAA 1ECFA 1NULA 2FXVA 2JBHA 1BD3A 2PRYA 4QRIA 5EUCA 1U9ZA 2GEBA 5IPFA 1XTVA 4P82A 4RADA 4PAWA 1HGXA 5JV5A 3LRTA 4RHUA 4ZFNA 2H08A 4M0KA 1VSTA 3ACCA 1J7JA 4RQAA 3O7MA 1G9SA 3NAGA 4LYGA 1G2QA 1A98A 1I13A 1OREA 1QK4A 3OHPA 4RHTA 1XZNA 2HCRA 3N2LA 5KAMA 1TC2A 1DQPA 1DQNA 4X45A 1ECJA 2JI4A 1BZYA 4M0PA 1A96A 1OROA 1A95A 2PS1A 3MJDA 1D6NA 4P80A 1V9SA 4M0UA 3GGCA 4RV4A 1DKRA 4P3KA 1ECCA 1GPH1 3QW4B 1W30A 1A97A 2H07A 3ACDA 5BRNA 2JKZA 3H83A 4LZOA 4RQBA 2VFAA 1ZN8A 2WNSA 4QYIB 3G6WA 5HIAA 1G2PA 3MBIA 5E38A 1ZN7A 4P81A 1TC1A 1WD5A 1P19A 1L1RA 1HMPA 5IAOA 3M3HA 5HKLA 1PZMA 2DY0A 1G9TA 1AO0A 3LPNA 1JLSA 4RACA 1ECGA 1QB7A 1R3UA 1A3CA 4RANA 4IJQA 2EHJA 5ESWA 3KB8A 3EFHA 2IGBA 4RAQA 4X44A 3S5JA 4P86A 1QCDA 2AEEA 4LYYA 4RHYA 4RAOA 5ESXA 3GGJA 3OZGA 1STOA 5JSQA 4S2UA 1ZN9A 4RABA 1P4AA 1I0IA 1VDMA 3HVUA 3OZFA 1L1QA 2JKYA 1O57A 1GRVA 1XTTA 1UFRA 1NONA 3DMPA 1BD4A 5KAPA 2C4KA 5BSKA 4P84A 1QB8A 2H06A 4FYMA 5K51A 4KN6A 4QYIA 4F8EA 1I14A 1Z7GA 2PRZA 2YZKA 1I5EA 1YFZA 1I0LA 4TWBA 4WN3A 3ACBA 4OHCA 1U9YA 3DAHA 5BQPA 1ECBA 1LH0A 1P18A 1QCCA 4PFQA 4WMLA 5BQOA 1OPRA 1UPUA 1VCHA 4P83A 1DBRA 1XZ8A 4LZNA 4JLSA 1FSGA 1MZVA 1P17A 2P1ZA 1CJBA 3DEZA 2XBUA 1JLRA 2E55A 1QK3A 4RHXA 1Y0BA 4Z1OA 1A4XA 3GEPA 1UPFA
chains in the Genus database with same CATH superfamily
4ND4A 2ZWVA 5I51A 3K72B 2JBHA 1T36B 4UVDA 1E7SA 1KDYA 4J3FA 4FE3A 2PNFA 3LQKA 1RLTA 1VG8A 3OZBA 1VHTA 4CL0A 5HNKA 4WX2B 1FJ2A 1MC8A 4RHUA 4DLLA 1XHFA 1CRZA 1HKHA 2WTNA 4R81A 2FWPA 5EXEA 5GVRA 3V32A 4AJ4A 3O1JC 2R8XA 4OP3A 3V4OA 3AT1A 2D7CA 3CLRC 3RVDA 2VBCA 4FCCA 3UJNA 2OA0A 1E3TA 2OILA 2ORVA 1OYWA 1CTQA 3SIPA 3OTWA 1SOUA 3G5AA 1ZITA 4JP2A 5HF5A 3C98A 2WKPA 3IUQA 1W35A 2UUPA 3FWZA 2B1JA 4YCDA 1UZLA 2ZSBA 4I55B 2X9LA 5JNUA 4BP1A 2BTQB 1RHQA 5F51A 4DW8A 2ZR0A 2OV6A 2QV0A 4WN9B 1JTEA 2VAVA 1KI7A 1V0JA 3TB4A 4GL4A 4YRBA 1UK7A 1PGNA 2ISCA 3R5HA 3EG9B 4H3SA 4KX3A 1Q7CA 4D99A 2C98A 2TECE 2XB8A 3P2MA 2AG1A 5I7OA 1S2GA 1WDLA 1XVVA 3I01A 2VHZA 2ANBA 5DZSA 3UJHA 1XZFA 2MSWA 3TSZA 4A0FA 1NG9A 2ESRA 3ICCA 4EY3A 2UVPB 3V4ZA 3M6WA 1NVKA 4L28A 1X87A 2IE8A 3VTAA 2Q5FA 1UJ5A 5LA6F 1JJFA 4C03A 1FUEA 1O5IA 5H80A 4TKUA 1MIOA 3UF0A 3NXSA 1MAVA 1O7JA 2DBVO 3KZ1E 2N75A 5DF1A 5B6PA 5FWNA 1UQUA 4ZCIA 1VXRA 1GGJA 3IJPA 1BXGA 2FK8A 1VKRA 5FBKA 4ZICA 1WUIS 1F0YA 4OQPA 1XAJA 5FHQA 1G38A 3NTLA 2XZOA 5EC8A 2VTBA 4DB2A 2HYIC 5MHTA 4NL4H 3T5PA 3ZE1B 1KVUA 5EWMB 5I5EA 1KFJB 5AQ1A 3GCWA 1CRWG 2YBEA 1UJ2A 1KXZA 3CX6A 4P54A 4QEKA 1TECE 2D4AA 2P62A 3MERA 4X1YA 3D3NA 4KDRA 4DNPA 1CDZA 5B1IA 2Y1GA 1I0IA 4CTNA 3OZVA 5JFOA 3RKSA 5KNCH 2YIDA 2AKAB 1FVXA 1YGYA 1ABEA 2JBAA 4I3FA 3N87A 1FQKA 4LY6A 4NV0A 1KQGA 2AZDA 4DSZA 1K89A 1IQUA 3LKZA 1ULBA 4QREA 1SBYA 4KQGA 1SCJA 4BQPA 4R84A 1V5FA 4NH0A 1LLDA 3E4DA 1DXYA 5E1DA 3VAYA 3TW8B 1KEPA 4F9GA 5KSWB 2FMHA 2WTAA 2QROA 2G0NA 5FXMA 3QEKA 1P7YA 3AEZA 2ZVPX 1FMFA 4QO7A 2P2LA 3IOYA 3PVSA 5F77A 5AVQA 1I5RA 2XBLA 1C14A 1KO4A 2OV8A 1SVWA 3MOIA 3OURA 3GJRA 1M8KA 4IDNA 1EP2B 4N5MA 4Y9UA 3W78A 3PJDA 4ZJYA 2IQ5A 1OZAA 3EPPA 2X8LA 5FOWA 2O8DA 1COWA 1U8AA 1IH8A 1OJ7A 4OD0A 4YLEA 1XEXB 3MSXA 1VBKA 4RHFA 1M5UA 2BWJA 2L82A 3LNCA 5CTAA 4DQDA 1X14A 4GOJA 5A62A 1KKUA 4K9LA 4WUTA 4BN4A 4GHWA 5BY2A 4E30A 2ZIEA 3DDNA 4KPYA 1S2NA 4MKGA 3ROXA 2WF8A 3ZE6A 2ID7A 4DEYA 4KIUA 3H4IA 2G76A 5K4GA 4ZO4A 3WDLA 1HMYA 4UQPA 3N0VA 1O03A 3LHDA 4YPVA 4JYBA 4B8ZA 4AS1A 5J4VA 3P5BA 1G5RA 4DANA 4KACA 5AM0A 1SB8A 1JN0A 3C5EA 3K0AB 3GA7A 3PNBA 3MGCA 4MGYR 3DBHA 4MWOA 3GI1A 4MKIA 5IHXA 2Q6TA 2QYHA 3FTCA 1UQRA 4KCGA 3P4UA 4ZO9A 1XDSA 3EZLA 5B7QA 3OHPA 4YQFA 4XB6B 5BW8A 2NZVG 1Y6JA 2C4UA 3HCCA 3W4JA 2JI4A 3IDZA 1DTWA 1V8OA 4TMYA 3X2FA 3PRYA 4G4IA 4G0WA 2JRCA 2WTXA 4IYJA 1BU5A 3PDIB 2VHEA 4X95A 4R9SA 5HDQA 3DB1A 2EP5A 5E0OA 3L82B 4JP8A 2I7DA 2J0SA 4LRWA 4AY4A 4Q05A 1ZL0A 3COWA 5DP2A 4JLWA 4CQNA 4HLCA 5A0VA 1MJGA 1WW8A 2VA9A 2WTUA 4DV4B 5F78A 5GADl 3GXOA 4EIWA 1KRXA 3SU8A 2H1WA 2CHUA 3WIBA 3T34A 3ZI7A 1A9RA 4QDJA 2EWWA 1EPUA 1AZSC 2XKKA 4FFRA 3A6ZA 4MQEA 4LRXA 4YCAA 1JEDA 2ZTSA 2MSDB 1VJCA 2PH3A 3D59A 3MWGA 4G5RA 4ZOEA 3HKCA 4RIGA 1NI4B 1PAUA 3PPIA 4IFBA 2GTHA 4K40A 4J1TA 3SFVA 4O0LA 4XSVA 3FPFA 2QJOA 4EFLA 1I6KA 2Z2ZA 1XRMA 2KE5A 4QPZA 1R3UA 3CONA 3A6JA 2QPLA 5TMDA 1N6RA 3BHNA 4G0QA 4I81A 3E1KA 4QA9A 5JEDA 4O2BB 1Z6QA 3I04M 3EZXA 4JJKA 3EMDA 4F4UA 5B6IA 2GB4A 3VOBA 1QCDA 3C3CA 1C0PA 3WGTA 2WPDA 3B12A 4PQGA 1AQIA 1PFQA 1G42A 1D2GA 1XMVA 3D3EA 4NJMA 3RW9A 3IUSA 3KALA 3ROPA 4AECA 1U8TA 4IQFA 2NU9A 2ZSKA 1OLOA 4XDHA 3SBXA 5B3KA 5K99A 5JHGB 2DXIA 1CVLA 1DNPA 4ZOLB 2LCIA 2QGFA 2LIPA 2HF7A 3EEYA 3K30A 5ER9A 3O3OB 5JQGA 1IK4A 2ODEA 3QF4A 4JIMA 2DKOA 3GLHB 2YY6A 1JPUA 5K3FA 2VHYA 1XT6A 2PWYA 3DAHA 5HTKA 3V1LA 4A5SA 1IY8A 3GUHA 1ZOPA 3OG9A 3DLIA 1H66A 3QKSA 4AN0A 3GDWA 5B7NA 5IAEA 5C8YF 2D3TA 1DPGA 4GF5A 4FB4A 2VDWB 4D9MA 1VPTA 3VXKA 3OWOA 2VTVA 1GCUA 3YASA 1IRIA 4REOA 5KHOC 3L7IA 3D7RA 4DWWA 3N8KA 2IH5A 3B1FA 3PTLA 4TV8B 2YZ2A 1M2VA 1SXPA 4N54A 4BNKA 3GNLA 3M34A 3ZIDA 4E5KA 5AI8A 1WOYA 4TL6A 