1CJBA

Malarial purine phosphoribosyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
227
structure length
227
Chain Sequence
b'PIPNNPGAGENAFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYDIKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE)
publication title The 2.0 A structure of malarial purine phosphoribosyltransferase in complex with a transition-state analogue inhibitor.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 74
structure length 227
sequence length 227
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1999-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cjbA00
1JLRA 5IPFA 1I0LA 1TC2A 3LPNA 1GRVA 1O5OA 4RAOA 1P4AA 1I0IA 4RV4A 4X45A 4LYGA 3H83A 3GEPA 1DQPA 1WD5A 1STOA 4RANA 4PAWA 3GGJA 1UPUA 1CJBA 4RQBA 1A4XA 1HMPA 1MZVA 3O7MA 1LH0A 1Y0BA 1XZNA 4RHXA 1G9SA 2AEEA 3ACBA 4P81A 1GPH1 3M3HA 1VDMA 2VFAA 3LRTA 1BZYA 3MBIA 3OZGA 4KN6A 4P82A 4M0UA 1TC1A 1JLSA 4RHYA 1G2PA 1P18A 2H07A 4QYIB 4IJQA 5BRNA 2WNSA 3G6WA 1A3CA 5EUCA 4JLSA 1A97A 4RACA 3ACCA 4P3KA 1R3UA 3GGCA 1BD4A 2DY0A 5BQPA 3DMPA 4P83A 5BQOA 1A95A 3KB8A 5E38A 1QB7A 1UFRA 3ACDA 4QRIA 1P17A 4RABA 5ESWA 4LYYA 1YFZA 4FYMA 3OZFA 1W30A 1XTTA 2H06A 1QK4A 4ZFNA 1ECFA 2JBHA 1ZN7A 4LZOA 1I14A 5KAMA 1QK3A 1QCCA 4P86A 1IBSA 4M0KA 5JSQA 1HGXA 1I13A 4RADA 1V9SA 1XZ8A 4QYIA 1G9TA 4RHUA 5ESXA 1QK5A 1VCHA 1ZN8A 4Z1OA 4RHTA 1OROA 1Z7GA 3OHPA 1U9YA 1ECGA 2JKYA 1DKUA 1I5EA 1G2QA 1A96A 1D6NA 1BD3A 4OHCA 5JV5A 2C4KA 2HCRA 2PRYA 5K51A 1XTUA 2JKZA 1DQNA 1OREA 4JITA 1O57A 1U9ZA 4TWBA 2PS1A 1P19A 1NULA 4LZNA 1PZMA 2EHJA 2IGBA 1J7JA 3DEZA 2GEBA 4S2UA 1UPFA 4F8EA 2YZKA 1QCDA 5HKLA 1ZN9A 4RAQA 4LZAA 3QW4B 1DBRA 1QB8A 2H08A 2JI4A 4RQAA 1ECJA 5BSKA 3MJDA 4WMLA 3S5JA 1L1RA 3EFHA 1FSGA 2PRZA 4P80A 2XBUA 4P84A 2E55A 2FXVA 1L1QA 4M0PA 5HIAA 1ECCA 1ECBA 3HVUA 4MB6A 4PFQA 1A98A 1AO0A 2P1ZA 1DKRA 3NAGA 5IAOA 5KAPA 3N2LA 1NONA 1XTVA 3DAHA 4WN3A 1OPRA 1VSTA 4X44A
chains in the Genus database with same CATH superfamily
2FN9A 5BW6B 2HO4A 3ZYCA 5CFNA 2GLXA 1A8IA 2PANA 4LTMA 1IWOA 1LLCA 2JATA 2NZ2A 3GW8A 4FEGA 1W9MA 4CGZA 1COZA 3QXXA 1ZW1A 4XD2A 1GGMA 2OAEA 3BXEA 3F3KA 3MILA 5A6SA 1UPUA 4C6HA 4GGMX 2EGGA 1W5FA 2YIMA 1G5TA 1PT8A 1XZLA 2AJCA 4NDNE 5LL6P 2O0KA 4GOJA 1N4AA 2IODA 3R7WA 6GPBA 5KU1A 3U7JA 3LM8A 1TZKA 1GGEA 2O50A 4KXMA 3ELBA 3RBAA 3T1VA 3WYBA 1AU9A 1U2DA 4PY2A 4AQYB 5I8WA 1TEVA 4NICA 5FUQA 1MTZA 3H5TA 2Q4RA 3BXPA 4JLSA 2FZ5A 2X0IA 2H5EA 3QM1A 5ARBA 4E4TA 2B21A 2ZJ0A 2VDPB 2H1HA 3QTBA 4LRTB 3N8DA 1WHSA 1JXOA 2CDRA 3JR7A 4P08A 3O7WA 1T3ZA 4NZZA 4LXQA 4M8KA 4X84A 1D1SA 1JR3A 4QUHA 3I2KA 3SPXA 2KX7A 3P20A 4FEYA 4QX6A 3B1JA 4DTIA 2HCFA 4PRLA 4MYHA 3MINA 4KN5A 1J5XA 1TFUA 1AUOA 1SKAA 3ZKWA 4QVKA 4GXRA 3JVDA 4YFYA 3DD5A 3MF4A 4W5WA 4JJIA 5L7YA 1L0BA 1CIJA 1M3SA 1Q7EA 3FVVA 3GT4A 3TZ6A 4UPEA 2VS1A 1U3CA 2WG0A 4H4EA 4I81A 1ADYA 5CR9A 3RVOA 5M3BA 5F2OA 4X1KB 3NUGA 1ELOA 1HNZB 3HB1A 2M6LA 5JTUA 1CUWA 3DZDA 5DU2A 3VMMA 3K0CA 4UBLA 3U7QB 3K5HA 3EIXA 2HH9A 5D6NA 4K9OA 1EHCA 1H2HA 1V9LA 3FKSD 2V7QA 2WZQA 1A2KC 1WCV1 5PGMA 3OM8A 4XUDA 3OCYA 1T3TA 1JHPA 2WHEA 2GS9A 1VGVA 2YJ5A 1YZLA 5AVJA 3SKYA 2ID7A 3SY8A 3CX4A 2PVSA 2OV6A 2FA9A 2YY7A 1H4QA 4M83A 4L3VA 5KIAA 5CFMA 4LTDA 2DHQA 2ATVA 1X1BA 2HCRA 4MDYA 4PCLA 5COAA 4DV4B 3IVAA 4AC9A 3SMQA 4QYSA 5INTA 3C0KA 3BULA 2IZOA 2YWCA 3KELA 1Y5NA 2FRVA 4ER0A 1ZVKA 5C52B 4PSCA 3RARA 1CUHA 1QYIA 4GOMD 5EUBA 2RJ3A 3FIUA 1F60A 4O5AA 4R83A 1CNEA 1IDN1 1OYWA 1P0IA 4OIMA 2PUCA 2G25A 1YE5A 3ZWAA 1BMFD 1O9BA 1P2GA 3H13A 3OO0A 2WKRA 2I78A 4LSZA 4P9NA 4CM9A 3PRYA 2RB5A 1ABFA 2JGAA 4KVFA 3HL4A 2E4YA 4YPOA 4YONB 4K3VA 3DLTA 2QTRA 2JS7A 1X7YB 3AETA 3FRJA 5AK5A 5ALFA 5TQJA 4AMBA 4QKQA 4J76A 1DJOA 2WTEA 3S28A 1S01A 3VV2A 5B55A 2W2NA 4TTSA 3SU8A 5HRCA 3B1YA 2OM2A 4M9XA 3BJEA 3UMVA 1ABBA 1G8JA 2X2OA 3D7LA 1ZCJA 4MS3A 4Y1RA 3H1AA 1JFRA 3FUTA 2OOKA 4J9VA 2P0AA 4LE1A 1E4OA 3RKSA 5I7OA 2QZ9A 1KJ9A 2DJIA 2HMTA 3CA8A 2H52A 4UNNA 5IW8A 4XH9B 3ZIDA 3UBTA 5LFAA 4MDEA 2VA9A 2ZCJA 2G9ZA 1HKHA 1CEXA 5C3MA 2RGBA 3LYHA 3EXAA 4FMPA 2I62A 2PX8A 2WY2D 3Q4GA 3H83A 1VHQA 2G6TA 3MWJA 2RBEA 1Q1QA 1BRTA 3IX7A 4RKRA 1LDBA 2AQIA 4MVJF 3LKVA 4U2KA 3CF2A 1CDZA 5G4KB 4RK6A 4X8OA 4YP1A 1KR5A 3SBDA 2GZDA 2COKA 1YU6A 4JP8A 4GVLA 2ZRGA 4M0DA 1NV8A 4OUKX 2Y2UA 3HA3A 3FX2A 3BXHA 2CW5A 4IKEA 4UAUA 2B1IA 3LY8A 2VYFA 4FSDA 2FZEA 2OD2A 5L4LA 2DUUA 4MVJP 2XMCA 5LR6A 3ITNA 4KZPA 3RTDA 4L72A 5C0OE 1MB3A 2P9JA 2VK8A 3BAFA 3DHVA 1FFXB 4LXYA 1B42A 1ISGA 2WUGA 4LWOA 4RWZA 1RI2A 3EVDA 5J58A 1MFZA 4RZUA 4U7JA 1UFQA 3T7EA 5CCDA 2QM8A 1LPAB 3E7DA 4XVCA 1V2HE 4LF8B 2G72A 1Q7GA 5TDHA 3K5PA 1E2QA 1VHJA 5CLJA 2BBSA 4HMOA 4TT3A 1F2DA 4PZLA 4GMFA 4F60A 2OHVA 4KQXA 1PUIA 4RIFA 4ZFNA 3L41A 3FPJA 1YBAA 2JD0A 4KIWA 4RHEA 4P5DA 4QPNA 1OLSA 3CB2A 3WKCA 3I2YX 2B92A 3DZHA 1CUVA 2PR7A 2IHYA 4DAEA 1YVDA 2CJWA 2CLSA 1ZXXA 1FRVA 1DAGA 1WSWA 4M54A 1WL8A 2H1FA 1KR2A 4JL5A 3V8QA 3SIRA 3VR2D 1H5NA 5B12A 1FNCA 2BZGA 2NNLD 2VOJA 4FBLA 3LY7A 5D1NA 1RZVA 3F6BX 1EWRA 2OVBA 5HG0A 1ZK1A 3X44A 1EEXB 2J59A 2FSGA 3BA1A 4X00A 4MDHA 2HMWA 2HMYB 2XAAA 2REQB 