1CJBA

Malarial purine phosphoribosyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
227
structure length
227
Chain Sequence
PIPNNPGAGENAFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYDIKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0 A structure of malarial purine phosphoribosyltransferase in complex with a transition-state analogue inhibitor.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords PROTEIN (HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE)
total genus 74
structure length 227
sequence length 227
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1999-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cjbA00
2H06A 1VSTA 4FYMA 2H07A 5BRNA 2AEEA 2H08A 4RHYA 5EUCA 1Z7GA 1A96A 4P84A 4QYIA 1DQPA 4RHXA 4TWBA 1O5OA 3DAHA 1PZMA 1ZN8A 1JLSA 1AO0A 1HGXA 1CJBA 5K51A 5JSQA 3M3HA 4QRIA 4P83A 1P19A 1P4AA 3EFHA 3N2LA 5BSKA 4M0UA 1J7JA 1ECCA 2VFAA 3OZFA 5JV5A 2JI4A 4RACA 2IGBA 4P80A 4RAOA 4Z1OA 4RAQA 1R3UA 3DEZA 2PRZA 1ECBA 1G9TA 3HVUA 4RQAA 3NAGA 1BD3A 1LH0A 1P17A 4X45A 1NONA 1NULA 1G2QA 1OROA 1DQNA 1L1RA 1DKUA 1G9SA 1GPH1 1U9ZA 1ZN7A 2P1ZA 2YZKA 3G6WA 3KB8A 4QYIB 2DY0A 5E38A 1A4XA 5KAMA 4P81A 1I0IA 4M0KA 1XTTA 1ECFA 5ESWA 3S5JA 1L1QA 4PFQA 2EHJA 1UPFA 4P82A 1W30A 4LYGA 4X44A 4LYYA 1OREA 4RANA 4RV4A 1I5EA 2JBHA 3ACBA 1JLRA 1QB7A 1D6NA 1QCDA 3MBIA 1XZ8A 1U9YA 1O57A 1ECJA 1DBRA 1BD4A 1TC2A 1UFRA 4IJQA 4P86A 4RABA 1V9SA 1HMPA 1YFZA 1A97A 2PS1A 5KAPA 3H83A 5HKLA 1XTVA 1QK4A 1G2PA 2GEBA 4KN6A 3OHPA 5IPFA 1P18A 2XBUA 4LZAA 5HIAA 1OPRA 4RQBA 1UPUA 1FSGA 4WN3A 1VCHA 4P3KA 5IAOA 4ZFNA 4WMLA 4MB6A 1I0LA 4S2UA 1WD5A 2JKZA 2JKYA 3QW4B 1GRVA 4JLSA 3DMPA 1QB8A 2FXVA 4RHUA 3LRTA 2HCRA 4RHTA 1ECGA 2PRYA 1Y0BA 3GGCA 1MZVA 4LZOA 4M0PA 3GGJA 1A95A 1BZYA 3O7MA 2E55A 1QK3A 1QCCA 1QK5A 1XTUA 5BQPA 3ACDA 4F8EA 4LZNA 1ZN9A 4RADA 1A3CA 1I14A 2C4KA 5BQOA 1I13A 1VDMA 2WNSA 3ACCA 5ESXA 1XZNA 1A98A 4OHCA 4PAWA 1TC1A 4JITA 1IBSA 1DKRA 1STOA 3GEPA 3MJDA 3LPNA 3OZGA
chains in the Genus database with same CATH superfamily
5F5LA 3UMBA 1E9CA 2HXGA 3OP4A 5EJ9A 3R7NA 4D3DA 1VLLA 4FSHA 1Z7BA 3E23A 1W59A 1ZI9A 2P6MA 2FUG6 2UXBB 1FDOA 3S2SA 5CFNA 1GUYA 4J3NA 3TQCA 4HTFA 1M2WA 1HE1C 2QDXA 5M04A 3NWJA 3ET4A 3K94A 3RHFA 4BFUA 3I2GA 4A0SA 4BMSA 3F96A 3PPXA 1ZSYA 4HLUA 4A8JB 3K9QO 5KTOA 3RF7A 2BH2A 2QGNA 3V32A 1K8QA 4J0IA 1ZMRA 4KMRA 4EGAA 1LBTA 2BOVA 3KOYA 4FOOA 1FFGA 4KWCA 1O89A 4WDRA 2CYBA 2CUTA 3MUNA 4Q4HB 4OU4A 4WFKA 4X0EA 5CX1A 1S0UA 2D62A 4JI5B 1S4QA 1ID8A 3ZWKA 1NQUA 1DTSA 1Y3HA 5FOXA 4A8JA 2BKEA 1U90A 2VSFA 2G1UA 1YC5A 3BKWA 1U7WA 2VJMB 5ILOA 5DGXA 1E0SA 2A9FA 2UZ0A 2ORWA 3VTKA 4EUNA 2CYAA 4K28A 4Q03A 1GGFA 2A1UB 4Q3NA 1Z25A 3K8YA 3U4DA 1NATA 1T36B 3NVAA 2MSEB 1JIXA 2YV4A 4IRMA 5U4XA 4N7JA 2CSXA 3JQEA 1YUMA 5ICEA 3KQWA 4IIHA 1G9SA 1OUMA 1QFSA 2GWRA 1TMYA 3LW7A 3ABZA 4LMRA 2BKUA 4G5HA 2XMBA 3R41A 4FMPA 4UTRA 3GJ7A 1P4SA 3AQIA 3L7YA 4MS3B 1L4NA 4ZAGA 3P9CA 3HNOA 3LOUA 3PXEA 1RAGA 3ESXA 4M1WA 4BNYA 4DCJA 4F4CA 2DR2A 1WMEA 2GKGA 1HDEA 2NSDA 2WSIA 3P2IA 3OC6A 4PTYA 1HETA 3CRRA 2BCJQ 4R5HA 3SM3A 4ACBA 2QTHA 4EGJA 1DC5A 2LD4A 5C35A 2MSKA 4KMSA 3BWYA 3NHSA 4MQ5A 3D5TA 3LUJA 4DSNA 1QYVA 2GHTA 1KEUA 2VYND 4AG6A 1ML3A 4RVOA 1E3SA 1V5GA 4MRMA 4WFIA 2A4MA 4TL9A 2IHVA 2IC5A 1EFLA 4WNAB 4YK7A 1N9ZA 5COAA 2OBLA 4WLNA 1OV6A 4WECA 3SGLA 3TLAA 1SUSA 3M0EA 2CXTA 5FI3A 4C89A 1F38A 5CJJA 2NNLD 4C08A 4LV8B 2ZRJA 2O3SA 2GLTA 2Q4OA 3ESQA 1BHJA 2I2AA 2IZOA 4O25A 2PJRA 1N2BA 1M74A 3DFUA 3B78A 4UU8A 3IERA 4QDOA 3S5UA 2GEUA 1UMCB 2Y9MB 2IV2X 4A15A 4DDMA 1UCFA 1JS1X 5ANRB 4LBWA 1GCIA 1EI9A 3PU6A 1B76A 4GXQA 5I5EA 3VAAA 3AUFA 5KKNB 4PYNA 1O6GA 4JASB 4M87A 2MWMA 4YI3A 5J58A 5BR1A 1LA2A 1H2AS 4P98A 4TRJA 2NXWA 2EBHX 2WUGA 1F8FA 2JAHA 1SKYB 3D6HA 2YFHA 3OF3A 1MUUA 2R5NA 1QHIA 1TC1A 4EW2A 3TF5A 4PIPA 4E14A 1KI8A 5K20A 1IBCA 3K0AB 1ESZA 1U3GA 4W1PA 2C1XA 4DEYA 1C3OA 1YULA 3CEAA 4MLCA 1QC5B 4MWOA 4MRSA 5ALLA 4D46A 4BFSA 3LUPA 2DFNA 4CEHB 1XMVA 3NOOA 4KG7A 3LP5A 4PZDA 3BSYA 4MQFA 4XJXA 2C29D 4ZRMA 7REQB 4LYAA 4FGSA 4EA9A 4NVRA 3P2YA 5DISB 2FUNB 5FUWA 4EW6A 4KOAA 2B5OA 4IZIA 4RU1A 2Q3MA 4BB0A 4WY5A 2BKLA 2ZRAA 4YDQA 2R11A 2OV2A 3IH5A 2C2MA 1PZMA 1G0OA 3KPVA 1YIDA 3EJWA 3UUWA 2VDNB 2HCFA 4B74A 3EQ7A 2QRHA 4DJTA 4GNRA 5LZ5A 2R62A 1B16A 4QTUB 1UFKA 3DL0A 1WEKA 2HK7A 2R6FA 2RHCA 3MN1A 2DQ4A 1VKNA 2YWGA 4LG1A 4LOAA 1NYLA 1ZSNA 3N7AA 4LVNA 3A6EA 4RGQA 1GADO 1VGQA 5E2AA 2MR5A 3TIIA 4B17A 3F49S 4FUQA 2PD3A 4WFJA 3TG2A 1Q1ZA 3E9MA 2QU7A 2B82A 2EW1A 4QGGA 5I4BA 3Q1KA 1MNAA 1HT2E 5JNUA 1SRRA 2VCYA 1NUUA 2HMSA 4HAIA 3INNA 1BHO1 3WGMA 4O5OA 5HKAA 2ZE7A 3A6KA 4V0ME 2OP0A 1W0JA 3TYXA 2UDPA 2BFFA 5ITZA 2Z58A 4BECA 1Q11A 1Q1NA 4Y8VA 5AVVA 3EPJA 2Q4RA 4GZ6A 1CY6A 3FFBA 3L0OA 1JZQA 2N42A 2GAFA 1OC2A 3FWYA 3BRWA 1MZPA 4QPPA 4DBVO 4W5OA 121PA 1Z4LA 4JLAA 3NW9A 4N39A 2AR9A 3Q5GA 4EKNB 5EOVA 5D6OA 2QAJA 3PFCA 5L7YA 4G4GA 1EJ6A 4IINA 2O2HA 3I2KA 1YHYA 1DKOA 2FLVA 2WPDA 3FNBA 3NJRA 3RR2A 5LIRA 4J49A 1ABFA 1EINA 2GERA 5H5JA 5FUMA 3GIWA 2VHYA 4MWSA 1RZUA 3U2QA 1TM4E 3V4VB 4P36A 4A5OA 1AKYA 3V4ZA 1CYDA 1FX0A 