2W2MA

Wt pcsk9-deltac bound to wt egf-a of ldlr
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
277
Chain Sequence
b'SIPWNLERITPPRGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDSKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
molecule tags Hydrolase/receptor
source organism Homo sapiens
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
total genus 92
structure length 277
sequence length 295
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2w2mA00
1Y9ZA 3A3OA 1T1EA 1Y33E 4CFZA 3VSBA 1SUPA 3A3NA 5FAXA 4AKSA 1R0RE 1ST2A 1BFUA 1TECE 1SPBS 1EA7A 1YJAA 3BGOS 3DW1X 3GT3A 3GT4A 3LPCA 3DYBA 3LPAA 3QMPA 3ZXYA 1TM3E 1SCNE 1TM4E 4NE9A 1AQNA 1Y48E 1DBIA 1NDQA 4ZARA 1ST3A 1SUBA 1OYOA 1S2NA 2SBTA 3VV3A 1YU6A 3DE1X 2V8BA 3BX1A 2SECE 2W2QA 2XRMA 5FBZA 1OYVA 5SICE 3UNXA 4OMDA 3OSZA 1AVTA 1MEEA 1AU9A 1KDZA 3TECE 4AKTA 1VSBA 1SCDA 2PRKA 2IY9A 3VHQA 3DE0X 3D43A 1Y4DE 2ZRQA 3Q40A 4KPGA 1Y3DE 1SBTA 1KDVA 4DZTA 4H6WA 3F49S 4B5LA 1SBNE 5JXIA 1T1IA 1KE2A 4KG7A 1C9JA 2Z2XA 1NLUA 1Q5PA 1SELA 1TO1E 1WSDA 3DE5X 3I30X 4BWGA 1P7VA 1ZVKA 4RYDA 3QTLA 1HT3A 1YJBA 2PWBA 2W2MA 1PEKE 2QTWB 2WWTA 3DW3X 1SUAA 2W2OA 2GKOA 3EE6A 4NE7A 1LW6E 1SN7A 4OV6B 1KDYA 5JXGA 3ZXXA 4YN3A 1NDUA 1SIBE 3LXUX 4J94A 2SNIE 3PTLA 1CSEE 3VYVA 2XTJA 1Y3FE 1R6VA 1BH6A 3EIFA 4NMXB 4Z2AA 5JXHA 1TM5E 1WMFA 4MZDA 5ARBA 1GTG1 1SBCA 3HJRA 3WHIA 1WMDA 1Y3CE 1AK9A 3EDYA 4GI3A 4JP8A 2B6NA 1T1GA 5AQEA 3DE7X 1WMEA 5AVJA 3AJ8A 2PQ2A 1AF4A 3DWEX 1SUEA 2HPZA 2WUWE 2SICE 1C9MA 1TM7E 1V5IA 1S01A 2Z2YA 2ZWOA 2Z56A 3T41A 5AVKA 1Y34E 1Y3BE 4LVNA 3VTAA 1IAVA 1CNMA 4K8RB 1PFGA 5FFNA 3DE2X 4WOBA 1Y1KE 1ZVJA 4DJ5X 1IC6A 5JXJA 3DE3X 4ZOQI 3AJ9A 1S02A 1SCJA 1SCBA 1SIOA 3DE4X 4M1ZA 1GCIA 2ZWPA 3A3PA 1R64A 1A2QA 1DUIA 1XF1A 1KE1A 1SBHA 2W2NA 4H6XA 3I34X 4C3UA 3SICE 2DQKA 3GCWA 1AV7A 1SH7A 3Q5GA 5B1DA 4C3VA 1UBNA 1SVNA 2PYZA 4DWWA 2ID4A 3BPSA 3DVRX 3I37X 4WOCA 5JMOA 2P4EA 1GTL1 2PKCA 1BJRE 1SUDA 3LPDA 5CW1A 1SCAA 4KB5A 1C9NA 1GA4A 3CO0S 3F7OA 1OT5A 4H6VA 1BFKA 2PWAA 1BE6A 2E1PA 2Z2ZA 3DDZX 1YJCA 4LVOA 2G4VA 4HX2A 5I9SA 3DVQX 1EGQA 1PTKA 1P8JA 2X8JA 1PJ8A 2HD4A 1SBIA 3I2YX 1TK2A 2IXTA 1WVMA 1P7WA 2ST1A 1GNVA 1TMGE 1Y4AE 3CNQS 3H42B 3DVSX 3L1KA 4FONA 1AH2A 1GA1A 3TI9A 1GA6A 2DUJA 2W2PA 3DE6X 3SQOA 5K7SA 2Z30A 1THMA 5ARDA 2TECE 4OMCA 2X8JB 2PMWB 3PRKE 4I0WB 3WQBA 1TO2E 1GT91 2Z57A 3F7MA 1TM1E 3TI7A 3QFHA 3P5BA 4HVLA 5B1EA 2Z58A 5ARCA 1BE8A 3GCXA 4CG0A 2WV7A 3D9QX 3VV2A 1V6CA 3WIUA 3WIVA 4CFYA 1GNSA 5AMXA 1JEAA 1SIUA 1SUCA 3AFGA 2DP4E 1MPTA 1C3LA 2ID8A 1GTJ1 2WUVA
chains in the Genus database with same CATH superfamily
5KDDA 3QMWA 1DXQA 3LOUA 3LTEA 3OFND 4RE6A 4XFJA 3R9IA 2GTIA 2A92A 4MAMA 1RI4A 1YULA 3TOXA 2DT5A 4A6XA 1CF2O 4D0NA 5ICCA 1QHIA 5E7QA 4GF5A 5EZ6B 3RJZA 3O8CA 5HJ5A 5SZIA 3WV5A 2JLWA 4PAWA 2Q49A 1M2JA 1A98A 3A26A 1LDMA 2PCJA 3NVMB 1HE8B 3AIOA 4IS2A 3A25A 2NQ8A 2G36A 2J3LA 2BFFB 3N05A 2O7QA 3W7VA 1I7PA 4GBED 4AJNA 4MS1B 4AZ3B 3KAQA 3HJFA 1E94E 4PVCA 5JANA 5G0TA 1L9KA 2PUDA 2PY6A 4K87A 4HMQA 2W11A 1Y1QA 2DFTA 3U19A 2F4VB 2HWUA 5I8WA 3SGLA 1M8PA 3VBCA 5LVAA 2UXCB 2PSEA 2WV9A 3NC1C 4J29A 4F1KA 2X4LA 2JPDA 4GE3A 5I51A 3VUEA 3CW9A 3FKQA 5FFMA 1IHYA 4RF5A 5KOIA 1M5RA 5J1SB 3ST7A 1YMQA 4DNPA 2MMCA 4Y1GA 3VFDA 2HJ9A 3LQQA 5CVJA 5E9AA 3Q3GE 4LDNA 3GJTA 3OJEA 1R9JA 3SF0A 1ZN9A 3N2EA 4MUAA 4B3GA 4YIKA 4K28A 2C4KA 4B2LA 1QH0A 2F9LA 5TT1A 