3S8MA 3QKUA 3QWHA 3O4VA 3L7MA 3SQDA 4RZHA 1UJ6A 4Q15A 5CITA 5AXBA 3MJSA 1KJNA 2AK2A 1I30A 1PIWA 2NT4A 4GG1A 1WZCA 4NYMQ 3LLMA 1Q92A 4YJHA 4ZYZA 3HI4A 1L4BA 4YRRA 5TARA 1H2YA 3NGLA 1X80B 1L9XA 5BW8A 2OFWA 4YRZA 4WCDA 5AVUA 2V3CC 5KYVA 1MG0A 2I6SA 3S5JA 1JFLA 1Q12A 3ZV3A 1BS2A 4CFSA 3O6VA 2IXTA 3IGFA 4ZOLA 4IY1A 4ZT6A 3GCXA 4PX2A 3RVBA 1U0OC 3BYZA 4B4KA 3K2BA 1M66A 3E23A 4DV0B 3WJAA 3B6KA 5HGJA 8LDHA 5KC9A 4ZO9A 2CMDA 2RCNA 3IE1A 1KBZA 3T7DA 4TTJA 1NW9B 3EHEA 5EP3A 1T2NA 4CDGA 1WMEA 3ICEA 1T6NA 2P8JA 2VHEA 421PA 4G0YA 2PKEA 2CMHA 3C3DA 4NCHA 1ZUWA 3MWDA 2C9YA 3T9EA 2OZKA 1NMQA 3JD3A 3VPCA 3D8SA 4J3JA 2Z6VA 1KZ6A 1DIBA 2QL5A 3MJVA 4P3PA 4RMIA 5EPOA 5I3CA 1Q0ZA 1T4DA 2EBWA 3GJ0A 2IYUA 4Q66C 1JG3A 2QL6A 1YDHA 1VLQA 3DTVD 3LGXA 3OI7A 3BWVA 2IEGA 2NO6A 4RNDB 2XZTA 2JIPA 2EZ9A 2GKGA 4LQLA 4Y2HA 4EYSA 2UUPA 3I4CA 1UMDA 3CRRA 1QDUA 4JL8A 1VDMA 3BX1A 4PAOA 1O94A 5E2BA 3EPLA 2PJRA 4D26A 2XCQA 5JC1A 2PCJA 3S29A 4DDTA 1RMYA 4CG3A 2ONZA 5DHQA 3FPSA 3QE3A 1Y6FA 2YHUA 4QYIB 2EFJA 2HSWA 2WD7B 3N70A 4P33A 3HGQA 2V6MA 4RK1A 2HPAA 1THMA 2HJWA 3ZR4B 1XVLA 1TZMA 3RADC 2ORVA 2ID9A 2XAUA 3Q10A 3DLCA 4GH5A 2IJGX 3NWEA 3QMVA 3R9WA 4OXIA 4IUYA 2HAEA 2JGFA 5DISB 4O25A 4E14A 2XEXA 4CM6A 4G85A 1YZFA 4X1IB 3I9JA 2HJRA 4LVNA 5KVQA 4LHZA 4EPTA 2QN6A 3OY2A 4MVWA 2NO4A 1WF6A 3BA6A 1D8AA 2JFUA 1FTWA 4KQCA 1LNZA 2PA0A 3ZX4A 2V6GA 2VK4A 1DHRA 1BVUA 3CX3A 3JQ6A 3LQYA 3R3JA 1DJMA 1E3WB 4WVLA 4JDPA 4C0JA 1PL0A 4L02A 5DN6A 1UFKA 4MJLA 2DY1A 3QI7A 7MHTA 2XQFA 4PHGA 3OPQA 4JLWA 5JPIA 4F93B 1BFKA 5B6PA 3TLGB 3VDMA 4DR7B 4WLUA 1XCPA 3WYNA 3W1VA 4ZC1A 1Z4JA 4G1UC 1M0SA 2OCAA 3A36A 4EY5A 5IM4F 1SQFA 1LDEA 1G3QA 2QU8A 2N46A 1N7GA 4AMUA 1M6VA 2GCOA 2I4IA 3BM5A 4MWTA 3LUBA 2Q7OE 1GFZA 4GUDA 1UAYA 1YZGA 2WABA 1W35A 3PQ8A 1ZHFA 5CK4A 3R0ZA 2YASA 4NK5A 3JASA 4RVGA 3VPSA 2P7HA 1LK7A 4EPVA 3RVPA 3HM2A 2I2FA 4IH4A 4RE6A 5GVSA 5MN6A 1VI5A 4C76A 2HRDA 3JARB 3OWOA 3ZBUA 1BXGB 1J8MF 3DMGA 2VJCA 3SZMA 1QHHA 1UPTA 3DVAA 3GDWA 5CM9C 3ZDDA 1QHGA 1JIXA 2ERXA 5F9FA 1AK1A 2NIPA 1YUBA 3LFUA 1A88A 4PV7A 3UNXA 3BGDA 3VHQA 1E1MA 3WYFA 1P5ZB 1J90A 3TPFA 4ZI7B 3K1AB 5IJ0A 1L1RA 3PNMA 4N54A 1P5FA 2BPOA 3KHUA 3MRXA 4X6UA 4ENQA 2ECPA 2V5AA 2GERA 5CYOA 1W19A 2Z9CA 3RYFB 4EHLA 1R8QA 3OCWA 4AZ3A 3MWEB 2VHJA 1P81A 2G6BA 2IU4A 3DCJA 3MBOA 1ONBA 5FULA 4QOEA 3ZE1B 1IQUA 4EO7A 2BRUA 1NTRA 2GWRA 4C03A 3NETA 2CJPA 3QY9A 1SCUB 4EITA 1LZKA 1PEDA 1IOLA 3GF4A 3K8YA 1P7CA 3EG9B 1XT6A 3DMYA 4G0OA 4ZRMA 4AZSA 3BMCA 3NVMB 4F84A 5IJWA 1LPSA 5KKNB 5EIXA 4NU8X 4W5OA 2OCPA 2FN7A 2BM9A 3WWPA 4CM7A 3QFHA 3Q3CA 1GU7A 1NJSA 4CTMA 1ID1A 1YJ5A 4PAWA 4C87A 4Q9DA 5D01A 2BFFB 3AU8A 2ANCA 3F2IA 3W7VA 2PMKA 2DLNA 4C0LA 1PRYA 4N8EA 4P4GA 4ZOCA 3A9WA 2C3UA 1I4LD 4PPFA 1KDPA 4QUEA 1CC1S 1YI1A 2DWOA 1L2TA 4FLFA 1RLIA 4CLDA 5EHIA 2R8PA 4V0QA 1IE3A 2C59A 2WWVD 5CXUA 4OXRA 2VQ3A 3I58A 3KVRA 4L5YA 2I9PA 4P36A 4ZCLA 2PAAA 4O4HB 4R69A 3LECA 1U9CA 3OZUA 3CZQA 3E9YA 4HPJB 4CLRA 5JAIA 2F62A 1Y1TA 1NUUA 4AP9A 1R8XA 4EJFA 2QMQA 1VBMA 1KXJA 3A1NA 1J2EA 2P4SA 3FOCA 1S4QA 4YYEA 3OOSA 1H1LA 5DPMA 4BLUA 1ANKA 3ZDCA 4DTCA 1XROA 3CLKA 3KJEA 3S5UA 4NQRA 4R3UC 2LRHA 5A4IS 3TSWA 3AG5A 3KB8A 1UP4A 1DKMA 2XOKD 1WKBA 2JLBA 4QTTB 2E6UX 3FWZA 3H18A 2VKQA 2X23A 3TLBA 3BREA 1SBNE 3PQEA 4FYMA 5CM2Z 1YFJA 2PXAA 4H3VA 3AVPA 4Q9LA 1PV4A 4H16A 3GHYA 5KKCA 5JFTA 4NYJQ 1Z13A 1P9LA 2V0NA 2BZSA 4AZ0A 1WHTB 4ACAA 4EA6A 3AVVA 4RU1A 2W6QA 5HOQA 4DEXA 8ABPA 2CF6A 2P3QA 3F9RA 3WBJA 3C1UA 1P44A 1T2FA 1TD1A 4RIGA 3PT9A 2QJFA 4QGAA 2O7SA 3GAFA 4GYKA 4YN3A 3GFSA 3IILA 3V34A 2QW0X 3UXEA 4DREA 1OOEA 2SICE 3GEDA 5U1PA 4NEHB 3EGDA 3PA6A 2X8AA 3RS3A 2WIFA 4X85A 3N3BC 1NL3A 4QU5A 2NMVA 1DBVO 3QXHA 3FDJA 3A2LA 1P31A 2XYGA 2OPHA 1UEIA 2NU6A 1NVEA 1L7MA 2DR3A 2QVLA 3SS7X 4DQXA 5IASA 1XPOA 3R6DA 4PTLA 3TYXA 7REQB 4Q7KA 3AY0A 2CLHB 1YDGA 3D54D 3X43A 2R4QA 4DILA 5HJ2A 1ETUA 4CR8A 2I3DA 4XWKA 4EG6A 1W1IA 1JLHA 2AG8A 3T0IA 1IU9A 2JA2A 4N7MA 4DCSA 3O4FA 4GYJA 4WBNA 3AFGA 1H65A 3ANSA 4N4AA 3I2FA 4PAGA 4RD6A 1QZ3A 5DLPA 5BMVA 4U2DA 4KUEA 2BM8A 1X7WB 2HA0A 1JKJA 4WKNA 4RYLA 4JYZA 3LHDA 4C20A 5FL7D 4GKBA 1HLDA 4UTVA 1BEZA 3IUBA 4KW7A 3U4AA 4Z54A 3A1CA 4MYSA 3WLTA 1XMPA 2FJPA 1JIVA 4Q4DA 2C9OA 3WSWA 1NDUA 3G2HA 3RREA 4CI0B 2PX0A 5AFSA 6NULA 4J03A 2ZRNA 1GG9A 3ME5A 2O0LA 4V0OA 5BWCA 1T25A 5K3EA 1O89A 2BMVA 3P2KA 3HZRA 4TVOA 1KQPA 3W1EA 1CFZA 3NI2A 4JBGA 1G1MA 2W4MA 3F47A 3ZI4A 5ADVA 4URFA 1KRHA 1ZI8A 2HF7A 3EVEA 3KKKA 2QW8A 5B3JA 1VBKA 1P3DA 3RUEA 3WL8A 1R0LA 1F2VA 1RQPA 3U3DA 1CJTC 2CWDA 3C85A 3F5FA 3R4VA 2HNBA 4KMSA 3M3DA 3STWA 3PI6A 2NO7A 2P1DA 5CDFE 4E5SA 1RJWA 1FTYA 4M0UA 1ZZEA 5EJIA 3S1AB 3G0DA 4UTOA 5JMOA 3AP2A 4PIVA 4BMZA 4EMSA 4QU0A 3SXUB 4OGLA 2XB2A 3ROXA 1PG0A 1VJ5A 3FROA 3AIIA 1GTVA 1NP3A 1Z2PX 3IJPA 4ILKA 2PLFA 1M1YA 1GNTA 3DJYA 4RMNA 5DM0A 4C7XA 3DZCA 1KSGA 2IYEA 5ABPA 3SYRA 4GZLA 3CNLA 5AKIA 1H9AA 1IIBA 3QX7A 2B25A 1ZINA 1G3IA 1E9CA 1X7XA 3KPWA 2CNKA 3GNTA 3IURA 3R8XA 2W42A 5CIWA 4QNMA 5FWYA 1J21A 3JWJA 1US8A 1AZSC 2PSDA 3OIGA 1F1BA 1ZH6A 3AF1A 2O2XA 4UVIA 2AS0A 4ZVSA 3A2KA 1A8UA 1FDIA 1Q74A 5AK6A 