5E1DA 2XT6A 1FYXA 2GSWA 2QYSA 1PUJA 4BQOA 1EWTA 4GUDA 2EQBA 2HDNB 3CM0A 3GBPA 3WLSA 3TW8A 1DPFA 4AKEA 3AF0A 3MTIA 1IBLB 4IV0A 4YQEA 2JC3A 2XYHA 1MTOA 2CLDX 1NR7A 5ALWA 3IDQA 5KYVA 1EK5A 2X0NA 1TCAA 1DNPA 2VJNA 2ZYIA 2QD2A 3GHYA 1R0RE 1IZ0A 2W6NA 3W9YA 3QBEA 4XR4A 5IWAB 4I08A 1BN7A 2PZAA 2QR2A 4EVIA 3RQSA 2ZYGA 2XZTA 5AUPB 2ZUUA 2WVHA 2GCEA 5I9IA 1A7JA 2JKYA 5HUJA 1NF8A 2XMGA 5AOBA 1T2FA 3I62A 5A05A 3CPSA 5CDTA 3A6HA 2PQMA 3CO0S 1DLIA 2NQ2C 4ND4A 4AJ9A 3WKEA 5AH0A 2VNHA 1E62A 1FK8A 2B4AA 2F9MA 2X8WA 3IPCA 3MCTA 5JO9A 3WDKA 1MZVA 3JVVA 3LVBA 4GMHA 5FBLB 1XCLA 2B9EA 1OILA 3HUEA 3OEHD 1KI4A 3P0HA 4FGKA 1N9KA 4LSWA 2P3OA 4B4OA 4CFZA 5LP1A 3GA7A 4MJLA 4X1IA 1E7YA 1A3CA 2PZ8A 2RH9B 4WUTA 1UM9B 4R05A 2N46A 1UPTA 3BG5A 3FOAA 5FD8A 3TM5A 1NP7A 3N2IA 2H1HA 3GCWA 3QA3E 4M3NA 5DJ5A 2CJPA 5EQFA 4ZEMA 1EE9A 1J25A 5JC8A 1MB3A 3OFKA 3I6IA 4P2GA 1NNEA 3BT7A 4A2WA 1NRXA 1UM9A 2DQZA 2ZAYA 3GLSA 1BFDA 4R3NA 3A1DA 3B53X 5B4TA 5DK6A 1XV5A 2J3JA 2HTEA 4JP2A 4R2MA 3HJHA 1Z9BA 2XGMA 3CLRD 3LCRA 4C87A 4NV3A 4HTAA 3W5HA 1V6SA 5BSHA 3BMNB 3EC2A 3ND7A 3EIQA 1CHNA 3MXTA 1I4LD 3NIFB 3D6JA 2F1HA 2XMZA 1EZ1A 1GA6A 2D5IA 4I14A 1H66A 2J3QA 2XUZA 5G4LA 4CMAA 3AB7A 5HMMA 2ZT5A 3DO5A 2BCGY 1RLIA 2P62A 4LISA 3PGLA 1SC3A 4CV3A 3OKPA 4BB9A 5HM8A 2HRRA 1RQ7A 4GXNA 3CIFA 1U0SY 2WP8J 1LPBB 1CETA 5JW6A 1FS5A 5CEEA 1Z0SA 4IFBA 1MJGA 1K68A 1SK9A 2BEVB 2HUNA 5TQ2A 1UANA 4W9RA 1MPXA 3GYGA 3V3TA 4N3BA 4RPHA 1QMPA 3C8ZA 1U4NA 3G82C 5DFAA 4L8YA 3VZRA 5CA0F 4I50B 2QJFA 3C5EA 1PQYA 3ZJTA 3ZIAD 5LZ4A 2WIBA 3O90A 3DMHA 3HB4X 1Z0KA 3UOAB 2VNAA 1BAPA 5EE5B 3NB0A 3NC4A 5C7OO 5ITWA 5DTEA 1A4XA 4PSDA 5GY7A 1ZD4A 2OFWA 1XTTA 2OZLB 3I9MA 1B8NA 1T5LA 3I4CA 4HZGA 3RVMA 3WQBA 2C4TA 3EDCA 3IR5A 5EJMA 2B83A 2XYGA 2O0HA 3FWKA 4WNCA 3JCZA 4NARA 1L4UA 4WLVA 5AJYA 3RIEA 4EUEA 2VTBB 4L8GA 2ZR8A 3VSEA 3AYXB 4YRKA 4Z7OB 5T6BA 4MDHA 5EHQA 4C3UA 4D98A 3MJFA 3PJGA 4KQGA 4H1UA 3OZSA 3ZYCA 1YDWA 4CMBA 2R6JA 2K7FA 5BV0A 3ELBA 3HP7A 4AMUA 2VPQA 2EIHA 3WB0A 1BVHA 2IODA 2OXEA 1VIDA 1KF0A 4XAQA 3UJDA 5BPFA 3SXUB 2VTEA 1TM2A 4BX0A 3Q1LA 1O1YA 2HCBA 3P32A 1EFDN 3PYMA 5FI0B 4EYSA 4DRXB 1BE8A 4L2IA 2D1TA 2QZ4A 1HYEA 3A4LA 4IAOA 3WZMA 3EQ6A 3IGFA 5CLIA 2GZRA 4BLQA 1Z8DA 3KYDA 4CIDA 3Q72A 1QQBA 1QZUA 1G60A 2EERA 3QH4A 1Y6QA 1Q92A 1B6SA 2BI4A 4UPEA 4BPBA 3DEFA 5DYIA 3S40A 3MRTA 3CLUC 5BY2A 2FWRA 3FNRA 5A5FA 2FEWB 2OAEA 2Y71A 1RJ9A 3ZU4A 3CSSA 5DH9A 4GLOA 1XB2A 4BE4A 3I53A 4RC9A 3FOEC 1KK0A 1YACA 5LQCA 5CFLA 2ACWA 1AMNA 5HJ2A 2FCRA 2G25A 2NSYA 1E7SA 3LUKA 4QU9A 4FEGA 5BVHA 4Y2RA 3PSHA 1QIDA 5JCPA 1UEXC 4MW6A 4EGCB 4GMKA 2QT9A 3KHTA 3WDMA 5IHXA 1JJAA 1WZCA 1QF9A 2HLDA 1E7MA 1B74A 1SWVA 1ZU5A 1EFPB 2EVWX 2J3IA 5ESXA 3S6JA 4DV7B 2PUDA 4CF4A 3T4UA 3TX6A 3VR0A 1J5PA 2HGSA 3O3NB 2R6CA 4K9DA 2VQDA 5TPWB 4GX2A 3RK0A 3SBXA 1JPUA 2FR8A 4V38A 2PKYX 5ERXA 4R1OA 1C3VA 1CUCA 5AHXA 3ZWNA 1Q1EA 3LTEA 4DMRA 4IXNA 1FYWA 4UVDA 4CEJA 1LPSA 4OO3A 1YTUA 2OZLA 3QA9A 2P1DA 5HFJA 3WX0A 3IQFA 1PR5A 3UMVA 3FTDA 5CTAA 3MMSA 1UC8A 4PZLA 1F0KA 1WQ4A 3NP9A 1T4CB 4GI1A 3G8CA 3ZGXA 5AW1A 2JIPA 4LX0A 1NQWA 4AZ3A 1NVVR 5B6JA 2WIFA 2IP1A 5KNCA 1QQ5A 1XEXB 2H00A 5K8LA 2QE7D 4WNIA 3GROA 3TIFA 3VO8A 4BO6A 4D9CA 1B42A 2JHPA 2PO7A 2G67A 2AJDA 1KMCA 1HFKA 3AETB 3HADA 3P2OA 1WQ1R 4NESA 2NYAA 4NULA 1OH8A 1BGVA 1RYBA 2H57A 2O6HA 2C4WA 2C9OA 1B0AA 1LPNA 1NVKA 2PHZA 2XNHA 3AHEA 2XE6A 2VJCA 3Q7IA 3LY5A 2MYPA 5H59A 1SQFA 2ZYAA 3BFKA 1WB9A 3U4MA 1KEZA 1LVHA 2DM6A 1SQ6A 4LJ6A 4TQGA 1MRSA 1VLZA 1AMUA 3D2CA 4NOJA 5LNK1 2X42A 3UA3A 4BNHA 1BX1A 5EC8A 3OU7A 1I2AA 1VP9A 2PQ6A 1UXOA 3K92A 4HAVA 4AP6A 4ATNA 3K53A 5TPZD 2Y68A 3V7FA 1PGQA 4LYGA 3G8AA 4PZUA 3E5RA 2CY0A 2V59A 3AFNA 4HNQA 3GJ6A 3DD1A 3QEMB 4JYPA 3ACBA 5CAEB 4AMYA 4DN6A 3EK2A 1WABA 1C7FA 1IY2A 2WTAA 3V6MA 2O2JA 3N8IA 1SKAA 3RS0A 4WLOA 1OJ7A 1YHNA 1YT5A 4P86A 4G84A 5FXMA 1L5HB 1NFFA 2PSSA 1OI2A 3NONA 1CJKC 1XZBA 1TZCA 3ND9A 2CBZA 2XUFA 3MD9A 4IDPA 1I8TA 1FEZA 5AXCA 4MR7B 4ZQBA 4KVAA 1DX9A 1RI1A 1D03A 2WB4A 4CQLA 1E4VA 4IV8A 4LYJA 2J6BA 1SUFA 2ZSBA 3HACA 4G8BA 1C1XB 3RSLA 1FFXA 3BK7A 4LZAA 3ZU6A 3ZBUA 3T5BA 4BNNA 3O8OA 3GGGA 4KAJA 4PWZA 1TEVA 2O8CA 2Q28A 3OEYA 3N8GA 2R1TA 1XXHA 5JZVA 2UU9B 1M1YE 3G88A 3DE2X 4WLFA 3TO5A 4N5MA 2B4YA 1E1QD 3ODGA 5B57C 3F5FA 4RX1A 4TQUS 2J07A 2PMWB 4RY0A 1CR6A 3LSYA 1I1QB 3MTBA 4JA2A 5F1KA 1UP4A 2PIAA 3QWBA 4PCLA 1KNQA 3V8PA 3WIOA 4TRRA 2VHCA 5KQMA 2WM3A 1F6BA 1E63A 1JJVA 1P0MA 1M34B 2Q46A 3JZDA 3A1FA 4QOIA 2QTMA 3U9SA 2OZPA 2IBSA 4I5GA 1GNLA 1FLNA 1ULBA 4F6RA 4JV5B 2JAWA 4KXFB 4H6PA 2GR9A 3ORQA 3ZN2A 4A8JC 4BKQA 3D3QA 4YRBA 3TOVA 1Z15A 1N5KA 2JGAA 2YY5A 2VCHA 3B9RA 4BFYA 1WSAA 4F6RB 1V6AA 1NVTA 4NECA 3C3MA 3U4GA 1NMZA 2BDUA 1WUJS 1GKKA 1RQGA 3V55A 2PBFA 4MV0A 1O87A 5DTMA 2IYZA 2WJAA 3H3JA 4QPDA 4IJ5A 5F1YA 3ABIA 5GZ3A 3V34A 2W2QA 1LGYA 1OIWA 4W5JA 2A0YA 2YYAA 3ZHTA 2CD9A 4XGNA 3H5AA 2H5IA 1K9SA 5DN6A 3STVA 4L9AA 3B5JA 1NBMD 2PBLA 1FSZA 2Q1UA 2WFLA 3KKZA 3QXHA 2CLFB 3PNPA 4XYGA 1NTRA 2NU9A 3E22A 3HFJA 1FP2A 1XCBA 2X4IA 3G7NA 4R1QA 1W5SA 2GF9A 3HP4A 2QAIA 2ZYDA 3BKXA 2QI9C 4RSMA 5HIIA 5LB2A 2QG4A 4DQXA 