2GCEA 5LN1A 2P11A 3Q5DA 4BVJA 5JHHB 1DKUA 2H7CA 4AG5A 3TQIA 3TM4A 2ZAIA 3NBKA 1XUOA 1Z0KA 2XDYA 3P20A 4Z54A 2DPLA 1JS1X 4ZO8A 5A5VA 1DFGA 1JHPA 2Q6KA 2R62A 3M3PA 4FYPA 4QGGA 4BWFB 3A1WA 2OT3B 1NLYA 2DKFA 2GEBA 1VB5A 2KPOA 1WJGA 1GUBA 4GOKA 1P60A 1IXZA 4CV2A 4L5JA 1T4DA 1X3SA 3WMFA 5LKAA 5LYJF 1DJQA 2C2WA 4V3CA 3JQBC 3RT1A 4RXMA 4P7GA 5ALLA 3G9XA 1I2CA 4JU9A 1SZCA 3RIGA 4I1YA 3IT0A 4IFEA 4OJMX 4D5GA 2PGAA 1X7XB 4ZI3A 4EY4A 3UK7A 5LQSA 4BLUA 1KI4A 1KAOA 1IY2A 3SDSA 1RQ7A 1D1SA 2ZBPA 1WDMA 2I66A 4TTAA 4YHBA 1NQTA 5PGMA 5I45A 5IVPA 3SZ3A 3E2PA 1EXWA 4BNVA 2V8OA 4OA8A 4OQFA 4EG8A 4X64B 4O25A 3DEFA 3I5AA 3ZGVA 4HVTA 2EAUA 4D8YA 2XF2A 1M6HA 1P2VA 1QVAA 1X2BA 4TRRA 3U48A 2DCMA 4G84A 3UMVA 1IOWA 2X9QA 3CN7A 3O0DA 3ZBQA 3F7TA 3ON5A 4KE8A 3MB5A 3K2QA 3SDBA 4CTJA 4B2YA 2HCTA 3OHSX 4UEQA 3T8YA 1U28C 4MW6A 1XCJA 3S8MA 2QAIA 2X8WA 5ALPA 1NNI1 4YMGA 5BVHA 1DCKA 4IGIA 3VC7A 4PZAA 5CCBA 1TVKA 1BDJA 2ZTHA 2VZLA 3SIWA 4I6GA 2WHRA 3G2QA 3I9OA 3IEKA 1O8CA 4FKBA 1AXGA 1UOEA 3BSWA 1UXGA 1QIDA 5CBKA 3EX7C 1A4RA 5J2UF 3A1UA 3WGJA 4CNBA 3KYCB 2QQ5A 1YBFA 4WFJA 2X0EA 1NW4A 2QL7A 3SPXA 3KLMX 1D4AA 3HCBA 1Y5IA 1E7YA 1KJ9A 3KSBC 4OM7A 5BMOA 4W5WA 3FCUB 3RS3A 2O3UA 4KE6A 3HRIA 2VNJA 4PZDA 4TT3D 3QG1A 2PIAA 5AOCA 5EJ4A 3GU3A 2IYUA 4IGFA 4KK4A 3H17A 4LOKA 4BVBA 1QOZA 3PNOA 3F2IA 5HOQA 3NPMA 5BSTA 3ZCRA 4PG4A 2HZ7A 1YJBA 4CLXA 3AI3A 3WRYC 4EJMA 2PY6A 1ANKA 3A6FA 3B1JA 1E7WA 4OFXA 3Q7QA 2BUAA 4INAA 1SG6A 3RYCB 4WCVA 1SHZA 5DYIA 1R9MA 3N6VA 3Q41A 5B30A 5K09A 5JD3A 1KKMA 1Z06A 1CNMA 3AY3A 1W44A 2IZ6A 3HB9A 3W6OA 2D2XA 1LF0A 4OAPA 3GAFA 2VEOA 4W8OA 3DLBA 4TWBA 1EX1A 1Y4AE 5KTTA 3HV0A 4F96A 2BFCA 4DRXB 4E33A 3X1YA 4OGWA 5KTOA 1E99A 2ZRAA 4O5OA 4DR5B 1HYHA 3T9BA 1H2ZA 4KBFA 2ONZA 1KYVA 3RFVA 1N7IA 3VV3A 3E3LA 4NC9A 4HDOB 4XH9B 2VJKA 1Y80A 3NGLA 4RJTA 5TLSA 1PG5A 1YMUA 1IG3A 3PYMA 4M1KA 1BDIA 3L8CA 4ENTA 4B2LA 2II6A 3SHQA 4L8FA 2D0PB 3TQSA 1DJMA 5EVJA 1SOVA 5ERYA 1B2LA 1Q74A 2W2TA 1YO6A 3CTMA 3Q4GA 5KNDH 1UXJA 2AYZA 4KDFA 5H3LA 1UEXC 1V2HE 3ZJUA 2IYFA 4IG9A 3JQQA 4R9NA 1AK9A 3ZTYA 2G0AA 1JEOA 4XUGB 4S04A 1W7AA 1I2BA 4L78A 2O2EA 3RS8A 3PVCA 1WP9A 4AJ2A 1XTPA 1A5SB 1JFFB 3DZIA 1NDHA 3CE6A 3C43A 4Z4EA 4EI9A 1CY1A 3TEMA 1N9GA 3T7IA 1PSZA 3TKAA 1ZK4A 2GLTA 2O2HA 4M76B 4RTRA 5EYPA 5DYGA 3QXCA 5CJJA 4B9AA 3FOAA 1RS0A 3FPHA 1Z5OA 2R5FA 4LX0A 2IYOA 2JG3A 1VDZA 4DV0B 1EXNA 1SUFA 1Z38A 3DNFA 1V1RA 2LDXA 1MAHA 2WUDA 2O8FA 1LPPA 4BBJA 4ZYLA 5EMKA 3BIXA 1N8TA 5U1PA 1WXHA 4JVSB 4EGFA 4HH4A 4AZ0B 3CTPA 2WABA 1I3MA 3E2IA 4FYKA 5EJ5A 3IAFA 1GPWB 2Z8ZA 3DT8A 3GGCA 3DHNA 1TVMA 2ZGVA 2HWYA 4ICIA 4N82A 2OO5A 1HT1E 2XVMA 4L8WB 4LMRA 3KV3O 3RSCA 3EIUA 1R5OA 3TM5A 3VDXA 4TYWA 3VZQA 4IWYA 3WMWA 4DUGD 4F86A 5JDCA 1K68A 3K05A 1HF3A 5BWMA 4GR9A 1W47A 1YVDA 2JLRA 2WHPB 4PZLA 3F47A 2X8JB 3T1NA 1C1HA 2ZUBA 4ZEMA 4CGYA 1E3QA 1JJBA 4MPPA 3GJZA 3WLPA 1KNXA 5NULA 1LK7A 2PIDA 2XWSA 2IHBA 3DD1A 4B83A 2QBYB 4DIFA 4DDTA 2JB9A 1R9NA 4PAQA 4TTIA 3X2EA 3FOFC 4XCVA 1AUQA 1I1NA 1UWCA 4PC7A 3MYRA 4LXYA 5C53B 3DZGA 3H5TA 3KR2A 5DNAA 4K8OA 3SKYA 1CY4A 2OWEA 2JJ2A 4RD3A 1RWWA 1KJ8A 3PX2A 3WB0A 5JFTA 1K6EA 1OWLA 1XVLA 2D00A 4P86A 3D9QX 3NHUA 5IC4A 1L5HB 3CUVA 3HEBA 3MG9A 5FBZA 5KQMA 4ZYUA 1QH9A 3TLKA 1D2CA 1N1MA 3R3VA 3OAAA 4JK3A 2GDJA 1L8AA 3O8QB 2I1LA 2WVGA 3DEYX 3IVRA 4LJSA 2F8SA 3C4QA 4OH7A 4AKIA 1OXKB 3KOZA 4RMGA 5JY1A 2JAXA 3DM9B 3ESQA 5GOTA 5BRAA 4LFAB 5B6JA 3N6RA 4TQAA 3DNPA 2HU8A 3JV7A 4JD5A 4NLLA 2QTLA 3FYSA 3L7JA 4GEGA 3PK0A 4PYQA 4OL0A 1MV5A 3QXXA 4MAMA 4R7ZA 1KPHA 4DA8A 3ADCA 4B6RA 2JLWA 4LF6B 3R4VA 3ACBA 3IKLA 3BWCA 1C2YA 1MJGM 4MHTA 5EE5B 1Y37A 4ZT4A 4DQUA 1OW3B 5EHXA 4EABA 3AMVA 3ZCQA 4ZCQA 4YJHA 1GN9A 5I8PA 4DMLA 4QYWA 4ETMA 4CW7A 2HA7A 1E7RA 1SUSA 3EQ8A 4E4YA 4YCCA 1JRLA 3UGKA 5DRYA 3DWFA 3QGMA 5EZSA 5J2TB 2GXAA 3CUKA 1RPNA 1D6MA 2BP7B 3QU5A 1GPJA 5E6UA 1AS3A 1P17A 1NG1A 1XCBA 2FG7C 3E5NA 1HZZA 2PKYX 4IIJA 3PUYA 1L5FA 4PX2A 4U63A 3TOVA 821PA 1YBVA 5H83A 5GPBA 2AFIA 3EXEB 3VA7A 5SZJA 4DLBA 3EXFB 2OCYC 5AM5A 1HGXA 4KVZA 2GAJA 1LX7A 2GMWA 1WAMA 2CLSA 4IIGA 3R0QA 5FBWB 1W2HA 4OF4A 2HA2A 2HMWA 5HVNA 2WD8A 4IFTA 3GYBA 1H85A 2EZUA 4FEYA 3ZBUA 3EDRA 2CUZA 5CB8A 1IATA 1Z15A 2C3MA 1Z28A 2Q5LA 2QUKA 4JQZA 4MI1A 4MWTA 4CR6A 3BWDD 5CCXA 2A3RA 3NU1A 3E35A 4BATA 4FDLA 5HF8A 5HW0A 1UUFA 3NYQA 3CFYA 2QXUA 4HL6A 2OUIA 2V5UA 1N6OA 4IKPA 4XJVA 1ZL2A 2EFJA 5DHUA 5AKYA 5K0TA 3NAGA 5FYDA 1LD3A 3BGOS 1J20A 3DDWA 2HSDA 3U26A 4BE7B 5DN6D 4N41A 2W2PA 4BIMA 1RWXA 3L49A 1DINA 1XWFA 1H65A 1XC7A 2B8TA 2BFAA 4CKCA 4DSAA 3MGAA 4ZGBA 2JGDB 2XTNA 2NO4A 2C99A 4EJSB 2D59A 1OLSA 2FW8A 2X0RA 3DCIA 4XA8A 1U9IC 2FWRA 1PT9A 4B4UA 5HS6A 3BWEA 1NYLA 4FFDA 2WKWA 2JCGA 1L9KA 2E4ZA 3Q3EA 1HYBA 1D4FA 3W5SA 2AG8A 2A84A 2CXXA 3IDSA 3OZCA 1JHAA 2WTBA 2EW2A 3N07A 2CCGA 1SU7A 4PVDA 1JAHA 5B53A 3VUFA 4D8VA 5K8JB 2GYWA 1J2TA 1LZLA 1W581 1BX1A 1RJGA 4ZKDA 1EM8A 1W59A 4GW3A 4C4YA 4H17A 5DP1A 3OUUA 1AQLA 2ZB2A 1Z2CA 3JQAD 3ZK8A 1MX5A 2YMPA 4LF5B 4KK3A 1ULAA 3G1WA 4G81A 2QJFA 3N2ZB 