3DXZA 3T1TA 1TUBB 1W46A 1CUDA 2RMKA 5F5XA 3GFGA 3QV2A 5E9QA 2YFQA 1DRUA 3DHEA 3Q11A 3FDFA 4G4SO 2P4UA 1WEHA 4PNZA 4QJBA 2IUYA 3KPJA 5DI3A 3VBCA 1DI0A 3T3OA 4JI5B 3E9NA 1T15A 5KNBH 6ADHA 1LS1A 2PBRA 2WT9A 4IJVA 1T5HX 2CE7A 1Z4QA 3AOEA 3NH6A 4AYWA 5JSQA 4OM7A 3K0SA 1QWOA 1QIJA 1JQLB 2IELA 4O1HA 4JROA 4Z9YA 4UU7A 2XA9A 3RS0A 2GR9A 1Z07A 3OU7A 3HB0A 4R7TA 3AEYA 2SCUB 3SQNA 1TNDA 3PPWA 2ZSIA 3OIWA 2RHCA 5MGNA 3IT2A 1PK9A 2JIDA 4Z7QB 2RK6A 2BUCA 1F8FA 2YXEA 3LY9A 1JEJA 1H3NA 2H5LA 1VKHA 1N7IA 1ZM2A 2SECE 3MN1A 5TX7A 3DYVA 4FS3A 4CL2A 2PBZA 3U6KA 5AIBA 4C21A 5KWIA 5KZMB 3RWOA 1Z25A 3CW2A 4RA9A 2QTVB 3FWYA 2IXDA 2BDTA 5H8WA 2OBLA 4S12A 1E1CA 3N39C 4OB7A 5FI1B 4FJ2A 4I1SA 4C7VA 2WLTA 3W3AA 4DUPA 2AOXA 3JTEA 4HAZA 4HZGA 4KXNA 1HYGA 2O2IA 4WCFB 1N0WA 5CD9A 3FPHA 1G38A 3L8FA 4E2YA 1V5EA 3H11B 5IKPA 4MUXA 4HH3C 5T4HA 4N5IX 2FK8A 3OZEA 5LDGA 1MQSA 4G4GA 3N8GA 3CRNA 3VR5A 3ND8A 1ZMRA 2QTCA 4ZEVA 5E6RA 3HDJA 3OP4A 2VJKA 4UU8A 5JSKA 1XTVA 4EHHA 5FEUA 4PQFA 5AICA 1QYVA 3ZWVA 3L05A 1T8YA 4F3CA 1GNRA 5TJ9A 2AJ8A 3G88A 3PLRA 1PR1A 1T4CB 3TIXB 3OTOB 3EA0A 2M6KA 3TRJA 3VOAA 1KQOA 1I2AA 4Q3KA 2I7VA 4N0DA 4WXPA 1U4SA 3BWXA 3U49A 2LGJA 4MO9A 2DECA 1XSEA 2WZDA 1IHOA 2WYIA 5H81A 2BYTA 1N78A 3ZHTA 4N03A 3EWAA 2QB5A 4W9NC 3BWBA 3JWIA 1SVSA 4MMZB 5FOWA 2XDQB 3MTJA 3HU1A 4HY3A 3QWFA 3OLQA 4WY5A 1IVNA 4I2NA 2F00A 2JLVA 2C5BA 4P82A 2L69A 1N2IA 1DWQA 4I4TA 1UBTS 4PLYA 4P2GA 4XRRA 2HGZA 1X0VA 2PSFA 4TMFA 4O4IA 4AMYA 2CYAA 3H9GA 3R5SA 3L6RA 4C4YA 1DC7A 1POWA 3BG5A 1X1CA 4I50F 5FBLB 2FQ1A 4YBZA 3R3VA 2IIVA 4DDMA 4Q34A 4DMLA 1KY2A 3V32A 4Z4CA 1QP4A 2YYZA 3EDCA 4OSOA 3MRVA 2OCKA 3AFNA 4ZEMA 3Q3VA 1NMSA 3B1KA 2GCIA 1YFLA 4RFSB 4O3MA 2H3HA 1EFLA 3R76A 1U0TA 3T34A 2X22A 3ENNA 1KI1A 5TQVA 4ES6A 2CD9A 1KI8A 2QUBA 1YRAA 1L7QA 1HFKA 3OE7A 5ICMA 1EVQA 3HUEA 4CQJA 2SBTA 2YL2A 1BN7A 4JZKA 4EFNA 3SCZA 1OWLA 5JRZA 4R9UC 4JI8B 2MDTA 3Q6IA 5FOVA 1PE0A 4GNRA 1OWMA 2DH5A 2UKDA 3EVFA 1WXHA 2PJDA 2HHCA 3KQWA 1EM6A 1Z5PA 1HT0A 1O95D 1VIAA 3OAAD 4FP9A 3DFUA 3DD1A 2B5WA 3PQFA 4QXOA 2B83A 4HNHA 2BZ1A 5BN3B 3P2MA 3OEWA 1Q0LA 3QMMA 2NSHA 1G2OA 3DDZX 3VMFA 1CB7A 2YDXA 3WL3A 5LJIA 3JPYA 4HGNA 4R3NA 4WGFA 4C0AC 1V26A 4HJXA 2CHGA 3PSHA 1F1JA 2PXXA 3K4PA 4CIAA 5K4HA 3BHIA 3WVNA 3W5CA 3KQQA 1EG7A 2PKYX 3DKIA 1TRKA 2SNIE 3ED1A 4JIGA 1XD2B 2YYSA 3P32A 1JYEA 1X8JA 3CRZA 1F14A 4HGQA 5KQLA 5A3JA 1IK4A 4KSYA 4YXWA 3TCNA 2GEKA 4QHSA 3ZXUB 1T2AA 3FTEA 3R0QA 4E6EA 4RTJA 4IIUA 1OQAA 3ANNA 5MF6A 4H6VA 1LPBB 1KEEA 5ICSA 1G291 2EEPA 4OHRA 4UBMA 1N9GA 3OCJA 2W2VA 1NZDA 2RH8A 2HRCA 2QTGA 5KDDA 1XHFA 4GL4A 3BFKA 3F4BA 4P0QB 4INAA 5HKKA 4RTNA 3AVYA 4HNVA 5EAIA 4YRJA 1CZUA 1G64A 2DTXA 2CB0A 5C53B 4MLCA 3C74A 3O21A 3R6WA 4HG2A 4MITA 3CUWA 1PNTA 4KPUB 4QA9A 1WDWB 5H83A 4DMKA 4I1VA 4P7GA 1NW3A 1GKUB 1A2QA 2HQOA 2F3TA 2YIDA 4W99A 1I5RA 2V3WA 1WQ3A 4OQYA 2L19A 3TNFA 4I1UA 2IUTA 1A9ZA 2WVHA 2ZE6A 4EKDA 1ADGA 1W4ZA 2EGUA 2ZI3A 1B8UA 3GLUA 5LVAA 5DEIA 1QC5A 1Z28A 1HDEA 1BCRA 2OD7A 1A71A 3QBJA 2X5OA 5LBTA 4OOFA 5CCXA 2F3QA 1XJWA 1DRVA 1GZSA 3RBVA 4E13A 5CD1A 1NMZA 4RJIA 4B6PA 4TMYA 4N0QA 2D74A 2VXBA 3GVIA 4KPGA 1INLA 1FSZA 2ONCA 4RNCA 4PYLA 1QH8B 4PR3A 3K2QA 3NUQA 4PCVA 2XUIA 4ALNA 3VH1A 2HDWA 4D4KA 1GLNA 2OCDA 3Q0IA 3GLIA 5B6JA 1E1NA 4X92A 1QR6A 3EZ9A 1K8ZB 4PGGA 2NO5A 2PMCA 3BWCA 3M3HA 2EFGA 3EH1A 1LJLA 3MPOA 3WK4A 2GXAA 1IUPA 1C4OA 2XECA 1GQFA 4H60A 2WEKA 2ZWVA 4MUYA 3RJTA 2PLNA 2AMFA 2CNLA 5JXIA 3QPUA 3GUVA 3RAJA 2X8BA 1MIHA 3P9YA 4K46A 1NRJB 4LOLA 5BN4B 3WLMA 5JSHA 2WSMA 4HYEA 4F5YA 1NM5A 1P1KA 3M0EA 2VF4X 4EHIA 1Y4UA 2GN6A 1Z63A 4LW8A 4EVSA 3Q9SA 4G0MA 4KYUA 1Q15A 1P62B 5FJJA 1PI3A 2ZULA 4LVCA 4YT8A 2VZLA 2HU5A 1Z39A 2Q9BA 2YTZA 3AI1A 4UUOA 4X8LA 2NZXA 5DCLA 1GZ3A 5FI0B 3SC2A 2QSUA 4BV9A 1JSXA 3SICE 5J23A 3B7WA 4CEIB 4H59A 1XEAA 5A9SA 5C7IO 3HCFA 1T6BY 1V1MA 2BTQA 3H5NA 4WNAA 1MB4A 1J5EB 5L7TA 4GC9A 1OIVA 5T3YA 3RC3A 2YWEA 4BNYA 3QPWA 4DCMA 2NQTA 1A9XB 1V95A 3AR7A 2IZ1A 4MVJI 4PONA 4D4GA 4DQ0A 1WEKA 5U9CA 4ZVUA 5B1YA 1D2MA 1DPGA 4KFSA 1B3RA 3SX4A 5EE3A 5MN4A 1NXSA 1K9SA 3V97A 4CZ2A 4N3CA 3W5DA 1S3FA 1QK5A 4P93A 1ZYUA 4ZCRA 1CUZA 5E0KB 1C0LA 1ECPA 1MT0A 2GOYA 2PMFA 4DRXB 1KI3A 1Z7GA 3Q9LA 2XQGA 4KFTA 3DZIA 5IBPA 4BNVA 5T57A 2YJ3A 4HLQB 3OCVA 4E7OA 5C32A 1TUEA 2Q3FA 3X1MA 3NFRA 3VI4B 1UBFA 1JKXA 3HYLA 3RU7A 4NCNA 1E77A 2QEQA 2MSCB 3NCHA 3UTDA 1RRVA 4JLJA 3V4SA 3ZDYB 2V0GA 4U6NA 2WINI 3A6HA 4UU0A 4Y2SA 3K9GA 3E7WA 4HEA6 3D1LA 6REQA 1P74A 4FYIA 4UAGA 4N0PA 1ZITA 4RM2A 4BU1A 4XQEA 4OK5A 2VPTA 1S3GA 5HKLA 2DSTA 1JQDA 2V4UA 1H2FA 1URPA 1N2JA 5K3SA 5NLLA 4DC0A 3FVRA 4NPAA 1ML3A 2F1KA 2X15A 5EGNA 3RHTA 3FOAA 4OLHA 3NBKA 5ALWA 4HWRA 4NDZA 3UF0A 2C7BA 1RAIA 2R4UA 2RHRA 3A1FA 1PX0A 1V3UA 1WBBA 2BFBA 2FFHA 2VSOA 2JARA 2PUGA 4BO6A 4L2IB 1VI2A 2C7GA 3R5JA 4KAXA 5BSGA 3V4LA 3JD0A 4M1TA 5F1PA 3V1NA 2XKKA 3MTGA 3A9UA 3PU6A 5THXA 5LQCA 4GP6A 4BUJA 4CTKA 1UJBA 5HJ5A 3DL4A 4HS9A 9LDBA 1LD3A 1Q84A 4RIIA 5TQ0A 2G4CA 3KXPA 3KQOA 1BG6A 2D13A 5JROA 1OTXA 1Y8CA 4MINA 4HXGA 4UMDA 4F04A 3UMYA 3B9BA 2X58A 2Z8ZA 1V4NA 5AI5A 5K3OA 1P72A 4KQKA 3GEPA 4Q82A 