4B3IA 2YRFA 3W79A 4UTZA 5DK4A 4DC9A 1BROA 4X7PA 5K0EA 4PZAA 4RYLA 1NZJA 3WB1A 3FNGA 3EXHB 3MWJA 2YIMA 4PZUA 1KI3A 3DAHA 5DHTA 1YZTA 3P8ZA 3PWTA 2XZPA 1GXSA 1BO6A 1E4EB 2OXTA 1IAVA 3IR7A 3KU4A 4JWTA 4AB1A 2C3YA 3RWOA 4N7JA 4AUKA 1RIIA 3X43A 4IJUA 4YI5A 2O2YA 2IGBA 1GNPA 1ZP6A 4GYWA 4TUYF 4DLYA 2HR1A 4UDXX 1P3JA 1WULS 5HQJA 3QBEA 4IY1A 3ADKA 4ZMSA 3LRPA 1Z2PX 2COEA 3LDUA 4LQLA 1AZWA 5FLKA 2ROQA 1AHIA 3L8MA 3OEYA 3MTDA 5COQA 3RVLA 5HQ3A 5B6JA 3PUZA 4Z4FA 4LCEA 1KMCA 2X8AA 5K0JA 4B4KA 3KHTA 3UUGA 2HPAA 1X7WB 1L7NA 2RGAA 4X1KB 1BCSB 3PPYA 3HEAA 4A0GA 1C50A 1MRZA 5HK9A 1TTHA 1D2NA 5CJPA 3U3RA 1KZYC 1V95A 2B78A 1MUUA 1U7UA 2NSHA 4HI0E 4W63A 4S1VA 1BHSA 5ESXA 2PRSA 4Q4JB 1ADYA 1ZEJA 1ZW6A 3G7SA 1SUFA 1E9DA 1QK3A 1JT2A 4HN4B 5LB2A 3ZVLA 2EL9A 1GRVA 4DNXA 3T5TA 3W7AA 4ZZIA 3TFWA 4LRSB 1QC5B 1B00A 1KI1A 4BNJA 1KBZA 5C1DA 1W93A 4ONEA 1Z36A 4J1TC 4RZ2A 1W29A 4EJMA 3KB2A 1TFUA 3JWEA 4J2OA 1V1RB 2X7JA 3QELB 1MTZA 5EXTA 2G0AA 2A0KA 3CN9A 3GZNB 4G63A 4BRZA 4L8LA 3EIOA 1R00A 1GAEO 2FQYA 3P9IA 4H16A 4KWEA 2AC2A 4IAOA 4LZNA 2HIGA 5FL7A 3WLLA 4KWHA 1VGRA 2JJYA 1O0CA 3U4AA 2ETXA 2A1UA 1OZ0A 4EPWA 4J3JA 1RQLA 3KJFA 3W5JA 2PO5A 1UJBA 1BMFA 3HBAA 4LHWA 2VA8A 5C2JB 4IIJA 1OA0A 3OPYI 5FOUA 1XJWA 4JI3B 3X44A 3Q7SA 4U5QA 4K0RA 5TJHA 1JT9A 5CUQA 1XLUA 1D6JA 5DW3A 4P93A 1ISIA 1M2HA 3ZWOA 3ICEA 3GPBA 2X3UA 2UVDA 3W5AA 1PDVA 4BMSA 1P2SA 4EHHA 4O4LF 5ANRB 2AKAB 4GD3Q 1PV1A 3VV3A 3CVOA 3VU1A 4ZJUA 2VFAA 1XA4A 5IBRA 1US8A 2YUTA 4L5BA 2V6MA 1X8LA 4BB9A 3IXLA 2E4AA 2GWRA 3NIDB 4JYMA 4QUGA 5F9HA 1KE2A 3FPHA 1P9NA 1L4BA 4RJ2A 1FSZA 1CZUA 4Y2JA 1AE1A 3UMJA 3DPUA 1DRVA 3CNNA 1WNTA 5H8WA 1DAGA 2GM3A 2WM9B 5TGTA 1HBJA 2FG7C 5KPJA 1I3NA 2B8NA 3ILSA 1XVUA 1MIOB 4LOAA 2Y1EA 2XYGA 3IAS1 5E1BA 1TUBA 2FAXA 2IJGX 2P2DA 1SD5A 1M75A 5F3DA 4TLDA 3KSRA 1KQPA 3ZD7A 1H4SA 3UHOA 1A69A 4OCZA 4UASA 3Q3JB 1D4OA 3EZ7A 5DU2A 3ED5A 2XNHA 2XWSA 1OV6A 3GAFA 3BK7A 4V24A 3I9V1 3QA3E 3VR6H 2PPLA 1LXCA 4GOMD 4X1IA 2AG0A 4ALJA 1Q0LA 4BO6A 3OIGA 5JXJA 1H2ZA 4CF5A 4KR3A 1FFXA 4LTMA 3VA7A 3F7NA 4RAQA 5DWDA 2OYCA 1CR6A 1UH5A 1DTEA 2I34A 5FHRA 1MOPA 4X8MA 1NFQA 3KQPA 3TSZA 4DNFA 4EWLA 4ZC1A 1SHJA 2I6QA 2ZJ5A 4ZZ3A 3C8UA 3ND6A 1G4UR 2G5TA 1UODA 4UNIA 1Z15A 3FOCA 4JDUA 4M53A 3T0IA 4TTAA 3USZA 4L6AA 1CY1A 2GZAA 2B0CA 3U39A 3F8WA 2X7XA 4WH0A 4IOKA 5D8DA 1ODIA 1TJNA 4GECA 3JVDA 4Q6BA 5MFPA 2Y1OA 3DOEA 3A04A 3BGDA 3REQB 3DWIA 3PICA 4L57A 4NE2A 5J2TA 2PS0A 5G4KA 4DA4A 1TGVA 2GYUA 2ZJZA 4XW2A 1P9RA 1Y8CA 4M1YA 1HYGA 3LK6A 1WQ1R 1E9AA 1PVDA 2OB1A 1E6KA 1KPGA 4G86A 1X42A 3P0FA 4G09A 1C7QA 4ABYA 1RI5A 4YRIA 4DE5A 3M3HA 1N2XA 4NFYA 1ZCJA 2PXHA 1KEEA 3DOCA 4MPDA 2PS3A 1B0AA 3H65A 4L4UA 4O8CA 5CEJA 1OLUB 2OV6A 3SJBA 4LK2A 4D44A 1ZR2A 2V7WA 1WNFA 5BO5A 1VMEA 1LDEA 1UINA 2GASA 2P2SA 2YOGA 3D6AA 3OAAA 4LXHA 3VO1A 1WD7A 2OV8A 2CSUA 2AR7A 1E7QA 4IH9A 1YI0A 4P35A 4LCBA 4ENWA 1EWQA 1T5TA 1N2GA 3OUTA 2AG5A 1Y82A 1H5UA 2EFYA 2L2QA 4GQIA 4PYQA 1XRQA 4N01A 4GYJA 3STVA 5A62A 4YCNA 1L5RA 4M1EA 5DI3B 4Q3OA 4HGZA 1Q0PA 1YJAA 4PZZA 5DI9A 2ZIWB 1V1JA 3DBLB 4BRUA 3D7RA 1T9KA 1OROA 2BCEA 2YYSA 2Y67A 4XKJA 5I3ZA 3RNLA 2FWPA 2C5BA 2J9XB 1DCKA 5AXBA 4MIYA 4IV0A 3EVNA 1Q0HA 4G8DA 4HL6A 4A10A 2A58A 1E3QA 3TCXB 4NMHA 3RK0A 1U8ZA 3FTDA 3IIIA 1ZCFA 1V47A 3DLAA 4IHAA 3ZTYA 1Z63A 1JFSA 4OG2A 4TZTA 2C4TA 1HYEA 2HSDA 2RFLA 4UVGA 2ONZA 3HEMA 3RB8A 4BCDA 5CCBA 1TMKA 1ZIYA 4LPKA 1GVHA 1WVGA 