5FI5A 1XCGB 1TJ5A 2XJ9A 1JHDA 2GZHA 3AIKA 3T0GA 1T6ZA 4YXWD 5EA2A 2J45A 3L4EA 2NOAA 1C1YA 3U7HB 4ZEXA 5DYNA 1RJWA 1K1EA 3DE0X 3QP9A 2GCOB 2JIMA 4DZRA 2V7VA 1BJRE 1DX9A 4IRMA 3ED1A 4W9RA 1NMZA 1IYZA 3KBOA 4QVGA 5HKOA 1N2GA 2MSNA 1M66A 4Q93A 2OAP1 5H02A 3U4HA 4AJHA 3N8IA 1P39A 5EKSA 1P1IA 3GFRA 4YCNA 4FDAA 4G37A 2QHXA 2JHPA 4RY2A 2DLNA 5TY0A 4W5RA 2PQ0A 3IP8A 5EJ2A 4HLUA 3BULA 1R9JA 1LA2A 2R7NA 3G0DA 4X00A 5JUWA 2I03A 2Q5OA 4GE0A 1H9CA 2WUGA 1S6YA 2F90A 4N6OA 4EG4A 5A7GA 1E96A 3MWDA 2JLUA 1OGJA 2Z9DA 2YC2C 2ZWIA 3PGXA 2JCYA 3STTA 1NTRA 3PHGA 2QZPA 4KEAA 1G17A 1KYIA 2FSVC 3K9CA 4F3RA 4NF2A 4A2PA 1QNLA 2RB5A 1FS4A 4GKBA 1PNRA 4NBNA 1NAHA 1LDEA 3E7WA 4RPIA 3VH2A 3RS5A 5KYYB 2D5IA 4P83A 1E9DA 1BH2A 3F74A 2ZR7A 4WUVA 1B0AA 1UC5B 2W8BA 4KGXA 1Y6RA 4AJ1A 5B1HA 1SGWA 1GPDG 3ZWYA 1KI1A 4ZCLA 3GEEA 3Q7TA 2DYKA 3J7TA 3K1TA 3QA3E 4NBVA 4X41A 4X20B 3PGMA 5L3SB 5C4GB 2RDMA 3ZWOA 2UU9B 3SKVA 1PNOA 3T35A 5AICA 4BMPB 3HWRA 5JPCA 2CL7X 1E79A 1PJ2A 3PE6A 2O8BB 1KARA 3HU5A 1ECFA 1XQ1A 5EPEA 1LGYA 3WBJA 4MUXA 3TG2A 1RRPA 3ZHVA 2YJ4A 3RVRA 3W2IA 3EK2A 2QUHA 1OGYA 1SXJA 4NV3A 3DYVA 2Q6VA 2W2KB 3FJ1A 3TD9A 1TFRA 4BNDA 2YKGA 4L02A 4UM5A 3RYHA 4GX5A 4MIKA 4GWLA 3FUCA 1RLJA 5HUHA 5D3KA 5LLTA 4CEIA 2O5CA 2XHEA 3V9AA 3ZGXA 1C2TA 1XXHB 4EATA 2CYCA 4HVAA 3WSWA 1N2JA 1YH3A 1MC1A 5F3RA 2R6R1 3RWOA 3ZDYB 1IDN1 2FFBA 2PU5A 2O07A 1GTVA 2Q99A 4GXRA 4X1KB 5CPBA 5TARA 1UKCA 4LCJA 4DEVA 1CD5A 2WZDA 3CO5A 4I8XA 3RTBA 4ESOA 1SZPA 4K7JA 4AO6A 4ZOAA 2B61A 2FCRA 4AJJA 1SFRA 3OICA 1A88A 3UJDA 5F98A 4CZ2A 1NJ2A 5C7YA 2HRQA 5K6RA 3DT6A 4B44A 1GG8A 4F12A 2VSXA 4K1LA 1YS9A 2NXNA 1ONOA 5DB4A 1RJDA 2EBWA 3PPVA 3P9RA 2VYVD 3M3DA 4LJYA 3UQZA 4B6GA 3UAGA 1GZSA 5J47A 3FB1A 2AOWA 3LKBA 1VLJA 3ZTWA 4C7OA 1H9BA 3JD0A 4HQNA 4CT5A 2P6MA 5ERGB 4G9EA 2H4WA 1J25A 4YAKA 4YRRA 2QLMA 3CGWA 2XI4A 3ISVA 4DM7A 1NMSA 2XTAA 5KYXB 3OZIA 2V6BA 5EEGA 3SHTA 1II8A 2DUUA 3LUJA 4M7OA 4WZBB 1GL3A 5HMLA 3USZA 3STWA 3Q7RA 4YEDA 5GTDA 1EUDB 1FMTA 2FZVA 1EKXA 1W96A 3DFMA 2CHGA 3M1IA 3QELA 4KU4A 4YRQA 1L1FA 1U7PA 3ENKA 4J0IA 5ALUA 3HUEA 1ND5A 2BCEA 3HWX1 3QMVA 4RTSA 2O2YA 4N3NA 3JQ7A 1SCUB 1KY5A 1P1KA 2QT9A 2H4HA 1DRJA 4ND5A 3S0JA 1T6BY 2BGNA 4WA8A 5K9ZA 3M6VA 3VX4A 2QPAA 1P2SA 3DXFA 3GRFA 4D8XA 2COKA 3WGGA 3E2MA 1YJCA 1NLMA 1E2NA 2R1ZA 1FP7A 1Q6ZA 1ZBQA 4YAIA 2GARA 3IPAA 1ODKA 1H0RA 2W6JD 4FHZA 1GA4A 3I3OA 1P0QA 1NW3A 4CV1A 3N59A 4WOBA 1USKA 2J6HA 4G5QA 1GRVA 4MV7A 1R6AA 3EVGA 3KU1A 4UJ3A 1M6WA 4Q7LA 2QLNA 2A1UA 4P84A 4B2PA 3W5BA 1XTKA 3HGQA 4M87A 1P91A 2AD1A 2VP5A 3K0BA 4F8EA 4ZU3A 4E31A 2FGKA 2X0KA 4KXYA 4NCBA 4O08A 4XB1A 4BL5A 1D1PA 3ZDFA 1HTTA 2BOVA 2J7PA 4NQRA 4XWKA 1XLTC 4KLAA 1WCWA 2HJVA 3E9EA 4PZUA 3VPCA 1U0EA 3I28A 3NOOA 2G8NA 4F1WA 4KPUB 3A7EA 5G53C 3EF3A 5C8ZA 1IBKB 2H5JA 2IEBA 1V1MB 4G0YA 1IHXA 1A2OA 3W05A 4YDSA 3DCJA 4KW7A 3VTKA 3FAZA 4ALLA 5CG2A 5U9CA 2CNDA 4UQOA 4AYWA 5DO9A 2WPNA 2ASEA 3NX4A 3UY4A 1C1DA 3IHKA 4MP8A 2FMKA 3GJQA 3TR0A 4DG9A 1A8SA 3QQ5A 5D86A 1M2EA 2YIMA 4ZMBA 3UWOA 3VU9A 1HLGA 1JSXA 1XI2A 2ZS8A 2QSJA 4ND1A 4A7PA 4C5BA 4F4DA 2QTWB 4QQKA 2IEAA 2PX5A 1YI1A 2FP3A 4RX1A 5EIAA 3PSAA 3GGOA 5HIIA 3UOAB 1NRJB 3DZFA 2DR0A 2ZUFA 1ZOOA 5A0FA 1NJSA 1G2OA 1QV6A 4B3XA 2B8WA 1EESA 3PQ2A 3QFHA 5AWFC 4TRNA 1JH9A 3F9IA 4FW9A 5GAJA 1DAPA 4M8IA 4LYJA 2A5DA 4OMDA 4NFHA 4WCFC 4MIYA 2X4DA 2HU7A 4G1BA 5J58A 1XQYA 1YRBA 3OU2A 1LLFA 1U2SA 4OTZA 5A4JA 1GNPA 2LXNA 3IB6A 3N2KB 3TPCA 4JH0A 2PKQO 4L9RA 1IBLB 2O2IA 1G6HA 2QX7A 2ODBA 1RTKA 4MQMA 1LBTA 4NI5A 4CTKA 4OQEA 1VJGA 2ZYRA 3UKDA 4ZRNA 3K71B 3EWSA 3MUFA 4KR2A 4MVJD 3WWEA 3MLAA 4FWTA 4PW0A 1FVHA 2RGRA 4MW7A 4XD7D 5KMGB 3TXXA 2OXTA 3WWYA 1CUFA 2DWPA 3EVNA 2FE1A 3SEFA 4RH0A 3GR6A 1Z83A 4JLMA 5FPQA 4FWIB 1MX1A 2AXEA 1GZVA 1F12A 3R7BA 4BMSA 1ZPDA 3A4YA 5CURA 2OO7A 2WFMA 2DH6A 3N53A 3RFXA 3ZG6A 2R1TA 3K92A 4AP6A 1FE8A 4KAXA 1FTYA 5DTIA 1AS0A 3DG9A 3UT5B 2PGNA 3W6NA 2QW0X 1K5DA 4DDWA 2JIBA 4O0MA 1CB0A 1KORA 4GDFA 1N3YA 2IEYA 4B17A 1K2WA 1JLSA 2R6JA 5DNCA 4Q9NA 2NZ2A 3OZAA 4W5NA 4RCVA 2PMFA 4PC3A 1DC8A 1LRKA 2YHIB 2CHFA 3X3HA 3GCGA 4M6WA 1HYGA 4YRCA 2OD2A 1QH1B 3WLSA 3UUGA 1BVYF 1HTBA 1ZINA 1IC6A 5HDBB 5I7UA 1NHWA 1PQ4A 2G0TA 3CT4A 3PGVA 4IICA 2ZR9A 2CDNA 1I94B 3FLMA 1YL5A 1V8ZA 1H05A 2Q9CA 3BRWA 1C7ZA 2WJGA 4DV1B 2YIJA 3VDNB 4R51A 3ZR4B 4CM8B 3L06A 1MIHA 2NU7B 2PGDA 4WSOA 2JHCA 2Z8XA 1JA0A 1VOTA 3PTZA 4JBNA 2AEJA 1JKJB 3AEQB 2BMVA 2XB4A 3PYLA 1UEIA 3T38A 4J9VA 1AKVA 3IHTA 1NQAO 2R84A 4LF7B 3WAJA 1U9YA 3IAS1 1X7GA 1G7CA 1KDOA 1ESDA 5EJGA 2Q9BA 2V1XA 4IEIA 4YMTA 5SZKB 1TYAE 2NP6A 2BM8A 4KMSA 4D44A 3R6GA 3KDPA 3X1XA 1A9SA 2PV7A 1O77A 2YJ3A 1CDOA 4M86A 1ZNQO 2BFBA 2H63A 3LPCA 4NOKA 1OH6A 1OZHA 5DI3A 5K0LA 4EB6B 3LBIA 4QOEA 3LTNC 4Z0TA 1MVLA 2P1RA 1CYDA 2V0NA 3FBWA 3ND9A 3EIOA 3Q2IA 3SICE 4BS9A 5HZHA 3WSTA 4F4FA 1FRZA 3Q9NA 4MKFA 4EUHA 2FEWB 3LT1A 3SOZA 3FUXA 2JGRA 4B75A 5C1PA 1L6IA 2ZU6A 3ZWWA 1YRHA 5FOQA 5JO0A 4LOAA 3AF0A 5JSZA 3HYCA 4MO2A 3TNYA 5JAUA 2QZJA 2A1IA 1M0WA 3ESXA 2V96A 1NVAA 2KJQA 3LC1O 