2RJOA 5H0IA 1U9IC 3BJMA 4GMKA 1K7XB 3E7FA 4LFCB 1JSZA 5BSVA 3ADCA 5J4VA 1ZSNA 3PUYA 3SFTA 1BU8A 1OJ7A 1GCGA 4BNWA 2B82A 4HVAA 3FTDA 3L1IA 3RS7A 1U7ZA 4YUVA 4R1SA 3I0NA 2GARA 3ZW7A 4AN0A 5ADWA 1LLFA 3ELYA 2Q3HA 3KIPA 1FLAA 3ZGZA 1D2NA 3KU1A 1U3DA 2HM7A 2VWQA 1W36B 1OX4B 4MS1A 3EQ6A 2ZUEA 2FQYA 4GKJB 2O19A 1L5GB 3VM6A 3ZXXA 3W9YA 4B3BA 2HRQA 3CURA 2VHUA 4O2AF 2UYGA 4BO9A 3FMPB 1NKVA 1RI1A 1YCDA 1E89A 1Z2NX 3AR8A 3NTUA 3VH3A 2CL6X 1TYCA 1T4BA 1Q14A 5AKYA 5BQ3A 3N07A 3DMPA 2QM0A 5M2QA 3ETGA 1JF8A 2CDAA 2Q3BA 3FPCA 4BQPA 3B6JA 1UM9A 1KYXA 1VYUA 4GYYA 2IP4A 4PZUA 4E03A 2Z6AA 1R4NB 2WHQA 4TRNA 3VVCA 3KBOA 1K0FA 2BHLA 2GBLC 4EJSA 4IOJA 3P9ZA 1F0KA 1GIAA 2FSUA 2JGLA 4GMHA 1YRBA 1GGVA 3JWHA 4F96A 4OU5A 3AYXB 2AKAB 1CLEA 2P77A 2VJMA 5H3LA 3L8MA 4XYLA 2IEBA 2Q1WA 5L8VA 1XVTA 3A3OA 4G5RA 4TUYF 4OI0A 2YRFA 1SUBA 3OCCA 4AP6A 1KVTA 2NUAA 4V0MA 3N0RA 5EQFA 1KE2A 3K6JA 1XZ8A 3MGGA 3T3PB 2ZIAA 1R9NA 1QF7A 2QUKA 1FQKA 1WV1A 3IPLA 3QNMA 3V8EA 4FLMA 2EL7A 1L5QA 4MLZA 3AVXA 3OBIA 1CIPA 1Q0UA 1A5ZA 4FQ8A 3ZOZA 4V1CA 1E3SA 2Y99A 4PINA 4EAQA 4FTWA 1CJMA 1YR6A 2WTBA 2BY4A 3NJRA 1NJGA 4V3BA 1GUFA 4M1SA 3THOA 4EKGA 4WK6A 4YDHB 4YJFB 5KNDH 4BX0A 4W9RA 1EFKA 4BB5A 4MW1A 1AGNA 3LYAA 1U4NA 2I99A 3LBAA 4QT0A 1E4EA 4XD7D 4JA2A 3FXAA 1Y98A 1E20A 1OFVA 3G2LA 5K8UA 2O06A 5CPFA 2RG1A 4N3GA 4ER5A 2AOUB 1RYYA 4OH7A 3A1SA 2EJUA 3Q2KA 1JDTA 1QH9A 3OIVA 1E7WA 3UM9A 3KQHA 4F7WA 4LJ5A 1BA3A 4V02A 2Z83A 3RQIA 4XWAA 4A26A 2OILA 2Y93A 4MYTA 2R60A 5F5NA 3FTNA 5LC1A 3MSCA 4MCJA 1GTRA 1S4MA 1M34A 5MFZA 4TQGA 4MGYR 5LYJA 2PNJA 1KEKA 3E22A 2X0EA 4KN8A 1UIRA 5JZVA 1AGRA 4D3FA 3RGGA 5IWAB 3A7EA 3AERB 4HH1A 3S1LA 3BRWA 4H7KA 4QHYA 3O3OB 2I1QA 3TTTA 1F8UA 2D1YA 3GNQA 3JS5A 3NTRA 4ZALA 1RJGA 5HCNA 4QGSA 1W88B 3A8TA 5LWQA 3EVNA 3U7FB 3OOHA 1K06A 1ZGAA 4ARBA 2ABWA 2Q4OA 4KIFA 2YS6A 2FN8A 1WMBA 3BXFA 4MR9A 3I62A 4TXHA 2O8FA 3QV1A 4U7GA 5KMGA 2WD9A 5A04A 1W4RA 5EP1A 4AURA 1FFEA 3WAKA 2R0QC 1AN9A 4DLBA 3QWBA 3HWX1 5DI9A 4TYPA 3B78A 5CCEA 1T1RA 2YV5A 4LISA 3EIWA 2J5RA 4CLOB 1WDLA 2UUAB 2B2CA 2G08A 1L8XA 4ZI7F 3OPYI 1IY0A 4Q48A 2OUKA 4FD3A 4TL6A 4ADSG 4ZAGA 1CEEA 2RHJA 3KD3A 5CVTA 1RLOA 1CETA 2M6RA 4MW4A 2HDHA 3BTVA 1RKBA 2IHTA 1P18A 2XXJA 3UV7A 1HY3A 5C7YA 1COWA 3GZ4A 2EFYA 1LBEA 1PW5A 1RQ7A 3AEUB 3DDWA 4Q02A 5CXSA 2J0QA 2H92A 2ORYA 2ZVPX 3P27A 1ZKMA 2D2XA 2H1CA 2ZCUA 4M1YA 4NEGA 5D51S 1G5QA 4RH0A 1TA9A 3KHSA 3R5HA 2XKJE 2OP0A 4KDRA 4NOLA 3C5VA 5AW7A 2WWHA 3N8KA 1I9CA 1IB0A 2GBFA 2R8XA 4F0JA 3LW8A 5J2TB 1RR6A 2AFHE 1VE3A 2A9RA 1AKRA 2W2KB 4IBOA 4AJ4A 2C57A 2Q6LA 5ALLA 4RH3A 3ZHSA 2FR8A 4WKOA 1CT9A 1PDWA 3GA7A 1SKMA 1KO1A 2L18A 1E9FA 2Q1YA 2W22A 3E5RA 4JX9A 1GCOA 1B0PA 3DEYX 4I55B 3PDWA 2H17A 1WXFA 2JBHA 4IYJA 3WKEA 4XRGA 4N8SA 2HIAA 3ZHOA 2D2FA 5FBKA 2CNWA 1ZRMA 1EBBA 2JFPA 4J9UE 4WFIA 4O4HF 4XJTA 4QAQA 1EQUA 4J4HA 1KQFA 2OM6A 2V6JA 3WJ2A 4OYLA 3ABQB 2ZSDA 3H1EA 2GDJA 1XB2A 3W8NA 4YUZA 2CLFB 2MOKA 4CLXA 1EVJA 3OT4A 3RF6A 2H29A 4OBEA 4XX0B 4EW3A 2Y8EA 5G1NA 3U7QA 3BBLA 3ORQA 1A96A 3F6YA 4GIBA 3WA6A 1QZZA 4F21A 1VRWA 3MOGA 3B38A 3MGCA 3W9BA 1QVVA 1SG6A 1DEXA 1DIHA 2P6UA 2HCTA 4PXSA 1AA6A 3CVYA 1DOHA 1J4AA 1YBHA 1U9ZA 3GC6A 3N7UA 3KQUA 1MH9A 4R2XA 2C00A 2JFOA 4GPEA 5A4FS 2ZTUA 2WB2A 3RWBA 3H5IA 1QNFA 1PV1A 4LK3A 1SUFA 4CIVA 2GGSA 4IDNA 2BFEB 3EDOA 1N77A 4G8DA 4D9KA 1BXKA 4OQLA 3TQSA 5KOIA 1XTSA 1XP5A 4FFDA 1P6QA 4FNAA 2X5NA 3FZGA 5AW4A 4U39A 5JU6A 1E6LA 2RH5A 4YLEA 1K5DA 4ZVLA 1JTEA 1KORA 1PQ4A 3VOTA 4DCNA 4ED9A 5B58C 1QYCA 3L2OB 1VE7A 4E15A 2Z4SA 1KA9H 2RHOA 5CDTA 5LLDA 1H2XA 5U4QA 1P29A 2V7PA 5GIOE 1HFEL 2BCJQ 1EAMA 3O1JC 4P22A 5CURA 2HHHB 4DWJA 2DULA 4EW2A 3HQ4O 2P2NA 3GVXA 3SM3A 3SXPA 3TD6A 1SVIA 2G7MC 3UTCA 3EISA 3HRIA 2Q3JA 3K9CA 3LV8A 2BI4A 1PS0A 4RORA 3LCJA 1SOAA 4ER3A 3CSSA 3VO9A 3D7RA 1SXHA 1KZ4A 1NXOA 3FR7A 4BN5A 3O8OB 2CFIA 2O8EB 1C7IA 4XVHA 1QTQA 2UYCA 3PJFA 4IIYA 1L7XA 1VKZA 3IJEB 1OF1A 1UPCA 3RS9A 3F96A 1U3UA 5HIIA 1UKVY 4LYFA 1WDKA 1F51E 1Z4OA 2JJ8A 3PYLA 4UCFA 1EDEA 3LY5A 3HO6A 3TE6A 4B75A 2QPLA 5G4KA 4A3SA 2VF5X 4E1BA 1CR6A 1AQUA 1DXOA 1E1KA 2ZR7A 3KVNA 4TTPA 3B12A 4B81A 1KMMA 4XQCA 1YMUA 3JRWA 2BE9A 4AT1A 1EI9A 3FF4A 3NOXA 5IYZA 5LQNA 3HVRA 4UMVA 1EP2B 4DAOA 4YQFA 2JFWA 1DRJA 1P5RA 4KQ6A 1YKGA 2XDWA 3BVPA 1W47A 3A4MA 2OZLB 3N05A 1X8KA 3PFNA 1PJ4A 3Q15C 1GPNA 2KM1A 2EYQA 3PE3A 2FUNB 3M4ZA 5DFAA 2BEWA 2ZG6A 4AS3A 3TEFA 2WF9A 1FFXA 1B0UA 1GVNB 4UD6A 5FDFA 1EGHA 3G7UA 1KDZA 4TZTA 1EKXA 2QRMA 4N9WA 2JPDA 1WDMA 3KKOA 3CH5A 3H9JA 1MV8A 3IE0A 3D4LA 2N9UA 5EZYF 4EI8A 4GHWA 1UJ2A 5EKXA 2Z2JA 2BZ0A 2Y68A 3A70A 3II6X 1XG5A 3O84A 4E32A 1GDTA 1YQWA 1IBSA 1AF7A 3GLSA 1SELA 3D6FA 3GWZA 1K27A 3FWNA 3G8AA 4PZ0A 4WHMA 2DFNA 3NHBA 4Q1EA 1DOAA 2MSWA 2YRXA 1GN9A 2ZRIA 3L6CA 4J7CA 5A7HA 4AJJA 5L3SA 4M49A 2C2HA 4FT4A 4BXOB 2ZKIA 4FOSA 1IY9A 2FPUA 5DRYA 4DSUA 1AV7A 2C9DA 4OQDA 1CF2O 4DLNA 2WTUA 4JWTA 2XYHA 2PQ0A 2QROA 2J0EA 3VH4A 3F6PA 2TRSB 1WXDA 4PG4A 2X3FA 2VCHA 3UMGA 3K05A 5K01A 1LCIA 1BA2A 3K0AB 3MD9A 1T91A 1IPFA 4ZGWA 4R2MA 4PE5B 5EQTA 1V4BA 4NLLA 3P9IA 3C5CA 5GAJA 1HDXA 3CVVA 4HEHA 4D9GA 1DINA 3H2JA 