4CKZA 3NVDA 2P9JA 3T5DA 1TQHA 3KOOA 5ALYA 3WWZA 2E89A 1CY0A 3ZHRA 4Z3OA 4YP1A 5KWEA 2W2MA 3AV0B 2QTWB 1I14A 4G97A 2W42A 1XTQA 3BF8A 3L9XA 1UFQA 2QEQA 3QK7A 3RVBA 2JFGA 1MP0A 3ZWVA 4L6CA 2XTJA 5C3UA 3DEJA 3G7UA 5JWRA 2KSQA 4GGOA 2BR5A 4CDRA 3OI7A 3PEFA 4N6GA 3H1AA 2Z95A 1BDIA 2NSLA 1KAGA 1UK9A 4H15A 1FJ2A 1NMSA 1V5IA 1Y3AA 1IXZA 3B6JA 3DDOA 4X91A 1EFHA 3SFVA 3CSDA 5FFNA 1MRNA 2CMFA 3TIGA 5EIOA 3LVQE 4CWAA 4EGFA 2ZJ8A 2JGLA 1FYEA 4DG8A 3FKSA 5IJ9B 4IIFA 4QPDA 4RQAA 1KARA 4ZDJA 2DKNA 3AKCA 4GUDA 4V0KA 3C7AA 5FTJA 2CUZA 4D8XA 2PUBA 3NDBB 1MBZA 2XV1A 4Q00A 1RXEA 4G36A 3MOSA 1VSQA 2V5UA 5CX4A 1H1LA 4K9SA 1PNTA 1QHEA 1EVEA 3DT6A 4FEEA 1NMXA 3OUUA 1VMAA 4LG1A 1SUWA 2C78A 3FJYA 3DVRX 2W58A 3UT5A 4KQCA 5EIHA 1FFBA 4I9HA 1OXKB 4MTCA 5I4CA 2PXXA 3KLBA 2J0UA 4YRNA 1G16A 5KSZA 3CF4A 5C4GB 3I9KA 1T3SA 3I0ZA 4KWIA 4CM9A 5FOSA 3RYTC 2G9QA 1K9SA 3F1LA 3DKKA 1AS3A 2JDIA 3FCCA 3HBNA 3U16A 1MAHA 4TWAA 4FMPA 3ABZA 1YAHA 1G0OA 2QPAA 5CA1F 4ENRA 2PDAA 1U7TA 3ORFA 3SC2B 3Q2OA 8ABPA 5ALGA 4BIIA 3KQUA 2ZUCA 1W0JA 2CZQA 1PJQA 3Q0TA 1N6RA 2PMWB 3BQ9A 2EC5A 3B3QA 1RBZA 2X2PA 1E2UA 2OCLA 3BYZA 3QNUA 4ZQCB 5E7IA 5HGJA 3UWKA 3BCHA 4O0MA 2B4YA 3I4CA 1VJ5A 2A9JA 2XYPA 2A4MA 4UBMA 1CRWG 4UE3S 2ZJ4A 2H5IA 4YY3B 4CUJA 3WIUA 2IBTA 5HIKA 5ECGC 3TNJA 3SMQA 3K15A 5F98A 2GXUA 4HQLA 1KZ1A 4MGHA 1X80A 1PZFA 1RAAA 1XRPA 4FSDA 4CV3A 3SMVA 1BW9B 3AL3A 3MS2A 4GAEA 3TNDA 3MJRA 3AEZA 3VGJA 3H4VA 4N3GA 1IXKA 3SX2A 4DM4A 5KSOA 3AR2A 1MO5A 3CQ9A 3DAGA 4P34A 4ER0A 2XXAA 2VF7A 5J4YA 3NW9A 4U3JB 4BO3A 2JEYA 4XQ0A 2X42A 4U8HA 5LQMA 4PN3A 4BOYA 4E46A 4RK6A 2J4FA 2HRCA 4AVYA 3CXUA 4NL4H 5LOVF 3FBGA 1YJXA 2HLPA 3PX2A 4O2AB 3ESZA 3UCXA 1Q22A 3ICPA 3LC1O 4YO8A 2QI9C 1AU9A 2ZM5A 3EXEA 5IUJC 3QKWA 3WL7A 3M4NA 4IFTA 3WAKA 1A5BB 1JAZA 4LJ4A 4AT1A 2ECKA 3BD8A 5DYNA 4G4SP 3IGFA 1I36A 3SY8A 1QTNA 4IO0A 5AI6A 4WWHA 4FGSA 1EFLA 4FFOA 4RHCA 1PCXA 1RVV1 4WESA 4C7VA 2X3YA 2VDRB 3IDQA 3JZMA 4MPRA 2V59A 2C4NA 1JKJB 1SUAA 4YDSA 3LV8A 3WBJA 5MN4A 4AQ7A 5EG5A 1QP7A 1C7JA 2H2DA 3TKLA 2CXUA 5JXHA 3RYCA 2NXCA 2YXDA 1FC0A 5CK4A 4KPUB 5EKSA 5B36A 4DDUA 3DXZA 3P27A 1LWNA 3I6QA 1ABEA 2OYSA 3DZ8A 1SBZA 3IDFA 3OPQA 1OFTA 3PQCA 4FZ3A 1KZGB 4JAVC 5KQRA 5TSDA 5A9TA 3ZU6A 1F5NA 3I61A 3OWHA 1IZ7A 1DCMA 4BFLA 3MGBA 2AI1A 3QX3A 3IUQA 5EYPA 4D8UA 1KSFX 3SWWA 3ZWYA 3N76A 1UDBA 1B6TA 2VPZA 4CJXA 4N0DA 3R7WA 4NYJQ 4OOEA 4HNVA 2BAGA 3GY0A 2CF6A 5C7YA 1E2EA 4AJ9A 5A3QA 5J2UF 1YSCA 4KK3A 3IDOA 2O3RA 4Q7KA 2BZ1A 2AG8A 2R6R1 1V8DA 1CY7A 3JQ9A 3W78A 4JJFA 3OTQA 1PW5A 2A5YB 3TZ6A 1G7RA 2CL5A 1QM5A 2DHCA 3MG9A 5ENZA 2QYSA 3MMXA 4JLWA 1W36B 2YJ3A 1OZGA 2BM0A 1LB1B 4LHSA 2JGDB 4U6NA 5HIJA 1ZHOA 1A2BA 3LBHA 2VZ9A 1PP4A 1GU0A 3QVOA 5EIXA 2KBFA 1V16A 1NHGA 3GFRA 4D4MA 3HDTA 4OAPA 4FOSA 4GZMA 4NKRA 1USVA 2GN2A 4MIKA 2ZRCA 4DLXA 5EKDA 1QNFA 2R1VA 5KSYA 1PV4A 1BX1A 2PFGA 3M9LA 2CXTA 1KI7A 5HP4A 5IABA 3ZE1B 1WSBA 3TOSA 5JS7A 1Z0UA 4IO1A 1IJEA 1A0OA 1VYHA 1MQ9A 2PD6A 4M0FA 3VPAA 5EIEA 3TF5A 3ERCA 2JFOA 2YXBA 4GZ6A 1LDBA 1T4BA 1IYZA 1V48A 4B8ZA 4QRIA 1T34A 4HN2A 4KLAA 3SYTA 1JYEA 2JAPA 3TH5A 1NW6A 4P3XA 1P1IA 2CLLB 3C70A 3AH8A 3QBDA 2ZAOA 4AN0A 4DV0B 4UTPA 1GD1O 3H5IA 3OP1A 3EZXA 1JLMA 4Y2HA 5BWNA 3N5CA 1ADGA 4Q39A 3ZIAA 2ZB3A 4IZOA 1LBTA 2E7ZA 4LC9A 5FI5A 4CV0A 2ZAMA 4TQUS 4ZD6A 1XU4A 2XXAB 2UZ1B 2F00A 2IVZA 2PX8A 5DM60 4BNDB 1J5EB 1X7ZB 1UF9A 4R1UA 4YUVA 1S3GA 5DOVA 3IUYA 2GYWA 2H48A 3X0DA 