2W2MA

Wt pcsk9-deltac bound to wt egf-a of ldlr
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
277
Chain Sequence
SIPWNLERITPPRGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDSKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/receptor
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 277
sequence length 295
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2w2mA00
3I2YX 1Y4DE 2GKOA 5CW1A 5JMOA 3QMPA 1GT91 1AK9A 1SUDA 3VV2A 1GNVA 3WIVA 3H42B 5JXJA 2XTJA 4ZARA 1SUPA 1CSEE 2ZWOA 1BFKA 3DE6X 1GA4A 1ST3A 1SBHA 4MZDA 1P7VA 3BX1A 1Y33E 2W2PA 1C3LA 1C9JA 2W2QA 4BWGA 4OV6B 4KB5A 3VHQA 3A3OA 3GT3A 1MPTA 5JXGA 1R64A 1PJ8A 1GCIA 1DUIA 3LPCA 3Q40A 3P5BA 1SPBS 1ZVJA 3D9QX 1WMFA 2WUWE 1PEKE 4FONA 1AV7A 2DQKA 2X8JB 4C3UA 3CNQS 1R0RE 5ARCA 1C9MA 3PRKE 1GNSA 1LW6E 2W2NA 2P4EA 1TM5E 4CFYA 1GTG1 3I37X 4M1ZA 5AVKA 1YJCA 3WHIA 1PFGA 5FAXA 1OT5A 1DBIA 1T1IA 2SECE 1EA7A 3A3PA 3EE6A 1NDQA 4H6WA 1TO2E 1SIUA 2X8JA 3LXUX 2V8BA 3DE5X 4KG7A 2WV7A 1P8JA 4B5LA 1V6CA 2DUJA 1Y48E 4WOBA 1AVTA 1A2QA 3EIFA 3HJRA 5AVJA 3WIUA 5I9SA 1HT3A 1SBCA 2IXTA 1THMA 2SICE 3DE7X 1BFUA 3LPDA 3DW3X 3QTLA 1KDZA 1SIOA 2W2MA 5JXIA 1P7WA 1SBNE 1TM4E 4DZTA 1TM3E 3SICE 4CFZA 5K7SA 1AH2A 1Y3CE 2ST1A 3DWEX 4DJ5X 1Y3BE 1ZVKA 3D43A 4HX2A 2QTWB 4LVOA 1SCDA 1WVMA 1TM1E 2PRKA 1TK2A 2PKCA 1UBNA 4JP8A 1TECE 5AMXA 4ZOQI 1CNMA 4AKSA 2SNIE 3BGOS 4YN3A 3WQBA 2Z2YA 1S2NA 1KE1A 3DE0X 3I30X 1BJRE 1SH7A 1SELA 1OYOA 1IC6A 1PTKA 3VYVA 4LVNA 1AF4A 5ARBA 5JXHA 4J94A 2Z2ZA 1SCAA 4KPGA 3GCWA 2PQ2A 1EGQA 3VV3A 1TM7E 1ST2A 4GI3A 1OYVA 1KDYA 3ZXYA 2DP4E 3DE1X 4Z2AA 2Z56A 1SCBA 2HPZA 1GA6A 4NE9A 1S02A 3TI7A 4I0WB 3TI9A 3AJ8A 3UNXA 3F49S 1YJBA 1SN7A 1T1EA 1V5IA 1VSBA 4RYDA 4AKTA 5FFNA 2Z58A 1TMGE 2PMWB 1SBIA 2E1PA 3PTLA 3GCXA 3EDYA 1SBTA 3VSBA 3F7MA 1WSDA 1C9NA 2PYZA 1YU6A 5FBZA 1GTL1 2ZRQA 4NMXB 3ZXXA 1Y9ZA 2TECE 2SBTA 1R6VA 1KDVA 4WOCA 2XRMA 2PWAA 4C3VA 1MEEA 3I34X 1BH6A 1T1GA 1XF1A 2B6NA 1SUBA 2W2OA 1WMDA 1SUCA 1BE8A 5SICE 1TO1E 4OMDA 1NDUA 3T41A 3BPSA 1SIBE 1Y3DE 1JEAA 4H6XA 1AU9A 3DE3X 2ZWPA 2ID8A 2WUVA 1SUEA 1S01A 1WMEA 3DW1X 3Q5GA 4H6VA 5B1DA 5AQEA 3AJ9A 1AQNA 3VTAA 1SCJA 3SQOA 3GT4A 3DVSX 4CG0A 3DDZX 2Z30A 1Y1KE 3AFGA 2IY9A 2PWBA 1BE6A 4NE7A 3TECE 1NLUA 1GTJ1 3QFHA 3CO0S 1SUAA 1Y34E 3OSZA 3A3NA 1Y3FE 1SVNA 2ID4A 1Q5PA 2HD4A 3DE4X 1YJAA 2Z57A 3F7OA 4OMCA 1Y4AE 4K8RB 1KE2A 3DE2X 3LPAA 1IAVA 5ARDA 4HVLA 3DVQX 1GA1A 2G4VA 5B1EA 4DWWA 1SCNE 3DYBA 2WWTA 2Z2XA 3L1KA 3DVRX
chains in the Genus database with same CATH superfamily
2HMYB 2WHEA 1P0FA 5KYWA 4NXMB 4C0BA 1H69A 5BO5A 2HKIA 4CN9A 1PWEA 1GT91 3ZCPA 4F91B 1ADCA 2W2LD 1I5EA 5EIHA 4IEEA 1T5LA 3SI7A 1WXXA 3U0BA 3ZNPA 3MXOA 1JZSA 3KYJB 4RLQA 3WHPA 1LF0A 1FP4B 2PMCA 3N70A 3OFJA 3TDMA 1O03A 1GZVA 3OJFA 1PN3A 4PPFA 1VKOA 2ZSEA 4OHBA 3FUWA 1IWOA 3EAFA 4IFBA 4P9NA 1TZBA 2CNOA 1RWKA 4O4IF 2QTFA 1B3BA 4LXGA 3F67A 4YJ3F 4MS1B 2HCTA 4MA4A 4MVJG 3U49A 4D0SA 3VJRA 3I6QA 4MJXA 3BDAA 4WH0A 3HM9A 4XWKA 4EJMA 3X43A 121PA 1CUDA 4JLJA 3FSGA 3EGIA 1PJ3A 2YYYA 1XTQA 1XTVA 4J0QA 4NTZA 5KYUB 2V9PA 3HKEA 4J1QA 3PPXA 4F06A 4WCFC 4FHCA 3LAWA 4UHBA 2RHJA 3LLMA 4ARZA 3U4GA 1H9CA 3IX7A 3WK4A 1Q0LA 3PDHA 1YZQA 3WWEA 3W5BA 4D8VA 3I9LA 2PS0A 4KB5A 1BD3A 3MINA 3Q98A 2PU5A 3I04A 1QF9A 3UHOA 4D9JA 5IZCA 1Y7TA 1KYVA 5H80A 5IT4A 1QZXA 2HA2A 2GCOB 2DCUA 5EKUA 4EKEA 9LDBA 4R8LA 4URHA 2XYHA 2ZRPA 4W5OA 2P6PA 4GI1A 2P4HX 3HWX1 4D0LB 5K05A 4FWTA 3JALB 1OAAA 5DHSA 1GPKA 1M2NA 1IZZA 1X70A 1JXAA 3QEKA 4ALIA 1T5TA 5L45A 4U7GA 4RTNA 4E94A 4HB3A 4NCHA 4WI1A 1V25A 3L6RA 2J5XA 4HB0A 4QL3A 1UF9A 1L7OA 1R0RE 2A1TS 2B1JA 2Q3LA 3OHPA 4LQLA 3P96A 2FH5B 2G08A 3FMIA 4J7XA 5FB3A 1QYCA 1KIFA 3EGOA 2ZB7A 5KO2A 4LPKA 1RAGA 1NUPA 3OX3A 1QKIA 2NV6A 2WU1A 4IHJF 2KLHA 3SYNA 1PT6A 4HDOB 3Q5EA 4URYR 3QLUC 3DZIA 3FA2A 1NUUA 2ZR9A 1LBTA 1W4RA 3A27A 2YWRA 3FVQA 3RWBA 4M9CA 3D1VA 1YASA 3CONA 1QGED 4PHCA 1B0ZA 1GZ4A 2Q2NA 3DCYA 1E1CA 1TJ4A 4N6OA 1D2RA 3GJXC 1WS6A 1KFCB 2PO7A 3MCZA 3TEMA 1ETUA 2OHFA 3PUJA 3BWVA 2ZXEA 1G3UA 1Q44A 1YE5A 4AJLA 1EUZA 1T1RA 1FX0A 2ZBUA 4NF2A 2DRIA 5D1HA 5AW2A 5KYWB 1OY1A 1BQ4A 1JXMA 3GQVA 5HE9A 4I19A 2R8RA 4QA9A 3VVLA 1M83A 5CG2A 2F9FA 3FNQA 5EXPA 4JJ6A 1VGVA 1VIDA 3T94A 4WGGA 4CGYA 3D3JA 3WADA 5JSHA 1U7DA 1NW3A 2DUNA 2XNKA 1XWWA 4ON9A 4GHWA 2NUPA 4GQAA 2ZRLA 2PTGA 2WIKA 4OH1A 4UM9B 4I7EA 5AVSA 1OXVA 2XW6A 1ISJA 3WP0A 2YHBA 1BGXT 5KTPA 4DMMA 3DQPA 1CJBA 1QB7A 3PXXA 4OQ4A 3VYRB 1YRHA 1N7HA 5LQCA 2HLHA 4O29A 4QBFA 4FFSA 2ZW9A 1WXIA 4LYDA 1E2EA 1RJ9A 4XX0A 1PHPA 2WQ7A 3PPVA 2NU7B 4DMHA 1TD1A 1VIYA 2X5KO 4Y9RA 4L5BA 3BHIA 4FKMA 2WTXA 1TTPB 2DUJA 2GTHA 1XFDA 2C98A 4R5HA 4YAGA 1GTRA 3QW2A 2FEXA 5J9FA 5TEWA 3TTTA 1E7RA 4KGZA 4MPJA 4II3A 4X45A 2HXYA 3IVGA 3KZKA 4AW9A 3DF9A 2XKJE 4X92A 4CTOA 4U7FA 2IYVA 4G3XA 2WLSA 4HS4A 5LQSA 3RVLA 4E22A 3WB0A 1BS1A 3R8CA 1A2QA 3EIFA 3T34A 1CUUA 1XEXB 5KOHB 2KS6A 3MGGA 4FTWA 1XNJA 1Z68A 4QWMA 4AJIA 1AGXA 1Z07A 5ECWA 2HLDA 2OUIA 1X87A 4BLPA 4QT0A 1Q95A 2FTKE 2OXCA 2WMDA 2Y1WA 3ONEA 4NBKA 1H0KA 4WNYA 1CY7A 4E6EA 2EOAA 3R1IA 1U8CB 5AM0A 