2KWIA 5C34B 1Y1QA 3L4BA 3N8NA 3FWKA 1HORA 2L82A 4RV9A 3ZZTA 5I7RA 5FOTA 4JA0A 1XU7A 4EGFA 1TTQB 3IAM1 1W85A 3WGKA 3EZ2A 2EIXA 1Y3BE 4HNQA 4QPPA 5G41A 2B1RA 3SEQA 4HUJA 3G9ZA 1U7HA 2B98A 2CVQA 3ILVA 2GZSA 1AH2A 2FXVA 1X80A 2WE7A 2HO5A 4YJ2B 5HHTA 4YCNA 2N42A 3W2EA 4BASA 4FKMA 1ECBA 1YS1X 1FVHA 1V8ZA 3H5RA 4U6SA 1JQEA 1TO1E 6Q21A 1MABA 3C43A 3UW3A 1G60A 5AM2A 3UJDA 4TRJA 4BRUA 4BYMA 5CA1B 1EUQA 2OO7A 5BNTA 4RGVA 2IUEA 1YIAA 2DZDA 5IKMA 2WF5A 5EZ6B 3G82C 1JLRA 1Z45A 4KUHA 4PLVA 4US0R 1JE0A 4QJIA 1UC4B 1W52X 2PZJA 2QR5A 3HYSA 4Y7CA 4EEKA 1IXYA 1V6SA 2B5VA 3T1NA 2BCEA 1CQWA 2IIPA 3QKWA 3CZ9A 4MLDA 4MV5A 2W6IA 5KVSA 3O1HB 3ZLJA 1N6PA 5CLFA 2VSNA 4I1PA 1IHPA 2ZSFA 3SJBA 1FFCA 3X1ZA 3SSAA 1JDUA 2A9VA 2D1RA 3H5LA 4KXYA 2UYOA 1MEEA 3TVYA 4BFWA 2OT3B 1FRFS 1ZWLA 4S1WA 4Y18A 3EVTA 1PUJA 5IBQA 3O2SB 1YZ3A 3D3KA 3KD2A 3OZVA 1MOPA 4WOPA 3B5JA 2W2TA 3MT9A 1EVZA 2R79A 4RHYA 3A1TA 2PKQP 4WERA 3ROGA 4DIBA 4FB4A 4QT4A 3A1WA 1YZVA 5H9VA 3A4YA 3E18A 1ZIOA 3FGOA 3M6UA 1QPGA 3BE5A 4KKXB 3IDSA 4L3OA 3NOQA 1EXDA 1MVNA 2FEMA 2WD7A 1LF5A 1RWKA 2PX4A 3NBFA 4F3KA 4AJNA 2C3MA 5GJBA 5CFOA 4Q3EA 4J91A 4LXGA 5LA6F 2J0UB 2COEA 3FMOB 3OPVA 1CU1A 3FYUA 1CRPA 4G36A 1CRZA 1XXLA 1G8HA 2OHIA 1UFRA 1KVQA 1O95C 1IY2A 2VT3A 1FVXA 4PF1A 2RK3A 3FG9A 1ZH2A 2HF2A 4M9RA 4QDKA 5FV4A 1VM6A 5BWMA 2JCSA 4CIDA 4LVOA 5FO0A 4BNLA 1GV0A 1FXWA 1UADA 3D6HA 2QLLA 4JR0A 5FBZA 1RZRD 1SC9A 4A8TA 2G70A 2IW1A 3NHAA 1K7SN 5LQUA 1LRLA 4BFSA 1SMKA 1VG8A 2ON6A 3U81A 3VTFA 3ESYA 4B3IA 5AW2A 4ERXA 5DHUA 2ZUTA 2VNIA 2WM3A 1M8PA 4FYVA 2PWPA 2J5BA 4I36A 4C43A 4OJKA 1TT5B 3I83A 2WF7A 3FFAA 4Z4FA 1P1FA 4OI2A 1TU4A 1YK0A 4BFXA 4F4IA 5CFPA 3PR2B 4Q93A 5LNK6 1DKUA 4J0QA 2XVYA 3H5WA 3GIWA 4KO2S 3DVSX 1E5VA 3LKZA 4DUGA 3I9V1 2XXBA 3G8DA 3KJZA 3TSYA 2Q2NA 2BFMA 1DVRA 3DMTA 2JAHA 4JXJA 3O73A 2NPFA 1BE1A 1Q11A 3G0OA 4M0FA 4WFQA 3LE8A 5TMEA 1SVKA 5BT8A 1VJRA 2Q28A 1JWBB 4X1OA 1WP4A 3ABIA 1U1EA 4EYQA 4C22A 4M87A 3TI9A 4PX9A 4CMGA 3DNMA 5EERA 4NZMA 2V7BA 3VR0A 1K6XA 5AVQA 1BXGA 2VDJA 2ZZNA 3V8MA 3S2IA 3VJRA 1R8SA 2FAXA 4NMMA 4JEMA 3O9ZA 5T7BA 5DDIP 2B8EA 1GNQA 3THYB 2IYLD 4INOA 1J0DA 3DR3A 2IH2A 3RYIB 1CERA 1NV9A 1PZHA 2X41A 3ZY6A 2J6HA 3DMHA 5JD3A 4B46A 2D8MA 3QVUA 3T3MB 1TM5E 4O8ZA 1YR8A 4E94A 2NTNA 3TQTA 1JYSA 1C50A 4HB2A 4PC6A 4FE3A 1MC1A 1QG6A 2I33A 5EXXA 4PU0A 2DU8A 4NMXB 1PJCA 3QH4A 2FCAA 3WLSA 3ZHRA 2VTBB 4UTZA 3SVTA 3RG2A 4LXXA 1SCUA 1RHRA 3HSYA 1YL5A 4OQPA 3VXKA 1EE9A 1B15A 4FNMA 3CEMA 3EG9A 1Y6QA 3M1IA 4IILA 2Q0SA 1A4UA 4A0SA 5LXTA 4IDGA 3DEHA 3PGA1 4Q37A 3ESRA 1SVUA 3JV7A 4ZVOA 3RT9A 1GDHA 4JLBA 2A0XA 3DHNA 3FNRA 3QFSA 3EEYA 5E3JA 3WSVA 1CHDA 2BFFA 2CUKA 2JIQA 2ODWA 4R3WA 5AH0A 2V4MA 1UJNA 1N1EA 4BNUA 2PYIA 3IMFA 2FFBA 4ZRDA 3G1WA 2IQIA 2JFFA 4G5HA 1XZEA 2FSHA 1XVUA 3I6IA 4FKBA 5LD2B 4II3A 2LDXA 1ZO8A 2A14A 3CN7A 4MCIA 4Y9UA 5CVJA 3MGKA 2IPMA 2R1ZA 4ISCA 3R0XA 2AFVA 2O0JA 2BW0A 3M9WA 4A4DA 1NBWB 4G07A 4H1WA 2O48X 1ESCA 2ZRCA 3SJAA 3MLAA 1BDMA 3LDGA 4YT4A 1Q20A 5JTTA 1E3MA 5E38A 1AUQA 1T9BA 4DANA 3UG7A 5FPQA 4DLZA 1ACLA 1WE2A 3NBUA 3HCAA 5ALRA 4J2HA 2JLCA 3A4LA 3QGMA 4QG3A 4IVPA 3GEEA 5JIBA 1U65A 1JE1A 2NVWA 3FJOA 4E5PA 1AIPA 5CDYA 2R5FA 5EFOA 4FJ0A 3ZTYA 4TV9A 3PC7A 1MIOB 3B82A 1TM7E 4X7MA 2CBXA 3QSGA 5CGQB 1BWSA 2HBRA 3ZQ4A 4BVGA 5CB8A 2WJIA 3B52X 3K09C 4NENB 3BORA 1WHTA 3LBIA 3L8CA 4JVLA 5D5QA 3X2EA 3OMWA 2ESRA 4JL6A 5HDBB 5J5CA 2IV2X 4EVRA 4YMIA 1HM5A 2C94A 4D4HA 1MRSA 2P0YA 2VK2A 3QHPA 1JHXA 4ABTA 1OAOA 4RY9A 3JQEA 2C4VA 1VB5A 3HB7A 4H9GA 2AGVA 5CYPA 4AFNA 5JLJA 3NATA 4OHMA 4X93A 1M8JA 3KWMA 3N75A 2IYSA 2VDWB 3TRIA 3QLEA 1KQNA 2R8EA 3N6RA 4JITA 4YHHB 2CL7X 3BB3A 3G0IA 2GMWA 3WYEA 2FMXA 5HF8A 4NBWA 1SG0A 2HSJA 2HF8A 5HFJA 2GJ9A 3Q85A 2I65A 2Q9UA 3OX4A 2CFCA 4MVJM 2JIZD 1A7JA 1NJ6A 4NBRA 2O8BA 2BKXA 2GUWA 1DKQA 3BH0A 5CNKA 5JD6A 1OHHD 3HA7A 3IIIA 1KIFA 3CV3A 1RMQA 4GMXA 2WFMA 3RT1A 1JDBB 4KO1S 4Y9SA 3TUJC 1K8QA 3V48A 5F98A 1KAEA 2MHCA 3KEGA 1QIGA 1QF9A 2F43B 2GFIA 2VSFA 1S3SA 2YXPX 1BX3A 4MCHA 2RGUA 1ECCA 1UBUS 3DS8A 5CT4A 3SS8A 4BV2A 3T5PA 2R44A 1E9SA 4EHJA 3FPAA 4CKBB 4EMBA 4ZZ2A 4X3CA 3UWSA 1E2EA 2TMYA 2PTGA 4ZAWA 5BNZA 1U3TA 1HYEA 2YJZA 2NZWA 1X7WA 1KJIA 4B6QA 4IFBA 5IZCC 2YJGA 4IGKA 1NMEA 3FPGA 5IM4A 2WVGA 1H0KA 2Q4DA 1QQAA 4U0JA 1XMQB 3DL2A 4WK0B 4CR6A 4AJ2A 3LRPA 2NUBA 1NE7A 4KITB 4S05A 1YJQA 1JHDA 5EHQA 5FOQA 1DBWA 4EVQA 3C5HA 4ZMBA 1E3TA 1J97A 1LBSA 2K6GA 3PF8A 4GM0A 3ZCVA 1KS2A 1GD1O 2ZITA 3H5VA 4ZKEA 1P1RA 2ORIA 2WIBA 2X4IA 4M21A 1E2HA 3PQ3A 3UKJA 3JQBA 4PHTA 4F9FA 4FHZA 5K0CA 1XCGB 2M6SA 5LWHA 3WIOA 1ZGBA 4FCVA 1NQUA 2PL1A 4AWBA 4C0XA 1WNTA 1P4GA 5BV2P 1DSSG 3HG7A 1RHKA 2A0KA 4FR5A 2UVQA 5HR5A 1E2LA 1KO7A 4RZIA 4BO2A 1YJAA 5AXDA 3NVKI 1EVYA 1Q3HA 2PUHA 1M2JA 2Q6VA 3BCHA 3C70A 4OGWA 4RELA 4DC9A 4MK4A 5DYWA 2PT6A 2X9GA 4B3MB 3AHGA 5HFAA 3SXUA 4FCCA 1F0NA 4G24A 5I8PA 4GRDA 3M33A 1ADJA 3CR3C 4A8JA 1EFVA 2FUG6 3EZ7A 4EKNB 1GGNA 1FX0A 3B1WA 3B6MA 4B5LA 4ER7A 2JJYA 2CDBA 4HXEB 3H0EA 2CVOA 4JQSA 3AO0B 4YLYA 1ZRNA 1DKOA 4MAFA 2VRBA 4B2PA 4B4UA 3ADDA 3EG5A 5TGDA 1K63A 1LSOA 3OQHA 1L4NA 1DMSA 1HEIA 2CCJA 