4BVFA 5L3RA 1RBMA 3THXA 1HQYE 4FS3A 4IDDA 3LUFA 3RUEA 3TL3A 1FS6A 3F49S 4ZEWA 3HSYA 1S6YA 3DKIA 2H07A 3I9FA 3NKFA 4IQ0A 3OQOA 2NO5A 1D8TA 1TOAA 1R0XA 1UAGA 4HNSA 1RJFA 3WMGA 4RL6A 2P1ZA 2GD0A 4V0MA 4CPDA 2D54A 4K6HA 4MR8B 3ROMA 3ZCPA 4D0GA 5FNVF 4M54A 1PGOA 5JEDA 1L7OA 1FX0A 4OHZA 2I3DA 3UKDA 1A27A 2XNJA 3AI7A 2NWQA 2VHUA 2BBWA 1XA3A 4OJMX 1E9EA 1Y1PA 4TSRA 1YRYE 4J0DA 3LBAA 2BFDA 2X14A 3RYIB 3UMBA 3OP4A 1PT9A 1P75A 3JWPA 3V2HA 4I1UA 1W59A 2VS1A 5HZKA 3BH0A 1Y3BE 3ZYCA 2AWOA 1M54A 2W5UA 3EMKA 4WOBA 3AU9A 2DPXA 4Q03A 2ZDQA 1S02A 1V6AA 1J8FA 1SCBA 4RGVA 3U0VA 1E2MA 1OOEA 1W0KD 4KVZA 4F93B 3KC2A 3Q10A 1O6GA 2G04A 1B8VA 1JUDA 1H22A 1SXJD 3HBMA 2O3TA 5E1OA 2BKUA 4AZ3A 5B57C 1JBKA 2GYYA 2VSQA 1A7KA 2OOKA 3KKKA 5EMHA 4CM7A 1CK4A 3UAVA 2FR0A 3TK1A 2H8KA 2FPGA 1E7WA 4QUEA 4JZKA 4GDFA 5AHXA 1ZJ6A 2FNAA 3CUYA 2YV4A 4L95C 2B92A 4EUFA 4QUAA 3DOIA 2PKCA 1JFLA 3LQ4A 2CL0X 4AO8A 2WAXA 3P9ZA 3PXEA 1C0KA 4L9RA 5KJFA 1BX3A 1YGPA 2UYYA 2VHEA 1SUSA 1U6IA 1Z4IA 4RO0A 4WZAB 3RT9A 1EX1A 1I6LA 4ID3A 2AA3A 4XFDA 3B38A 4RCVA 1BWQA 3U13A 1RI1A 1XSEA 1DEHA 3QBJA 1LUAA 3DONA 1EX6A 4IJWA 1LI4A 4MGIR 5DBIA 2RHCA 1OX4A 1U3WA 2AWNA 2C58A 2CYAA 3DDNA 1EINA 1XTTA 2VQ6A 4X90A 4RFLA 4RPHA 2I3AA 5FTKA 1QO9A 3O8BA 2CHGA 2O2IA 4KLZA 3LNCA 1Y3IA 4CU5A 2QM0A 1KFEB 1EQAA 4X7MA 4I81A 1T5OA 1UEIA 4KGXA 3M89A 3BMOB 5B1EA 4GMFA 1D6SA 2ONJA 1EUQA 4N3BA 5LC1A 2P7HA 3WIVA 3M2PA 2PVSA 2YWCA 3HNPA 1KMMA 3INRA 4UNNA 4M9CA 3DO8A 3OCUA 1K06A 1M1UA 3GJ6A 3T3MB 4RAOA 5DIFA 4Z54A 1L7XA 1QQ6A 4AX8A 3EB9A 1IBSA 2OLEA 2GN6A 2IS6A 1ZM2A 5AW1A 2QX8A 5AHKA 3IMFA 4MA0A 2BL4A 3ZNQA 3JWJA 1UMBB 3EUFA 1E66A 2ZAYA 3CZMA 2G1PA 3GXOA 4ACAA 5F2KA 5GPBA 3TKYA 2FN8A 4M1MA 3ZQ6A 2Q3CA 3OWOA 1Q1NA 2JBHA 2YJ5A 4DCTA 1CFJA 4B6JA 4B2YA 1RLTA 4HNRA 3MD9A 4GKVA 4Q82A 2XRZA 1VMKA 2RONA 3K92A 4D3XA 1JX6A 3PZBA 5A06A 5A1JA 4H4EA 2QENA 4ZAGA 1CRPA 2ZQ5A 1SB9A 3JQCA 2QVLA 4UUNA 2JFNA 5L6LB 2FWIA 2VP3A 1JQBA 2WKQA 4V02A 4ZQEA 4OHCA 4QT0A 2QY9A 5U4QA 4QUHA 1MJFA 1W4LA 4MI3A 3UC5A 1WBDA 4DB2A 1P7VA 3V34A 3PE6A 4GMXA 4DAEA 3U3KA 1T9AA 1A2OA 3C74A 3ET4A 5C8YF 1Z45A 3DW3X 4NICA 2YHSA 3R6WA 1SN7A 5BV8A 4KNYA 4XWAA 2DUMA 4FQ7A 5H70A 3I4FA 3V1YA 3QUQA 4G25A 5JSQA 1T3TA 2JHPA 3C3KA 4DC0A 4KE6A 1Y3CE 3DP7A 3P2YA 4MGYR 1VPLA 3GAMA 4DADA 4IG4A 2PUAA 4XYGA 1NZFA 2IXEA 2Z6AA 3EGXB 3SEZA 5J3JA 4DNQA 2FWNA 1W8IA 2GARA 1CDOA 2PQ0A 5KOYA 1R74A 3HA5A 3H7AA 3PSHA 2GXAA 3ZBQA 4EUSA 1Y6RA 1TZMA 1OFUA 2LKDA 1G60A 3K1TA 3A6HA 3TL6A 3EX7C 1QKKA 4K05A 5LUBA 1FB5A 1XMJA 2DQYA 2ID7A 1V96A 4XJVA 1JG1A 4YNBA 3TX6A 4PLCA 1QH1A 4C0BA 4ND2A 1RHQA 2XCOA 3W7BA 3TINA 5LCXA 1A4RA 1U0FA 1DEOA 1W1WA 3UQZA 2QGFA 2QF7A 3TGWA 3AL0C 4F91B 3LUCA 4A6PA 1M6WA 3EPLA 1TT5B 3GLHE 2DUWA 3N0VA 4GX1A 2HBZA 3Q4GA 3D2BA 1PSZA 2J32A 5MDHA 1ZGHA 4W1QA 3TZEA 3WJ2A 1ZD4A 2IX9A 3QYPA 1D2HA 3AHCA 1GFSA 4U1RA 4Q4DA 1U8TA 3M6UA 1YR3A 2DSNA 2IYLD 3P9SA 3SQWA 2QD3A 3BWBA 1TMYA 1TMGE 1Y4AE 2DFDA 3TDMA 2E5FA 3OJOA 4LWZA 4ROTA 1TJYA 4LHZA 3EIUA 1WXQA 3VR4A 3W5DA 1RYZA 2AGVA 2SCUA 2FDRA 1ZM7A 1JPJA 4O4HA 4CIYA 4E5KA 4MWSA 2O52A 4EKGA 4B17A 2ZBEA 1MABA 2OQRA 1SHUX 3RSHA 1MGPA 2RH9B 1KO8A 1P44A 4ZYTA 1HRDA 3GJ0A 1O1YA 5KNBA 2WU3A 1DOZA 1EX9A 5JUWA 4HAVA 1DWOA 1SQ0A 3PIRA 4F8YA 4IIXA 4KQ9A 4NAVA 5DE3A 4DLPA 1A72A 1C1XA 1GNQA 1OYYA 4QOHA 1W36D 1RXVA 1C8LA 4IXTA 2J0SA 5JCOC 3PFKA 3EZNA 2HNAA 2VF2A 3FZNA 1SBYA 3PQEA 3LYAA 4OSOA 