4YCLA 1L4EA 3WNBA 1RZRD 3U7QA 4ZYVA 4BLTA 5FNVB 4BC0A 5ILQA 2W6OA 5F64A 1YGYA 1PTJC 1SVIA 3E22B 3ROPA 4RNDB 2EBWA 5H68A 3RBZA 5G0UA 3DEJA 3DVRX 3SKVA 2AI1A 4RK1A 4NZZA 2R8EA 5F7ZA 2HWWA 1C1XA 3BXXA 1X39A 4B7XA 2BFEA 1P7ZA 3FZYA 3UMGA 1GFWA 3QUCA 2VHZA 5LBTA 1MKYA 1BDJA 4H6VA 4IGFA 2VNJA 4PHFA 1G2QA 2BZ0A 1LB1B 1VYTA 3KQHA 2BFMA 5KNCD 3FSGA 1Z2AA 3OPYI 3CEHA 1HYBA 4G56A 5DEOA 4RH0A 4YRSA 3DAYA 5ALJA 2ZJ1A 2JZOA 2PUHA 4C4AA 4DLNA 4ABTA 1WZ2A 2Q45A 1V5IA 2IW1A 1GQYA 5H16A 3UT5B 1OXMA 1SXJD 4R6XA 2XB9A 2ZTHA 1XQYA 3BD7A 2R1VA 1FDUA 4LPSA 4XGRA 1KI9A 1A8HA 1O57A 4N9WA 2JFGA 3T61A 2OB1A 3OKFA 4O63O 3UFXA 1XROA 2QGFA 5BQ5A 2HA6A 4XWWA 1A5AB 3SR0A 2RC6A 3G0IA 3CMCO 1YR8A 2SCUA 3UJAA 4EI2A 3BN3A 5FIUA 4CLOA 4TWZA 2YKGA 4OHKA 3G49A 3JATB 1N4AA 3GW8A 2AQHA 3EBLA 3IR7A 3AERA 4QYWA 3EXFB 3HGMA 4P93A 4B1FA 3DS8A 5C8YB 4GBJA 3PWSA 3IVCA 1NW5A 2CCJA 3TSWA 4HDCA 3BA6A 3TH5A 4YJ3A 1QBGA 4G65A 1CUYA 1ZXXA 4DCSA 4KI0A 1O58A 3QX3A 4H18A 1H93A 1CV2A 3G8BA 1QCYA 2HA7A 2RGAA 2CWWA 2H5JA 4I81A 3OJ0A 1CYEA 2R96A 2I2WA 3OE7D 3ZD9A 1I7LA 2PFSA 1XFAA 2R7MA 3CKYA 4TLAA 3RSGA 4TZ0A 3U44A 2FRXA 1NL3A 1OU0A 1PIWA 1SU4A 1YRYE 4RHCA 3QKSB 1FNBA 4G1EB 3RKRA 5LQKA 4RDHA 5D84A 4BO0A 2F55A 1AX9A 1QK3A 3B1JA 5BSWA 1CFZA 2I3DA 2PAFA 221PA 2DC1A 4FDMA 4LRYA 4GX5A 5IJWA 2W2MA 5GWXA 2AF3C 1IN6A 3BE6A 2NYUA 3I5XA 3BERA 4MNTA 1P45A 3U17A 5GJCA 1M2OA 2HOQA 2AYZA 4QICA 5CM9C 3K9WA 2Q41A 5JT1A 2FRDA 1E7QA 4XFKA 3ROEA 1X7WB 3BJZA 2HC9A 5IASA 3N7TA 2MOKA 4H4CA 2VP4A 1ZGBA 1U7ZA 3LKDA 1RMQA 1T2CA 3E1SA 1WCV1 5CRIA 1E2BA 2Q2NA 3UA4A 1SHJA 4FBLA 4QYXA 1YB1A 3D1VA 2DEUA 2PMDA 4Q7JB 5ESDA 1L4MA 1M76A 1SKBA 3CW8X 4TX1A 5HE9A 3LJKA 4DBZA 4AP9A 1G20A 4L1KA 3NUZA 2Q8QA 1M5RA 2YHIB 3GFRA 1U9CA 3QIVA 4CT0A 5KVAA 3O1LA 5E9WA 2BMEA 1BVRA 1PV1A 2VHVA 3OPVA 2P8SA 3FYCA 1ZAKA 4ALMA 5ALGA 3W5VA 4LTDA 2XCTB 2GPSA 3N74A 2R6AA 5HEKA 1BMQA 2G9UA 4Y9UA 4EITA 1X7XA 1ECCA 5I48A 4J1SA 4YY3B 2Q9CA 3EUEA 4N1AA 4XVHA 2PT6A 1Q3KA 1QRAA 2FQQA 4INAA 1OZHA 2J1LA 3PGJA 5GV8A 3N6XA 2XEXA 4X97A 3BZWA 4XIFA 1FL9A 3TS1A 5JEDA 3ADBA 1G38A 1T6XA 2NTVA 1X74A 2PCLA 1XZDA 3WO1A 5EMJA 5CCBA 3II6X 5IAKA 3FWZA 2WAXA 1COWA 3B13B 1RLOA 4NG4A 4NSNA 3BD9A 3ZJVA 3QVWA 2B0CA 1A1VA 1PUXA 1G7TA 1O0CA 4L85A 1X9HA 3OM9A 2AOUB 5E6UA 4L22A 1R8YA 3CLKA 3IJ5A 3TVTA 3I30X 4H0NA 1OXKB 1TVKA 1T9GR 1BU8A 2WW8A 4U8HA 3WI7A 2GYVA 1VOTA 2WJHA 1SKYE 1F5NA 3NIWA 4JP8A 1H2RS 2J6CA 4G5YA 4S2EA 2BL4A 2FUCA 1D2GA 1GPNA 4M1QA 3AU8A 1XIVA 1QYCA 3SQXA 3U3XA 3V1YA 4HN2A 3GLHA 1HQYE 4FONA 4UDXX 4C30A 5K99A 1CQJA 5J43A 3FVTA 4TTIA 4P7BA 3FUXA 5ALIA 1ADGA 2AW5A 4C7JA 4JJ4A 4XWKA 2ERXA 3NBXX 1Q0UA 2J3KA 4NOLA 2NVWA 1J2RA 1CY8A 3DP9A 1UH5A 4JSYA 5LKRA 1E58A 4MCAA 1W4AA 4RJ2A 2HF2A 3G85A 3H75A 4JJ6A 2R1ZA 1E6MA 3KX2A 4RGVA 1N6LA 4UZEA 1V2GA 4WNAA 5CD9A 5HKOA 1P9NA 4CL2A 3T5MA 3FDFA 1G0NA 2I1QA 4IZHA 2VT2A 3EFEA 2ZJZA 4FBGA 6YASA 2JI8A 1Y81A 1NSYA 1G20B 1SFRA 2ORVA 1KDYA 3CKMA 4AJJA 2WTUA 2JLRA 2ZQYA 1DAEA 3IMCA 4QLBA 3DNMA 1UXJA 2OBMA 1V16B 3HB5X 3T1QA 3I9KA 2IPXA 3DMPA 1IB6A 1L4KA 1Z7EA 2FN8A 3SS7X 2RHMA 1KC3A 1EXWA 5CLJA 4LHXA 3MTEA 2XQVA 5H81A 1ULUA 2QLLA 3VH3A 1D2EA 2Y0DA 3TK1A 1K4KA 2P2SA 3OZEA 4TWJA 1JHXA 5ECGC 1NVEA 4UDOA 2M32A 4MAMA 1QH1A 4K9MA 5JRZA 3NIGB 4LYHA 2WZCA 1BMFD 3FAKA 3VPXA 4ZTZB 3ZU2A 2W2NA 3ZCUA 4PSUA 4DA9A 3ETLA 4RD0A 4Y1RA 3ZE7A 1UPCA 2AFIA 3MPOA 4M9XA 2YWXA 5MN6A 2Z4SA 4ARUA 3ER9A 1BE1A 3K3PA 4KQXA 3K0AA 2V7UA 5ALVA 5JS7A 5KYTA 1U4SA 4XDYA 4S1NA 3L1HA 1WMAA 2W0MA 3C3YA 1TQHA 1PR2A 2P3QA 2O23A 3AR7A 4L8WB 2LCQA 1ZOSA 2AFIB 4JGIA 3REQA 2IKQA 4MVJA 3FETA 5JUWA 2AOUA 1M5UA 1D0SA 4M86A 1PP4A 1CUGA 2YJ6A 3QUBA 4CMGA 5EIEA 2I2CA 2CHEA 3M4XA 4PG6A 4KO3S 4BEWA 4JL6A 3RU3A 5C1OA 3VI3B 5AVYA 2C4UA 3FHOA 2Q6KA 3BRCA 2Q7OE 2NVBA 4LZPA 1DO8A 1EVKA 2DHDA 1NC3A 1CNFA 1MC5A 2W6ZA 3N2LA 4ZOEA 3IP9A 3EIWA 3ETCA 1DKLA 4OLHA 2RGNC 4ZD6A 1D04A 3SU8A 3INTA 4H17A 2D4AA 4TLBA 2ZUEA 4YFYA 1CX9B 5PGMA 2AX3A 1T1RA 3BVPA 1H0RA 3FZGA 1L5KA 3WRWA 5L3SA 2WUWE 3U5TA 2BM9A 3COWA 4CMHA 3EOZA 3G0CA 1CZKA 3JQBC 1L5QA 2C5LA 4PBRA 3ZQ4A 4EO9A 4GMDA 1YJ5A 4HH1A 1QO9A 3CINA 1GT6A 5DHTA 4UAVA 4A6EA 4BCCA 2OSBA 1S2OA 5J5AA 1TM5E 2ZIXB 1ZMXA 2JD0A 3MSCA 3E03A 2FMHA 1LQ2A 3I2FA 4AMVA 4MW9A 5KYNA 2VSXA 2XODA 2YOFA 5B55A 1JR3D 1Y1PA 3GMDA 3OFVA 4NC9A 2BAGA 1N9GB 3GGPA 4KPGA 5FB3A 1L4LA 1NNLA 2X6RA 4GKBA 3GAFA 1E0DA 3BQNB 1YS2X 4K88A 4NJMA 4PW0A 4CM8A 3O3CA 1GSOA 1JDJA 1XJ0A 1PTJA 1U02A 3LUGA 3GLHE 5L6LB 5KQPA 2PZLA 4RE5A 1LFAA 3RIXA 3ZCSA 2Q1SA 3LY9A 3W1VA 3VGJA 3GFOA 3GZ4A 4EUHA 4JENA 2FPWA 5CK5A 5LPNA 3OJXA 3Q6IA 3LWZA 2PNFA 2PUEA 3VDRA 1SA0B 3OIDA 4RFLA 1P2BA 1J20A 1L7AA 2PZEA 3G0DA 1F48A 1W4LA 5BN5B 4ALIA 3PFGA 4AURA 3I04M 4BZWA 4DGSA 3AFGA 3F2IA 3FF4A 5CGQB 2ETVA 3EISA 4HMQA 3UWOA 2VJAA 1TW3A 2ACKA 3O4FA 2WWFA 1MGPA 4JCOA 5AJUA 4BVFA 2JGDB 1NVXQ 5FWNA 2E49A 3KT6A 1R9GA 2Z83A 3BF8A 4L28A 3TTSA 1FMFA 1JDBB 4WKNA 4HEA6 4UQPA 3TNDA 1IK4A 1W76A 1KRXA 2WP0A 1VCMA 2GCOB 4UUPA 2HU8A 4NBKA 3OZRA 3TEMA 4NDNE 3HUFA 2G1JA 3DNPA 4FYXA 3I9LA 3HRKA 4BJ3A 4Q48A 2ZBRA 3R4VA 3KUDA 4NH4A 3AIKA 3AR9A 3BXHA 2Z98A 