3GELA 4IMJB 3MRTA 1RCFA 1SIOA 2NVUB 4DV6B 3L04A 3R7LA 1XA3A 1XTKA 1P2TA 4XYBA 4H3SA 3WBBA 3EDQA 3KYCA 1MT3A 1XDWA 4QL3A 4AL4A 3JVIA 3LTNC 2HADA 2BI8A 3IXLA 3OKFA 3RVMA 3LUJA 3W7AA 5IMSA 1FP1D 4XVUA 3G0BA 3QKSA 1V1RB 2VK1A 2QA5A 2QVZX 4PZYA 4MQ6A 1ZJWA 3SLRA 2IHKA 4ND6A 1OI7A 1QIDA 4ETWA 1E0DA 1ENPA 1VLMA 1HL7A 3DPUA 3DXYA 1VHWA 3HDTA 3LCMA 4Q1CA 1G4UR 3PITA 4FOLA 4Q3LA 3KHKA 3PTAA 2IP1A 3TB6A 1HA3A 1FDRA 1XZJA 3CKYA 3TW4A 3JRNA 4JC0A 4S1PA 3DO8A 2OCBA 3N2YA 2PS0A 4PSVA 4BV8A 3B8EA 1KYWA 2KLHA 3L1KA 5BR1A 5JNSA 2QJWA 3CR8A 3FJYA 4NR0A 1BGXT 2FQQA 2LNDA 1W4LA 1E8DA 1LI4A 3NXKA 4AO8A 4OXKA 2HWXA 2QRPA 3K9FC 1U90A 2AJDA 4NE7A 5AHXA 2DUMA 1TUIA 2I6UA 4RKFA 3VO2A 1QCDA 4J7AA 1ODLA 3WGOA 3QFTA 3QVLA 4EG7A 4Y30A 1NQOA 1WV0A 3L8YA 5HEKA 4Q7MB 3R0VA 3WWCA 4F97A 1A8SA 1RJ9B 2QTVA 3DMNA 4WLEA 2ANBA 3F2VA 3SSNA 3UB3A 3KE9A 3RR2A 1NVFA 1EZ4A 1ODTC 1AS3A 3BS4A 4TLAA 1JL3A 1T0JB 3F6SA 3WTCA 1RHJA 2WKSA 2PZEA 3S0JA 3I73A 3QFRA 1CJKC 4DSOA 2ALJA 4WCFA 1YWGO 5DWQA 5JPCA 2H7CA 4EYGA 4EI7A 3H11A 2FEXA 2QLJA 4ME6A 1JQAA 3EA4A 1SC1A 3DNPA 1U8EA 4F2HA 3WWDA 2MSNA 3PUVA 5K5EA 2AVNA 1VSTA 1JWAB 1Q7RA 3OT5A 1A9TA 3IE2A 3DWIA 2RBGA 3WL6A 1NX9A 2NV0A 1FP6A 2C1EA 1T43A 3LX8A 4GQAA 4U63A 5DBGA 3OCZA 2ICAA 1V11A 3R74A 2ZQ5A 4CBVA 5ELLA 2E0IA 1WSDA 3AKDA 1Y7IA 1T4CA 3ZEIA 4ESOA 4TMZA 1XVAA 2QJOA 4YQZA 2DFVA 2IWHA 4PWZA 5J3JA 3AF0A 1YS7A 1TF7A 2O20A 2D59A 4RJKA 1BROA 1L8QA 5G2OA 5BV1A 1RWWA 4RK4A 3FDXA 1FW6A 1OB2A 4L8YA 4O08A 2V55B 3G7NA 3GT7A 3P7MA 1U94A 3GFTA 2I2XB 3QEMB 1Z5GA 5GP1A 5IP5A 4DBVO 5JMWA 3VR6A 2E48A 3LS2A 1E2JA 1U8TA 1N6LA 5FUXA 1ZAYA 4CDMA 3E3AA 3KBBA 4WZBA 5D3KA 5D3MB 3IP9A 1Z0IA 2QN1A 2VJOA 4B6SA 4DIOA 4J7UA 1OH7A 2FVXA 2HEIA 5EWLA 4OLBA 4ALJA 4Z53A 7MDHA 1KERA 2ACKA 5CJJA 5BQPA 3KKNA 2QI9F 2H4HA 2P40A 3D31A 4CQNA 2J85A 3AVQA 3IUPA 2IQ5A 1OTHA 4F8JA 1HYBA 3V9PA 1JVBA 1PYOA 3UYKA 1KZ9A 2ECFA 4IG4A 3FY4A 4BO0A 4LYYA 3RFFA 3R41A 4ZDIA 2ZYTX 4K40A 4LY6A 4RFSA 3AUFA 2XA2A 1XL0A 1XD9A 4QM6A 3A4TA 1E2IA 5AW6A 3JQGB 3FBGA 4D3XA 3REOA 1GQQA 3WISA 5JASA 3R3UA 1DLJA 1G7SA 3ZVNA 2VC2B 4G1CA 2F1RA 2WA1A 2H31A 1WCIB 4PX5A 4B8ZA 4CKCA 1N57A 1XLWA 2I5PO 2WICA 3NS7A 4MWEA 5KOYA 3G8CA 1OIWA 4Q00A 3EDMA 1KSFX 4BP9A 3T3DA 4UPDA 1JI3A 2GTIA 3MWGA 4JIMA 3M5DA 4EO4A 4UFOA 3WZ2A 1J7KA 1JHQA 3HJHA 3GFRA 1O4VA 1N32B 1D7AA 1U7PA 5J2TF 3E53A 3DEJA 3TINA 1Z8FA 5BN3A 2QWXA 4AVYA 4BNXA 2I6TA 1ZCBA 2JIMA 3RRJA 1LQUA 3DYIA 2PFGA 4GBJA 2J3QA 1WB5A 1KH3A 4RTMA 4TWBA 1O77A 1EDOA 4G9GA 3LQ1A 4EB0A 3H19A 1N1GA 1UBKS 5JZBA 1P7WA 1JG7A 4DMUB 3H97A 5LQSA 2H2AA 3MIZA 1JJBA 3T6KA 3QYAA 3T5DA 4X61A 2FKAA 2A0YA 2ZBPA 1E1RD 4EG0A 1X42A 2XCSB 1SU8A 3W6OA 1ONOA 2UXDB 1VLZA 3D7SA 4PO9A 3F1LA 1GZ5A 1TM4E 4BJ5A 1U11A 3DDHA 3G5LA 4QEDA 3OZIA 3LYUA 3KOMA 4WLFA 1C8KA 2CLIB 4GPIB 5H70A 3RV4A 3COJA 3A04A 2HB6A 1HPLA 4XIJA 2NU9B 2WSLA 2QX8A 2WYWA 3N2ZB 3F5QA 4GR4A 3WGJA 4JYCA 3PRKE 4KPUA 3JVUA 4A2CA 1VCNA 4BFCA 2BM0A 4YRCA 3WWYA 4XA8A 5EWMA 4XLLA 4B7ZA 4H7JA 1U3VA 3EEQA 5B4VA 1OPRA 5B7GA 4EQZA 2E5LB 5E1OA 1GAWA 3G8YA 5H4HA 5TRTA 3VPXA 4EGQA 1Z73A 5JJBA 2IIBA 5CFLA 5BQXA 2BDEA 1SQ5A 2HU8A 1X1RA 4CVNA 1Y4AE 3ET5A 1GPUA 3TF5A 4GPZA 3G13A 4G09A 2VKTA 1L7EA 1G5RA 3LL7A 5C8ZA 3RAFC 1C9NA 3BSSA 4YC7A 5JFOA 2C78A 1OW3B 1JZSA 2OGTA 3A9RA 2A3NA 4RQBA 3HJUA 4TGLA 5AVVA 5IT4A 1PR0A 4OTZA 1FFGA 1QFXA 2J87A 4OYYA 1QH8A 2UZ4A 2ZT7A 1EVKA 3M6FA 3MJCA 5JI2E 2YC4C 1QZTA 2ZXUA 4GI5A 5F7XA 5C4GB 4KNWA 2GO7A 5I7EA 4NH4A 4XARA 1UZMA 3E0QA 3LIIA 3HJNA 4JN6B 4S1VA 3HN7A 4WJKB 4WZAE 4WZAB 1WUKS 4Y2VA 3AEQB 2FPMA 2XSZD 2I4MA 5ALGA 4LJ7A 1FP4B 1XLVA 3VSAA 1GSIA 3ASZA 1E9EA 3FUWA 1CR0A 3PBKA 3GPCA 3MPUA 5B30A 5KNCH 1F3LA 2NUPB 2M98A 4EG3A 1UBLS 3OF3A 2GLTA 4P3NA 4UM5A 1EHIA 1DX6A 5DWDA 4A6XA 5DXJA 3TOZA 3TI7A 4F5ZA 3TZLA 5BN4A 4CETA 5EQJB 4Y98A 1WKCA 2Q0QA 3IPRA 1OMOA 4CMEC 2G17A 2H2WA 3CXRA 5EY5B 4ZVKA 1UUFA 4HNAA 4JJ4A 3EULA 4RABA 1GUZA 4YP5A 2AW5A 1SXJD 2XH8A 4KRYA 4QYXA 1GG2A 2YBDA 4D4LA 4QQKA 4AWXA 1O6FA 1XTZA 4Q7LA 1KAHA 3TIGA 3TSCA 4NJMB 3OFKA 3HLYA 4PSKA 4CTOA 2O5CA 3CPSA 4F5DA 3TS1A 1I14A 2BBWA 4HDOB 4HNUA 3O8RA 2P2YA 1KKMA 3D0QA 2QKYA 5HOEA 1JKIA 3DEAA 3VKWA 1VXOA 4MWZA 4PLZA 4OHZA 3OZRA 1ZVMA 3ID6C 3D2BA 4HX9A 3D2AA 5CX4A 1L6IA 2H11A 1T36A 2G83A 2AI1A 3H84A 3Q5GA 2XCTB 1JDJA 3G2JA 4OMUA 4MARA 1A9XA 1HG1A 3I04A 2IY9A 2PKXA 3UZUA 2IS4A 4UBKA 1Z7EA 1P61B 3Q40A 3ELUA 4V39A 4HX5A 1FUEA 3ND6A 1G8YA 3H1TA 1P1HA 4DRXA 2X0RA 3KYDA 3OZDA 3B2EA 4JXZA 4FJ1A 1ZD9A 2C0CA 2DFLA 2HTEA 3BAZA 2XUHA 4BO5A 3KSAC 4AJOA 4IJ6A 4D3SA 3UJ3X 4U9IS 3UXHA 3UV6A 2YWXA 2XKAA 2BR5A 4WKBA 3PD1A 3V2UA 3VJKA 5MN5A 4EW6A 1Z0FA 1KP2A 1YULA 1E98A 3Q7RA 4BVEA 4OGFA 2FDCA 3QBTA 3MFYA 1OIXA 5IS2A 1QHSA 2WAOA 1SQGA 1SD2A 3B2NA 4LCEA 3QNUA 3WQSB 2OMKA 1ZK3A 1SCBA 3H9EO 3JR3A 4AX8A 4E33A 4QBTA 3DT9A 4QUGA 1E3IA 3GDFA 3KG2A 5L3QB 4DIFA 4IDEA 1CQJB 4J0JA 1AGPA 4AUKA 3TNDA 2QBYB 4R84A 1I6KA 4ZAZA 2O2HA 3BWDD 4UAJA 5CT5A 2V7GA 2BLLA 2JF0A 3I5AA 1H8HA 1L1EA 2GZHA 4HPWA 2Z2YA 4X6XA 3FH0A 3D8HA 1FDVA 3S7TA 4OFBA 4L2IA 5HUJA 4RVUA 4GL2A 1AZWA 1JLLA 1E2GA 3PC8C 3UJ6A 2K2QB 3JVVA 