4F71A 1YUBA 5JZMA 1JDJA 3B5IA 1DAOA 4QE3A 2BZSA 5DNAA 3OT1A 3PF8A 5JRDS 3VNBA 4OK5A 4N48A 3CKMA 4WKPA 2QMQA 5EC8A 3E2IA 5KI6A 4YX9A 5IDWA 2JFVA 3DP9A 1KC1A 3BEDA 3B7GA 5DX8A 1KEWA 3L6DA 2R4UA 3ZDCA 5AK5A 4W5JA 2XUHA 3U17A 3EXEB 5EIBD 5REQB 1H6BA 2R5FA 3O75A 3FVRA 2AFVA 1CQXA 3SD7A 4D9CA 4DR6B 2QRPA 1UXKA 3HH8A 3JZDA 2WHPA 3B89A 3OZCA 3WRVA 3ZCUA 3G9ZA 1CJVC 1K8QA 3SBOA 1ZPDA 2PKQO 2XUOA 4C78A 4CEHA 3WDMA 3S7TA 1KJQA 1E96A 4G3XA 1Y9JA 4Y98A 2OFFA 4AP9A 4ZI7F 4ZU1X 1Y81A 2PBFA 2PTHA 1U2RA 5CTJA 3MCWA 4QYIB 4E5PA 3D4PA 1CZRA 4ZGGA 3EDMA 5AM5A 1MNQA 4QQ8A 1S3IA 4CLRB 1R0LA 1RYDA 3I6IA 4DRXA 3LGSA 2C9BA 4LGYA 2RAUA 1XKQA 4RM2A 1QDUA 3TGLA 1EJ6A 2FJ0A 2VOJA 4LYFA 3F5QA 5A4KA 5JD6A 2XMSA 3F47A 4UVIA 1JIQA 1OSNA 1P33A 1XAGA 4HJXA 4KXYA 4Q9HA 1X2BA 2WHQA 3FNEA 3K1JA 3KD3A 4DM7A 2E6UX 4Q3BA 1EWKA 1A2QA 1KK2A 4N3NA 3ZY5A 3WRXA 1HDCA 3TB6A 3HGQA 1N32B 3K8YA 3OQ1A 1GRCA 1V39A 5JRJA 2AOVA 1JSRA 4EW3A 1Z08A 4KIJA 3BK1A 3QWFA 3SICE 3UJNA 1KK1A 4IVPA 2Q50A 1RPZA 1B1AA 2P2NA 1FRQA 1NLYA 2RGEA 5CLJA 3C3MA 3ND9A 1HNNA 5JNSA 1EFKA 3CNBA 1SULA 2VDQB 1K75A 1JQ5A 2QVXX 3IESA 4RKYA 2HDHA 1I9CA 4FM9A 1GDDA 5CR9A 1Q0TA 5BWLA 2BEVA 1Z56C 3AR8A 1QG4A 1SCAA 5HGXA 2POQX 3AEQB 2F3SA 3ODPA 1PBNA 1X8KA 1Y1SA 3JPWA 3LXXA 4M87A 3IXQA 2IYPA 3I1FA 4F3YA 1Z0KA 2EWWA 1FPQA 3KKLA 1XQXA 1WTAA 4A2WA 2IXDA 4Y1EA 3BD7A 4Q3DA 5EINA 4BCBA 4JNKA 2CXNA 4L5IA 2J33A 3F6CA 4PYKA 3UT6A 3IEUA 4GDMA 5FWYB 9LDTA 2CWDA 2B30A 4HAXA 5KC8A 4COKA 2WWGA 4MP8A 4LE2A 2RKWA 3K7EA 4EY6A 1DO8A 1B42A 4UHCA 4Z53A 3PCTA 2WIFA 2V7TA 4KFSA 4REQA 3P2KA 1I4TD 3ONVA 4LZZA 5EWLB 1H9BA 2L17A 4OYYA 3ODGA 2OL4A 3RPEA 3PC8C 4FINA 2E6KA 3OICA 2B1JA 4NBRA 3EWAA 4NI5A 4WNIA 5BVHA 3EQ6A 1L4GA 3Q7TA 3T7TA 4BUCA 5CDSA 3Q88A 1PR4A 1T10A 4QYSA 3AB3A 3QVVA 4LJ9A 3T41A 4JIGA 4FB5A 1LRKA 1EA7A 4ZTUB 3IOMA 4BAUA 3C3DA 4RSMA 1XNQB 3NIWA 3FJOA 4Q1VA 1VJRA 5F2OA 4ZZ1A 3V5NA 2PYIA 1W48A 2IP4A 4ZOLA 2G1KA 4GRIA 1G3UA 3NM5A 3LP5A 1EVZA 1R8QA 3IPRA 1OB5A 1E0JA 3TFOA 1G42A 3FI9A 1EE2A 3AHGA 3ECSA 4Y2SA 1U0EA 2AOXA 4BNDA 3GPCA 5ED0A 2DUNA 4RLHA 4Z7QB 4YUAA 5CDYA 2Y05A 1JDSA 5FEUA 4H59A 1RBYA 3C39A 4N8EA 4Q1CA 3TAUA 4AJ4A 2C88A 4MUJA 3QLEA 4DDWA 3IULA 4TZ6A 5K3FA 1NSFA 1FXWF 4C4YA 4PNPA 3WP1B 1U0BB 2DF8A 3DZKA 4YXWD 2V9ZA 4A0SA 2FG6C 4RDIA 5FTWA 3D6NB 3EDCA 4OH1A 5TC4A 1H1DA 1IMOA 3BRQA 4GL4A 2OFWA 3KTFA 1QPBA 4HTAA 4F6CA 4ZT2A 1UKYA 4DIUA 1ZXLA 4IDFA 4RF3A 5FO1A 1PEKE 1W581 5HTOA 5CPBA 3WLEA 4HRYA 5TQ0B 4AJKA 3FMPB 4XTCS 5BV2P 4RVCA 4W82A 2QNBA 5EQJB 1ONPA 1KYIA 3E9QA 2FJPA 3BIJA 4X1YA 3STYA 3GLQA 4CCAA 1F7UA 2WFMA 2PFSA 4NPHA 4LMRA 3ZE7A 1SJ9A 4RU1A 4WNCA 5AVSA 2IPXA 5HNKA 1E1RA 4BEWA 3AQIA 4RH0A 4YPOA 5CA1B 5JDCA 1TTTA 3TSYA 4NBVA 4MVJE 1RYMA 1H0KA 5BYKA 5CDGA 1L5WA 3IMKA 4AKGA 1M7BA 4P98A 4R1QA 5GZ3A 1JJIA 5DTIA 2W93A 4DV3B 1IBMB 4PBSA 3FMIA 4PIMA 3ZIUA 5JQGA 1P5JA 1MCZA 4MR7A 2WRZA 1OH6A 5HFNA 3P1JA 1SKYB 3HM2A 3HCFA 3KXKA 1J24A 4BO4A 2X4IA 1C4WA 2QORA 2OCDA 3ACBA 2BHRA 2HFJA 3MOIA 1H5QA 1H66A 5FOWA 5KVCA 3TJZA 1AS0A 2JBAB 1IUKA 4HNGA 1RAIA 1T25A 2WJZB 5CB6A 4QKQA 1E8NA 4O2RA 3LXMA 1R88A 4BX0A 4X6LA 4JLVA 2FLWA 4NCNA 1F48A 1JJBA 1P2GA 2BUAA 2FQ1A 1FNCA 2WR8A 3AZOA 3QE0A 4U7WA 3E9MA 3R40A 1TU3A 1GFWA 1U3GA 2WZDA 3NWBA 2GCOB 2QJTA 4DZZA 2GMWA 3TGPA 1SO8A 2BUCA 4PIPA 4QD3A 3FUUA 1KRXA 2MJLA 1RQXA 1YFLA 3HU3A 2QGZA 2D59A 3KLPX 4A8HA 4J6EA 4HQOA 2OHOA 2Y0EA 1XDUA 2R1TA 