1TKAA 4AY5A 3CUYA 3KAJA 4JUBA 3RU9A 3PVCA 4PO3X 5E6SA 5BSVA 4U00A 5KYYB 2QRUA 2GK3A 4AM8A 1DWUA 1SR8A 4BBAA 4ZCMA 4E5NA 3AIMA 1A27A 2AD5A 4NENB 4A0GA 3DBHA 4R40A 5ES3A 4LY9A 3SOPA 2VPZA 3R3HA 3ZLJA 2WQZA 4Y6PA 1XLWA 4CODB 4KQWA 4FM9A 3WHLA 2QF7A 4XM0A 1MO4A 5CP8A 2OXRA 2AC7A 2WAAA 1YK0A 3AV3A 1ZM3A 4CV0A 4CU2A 4US2R 2Z57A 3LQ1A 3WLKX 4R83A 4ENUA 3ZIAA 3D8HA 1COZA 1OIXA 2P0EA 4RJLA 5LQSA 4UNNA 2XNDD 4TMXA 1HPLA 5A9RA 4KQ6A 4GYJA 3W79A 1ZN2A 2JHFA 4TXHA 2OZEA 5THKA 3D3WA 1WPRA 4M55A 4KX5A 4M89A 2A6PA 1KAGA 3KRTA 3W8EA 1PR0A 1QE3A 3WXBA 4URVR 2BZ1A 2QLBA 2DUUA 2D4HA 2VYFA 1NVGA 2K4MA 3VHRA 5IWCA 4UTPA 4G6ZA 1KPHA 4QUAA 4BN0A 1MOSA 3MAJA 1BA2A 1PT7A 1T9DA 4JB0A 4KVFA 4LYEA 4O4JB 5DOVA 3ENNA 3KEQA 1Y98A 2P3SA 2X6TA 3HVUA 4LWQA 4MGYR 3FRJA 1ADCA 3ZGVA 1K7YA 2CBXA 2WJ4A 5L9AA 1IONA 3A6JA 4BBZA 5JH7B 4O3FA 3M1AA 5KJEA 5JASA 2Q2QA 2LCFA 4FW9A 1JXOA 2JLQA 1R00A 1Y9AA 5JXHA 2H0RA 1SZJG 4BV9A 3N2EA 2I3AA 4R51A 4X1KA 4R2JA 2IVFA 3M4JA 3O74A 4LVCA 3RB8A 2ZWIA 3BTOA 3S1AB 5KYGA 3GPBA 5C80A 2OY0A 4P0QB 1UJCA 5TMDA 5KNLA 2Z9DA 3E27A 4NIMA 2XUPA 3SIXA 1LLCA 1G8JA 1ZS9A 3W2TA 3X1KA 1O4WA 1VPVA 4O2BF 1IWBB 3CF4G 4IFIA 4WRRA 3S70A 5HKLA 4ENRA 1C29B 1OH5A 3LCCA 3R7SA 1ZRHA 4PY2A 5HS6A 2VAMA 1Y8RB 2W42A 1RAHA 1J49A 1X2BA 4PSVA 4FFNA 3VV3A 1EK6A 4E09A 5IKMA 5TMPA 1K4MA 1UZMA 2RONA 3UAYA 4UZSA 4KXUA 1YXMA 1MO2A 2QVGA 3D8TA 3NBMA 4BGVA 1P3Y1 3W04A 3ZHBA 4Z0PA 4U6SA 4CKWA 3PCRB 5A7HA 4QXOA 1DC8A 5CUQA 2FGKA 2P2CA 1FMJA 4ZJYA 4E70A 2GZ3A 2AZXA 2P2NA 1L7VC 2P30A 4M83A 3HCBA 4HWKA 5HJ5A 1JALA 1QU2A 2DMRA 4C2UA 1WG8A 3NO4A 3OKAA 3PQ6A 3OIUA 4RTLA 4EJ2A 2IS1A 4ZZ0A 5CNMA 2ZS9A 1AKWA 1CVIA 4PN7A 4FHEA 4KDCA 1UJ5A 7GPBA 2ZSDA 4MW0A 4MA4A 3Q9NA 1QVWA 2ENWA 3L46A 2EG5A 2EFHB 3L7NA 4QHTA 3U62A 4Q47A 4JJIA 3S2EA 2XE8A 4J4BA 1L4GA 4LKOA 4FGJA 3ZS9A 2BM0A 3FKSD 3EQ9A 2X5KO 2J48A 2XTZA 2DBYA 5BQOA 3K9HA 4LXYA 5A6VA 1EFVA 3SHQA 1QHXA 4BDSA 2H8GA 1SOWA 3R7WB 3DEYX 4WCFB 4F11A 3RT9A 2BBOA 2G7MC 1ZNWA 2QENA 4MI1A 4Y7DA 3GFFA 2DGDA 2HH9A 5EXDA 3VO1A 2Y4OA 2I3ZA 3GGOA 1USVA 4RHEA 4BAUA 4RTJA 4YLGA 4YYEA 3EF1A 4UNPA 3RS3A 5EKXA 1GIAA 2BMAA 3R9XB 1T3HA 3ZHOA 1IWOA 1T9BA 1TEXA 2FTKE 2RE8A 1N6RA 3WLHA 2AXNA 2HLPA 3RSHA 1O95C 5K0FA 3ES9A 1KAMA 2VDQB 4MGEA 3N28A 4AO7A 4AZSA 1RYDA 3IAFA 1NUHA 5HMLA 3BMCB 2Z4TA 2XMRA 3DAHA 3LPDA 4FYKA 4O8CA 1GGVA 3EW9A 1E6UA 2R4TA 4AF7A 1EVYA 5ED0A 2GEJA 4RDCA 2PUWA 1EP2B 5KPJA 4NONA 3MJVA 3EE6A 3CX6A 3QYFA 3ZOKA 3AY0A 1U9IA 4WXPA 4X90A 4AZ3B 2BLNA 3BF7A 4JU9A 1M2FA 1EVIA 4YIKA 3ZCPA 4NFSA 1QHFA 5SZIA 4I2NA 1V3UA 4KRYA 1A9PA 2J8ZA 3WMFA 1OW3B 2GASA 3HU1A 3O1IC 5H3HA 2ORIA 2GXSA 2MDTA 3RIHA 1YE5A 4H7IA 3R0JA 4P5EA 4IFTA 2Y93A 3GJ3A 3I9OA 4XGIA 5TXGA 4GSLA 1DQYA 1ECBA 3KL4A 5D5PA 5GM2A 3MJTA 4X66B 2DFVA 4GVXA 2OM2A 1V9CA 5HRCA 1UJ2A 4KBFA 7MDHA 4FJ1A 2X0FA 3V4SA 3BCRA 5I7VA 3GELA 2Y2VA 2ZSEA 1S96A 3IXLA 3LH5A 1M8GA 1N7GA 1IHXA 4ZGWA 2IDKA 4LI0A 1TGVA 1XN4A 3H3FA 3Q9SA 1H42A 3C3BA 2JIRA 1EX6A 1JZSA 3PJFA 4UPDA 5HUQA 3CTMA 1BU5A 1U0NA 1ZXLA 3HB7A 1CIJA 3SC2B 2O8EA 2OP1A 4Y1GA 5AKYA 821PA 5L8VA 2NU7A 1ZOOA 3TJRA 2QX6A 3WWZA 5IXJA 1X1QA 1MOZA 2SNIE 4U7HA 3F4LA 5TPZA 2QN7A 4E4YA 3I6MA 4N40A 3N2KB 4HFNA 1H8HD 1RKUA 4UVEA 2NN3C 3LAWA 1R66A 2C92A 2VP0A 3O03A 2OFFA 3UKJA 4AG3A 1YFZA 4KNWA 4QC2A 2C5GA 4QNMA 1Z6YA 3NGMA 3PQCA 3U26A 3UQZA 1KGSA 1F0YA 1OLOA 4V02A 4DNFA 2GH1A 3DDWA 3UMFA 3EDRA 1AKQA 2YJTD 3DKRA 4Q1CA 3HK2A 2E2WA 4B75A 1G8MA 4ZDIA 1WW3A 5B6IA 4QVKA 3E0QA 4Q9HA 2WT4A 1X38A 3EEYA 2ZI6A 4LJLA 3UWSA 3W2GA 3PEYA 1ZINA 1I6LA 4N9QA 4UBMA 4NE7A 4LSGA 3DMTC 1R0KA 3NHUA 3RAJA 2QB5A 1U7HA 5K8IA 5DIZA 4D3XA 4HX9A 4JUDX 4QODA 2PXHA 3ZD8A 1OX6A 1PBNA 1AGRA 1LRKA 3AP3A 2UUBB 3UK7A 4JLSA 1FFSA 3BMCA 3W0LB 2RAPA 4IJMA 1K3UB 1AB6A 2IGTA 2D74A 5HPYB 1SD5A 3OT1A 4YALA 1RXYA 4KSYA 3O7MA 4EYEA 1CUXA 2CMHA 2F8MA 1Z5VA 2IDJA 4IIJB 3TCXB 3C0KA 1M8JA 2J85A 4KPUB 1K0UA 3ABOB 2NO5A 3JYNA 1PWYE 4DHEA 3HXQA 3WA6A 1XEWY 1JQKA 2A9JA 2VK8A 3P96A 4LRXA 3TW6A 1J99A 1ZO8A 4HEJA 1NVDA 2JI9A 3C74A 4OLJA 4RF4A 4UU1A 3U1BA 3ZJ5A 4XPZA 1KP2A 2O0MA 3URKA 2HSZA 3KSMA 5G1NA 1JXQA 2I71A 1Q7BA 2YXLA 1KYYA 3OCZA 4MKZA 1OHHA 2XUDA 2P27A 2VHXA 1MEJA 4ND8A 2WOJA 5DSXA 3MJSA 3WB2A 4PYJA 2IOYA 1L7XA 2WAYA 4DZRA 6REQB 4BMVA 4LUCA 3GMIA 4YAJA 1II9A 5ALXA 1XCGB 4R2WA 3KSRA 4N18A 1E2HA 1RWWA 4KQ9A 3GWGA 3NWEA 1P44A 2FMUA 3QKWA 1ZD9A 1T9ZA 1CJBA 1N5OX 2JGFA 4HAYA 4MYUA 3U3OA 2XDWA 1P81A 1ZUNA 3AKEA 1Z74A 2WAOA 1R8SA 2JHAA 1ULZA 1YRHA 5FOWA 2WKQA 4TYMA 3EF0A 4WBXC 1DINA 3JQ7A 5BW4A 5DGDA 5HX7A 4Q9IA 1UEIA 3PKIA 2IOFA 2R6ZA 2C2ZA 1U1IA 5CA0A 3EVZA 2H18A 3AFIA 3CF4A 1TQ8A 1DVRA 1Z5OA 4HEA1 3BMOB 1NKVA 1L5FA 2EP5A 4LJSA 2PMEA 1RE0A 3WAKA 5FLYA 2I6UA 3ETJA 5L40A 1YQ9A 2AVNA 3HI6A 9LDTA 4BQPA 1J8QA 1DAKA 4RLHA 1IL0A 1E2UA 1QGOA 2VPXA 4U0KA 3TEFA 4HUTA 1T5TA 4OI4A 4PFQA 1CJVC 2ISQA 4QARA 3ROTA 2DFKB 1K4YA 5KC9A 4DR6B 3OD5A 4IJVA 2MHCA 2D0PB 1YRAA 1YJ8A 4LDJA 2G1PA 3HXKA 1K6XA 1WDLA 2GJ9A 1V5FA 3D7MA 5IXSA 3QITA 2EYUA 4L27A 2X1HA 3ESBA 3KEOA 1WHSA 1QAOA 3L7DA 1G2OA 3IT1A 4QBTA 3T7KA 2Z08A 4ZCRA 5A02A 4CCAA 2YFYA 4FD3A 4PCUA 