3BIOA 5KWEA 2RJ3A 3LBAA 3JSXA 1TE2A 4QTYA 2O59A 1OWMA 1BCSB 1JLSA 1JPUA 1SC3A 1ENPA 1M33A 3QI2A 3UB4A 4CKBA 4ABTA 3JQAB 2QM7A 2QZPA 4KFCA 3WR5A 5EQDA 4F4JA 1Y0BA 2FDCA 3DTNA 3KSAC 1F9EA 1VP9A 2FSVC 3HCFA 4IIUA 4YTEA 1V8OA 2H9AA 1F12A 3CZCA 3DCJA 4LE1A 3KAQA 4DZTA 4HR7A 2GCEA 1B6GA 3JTEA 1DAOA 4UW9A 4HDSA 1K66A 1FLDA 3B8HA 4WNIA 1OD6A 3ZD9A 5T8KA 5BRJA 2IC5A 4GVLA 4OFZA 5K3FA 4A16A 3ECAA 4MLDA 3IQIX 1EQAA 4WN9B 2GBGA 1YC2A 3O3NB 4PX5A 1AHNA 3DNMA 1HM5A 3GLSA 4PF1A 4WERA 4KTVE 3AUAA 3A31A 3D5EA 4Z2YA 3VKVA 5JI2E 3IE0A 5JS7A 3CTPA 2EP8A 4PLFA 3C4QA 5T4EA 5A04A 4YCCA 4H1VA 1H2XA 4B3RB 2IIQA 1MB4A 1STOA 1OB5A 4E5NA 3AR9A 3BE5A 3A37A 3MILA 3OQPA 4A0QA 2X0JA 4TSFD 2MJLA 3A1UA 3QBDA 1CB7A 1JR4A 2GLUA 4ZCLA 4WOJA 2C9ZA 2CCJA 3UK7A 4MVJA 4O4JF 3H5WA 1NPYA 1EFVA 2W8ZA 3QVLA 1C7RA 1MJGA 2NUPB 3NOOA 1G3QA 1SCQA 3HUUA 4L73A 3MTJA 1AZTA 2OHHA 1C1HA 4XCXA 1YKFA 4RF5A 1LBIA 2GLTA 5LXTF 3VNSA 3BJRA 4HGNA 4EAQA 2XCQA 2XTNA 4MWGA 4UD2A 3COVA 4XGNA 5SYMA 5DLYA 3REOA 2CB0A 4XX0B 3FZYA 4AWAA 3WLNA 2Z2YA 5U1PA 1HQDA 4R31A 1HT1E 1X2EA 4ENVA 3G23A 2IP4A 1P8AA 3ZHCA 4D9GA 4LOHA 1PFWA 1PT9A 4P8RA 1SZJG 5K01A 3AVQA 1RKQA 1K4YA 3KQTA 4PVCA 5CURA 2PKQO 4J76A 4NKRA 4HDQB 3W1EA 1CR4A 4XW2A 3GJRA 4L72A 5DN6D 4UJ3A 1BDMA 3E3LA 4H7EA 1ZAKA 2ZS8A 2XJ9A 1L7AA 1PGJA 3E1GA 3KOUA 2O6LA 2R5WA 5EVJA 1PAUA 3SEAA 5AESA 3FTFA 3ZK8A 3AM5A 4AF8A 2Y4NA 4BQEA 2QYHA 1I2DA 1EAMA 2XZTA 3HY6A 2QN1A 4C6TB 3L8DA 4P5PA 2ZI5A 3IEPA 5KSOA 2Z2ZA 1U0LA 3GEHA 2LTAA 1ZJ5A 3TTYA 4BQQA 1TKCA 1SQ5A 1AF7A 1DKNA 3Q6NA 3RQIA 3VYSB 4Q4DA 2IS4A 3K1JA 3JQ7B 2VJAA 1C30A 1E8MA 3MS4A 3P2OA 4LKRA 2WFLA 1S3FA 2B5WA 4DIDA 1KAMA 1G66A 1T36B 1FPQA 3ICPA 3B6EA 3NV7A 3MJEA 3IV6A 4LJ5A 3HGMA 3BWCA 1KNXA 2JAOA 2VOEA 2NO6A 4DAOA 3UM9A 4B84A 2F6RA 3HBFA 5GZ1A 1J0DA 3U40A 2FWNA 2A5YB 3CVWA 4NBSA 3UAYA 1LWOA 2Z56A 3UMSA 3FWPA 5L9AA 1EB8A 2P9HA 3VNRA 3ANYB 1H9AA 5K3FB 1UIRA 1NM5A 2B9VA 3G9ZA 1Q2UA 1P1FA 4CL0A 4MINA 4A6EA 4BN5A 4EBFA 1VL6A 2FZ5A 4Y7CA 1LPMA 1M74A 2PX0A 4GL4A 1J9EA 5IEBA 1V5IA 3C43A 3HCCA 2Q07A 4CQMD 4NRDA 1KBZA 1R5NA 5ESRA 3PCTA 3WLSA 3ZBTA 2H2GA 1QKJA 4LYEA 3DTTA 3YASA 1DBVO 3ZW9A 4DYVA 3L79A 1Y5NA 3K53A 4OJQA 1JFFA 3OCYA 4BLTA 2W2KA 5IVDA 3UXYA 2AXPA 4UOZA 2QUZA 3ECSA 1KO4A 1OQAA 2XVXA 4B6FA 2EEZA 4WTOA 3W7BA 3KZMA 3DULA 3GLIB 1K92A 2QP4A 3IPAA 3LT2A 1WSDA 1UIMA 4FPXA 4W5HA 1TT5A 4GBGA 3NT5A 2O5VA 2RIPA 1DC3A 1XZ8A 3JQ9C 3NBKA 4OHWA 3NVAA 1R9MA 3L0PA 4M38A 4BNUA 3K8ZA 2QMUA 5H4GA 4KWEA 1JSRA 2DBYA 5HBGA 4HV4A 3EAQA 1J5XA 1XMXA 1NUAA 4LBYA 1BDIA 3CSUA 4PXAA 4W5JA 4EI9A 2QVZX 3QUTA 1Z63A 2CDAA 4OHVA 4U6NA 1T5IA 3G2PA 1JIKA 1G8HA 3UT5A 5A05A 3BE8A 4CKCA 4H35A 1QVWA 2I62A 2EX0A 4JLUA 3ABZA 3M4XA 2XA2A 5K3EA 2CL0X 5FHRA 5FPYA 1WDKA 4KXMA 3W4KA 1OX4B 1YL6A 1ID8A 4PVDA 1UMDB 4KQ9A 1SKUA 5IDXA 3KSDO 3ZE6A 3TMKA 2WA2A 1QRRA 1E77A 3ZV3A 4ZYZA 2OTCA 3L9WA 3DAYA 1HDOA 1FS6A 1QZZA 2JBAB 2P1ZA 5BRAA 3LFHA 4AC9A 1QVRA 2Z8YM 1YDHA 1N3LA 3HYSA 1H0SA 4POAA 2HIAA 1VE3A 1ISGA 1Q1BA 1ZUHA 4QFBA 1QFXA 4IH9A 2B6NA 2H59A 2O54A 3V7NA 4WLEA 4YI3A 3DBRB 2CLEB 2WFLB 2Y8EA 3GJ0A 3L8HA 4RPLA 5DX1A 4EDHA 4A91A 1H65A 1M2FA 3AY0A 3E3AA 3HC7A 4EJ2A 4EUHA 5FLKA 3O4GA 2WKSA 2FMTA 5KYNA 1YS6A 5EYPA 5DYNA 3HO8A 4YCNA 1U3UA 2DWCA 3BZWA 1YZ3A 1NVUQ 3O8NA 1DWUA 4MAAA 5FBWB 2B82A 2B78A 1IG3A 3U4IA 2KPOA 3K1TA 1KAHA 4QOJA 3VHXA 2JVJA 3HH8A 5BN1A 1OZHA 1Z4MA 2ZRKA 4B34A 4DQDA 4Y0AA 4QFDA 2XUZA 4XASA 1DB3A 3IHTA 4BVGA 4KQGA 5DRYA 1YVPA 1A2OA 2WKQA 2PV7A 4ITUA 1Q11A 3DMNA 1Z4QA 1U5AA 3OWHA 4OHMA 3CJTA 3NI2A 4K0RA 4KRGA 4PSCA 1XQVA 1K5HA 5HWSA 1JFSA 3PS9A 4CXMA 2NQ2C 1XD8A 3TCKA 4I14A 2ZTHA 1GG8A 3QWBA 1ZSNA 1SUEA 3CVJA 4JLPA 4R8RA 2AN4A 1Z82A 2JJ8A 3B8EA 4RKQA 1PJAA 4GQBA 2DLCX 3NWEA 3SOPA 3X1WA 1KMIY 4MUBA 4Q4AB 1J2UA 3PUHA 1JFFB 4JELA 2C2OA 3BCUA 1ZN7A 3LMKA 3WL5A 5B3LA 3O5AA 2A1UB 1HO3A 4R0NA 1BXGA 1FJ2A 5NULA 3TD2A 4EY8A 1SUSA 3MD9A 1ZEMA 4MCJA 3U2QA 4YPVA 3VYWA 2AGVA 2CEAA 3GT4A 1KERA 1T34A 4O59O 3WLKX 1WLYA 1JQDA 2XYRA 3JAMA 1D2GA 3FFTA 2OM6A 3MB8A 1YZLA 2EGGA 5IKMA 1JFVA 3OJEA 1J4AA 3QPUA 4D3DA 2VT7A 4MR8A 2D7DA 4CU5A 1D2AA 3AF0A 5FLEX 4B6PA 2YRWA 3UCFA 2W11A 3Q10A 4KXXA 3W5JA 2CMHA 2GYWA 2RDMA 1HG0A 4TL6A 4MI1A 4IDHA 3ZY2A 1BE6A 1PQ4A 4CM4B 2FR1A 1QCCA 4ITRC 3STUA 3V2UA 3QFHA 4G1BA 5F7OA 2YFYA 3IBYA 3RC3A 1PS0A 1FEZA 2Q0HA 1X1AA 4EKIA 4UUMA 1EX7A 2GOYA 3LSTA 3P97A 1QVAA 3D3QA 2Q1YA 3KOZA 2J3DA 2PMDA 4JB2A 3FR7A 2CMDA 1GGNA 3QOYA 3U3MA 1EDZA 1ZINA 2GHRA 3O3OB 4L8WB 5E7QA 3WNDA 2AYZA 9ATCA 3UUEA 2EYQA 1Y3FE 3DBVO 3DE4X 3TR5A 2I6XA 4KIWA 4XFJA 1TF7A 1XKXA 1PJZA 5BR7A 1NX6A 4AU1A 2HSZA 3L49A 3TTSA 2YINC 3JQCA 3PX3A 2M6SA 2R00A 2OE2A 2P0YA 1H2AS 3UXHA 4CCYA 3BMXA 4DANA 1XRNA 2V7TA 1XB2A 2H4YA 3LHSA 2ZIEA 4KUGA 3KR0A 4PRYA 2AJTA 1A8SA 1CVIA 2ZU0C 2IEAA 1JQLB 3Q4GA 3DOIA 4EW2A 3BEOA 1Z8NA 1MU0A 1SCNE 1YONA 2HIHA 1SU8A 2IYUA 3C16C 1XN4A 5FOUA 2ICAA 1YCDA 5B4VA 1ADJA 2WAYA 3RKSA 2UUOA 5AKYA 3IURA 1TZMA 4HWSA 4IGAA 3LC2O 3RVBA 3DVRX 1M1NA 6ADHA 4DA7A 3AKYA 4RJIA 4BB0A 1UBGA 1P9WA 4KMMA 1KBOA 3MRSA 4YMVA 4P7GA 1M0WA 5HTOA 1ODTC 