1A71A 1ZKDA 3T4UA 2XGJA 2MYTA 3GUYA 2P27A 2VQSA 2F1IA 4JBLA 2MYPA 5ICCA 4Q9DA 1NQUA 5IXJA 1FMLA 3GT7A 2AFHA 1SG0A 4LSZA 3IXMA 5GOZA 2FG6C 2BFMA 1ZWKA 2PA3A 2M2IA 5I9SA 3JU3A 1VG0B 2NADA 4HDKA 7MDHA 3CVVA 1XNGA 2G9ZA 3FPSA 5LXTA 4XPIB 3C3MA 3TO5A 4JWTA 1IL0A 1H4SA 1FNDA 2W6ID 1LDGA 2V03A 2C3PA 3MXTA 4NG5A 3DV9A 5JADA 4KTVE 1Z4MA 1TKRA 5U4QA 3I9JA 1WMDA 8LDHA 2O8EB 1Q19A 1YR7A 3L40A 2Q5EA 4RV4A 3F3SA 1QRUA 2D0DA 3L6CA 4IINA 3GOHA 5EEHA 4LXTA 4UKDA 5A9SA 2YOHA 3D8TA 3RK1A 1ZOLA 2EEZA 1SB9A 5FP0A 4JLOA 3C41J 2FWBA 4CQMB 6PFKA 3C87A 1DRVA 1NV9A 2XX3A 4IX9A 4RF4A 5IARA 3V55A 5HIKA 2Q41A 1KTIA 2W2XA 4CKWA 2VSQA 4LOLA 3QU9A 4G36A 5TRTA 4NU5A 4DSOA 2I4NA 1UDBA 3FTFA 1D0IA 1TIPA 5C32A 4I1VA 2NZJA 3A1TA 3IAEA 2UZIR 1ESMA 1G8SA 3SF0A 4BEBA 1KK1A 1E69A 3B1XA 5JG7A 4DUZB 2OGTA 4D1YA 1BRTA 3KR1A 1E2UA 3X1DA 1XQ6A 3QTLA 4KXQA 1BS1A 1YL6A 3EZNA 3LGSA 4R8LA 2VRWA 3FWPA 1EE2A 3O4FA 2IOFA 4KDCA 4PRLA 1SJ9A 3SC2A 1R5JA 1HX7A 2YVAA 1GCGA 1JDJA 2ACWA 3CQ9A 3F2VA 1K3TA 1MLDA 2ZYSA 3Q7IA 4PANA 3HJTA 5DWVA 3JQDA 3KK0A 5BV7A 2C7RA 3RNOA 1CUWA 1D07A 1A8PA 1Q21A 2XNDA 4MQ5A 4ZTUB 1UP6A 1N0IA 2HNBA 4E14A 1JR3D 5EJEA 1JIVA 1V7ZA 4FR0A 2WHQA 4N5LA 4YJ3B 3H04A 3OZTA 1KZHA 4YMLA 4J1TC 4C30A 4B1FA 4XLLA 4BGVA 2AC4A 5B12A 2PZKA 2J41A 4L9AA 3IOCA 2P75A 3KTAA 3QX7A 3BILA 1MHTA 5B5SA 2OV3A 4RIFA 2P2GA 2RGNC 3NC4A 1Y5NA 4UE2A 3ND6A 2D54A 4XR4A 3CY6A 1AB5A 1WV0A 1ZM4A 1TF5A 2ZYWX 1EFRD 2H2HA 2QUBA 4PG7A 4E6PA 2GAIA 4H4DA 2QRKA 2YUTA 3U5ZB 1SC9A 4YC7A 1P5FA 1EB8A 3KXPA 4RDIA 3THYA 3LTEA 4MR9B 5AW2A 4FSDA 3KCQA 4BYGA 3KL4A 3WDSA 2CLIB 2EJUA 3H1GA 3N7TA 3K5PA 4PYIA 3U09A 5CM8B 3IURA 1IBSA 4GRDA 5EZYF 1O96B 3DLPX 3AIIA 4EKNB 1XQWA 1CXZA 1H5QA 3SVTA 1KYXA 3BKXA 2GTIA 3KM0A 4ZVOA 3KQHA 5LQMA 4HB2A 3QVKA 1E1CB 1ZK0A 2HSJA 1KMQA 4GXQA 2HZBA 3B5EA 1VMAA 4KFSA 4MCHA 4RCYA 4H6VA 3C3PA 1IXKA 1ZIXA 2P9JA 4UUOA 3T12A 3DBLA 2VJNA 1PGOA 3CZPA 3O38A 4NK4A 5T57A 3FB4A 4KDEA 5CM2Z 1Q95A 1VSTA 5KC8A 1FJGB 4YR7A 2HAEA 1DDIA 1PK9A 1C7FA 4J4HA 4F60A 5JMOA 3LSYA 1GYPA 1GR1A 2Z4TA 4RKYA 3JZDA 2HWKA 3IR5A 4JC0A 1XV5A 1XXLA 4I1OA 4O8CA 1BCSB 1XRRA 3VUEA 3B1WA 1C8KA 4QATA 2RH8A 3TLAA 3U3RA 1Y9ZA 3NBUA 3TZHA 4HDMB 2CMHA 1G3MA 1PIWA 1C30A 3FGNA 1EK6A 4EKIA 2Y2UA 3QBTA 4KPEC 1DG3A 1JHMA 3MXOA 1RHJA 2BFNA 2FN4A 2R7MA 2Y6VA 3K1YA 3PDWA 1DXQA 1SD1A 2WIJA 3JD1A 1W4ZA 3C14C 1V11A 2PGOA 4FDUA 5DXAA 5ED4A 4MDEA 2R8RA 3HBNA 3WGVA 1X38A 2H1HA 1L7XA 2QE7D 3GZ4A 3C24A 3NJRA 4TTQA 4RETA 4A82A 2VWHA 4QD3A 4AK9A 4E1AA 5L7TA 3K1AA 3RT7A 3LPAA 3VPDA 1TF2A 1X7ZA 1IHPA 3R5XA 1DZ3A 2Z43A 2VDJA 1W36D 3IVGA 3NUQA 3A0UA 4JC5A 2ZJ4A 4HDSA 4UDOA 3WB1A 1TAUA 4V0QA 4U8GA 4E1BA 4GGMX 4ROTA 3EVZA 5CA1B 4MXDA 1CQJB 1G19A 2VJLA 2Q7OE 1OHHA 1HZJA 4GBED 4H77A 4IHAA 1T26A 4AW9A 5JC1A 1C9JA 2BI8A 2WKRA 3G79A 3Q5EA 4JXKA 3G88A 4UU8A 4EP1A 1RMTA 1XELA 1JAYA 3FHLA 3FPGA 3ECSA 4P3OA 3EHEA 4HWTA 1G0NA 4G1FA 3GK3A 2OHXA 2HEIA 2PV0A 4PS0A 4X44A 4V2IA 5I7FA 1HLDA 1GKLA 3JAKA 1KKLA 5BYKA 1DT3A 4M4SA 1UR5A 2JAHA 1I9GA 3F6SA 4AUMA 3KXDA 1KJWA 1ZI6A 2ZI5A 2JVKA 1SUDA 1WMEA 1XD2A 3GP3A 3RAPR 2IYPA 4DKJA 1RC8A 1WHSB 2R87A 3D6UA 2HMSA 3EY9A 1WABA 4HQFA 3DOFA 4ZZIA 5BVGB 2H54A 4JX8A 1D1QA 1CQIA 1VIMA 3UOWA 4HNTA 4KI7A 4QHYA 4YJKA 2YZ7A 4EG1A 1JHYA 2BFEB 3D3QA 1Q1QA 1PGPA 3I9NA 4O1MA 1NXXA 1RABA 4R98A 1K8XB 1KC3A 3HB0A 3U16A 3AW8A 2FUG6 3FWYA 1YOVA 2IP4A 5BURA 5FWXB 1UPUA 2QTBA 4AG6A 4Z7JA 1CUJA 1HWYA 1Z35A 1F8YA 1HT2E 5HKKA 3QEJA 5IYZA 1YIAA 3EEOA 5A3SA 1GYRA 2OZKA 4K87A 2WFLA 3MAAC 4NEQA 4QE3A 4TMKA 4YK7A 3U7QB 4JI7B 4DAOA 4HN9A 4L4RA 2RGAA 3LVQE 1R6DA 3O8OA 3PT9A 5TDHA 1OVGA 4KWEA 2C04A 5EJIA 4NU0A 5IJWA 4BNZA 2FKNA 1JQDA 2L2QA 3SXUB 3MA0A 1OXSC 5CDTA 3D3KA 5DGHA 3EW9A 3OOHA 1ODFA 4MUBA 4C2UA 5BUCA 4LYAA 1QIEA 2DPYA 3EVBA 3G2PA 3IBGA 4LGCA 4ZC8A 3V2GA 4CQJA 1FLNA 1U8FO 2EBFX 2VP0A 3FRJA 4TZKA 4ZI7A 1GEEA 4B3JA 3BT7A 3HZRA 4IQ4A 4CQLA 1H3FA 5IJ9B 2IELA 5AKZA 1EWYA 4CLRB 1CEEA 1MG0A 1WHTB 3WB2A 5AVYA 4HB0A 2GZAA 3D8HA 3KPJA 3OC6A 4D26A 4LYEA 3RG8A 3PCXA 3X2SA 1T9HA 4NCXA 1AU9A 4QPJC 4Y6LA 4BGEA 5IASA 5H82A 4MIEA 4Q82A 1BRMA 4QDKA 1JALA 4C4AA 3LBHA 1QQ7A 2J0UB 1J9ZA 4CG0A 5KU7A 2XNCA 1KL7A 2C95A 4H1TA 5CRIA 1QH8B 2V6FA 1T36A 5CYOA 1CJCA 3GRVA 3PUHA 4EFNA 4R71A 3NVMB 3CBGA 3C45A 1K3UB 3IFSA 3ITNA 4LQDA 1PYOA 3QW4B 1FMJA 4R68A 4TKVB 2VI5A 2DBZA 4FEGA 5FPKA 4LRQA 3L0YA 1NFRA 3L7BA 2G9RA 1E0JA 1MRNA 4KUGA 4Z1MA 3VYTB 1ZO8A 4EZEA 5JMWA 5ENVA 3T6KA 4D9HA 2DLCX 3H5LA 3B78A 3LPLA 1B6GA 2Z3ZA 5THXA 1VECA 3HFJA 4YXFA 4K6MA 4ARUA 5A1TA 2F3SA 4REQB 3AUFA 1A8UA 4CFZA 5L4LA 5IT9A 2FOLA 1MD9A 2P41A 1KRHA 2GO1A 4D3FA 3GW8A 4XQ9A 1RCUA 1KQFA 2WJJA 1KVQA 2ZIFA 2QRUA 1L8LA 1OXMA 1Z0UA 1NUPA 5H3CA 3GCDA 2EERA 3D0KA 1YMVA 2Z6UA 1OPXA 4YMUA 1MOQA 1XQ9A 4I55A 1QGUB 3ISJA 3N28A 3U3MA 1FL9A 3X1WA 5BR7A 3HO1A 3SI7A 2BTQA 1ZKMA 1T0IA 1EG7A 1MO5A 1RVV1 2J32A 4Z7NB 5ESRA 4RVHA 4NNJA 2NZXA 3H2HA 5JDCC 9ATCA 2EU8A 2PRIA 1W8IA 4C3UA 1OT5A 4UFPA 4JENA 1NYRA 1QGAA 5IVDA 5E7MA 5GJVC 3TBKA 2UVPA 1LQ2A 1N2SA 