3G7SA 3AVXA 1A97A 1E6CA 4D0NA 1T6BY 2DHRA 1EBFA 5JJ5A 1NX9A 3WADA 2VSOA 4TKVB 4M1KA 3H8WA 5ICSA 3EGXA 3PUHA 5KYWB 3E7FA 3FPHA 5I8ZA 3R7FA 4B4WA 4KN6A 5IVPA 4NZPA 3G2NA 4FC6A 4OHFA 3TI9A 3LTNC 3OZWA 5HXAA 3HXPA 3L05A 1W88A 5EIOA 2DLNA 4AJEA 1TQ4A 3C2QA 5LOVF 3AJAA 4DB2A 1JPJA 1G4UR 1MIOA 1J8YF 1Q3TA 3MPUA 4H3KB 4MI6A 4KPEC 3OPYA 1ORTA 2HJ9A 1W47A 2O8BA 1LJLA 3B3JA 3JQCA 1W88B 3LD9A 4G07A 2CNOA 5B1HA 3N70A 3IOYA 3L7LA 4UM9D 1F2VA 2BW0A 2VC2B 4WOPA 1MQ9A 5JTUA 2PX5A 1QDUA 3LDFA 3UN1A 1EG2A 1YAHA 1Z35A 4JYAB 5ADHA 1BN6A 2IF2A 3W90A 4AICA 5A2QA 3TB4A 3U13A 2XXAA 1W4CA 4LZNA 4DC1A 3WA7A 1FNNA 1I14A 4GNKA 4NX2A 4TYQA 1A9SA 2YHUA 4J0EA 3QQPA 1TU4A 2OLKA 3IEKA 1J21A 4LKRA 1YS4A 4PAWA 4ZI3A 3THYA 4N5DA 4DA7A 3GJTA 3GLGE 3PZBA 2YDYA 1NDUA 3LQFA 3AI7A 3HB0A 4MVJE 2RBEA 4H6WA 1DRUA 4P5DA 4IYJA 1BCRA 2ZWMA 4QFCA 3IBSA 5IZCC 5A0VA 3DW3X 3U49A 4Q39A 2AXQA 3ZE6A 4MGHA 1U8TA 4PLGA 3QVXA 4WN9A 1VG0B 2Y0BA 4TV8F 5EJFA 4MS4B 1VBNA 2ONYA 2IQIA 3GRAA 4NQZA 2G1KA 1YJQA 2VUSA 2WRZA 4I9FA 3DOFA 4F9EA 4M99A 4FR5A 4MUMA 5HJEA 2QQEA 1E8DA 3DUWA 2P9FA 4XWAA 1P4AA 5K03A 1Y6GA 1JUDA 1DGQA 2VT6A 4I1IA 1GNQA 2A57A 2ADFA 3CLSC 4INJA 3AB3A 4J76A 4JLMA 4Z8XA 1E2IA 4PV7A 2FEXA 4GPIB 3WGOA 3EGCA 3WLAA 1IVNA 1WQ3A 1S8AA 1TD9A 3NDPA 5CCXA 1PKXA 2V58A 5IX8A 2HO5A 1IZ7A 4CMJA 2VCEA 1KHTA 2GN4A 1GZ7A 2OFXA 2IEBA 2GVZC 3CBGA 3E8MA 1YB6A 5TT1A 4A2PA 2EBUA 2H9IA 1T2EA 4JJAA 4GW3A 4B43A 5LMNB 1U0GA 4PZZA 2WIAA 4Q1BA 3ZI4A 3LDHA 2X8AA 3OZ7A 5E38A 2N9UA 1UQTA 1S9HA 4ETWA 5BR8B 4LDZA 3QWIA 3GRCA 1HE5A 1GRQA 3RSZA 4KKVA 3LGXA 1VA4A 5KQLA 2HHLA 3LY7A 2MYUA 3A3PA 5G0VA 3A7DA 3QOWA 2O2ZA 5LDHA 3FPEA 5ITZB 1HO3A 3OA2A 4OB6A 3AXTA 3I58A 1CR1A 2JBAA 3KJGA 3WBBA 4LBYA 1BO6A 2GN2A 9LDBA 3PC2A 1NY5A 1HX7A 2OBFA 5E7QA 3WYNA 1E5DA 1TPZA 4P7JA 4Q24A 4Y6RA 3C3PA 1KWKA 3CVWA 3CH5A 2ZJ2A 1GA1A 5TV2A 1RPNA 1U0RA 4RTSA 3HUTA 1WU8A 3ROXA 3ZTTA 3KCNA 1QTRA 1LLDA 3BEDA 3HL4A 2CZGA 4OHPA 3C5HA 1NDQA 1VJGA 2PZKA 1LUAA 4OYHA 4YCDA 3OHPA 5CG1A 3IE0A 1VCOA 4Q4HA 4XB6B 2VF5X 1DQSA 1R6DA 5IAAA 1S8FA 4EHIA 3AUXA 2ZQ5A 3UUGA 1U2SA 3H11B 3T3MB 3VHXB 5K0EA 4KIUA 2Y3IA 4ZVKA 3W5BA 1VL0A 3FSEA 4RIGA 2XZDA 1YBFA 3TBFA 1AM4D 4S2UA 1MFPA 5F4ZA 4OUKX 1MH1A 3AVQA 3NAZA 3OZDA 4D3ZA 1CEEA 3HKEA 1FMTA 3A1NA 4QGAA 4WK0B 1UBNA 1P5HA 3ZU3A 4L57A 1Q84A 3F97A 2JZNA 3OT4A 1RW4A 4R1MA 1N25A 5C3UA 1QCZA 1VSBA 2YW2A 3FWNA 1EESA 3TD6A 4KAXA 2Z9BA 4GWKA 3QFSA 5KVVA 4JDUA 4D9BA 3B9BA 2QX4A 2WNSA 4QTZA 1FS6A 1XNJA 4RLSA 2VI5A 1V96A 3ZZMA 1QH1B 2J33A 3FPCA 1WY5A 4DY4A 3LX4A 1U0JA 3G2JA 3FYSA 4A73A 3HM9A 1EWVA 3DF9A 2VAXA 3NANA 4QL3A 1EQAA 2FOLA 3V8VA 1NURA 2VXOA 2A78A 3I5AA 4HVAA 2EZUA 1T2AA 3GGSA 2JGKA 3G0GA 4IXWA 1EEXB 4DCTA 1R6UA 4S0ZA 3WNCA 3B7PA 3EA4A 3DDCA 3JYOA 3L7AA 4J16A 3TXXA 4E1VA 2GZ2A 1M6WA 1LNSA 5EA2A 5FYDA 4MR8B 2O2SA 4ND3A 1YCDA 6GPBA 3MZ0A 1Y3FE 2BFBA 4W6QA 2RI0A 1EVJA 1K2WA 1SC9A 1YBHA 2HSWA 4WINA 4HYEA 5I7UA 4V0NA 2PV0A 1BDHA 1KI6A 3EZGA 1DV1A 1HDGO 4MR8A 2ZE8A 2H4ZA 3LDAA 4NK4A 3DZKA 4YRLA 2IWHA 5EMMA 3ZWDA 5BVGB 5IBCA 3NM4A 5IC4A 1G21E 3GUVA 4NCKA 1WP4A 2EW2A 2Z3ZA 4MKIA 5TX7A 3PV0A 1FMCA 1VFPA 1KZ4A 2ZB8A 4MW7A 1MJ5A 2HMVA 4PQRA 3QOYA 5B3JA 1PJTA 3QUAA 4B84A 3WO0A 3U6KA 2PEZA 3MXOA 5KNCH 2EDCA 4U7JA 3FX2A 1ODTC 2WU0A 2GLXA 2Z2JA 4QOSA 3SKXA 3DC2A 4F1KA 1L4BA 2ECFA 1PFYA 5J4KA 4AY3A 4U5QA 4Q93A 1UK9A 2X9LA 3C98A 2YASA 3GG9A 3T5CA 4MUGA 2C5FA 2O9JA 1JWBB 3A4NA 4Z9BA 5LQUA 5DCUA 1ONNA 1DJMA 3VVBA 3MWFA 1C14A 1QV9A 2X22A 3AR4A 1QC5A 2P9TA 5JZSA 3U7GA 3I1IA 1ZL2A 3R20A 2X15A 2AN9A 1AK9A 1NA5A 3LS2A 3O93A 4P1ZA 3DVQX 4WERA 1Y34E 3MRXA 4DDVA 3HCCA 4ZANA 1W49A 2Q3FA 3U09A 3AL0C 2OSVA 2NU6A 4D4HA 4WXEA 1ZG3A 5TS2A 3MNFA 4U8GA 2BEUB 3ZV5A 1JIIA 1P0CA 1XVAA 2PH1A 3L43A 4KP7A 4J0JA 1P18A 5E7MA 2VHQA 3EJ6A 4HDMA 4WASA 1NF3A 3UJBA 5F3DA 5K2OA 2JGNA 1HM5A 2H7XA 1CJUC 2AN3A 4UMVA 3RYHB 4D0RA 1F2TB 4ZZ1A 1NG9A 2ZCJA 3ZCVA 4AQ7A 3K9LA 2B20A 1MP0A 1NJ8A 1PJBA 1RMYA 3GNLA 1XD8A 2WJVA 4KFSA 3JSXA 5KWVA 3BC1A 1VE7A 1AGPA 3G89A 1AU9A 3LM8A 4MICA 5A6SA 4HGZA 2OD2A 3B3QA 3TXYA 1T5DX 3G02A 1E2KA 1U3FA 4Q1FA 1XCMA 1X3SA 3BBPA 2IXFA 3B6ZA 3CF0A 4L2IB 4DMMA 1PJ4A 1UK6A 3NI2A 2JEYA 3LMKA 2V6JA 4W1QA 2DBQA 5TY0A 4BAZA 3CGGA 2G83A 1EU1A 2ZBPA 5C8DA 4YJFA 3ZDCA 2V96A 3EEBA 1GZSA 3VR6D 4DDUA 4AB1A 4IJUA 4Q5IA 5CD1A 2XD9A 2O2GA 1M73E 1P6XA 4BWGA 4FOLA 4PN3A 2QUIA 2X8BA 1AUVA 4J4HA 4ML3A 3DEHA 1RU3A 4Z86A 4KACA 3GVXA 4NPAA 4XQGA 5H0IA 3EWIA 5A5GA 5IRCD 2V0NA 5CHEA 4YCMA 1E3LA 3PSAA 2CB0A 1MVOA 2EWVA 4M8NE 3SX2A 6ABPA 4P34A 3BBLA 1H6BA 4G1VA 5EWJB 2C42A 3FKSA 2C7QA 4MYHA 1K5PA 1XTQA 2FMKA 3PRJA 4IHJA 2YN2A 4H15A 4RMHA 4BYGA 4DRYA 4CLRA 1A96A 4G5SA 2ZDGA 3Q7TA 4PWYA 4W7IA 1T5SA 5ALNA 1HLFA 1HDZA 1X8XA 2C07A 3BS4A 4U6NA 4WKBA 5TPWA 4J9VA 4F91B 2CKMA 4EJ0A 2O0LA 3MLBA 2J9ZB 2RHHA 5JSQA 2JW5A 5A0TA 1JKJA 3TZBA 1CLEA 3VDQA 4AQYB 3UW3A 2Q99A 3DE5X 3OH8A 4E5DA 2G71A 3FCSB 1A8SA 2E4VA 3PE3A 3NGXA 4DLWA 4JVOA 3DHEA 1FJGB 4H35A 3REFA 1R8QA 3TN7A 1ODCA 2HJRA 1ODIA 2BGGA 3NTQA 4E12A 3KELA 3A6ZA 3IHWA 5DHRA 3WLQA 2Z4RA 4HQKA 3DXXA 4GMFA 2W6PA 4B4VA 5K8UA 2GBGA 2ZE5A 1N0UA 