4PN3A 1Z12A 4S0XA 3MHTA 3ZGZA 1Y4DE 1GR0A 5K3AA 1UMBA 1Y6QA 3PFGA 3QYAA 2Q6OA 2XRFA 5EPUA 4DE5A 3ILYA 5FTWA 3WTBA 5IHXA 3SYRA 3UJ3X 1WV0A 1Q6ZA 1AV6A 1M6WA 4GYYA 2PDAA 4MJ3A 1WQ3A 5JXJA 3CVYA 4YO7A 3DWGA 1E3MA 3TD6A 2GJ9A 5GONB 3EIOA 3V46A 1ZN9A 2I8AA 4PZDA 3ROTA 4M8SA 5DP1A 3BMNA 3CS3A 5GTDA 3NRCA 1Q14A 2D0OB 1GL3A 5K99A 1XTSA 2O5RA 4W6QA 1V71A 5LOVA 4XOUA 1G8JA 2AFVA 4ALNA 4DR7B 1WCYA 2I4IA 1E7YA 1BDBA 4MWEA 4X64B 2QMQA 2BW0A 5AI0A 4X63A 1R37A 4D5EA 2A5DA 3GUCA 4F12A 1RQLA 4ZQEA 3HVHA 4UNRA 5IBCA 2AT1A 4MYSA 1N6LA 5C8YA 3NTVA 4A8JA 1OA0A 3UJAA 2EZ8A 4K81B 1CTQA 2JLBA 1TZJA 2R8ZA 3LBIA 3NANA 4FKBA 4MEJA 1LKZA 4INPA 3MAAC 5IZ4A 5J59A 3K70B 1E64A 2E3JA 4B74A 2RARA 4RK7A 4BO3A 2JLRA 2R48A 2VUSA 3U3ZA 3M9LA 3NIDB 1M7HA 1Z6ZA 1X80B 3Q9NA 4AJ9A 2ZQZA 1H3EA 4AJNA 4MZXA 2ZIXA 2QTVA 3A3OA 3IDFA 1E92A 1RR6A 3GMIA 3O94A 5G40A 4DWJA 1KTIA 2B4YA 4O4LB 4M7WA 2GJAA 1M6VB 3QPCA 2AC4A 2VJKA 2Q7XA 4Q48A 4YUZA 1IJEA 4RTRA 1ZH2A 3LRTA 4R1QA 5SY6A 3BK2A 3EFBA 3UHFA 4INOA 1DC8A 3B60A 3HV0A 4PQFA 4X0EA 5TPWA 2PZAA 2C5AA 1ZUNB 4TLCA 2JFPA 2QPTA 2VPYA 2Q5JA 3W3AA 4I55B 4K6CA 1FUYB 1M6NA 4JODA 1KMCA 2ZRAA 4PC7A 5EJFA 2B30A 5EPOA 821PA 2KB0A 3R7DA 2I22A 3KR2A 1W75A 1L7QA 4BAGA 3Q8KA 1V6SA 3ZHSA 1VKNA 2K7FA 1N4AA 1UDCA 5CHEA 3SX4A 5JS1A 2JFVA 1JALA 3HKCA 1PV1A 2DPHA 4YWHA 2R8YA 3ZU2A 4CEJB 3P94A 4MVCA 4MHOA 5I8PA 1N5OX 4ZQCB 2IP1A 3DEHA 3N2NA 2B4RO 4LOAA 1N6KA 2GEFA 2Y0DA 4WLNA 1HKUA 1MC1A 1TM5E 2GTIA 3ZWMA 4GO1A 1W36C 4LNUB 1RNLA 3L4BC 3ZDXB 1A8UA 4F8JA 1L5SA 5DASA 1BJKA 1D0VA 1EXVA 3SSOA 2XXAA 1D1SA 1ANKA 3AQ4A 2GZSA 4MWZA 1C7FA 2MINA 4H4EA 2IWRA 5JC8A 4D9NA 3DTYA 4PANA 4A36A 4OQXA 2WW8A 3LD9A 3ADCA 1GV0A 2O8DB 2C58A 1B43A 4Z4EA 1ZDMA 1M1YB 4KI0A 2Q5EA 1A82A 1GWNA 3VOTA 1X42A 1DBIA 3N58A 4NBUA 4TTJA 1J2JA 2YICA 3A2MA 4HGRA 2J6IA 3IEVA 2YVAA 2PMEA 3R3WA 3AIOA 4DPLA 2F2TA 4XQCA 2Q5FA 1A4RA 1QG6A 2FXIA 2IV7A 1L1EA 2FGKA 3QKSA 4E1AA 2QROA 4PX9A 4H6WA 1I2MA 3DYIA 2KHZA 3QWFA 1WPXA 1GTZA 2ZQ5A 3ISTA 4UZSA 3ZBPA 3WL8A 1NATA 1DRWA 2JAXA 2C83A 4FYVA 3LXUX 3K20A 4PX3A 3EEFA 1VJCA 2ZBPA 1OV6A 1THTA 2EATA 2Q4TA 3P20A 4TOIA 1KDTA 4XI9A 4ZPJA 5EE5B 2W37A 4FYPA 5FWXA 4JAVC 1KBQA 3CPJB 4R1MA 3EPJA 4MHTA 2ZYUX 1EM8B 1Q0RA 2PL5A 2V0GA 4B09A 5LQDA 2PS9A 1UXJA 2PU7A 1GL6A 4ZOEA 5JROA 1YI1A 4KXVA 4UVDA 2VCEA 3WTCA 3L1IA 3BK7A 3I5AA 4OM7A 2Q8NA 2QN8A 3W2EA 3N8IA 2O52A 3K0FA 2YZKA 5F3RA 2AFHA 2NT4A 2O1XA 3AERA 3NTQA 4FCWA 3QQ5A 5EHNA 5AI6A 4AMYA 4TVOA 4EK9A 4DKJA 1S8AA 2DAPA 1KY4A 1SBCA 2OZEA 2FJ0A 4FZRA 3WQRA 5B4UA 2WHPB 2ZIXB 3VGPA 4CEIA 5JD5A 1W47A 1V7PC 2NUTA 5DTMA 1YBAA 3PL5A 2QMEA 4FGKA 4N5DA 3HB5X 5DBFA 5DNDA 5EP4A 4DRYA 3A7DA 4ZYVA 1KDPA 3M6XA 1D09A 2FPSA 3AZOA 1BO6A 2FZWA 4QUHA 2J08A 2P2GA 4AJEA 3ABRB 4NOKA 1EZ1A 2OCIA 5H16A 3ZU5A 3H2KA 5TDHA 1OE0A 2Q1XA 3LM8A 1Z2EA 1YOVB 4F04A 5AW3A 1JEJA 3KU1A 5HPYB 1RYNA 2VFAA 2ZAYA 1FFHA 3N2KA 3N6RA 1G9XA 4X6XA 4C0KA 2ZYGA 4WA7A 3EEIA 2ZUVA 4HAXA 5DBEX 4RKFA 1BQ3A 3D7LA 5A3SA 2PUFA 2M2IA 3OKAA 4PS1A 1EQUA 2X3YA 3ZE8A 1VLZA 3ZGOA 1XHLA 2JZCA 4OMUA 3ZI0A 1NR1A 3UCEA 1EX6A 1LI4A 1WB6A 3B78A 1FS5A 2HGZA 1K8QA 1U2ZA 2QZSA 3F6PA 1ZVKA 3HEMA 4EG6A 1N5IA 2WD8A 1QIKA 3NUGA 4JQSA 4A2QA 5KYXA 1P6UA 4TT3D 2MINB 4EUNA 2C5SA 3N8GA 4GPZA 2QTWB 1K9SA 3ITEA 5JSUA 4RXUA 3T0GA 2DHQA 2XBMA 4TMTA 3IV7A 4Y2VA 1SCDA 2Z1NA 3AM4A 3NXKA 4LGCA 4OJTA 4ZDJA 2QUHA 4I1PA 1R4NA 4S1OA 4V3CA 2GCPA 1QM5A 1XRJA 1G8FA 4TTPA 4M89A 1LSUA 4BMDA 4R8SA 2SCUB 1UJ6A 3ANMA 4OTZA 1TGYA 3O0DA 2JJYA 2GMWA 1PKEA 4NL4H 1LTKA 2FA9A 4IIFA 3ZCXA 2PZGA 3B51X 5DGCA 2QLNA 3UOWA 3PC7A 4BV8A 3R44A 4HUTA 3NWJA 4ND1A 3TAXA 4G24A 2GN8A 4LWQA 5TVGA 1HNZB 1LNQA 1E96A 4W7HA 2ZDHA 2N75A 5DCUA 1LLFA 2G0AA 4EZIA 5AK4A 3S44A 3GAAA 3TM4A 1PJSA 3I58A 5FQNA 2HADA 4TQGA 1VMEA 4BNZA 2FWAA 1GLVA 2O4CA 1E0KA 1IXKA 3QVXA 4DA6A 1HOXA 2FZKA 1ZI9A 3WIDA 1PJTA 1I2BA 5A6VA 4KVGA 2YUTA 2FMUA 5KKCA 2HAEA 1GPMA 3DOFA 3OFNA 2RGRA 1M34B 2Q49A 2YDXA 3AOEA 1TK3A 5CBPB 3CVXA 1PNQA 1IC6A 3EMVA 1R6DA 3E1KA 2I1QA 3IKMB 3K0FB 4J1SA 2AFHB 2AWOA 5ALGA 3AERB 4JBXA 4RL6A 2EZTA 4MB6A 1QIEA 1XNGA 3NKVA 1AK1A 1Y8RA 4GAEA 4CCSA 4EHKA 3U7HB 4F96A 4ZT5A 1C7EA 1NQTA 2IIVA 2ZRMA 2QU7A 3D31A 3IMGA 4EGQA 5DSZA 3TXAA 1TNDA 5AHKA 3AFMA 1MP0A 2J5KA 1NNI1 3AVPA 4NLLA 3AFHA 4LMAA 3MTEA 1MAHA 5EWMA 1ZMXA 1XLTC 1LLQA 2AXEA 4PYOA 1PUJA 1VMAA 2VUIB 3MCTA 3QA9A 4TS3A 4EPRA 4C2UA 2XVZA 5FJJA 2XKBA 3ABSB 3OAAA 2WG0A 1YMUA 3AQIA 5ENVA 4EX6A 1IB0A 1XYYA 2P75A 3QE4A 4AZSA 2FQYA 5BRNA 4BQRA 1HTTA 2CCGA 4CDGA 2IYOA 1P19A 4HOYA 4D4JA 2XBUA 2ZSJA 3GT0A 2HWWA 1QAMA 4JI5B 3RU3A 2O19A 2ZAMA 3H2YA 4KGDA 3QVGA 4JLNA 1YVDA 1DRKA 4Q39A 2C3OA 3CNLA 3MRTA 4FZJA 4XUEA 4C05A 3EVCA 1CLEA 2P2ZA 3INRA 3Q1KA 4AKGA 4GXTA 3UUFA 3ILSA 3ZE7A 2BLNA 4JUFA 3W1VA 5I7WA 3QZUA 4U7JA 4PPNA 2B36A 3K0HA 5C2JB 2H5LA 5EJ2A 1QOPB 2IHVA 4UZFA 1KIAA 1IAQA 2Q3MA 2K2QB 2X0DA 5KYXB 5FD8A 1EIZA 2OPBA 4RSRA 3QW4B 1T9GR 3FH0A 3T35A 5DNAA 3MNFA 2C4WA 2ZK7A 2Q5OA 1N8SA 1TMGE 2R6FA 4KQWA 3ZDDA 3EIXA 1RCUA 4UAVA 4WJKB 1GPH1 1M2JA 2I2WA 2G72A 5AHWA 4Q3CA 1XU9A 1EE9A 2GK6A 1L3CA 