3BZBA 1QUFA 1F8FA 2YFHA 2RAFA 3ZE0B 1DMRA 5ALPA 1IN1A 4HH3C 3WVNA 2X8LA 1XELA 3BKWA 2ZSFA 3IQHX 3LWNA 4B6PA 3A0UA 2GBLC 5HYVA 2BUBA 1OH5A 4DMUB 2ZRHA 1T29A 1GNSA 4MUKA 3EVEA 3BCSA 4UU8A 5AMXA 1VJGA 4IRUB 4KH0A 3AONB 2ZE5A 2MHCA 2DKOA 1RKUA 5EAIA 3CNLA 5EEHA 3AXTA 3OUZA 1C9EA 4BE4A 3WS7A 4KQJA 5D87A 1N8KA 2XOKA 1BMFD 3IQZA 1V3UA 3NNDA 3PGKA 3VSBA 2HYIC 4CR7A 3VKHA 2WAYA 4BQFA 3OD5A 4YAWA 3TPZA 4WIAA 1EX7A 1F17A 2ARKA 3ETHA 4INOA 1KMNA 1XD2B 3I9JA 2V0NA 4MVJH 1YB4A 4QQFA 4E7PA 1TZ2A 4FD2A 4W99A 1AZLA 4A5OA 5ICFA 1WEHA 2BP7A 1A04A 1L6IA 2CE7A 3GPLA 1VLHA 4U5XA 2PUHA 1MU0A 3EGEA 1HF3A 1MOQA 2REBA 1PJ4A 3O4FA 3GV0A 2OBLA 1WUYA 3LJKA 4TYQA 2XEDA 5EJ4A 1YVDA 1LCIA 3PBKA 1BX0A 4J0HA 5CA0F 1JDVA 3OMXA 4UMEA 3ID6C 2QKYA 3OKAA 1UDRA 2I8LA 2VO1A 5A7GA 5K9ZA 4IXNA 5K3DA 5H3LA 1F3OA 5BWBA 3STUA 3HGTA 4ROSA 1K86A 3C41J 4Q4CA 3OFKA 3GQBA 1E2BA 1XC7A 1BWPA 4U2EA 3PDUA 5KYVA 3DFUA 2NOAA 5E6RA 1WPXA 5JI3E 1GTSA 4RZXA 3OQ6A 4YBZA 4LGMA 2HNBA 3L8HA 3CX7A 5AJTA 4ZOLF 1U04A 3G2OA 4X9XA 1AUOA 1T9HA 4KX5A 4A9AA 4XIGS 3C45A 1YCDA 1DRKA 3COVA 3E8SA 3KTAB 5KQLA 1P1HA 2ZR8A 3OF5A 4G5QA 3PIIA 3BF7A 2V8OA 2ZANA 2XI4A 4FNMA 5DYGA 5CLHA 1BHJA 1AD2A 4KDCA 1BVYF 2EGHA 5D85A 1W35A 3Q9UA 1T4CB 4N18A 1T1SA 4JI5B 1TPYA 2ZUVA 3NLLA 3B9BA 3JTMA 2FQQA 3EHDA 1M8JA 2ATEA 2GN4A 3L8ZA 4YUYA 4RKQA 2C5AA 5DNVA 5EJ8A 3GLKA 1IHPA 4IF6A 3JYNA 4AXXA 4C4SA 2R68A 3VZRA 4UOZA 1OWNA 1ZO8A 1MV5A 2C2YA 2D1SA 3RU3A 2G4CA 4RY9A 3VYWA 4PWYA 4KN9S 2P69A 1TPZA 1E5XA 1KNXA 2I80A 2WJWA 3HBLA 4G01B 4D92A 4DLWA 5KYYA 1RYHA 4PVDA 4EI2A 1NUQA 3O1IC 5HX7A 3ED1A 1IEWA 1C9NA 1AHHA 4YP5A 1RLOA 3DDZX 4BPBA 1HOTA 2ZREA 1KY3A 1XPRA 1E3LA 4DCSA 3KELA 2PX6A 1DX4A 4WA7A 1TEVA 2Q4DA 3GJ3A 4XM2A 5IAJA 4CETA 2V6IA 3H0KA 5AOVA 4YRJA 3RARA 4EKIA 3PXUA 4LNUB 3AIMA 3KEMA 2XLCA 1DAMA 3MD0A 1V4BA 4FIZA 3TM5A 4ARUA 5IYZF 1PRYA 1KJWA 2IF2A 1DS6A 4JC4A 1N1GA 1FOEB 4QGAA 4XB2A 5DI3A 2Y0CA 3GG2A 1G2IA 2YRWA 4Z9BA 3SSAA 3TWOA 1P9OA 3LKVA 3O3NB 2DZDA 2BGMA 4UVDA 3I6BA 4RJTA 1X9GA 2JHFA 2ZDHA 4QVGA 1NVFA 5FT9A 3FPEA 2NU9A 1G5QA 2G7ZA 4MVXA 1VKHA 2JLUA 1PLLA 3QVJA 1ZZEA 2IXGA 1GYPA 2FRXA 5AW7A 1QIFA 4IXMA 4IHKA 3WYDA 2B2NA 1B14A 3I23A 4JS0A 2VPIA 3AR3A 3RSLA 1DQPA 1TT7A 1JJVA 1EWTA 3OH8A 1D1PA 1MX5A 1MAUA 4G4SO 1C29B 3KOMA 2R47A 5M3BA 5B3KA 1U8EA 1Q11A 2XUKA 3VXKA 4AKEA 4HZUA 1X7GA 4PZ0A 2AI3A 2CDBA 3KZ1E 1U3FA 3O7MA 4ZK2A 1XRSB 2PFKA 2QAGA 4NULA 4WXEA 3NEJA 3M7IA 4HVTA 2ZS8A 3L5KA 4GXNA 2ZXUA 2A8YA 1SC3A 1QUEA 4BP8A 4B46A 3R77A 4QTTB 1KXZA 2RC6A 1A9OA 1Z2AA 3KHKA 1G2OA 3FETA 4LTDA 4NC9A 3KT6A 1OVMA 2XRMA 3DMRA 3L0YA 4QGHA 4UBKA 4NMLA 1N2JA 1RMYA 4F4UA 5I6DA 1E5DA 1XRNA 1TVKA 4NOLA 2PRKA 2YS6A 3JQQA 4XUGB 4D9GA 4XWWA 1MZPA 3UATA 3JALA 1ZWLA 4EOGA 1QONA 5HF5A 3MJEA 3VH4A 2PGLA 3DPSA 3GEHA 4CMAA 5LJIA 1H5NA 3COZA 2R8OA 1I2ZA 5JAHA 3OKFA 3NHAA 3U3DA 1IVSA 3QZUA 4E6EA 4NPAA 4B2IA 4XDZA 3DDSA 4YR9A 2NQ2C 1GZVA 1EQ2A 3NT4A 3RVMA 2SNIE 3W2HA 3EDOA 1JEYA 1MB0A 1I5RA 1SBCA 2H4HA 2H3EA 4QULA 2CJPA 3HU5A 3PG5A 4R01A 4D74A 2OILA 3JD4A 2AK3A 2G9ZA 1ORVA 4R40A 1W0JD 2FR8C 1C9MA 3N74A 4UREA 5AXDA 5KTOA 1ZMBA 1FDSA 2ODQA 2CZGA 1L4FA 3UAWA 3FY4A 1DG3A 2O4CA 1SFRA 2EFJA 1MTOA 2M6KA 1AKUA 3UMFA 1KY5A 1FF9A 4KIWA 1P4SA 3IBYA 2CLDX 4RIFA 4JJ7A 4EO9A 2W2VA 3BE6A 2V54A 1MC5A 2BDTA 3MCUA 3ZCQA 4IMPA 3CE6A 4HFMA 3I34X 2YMMA 4ND3A 4OBBA 3DGEC 3FOWA 3KTOA 3H2JA 2YHIB 3DS8A 2D1YA 2B4QA 3EN0A 4GVPA 