1UXHA 1FVOA 3QXGA 1VJ5A 4FDVA 4LTNA 2W8ZA 2FW9A 4X45A 1NVMB 1OI7A 1NVUQ 3U7HB 1QRSA 3D3EA 3P5SA 4QPJC 2XNJA 2E0IA 1XTZA 2ZJ0A 3WP1B 4Q3OA 5G1OA 1SU7A 2WFZA 4TYNA 1U2GC 4QULA 3TW4A 4Q6WA 1CR2A 1XZLA 1Z2PX 1NBHA 3U3ZA 3R3WA 3CLUD 1YQGA 2A5FA 1WMDA 3NHYA 4PQGA 5LD2B 2KMLA 3OLWA 3S1AA 4JI3B 4EFMA 3N1UA 2PE5A 4KREA 1AGNA 2Q8PA 4DV6B 1DG3A 1GLVA 5TDHA 1YS6A 1ZIXA 3WMRA 4G5FA 4HWPA 1RXWA 1USWA 4KR6A 3B1XA 1HLPA 3TPZA 4YX9A 3AUAA 4PYKA 3HFGA 2BUAA 1RJGA 3RS5A 1UEJA 3GUCA 3IMEA 4E33A 3ENQA 1I51A 1SEPA 5KVCA 3IHLA 2QTCA 4ZO9A 3WZ2A 5HKKD 5CDFA 3H18A 2OGTA 4PLZA 1F8XA 1YQXA 3GJ5A 5JS8A 1U8AA 2ZRQA 1OFTA 3GQBB 1YOVB 3WBFA 4PBSA 4IEIA 4BRUA 1LDYA 4I4TA 1SU6A 2F6RA 4DXDA 3RNOA 1PX2A 1PG2A 3KNZA 3KCQA 3OOJA 3K70C 3IEIA 3UT6A 1K8RA 1L6IA 1T8RA 3TD9A 1J4AA 5EKTA 5CB6A 3IQEA 2QQFA 2UYGA 3ITKA 4ZOBA 4XLLA 4TYPA 1FFCA 2O2EA 1T29A 3ZQKA 1WNFA 2BTOA 2QWXA 1MB4A 1ZBQA 1EMDA 2FB9A 4M49A 3GLVA 4JP5A 4XUGB 5HF8A 4BX2A 3RC7A 1WF6A 3G5MA 3U5ZB 2JEZA 3WZLA 2HV8A 3SHFA 5HCNA 3T7JA 2INGX 1WB5A 1OB5A 4AY2A 5DM1A 1ZRMA 5T3YA 4LNHA 3OU6A 3DDHA 1LLUA 2JFUA 5EHGA 4ER7A 5B58C 3JAMA 2WG1A 3TTXA 3G2QA 3ZV3A 5DMXA 2X86A 1R74A 1YO6A 3GBSA 3KSUA 3G68A 3DLIA 3NATA 4KAFA 5COBA 4RV5A 3SIPA 1MB2A 2RHJA 3C7TA 4MVJF 1PKEA 1TQ6A 1RPTA 2YZ2A 4NBVA 4WD3A 1KVRA 5EIAA 2YNMC 3EARA 4I5FA 5IJAA 4B4KA 4N5IX 3HBMA 5A03A 1Z82A 3K6SB 4JYZA 1QGAA 1X1SA 3VPBA 1OBCA 2DQYA 1NI3A 1RFGE 4NU8X 3PB3A 3UW1A 5HTKA 1NBME 3MMNA 1NBEA 2GAIA 4RORA 5K51A 4I1PA 1ZRNA 1EX1A 5JPDA 1YKFA 1G3IA 1TECE 4EENA 2JCYA 3E9NA 4J43A 1TKCA 2MSWA 4M6WB 4E4TA 3KR9A 5JH7F 4MDYA 1RDFA 1Y3DE 4RPGA 5JSUA 3PT5A 2O54A 3QU9A 4N0MA 3WL6A 5DNAA 4ARBA 2NUAB 3P1JA 4DIUA 3E3LA 1KXJA 2CFOA 3SQOA 2I0FA 3RT1A 1F51E 3PI7A 4PAQA 2I7VA 1CY1A 1EK0A 2J7PD 3A27A 4FPXA 1QIKA 5KSZA 5K09A 2B78A 2PKEA 3T7DA 2XOEA 1N1GA 1ZCZA 2NUAA 5FFFA 5IMBA 4RF5A 1NNUA 5C4GB 5DP2A 2BMVA 3R9KA 2FKAA 4NY1A 3VQTA 4CPDA 4EFDA 1J97A 1ZJJA 3BK2A 4RLQA 5F3RA 1G9XA 1L3IA 3KXPA 3JQAA 4URZR 4X5OA 2YXDA 4XFDA 1SHZA 2CLEB 5HZKA 3C97A 3NOVA 4ZMSA 5I5GA 5FORA 2EOAA 4G2TA 5E0KB 1MOPA 1SOUA 2DR0A 3VAZA 3ZHUA 2AD1A 5CLLA 3ZCQA 1ZONA 2QTVA 3DLCA 1K7SN 5FADA 1MD9A 3VA7A 1PSWA 1XCJA 3Q7EA 3E9YA 3CT6A 3GPIA 2UYHA 1PV4A 4J1TC 1FLAA 1N2OA 3L8DA 5AW4A 3MT8A 1TO1E 4CCYB 2OOSA 1WCIA 2PSJA 1OWNA 4HSGA 2FF5A 4IS3A 1A8IA 2JJQA 2DPYA 4BVLA 2JLUA 1GN9A 1XZHA 3DFIA 4FN5A 2J0UB 2P41A 1JFFB 2PH7A 2RAUA 4X61A 3ONNA 1OPRA 2PZBA 2ZRHA 3DAGA 5FCDA 5L3RA 2VF8A 3R5HA 2KWIA 3ORSA 2RK6A 2JIZD 1ZMOA 1HY3A 3L3BA 1W93A 3LIPA 4DUPA 3QNMA 1Z6QA 2P7HA 1ZGHA 3E81A 1KYXA 3JATA 3NC1C 2ZSUA 2JS7A 3CIOA 1OBOA 5JNLA 4RXUA 4YCSA 1PLLA 2DXIA 4AXBA 2I9KA 3AM3A 2EQ5A 4GBMA 3KYCB 1N6IA 2X19A 3E5HA 1JLLB 3B9PA 4G89A 1GGEA 4UBJA 2XNSA 3JWJA 2F59A 3AVOA 4YRNA 5LL6P 5FLKA 4G0MA 2DT8A 2HREA 1VJ0A 1PK7A 1SB8A 1IUPA 4JJGA 1RXCA 2HYDA 3SR4A 3I61A 2X9VA 4C7OA 3UYKA 1MW8X 3EIUA 1S7GA 3AEQB 2NV2B 4QM7A 2PVSA 5AM5A 2HJHA 5DGTA 1TU3A 1GL6A 4HX2A 1QX3A 5JV5A 4QOJA 1YZKA 2PSHA 4EL5A 2IY9A 5IAGA 3WLNA 2OPHA 2CXPA 2QMOA 5GIOE 3QPUA 2QVCA 4ON9A 3IVAA 5BSEA 4KXMA 5LB4A 1DQRA 1NW8A 3KKNA 2J59A 3HJBA 3T4PA 1JG4A 1N78A 1IPEA 5EXPA 2OCGA 1Q0QA 4OSEA 2EZ8A 4V0LA 4BGDA 1EM6A 4RHYA 2A5LA 2O3RA 5FLXA 5CVEA 1BDBA 4HNHA 3ISJA 3T7CA 5JSHA 5EJ4A 3PIDA 2F9LA 1FJXA 2ZI7A 4HLNA 3ZDRA 3PPWA 1H2HA 2VYVA 2NPFA 2XITA 1N75A 2LPMA 5CG2A 1MBZA 2EDAA 3GARA 1KP9A 1Y7HA 2QNBA 4HGPA 4BV8A 1L5RA 3BIXA 1II0A 1NG1A 4U3JB 1PSDA 4E2WA 5LP6B 1UDWA 2WG0A 2EYQA 1P2TA 1MJFA 1I7PA 2OHIA 1F0NA 3IUMA 3NHLA 3ICWA 2II6A 2QRMA 2YHIA 1UL1X 1P7VA 3OZFA 4PHTA 1KDTA 4PX5A 4CCYA 4EX7A 3PUWA 3JQ7B 4RAOA 1JJBA 4C88A 1AE1A 5EIWA 1LV7A 1QFYA 4PO8A 2P0AA 2QXTA 4L9WA 4PXAA 3RUFA 1R0CA 5D3MA 5FYQA 1SUPA 2GBLC 1U0EA 1SQ5A 1PX0A 1A5BB 1RC1A 4IXDA 1MENA 1IU9A 1YS9A 2G4LA 1BX3A 2C9MA 2RIPA 1AS3A 1W36D 1P6UA 1Q0PA 1XNGA 3C6YA 5CT5A 1EE2A 3KKKA 4KR9A 3NTLA 3KV3O 2FN9A 2IA5A 3K6JA 1W9MA 9ATCA 2EL7A 4P82A 1DELA 4QPZA 5K8TA 2O48X 2Q07A 3E61A 4ZIRB 1U5AA 2GFHA 1M1XB 2VK2A 4KXWA 3VUFA 2XKKA 3CCFA 1WVGA 3MBIA 3L8ZA 4PNHA 1ADYA 2P5UA 4TSRA 1N4DA 4DJFC 1EB9A 3FUVA 2X77A 3R2JA 3PGKA 4RPKA 3MS2A 1CU1A 1QM5A 3S8MA 4CE6A 2XAUA 3D3NA 4FNAA 2PQ0A 1V0JA 5IVDA 1CNEA 4BPRA 1ZDMA 3DKIA 4XA8A 1C0KA 2F43A 1XK7A 2QAGC 2V98A 4Z53A 5FR1A 1FRZA 5EWMA 2H2GA 2X0JA 1J8DA 2C8KA 5IT4A 2XNDA 4C4RA 3N3BC 3DA8A 1YONA 2GMWA 4MLZA 4ALLA 5GGXA 5IKXA 3RFVA 1H22A 2QYHA 3SP1A 3T1OA 4QHSA 4G0OA 5K3AA 5EY5B 2QA5A 3HCAA 1CHDA 2FK7A 3EUFA 4O4HB 1G8KA 1RRKA 4HFJA 1KDOA 4EHBA 2HU7A 2ANCA 1VSVA 1CNMA 2C2HA 1ABBA 4UQOA 3FJ1A 4F3YA 3PFIA 2H1CA 5ARBA 2NO7A 4CG3A 1CP2A 2G5TA 1PNRA 3NTOA 4U63A 1H2YA 4BNGA 3UG7A 2C88A 3GUYA 3HA7A 4RHTA 1GL3A 4LZOA 3GHHA 2RH5A 1JTEA 1KMNA 1U1DA 3EW7A 3OF2A 2CYCA 4U3JA 4WEQA 4XDZA 5JZMA 3A1UA 1GN8A 3X1MA 3VNQA 2VOEA 3EYWA 1F8GA 3UJ3X 1MFZA 3QLVA 1JAIA 1TU0A 2BBWA 4OH1A 5CB4A 1H5QA 1S02A 4FFWA 1Z4PX 3JQDA 4WEOA 2IW3A 1A9TA 2D8MA 3PXAA 3RIYA 4LE2A 2QSZA 5TB5A 1DI0A 4DV2B 4DFDA 2I1VB 3VR5H 1N6OA 1P29A 3KR1A 4AFNA 3C8DA 4HQNA 4LF8B 3CYFA 3SE0A 1JDTA 4I1VA 3EFBA 1MEEA 1YBMA 3DT9A 5JXGA 2WD9A 3W9UA 4O4LF 2P9EA 4Q34A 4EHHA 1ZVVA 