3NPMA 4EHAA 2PGIA 1OBFO 2C2BA 1J1ZA 2XECA 3R8XA 2FJPA 4LRTB 4MUKA 3NU1A 5J5AA 2FWIA 1RVV1 4B3GA 3BHNA 1X38A 3EBOA 2YZNA 1H4QA 1KI2A 2HT1A 3QTBA 1YU6A 2C0QA 3LUKA 2YUIA 3EVZA 3MFYA 1AN9A 2BOVA 1DC7A 1PBTA 1P91A 2O9JA 3IP5A 4M0MA 4Q9IA 4P3YA 2VA9A 4KXWA 2XAAA 3WKBA 3K9FC 2GPSA 2A4KA 4DTCA 4Z4QA 3ETLA 2RB5A 2O57A 4J4TA 2QVBA 2QZ4A 3ESBA 2B8EA 3RBAA 4NJMA 5EHXA 5BMVF 1Q7EA 3L84A 4BJ6A 4FFBA 1R6UA 2XNDD 3ORSA 1JPVA 3CLTD 3NORA 1XDGA 2A4MA 3REFA 4KYUA 1O4WA 3E0XA 3Q9UA 4I4NA 3TUIC 1E1QA 3CRZA 4BMCA 2ZJOA 3FJYA 4E4RA 4R0VA 5FEMA 2AI2A 1X7ZB 3D6JA 3EGDA 1GT6A 4TV8A 4NCKA 1DBRA 4G26A 5EWJB 1L5YA 2G9UA 2VQSA 5G3ZA 3PVCA 1O9BA 1TMKA 1JFRA 2Z2JA 3C3CA 3I34X 4ZVSA 3WSWA 1CS0B 2Q3DA 2QX8A 3ZDZB 2XCRB 4OK5A 4B71A 4RFVA 1BH6A 3OG9A 4UDXX 3ZHTA 3OURA 4OU4A 2W2OA 5FEUA 5JECA 2Y1KA 1PFQA 1MTZA 1RHUA 3CZPA 4A5SA 4EA7A 4LJSA 1IL0A 4TMXA 4ERNA 1Z88A 2OXIA 3RYHB 2V6BA 3BHMA 3TX6A 2H1VA 4C2BA 3EUAA 4O2RA 4IMJB 2CHUA 3LY7A 4W5QA 1F06A 1NY6A 3S1LA 3O3MB 4MWCA 3H5RA 5T4FA 1X1CA 1XTIA 3HB1A 1WOYA 2ONYA 2R7KA 1NDUA 1NPDA 3KYCA 3M5WA 3M4YA 3OJ0A 4G41A 1KVRA 4JX8A 4LFAB 1O95A 5A0FA 4JOBA 4QREA 4E13A 2QVXX 5F9MA 2Q4RA 3I61A 2X1LA 4BEJA 5HA5A 2YNMA 3MJSA 2JJ1A 3P4XA 2PRZA 3G8YA 2WAAA 3J81k 1P9NA 3UUWA 2JGFA 1BWPA 1Z2OX 2Q1WA 2QYSA 5TSDA 4KPFC 1SXGA 3P0HA 4O08A 3ITKA 1X19A 4YJFA 2P5TB 3DFIA 3PWZA 1O77A 2G4CA 5HIIA 1R8YA 2RG1A 2VJYA 3PHIA 5JRJA 1O7JA 4Y7DA 1AO3A 1HQKA 4R16A 1XG5A 5EJ4A 2RK3A 1ECPA 1JR3A 2FK8A 4NS4A 1L7EA 5E6SA 4CF7A 1EFRA 4PC1A 2PMKA 4D9KA 5HX7A 1DADA 3JAWB 5J2UA 2BHNA 5LQKA 4X8OA 4XIGS 3GP8A 1FFEA 4I8DA 1P81A 4LF8B 1NVAA 2DM6A 4DDMA 3BMOA 3IOEA 1YB5A 4OBWA 5BNWA 1LV7A 4Q0MA 3QXJA 2OAGA 4U6QA 4YCMA 2NTNA 2C2MA 4NULA 4DM7A 2IUFA 4ZZ3A 1NC3A 1HWYA 3IPXA 3CRW1 1F4PA 2YYZA 4LQDA 4NEQA 3HKBB 3B20A 4RMNA 2CKMA 2IYYA 2WUGA 4IW3B 5K0SA 3Q5DA 1FQOA 1R3DA 2RJNA 4NZYA 4XB1A 5GM1A 2WA1A 2YMPA 4D6XA 2XUDA 2HSJA 1PRYA 1DCMA 3HDVA 4FJ0A 1QX3A 1U8TA 1RHMA 4IVRA 4KEAA 4L4ZA 1M5RA 2PYDA 1IWPB 4ZQBA 1GQ2A 1XCOA 2TMKA 4TMYA 3RIHA 5EOVA 3HJFA 3L8EA 4PLCA 2R25B 3PSAA 4YAFA 2YWJA 2CFOA 3HFSA 2QVYX 4JLDA 1D3AA 2V9ZA 1MAUA 4F1KA 2Y77A 2HXSA 5D3MA 2WILA 3IPLA 1V16B 3QWAA 4IHQA 3B1FA 4ID9A 2P0AA 2PN1A 5ALWA 2P91A 1UFVA 1JV2B 3GZTB 5H3LA 4QTXA 1N33B 3EYWA 1UXGA 2BT4A 1B76A 1Y37A 3PQ5A 3LZDA 3ZCTA 4LY6A 1KJIA 1MFZA 3RT9A 1R9GA 3W5IA 4D4KA 4Q05A 3UATA 1N2EA 1K63A 4QJIA 2CNWA 5AKXA 4CMBA 5DI9A 5DKFA 1YZFA 4YRAA 3KJFA 1NFQA 2REXB 1Z5OA 4R3UC 4TRJA 5FQOA 4NZOA 3S40A 4AMZA 4BNYA 2D5AA 4LJ4A 1KNQA 2PEYA 3CPSA 4INJA 1PD1A 5FOSA 2PH7A 1G2IA 3IVXA 5E6UA 5BWBA 1Q7BA 3N39C 1DO8A 2BJVA 2XAUA 1VPLA 3UCXA 5BYBA 4N5LA 1L5HA 1T9AA 4RFSB 3KYCB 4R05A 3A05A 2GH1A 2W42A 2XQKA 3LHDA 2W6NA 1KI4A 2Z83A 4K6FA 2GN2A 4DCNA 1EAYA 3P7MA 1L4MA 5CDYA 3MEQA 2QRPA 4BX2A 4H3VA 2NZVG 1J7KA 1ZI8A 3HDJA 1MB9A 1LK0A 3ZOZA 1GM5A 1THZA 3QMPA 2ZSIA 3C5WP 4O4HA 1GL9B 1AK9A 3F7TA 3FUUA 4GF5A 3SJUA 3KDSE 1EDBA 5EP1A 2GB4A 4YJFB 5EJ6A 1BCRA 2HA3A 1DWPA 1HEUA 3C3WA 4FI3C 4NEGA 1PSDA 1OAKA 3FKSD 4P83A 4ZQIA 3UTDA 2IY8A 4GX1A 3TJMA 2XOEA 5E6SB 1VIAA 3ESXA 4PYLA 4H3HB 4YPFA 1WXQA 3FN4A 1SHLA 3LDHA 2AOTA 2PUDA 1S8FA 3PHJA 4EKNB 1MX1A 5KIAA 3D2AA 2P30A 4S1WA 5AR1A 2BN4A 2ZDQA 4RSHA 5ILGA 2PJUA 2BRUC 3QVOA 3BICA 3ICWA 1EJ2A 4RF3A 2PSDA 1C3LA 1GL7A 4CDNA 3PXUA 4CLDA 2W2QA 1IYZA 2ZU6A 1H22A 1I2ZA 2RHOA 3E9ZA 3FVTA 2EDCA 3IT1A 2XUAA 3OHSX 2H2IA 4QO8A 5EUBA 1RQNA 1YE3A 2FRDC 2GZAA 2FPOA 5IN5A 3RHFA 3M6UA 2Y2UA 2F67A 4Y9SA 3BQMB 1V6AA 3Q2KA 4ZDWA 3T95A 3GLQA 5KOIA 2ZI7A 4TYNA 4S1PA 4HWGA 3DVLA 4D8XA 1BKSB 1U3GA 4XUGB 4YRZA 3PWSA 5JHHB 3EOBI 2WINI 1Z39A 3KDAA 5A5GA 4AKIA 2DHDA 1SO8A 4DEVA 2ERCA 4WA8A 2ZIGA 5HZMA 4Z1OA 1L1FA 1PJ8A 2UVPA 1PKXA 4KO8A 4RELA 1EFDN 1R4MA 4YUYA 2G0NA 3HLKA 1CEEA 2VZ8A 4OREX 3UWOA 3P5BA 3I52A 4B7CA 3MCUA 5KNCD 2CFSA 2QLLA 1AKNA 2H5EA 2WWXA 4GMHA 1DNPA 4UNSA 3E81A 4IGFA 1R5JA 3DJFA 3LHKA 4XWWA 4C0SA 2Z0MA 3DJYA 4TL9A 2ZWIA 2IXDA 3BF8A 2X40A 4KV9A 1U3DA 1Y3IA 4OGWA 1J90A 3AI1A 1Y8CA 3UJ7A 5KTTA 2PLRA 3CNQS 3QPVA 3QXXA 3O82A 3KKPA 3UVEA 4KAAA 1VE5A 1F7UA 2XB4A 5KHLB 3VU1A 4K3UA 2WFMA 4YJ3B 5CT8A 2IU0A 1XVLA 1GLNA 4X3PA 3QBTA 2VLIA 2Z4RA 3HJNA 4BBAA 2HEGA 4TUYB 5H82A 4OQPA 2FPWA 2H4JA 4UCFA 5E6UB 1QZ3A 5B7QA 2BEJA 1ZVVA 1L5HB 3I37X 2E85A 4XDHA 4DABA 3T1VA 5EUQB 1DKQA 3D1JA 1ZOSA 4AY4A 3PGJA 3EGWA 2QPOA 2A7QA 2V4UA 4ER0A 1T5OA 4BKPA 4NR0A 4M9RA 4D42A 2NYVA 1F48A 2FN7A 2V9CA 3D4IA 4TXJA 4INAA 4DNFA 1C7JA 5DM70 1Z3IX 1E1LA 1K7FB 1FL9A 2ZEJA 3PFWO 1HOTA 1Z36A 3WLLA 5K09A 2PUEA 4WIAA 1LNZA 2JH3A 3MF4A 4FX2A 4G0NA 3NAQA 5FNVF 1FTWA 5J2TF 3JYOA 1QQBA 1EM6A 5KQLA 1BCRB 2LBPA 2YWHA 5IUJC 3KXIA 4J91A 4JLVA 2G70A 5IDWA 1ID1A 3I83A 1BVYF 4CMEC 1YDFA 1Z38A 1XZIA 2V58A 4W1SA 2P5SA 5IWAB 2GM4A 1CQZA 1TYCA 2BEVB 1JVNA 5DXAA 2JPDA 2W6CX 4BVAA 4D74A 3HO1A 2JF0A 4M86A 2BDUA 2AZTA 1FTYA 4L5AA 4JR0A 4MA5A 1KJYA 3ZUPA 3FVVA 1NYRA 3NBAA 1K08A 4UBIA 1NF2A 1KEUA 1WD5A 4I99A 2P90A 3EQ2A 4XR9A 5DULA 1BQEA 1WD7A 1QNLA 2FDXA 3AHEA 4IHJB 4S12A 2A5LA 4WOPA 3ROMA 4EYGA 4Q93A 2R8BA 2XZOA 1UR5A 2IYEA 1DCTA 1QHYA 2FSFA 2OXTA 