5BOVA 5I7OA 2A2ZA 1YA4A 4WX2B 1XZPA 3H1BA 5KREA 4EYKA 1NOIA 1OGJA 3ZKWA 1NUTA 2OC4A 4Z1OA 5IEJA 3ZLJA 4DS3A 1E2PA 5CX1A 3ENWA 3BE5A 4IQGA 3O9ZA 1VG9B 3IERA 3L4JA 3A11A 4D8YA 1HNXB 1RI3A 1UJ5A 3DT8A 4Q24A 2CW5A 1OZHA 2PH7A 4LEIA 4RHYA 3DM9B 3RSOA 2GT1A 2FUCA 5A4DA 3IUNA 5LIRA 2Z6QA 3ZX5A 2DLCX 2AZDA 4NCXA 5CVVA 3PGMA 2HT1A 3B2NA 5LWQA 4DR1B 2PX2A 4QUIA 2BMEA 1W1IA 5LQKA 3E8MA 3LA6A 3EA5A 1N25A 1YR7A 4AMBA 4AULA 3CLHA 3MTGA 2DJ5A 3DEYX 1VPEA 1NN0A 3CEHA 3G8YA 1ZUIA 1NXVA 2OAEA 5G0SA 3WRWA 4Z4GA 3THWA 1V2GA 4BNUA 3BZUA 1Z7GA 4MUYA 4RFVA 3LE8A 1U94A 2GNPA 1ZLYA 1Y9ZA 1NYLA 2PAAA 3BWYA 3EXIA 3MT0A 3LW7A 2QYHA 2AEFA 3K8OE 1DLIA 3Q7QA 5KBYA 1U2EA 3QEOA 4LSMA 3D6VA 1VLMA 3D6TB 3ER6A 4IXDA 3T8YA 1I24A 3ND7A 1PJ3A 2VNJA 1RJGA 4YJ2F 4RMGA 3E2MA 1UEJA 2QNRA 4D6YA 4F3CA 3EIQA 1T5BA 2QLJA 3DBVO 3DBRA 2IEGA 3E48A 4NCHA 4OM8A 3V4OA 1XZHA 4PGAA 1HGXA 1M7HA 1E32A 1G55A 1I9GA 2H54A 2ODWA 3Q9SA 4FDMA 2QBYA 4YMVA 2GJ9A 1QG2A 2O23A 3DZDA 4HYYA 5EMLA 1OV4A 4BRWA 4E94A 2FPKA 3A9WA 2ACWA 1G5IA 1W44A 2ZRAA 4WV3A 5JFTA 1WCIA 3K6JA 4QAJA 3RK4A 4R2XA 4RJIA 5G4LA 2R0QC 4AU1A 2FDXA 2ACKA 4OTZA 2RIRA 2PBLA 1T2NA 4PIVA 3Q12A 2ZFUA 2P3OA 3GGDA 5KS2A 1KI6A 3L1VA 2CY0A 5LP1A 2JLYA 4A15A 4OHBA 4OMUA 2REQA 5LB4A 2GH1A 5ARBA 1DX9A 3W2IA 2JFQA 2UAGA 3AESA 1FY2A 4DJTA 1L7QA 3D8SA 1Z0SA 5A4JA 5KC9A 1D9XA 1P19A 2FOLA 3IAUA 3SXUA 3OX2A 4DBZA 3P94A 4ALLA 1DIHA 1EVYA 3H19A 3QPVA 4X20A 3TQCA 4G0YA 5J63A 4OBXA 3E58A 3BMCB 4GLFA 2XKKA 5K4GA 1E7RA 2XSZD 5DSXA 1N8NA 3GCZA 5SY9A 3ZE2B 4IW3B 2H2IA 1BJKA 3HWRA 2VA9A 4H1UA 1LLDA 2F59A 4URVR 3ZDBA 1FMTA 3KDAA 3VX3A 5FOTA 2BR3A 1VXOA 5D5HA 2B35A 3MGAA 3HCDA 4Q9KA 4QEDA 3A1SA 5KX5A 1J7KA 5BOSB 1U2SA 1Q95A 5ALKA 1Y6QA 4CU2A 1NJ1A 2G6BA 2IFTA 4KV9A 2FDCA 3HP1A 2UYHA 2FN9A 1G7TA 4KI7A 4RQUA 2JEOA 2O14A 3VZDA 4TTJA 4MUXA 4WZBB 4WDQA 1T9CA 4WLNA 5TXGA 4CTOA 1JU4A 3GP3A 4MOWA 4XAQA 1Z22A 2PRZA 1JR2A 3L46A 4YRCA 4GW3A 2HGSA 2I1WA 3P2MA 3PJRA 4HFRA 4CM9D 2ZCVA 4CT4B 4C06A 3AUKA 1KI9A 2Y76A 1NULA 3FMVA 1U2DA 4V0SA 5E6SB 3ITKA 3R6TA 4PC6A 4KKVA 4QVIA 2WD9A 3KUXA 2RHBA 1K89A 4GNKA 5FAKA 1UK6A 2OBNA 3PHHA 2GNAA 3RLFA 4C6SA 2HLHA 4RHFA 2FF7A 2DWQA 1RJWA 2YFKA 1UFRA 3C14C 2PV0A 1DUSA 3T5GA 4EECA 5HF6A 3IL2A 4EF6A 1E89A 1PJTA 5SYNA 1NVMB 1K5HA 4HLCA 1B2RA 4KV7A 3DZJA 3STHA 1Y4ZA 4XYMA 2QRVA 4HG2A 3V4ZA 5CLLA 2EWVA 2FPOA 4QQRA 2GHQA 1YC2A 3GJ5A 3P9XA 3QKSA 4GSKA 3DLCA 3VUFA 4EW6A 2P2GA 3D2LA 4RSHA 4QFCA 5FOVA 5K6RA 2J3QA 4LOLA 4QYMA 1IOZA 4S35A 1GPBA 9GPBA 3D2CA 5EEGA 5CYOA 3TQTA 2PT6A 1L7RA 2HJSA 5KOJB 3PZRA 1EHYA 1F60A 2WHRA 3V48A 1DPFA 3EA4A 1V5EA 1OH8A 1GGKA 4ESEA 1UZNA 2I6TA 2RHOA 1RWBA 4KZKA 5G3YA 2ODAA 4MR8A 4Y7DA 1XQYA 1D9ZA 4CN8A 3R23A 2A1IA 4OLHA 4EW1A 5B58C 2PN1A 3M49A 1O9BA 1BVUA 1YFJA 1L5YA 1QJCA 5JXWA 4RHXA 4XGQA 4AF7A 2AF4C 4QO7A 1JKIA 2C83A 4HFJA 4DY6A 4FYWA 1I4WA 3CX8A 2GPWA 3ZV6A 2J9YB 1DHTA 1R37A 4BATA 4J0CA 1CDDA 3IT0A 4WESB 5FWYA 5CH8A 3BXEA 2ZI6A 3HV2A 1HT3A 4FEGA 2M1XA 3LUAA 1H8ED 4A2CA 4E5UA 3ES9A 2JCGA 4XOIA 4TGLA 3B5EA 4WXMA 1CQZA 4CI0B 2RBGA 2R6CA 4JU8A 3WLJA 1M6VA 1K7SN 1NDUA 3MWGA 5FL7D 3X2SA 3CXRA 3RV4A 5IS2A 3LPLA 3ETGA 2WJAA 3PKJA 3ZCXA 4GE0A 3WIBA 1C0EA 4EL0A 1YZNA 2QRGA 3O1LA 1RZVA 1UMKA 3JSAA 4G1VA 3IURA 3O90A 2BGIA 5AW5A 3VX4A 4BNFA 1F7VA 4GEKA 3KHUA 4HPXB 2E1RA 4L50A 4Q48A 5EOVA 3TVDA 3IJRA 1XVLA 5DNEA 1SXJB 2PVCA 3F2VA 2Z5VA 4I66A 4MULA 4BKUA 1FSFA 1GTRA 