2CF6A 3C8ZA 4KB5A 1T9GR 5DW0A 4CL8A 3ONEA 2VAMA 3MB8A 3HB5X 3MIIA 4HXYA 3FNFA 5JZVA 4F46A 1JXAA 2IK8A 3L7NA 3ZN2A 3K0FB 1ZIYA 3M33A 4UMVA 3WWZA 2AYXA 4WEQA 4D3ZA 4EH1A 4HNVA 2OMKA 1T4BA 2GLXA 1XAHA 2QORA 4JLBA 4EKDA 1XQVA 2RCYA 2SECE 2BSXA 3EJWA 4EFDA 1O0CA 5YASA 3M5DA 1H2YA 1I32A 3RFUA 1EWVA 2WINI 3FROA 1QOQB 3ZGOA 2GJ8A 4KFTA 4H59A 4KVGA 4LDAA 4FFLA 1GQYA 4M38A 2AVDA 3O26A 3C0KA 4I1PA 2A33A 4YBZA 5D3MB 4XLZA 5EWMA 2P77A 5DBGA 4DT1B 2PUWA 3RYIB 2ZP1A 2D2EA 3CSDA 4WK0B 4CTMA 3ILHA 3GG2A 2R6HA 1TZ2A 3KRTA 4OB8A 4U2EA 3SS7X 2YRXA 1ZVKA 3QPUA 3MLBA 3VVBA 2MSEB 2BMWA 4EYGA 3LCJA 1N25A 2YJ6A 2VNHA 3FNBA 4V39A 1M1YB 4LQCA 5FR2A 1GPMA 1Q22A 2ZFUA 4IIUA 3AKDA 1Q7BA 4LE0A 2WA2A 2B20A 2FX5A 3TW8A 5JD5A 4XVUA 3WIUA 3IODA 4CMAA 4QXMA 4B6FA 4FNGA 3LF1A 2WT4A 2JC3A 2WMOB 1I3NA 2I67A 5KKAA 4UEJA 2KLHA 3DBRB 5IP5A 3JAMA 1FFEA 1HZZC 3HY3A 2VT7A 2YICA 5IWCA 3H7IA 2V98A 3PT5A 4XM0A 2CD9A 3NWEA 4HGPA 1TQ6A 1JEEA 2AQ8A 3OQPA 5BWCA 4YN3A 4I9FA 2W2OA 4KQMA 2ZUTA 3WGNA 5IN4A 1YVUA 1FVOA 2VO1A 4YCSA 1QQ5A 1XEXA 4K9KA 2N0SA 4D4MA 4WW0A 1Z68A 4ZHSA 2EBHX 3DF9A 2WOJA 4A23A 1CLUA 2F8TA 3QU7A 1TPYA 4TT8A 2EJVA 4XE5A 2KMLA 1T9ZA 2RHDA 2PGXA 1CUVA 3VNQA 2BLLA 3DJYA 2ZQYA 3TQTA 4BWGA 1KO8A 1GZ6A 3VHLB 3VHRA 4RU1A 3OLXA 3VZDA 3HA5A 3K0AA 1FRNA 1F8XA 4OHZA 3OM9A 1QIFA 3AWDA 3BVPA 3UPTA 3K0SA 4LF9B 3IBTA 2AJCA 4AJLA 5F12A 1CR6A 1TYZA 3WFIA 3TW4A 4O4LF 1E8MA 1KVSA 1GTMA 2D1TA 3ND5A 3V1KA 1ICEA 4CM6A 5JOQA 2C88A 4JLVA 3L1JA 1RJEA 1ST2A 4QC2A 2WM9B 2X76A 4RXUA 2WVAA 4YJGB 3KFLA 3C2QA 3SC3A 4U7GA 3ZWXA 5L45A 2M6KA 3RU2A 5SY6A 1M0EA 4MYCA 3LP5A 4FM9A 3KLOA 1H42A 2PN1A 4EPTA 1C7QA 1Q84A 2R5NA 2W0MA 3SIRA 1WSDA 3DLAA 5ISMA 3GLGB 5UKDA 2ADOA 3C1UA 4KH0A 4C43A 1RVDA 1GO2A 1RYDA 3ETDA 3PC2A 5LOVB 3UAWA 5HIMA 4BE9A 1MJNA 2C4NA 1RQXA 4HVCA 4WPGA 3DVLA 2ZRHA 4QU9A 4TVSA 3LDUA 2GVDC 1GPUA 3FTQA 5H70A 1NI4A 3V4FA 4D9BA 4WLUA 1JHUA 3DE2X 3DPUA 4JYCA 2VK1A 1QP4A 3VH1A 2OBNA 3E0QA 4OI4A 1Q0SA 3AI7A 4UNSA 1JIXA 4F4HA 1WBBA 4QUEA 2B78A 1V6SA 2JIZD 3TTUA 1WU8A 4O2BA 2GO7A 1Y89A 1Z8FA 2BLNA 5DX0A 4YUAA 2PWAA 4D0LB 2NYRA 5EUQB 1EA5A 2ZJ2A 2AN1A 2F67A 2IUFA 3CRNA 1TUGA 4R9VA 3REQA 1H0HA 4D74A 1NDUA 4UVEA 5CCDA 4CYMA 1N6PA 4XEUA 4J7UA 1L5ZA 2GFIA 1YCGA 1ZD8A 4L22A 2WU0A 5C7IO 4P33A 4FR5A 3PEEA 5ANRB 2O3RA 1U1IA 4N40A 1IVYA 4NCHA 4ZOLA 4CG1A 3SKXA 1Y7PA 4KR0A 2X9NA 4DMRA 1G41A 5EUCA 4OBBA 3HFGA 1DUVG 4FK8A 1O08A 1W73A 1ZD5A 2AJDA 2FY8A 5FO0A 4AYTA 3ET5A 1YS4A 1RWVA 3GLHA 3L4SO 3AU8A 2AKEA 1XJ5A 4AURA 2Q6LA 1JG6A 2CJYA 5HQ3A 2F1KA 3EW7A 4K6CA 4ASUA 3RV4A 2VCYA 2VDVE 2VDWA 5FJJA 3TJZA 4EB3A 1CY6A 2H2DA 4D8UA 2ZJZA 3E22B 4RS4A 4LZWA 4CDMA 4TV8A 2FLVA 3VYRB 3M6FA 1WMBA 4PFSA 1HNNA 4XD2A 4UNPA 3I2YX 4RWZA 1QANA 3UO8B 4D42A 5IUNC 2WNHA 5LNK1 3ZJTA 1XJ0A 2E49A 1CR1A 3WE7A 3U6BA 3ZX5A 2POCA 5HQJA 2CGEA 5JECA 1D6NA 3B20A 1UBLS 3HB7A 3ZJVA 1SXJC 4Y67A 4RKRA 5CGQB 4IHKA 3EH1A 3V8QA 3U4CA 3NHSA 2EVWX 4PS1A 4QLOA 3VKFA 2G4LA 1XEWY 4ZZ0A 1SBTA 4RTNA 2AF3C 2BKUA 4ACBA 2IUUA 3TZCA 5EIFA 1K08A 2JEOA 2V9CA 4RQBA 1KHHA 4HNQA 2CKMA 5CT6A 3I2IA 1X19A 3AY7A 3P9XA 1GU0A 5AVZA 3HACA 3CA8A 4LHXA 2H1FA 1F8FA 2WZQA 2DPHA 4K2HA 1GJRA 2GT1A 5DHSA 1QJ4A 4M22A 1RI1A 4H7PA 2PRSA 1R18A 4PLCA 4QARA 3SCZA 3QUAA 2EL7A 1GCIA 4IM7A 5FL3A 2VAPA 3W8FA 4O4JB 2OZPA 3HJUA 4BMVA 3V1TC 4E5PA 1KNQA 1ESNA 1KH3A 1T9GS 4PFKA 2VDPB 3AUAA 4W5HA 4TMXA 1RP1A 3NHAA 1C3JA 1T5TA 2OBYA 3GLFB 3UYKA 3GLIB 4MVJF 4CM4B 1BS9A 3FLEA 5EQFA 5LSAA 4UTOA 1OXVA 1T1GA 3KQOA 4Q3CA 2GM5A 3T95A 5ADUS 2GEUA 4TUYB 4BNGA 4ITUA 1T1EA 2NPOA 3FNGA 2RGBA 5JS1A 1ZGJA 3BXGA 3CIOA 1X92A 1YRQA 3OQVA 4G5HA 3FR8A 4QPPA 3LM8A 2Z9BA 4NCNA 2O57A 1MW9X 1GCAA 3QX8A 4TRJA 4BKPA 1JDVA 1JHVA 3F0TA 4RHCA 3KYCA 3L46A 4HNHA 1C8LA 1O95D 3AFNA 4QU8A 2NU6B 3CMCO 4ZO7A 1QKJA 3VYVA 1FEZA 4G1MB 3OFVA 1G4AE 1PFUA 2IYTA 3DYIA 3WSVA 4D46A 3N0RA 1L5VA 3KG2A 3LIPA 3PV0A 1PP4A 2WB4A 2NSHA 4NENB 3R5JA 3TLYA 3ESDA 4LBVA 1P4JA 4HB3A 2CHVA 3SYRA 1DGQA 1AIPA 3JRNA 3IELA 3PIIA 2FDRA 1ZA2A 2JJYA 4IQGA 3RYCA 2X2PA 3SX4A 1LK0A 1OXUA 1P77A 1Y7TA 4C5AA 5IU6A 5DNDA 3C3EA 4ETNA 4AKEA 2GA8A 5IPFA 4RVUA 4OYHA 2B4AA 3EMVA 1LBSA 4KE7A 4HQKA 4N8SA 1REQB 1X1QA 4ZEWA 4Q01A 4DRXA 3K6KA 3OF5A 4LWPA 2GVZC 2HY7A 1CG6A 1WIWA 4KBGA 4UXHA 3RVOA 1SY7A 3HCDA 1VB3A 4C9BA 2YXBA 2VPPA 1WR8A 1QG0A 1G9SA 5JJCA 1V8DA 2PJUA 2QRGA 2GRAA 3PDUA 2DLDA 2CEAA 3O90A 4X8HA 5JYCA 1WNTA 3TLZA 2ES4A 2J9YB 3KKZA 4DLSA 1QR2A 2JLSA 4XWWA 2NTJA 4WLFA 3THXB 3AUXA 3TVTA 1NWCA 5E8RA 1E4EA 3PWSA 4QO8A 3U49A 5CR9A 2GCPA 4BWYA 2ZRGA 4F7DA 4OCZA 5IF9A 1AOXA 3ZE8A 3R0IA 1Y82A 3U7FB 1FTWA 2ZZNA 1OQAA 2ERCA 2FHSA 2QVYX 4ZA2A 3RODA 2A9QA 3EWNA 1AM4D 1A5BB 1HRDA 1NVUQ 2E7ZA 2FPPB 2MSKA 2YNMD 4WZZA 3ZDCA 2OGWA 3ISTA 1I7SB 2UUOA 3B6MA 4YP7A 1VKJA 3ENWA 1J9EA 4XIYA 4ZAYA 1ICIA 1SAYA 3MBIA 4U7JA 3DZ8A 4OI2A 3UG7A 3F5FA 2XOXA 5AJWA 2ISSD 4ZEVA 1RRGA 2H1SA 2VAWA 3LYHA 3G8CA 5MFPA 4Q00A 4L0MA 3LVRE 4CM3A 1VYHA 2FNAA 3K7EA 1KMHB 3Q15C 3UA4A 4LC1A 5HCUA 1M73E 3PPXA 4H6WA 1X8LA 4AZ0A 3GRPA 