4MVXA 1L4GA 1SK9A 2FP4B 3ACDA 4KJXA 1ND5A 4FQ5A 4DYDA 1J23A 3HJRA 3FTPA 1XA0A 4P92A 3GUUA 2BGGA 1HF3A 1Z18A 4WJLA 2IXTA 5BNTA 5DNCA 3DQZA 1SVMA 3GYGA 3JQFC 2AN1A 4Y6RA 4P3OA 3I9OA 1PV4A 2YFQA 3UB3A 1B2LA 1JKIA 3LDAA 1F20A 1HYEA 3PYLA 4NDNE 4E5SA 3S2YA 1P60A 1M9NA 3MJRA 2MYUA 1SIOA 2HL6A 2W2MA 2QB5A 2J09A 2B1IA 2PRIA 2YZ7A 4L6CA 1PZXA 4YUXA 1I7DA 3Q3HA 3BMQB 5DXJA 4CEHB 1E6CA 4DPKA 1UXHA 2W4QA 3AHJA 4B8YA 4BQIA 4PBSA 1M7BA 2PGAA 5C9ZA 1JU9A 1SK8A 1CRZA 2EFHB 1SU6A 3JSAA 3NM6B 4HWOA 4IXMA 5FI0B 4C22A 3I2JA 4TKUB 2BM8A 3S1AA 4B45A 1MIHA 4KN8A 5ALVA 5BW8A 3HHEA 3B6MA 2VYVD 4KPYA 1POWA 3O73A 2FRVA 3PDUA 4M49A 3INTA 1JR6A 2B8JA 4JCOA 3VGJA 2I7XA 3LZ6A 5EFZA 1Y3BE 4M1EA 4Z1MA 1W44A 1T9KA 2EVWX 2Q3CA 1ECCA 2C00A 1UBRS 3GJ8A 4MV0A 2ZB3A 4BCDA 5HGXA 4LJRA 1WB4A 2FPIA 1GDDA 1FZQA 1K7CA 3TZEA 1B1AA 3SIRA 3T1YB 4WXMA 5FWYA 2MMGA 1U1FA 5IAAA 3Q7TA 1IBSA 1PQYA 2IDJA 1W88A 1IJBA 3K9CA 5HFNA 3RJ9A 5CB8A 1IHDA 2XXBA 1AKTA 3C5HA 1FFGA 2XUFA 4X61A 3AW8A 1ORDA 1KYYA 3ZQ6A 3AY7A 1N7GA 4N5HX 2O23A 1L3IA 1UPCA 2JHAA 1VL0A 3PFIA 4JVSB 4LIPD 4UEQA 3TSWA 1Y7HA 3IOCA 4LGYA 1Z6PA 3TNJA 1Z7EA 4LRXA 4JZYA 1EK0A 2VTBA 1N4DA 1ZONA 2Z2IA 3TQTA 4Y1RA 5K1ZA 2ZCJA 2QIPA 4XZ3A 2A59A 1X7XB 2R1TB 3HMQA 1PJRA 2J6BA 1N0HA 2A0FA 2ODPA 3HBJA 3F3KA 3LC1O 2WF9A 5KNBA 4AQ7A 1EJ0A 1UH5A 3W5SA 3KK0A 1DHRA 2CBXA 3TEJA 4DV0B 2AEEA 5F12A 1KE1A 2NO0A 1VA5A 1SXJC 2EKZA 3UMFA 5ADVA 4Y9TA 4ESEA 4Y2XA 5CH3A 1ZP6A 2W58A 4UHJA 5CIWA 1DL5A 1HZZA 4HRYA 1JA0A 3O21A 1U1CA 2RGGA 2I7VA 3H4MA 5C8ZA 1ITZA 3N2ZB 4MS3B 4QJ5A 4AXBA 3GPLA 3PITA 3O8DA 4ZCPA 5E3JA 4IZOA 4OQMA 4PBRA 1TGVA 3OIDA 5GQSA 1GJRA 3RYCB 1QO0A 3QLVC 1SWVA 5AOVA 4C6SA 4Z54A 2LIPA 4QQRA 4DR6B 2G1KA 3H87A 3KPWA 3SP1A 5AKLA 2J31A 3GNLA 3HYNA 1CUFA 3TIXB 2IS6A 2H1RA 1ZQ1A 5IVIA 4AT1A 3IEIA 3EXG2 1PK9A 3E03A 2PBRA 3R3VA 1UPTA 3RTBA 2JH8A 5E4JA 2VA8A 4L95C 2Z5LA 4OOEA 4ZK6A 4LNHA 3NTOA 3BFKA 3D8UA 3AVWA 1YRAA 3EXG1 1GYRA 1OREA 3KJEA 2EHJA 1RZUA 2YX1A 4MUAA 4JT2A 3ERCA 3H04A 3W5VA 1SCUA 5HGJA 4BDTA 1SAYA 1T9ZA 2QZJA 4RDXA 1FW8A 2WNIA 1S02A 3UB2A 3DZ8A 2AG5A 4NEHB 1OFUX 4EJ6A 1KI6A 1ZGGA 1PEDA 1ZIPA 1K7XB 1TAQA 3AHFA 4L85A 4P2BA 3R9XA 5GIPE 3FYTA 4M9SA 5JS2A 2B2XA 1GVNB 1OBCA 5LJLA 1MTOA 3PK0A 1HG1A 1VSBA 4QDOA 3TM5A 1MW9X 2IEYA 3OE7D 2Q29A 2MYTA 1F5NA 1A95A 2PKWA 1A9OA 3OU6A 3T61A 1FNSA 1SBIA 2OP1A 1ZBQA 1AKVA 4ZQGA 5FWYB 2FOLA 3LUAA 3W3AH 4TXMA 3W9BA 1GZ6A 1V96A 4OI1A 1U04A 3WK7A 2YY5A 3QNUA 4EG5A 1VSVA 4CMGA 4RA9A 1GRVA 1WR8A 2AE2A 1WSBA 5H68A 3V4RA 1XTZA 2J3QA 2G25A 3FYUA 4WBXC 4DLKA 2GA9A 4ZRDA 4B6RA 4E46A 3HCWA 3QVUA 3QMWA 2UUCB 1XRMA 1U2SA 4GOJA 2IITA 4JLBA 1EWQA 2O1EA 2PLAA 3ZHYA 2IEBA 4I08A 4GT1A 1MG0A 1SULA 4UFNA 3JW8A 4MRPA 2LWIA 4H1HA 1E9VA 1TAHA 2DXIA 4DLWA 1YQ9A 1J1IA 3CV3A 1FXWF 1RC0A 3FCSB 5B1SA 3TUZC 3Q2IA 4TGLA 3ICOA 4LY0A 5CT5A 4BO5A 5DT9A 3Q7RA 2D1RA 2ZVPX 5KMGB 1KI9A 3N3BC 3CNHA 4C4SA 2P7HA 2R8XA 5EJAA 1SUIA 1IJFA 2NX2A 4G5QA 4J7AA 4ZEMA 1NJ8A 4FMCB 4RACA 2R68A 4Q6WA 5GOTA 4ER3A 3P0FA 4DMLA 1CNFA 1J49A 4DNXA 3EXFB 4PCVA 5A6SB 3SKYA 2O8VA 2ZWMA 3PC3A 4C14A 2XRMA 4ABYA 5B2EA 3G0BA 2OCAA 2V5AA 3EH1A 4F6RB 3G2NA 2FAXA 1PR9A 1IZ0A 2EW8A 4QQKA 4ASUA 5KTNA 1APBA 4QE3A 3L77A 1BDJA 5JO9A 5I3CA 3JASB 5EPEA 3H2SA 4JY7A 4YJ2F 4C0HA 2HFKA 2WZQA 4URZR 1OMOA 1M75A 3TS1A 3BULA 1LBHA 2WJYA 5K8JB 1Z4OA 3DAOA 1XXHE 3MMXA 4XPIA 4BNGA 3L7NA 3ZWQA 3W8EA 3N0TA 3ZGLA 4Y0NA 1QZUA 3ZHXA 1TMOA 4C89A 3A1VA 4HLNA 1EK5A 4A0GA 2P9ZA 4JEMA 4JJ7A 3CJRA 3LZCA 3S5UA 4S3MA 3BM5A 3DDCA 1SCUB 3QP9A 3I2HA 4FBGA 2PO5A 1FJHA 1R8SA 1SIBE 3EDMA 3IKLA 3EC7A 1XKTA 5DLDA 5L95A 1GUAA 2R4QA 3M81A 4K28A 4DR4B 1C2YA 2K7ZA 2ANBA 4MUXA 4UXIA 2DPMA 2BHRA 3LQ4A 3ZE0B 3IUQA 3R9XB 1KDRA 1E4OA 4ITVA 1TYDE 5F76A 3SYKA 5BVGA 2BZGA 3K6JA 4BGIA 4JYAB 1GKIA 4GXQA 5DK4A 2Q6VA 3O7MA 5CJPA 4E5YA 4B87A 3ESAA 3Q5GA 1V3UA 1FYDA 2OCYC 4R6WA 1RFGE 2CJXA 1QIJA 3F1KA 1P4RA 2LW7A 4UU7A 4EFNA 3O8QA 2RGDA 4AG3A 5LLTA 2HBZA 1DPGA 1O94D 4Q1BA 5EQTA 3B3QA 3FYUB 1CZNA 1YUMA 4HRXA 2HI0A 3LOUA 2NYUA 3DVSX 3BMCA 3V1TC 2X6QA 4CGZA 3V4FA 3KQMA 4YECA 4AS1A 2AA3A 3HDHA 5KSZA 3ZDRA 4R1PA 4Z49A 5F7JA 5JPIA 5HKOA 1COZA 1QPZA 4OX9B 4HDKA 4N82A 1L8OA 3ETGA 1U1GA 4GMDA 2MSDB 4M0FA 2OZKA 2HMWA 3OPXA 5JFTA 5JG7A 4II2A 2YFKA 2IHTA 3WLTA 3AI2A 1K9VF 3A1WA 1JIQA 1O0SA 3COYA 3F7NA 3LHFA 1P2GA 3PQ3A 4QIHA 3V80A 1G16A 1TUBB 4IQ4A 1AB5A 5IX8A 4LOIA 1QGUA 2JD1A 1AXEA 4N18A 4YLGA 3RPEA 3GLGA 3DBOB 3PPWA 4MEAA 4S1NA 4DMFA 3G1WA 2HTFA 4UATA 4WCFA 5FO0A 4QVIA 5AH0A 3UWKA 2XYVA 5F2NA 3FOCA 2IHYA 1A8HA 5EIFA 1M8FA 3EY9A 4WBNA 5H4HA 1TZCA 3QPAA 3JAKA 4JH0A 4Q7JB 4UU8A 3ENZA 4DXDA 4A6DA 2Q1TA 1A77A 5K0BA 1Y8QA 3F7OA 3LHIA 5ALMA 5C5CA 2ETXA 5MDHA 4DR1B 4CF3A 1Z37A 1WY7A 5C31A 3ZXUB 3LY5A 4M1TA 4FSXA 1KMMA 3DWIA 1Y4AE 1ULBA 4ZT3A 1UWVA 3BK1A 4S04A 1GSAA 4AQYB 2G28A 2DMRA 2B1RA 1E7MA 3GDOA 3KXKA 4RKRA 3GN1A 2ZTVA 4KIUA 4QXOA 2NUAB 2WWWA 3VZSA 1RPTA 3L4EA 5I9TA 3RU7A 4BJ1A 3SN6A 3FOZA 1RQGA 1MPXA 3IDQA 3K8OE 3GRCA 1YRLA 2CLCX 3DYBA 4DJJA 1P4AA 5H9VA 3DEKA 2Z2XA 3V00A 3QBVA 3T5DA 4R2LA 4F2PA 4J0IA 3IDZA 4MYDA 