4HAZA 4YMGA 4JNCA 4FZRA 5BWCA 2I65A 2HIGA 4P92A 5HIMA 3MBOA 1T36A 1K7EB 1UBMS 2G28A 2Q5JA 2W58A 4HMPA 4F1WA 1Z62A 4Y98A 1V7ZA 5KPDA 3HRHA 2CXUA 3PUZA 4O02B 1E92A 2FPLA 3D2LA 3F6EX 3D4PA 2WD7B 2AFVA 1LLQA 4QBIA 4TSFA 1EEHA 3E5MA 5IYZA 1DXOA 3GLHB 2Y05A 4P3NA 4CEHA 3K9CA 4M46A 1N2JA 1WAMA 3ODPA 2MSLA 2Q1WA 1N2CA 3ITEA 1CY0A 2CN1A 4BE7B 3CEPB 4IV5A 4LNAA 4EUKA 4XCQA 1PDWA 2DBRA 2PX4A 1YWGO 1ZJZA 4YRFA 3ZJUA 3O9MA 4OQZA 3FFAA 4BLSA 2IUUA 1T0PA 1AKRA 4RO0A 2JLWA 4I6GA 1T2NA 2B99A 1UFOA 3H7AA 4N3AA 3QOXA 4MIKA 1X7WA 4RD2A 3AF5A 5JNVA 2A5DA 1HDIA 1G8AA 4BX9A 4N49A 2HL6A 4FLEA 4OFZA 2FSPA 2IXAA 1BA3A 2QORA 4GR5A 5K3FA 1VB3A 4I55F 1S2IA 2C8JA 1TTTA 2NV6A 5B4VA 3TGPA 1XAIA 3EVGA 5AJWA 1QHYA 2P5TB 1GPBA 1I5RA 4ECAA 4UQLA 3GLQA 3GUHA 5L51A 5A4MS 3B60A 3EC7A 5KTTA 2RGBA 2DUMA 1II8B 2CCGA 3R5JA 1D5WA 1GHTA 2VBCA 3WK6A 1RRCA 3RUHA 1F20A 1G2PA 3Q9LA 5AI4A 3WMXA 2VF4X 3NHFA 4X54A 1TF5A 4U2EA 4DWJA 3WWCA 1ZLYA 2DPGA 1RAAA 1FXUA 3L8EA 5F52A 1E5XA 1UAYA 1YZ3A 5E4JA 5CDYA 2CLCX 3P9SA 2A86A 4P4SB 5JXJA 3H0KA 4UNQA 4UUAA 4YP7A 4N7MA 3UMSA 4TVOA 4F21A 1DB3A 1TIPA 4MUNA 1VJRA 2FG7C 1RS0A 5F35A 3QU2A 4I8XA 1XVTA 3KPWA 1Q5PA 3IVXA 4MVJD 5IBQA 4UXHA 5BN3A 2ZJ8A 4HVCA 1NN3A 2ZJ5A 4FK8A 3U48A 4AJLA 2BONA 4MW2A 4IOKA 3ROFA 2FDXA 1KZ7B 1A4IA 1G21A 1M75A 1NN5A 2OK8A 2H1VA 2CEAA 1V26A 1FYFA 2HPAA 4H16A 3E05A 2JATA 1BZYA 3SF0A 4YMHA 1LBHA 3CCCA 5CT4A 2WILA 1B6RA 3U3JA 3VR4H 3TLEA 2J9GA 3JPWA 3WWYA 2DFPA 3NUGA 3QEOA 2MMGA 5F51A 2WY2D 4HPWA 1TYDE 2QN6A 1RXIA 3QKIA 3QHPA 3ZHSA 4Q9KA 1U6JA 3A9WA 3B3GA 4ZU6X 3ZCXA 4XRGA 1UKAA 5KUTA 3R8CA 1V95A 4RLFA 4JQCA 4RKWA 2GNAA 2H07A 4UAJA 3DR3A 3FYUC 1LCIA 1BOOA 2GPTA 4ZO6A 2HBRA 1T1SA 1XKXA 5ALEA 4D3YA 1I4WA 2W90A 1UQUA 2PO5A 4DW8A 2J9YB 4JFAA 1K5DA 2ODWA 1E2JA 3RKSA 3EOBI 2QRVB 3GVCA 1UOQA 3UWKA 5AJTA 1UOPA 2AJTA 1Y1QA 2EZ4A 3EDMA 4K86A 3U7RA 1C9EA 2FCAA 5E1OA 3D4BA 2JH9A 4BVAA 1RR6A 2IYXA 1RC0A 3OZBA 1NJGA 1PGPA 3PC8A 3PTLA 1TM7E 1EXMA 2ZTUA 4YQZA 4BEVA 3DFMA 2P4HX 3JV7A 3Q2KA 2BFFB 3BX1A 4MKGA 3RJMA 1DIRA 2AFHB 2YXPX 5BSKA 2OCYC 5DRYA 4OXKA 4TV9B 5DZSA 4FGZA 4TZTA 4YDRA 3CRNA 1GGHA 2DWPA 4G4SO 4ZT2A 3K0FB 4HLCA 3CNLA 4DL9A 3ZHXA 4EVQA 1YRBA 4MITA 2BJHA 3ECCA 4PRZA 1L5WA 1P4HA 5BVGA 3L4EA 4UBLA 5B12A 4KE8A 4Q05A 3TSAA 4CYMA 4TYYA 2A1TS 2B7BA 4ZAWA 3K0FA 4C0KA 4JELA 3PHCA 1JDZA 1TZBA 2ZIAA 4NZNA 3D3WB 5EEHA 3RUAA 5LBIA 2WJ6A 5FNZA 3E58A 4HNSA 3N2GB 3D7KA 3JWEA 3R44A 5HF9A 4RXMA 3BL6A 3JW8A 4FSXA 4LYYA 4HSEA 1OYOA 4KDFA 2VXYA 1YMVA 4HP8A 1SUEA 3P4XA 4B2LA 3OPXA 4WZBA 3H1AA 2VKQA 4N01A 5IKPA 1XPJA 2XWBF 2XF8A 3HN2A 2PWBA 2XTAA 4EW3A 1K5HA 1T0JB 1XU4A 4ITUA 4MKFA 4G85A 3UMRA 4AJOA 4C7KA 2I4OA 1YIAA 1V9SA 5A5EA 5GOTA 3F8SA 4G25A 1DG1G 2FLKA 4G5GA 1L5ZA 3CE9A 4OQNA 5JMPA 1F4LA 3ZGNA 2D0OB 4Z3DA 1BMDA 4RQUA 3OCVA 1JB9A 1W46A 3FSJX 2ZRMA 5IPFA 2RHOA 1E9VA 3OY7A 1UT5A 1JFVA 2I2FA 4AZWA 1GRRA 2ILVA 2IYNA 4QUIA 3TLKA 4CIYA 1HFWA 2BFOA 1V4VA 3B9QA 2PX0A 2NO4A 4D9JA 2NZ8A 2WU8A 4FHGA 3CX3A 5AVTA 3FVVA 3SBDA 1B6GA 1D7OA 1AB5A 1YU9A 2I1WA 2WEKA 4XVCA 3FR8A 2HR1A 4OLAA 1ZA2A 4MW5A 3I2YX 3WRVA 4RKYA 4E5PA 3TR0A 1JSLA 4D41A 2ZUFA 2E7ZA 1JYEA 3AO0B 3ONWA 2X3UA 2F1KA 3ROKA 2ALJA 2BKXA 1CRQA 3ITDA 3GRRA 4WVFA 5FULA 5CPBA 1B0ZA 1SKMA 1U94A 1O97D 3FN4A 2P65A 2PJZA 3PGMA 3EULA 1XU7A 1MV5A 3SXUA 3RYFA 2B2CA 1WDTA 2G17A 3PE6A 5D51S 3TZ6A 1B3BA 1UKEA 5ADVA 5EP4A 5K7SA 2FZEA 1XMIA 5EIFA 4A1OA 4HY3A 1FP7A 3AM5A 3W1WA 5C8VA 4V1CA 1DKRA 2F3PA 1F06A 3QFRA 1FP4B 1UBKS 2CE7A 3PPYA 4KAAA 1ETHA 1N2IA 3FDZB 4WJKB 3C3EA 3CLVA 3TI7A 1T3LA 1JAZA 4YUXA 4L0MA 2OMEA 1Y1KE 4J8PA 5YASA 5K9ZA 3R23A 2IYVA 5IUKC 2UXDB 4JEUA 3L1UA 3LO8A 2ZM6B 4QDUA 3ETNA 4Z6KA 4GRDA 4TXNA 1DUVG 3U60B 4X71A 1R6XA 4RK4A 1EFVB 3OZAA 4F9TA 3PCTA 3RFUA 4EUFA 2YWRA 3KZVA 4HLQB 3LT1A 2CV2A 1XU9A 3AONB 4H1HA 2FR8C 2EJCA 4BE9A 1HE3A 3UV6A 2RIRA 3E3OA 4LVOA 3TRFA 1C30B 2JH8A 3VKHA 1F3OA 1X7DA 3KKEA 5EFOA 1GFSA 2PWZA 5CLHA 3M5WA 4YBZA 1HDXA 1Q7TA 2HN9A 3H6GA 4NE9A 2PLRA 5F78A 2FE4A 2IYEA 3S2UA 4AS3A 1C0IA 4P2BA 2B4KA 3DTVD 4OI0A 1NVFA 2FNAA 4LWZA 4ENQA 1U63A 4NYIQ 1SUIA 2EJVA 2I4IA 3AW8A 3A1WA 1FQWA 1XP5A 3C6MA 2C04A 3VNRA 3SDSA 3PTAA 3VYWA 3OFSA 3ZI7A 4K8RB 1E6WA 4YB8A 3ZEAA 4UHEA 4HNVA 4WLEA 1SQGA 1J9ZA 3X0DA 1U28A 1ZC3A 1J22A 2Y1LA 2O2XA 2ZTSA 2BGLA 3M5CA 4HRVA 3VSCA 3HXOA 4JR0A 1XTBA 1TUBB 5L4SA 2ZRNA 1ZHOA 5EP3A 1E2GA 1RAFA 2Q1YA 4MMZB 4C6HA 1YBVA 5EIXA 4D44A 3H1GA 3LWNA 3ETDA 1FNDA 2F1RA 2IHJA 3CNEA 1PHRA 4TVSA 1OR8A 4KBYA 4UEQA 3WRXA 2XQJA 3LBIA 4W7SA 5JCJA 1EYZA 3OUUA 4UDYX 3X1YA 1XPUA 1EXNA 3C1AA 1DIBA 1VHJA 1YZQA 2J08A 2P78A 4JROA 1IHDA 4LW8A 3ZDYB 4ARVA 2VPIA 3UBMA 3VPAA 4BO3A 2IXTA 4C4ZA 1H8ED 2MTBA 5KC8A 1W5EA 2CT8A 3G6KA 1RRGA 3C3DA 3G9UA 2VZ8A 3MOGA 4TRMA 3ZDBA 2V55B 1ND5A 5J3JA 4E6PA 1YZTA 3RSQA 1NV9A 2Q1TA 3AH8A 3E48A 3EXIB 5G3YA 5JSYA 3SQMA 4D8VA 4OU5A 3I6ZA 5L3ZA 4EA7A 1XAHA 3IDAA 1PNOA 2WUDA 1M6VB 3WNZA 3ZGOA 3VZCA 1H2BA 2A94A 3EN0A 3EUWA 1UBGA 1KGDA 3SVLA 2HRZA 3T1YB 1EFRA 3EY4A 4HJXA 4NU5A 1V1JA 3Q8WA 4LJ4A 1BDIA 3OY2A 1TX4B 3LO5A 2WWHA 2N1BA 5DI9A 5F2NA 3KKOA 5DWVA 4QVGA 5EXEA 3O8RA 1EG7A 1V7PC 