3R4CA 4DJAA 1AZWA 1X0XA 1H94A 4FHGA 3ZHUA 4ONEA 3T1HB 2LWIA 2H16A 2HMTA 1YDFA 2GM3A 1DADA 4WY2A 3A31A 1JT2A 1OIWA 2RC5A 4BPBA 1IZYA 2FMXA 1P2TA 2RGXA 1XDUA 1H2EA 1TPZA 1ZZGA 3DTVB 3VZPA 5B7PA 5D5PA 1Y9EA 2NSDA 4FBMA 2ZPAA 4LF4B 2IXEA 3ZY6A 3OQ1A 4KUHA 4DCNA 1AKTA 1E4OA 1KH1A 3R0VA 1CSEE 3WICA 2UZAA 1NW7A 3K9BA 2QBYA 2BKVA 3BOSA 5EWJB 3QENA 1VHQA 4QUDA 1WXWA 2QTAA 4AC9A 4OHPA 2Z58A 1ZW1A 2PSEA 2WUVA 3QPCA 4DQ0A 2WR8A 2AN3A 3MMXA 3PQ6A 3DS8A 2NX2A 2I3GA 5LB2A 3F1KA 4QGFA 4G0NA 2EF0A 5DBIA 3RVQA 3SYMA 2R1VA 3WZMA 1IULA 3U13A 4HH0A 4C4RA 3ZU2A 1NVGA 4Y8VA 1FXWA 3DKPA 3ENZA 5DLEA 4B4DA 4R8SA 4EZBA 3NMUF 4LV8B 1ID1A 1FS6A 3MOSA 4ND3A 3O8QA 4URFA 1R0WA 3WNQA 2PYZA 3QITA 3VO2A 4EEKA 3V8BA 5L3RA 3RTDA 3M6AA 3M6MD 1VHJA 2HIGA 2YYAA 2DPXA 4RKFA 5FI0B 1B43A 4MS4B 3PA6A 2Q0XA 3DKIA 2A14A 4BGUA 4N12A 4DRYA 4B3GA 5JFGA 2RKWA 3Q9SA 5DHRA 1Z13A 3QJGA 1N0WA 1V41E 2MMGA 4WL0A 3T3NA 1J7JA 3W6UA 2QU8A 2ZKLA 3ECAA 4IX1A 3IOEA 4A3SA 1SIWA 2I9PA 4UVIA 5J2TA 1EMDA 3DVQX 1M3SA 4FWBA 5HJEA 2BP7A 1GG2A 4QXRA 2MYUA 2I4LA 5HYVA 1YU6A 3MUNA 2GETA 4UTVA 4F4CA 4MA0A 3QU2A 5LL6P 2IV2X 2JEZA 3EXEA 4UUBA 2PGJA 5FBLB 4JI3B 3EXFA 1SXQA 4OJKA 3ELWA 3H86A 4I50F 4D6PA 2CFRA 2ZRCA 3LBAA 4YWHA 3PG5A 1W94A 1T8TA 2CXHA 2DQSA 2R79A 2AOUB 1R0CA 1DFIA 4Q3LA 4CT4B 1IRXA 3LT5A 1CRPA 4US0R 1JQJC 3AF4A 3E48A 5K3SA 4CCSA 1C9DB 1IEQA 1XCMA 5H0IA 2ZSDA 2CFTA 1J7KA 2O2DA 4HEA1 5DI9A 1SVIA 3V4LA 3ZUPA 4BIIA 4KSYA 5LQNA 1K5PA 2OBFA 5ITSA 2ZULA 3AHHA 3AHJA 4G1CA 2J4DA 2BGRA 1DKMA 2G4CA 2WAMA 3LT0A 3I5YA 2DQYA 3M6IA 2ZAYA 2XUPA 1CEXA 3K8YA 5ALTA 4AMVA 3V4VB 4BQSA 2NO9A 4ZRDA 1EJBA 1UMBA 5ECDA 3CV3A 5KIAA 2AZXA 1R4AA 4ZT6A 5KB3A 2OGZA 5JCJA 3WAGA 1E1QA 2JGDA 1RAIA 3EUAA 3LPNA 3K53A 4OXQA 2CLMB 1KVRA 1NUTA 1UDCA 3O8BA 3IR6A 3OKFA 1XN4A 4GMHA 3RM3A 1ITZA 1V5WA 2GK3A 3R9IA 4L51A 4L2IB 4EJSA 5F7XA 3QKUA 4KP7A 1XNHA 3FMIA 4OXKA 3RJ5A 2IPNA 3LQRA 4J1SA 2VDQB 4MW5A 2Q1UA 4EW1A 5IM5A 2WKQA 1SKUA 2QJRA 2EP7A 3CLHA 5AIAA 4KR9A 2D2IA 3RC9A 4MUGA 3TAUA 5CNIA 3LW7A 5JWHA 1KYWA 1ULSA 1VG9B 3L0SA 2FW6A 2PX6A 2WYVA 4US2R 8ATCA 4ZAVA 1FYWA 3GBSA 3OY2A 4FOOA 3SD7A 4V0KA 1UK8A 4X1IA 5KWIA 1Q0QA 4AT1A 2PRZA 3E61A 1DKLA 4IF4A 1Z4NA 3G2IA 4I5DA 1JXQA 1T91A 2P68A 3QE2A 3D6JA 4TSRA 4UHCA 3BZBA 3U1TA 4F3YA 1ZD2P 2JJ1A 1EJ6A 3FJOA 1ZCJA 4FB5A 4EYEA 1H0SA 3W8NA 1Z5WA 1NNEA 1VCHA 2WJ4A 4DR2B 1U5BA 2GUWA 3GRAA 2GCOA 1D4ZA 3PKIA 1L5MA 3BRCA 4UHDA 4F9EA 2RGWA 3NM6B 2YOGA 4CIDA 2WW8A 4LXIA 3MWYW 1PQUA 4XOIA 2AN5A 1EM6A 4RVCA 3OETA 4IUCS 1YRLA 5L4NA 3RROA 1XA0A 3DLHA 1GGEA 3D4PA 5GP1A 4KOAA 5BRNA 4RZ2A 5MGNA 1MJFA 1BXRA 4BFCA 3I09A 3T5BA 5A4FS 1P3Y1 3WLKX 4OFBA 2CB0A 1Z2PX 4J4TA 3VNBA 4S1PA 4NXNB 5TMPA 4MUFA 4F5WA 3MTAA 5C31A 2HM7A 1TQDA 5C1IA 5FFNA 3CLVA 2HRDA 2PD6A 2AWOA 1PR6A 3FFXA 1HR0B 3TDNA 4H60A 3B6KA 4J07A 1VIAA 4CCAA 4UUMA 5CA1F 5CG1A 2B99A 4Q7MB 1RRCA 4PQYA 4QQRA 1E9BA 4OHWA 2H00A 3T4EA 1PGJA 2GN1A 4HNSA 4ZVPA 2WAYA 1N6HA 3AM3A 3WG9A 5KWVA 2MYNA 4JOBA 1OREA 3K94A 4PAGA 2IBMA 4Q24A 1V9LA 4FX5A 4R0VA 4X20A 3G2LA 1TAQA 5L3SA 4YUYA 5AVRA 1F4PA 3QOFA 1MC5A 3FUVA 3MTEA 1UXOA 1BEUB 1XZIA 4G2NA 1DHTA 4I08A 4LBWA 5P8WA 2O8BA 1GCOA 2MCFA 3TE6A 1XZPA 2W90A 1YZQA 4ZU6X 4NVRA 4ECAA 2WWGA 3I6YA 1ZCAA 4X60A 3V33A 8ADHA 2TRSB 4GUAA 1MN6A 2V3VA 4IV0A 2W2KA 3P9NA 5L4SA 3K2BA 5CPFA 4WNAB 1CT9A 1FDTA 3KHTA 1X8JA 1QZXA 4EPXA 4S2EA 3H8VA 1H93A 1SC3A 1YCDA 2A58A 3BHMA 4AXXA 3DOCA 2ETVA 3WMRA 3U9TA 1KJIA 1M6EX 2Q3MA 1YHZA 1JKXA 4HRXA 1HOXA 3GVPA 2BMDA 1E94E 3NATA 1Y1KE 2Q5CA 4I19A 3QOYA 4ENPA 3AHDA 1HE3A 4KWCA 5C4IA 1JFTA 3WMEA 3ZDDA 1W93A 2WIFA 3NVKI 1M2HA 2A9PA 2GZ2A 1JZQA 4LVNA 1B42A 2IP1A 2YFYA 3UMMA 4M21A 4MQBA 1II0A 4LIPD 1UIRA 5EP4A 1M7HA 2QTVB 4RF5A 2Q4DA 1W0JD 4BJ1A 2IYYA 4EVRA 5CB6A 4NU8X 2BM1A 4M8LA 1AQYA 2I22A 3WQBA 1WPRA 4FGJA 3AFGA 2GBFA 4MRMB 4RD2A 3VI4B 5I4KA 2F17A 4M54A 3NDRA 3NONA 5AJUA 2D1SA 1T8UA 3IPXA 3N8NA 3SNKA 3RUCA 1FFDA 2QA5A 3MIZA 1LPBB 4P36A 3PC4A 4U9IS 4QBIA 5E9JA 5CYGA 4BFLA 2I4RA 4XWAA 1NP3A 5K2MA 1Q5PA 5BNWA 4WGFA 4D6XA 3QXHA 2GF0A 2JAOA 3D6NB 1NBWB 1DCTA 4C7OB 2FU5C 3OSUA 4KE9A 4Y0AA 3KT0A 3I9MA 2C7QA 1I14A 1Z12A 5AMXA 4DIKA 2HXYA 3LUBA 3WGQA 1EUDA 1KPGA 3RS9A 5CW1A 1ENZA 1Z0DA 4J0GA 3VV2A 2O06A 4BKRA 1KEKA 5K0EA 2RAUA 2MTBA 2VLBA 1P29A 3BWBA 3D6AA 3H11B 2RGUA 4Y6RA 1SCUA 1V95A 1MNQA 2CCJA 3KYIB 3OX4A 3Q6MA 4NCIA 1CE8A 2P9ZA 2JDID 1ZM9A 2LV8A 3WV4A 2PQ6A 5AKXA 1F8UA 4DOMA 4OBWA 1ZBDA 4JYPA 2A59A 3G5MA 1VPVA 2RC6A 3DO6A 4WBNB 3I1JA 2XUFA 4BP3A 1MABB 1WCXA 1XFDA 2I1VB 1KK2A 3ZHRA 4ZVQA 1KFCB 1AV7A 5FUXA 3W6ZA 5DT2A 5FQOA 1A27A 3LC2O 5DNUA 2HFJA 4LTMA 2ZTUA 3PFWO 3EYAA 1CDEA 1Y3HA 1DEAA 3ZY2A 1I3CA 3B8EA 2W98A 1O94A 3DKKA 3V8EA 1G3UA 2ODTX 2YJGA 3ADKA 3GRKA 4IP0A 5TPZA 2XCSB 3GIWA 2QX8A 4CM1A 1N5LA 1WD7A 2B30A 1D2AA 2JEYA 2TSYB 3G2JA 1ADGA 2OHFA 1AXRA 4E11A 2JZCA 5IK2D 3I6ZA 5BOSB 2C2HA 1P81A 3ROQA 3ZDBA 1NBHA 1T4GA 1QHNA 4KPUA 2XIJA 3I6BA 4LJ5A 1V1MA 3KOYA 3ANMA 4HDRB 1HDOA 2F3RA 2W4QA 2L0XA 2B82A 2F2TA 5LFAA 1JEYB 1MOPA 2V7QD 3NYRA 