3ZYZA 1IN6A 2AUTA 2D0PB 6GPBA 2UV8A 3BXGA 3GXBA 3OZDA 1KJ8A 2DQZA 4I9FA 5C7YA 3ORRA 3FWZA 3KFXA 3LX4A 3O1LA 4HDRA 3S70A 4LXIA 5DHTA 1KEEA 3ED5A 1G8AA 1E94E 3EG5A 4OAPA 1OFHA 5MFPA 1IIBA 2BFWA 5LJIA 2OLKA 1WJGA 2PBZA 4M7OA 1GNVA 1T2EA 3VV2A 4A15A 3ZJVA 4JYZA 1TTTA 4BUJA 2BFNA 4F5WA 1VYTA 2AYXA 4NNOA 2ISCA 5FWAA 1RI3A 1AOXA 5KAMA 2Y3IA 3K32A 3PR3A 1JAXA 3ZKWB 1KSHA 3B5IA 4G09A 3EA0A 1T2UA 4RIFA 3SC2A 2GNOA 2ZUCA 3LUDA 3TXXA 3TTVA 5JQGA 4F2WA 1PI3A 5A9SB 1SBHA 1N6HA 3ZZTA 1DAIA 1E6UA 3DDNA 4HD8A 5C3MA 2GD1O 1SC9A 2PAAA 2EW1A 4G81A 2JHCA 2R8PA 4AJ4A 3BX1A 1H23A 1ATZA 3WGHA 3DAHA 2MR5A 2CF6A 1E99A 1T0BA 2R6ZA 3ENNA 4RWEA 3BJIC 4I81A 5ESWA 4BKRA 5IASA 1K06A 3B48A 3DXFA 4L0CA 2GUGA 3ZTYA 3KUCA 1U9ZA 4MGHA 3CEAA 2B3DA 4QUIA 2AL7A 3COWA 1KRHA 5IM5A 5FUQA 1GNPA 1OC2A 1LPSA 3CLRD 1EFKA 1LDNA 2GD2A 3GFBA 3OKFA 4Q7LA 5LWQA 5U4XA 4BB9A 3V9PA 4RVFA 4FGLA 5CEEA 4RVNA 3DLCA 4R68A 4P0TA 3MN1A 1UK7A 2JI4A 4DVGA 2BKXA 2PY6A 3S7ZA 3T3EA 1ZU5A 3T5PA 1CIPA 1N78A 2VWHA 1XMOB 5T57A 1JJVA 5HKAA 1QGUB 1MPTA 1GTMA 5REQA 3C7DB 2EP5A 3D5QA 3I01A 1EMDA 1OW3B 4EHNA 5BQXA 2XY4A 1GOTA 1W6UA 1Z4LA 4HWRA 2I9PA 3D6AA 4XM1A 1TVCA 2WU4A 4I1SA 3VPAA 1EHIA 2ENWA 3NJ4A 2QJOA 4XLTA 3F8WA 4MWTA 3C4VA 3OC0A 1C4WA 4Q6BA 4TSRA 4G5FA 1QP4A 2Y27A 3K0AA 2B8TA 3LY8A 1L4NA 3IVAA 4MWBA 3PNPA 4FMDF 4C43A 2OECA 5ARCA 1CY6A 1C9MA 2IOQA 3KQYA 3VDRA 3R3XA 3W9SA 3JWIA 4BNTA 3MOGA 2PX2A 3VR6A 2VHEA 3WGTA 2R5NA 3DBHB 4R8KA 3FPEA 1E3WA 2BBWA 4OA8A 3KZCA 4HH0A 4MH0R 1SHTX 4BZPA 4IKEA 4LNAA 4M54A 4RLFA 1G6Q1 4AECA 2FSVA 2JVKA 4C4PA 2P9QA 1OXMA 4G37A 3K6KA 3OPVA 4MV6A 4XTCS 3TPCA 2H0AA 4N0PA 4L07A 4EPWA 3J80A 3DQQA 3MWDA 5JFOA 3OWXA 1EVQA 1ADFA 1A2KC 2DLNA 1PV2A 1WXHA 4OGKA 1XMIA 1A0OA 4UE3S 4I50F 4UXHA 3UO8B 3ZCQA 5A9RA 4RNCA 2NV2B 2BCEA 5KCMA 1OU0A 2PGXA 4UXJA 3H1GA 5M04A 2I29A 3CLTC 3UYLA 1F2VA 1OXBB 3H6HA 1N2CB 3EE6A 4GRDA 4L8VA 1NDQA 1JLKA 1JLRA 1QG2A 4AKHA 1QMGA 1EEXB 3WFIA 2O48X 4DUPA 3A6GA 2UXCB 3PUIA 1BJTA 1EJ6A 5DNEA 3GRVA 5TGDA 4M3NA 3U16A 2BBOA 4YRKA 1UEJA 4EY6A 1JVBA 5JQGB 5ERGB 1M67A 3V8MA 5C7LO 1PWHA 4KWHA 2C84A 2JA1A 3GMSA 3V8BA 4YV1A 1BWRA 2ZUUA 2I7CA 4ZI7F 4P4NA 3HSYA 4QUBA 3SC6A 1ZOPA 2D5IA 1Z4PX 2W8BA 3H17A 4YV2A 5CH8A 1PNOA 2H2FA 4MOWA 3REGA 5CTAA 3S29A 1G6HA 1QRDA 1R0YA 2NU9A 1RRKA 3HVIA 4FJ2A 1DJMA 3NIFB 4YASA 5B30A 4QGBA 2AHRA 4LZOA 2VYQA 4KVFA 2CNKA 4R9SA 2J9FB 5J4VA 5EZSA 4DJDC 5BN4B 1K4KA 1J0XO 1Y7PA 2FMHA 1P4SA 2DERA 1JHPA 3FIUA 1Q1QA 2Q9UA 4GZ6A 3MJ4A 3O9VA 5I9SA 5LZ4A 4RJ2A 1B42A 2IQ5A 2JFXA 4XWTA 1W49A 2X2PA 4TZKA 1CDDA 1CNEA 3CUVA 2VJOA 3LC0A 5REQB 4D46A 2GEKA 3I9FA 1W6RA 5BN5A 4GZ5A 3DE7X 1XDZA 4RSGA 2OCDA 4X62B 3F90A 4N5MA 4WZZA 3OT1B 3PQFA 1XD2A 3DOJA 3MB5A 1M0SA 4QPCA 3HS3A 4WHMA 1GAEO 4DBVO 5LMCA 1JE0A 1LPOA 3GJ4A 1UPAA 1K89A 2WE7A 3RT1A 3F46A 1B8OA 4JFAA 2GFQA 3SM9A 1U1IA 2WG1A 2CL5A 4UOQA 521PA 4U2CA 1PP4A 3W5AA 1C0EA 1VE7A 3NB0A 3BT7A 2ECOA 4J16C 4O5AA 3VTKA 1WKCA 4RXMA 3OZCA 1CETA 4OHZA 1IZ7A 1E3WB 2CLMB 4IGIA 3AI3A 4FR0A 1DDGA 4N5IX 1Z17A 4N6GA 5LL6P 1Q0ZA 1B2RA 1N77A 3OECA 5DPMA 2MR6A 2WAOA 5ALOA 4OP1A 5HHTA 2FMXA 2OZVA 1LW7A 4ZZIA 1L1RA 5J47A 2CD9A 2Q5LA 3EIWA 1HL3A 2OHVA 3RC9A 3VSCA 5JNSA 1JPJA 5K8UA 4PO3X 2ODWA 3GEDA 4UMVA 4X94A 4CM3A 5KBYA 4ARCA 3EXAA 4ZTBA 2ZJ3A 4MP6A 2ZRIA 2XIQA 3HJGA 4YJKA 3RS9A 1E2JA 2RBGA 3VJKA 3H8SA 3P27A 4MPRA 2VP3A 4X71A 3RVOA 4Y6SA 4EGCB 1IY8A 4JCCA 5DSXA 2JGAA 1WE2A 4PG8A 5AK3A 1MGPA 3CRMA 3FHTA 5AMXA 5AW4A 1DXYA 2PL3A 3KLMX 5JRZA 2ERXA 1EXWA 2VDKB 2XUHA 3CU5A 3Q0TA 4BWGA 4DF3A 4ZOQI 3GD5A 3NDBB 2GILA 3GPDG 4LCEA 4RTLA 2CZQA 2DF8A 4GKJB 1ABEA 3ZGXA 5K5EA 3D7KA 1RJWA 3LQ2A 2HOQA 3WICA 3A36A 1M2GA 2J9GA 2CL6X 2HMVA 2W8BB 4WACA 1MIOA 3G13A 3NYWA 1KXJA 1N1EA 2I7DA 1B1CA 3FW1A 3DYVA 4HGYA 2HUNA 4PRKA 3G17A 3KJHA 2AJCA 5D01A 2WYHA 3B9QA 4KVAA 3BTVA 1KRXA 1OI2A 4LZWA 2AG8A 4HXEB 2A78A 1M73E 2I71A 1MH1A 3EWIA 3JQ9A 4UE2A 5GM2A 5LN1A 2OBMA 1NP3A 4ZVVA 2JS7A 1HL7A 1ZKMA 1ECFA 5FA8A 3VYVA 4UPEA 1DFIA 4D3FA 2VHTA 2WWRA 3OKCA 3E82A 3UHAA 3LBFA 5DYYA 5C8DA 1H8HD 5HS4A 2XEDA 4G2NA 4PLWA 4EUFA 5ENDA 3SR4A 5KQMA 1QUFA 2V74B 3S99A 1ZD1A 3KWLA 4PSAA 3PWTA 4JDPA 4K6OA 3ROPA 4AN0A 4UJ5A 3RE1A 5KS2A 2P4UA 2YVKA 1XD2B 4DR5B 1QS0A 3VKFA 4AXXA 4FYYA 4ZVKA 1YI8A 3VRHA 2H07A 1OH8A 3E2MA 4JI6B 3SQNA 2XTZA 1MUUA 1Y1QA 2NTYC 2WT8A 4B3IA 4YB8A 4BLUA 2VNAA 4QU9A 3L6UA 1F6BA 1FSZA 1EFHA 1RM5A 1UMCB 2JIZD 3RABA 3M6WA 3HZRA 1GA6A 4LFCB 1ZY2A 2C5BA 1W0CA 2Z6UA 5F98A 4CG3A 3RFTA 1W5FA 2AMFA 1EYZA 1PZMA 3R0IA 5A4AA 3DC2A 5B1YA 2CDCA 4XRGA 5HK8A 3KJGA 4MCAA 3EZFA 3URKA 1EBBA 2CUZA 4RPGA 4RYDA 2IOYA 1FUKA 4I46A 2AI1A 4B0PA 5JNUA 4IY1A 5L51A 1R8QA 1PZGA 4LSWA 4FJ1A 3MJTA 3EHEA 2PMWB 1NZJA 4GDMA 1DQSA 2Y71A 3G0GA 3PTLA 5CCBA 3EVFA 3ZUGA 2O3RA 2WWGA 4BMPB 2W9XA 1L7PA 1B93A 2GRAA 3AJAA 2M98A 3I2IA 2VHVA 3LT0A 3CRVA 1HTBA 2WK1A 2BE9A 4MUYA 1Q1EA 3FBWA 4B3SB 4YRFA 3KOYA 4HQRA 4L15A 2ZM5A 3ZLJA 3L4JA 3ZD7A 4WPGA 3MT9A 4XVRA 1IQPA 3OCVA 3SBXA 4DLRA 4G4IA 3PNYA 3PEFA 3PIDA 4CMJA 3GH3A 1U2TA 3IEUA 1GTL1 4WDQA 3E9YA 1HRKA 2EWVA 4L8YA 5FL7D 1KZ6A 2FN8A 