4LX8A 1TC2A 1MX3A 1P77A 1CJUC 3PDHA 3D7MA 1XDBA 1AURA 3BICA 2QMEA 3KK0A 1GT91 2V59A 4HFRA 1ZAKA 5EHZA 2C2XA 1QKIA 3ZGNA 1FZQA 3H16A 1VOTA 3PXDA 4PS1A 2B6NA 2BMFA 1Z5OA 3PFCA 3NYIA 3SBOA 4F85A 3WC4A 1ZJZA 1TCCA 5ALSA 4GLJA 3VC3A 2Q5EA 3MBIA 2GPAA 4DR4B 2YY5A 1QQTA 4LQ4A 5FKJA 2Z2KA 1J0EA 3IQHX 4EB6B 3IUMA 1CUXA 2GN8A 3D5QA 1U2TA 4AJ1A 1GTJ1 2ZRMA 1QIEA 5C8YF 5DGCA 2RH4A 1L8AA 2ACVA 4JOSA 4XYGA 3WYAA 5K6RA 3GG2A 1J56A 4C0QC 2OCXA 4Q18A 4QO7A 4S35A 1Y9ZA 1YB4A 2ZTVA 2VO1A 2E5FA 1XCMA 4IQFA 5EXEA 5JARA 1L5VA 1V37A 4NVRA 3TFQA 2XUJA 3R9XA 2O0MA 2PG3A 1D2RA 5CB4B 1MC4A 1A5AB 2PPVA 2W71A 3P9QA 3WP0A 3S44A 1RJDA 1BFDA 2IY7A 3ROTA 4M2LA 1I7NA 4TVBA 5DCWA 3ZJ4A 5GTDA 4ZQEA 4ZVNA 4GMDA 4Y9TA 5C7OO 1I3NA 4FIDA 4XSGA 4IIJB 2BSXA 4RF2A 3H3FA 1EFRA 3IQDB 1W75A 2GM9A 3OX1A 1J25A 4D3YA 5JBNA 1DUVG 5KTYA 5L7WA 3CQ9A 1MOQA 2GXUA 3G2PA 1AMUA 2E87A 5EESA 2G28A 1WCWA 5CLLA 2BSAA 4B6EA 1JPVA 4RH1A 4P86A 3I6QA 4JYPA 2H57A 5B6IA 2ZYGA 3OX2A 4MRSA 1S3IA 3C6YA 5FPKA 2G4LA 4WQMA 1L5HB 2JH3A 4MWOA 4E5UA 2ZB2A 3Q41A 3R6GA 1CUIA 4I1IA 1R66A 5HILA 5ESXA 5KX5A 1MAHA 1M6EX 1FYXA 2AR9A 2CZGA 1IXKA 2H8KA 3OTHA 5A5EA 4EWLA 5C37A 3DYBA 2DVMA 1M9NA 2NP6A 2BDUA 1TVMA 3AM3A 4URWR 3VYWA 1VLVA 4D0LB 1CS0A 2Q5OA 3RD5A 3BB4A 3WGZA 4X9XA 2ZIUB 4UM8B 4AY5A 3HB9A 1YA6A 3PR3A 4LF5B 3GQBB 2PSEA 2R00C 2QZJA 2WU1A 3C97A 3NM5A 4CM3A 3ROMA 4W8GA 5IF3A 1YQTA 3GP8A 4CKEB 4F9TA 4BLQA 1C4KA 4HTFA 2IFTA 1CRLA 2VYQA 2B7LA 3L8GA 3G0HA 1HE4A 3SZOA 1CY4A 2NG1A 5DYIA 5I01A 3HBLA 1QTNA 3IP6A 3PHLA 2UZ1A 2VN8A 4KU4A 1IK6A 4QE3A 3TKAA 5KTKA 3ER8A 4HQRA 2DFKB 5EJEA 3ZNNA 3NHWA 4EA8A 1IG3A 4DCVA 5LZ7A 2H9IA 2H08A 3IMKA 3MCTA 1TMGE 4RQAA 3IUEA 4BLSA 221PA 2AOUA 1DEHA 1XZFA 4M1EA 5C2JB 5IVPA 3KT8A 2I6XA 2AX3A 3DTNA 1PNOA 2AF4C 4GBGA 1RAGA 1Z6ZA 5BNFA 4MQ4A 1VXRA 3RKUA 1T8UA 1O96A 3S7ZA 4E2WA 2AZXA 4ND4A 1QS0B 5JHGB 4TWIA 1MF7A 1RM4A 3ZCRA 2FWIA 2IHJA 3HVUA 1SZPA 1X87A 2O6HA 3L8HA 4BNHA 5AP9A 4NNPA 5IAOA 1VBNA 2ZUBA 5EOVA 4D96A 3IBTA 3N58A 3EH2A 1HDYA 2IIQA 3WB9A 5I7HA 4LSWA 4JAVC 5LOVA 3I9FA 5LZ2A 5AK4A 4ARIA 1V8FA 4F2GA 1Z5WA 3UPDA 1NQXA 3OQOA 5KQRA 5CBPB 2FMTA 3B2QA 2DCMA 3EQZA 1YZYA 2W2XA 3UMSA 1O5OA 2OORC 3O4GA 4XWOA 1W88A 3ZHVA 4BFVA 2B3DA 1UXKA 4OFZA 2DPMA 4WK2B 1XRQA 2QZZA 1Z2DA 4I7EA 2B2NA 3BJRA 3FSGD 4RENA 2WJVA 3SYTA 4LGYA 1XR3A 3LPAA 2F7SA 4IS2A 3TL3A 4MQEB 5DNCA 4GMGA 1RABA 2C07A 4MV7A 5H5JA 1ZL2A 2RGRA 2DERA 1PJ3A 2ZYDA 4HDSB 3V4OA 3HA5A 2JDID 5F77A 4OI1A 4C9BA 2H1OA 5I51A 3B48A 1SH7A 2QX4A 3FFWA 1I80A 3MCUA 1U7TA 1IHXA 4D3ZA 4QTXA 1ZOIA 3PRHA 1H93A 4IOLA 1DO2A 1KPIA 4FGWA 4BX3A 1PJSA 2ZAOA 3KSRA 3GLQA 2LVBA 4BFTA 4EL0A 2GD0A 3GGCA 5J2UF 3I01A 3SNHA 2VHYA 2QAGB 1WJGA 3AEUA 3CEHA 2E18A 3RGWS 4MJ7A 1K7CA 1NPYA 1R18A 2G1JA 7ADHA 2WM8A 1QHNA 3JQQA 3ACDA 3TJZA 1ESEA 4K9QA 3CJRA 2FW8A 4FFNA 2XOXA 4J43A 2HUNA 2XRYA 4EGJA 2ATXA 3I39X 2AEFA 4TTQA 1E3LA 2FWAA 3RK1A 4NARA 3A0RB 4HXYA 2CYBA 1P7YA 2Y6VA 4LZOA 3R9IA 2HHAA 3TNJA 1BIFA 1DARA 1O6ZA 2ZIXA 3NHSA 2ZE7A 4QDJA 4AULA 1DFHA 3QEAZ 3T9CA 1X9IA 5F52A 5M04A 3HCEA 3ZI0A 1G1AA 3L7BA 4PR0A 1I4WA 5GV8A 3NBYC 3TLJA 5K8VA 1IN5A 1BHO1 4ICIA 3U9TA 1RXIA 1Z0AA 1Y6ZA 1U99A 1Z17A 3CB4A 3IIJA 1ARZA 1CZOA 4G5GA 4M8NE 2G1AA 4R41A 3UQYS 3WNQA 1QE5A 3THXB 3KWJA 3HZHA 4H31A 3RU3A 2ZPAA 3HFSA 1CY7A 1A7KA 3R09A 3UICA 4EHFA 4OKSA 1EJ0A 1NYTA 2YQ4A 3HABA 2FE1A 2OHOA 2ZDGA 1ENOA 5LJLA 1OLXA 1GGFA 3KOUA 5BW5A 1ZGCA 1PDOA 3UAWA 1MB0A 4R4JA 3IV6A 5A4JA 4GO1A 4DMGA 1JPUA 2HXSA 4DW8A 2VH5R 4ZIRA 1H1DA 1EB9A 1TEHA 3A06A 1Y34E 2O23A 3LNCA 4B34A 1FYWA 4QEKA 4NMLA 1YE3A 4RHFA 2QZ4A 3RTBA 1G8MA 2ODBA 2QVCA 3EF1A 3NPAA 1K6EA 4MEJA 4RK5A 4G6ZA 3RTGA 3DA8A 3FFTA 3HRKA 1OH6A 2GFHA 4BE4A 3AC0A 3IOBA 1ECJA 4JLMA 2HZBA 4ZC8A 3SI7A 4D0RA 1V5WA 1XYVA 2G5TA 1NSFA 4K9RA 1CQIB 3VX3A 2QG9A 3L0BA 3DZFA 4L4XA 1W48A 4TSFD 4H6WA 5DXAA 5B1SA 3K72B 1A27A 1NZJA 2QT1A 3ROKA 4B09A 1Z5NA 4TOIA 2OY0A 3WK7A 2YFKA 4U2CA 5K0LA 4GPTA 1R8YA 4AZWA 1MNAA 3KOXA 5TY0A 4MA0A 3RW9A 1D4ZA 1JV2B 2IK8A 4QFCA 1U3GA 5CLIA 2P9CA 3GR6A 2C2GA 1TFRA 1TQ2A 2JLYA 1HH4A 1IFXA 3W78A 1A4IA 3EBLA 3U7EB 3PQ2A 2G5GX 4UCWA 2J5QA 3PDIB 2BKVA 2PGJA 2LKCA 3I6BA 4YR9A 4CCYB 4BNDA 3LCRA 1H3EA 1J00A 1K4MA 3V2HA 1U1DA 3WGQA 1RBQA 1XQ1A 1U1GA 1R37A 5E3IA 5ALKA 1EPUA 1OLUA 3QJYA 4G5FA 1AOXA 1RQLA 3T7SA 1KO4A 2RGYA 3ZV6A 2XJ9A 4WOJA 3JZDA 1KYTA 3JZIA 3O8OA 1C4WA 4JXKA 4WVFA 4IIBA 5DMXA 4AF7A 1GUDA 2Y0DA 1M2GA 1XXHB 3FZEA 1NVDA 2H07A 2J3IA 1FB5A 1ZXLA 2C2BA 2C8LA 3E9ZA 3G02A 4K7JA 4M55A 4NZNA 3TGPA 2QAIA 1HQYE 4G67A 3VNQA 5I4CA 1LSSA 2AJTA 2YS7A 4MV8A 4BLOA 5AJXA 3OFJA 5M34A 4J3NA 2UU9B 3TTWA 4MKRA 1RLMA 3D0RA 1K8RA 4C88A 4DMFA 4F4DA 3QU2A 1CEQA 2GKOA 1Z3IX 3A6FA 4UUAA 3SBEA 2D2VA 4NOJA 2VHQA 1X1AA 3BB1A 2OZLA 1B73A 4FSHA 5AT1A 3OU2A 3OM1A 1D6JA 3HR7A 4IEFB 5JNVA 4YROA 2Z0MA 4MPPA 1UM8A 3Q3GE 4DL9A 4RXTA 4F2WA 1UT5A 2R5WA 4LOKA 5EYPB 3ITKA 1MG5A 1VKJA 1SEVA 2IZ5A 3PD0A 3ZHYA 1GM5A 1B14A 5G0VA 4QFBA 4O2BB 5KTSA 5SY6A 3WIVA 5IANA 4TSKA 4URUR 1BWQA 1UXGA 4F72A 3I3SR 3BGSA 4A03A 1Y1RA 4CIYA 4GWGA 3KKMA 1RYNA 4RPKA 3W5VA 5JS7A 5EMMA 4HAYA 2J3MA 2W6JD 