5C8DA 1ECJA 4GR4A 2OOSA 1ZIDA 3HY4A 4D92A 3WKEA 3UIEA 1L4UA 4EFMA 5F64A 3KVOA 4MGZR 1DTSA 1O9HA 2BM9A 3B3FA 4NCAA 1J1IA 4JT8A 4LMAA 1V8BA 4DG8A 2VVTA 3AHCA 3ZV6A 1ZR2A 1Z4JA 1A97A 3P0IA 2H7VA 3O21A 1Q15A 1F51E 1U1CA 1YDMA 2G70A 5KNDD 3M4XA 3R5SA 1N5JA 2J3LA 1FQOA 5EHIA 4BX0A 2HCFA 1MXHA 1DSSG 2E89A 2GYUA 1L4KA 5FCDA 5E4FA 2A2ZA 5SZHB 4JI1B 3TTXA 5K0SA 1XPOA 4LWZA 4FYVA 5IDWA 2CV0A 2B7CA 2W7TA 5IJAA 3WZ2A 1LTQA 2E4YA 2RK3A 3LOUA 3QNWA 2VJYA 1EP9A 3OLVA 4XARA 2XCOA 2P9BA 4ZREA 3EDMA 3N2KA 5L9AA 1RT9A 2XDWA 1PLKA 1FFWA 5BQFA 1C7JA 2ZT8A 1KR5A 3CW9A 3KZOA 5J4KA 3W3AD 1LQUA 2Y1CA 4BRSA 5HRAA 4MLZA 4JJIA 2E5FA 1P4RA 2OKGA 4PGHA 3CKMA 1L0BA 2XUAA 3RRXA 1VE3A 4F06A 2XPCA 1LU9A 4WTOA 3S6JA 3KAQA 4M1TA 1ILEA 4Y0NA 2FFQA 4TMVA 2FYTA 5LKRA 3GUCA 2BHLA 2W2VA 4MHOA 5A04A 3EQ9A 5LMZA 1NT4A 2I78A 1SM4A 4G23A 4EUNA 4ABYA 1NW9B 1WRBA 2Y93A 5HBGA 4V24A 4GKJB 4IH1A 3H2YA 3KKNA 1AHIA 2FSSA 1D3AA 1USWA 2QEQA 2WWFA 4URHA 1J9GA 2C5AA 2RJ3A 4R2LA 5I9BA 1OH7A 3OD5A 3S27A 3W2GA 3I53A 2H0RA 4LOIA 5G02A 3OJFA 4WK4B 2J3MA 4X66B 3PR2B 3KB6A 4AN4A 4P5DA 3RRZA 2BHRA 4XUCA 1UOQA 2JGJA 4KLZA 1CJMA 1QP0A 2ETXA 3KSRA 1JDUA 1PJ8A 2YHIA 2TS1A 3OT1A 2BKLA 2QG6A 5HFNA 3EDQA 1RWOA 3RANA 4AUKA 1N3BA 5FNVA 4QAJA 1ODTC 2VPIA 3HCOA 5K0NA 4P4SB 1JW9B 4R5HA 5A5EA 1ULHA 1ORTA 3L7KA 4DKXA 4DR4B 3QEOA 2Z5LA 3U0BA 5IX8A 4YRAA 4CKZA 3LY8A 3OIFA 1CR2A 4IWXA 1E3DA 3IAXA 4OHVA 4DQXA 4D3DA 2X22A 2Q2VA 3RH0A 2PNJA 4CM8A 4AY2A 2NU7A 1JJ7A 4MA4A 4HWKA 2OFOA 2GF9A 4DCCA 3AEQA 3PD0A 4UATA 2QLFA 3GAMA 2WEKA 5FF9A 5JS2A 3FHTA 4OB6A 2CN1A 3VVMA 2P69A 3HYLA 1QIKA 5AK0A 2Z04A 4CKYA 1QMPA 3U56A 4FS8A 6YASA 4F38A 3B1ZA 4QT4A 2IIQA 2HXGA 2PT7A 1UM8A 3I0MA 3UJPA 3GLTA 2G77B 3QXGA 4PO1A 2YYYA 3OM0A 3PDCA 4YCLA 3SMVA 3AL2A 5JI2E 2N3ZA 3GRYA 3KLBA 4PYJA 9GPBA 1FP1D 1E9RA 1EX7A 3I45A 3O95A 4CF7A 3IAUA 1QUFA 5JSKA 3R3ZA 4EB6A 3AVXA 1DWUA 4ZK6A 2ODNA 4D96A 2PLFA 4JX9A 2NACA 1T15A 3D8UA 1WCIA 1U0RA 3HH8A 1G21B 2KBFA 3A6KA 1JQLB 1YVEI 1U1EA 1QYRA 1YUMA 4N7MA 4PZCA 1FSFA 4KLRA 2ZG6A 2QR2A 2JGFA 2VJAA 4MULA 3CF0A 1PD0A 5INTA 3SQWA 3HMKA 2J4FA 5KO2A 1U8XX 4C87A 1O6BA 5TSDA 3O3NB 5LOVF 2VT2A 4Q6WA 4EOGA 3S2SA 1ZEJA 3VDMA 2QE6A 1Y8CA 2M6LA 3S2FA 1SBNE 5MFZA 1LK5A 4MV4A 4H7IA 2AHRA 3MTGA 5IH7A 2Q4OA 4ZOCA 5HMMA 5IC5A 4MPRA 3E9CA 2HSZA 1B0PA 5CH8A 4DLAA 2M6SA 1P19A 4Q19A 3HTXA 4IXWA 5LBIA 4EHKA 4H08A 1T0HB 3I64A 4XPIA 3DWIA 1MQ9A 4RGYA 1IJKA 3MTQA 5LJLA 5KS2A 1XPUA 3ZLUA 1YKSA 3M83A 4BNMA 4A0GA 1A5TA 1WL8A 1QMGA 1Q0HA 3RF7A 3GGDA 4IMPA 2O8EA 4OHUA 3LLMA 3DZBA 4CEHB 3ZUGA 1G291 1A5AB 1I4LD 1G8HA 1PKXA 3KWJA 4P4GA 5EXXA 3U4GA 3V4PB 5CFZA 3O1HB 4HUTA 3GGJA 2IS2A 4IDFA 1PJBA 3D02A 1YRYE 1QHFA 2FWNA 3EDYA 3OE1A 3HBLA 1Q3TA 1V6CA 4FGWA 4PQRA 3EAQA 4ZVUA 3H2SA 3I9FA 3ZBPA 3WK7A 3QEBZ 3F6CA 1RI4A 3KFXA 4CQMA 1J21A 1LI7A 4CFYA 5SY4A 3DVSX 4W5QA 3TLEA 5JI3E 1KQNA 4DA9A 2Q3CA 4DM4A 4C21A 1U7HA 3IAM1 1E4YA 3S44A 4YRSA 1NIJA 2DP4E 2Y9MB 2JLVA 1RWBA 2Z56A 2VYNA 5FI1B 4MW0A 5K6AC 3J7AC 1P18A 3JQPA 1RRKA 1E3MA 1NF9A 3VNRA 2UYOA 3QFRA 2AG0A 5DOVA 3NEAA 1AGNA 2ATIA 1E2KA 2C61A 5JTTA 3IHWA 4ED9A 5I8ZA 5TE9A 5HZMA 1P2GA 2H5IA 1Q3KA 3NFYA 1E3WB 4Y2HA 1Q1GA 2PT9A 1MX3A 4PRYA 5EESA 3FSGA 1GKYA 4GQBA 3CJTA 3GD5A 4NONA 3N2YA 1HT0A 1PHRA 1RLIA 2OQRA 3L9WA 3W4KA 4LMPA 3UPDA 1DOZA 3EDCA 1Z88A 4DIEA 1HG0A 4LY9A 3JALB 2QRPA 3BXEA 1RBMA 2PCJA 4IMIB 4OGFA 5FAXA 3R6TA 3PL5A 4PO3X 4RK7A 3RSSA 2HUNA 1RYNA 4J91A 4M0EA 5FJIA 4O02B 4YMIA 3DMTC 2QMOA 4FONA 1OA0A 2B6HA 2GEDA 3WO0A 5E6SB 4HX2A 3ZZNA 5H81A 3AILA 3EAGA 1UZNA 3ITDA 4QDTA 1M34B 4X94A 3G9UA 1RHUA 2NAFA 4HXFB 2DTDA 2QJTA 1AUOA 1V5GA 2DULA 1BQEA 1XZJA 1E8DA 1I24A 1JT9A 3ZHCA 3PRHA 2JI9A 1WXFA 3CLUD 1E5VA 2ZKIA 1ZLYA 3QPWA 2ZROA 4MR9A 1OBFO 1SQ6A 1RZRD 4J3JA 4RH3A 5AI6A 1GT91 1Y33E 4BN5A 1PFYA 1QVWA 2DWQA 2UXBB 3PL1A 4JT9A 4PN7A 1XYYA 2WU1A 1PS8A 3DDUA 1RKVA 3HYNA 1O96A 1K0UA 4RFSA 3IKVA 1E1MA 2ZB8A 3HB4X 3HV2A 1EIWA 3QJ5A 1KBZA 3VR5A 6CHYA 1T6NA 2BAGA 5AJTA 4J7AA 1E1CA 4WCFB 2ZXUA 3RI3A 1J0CA 2DETA 2ID4A 3PRJA 3F4BA 5CVUA 3CZMA 3K15A 1GKUB 4EF5A 1I2AA 1QV7A 1ZGAA 3D7KA 5KJEA 4D82A 2V9ZA 4UW9A 1EXMA 4QYIB 5EIXA 3CSUA 4EHIA 3FYDA 4TX1A 1JWLA 3B3QA 1OLXB 2JVJA 2QW8A 2E6UX 4R6WA 4FTWA 5DX1A 1EXVA 3P9YA 2C58A 1BCSA 2W48A 1LTHR 1DXOA 2Q46A 1CLEA 1VGQA 3M0EA 1QTRA 3BJIC 4DLZA 1AGYA 4WKNA 2XY4A 3T06B 5HUJA 1WB9A 3M5CA 4JBYA 2QNRA 3WIVA 2OUKA 3I30X 4ER0A 3Q9LA 1AKYA 4E5UA 5CDSA 3TLGA 2YV3A 3K16A 2C83A 3TJRA 3SHFA 3CEHA 4RQUA 5T6MA 3GPLA 3R7SA 3WS7A 1MORA 2H11A 3NBAA 2ZRKA 1PZEA 2ZBDA 3MZ0A 2QLJA 2R6FA 1L4YA 1FLDA 3GPIA 3I92A 1R0XA 4J6EA 2UZ0A 5F9HA 4I99A 2ZT6A 1BHQ1 1VXOA 2OAEA 3C74A 2JKYA 3OESA 3QVLA 4KAJA 1W1WA 3ST7A 2V74B 2B2XA 3AFHA 3R74A 3UJ8A 1M2NA 3RD5A 4MV6A 1FUIA 3KFVA 3AETB 3QWFA 3A32A 3LA6A 3FY4A 4PRZA 1RM3A 1YC2A 3RVKA 4ADSG 4WIAA 3M9LA 4CM5A 1L3CA 2W93A 4YUZA 1CQJA 3QVUA 4ZVTA 1JG7A 3AR4A 5A4IS 3O1IC 3F6PA 2QAGA 2V45A 4MR8B 4DPKA 1S2DA 1F17A 1GFIA 3IBSA 4H35A 5DBHX 5J5VA 4LQ4A 1POWA 4TKUB 4PLFA 1D0SA 2VPQA 1WDWB 