3L93A 4RJLA 2BFAA 3L1UA 1PIWA 3OEEA 4HN2A 1E2MA 4X1YB 1NI4B 3G0DA 3ZXXA 4E2ZA 1DAEA 5IVHA 2OCPA 4GX5A 5BQPA 3EZXA 2AD1A 4Z9XA 3T7SA 1QONA 2P67A 5I7EA 1RI2A 2ZJ5A 4PQGA 5LIRA 4D8UA 4OLAA 1GILA 2A0KA 2JD2A 1FDRA 5COAA 4ZOAA 1N7JA 3H1TA 2ADOA 1P9RA 1GG2A 2WIGA 3QU9A 4IWNA 1JDJA 2A9PA 2FQWA 1WPGA 1U4SA 2VEDA 2W6QA 2XDQB 3L8FA 3PCXA 3FLBA 2FSGA 1H05A 4G63A 4QHYA 3DOUA 1T4CA 3CZQA 2F59A 2Z04A 1HFKA 1VL2A 3GLUA 3EBPA 3UV3A 5IKOA 1L8QA 3DUFA 5E9QA 1D4ZA 3H8VA 3M3HA 2FSUA 4QTZA 1M8JA 2V54A 4QOHA 3FCEA 4Q3OA 3LYLA 2DR2A 1K6MA 3OWOA 4PR3A 4RV5A 3EG9B 4DARA 1SUCA 4QKQA 3FGNA 2X7JA 3EFOA 4X93A 3DWFA 3H83A 3GZNB 1XLUA 4D3XA 2V7QD 4R1LA 5KC9A 5M5BA 4DC9A 1KZYC 1XCMA 3AYZB 1FU4A 4L2IB 3AOGA 4MDHA 4JP2A 3W7VA 2NZ2A 5CCEA 3IL2A 2OFPA 5JIBA 2CLLB 2HWXA 4G1FA 3AR7A 3A4YA 2NVOA 3KB6A 3S8YA 2B25A 2ZSFA 4AF6A 4Z0HO 4LGMA 1DGQA 4BTLA 4EMUA 2CXTA 4MJLA 3GNQA 1N2CE 1JEAA 1SM4A 2DSTA 2QM3A 4TT8A 4WCDA 4ZALA 5HBRA 3SF0A 5K9ZA 2B2NA 3GJSA 3O4RA 2D59A 3HMKA 4AP6A 1XN1A 1F6WA 1XAJA 1ODJA 2NTJA 3JD1A 1R0SA 3E9EA 1PS9A 2ID8A 3RSGA 1Y6JA 4YP1A 1Z2CA 2IYSA 4REMA 1I3CA 3ZS9A 4V0QA 4PZ0A 1BN6A 3DBLA 2DPXA 6REQB 3T7DA 1EFAA 2WSMA 2E5LB 5JJIA 1PJLA 4ZQFA 1J0AA 1EZZA 1NQWA 2P3LA 2QL6A 2GN1A 3W06A 4E0BA 1XZKA 4X6LA 4MV3A 4EB0A 2MYNA 3OJWA 4H7DA 5JATA 1AT1A 5CLHA 3Q2OA 5EEHA 1OI3A 4OYHA 1KVQA 4RL4A 5CFOA 4UBOA 4BNIA 1LDBA 2J41A 2LGJA 1P31A 3LUBA 3M6LA 4K9SA 4CL8A 3O91A 4IAOA 5BVHA 3JWPA 1TYAE 3KOWA 3KQLA 4AIIA 4K9PA 1QF7A 4YLYA 2BFFA 4R3NA 3DKVA 2J45A 4WVLA 3WYCA 4UAGA 4WFQA 2E4YA 1CJSA 3ZW8A 4DLPA 4X7MA 1ULTA 5JZOA 3UZUA 4CMIA 4LHZA 3NPAA 1KJ9A 2HY7A 3AR2A 4WADA 3VPXA 4HT3B 4YRBA 3UAZA 2B5OA 2I91A 5ED4A 2F8SA 3IAAA 1NLUA 1TUEA 4OKNA 2AZDA 2X9GA 3OTHA 4WASA 5EP3A 2RGCA 1WMSA 1T29A 3DFKA 4URUR 1KWGA 4E1BA 4LF6B 2H06A 4URXR 1S8NA 1DEXA 4AZVA 3EODA 2BM0A 1JDPA 3CH6A 3D4PA 4EF6A 3KKNA 5KC8A 3A3NA 3MWEA 1FTQA 1OWLA 1SVNA 2ILTA 3TKYA 3DUFB 4OQDA 2O8BB 2NYRA 1TEVA 3HBNA 4PLZA 4Q9NA 2PSEA 2P2DA 1W25A 5E7MA 2DFKB 1ONOA 1GYPA 4L4SA 5LWHA 4BX9A 1TL7C 2J33A 4CF4A 5KNBH 6ABPA 4TV9B 3PI6A 3RU9A 4Q4JA 1L0BA 4Q7MB 3A2LA 2PH3A 5JEEA 4GZMA 2OY0A 5EZ6B 2AR0A 2H48A 2I6TA 3PDIA 3VAZA 3FCOA 3FWYA 1Z33A 3N9IA 2V7VA 1LPAB 3GGPA 4AJOA 3PTAA 1L4BA 3WWOA 3EGEA 1AHIA 1QR2A 4U2GA 4FHEA 4UUOA 1VKZA 3Q3GE 4P3PA 1AN0A 4IV0A 1E0AA 4JBLA 4BC1A 4LF7B 4XA8A 2OPHA 3EIEA 3V2GA 4RAOA 3AP3A 1Y80A 4X44A 4HNUA 4ZJZA 2P69A 3DOOA 1P61B 5ISMA 4OVKA 2A9QA 1S4QA 4JBNA 3USZA 1Z0KA 4ZT6A 2IUEA 4FW8A 3SHOA 1RWBA 2ZSHA 3LWZA 4IDEA 1C1DA 1RLOA 2GXQA 1AHHA 2NAPA 3ZLTA 1UPBA 5CU7A 1BW9B 3KPYA 1COWD 1SKAA 2O05A 2CUKA 4B4UA 3G88A 3BC1A 4FMBB 4HS9A 2HC9A 1K3UB 2QLJA 3TW6A 3AF4A 1KZ4A 5DGXA 5AIAA 4OH7A 1MNQA 2NVWA 5TJHA 3KVRA 4IINA 2ZTLA 1ILWA 1Z13A 4C9BA 5AIBA 3RFXA 2PFGA 5A1JA 4P4LA 2AFIE 3U4HA 1B00A 3GLKA 5JAPA 1P72A 1F0NA 2HK7A 4GXRA 5IYZF 3LV8A 1L7NA 3J7TA 3IP7A 3HVUA 1E2UA 1T3ZA 3RC7A 2OCXA 3VC1A 3ZDBA 1E2BA 3JWHA 1DXQA 4NI5A 5EQJB 5EZYF 5K2MA 4CE6A 1GZ5A 4QG3A 1NSTA 3HJHA 2ES4A 4HGOA 3WI7A 4M0EA 3D2LA 3IPCA 3DNPA 4RADA 3UC5A 5KJ1A 2F1RA 5CLIA 1Z0IA 4FHFA 2RONA 1F6DA 3R41A 5LA6F 5IJZA 4QATA 4C3OB 2VWPA 2DSNA 2J7KA 2R86A 5KDLA 3NHKA 4F7DA 5CDHA 3UJDA 5JNLA 5L7WA 1ZESA 3EPKA 4CMIB 3EPPA 3HB7A 1SEPA 4Z8YA 4BVBA 4KREA 2VYFA 1QH0A 3VR4A 2Q3JA 1U7ZA 3NZEA 4JU8A 2GCNA 1FUIA 1U80A 2GWRA 2O7RA 1GPBA 3FNHA 3KIPA 3OQ6A 4MVJP 5GADl 5JXGA 2X4LA 4P53A 4XD7A 5EJ5A 1GPDG 1O4VA 2LE0A 3Q87B 4FGJA 4HFJA 1Z73A 3R7BA 2G36A 3BORA 2RCYA 3K0EA 4NABA 1YRQA 4A6PA 4RD6A 4BE9A 1Q84A 5CHYA 1VG1A 1WW2A 2BI7A 3W2HA 5DVZA 4BY9E 4GUDA 2HFJA 4J1NA 2PFSA 2VF7A 1M76A 1AKYA 3RS2A 2GXAA 3AUSA 3IJ5A 5ICSA 1MRNA 4H6PA 1QF6A 2YYAA 2AMYA 3N87A 1IM5A 4JKIA 2OR3A 1H6DA 1LF5A 2YN4A 4W82A 4FK8A 4AZ3B 3IIJA 4DCPA 1L5WA 2HMTA 3PRKE 2NTVA 3RK4A 1SCIA 2PBFA 4H3KB 1PEAA 1Z22A 2DHEA 2VSFA 2YWBA 1LV8A 4TYPA 5DRTA 3RTCA 1WVGA 2G7MC 3RYIB 1TXGA 1PWZA 3QY0A 1TA4A 2PUJA 3DAPA 3ESDA 1XIVA 3N7TA 4UHFA 1IEWA 3VHRA 1GGKA 5KPJA 4YQFA 2YOHA 2F1KA 3RJZA 3VYUB 2CNDA 4TLLB 2OUKA 1NX9A 1VBKA 2NU8A 1OZFA 3ASZA 2G6TA 3CPEA 2GHQA 4PV7A 3TVTA 3O3CA 1Q7TA 4EATA 1PLJA 1CUXA 5B58C 1UXKA 2CWWA 2J4DA 3I76A 4IJ6A 3TZQA 1P33A 5IT0A 4EYQA 2BAGA 1WCIB 2NM0A 4JB3A 3PEWA 1YAJA 4NH4A 3M9WA 2G9QA 1IM2A 3WB2A 1KQ3A 3VPHA 1W36B 2ZJYA 2AEFA 4D0NA 3LSYA 1X1EA 4S05A 3F9IA 3GNSA 2GYVA 4PAMA 1YH3A 4AMGA 2W98A 3RYTC 5E6RA 4DJFC 4QG7A 2PVSA 1WTCA 1SIUA 3T54A 3TLYA 3B2EA 6PFKA 5JALA 3FSEA 5CX1B 3FROA 4JEUA 1CW2B 1G6KA 3UW3A 3C85A 4FCVA 1WU8A 5AJZA 1ZJ6A 2A33A 3EVBA 4ED9A 3H2ZA 1FCJA 3ANLA 4D45A 3QKRB 1ZAYA 4WY2A 3B7WA 4R7TA 1T1SA 1TQ4A 1G9TA 1OJLA 1MA0A 1NW9B 3QELB 3TK1A 2C3YA 3UEOA 2Q0XA 1Y8ZA 2F43A 4LKOA 5FUWA 2QN9A 3P9PA 4ML3A 2TYSB 3NTXA 4D0RA 4L57A 2PJZA 1HDXA 1L8LA 3L7OA 2R6DA 5E7IA 3TCNA 1XJWA 2R8OA 4OD0A 2H1OA 3ONVA 1Q50A 1YRYE 1PUXA 4Q7EA 5K45A 4C88A 4HUQB 2ZE6A 4OAQA 1LDMA 2IY7A 3ROXA 3B3JA 4Z7JA 1U28A 1P5ZB 1CUIA 3NDPA 1QTIA 2VEOA 1OBVA 1L8XA 1WUJS 2D1QA 1XRSB 4KQHA 1WL8A 5IS2A 3OZTA 3V4ZA 4B2LA 4BNNA 3KR9A 1QH8A 4R1TA 3UGTA 2VK1A 1JDNA 4TTIA 2VQEB 1HH4A 4J4BA 3SQDA 2D7JA 3KEOA 4LA4A 