3N6XA 3VAZA 1NC1A 1LXCA 1WSAA 1O97D 2H7YA 3ZN2A 4L27A 1P9RA 2KS6A 4M37A 4BQFA 2A1UA 2Q5HA 5JC8A 4Z0PA 4REOA 4BFZA 2MMGA 1U98A 2GCGA 3JQ9A 3ENZA 4N8DA 2CV0A 3CTMA 3KV3O 1T5IA 4MYRA 5AXAA 5K8LA 4MP6A 3TRHA 3AFOA 1GADO 3NHPA 4P5PA 4M46A 1ZU4A 4PPYA 1JAHA 2ODTX 3TIFA 2JEZA 2QNIA 4Z3DA 1PR3A 1UAAA 1LC3A 4W5NA 3OY7A 3FHTA 2C7OA 2DXIA 1GN8A 1IEQA 2AG1A 2X7XA 3GLHE 4GE0A 3GLHB 2WT8A 2XDAA 3EFHA 3PTLA 4K8RB 2ZROA 3HWRA 1XEXB 4J1NA 4OKNA 2XUDA 1QPBA 3M3PA 4QFDA 5FV7A 5I9MA 5ELMA 1FYVA 2GJ4A 4QBHA 1CBUA 1T3SA 5IDYA 4D99A 4UEOA 4D9JA 1AO0A 4XDGA 5KAPA 1TZCA 1Z0DA 2F6RA 1T5DX 4YJ2A 3Q3HA 1L6RA 3O03A 5IBRA 3GUCA 4MO2A 5TPZA 2PWBA 1IN1A 3ODGA 3BQ9A 3OETA 3ZCQA 4Z2AA 4QC2A 3K15A 2XCLA 1YONA 1SBYA 3IKMB 3MS7A 3FLEA 5BSUA 4PRZA 1H6DA 3HACA 4RFVA 4B87A 3A7DA 4RANA 4HGPA 4QARA 1SXQA 1S8OA 1PJ8A 1H4VB 3EBPA 3VR3A 2AQKA 2WJJA 5CNIA 1ACMA 4O4LB 3MEQA 1UPAA 1XPJA 4MUHA 3IRVA 4S1TA 4QTYA 5HJ7A 3U4MA 2FW6A 3P19A 2J8ZA 1OBOA 2WP0A 2G36A 3ZLBA 3OIUA 4LVUA 4EY6A 1SURA 2CL5A 3O91A 5C1BA 3IESA 4YMUA 2O54A 4OBWA 3K0FB 4ASUA 5L6LB 1AB6A 4URYR 4FMDF 3TIIA 4BMNA 4QDTA 2PM8A 4JASB 1L5FA 1DDGA 4MQ5A 4A92A 5CEFA 2CD7A 3UKOA 3HADA 4KBYA 5BV0A 4CQMB 4I99A 4QDXA 5FPPA 1U0GA 5ILOA 4CM5A 4PQRA 1WUYA 5B7PA 3RYCB 1YFZA 1PFWA 3KQSA 4IIHA 3TBFA 2J0UA 1AJEA 5KJEA 1XTTA 3U13A 4HDCA 1EG2A 1UBHS 1EGVB 1PR6A 1Q0QA 1Z8HA 5HM6A 3L7NA 3LQQA 4JEHA 4B6RA 4K0KB 4RZXA 3U7GA 1JEQA 3MWYW 3MQFA 2CHEA 3V1UA 1XWWA 1QORA 3BGVA 1Y3CE 2HHLA 1M2HA 3AHJA 1XEWY 2AE1A 2JGRA 3DZBA 3FSRA 4XWYA 3H8JA 3PPVA 3W8DA 4TYMA 1LBQA 3MD0A 4B3CA 5KWVA 2ZBRA 4I50A 3TLXA 4UEKA 1F2UA 3CGWA 2M32A 5F4ZA 1TF2A 4YAEA 5KSYA 1I3CA 3MVEA 2O1SA 1T6XA 3RS4A 9ATCA 4KLNA 3RIXA 4EUFA 3B85A 3KFXA 4COKA 4L95C 4R2HA 2YZ7A 5AVXA 2ERYA 1S7GA 4U9UA 4D4MA 5TNXA 3O3NB 3H5OA 3X1KA 4JBHA 2HT6A 1HTWA 3JAWA 4IW3B 4M1MA 4UW9A 5E1DA 3TUZC 1YBVA 1K5HA 3J81k 1G21A 1X19A 3E5NA 2DQ4A 3KVVA 3IHWA 4RIEA 2CLLB 4FGJA 3AF4A 3ZNOA 3UJPA 3AEZA 3N5CA 3AB8A 4Q3DA 4YVFA 3CLRD 1RI3A 5AM1A 2ZYIA 3R7FA 3C6ZA 1W2WB 1NU8A 4GD3Q 3OESA 2WV9A 2HLHA 3B3AA 4QOJA 5DHSA 5DNWA 1CZHA 3R7WB 5I4IA 2BSQA 4B9EA 4ETIA 1G98A 2HWWA 3TMAA 1Y9AA 4P80A 4ROSA 4AUMA 1JP7A 1RYZA 3CW8X 1GSOA 3BGWA 2X2PA 2GASA 4BCBA 1KZ7B 2QRNA 1X9HA 3DBOB 2RHGB 2JFZA 2Y92A 1IWBB 1WHSB 2OL4A 3EXG1 3PG5A 4LDRA 3RV3A 4IIVA 3HKEB 3UG6A 2HI0A 3KB1A 4RGQA 2V7QD 4RVHA 3OA0A 5DIFA 1PYDA 3VSBA 5IFLA 1JR3E 3RYIA 5BVGA 3NDRA 4D6YA 1AQYA 1MO5A 1DAKA 4F2PA 2I22A 3MINB 4DZRA 1T8SA 1EWTA 3IYLW 3ZI7A 3GNSA 1IH8A 2ZYSA 1TYDE 2Q49A 1EGQA 3CPHA 4FMCB 4FX2A 1XJ0A 1LW6E 3LXXA 3ETJA 3UJ8A 1H94A 2C4WA 4JJAA 3MFQA 1DIRA 4W9NA 4NF2A 3I4FA 4DQVA 4XR4A 1Z06A 3WHLA 3OZGA 1DX4A 3L77A 3CONA 2QVBA 1V47A 4ZHQB 3UB2A 5I4KA 2R1VB 4KIGA 2ACWA 5DCUA 3LGSA 4BZWA 2GZ2A 1A97A 2VDKB 3K6SA 2RHLA 4UVEA 4WXEA 2O1EA 1Z33A 1SXJC 4IX1A 5A3RA 2ZK7A 5EMHA 3RVJA 3IB3A 1AS0A 3OFSA 1OGJA 3THRA 4PAMA 2W4QA 3BRCA 1X1EA 4TTAA 2EP7A 2YFYA 1T9CA 3E82A 1A72A 3I34X 4DB4A 5DK6A 1DOZA 1X86B 5T64A 1D4AA 1JDSA 3QXSA 2QSZA 5FUBA 2BMJA 2E89A 1IZ8A 4KOEC 1X3SA 2I29A 3D4PA 1IYZA 4PYIA 5FTWA 3DQQA 3FNIA 3N59A 5SYAA 1IOVA 5BYBA 2G67A 2HC9A 1HK7A 3EAGA 3F7OA 4KNVA 4Y6RA 3UWDA 1B74A 5JY1A 2ZSUA 4JS0A 4NYMR 5JAUA 3SP1A 4K86A 3C4VA 1O0CA 4ZO8A 4ZODA 5LPNA 1Q6ZA 2OZPA 4PXYA 2PZBA 3AETB 4LGVA 3OTIA 4M9ZA 1R8JA 1NVTA 4GKAA 4QYTA 1SXPA 3VJMA 1GDDA 1OGYA 3NAMA 2ZBEA 1F0YA 2VQDA 4RHTA 1EK2A 1GKKA 4Y2YA 1NOJA 1ZJYA 1E9DA 1U8UA 4L9RA 4Y1RB 4L5JA 2XJ4A 2AD5A 3UMCA 4LMPA 2ZQYA 1NW5A 4NENA 2GHRA 3IDZA 3NP9A 3TM4A 4GSLA 1HG0A 3LMKA 4XFDA 3GZTB 2IUFA 4FGZA 4K0RA 3FOEC 4LF4B 1BMTA 4LZJA 2ZB3A 1VPDA 1DTSA 5DYGA 4TQUS 3G2NA 5CTAA 2Z8YM 5JXHA 5HE8A 2ONYA 2GETA 1NN0A 1GNPA 1UWKA 4LF6B 5A9TA 1OVMA 4CEHA 2VDWA 5C1IA 1J6UA 3RSZA 3GOHA 2GBCA 3TOXA 1R74A 1WOMA 1D8TA 2RD2A 3QHAA 1IN4A 2IOFK 3CPJB 4OO3A 3TZHA 1OBVA 2E55A 3D6MA 1IMOA 1AUXA 1BW9A 3GJRA 1GRNA 1NJ2A 3ROFA 1JTFA 4MWGA 4FYWA 1U8CB 5EJGA 2W98A 2XMQA 4MYCA 1A7AA 3DKPA 3PNYA 4B4DA 3EUAA 3CGGA 2F43A 3H1GA 4EFLA 1Y9EA 2HX1A 3P8ZA 4JDUA 1PG2A 1JS1X 5DWVA 3SIWA 3GK3A 1M2EA 2E37A 3MTEA 4UATA 4RTLA 4CKBA 4DG8A 5KYWA 1KSJA 2P30A 3E48A 2VNHA 3I0MA 3OEYA 4Z8XA 1DBPA 1XWFA 2P2LA 3H1FA 3N2IA 4QODA 4TRRA 5P8WA 4YBRA 4PCAA 5A9RA 4EJMA 1I4DD 2YUIA 3UCFA 4C3ZA 4ZGGA 3I09A 4I3FA 2O3RA 4MDFA 1CNMA 2A57A 5FPSA 4K1LA 1NQ5A 1E2PA 5FBHA 5T41A 2FPIB 3CG0A 2ZJ3A 1T8TA 2POQX 1GGKA 1PZFA 3ORFA 2O8CB 1I4TD 1GHTA 2GBPA 3W5AA 3EA5A 2R6CA 4IJQA 3FW1A 2YMQA 5AESA 4IXWA 3R7NA 3T1OA 1MQ8B 4HKTA 1LPNA 2X4GA 2HREA 3OM9A 3OOWA 4JY7A 4LC1A 1Y8QA 2O4UX 2Z56A 2ZOSA 4ZKDA 3R9KA 3A0UA 1SIBE 1KSHA 2UYYA 2ZETA 3QENA 3SJUA 5I7SA 1QV7A 3VAAA 1VGRA 1N5IA 1R0ZA 1QHIA 3A9VA 3I64A 5LZ4A 1UMBA 2Z6UA 4YAWA 1QFSA 1J06A 4MQFA 3IHTA 5AM5A 3W2GA 3U1VA 4TXLA 2EP5A 5AWFC 1A9YA 2B4KA 4N12A 4QPJC 1Q1NA 2IP2A 4B71A 5HNKA 3H4MA 4YJHB 3PCTA 1LC0A 1W76A 4IGIA 4JC8A 1KWGA 2ZZMA 2OCGA 2VA8A 1NFRA 3C3MA 1LS6A 4DBLC 4GPAA 1D7OA 5IAJA 4BFYA 4ERNA 1X92A 2IPNA 3AUXA 2VRWA 4LNHA 1J33A 1RSZA 1S2DA 1G0NA 2NLOA 1I4OA 1FMTA 2QTTA 3CBQA 1HBJA 4GRAA 5FO1A 2Q4EA 2Z5LA 3BBPA 3O38A 4ZOLB 3HM9A 3DC7A 2F3UA 1O94D 1I2ZA