2RH4A 4QZVA 4H7FA 3PVZA 1TYDE 4HUQB 4LJ6A 3AR9A 2QRMA 4IH9A 1YFJA 3LFTA 3L79A 1YI0A 5AI4A 5G4KA 2DFDA 2H7YA 3ZWDA 3KQSA 5BQ3A 1A9PA 3WHIA 2X5NA 4QGBA 3A4LA 4JITA 2OZLB 2HDWA 1NULA 1P0FA 1WHSA 3IHLA 1GNVA 1Y48E 1XDZA 1ISIA 2GPSA 4PPFA 5CFPA 4A36A 3HJAA 5JIBA 1XTJA 3DMHA 3NOXA 1BDMA 1MVNA 1WKVA 3QFFA 4OHFA 5BVGA 1F7VA 2EF1A 2GKSA 1H8HA 2IHUA 3HZOA 4TV9A 1FW8A 2ZREA 2Z0MA 3ZE7A 2CNNA 2CNWA 2BE9A 3BIJA 1L7MA 4EGAA 4Y9SA 1G7TA 3O9VA 1CK4A 1SVLA 1YQGA 2DFTA 5ABPA 2BGGA 2I3DA 2O1XA 3EUWA 5CDFA 5FWXA 1A72A 3HCEA 3OO1A 3RUIA 2ZJ0A 3URMA 4BO7A 1ZRHA 4LA4A 2B4YA 2GWHA 3PXEA 1GAQA 1OFVA 2R751 3JPYA 1EVKA 4OK5A 2ZE6A 3C7AA 4HG2A 3IOMA 4RD0A 3U7QA 2HSEA 1CQPA 4K6FA 2XZLA 2FEXA 3THOA 4K9NA 5LZ8A 9MHTA 5TJ9A 1ORDA 2GAAA 2VDRB 1S8NA 3SZGA 2JLCA 4CMCA 3X1MA 4AMUA 4JJFA 3WJAA 5KPJA 3VNVA 4CKXA 3FKQA 721PA 1GA1A 4X7RA 5JJLA 2ADFA 4MWZA 2WQ7A 1OYYA 3V8RA 2OHOA 4FZ3A 3I05A 2XRZA 1NZJA 3CKKA 1JFRA 3VR2A 2WSMA 4B3IA 5KYVA 1N6LA 3UMRA 3UHOA 4JP5A 2GD1O 2O0KA 2AR9A 4FMDB 1VSUA 1BJKA 4BVHA 1RXYA 2VS1A 1GFZA 4QECA 4Z8XA 5TQ0B 1I0ZA 1RM0A 1CNEA 1WKCA 2QQ0A 3FYHA 3RIEA 1O9BA 1UT5A 2FPIB 1E9FA 2Z5FA 2PR7A 3C7TA 4TVBA 4MW2A 3IKJA 5FFFA 5CCEA 5IJ9A 3LWNA 2WJZB 3BJRA 1WHTA 1KZGB 4PNZA 4FZVA 5TPWB 5EMMA 2L69A 2QGZA 4UVGA 2VNIA 4RELA 3RUHA 5TS3A 3TFOA 2DBRA 4Q3AA 1YA8A 5DCLA 1BO6A 3DYBA 5AK3A 1QB7A 3GUUA 1FUUA 3RVMA 1N32B 1TYCA 1VIYA 5T41A 4CDGA 3GEGA 6Q21A 4B46A 2J0UA 5MN4A 3DBHB 2A6PA 1FCJA 3OKPA 2BEVB 4Q3BA 3PGA1 4HSEA 4UHEA 4GVLA 2AJ8A 5LB4A 1RKQA 2IU4A 3ZTTA 5I9LA 1ZXBA 2YWGA 3R7NA 4YJ2B 4M9CA 1BKYA 1E62A 1JHOA 1Q2UA 1Z2DA 2XLCA 3PEFA 1L1QA 3ICVA 2VUHB 4R1MA 4A8HA 2ZRFA 1VE9A 1QXSA 2EG9A 3FMPB 3OJCA 4HAZA 4K6OA 2CXRA 2VJCA 3FA2A 3E7PA 1N9KA 1AKNA 1U11A 3R8XA 1IQ0A 1IOLA 1T1IA 4V03A 1J2RA 2CZQA 5K8CA 2YL2A 5KKCA 5EWLB 1PFVA 2H65A 3M6XA 4F9TA 2YQ4A 3AG6A 1YHYA 4HX5A 1E18A 1UQTA 2FMUA 1I2DA 1YRAA 5F73A 1JR4A 1ZQ1A 3ZHXA 4INPA 4PRKA 2QN9A 1NN1A 4XGIA 1QGUA 4IEFB 2P2ZA 1ORRA 1RAEA 2G5PA 3B9PA 4XFJA 3PYXA 5JXWA 5F5LA 4TMWA 3TSAA 5J23A 3FKSD 2I2CA 5CJ2A 1UM9B 4RPCA 5ER6A 1MKYA 2R60A 3ETCA 4OV6B 5IUKC 1IB6A 5JROA 1Q0RA 3GFBA 5DIFA 3BWYA 4HRVA 4JNKA 5AW3A 3VR0A 1NVMB 1TE2A 2BKXA 3F73A 5CNKA 1O5OA 1EWRA 1MTZA 2B4TO 4E70A 3QH4A 1L5OA 4II7A 2WF9A 4ZYTA 1N77A 1U8YA 2X5OA 2G8LA 3D0QA 4KC0A 4QELA 1PT6A 4BECA 1ORIA 2E82A 1SURA 2A78A 5HSGA 1RNLA 2X5XA 2EFHB 3LCCA 2C4HA 3QLUA 4RFVA 5ALOA 5DMXA 3FSRA 3Q6NA 4S1WA 1XX6A 2J33A 2H08A 2SCUA 1LI4A 1Y6ZA 2RHGB 2R7AA 2F7SA 2Z6VA 3MPUA 5AJVB 3SVZA 1Q77A 4JOSA 4CFSA 4NXMB 5D87A 1CQZA 1MEJA 2YQ5A 4PSAA 4M1QA 4OXNA 3CEPB 1MPXA 1DEXA 3QF4B 4YMHA 5M7EA 1A4IA 2IXDA 4MQFA 5HZKA 3AF3A 4DT1A 1B16A 1Y1LA 3SWWA 2YHAA 2ZRDA 3GBVA 3K9LA 3QMMA 1XZMA 3ASYA 3P19A 3ZHBA 5C34B 2DUJA 1OROA 1IBMB 4GI1A 3VNSA 4LDNA 1VCOA 2C9YA 2J5BA 2O3TA 1U1GA 1EI9A 2P35A 2WZBA 3E3MA 1S0UA 4DUPA 5B1YA 1E3JA 3HG7A 4JUCA 2YQZA 2A3NA 4YQYA 2C7GA 4BTEA 5IFKA 5LP6F 5AXCA 3UQYS 2WP8J 1M1YA 3PD7A 1E2PA 2I6GA 1XEWX 4JSYA 5D7BA 5E3HA 4BMYA 3GGGA 2VKQA 4OJNA 1XD8A 1ESZA 1GARA 4F5ZA 3H87A 1Y1QA 3O4HA 3T7RA 1SEPA 3BL8A 5B3LA 1TRKA 1U7DA 1LXCA 2FWMX 2YV1A 5JANA 2EKZA 3V00A 3ZVKA 3KUUA 3IQXA 3IULA 5DK6A 1XFAA 3ZWKA 1P61B 3ZIAA 1V6AA 4O4HA 4UTNA 3ZCSA 1YFLA 1YT5A 5JZMA 3A3YA 4JMPA 521PA 3CR8A 1NP7A 1SUAA 2CFSA 2AZMA 3FWKA 3NM5A 1HDYA 1JR2A 3WLJA 2VATA 5F2NA 4L74A 4B6OA 4KPFC 2ZB4A 3UAXA 2FW9A 3N3BC 4MEJA 5AW4A 3DVAB 4YVFA 4D7AA 4CR8A 3LX8A 3MEQA 3WK8A 1PV2A 5I9NA 5K0JA 2WAAA 1QP7A 1L7QA 2DHQA 2OQIA 2C7VA 4G8BA 2LR0A 4XKJA 3EA5A 1STOA 1B73A 1W5BA 3DZDA 2R8ZA 1T3GA 2RB4A 2C2BA 4PX5A 4O4IB 4W5OA 1V2GA 1VE6A 5C81A 4BB0A 2W43A 1DWPA 2X1LA 3O94A 5DGCA 3TRKA 2OZEA 3AGQA 4DWJA 1RPJA 5ULLA 2BEUA 5JAQA 1AKWA 1S1CA 3OCJA 2H48A 4N76A 2VHJA 2WD7A 3NG1A 3LXRA 2YXDA 3PQ4A 1I0LA 3HADA 4OQ4A 3W90A 3BAFA 2EYUA 3NR2A 4MUAA 2OK8A 4BVLA 2KB0A 2ZAOA 4UFNA 2IDMA 2TMGA 1WMFA 3IJRA 4DLUA 5D1NA 3RHSA 4EJSC 2XCLA 2WYUA 4P31A 1OPRA 4GFDA 3UICA 3ZH9B 3ML1A 2LIVA 5I7AA 3URKA 4BBAA 3GEDA 1JB9A 1YDWA 5BRJA 3L8MA 3AY6A 3H5AA 3PHCA 2QIOA 3HYTA 2QLTA 3RUPA 9ABPA 4QPCA 5ILQA 1D2HA 4H16A 4CG3A 4ZI2A 3SC4A 5G1NA 3BGSA 3OF2A 2QR3A 4RO0A 1JF8A 2XRYA 3QLJA 1L4HA 4H1HA 1G6Q1 3GLGA 2G9VA 1G63A 4BZQA 4RE6A 1EGMB 1XTBA 4YAWA 2P9EA 2OBXA 5FQNA 4UU0A 1R12A 3D43A 3HLYA 3ASZA 3GMTA 4WADA 1DCFA 1Q92A 5TIIA 4K81B 1NZFA 1A82A 1A5ZA 3LX5A 3QI2A 4L7VA 4LNUB 1P72A 1P5RA 3A3PA 5CP8A 3WL5A 2EEPA 4X7PA 3VC2A 3VSEA 3B2QA 4CMGA 2YZGA 1VC2A 4RUKA 2BF4A 5KX5B 2DZDA 2DU8A 3MAGA 4MWBA 4O2RA 4R8VA 4IDDA 1CS0A 4HFRA 1TYBE 5BNZA 2JVIA 2ORYA 3USCS 1A98A 3U3JA 2DERA 1W4CA 1VCMA 3IT1A 3LQ4A 1NUQA 1RPAA 5HP4A 4ZYXA 2VP3A 4JT2A 5B3AA 1KZ7B 1UBMS 1YTUA 3GZTB 1S02A 4HJRA 1N7HA 5B36A 1TQ8A 5CK5A 3UB2A 4EF4A 2O7VA 3AR3A 4TXMA 1KA9H 1XZGA 1F2VA 2REXB 3TLMA 2EWMA 4S1OA 3VDQA 4MYSA 3WLHA 3LOPA 4L85A 4MQ4A 4BZZA 1GVHA 3B6EA 4GG1A 3DULA 1NUAA 1C9MA 1X9HA 2IHZA 3M81A 4PO9A 1OAAA 3V6MA 2X5KO 1MR3F 2VJDA 3H9QA 4B4KA 1E2FA 1YRWA 3CEMA 2I91A 1V35A 5T3UA 3L43A 4KHZA 3FHCB 3FBGA 3M70A 3W8DA 2PLAA 4U5XA