4ZYWA 5AVZA 2EKPA 1KXZA 3CLKA 2AF3C 4KBYA 1UXIA 1R5OA 3KALA 4TTTS 2GCGA 4Y6OA 5DT2A 2D62A 2P62A 4MIKA 1E1YA 4UHKA 1XE3A 5EJMA 3TLZA 1J09A 3I0NA 3CKLA 4K88A 4WLUA 1H5QA 2F62A 1FMCA 1V8PA 4TZ6A 1XLTA 1ILEA 2GBFA 2C77A 1V8FA 3WYDA 2W2LA 3OBBA 2X2FA 1Z56C 2WBLC 5FI1B 3KHKA 1BS2A 5EJ8A 3IAXA 4XTRA 5AHXA 4ZRMA 4R1NA 2ZRCA 5GJCA 3D54D 4HAZA 3T3NA 1Z4JA 1IDN1 3WGIA 2GAOA 3AUJB 4HX2A 1RWXA 3TLXA 1NOJA 4HZIA 1I7PA 4KDEA 3W2TA 1L7BA 1R16A 2YJ4A 4MQBA 3NBYC 5TMEA 3SG0A 2HHCA 5FADA 1IOZA 1UANA 5IC5A 5IFKA 1HY3A 1NJGA 3LT5A 1FVOA 1YBVA 1SVOA 1DV2A 2WSSD 4GEKA 1EVIA 1Z0FA 2XBLA 4LHYA 1XP8A 8LDHA 2WF8A 1C8LA 3IDSA 5GPBA 2GT1A 2RHHA 1DRUA 3ISVA 3QYPA 4F46A 3NRBA 5JDCC 4KPEC 5H5JA 1U8FO 3TN7A 1YMQA 5DNWA 3CLVA 1FDVA 5HKKD 4QHTA 2XNJA 1GKYA 4BO2A 2VHXA 1R15A 4I66A 3WQBA 3SBEA 2AX3A 2Z9DA 5IULC 5DLEA 2P41A 3LLUA 5LZ5A 3OPYB 2NG1A 4Z4CA 5HIKA 2OAEA 1NOIA 1HDIA 5T5QA 4LSMA 1OH7A 2G40A 1MAAA 4J9UE 4LDPA 3V8PA 1JMKC 3FPBA 4B76A 4YUWA 1ENZA 4Q9JA 1FU8A 1W73A 3MELA 1MBZA 2WJJA 5FH9A 3HJAA 1BNCA 2OO5C 4G5OA 1NFFA 2QTLA 3CO5A 5JAHA 1FRZA 3ZV4A 1VBMA 3GGJA 4JOSA 1T8TA 1E1DA 4OIFA 4R2XA 1VZ2A 1TPZA 3R5SA 4O8CA 1UM8A 5CEFA 3T7CA 3BL6A 3N0WA 5CVCA 3L8MA 4XCVA 5DLQC 2FN4A 3FX2A 1KOLA 3THRA 3C48A 3IUSA 3U3JA 4DLTA 3ZLBA 4EG3A 4Y2UA 3OX1A 3QBJA 3HP4A 3KPUA 3V55A 2I4OA 2QNBA 4YDRA 4ZVNA 1HSZA 4G2TA 4ESHA 3R40A 1WZUA 5J5VA 1ISPA 2PXHA 3DE1X 4WXEA 2RSLA 1LUAA 2AQKA 2FKNA 2PD6A 5CDUA 2IOFK 4QYXA 4QYWA 1DO0A 4UUQA 4OBEA 3N07A 5HQ3B 4O4IA 1E3IA 1EBFA 2P9CA 3KSRA 3QHQA 4KXQA 4YQEA 1T0IA 4EARA 3O2NA 2O2IA 5ALDA 2C99A 3VMFA 1XPUA 2UYQA 1KJQA 1RFLA 2VCYA 5FBLB 4DT1A 1X9GA 2VQ3A 3CNNA 1W29A 1Y4SA 3PKJA 3E18A 1WETA 1E0JA 2XMSA 4BUZA 3CLRC 2I4MA 3RH0A 2PQ0A 4TMFA 5LZ2A 3B7GA 5HCUA 4FFMA 3E22B 4BFSA 2R7LA 2I3BA 5DSTA 1X7DA 1JBQA 2ILVA 2RG7A 5JWOA 1RABA 1YR6A 3GCXA 2CFCA 3G6KA 3DV0B 3AUTA 4K7JA 4CLEA 5JCPA 4XSVA 3CLUD 3PDWA 2DOKA 5AQ1A 4N39A 3ZHOA 3UGJA 2C4TA 5JR3A 3HNRA 4EA9A 3B1ZA 5KX5F 3E61A 5F2EA 2E5FA 2YXLA 1QLHA 4NU5A 1W35A 2WB2A 2IW3A 3RBZA 3V5NA 3VR6H 2BFOA 2OBXA 3LRXA 4NYIQ 4TZ0A 2OQIA 2JGIA 5FBZA 4BNKA 3T3HA 4REQB 5BW6B 2DCMA 3AETA 2PUGA 2EXXA 2GZHA 4JC8A 3X44A 4QXPA 1VECA 1E2PA 4LZPA 5SY4A 2FMKA 4IH4A 3ZNNA 3KC2A 3SJAA 2VYCA 3U19A 5AVVA 3M6IA 3ZZMA 3EXHB 1QIHA 4B9EA 3O6VA 1R74A 1U99A 2IH2A 1X6VA 5FTKA 5A06A 3AESB 1AD2A 3BILA 1G5IA 1ZOLA 2CUNA 2I76A 2NIPA 4PQYA 4NBVA 1IVYA 4ZXPA 1F51E 1VCMA 3EY4A 5EIAA 4JUBA 4YJGB 3C6XA 3A2KA 1ISFA 4L9RA 5EHQA 4Z0NA 1V11A 3EZ2A 4O2BA 5AVYA 3P2KA 2OT3B 3TJZA 3X1JA 1UOOA 2GBIA 1OIWA 4U7TB 5D6OA 1A9TA 4MR9A 3KNZA 4MVJE 4N9QA 2VSQA 4LDRA 4OIMA 2A57A 4PSUA 4RNDB 3H5IA 4X84A 3LT4A 5LYJA 1II8A 3K05A 4GMGA 2NOAA 3K1ZA 1MXFA 3FTDA 2O3JA 3K92A 4A27A 4DQVA 1WO8A 3DP7A 1QV9A 2P9TA 2JGKA 2EWWA 3GG9A 4N7MA 3KKQA 2ZI4A 1VJ1A 3KBBA 4QVKA 3ZI7A 1UFQA 4IUDS 4Q66C 5BSMA 3H75A 3VR5D 1YQDA 4TTSA 5C37A 3DL2A 4IRMA 2XT9A 5JAZA 3S2ZA 1T3LA 1R6TA 5F35A 3R2JA 3UJCA 3WVNA 2V3WA 1POXA 2Y9MB 3VMMA 1T2DA 1KAOA 4F4IA 1TO1E 3BJEA 4GOXA 4YRRA 2MSEB 3HRIA 2QMHA 3NHZA 1E66A 3JQGB 5HW0A 5MF6A 5T6BA 2WWYA 3SX0A 3I5UA 4TSFA 2O2DA 3KLNA 4IIJA 2C0CA 3N5CA 2O2SA 2O2GA 5IJ0B 1YL7A 1NL3A 3GFTA 3IQWA 1JXQA 1UPUA 2R00C 1DJNA 4B79A 2QG6A 1O8CA 2ZP1A 4NMMA 3PLRA 3VKUA 1N92A 4LHEA 4TS4A 3ND6A 2HF8A 5AJWA 1IULA 4F93B 2FGJA 3R3ZA 1Q20A 2J48A 4NVRA 5AICA 3WWPA 3DTVB 5TPZD 4BBZA 2PUCA 3QPDA 4CUJA 1Y98A 2GPYA 3NETA 4KSYA 2ASVA 4CDMA 5AQEA 2FSPA 3SJ7A 4MKHA 2DHCA 1G5RA 1RXIA 4IDPA 4UBLA 4CM7A 5AI5A 2D6FA 3KQOA 4ZOLB 4BO9A 2BTQB 2FR8C 4GUAA 5IMBA 1YVRA 1YBHA 1EE1A 4FR5A 1ECGA 3RIEA 2PMBA 1E4EB 5H7XA 4B7AA 5DN6A 2XMGA 3EDRA 1FP2A 3F5SA 3VOAA 2CHVA 2IKQA 3H2GA 3HBLA 4W7IA 1INLA 4B73A 3G0HA 2F9LA 2CF5A 4UDYX 2FFAA 2RHRA 4PFKA 2PT6A 4MTCA 4FB4A 2D1SA 3O4HA 2PBLA 5CM9C 4GW3A 5FFFA 4EL0A 1EFPB 2AN3A 3K71B 2EFGA 4BXOB 4Z53A 3H2HA 3N2LA 1D4OA 3P4YA 2ZULA 2OYCA 5HSGA 3R5JA 3BGVA 5FOXA 2WU0A 3K16A 1I0IA 4BFYA 3MCWA 1D7OA 4CLXA 2HU8A 1I1QB 5LQUA 4MW4A 3H9BA 1XEFA 4HL6A 4J07A 2IZ0A 1RWPA 3OTQA 1FDSA 2EHDA 3AEUB 3GH1A 4IWYA 3EQ6A 3W6ZA 2YCLA 3CUTA 3P9XA 3OQHA 5B3JA 4PLTA 1TYBE 2HHAA 4RK4A 4AMVA 1X94A 2H3EA 1I32A 4KRFA 2FX2A 4Q9DA 2QE6A 2C54A 1Q5PA 2RAFA 4I1YA 1LBEA 3AP1A 4V02A 3T4EA 4ZYLA 4L0DA 4H08A 4R54A 4L74A 5LYJB 1X1DA 2JIRA 3I6BA 3NNNA 4Z99A 1C14A 1X92A 2RHBA 3LIIA 4TWIA 1WOMA 1Y1PA 3TRKA 3JY6A 4GFDA 1E5XA 2G9RA 1CY1A 3CWQA 1GEGA 1RRMA 4NOMA 4BQFA 1YBFA 1O5TA 1U7HA 3BXXA 2H92A 3JQ6A 5CM2Z 1X8LA 2J0VA 3U7QB 3AHHA 3CBQA 3HLYA 1AKRA 4BL5A 5EIBD 1NPTO 4YMUA 2CVQA 2C04A 4O4JA 4CQMA 5TJ9A 3RSFA 1P2UA 1MKYA 2P78A 3JX9A 3RIMA 2XCIA 3KYDA 4POOA 4RTSA 3WFJA 1SXIA 4GNKA 2HZ7A 4UM9D 5AFSA 1RJFA 5HZKA 1PGQA 4RENA 2CXRA 2OSVA 3CLSC 4IIJB 1AMNA 1JHRA 2P8SA 3KXLA 4W99A 5JQWA 1XMPA 5AVTA 4HGZA 4J0HA 2J07A 2NGRA 3IXMA 4W1QA 3H0CA 4RXTA 1IATA 2QORA 3BTSA 4L75A 1DT5A 4GP6A 4IOMA 3ULKA 4HQLA 2HU2A 4EB6B 3IT3A 3X0DA 1Z6XA 5B6JA 1IUNA 1SMKA 1ZD2P 3RRMA 1CQIA 3JWJA 1NN5A 2RCNA 4WZAE 3KT3A 4BMXA 1SVSA 5A62A 3CEJA 3OQMA 4PYJA 3P0IA 1PK8A 2VJMA 4I6EA 5HDQA 2GJSA 3CUWA 4AY2A 4UQLA 1XAHA 1G8GA 5G02A 4LF4B