3PUYA 1Z68A 2QRNA 5JQGF 2XUOA 5GJBA 2C4MA 2K6GA 1WA5A 3AFOA 4PLHA 3GUZA 4ZT7A 3EPHA 1K0FA 3S2YA 1YNOA 5I8PA 3IBYA 1RHRA 1DLJA 4JIGA 3DM5A 1LDGA 2C2YA 2PRYA 4ISBA 5AM4A 3FVRA 1BRMA 3NFYA 4FP9A 1AV7A 3U19A 1ZH8A 1XYYA 1U1GA 1ONOA 3RHSA 1ENZA 1UIMA 4MKHA 1IUOA 4RQTA 3E9EA 1E94E 4RJJA 2Q0HA 2WMNB 2YX1A 3AVTA 3P2KA 4G4IA 4DOMA 2ORYA 5IAEA 3GP5A 1TIKA 2A58A 1PZFA 3KB6A 3COZA 3IRUA 2AG8A 1VJTA 3NV9A 4LV5B 1QZTA 4ZQEA 2WKRA 3VSDA 4WVLA 3SHWA 1D7AA 1WCWA 2IITA 4JBGA 1KIMA 3H9JA 4WK6A 4DJAA 4IXMA 1QVRA 3VZBA 1JXMA 1VSTA 3KZ1E 1WKVA 3ETEA 3SZUA 1T6ZA 1TK2A 3ANXA 1I2DA 3BTUA 1B2LA 5H02A 3UHAA 5C52B 3H19A 2GFQA 1OAAA 3H8VA 3IR6A 3L93A 1ISJA 1WXHA 2YFQA 4PAOA 2BEWA 4PNPA 4R68A 4F2HA 1N32B 2AKYA 3GLFA 5FV7A 2JDID 4UASA 4YNBA 3WSVA 3VR2D 5BWNA 1X8JA 2PU5A 3BRQA 5E8RA 4J0GA 3TLGB 5I7EA 3OG9A 2WU4A 4EM6A 1NAIA 4EIWA 2Z1DA 1GQFA 3SE7A 1X94A 2Q4EA 1J7JA 1Z0AA 1OXUA 4BZZA 1DWPA 4M6WA 1VMAA 5FBVB 1HDYA 4UMFA 1KBQA 1E2NA 2LE0A 1M72A 4EP1A 3BMQA 4B6JA 4EG3A 5BPHA 1HOTA 3JALA 2PGLA 3S68A 4KQ1A 3AY3A 1GAWA 2VJQA 4JOCA 1HE2A 1LBQA 2F48A 2UVDA 4G63A 3OBIA 2QIOA 1BCSB 5KKAA 4LF7B 1UF9A 1Z3CA 1JHDA 4U9HS 2BGIA 1GUBA 1NW4A 2PG3A 2OQIA 4DSOA 5KU7A 5DNYB 4KN8A 1T9KA 1E4EA 1C8LA 2H29A 1M7GA 3Q3HA 1NP3A 3PQEA 1HG1A 1VL1A 4UC0A 1JDNA 4X62B 2OC4A 2QD1A 4RMIA 5JCOC 1G8PA 2D7JA 3GRPA 4JK3A 1U0LA 1GTG1 2UAGA 7ABPA 3GJYA 1KO4A 2C2WA 3IJPA 5AVZA 2PD6A 4H3VA 4JMLA 2OYSA 4OGFA 5DHUA 2E4XA 3L7OA 3L6DA 4C3OB 4YDSA 1EUCA 4P4LA 1HORA 5JISA 4FOPA 4YP6A 2WSYB 1PEYA 3TAXA 1NMQA 1UFRA 1GAEO 4DEXA 1I7NA 2QMYA 1EWYA 4XJTA 4EWLA 4WK4B 1YVEI 2AN1A 4ALNA 4HUQB 4F04A 2ZAOA 4J0HA 1U0TA 3L0IB 4IIGA 2O7SA 2AXPA 3SDBA 5CFPA 3Q7PA 2GO1A 3PK0A 3OEHA 3B5EA 1YKGA 2RARA 3S55A 2I03A 1ITZA 4QOGA 3ZEIA 4A16A 2NIPA 4B32A 1RYZA 1B7GO 4KPUA 4MOWA 4A10A 2D5LA 4L4UA 1TT5A 1CULC 3W4IA 4A0RA 3CT4A 1NVWQ 4JT2A 2WLSA 2QMHA 3CN7A 521PA 1BQ4A 4RQBA 3WGUA 4LEIA 4NL4H 5DHAA 2FWJA 4B0OA 1TQ2A 4V0RA 4P3KA 3QLTA 3Q3VA 4LSZA 5AKHA 4AP5A 3NT2A 5ALTA 2ADMA 4MPPA 2YQ5A 1M6EX 3I12A 3PITA 3EGXB 1UWVA 2NT4A 1V1MB 4QO7A 2FETA 3AI3A 5D85A 5G2OA 2I22A 1E0JA 4V39A 3OPNA 2FRDC 3TLGA 1H94A 2B30A 1JR4A 2JGLA 3QVUA 3ELUA 4I4IA 4X7BA 2Z1MA 2KW5A 3K4QA 3UB3A 1IBMB 5DNEA 1E66A 1MIOB 4I1OA 3JD0A 4CLOB 3O2NA 1OZAA 3ZNQA 5JYEA 4Y2HA 4WDQA 4KOEC 3T0FA 1F1JA 1OLXB 4EF5A 4IDAA 4OY3A 2ISSD 2NU8A 2DKFA 5BN4A 3FOCA 2Q3JA 3AEQA 2ZSAA 2KX7A 2LP4Y 1YASA 1AZTA 4EDHA 4EKYA 2IXGA 4JYCA 3T6KA 4DQLA 3VPSA 1K7FB 4LAFA 2A9RA 1HZZA 4UULA 1FJ2A 1KJJA 4JI2B 3Q6MA 5C46F 1PG0A 3N05A 4D97A 1JIJA 1YMUA 1Z22A 4KEAA 2ZBVA 3IUJA 4XFJA 1TVEA 2J9FA 2YVUA 1U8EA 2XV1A 4FW8A 5FX2A 1KYQA 2VDUE 4IH9A 5H8WA 1FNMA 2EQAA 5DX0A 2EFCB 3NPMA 4B85A 5KJCA 3AYZB 2JGIA 4YGYA 4QEKA 1U0OC 1ISSA 1JSXA 4YQYA 5CX1B 2PKQP 5E3HA 4BTLA 4F2GA 1POWA 2EG9A 2BP7B 4HVLA 1TJNA 3W6ZA 4X20A 4B0PA 1ZUD1 3D6VA 1X7HA 1I36A 2VJLA 2VJMA 4HI0E 1W34A 2FFHA 4UVIA 4C0LA 4C5BA 2JGRA 2JIZA 4MVXA 4X94A 5CGZA 3EFOB 3J7AC 1FUYB 4Q1VA 4D56A 5EE9A 3QXXA 1UBSB 3IIKA 3K09C 3VTZA 2TMGA 2DJIA 2RAFA 4YPOA 1NM5A 2HT6A 3E1GA 4IQ8A 3F7TA 3R5FA 1AF4A 1W5FA 2QT1A 2CVFA 2QVLA 3AUSA 4FFSA 4OJTA 4PIMA 1D4AA 3WYDA 2AGVA 2G6BA 2IYAA 4F4UA 3G6WA 1FUIA 1NU8A 1IEVA 1KY5A 1XZPA 3BB3A 5KAMA 1JXAA 2B34A 3DYVA 4BC1A 1B3RA 3UFXB 1YBAA 1C3JA 5B7PA 3WOVA 4OGLA 1ZI8A 4OQXA 1BFKA 4DG9A 4EB8A 1E1CB 2HEIA 4MQ6A 2XB2A 5DN6D 4DV1B 3WWDA 3BCHA 4HKTA 3UWDA 3SK0A 1M1NB 3Q9UA 5B64A 2DWUA 1XZMA 7AT1A 3S7TA 1WWKA 3A4VA 1TEHA 4QXRA 1JL3A 1SCBA 4MMXB 5JDIC 2FK8A 3PA8A 5AFSA 4JDPA 4Z49A 4NBRA 1D1PA 1ZY2A 4QELA 1QIEA 3F98A 2IH4A 1OD6A 1KFEB 2XE4A 2XIQA 3X2SA 2P5SA 1HQKA 2C59A 1C4XA 3H2IA 5HHTA 3ZW7A 1H2ZA 2XGSA 2V7VA 3JARA 3D02A 3TFQA 4D0LB 2I6QA 2KJQA 1XWFA 4B3TB 1QVVA 3EVBA 4PPQA 3MGGA 3BGIA 4HS4A 1SIUA 2E3JA 1D07A 4DMCA 2PUJA 4BVJA 5JANA 5JLJA 3ERCA 3ORHA 3F74A 4RTMA 1OA1A 3FZEA 3HWWA 3EZ7A 2WT8A 2PL3A 1WD5A 4WL0A 3A04A 4A1FA 1J0AA 3V1NA 2HA4A 3AG6A 1PU2A 4GR4A 3N59A 5GV7A 1ADBA 3L92A 4Q7MB 4HNRA 3MT0A 4UVHA 3VKWA 3A1TA 4KXLA 1SXQA 2HCRA 4URYR 2A35A 2D3WA 2WJIA 4W1RA 3CNOA 3IHTA 4JVLA 2PGJA 4KWEA 3C1UA 2OLJA 3X44A 3T7TA 1TI7A 4NFYA 2PSFA 3U37A 2CNDA 3WLOA 5JEEA 3S2FA 2Q6VA 3EPRA 4AJPA 1L5NA 4DIDA 2EGUA 1RZ3A 1N5RA 1ZSVA 2SKEA 4KTVE 1MA0A 1PFQA 4X85A 3A36A 2IRWA 4OAQA 3KALA 2VAPA 3GEBA 3OLCX 4JJKA 4U2BA 4X60A 2BF4A 3VBEA 1KETA 4EATA 1SUAA 4NYMR 1OQAA 3WQSB 2HQBA 1O6FA 4BRWA 2CUNA 4KI7A 4C4SA 3T94A 3MYYA 1XDBA 3ZUGA 1NLUA 1P1FA 2XADA 1MO3A 3F9RA 4HB4A 2PUBA 4YV1A 2ZVQX 3DKPA 2G82A 3RVPA 1OBVA 2DLCX 1K89A 2ZQZA 5E3JA 5L4LA 2B1QA 4MV8A 4JUFA 1C41A 3DDOA 4ME6A 3GLUA 3UQYS 4M1SA 1QKIA 4TS1A 4D4GA 3EGVA 3OZIA 3RTGA 3PL5A 1M9NA 3WBKA 4L9RA 5KTNA 4FZ3A 3GBVA 3H99A 2XXJA 4XSGA 2ZYTX 4DARA 2NM0A 1OI3A 4Y2UA 5MGNA 1OXBB 1U2RA 1ZITA 3OO0A 8ADHA 5BOSB 1XALA 2OCXA 3IEUA 1Z7YA 3TCNA 4OQFA 2CVZA 1XDSA 1QYXA 5DASA 4PFSA 2CCKA 3ICVA 3KQQA 4EUSA 4G4JA 4FFDA 1FYEA 4DS3A 4WY2A 1Z07A 3S8YA 4C21A 3QYPA 3RHZA 2IELA 3R3SA 1OFVA 1G5TA 4GLJA 4HQFA 4TGLA 2W8BB 2ZAGA 2W6QA 1FDWA 5BV1A 5IYZB 4OI1A 4WBNA 2G06A 5B2FA 1U0BB 2PKRA 5DHPA 2VDWB 1WF3A 1NX6A 4LK2A 2I33A 2QE7A 1UJNA 1QTNA 1Z5ZA