5EHQA 4BAZA 1F0KA 2DKFA 3RJ9A 5HOQA 4M0EA 1E62A 4RJKA 3T12A 4G4JA 1VXRA 1SA0A 1O96A 1EKXA 2JGAA 3M4JA 1LV8A 1NF2A 3HWWA 4QDOA 4UZFA 2H1IA 4LY3A 4XE5A 4C3UA 5BQ3A 1W4RA 4P5DA 5FQOA 2FUG1 3EXG2 3G9TA 1MVOA 3K2BA 2R25B 4NCBA 1CTQA 5AVOA 1RJEA 1V11B 5AUQA 1GZ5A 2GTHA 3LDGA 3DZCA 2QAGB 3ZY3A 2O5VA 2QTCA 4FS8A 1I0LA 4Y6OA 2Z3WA 5FNVB 5JHGB 1MDFA 4I3GA 1CIPA 2OLKA 4CQLB 2FPSA 1JAIA 1UADA 4LMAA 4QBIA 3ZV3A 2OQIA 4FGJA 1ZK1A 1E2JA 1Z28A 3LI2A 4HDRB 4KTTE 1TUEA 3CLSD 3DC7A 5FPYA 1MV8A 1E69A 1ORIA 1Z7EA 3F46A 2Z5GA 5DGXA 2J31A 5KYWA 2O8CB 1XZIA 2XQIA 3E53A 2ZRJA 2NTEA 1TK2A 5GM1A 2ORWA 1JI0A 1MMFB 3HB1A 3CGWA 3I09A 4KXFB 3N7AA 3V9PA 1G20E 5EN4A 2C31A 4YRAA 1XPJA 2IUUA 2PSDA 4MWDA 1YQ9A 4FFPA 2C61A 4JH0A 4PHTA 3D7NA 3I76A 4REQB 1U2PA 1G9TA 3MS4A 5KNBD 2X19A 3BJEA 3O83A 3IEMA 3IXMA 1VKOA 3GFQA 5LUAA 2OM6A 3OOYA 1TM1E 3H4MA 4ALKA 2Z09A 1K6IA 4NJOA 3F6PA 1Z3IX 2KBEA 5M5BA 1B43A 1DBSA 3VOBA 1J07A 2JAQA 2OY0A 2ZETA 3MCVA 3OZIA 5J58A 1U6JA 2VTKA 1ZESA 1L4HA 1I2DA 1TQ4A 5JATA 3HKEB 3EXFB 1HZZC 1KBQA 3EBLA 5JMOA 5EIWA 3ORSA 4DXHA 4G8CA 4URHA 2GK7A 5EESA 3T4UA 1TCUA 3F9IA 5A5VA 5LM3A 2LCQA 4XI9A 4PONA 3RSQA 3VSCA 1HR0B 3R9XA 3DYVA 3ZGOA 3RYCB 2P9GA 1WMBA 1AIPA 3C7TA 2GCIA 1XMPA 1Z0DA 2B4TO 3DMGA 3KAJA 4U6QA 4CNBA 4EG0A 2ALJA 4NYMQ 2V8BA 4XX0B 3SIPA 1MIHA 2HRRA 4X00A 3LDHA 1W2GA 4I08A 5AKJA 1MEEA 5FWAA 2R751 3ELDA 3WX0A 3ZZ0A 1OXUA 1P62B 2BMJA 5IYZA 2VYNA 1IE3A 2F3TA 3DFMA 4UEOA 3RS2A 3ZCVA 1UBUS 2CD9A 5LQNA 4M1OA 3S1AB 3JZFA 1C3XA 4HBGA 4RV9A 1OAOC 2J3EA 3EF3A 2FRDA 1ONNA 2A9RA 4ZXPA 1CVLA 2VHTA 5GVRA 5SZKB 5KCMA 2PH1A 4E6PA 2DM6A 3GCDA 4UU0A 2FW9A 4PGGA 4QBFA 3A4YA 4UUAA 4C0LA 2PE5A 4AJEA 3BTVA 3DEZA 4YB8A 4B3XA 1OWPA 2PMDA 1X7DA 2YY5A 4CDMA 1YRBA 5EXSA 4DLKA 4LHVA 4C9BA 2OZEA 4HLNA 4Q9JA 4UU7A 5ERYA 2QQ0A 3FTNA 1GADO 1TC1A 5TQ2A 4F4HA 2X4GA 1CJCA 1ATZA 3ZQUA 2QTGA 2HPZA 2Q6VA 2GCNA 4HDMB 5JFOA 1AOXA 1IZZA 2ORYA 3IHWA 3UICA 3QF4A 3S1SA 3HCBA 5FQNA 4CVNA 1QO7A 2VDMB 1A3CA 2C4MA 4FFSA 4JR2A 4MR7B 1GRQA 1XZ8A 1U1EA 1E6LA 3T5MA 3FLAA 4Q7EA 3SLKA 3NKVA 5CLGA 5CK5A 1X19A 1TQDA 3H1GA 4W7SA 2BGRA 5LP6B 4W9MC 2AN9A 1BXRB 1ECBA 2OTCA 3A9TA 1EJ0A 4H7DA 4B8WA 4QNNA 5CFQA 1VPWA 3RVPA 4DCPA 4XSGA 5LKAA 2CK3D 4ESHA 4JT4A 5DOZA 1V35A 1IB0A 1RBQA 4UUOA 1UMCB 3A6LA 1ZMTA 3GLSA 4DQVA 4ZYVA 1JIXA 2W6QA 3D3NA 3B52X 3UAOA 4ZU6X 3DUWA 1T3ZA 5IPFA 3N2ZB 2ZU6A 1EGQA 1NWCA 5AXAA 3DBIA 1Z6PA 3LKZA 2HOQA 2GVZC 5JECA 3NTOA 4MZXA 4A0HA 3D8RA 1VSUA 4I5IA 1DSSG 1P5FA 1RWKA 5J4KA 2J3MA 2WQ6A 1I2CA 1X1BA 4KUHA 3ENNA 1EGHA 5FA6A 5D2CA 4BEBA 4DEYA 3OOEA 4XZ3A 4RTOA 5ALEA 2FE1A 1V8FA 4UJ5A 4MVJF 1Z74A 1J2YA 2VDPB 1ZNWA 4L08A 5FV4A 1RM5A 2ISCA 2I22A 2IOFA 1UC4B 1KJNA 3DTVB 4O29A 3C3XA 4I7EA 4DMRA 3DEFA 3EG5A 3HCCA 2RKOA 4ZVLA 4BV9A 1J0CA 4M49A 2OCPA 5KJ6A 3O8LA 1JPVA 2IQIA 4G0NA 3PXAA 2VRNA 3T6KA 2DVMA 4RTMA 2PBZA 4RY8A 2O0HA 3D02A 2L18A 4Y0AA 2XA1A 3JRXA 3GRZA 3H5VA 5B6PA 1JHYA 3M5WA 1LPMA 5FBLB 2Q1SA 2JJ1A 3M1AA 3WHLA 5JH7A 3MB8A 2JLSA 1C4XA 3WFJA 5A03A 2CLMB 2QOEA 3NUZA 5ICSA 3LY8A 1RJ9A 1SG9A 1E20A 3RIHA 1NKTA 1DV2A 1JSZA 1SQ5A 1T2CA 1YR9A 2XGMA 2WUDA 2VLIA 5KMGA 4JOCA 3IAAA 1UPFA 5FPSA 3KEOA 3WLFA 8LDHA 2IY9A 1CUUA 2C82A 2Q1TA 1VCHA 1C3OB 3QOXA 2G83A 2MR5A 3EAFA 3TS1A 1VIMA 3SJZA 4ZRDA 4RYDA 2XUJA 1U8XX 4W5OA 1ICEA 1CQJA 1FMJA 1ZHFA 1QZZA 4R8RA 2IEZA 3KAPA 5E6UB 1MFPA 3ASYA 3QPUA 3ZWPA 4DSZA 3ISVA 4NOKA 5JXIA 5CIQA 3B6KA 1FYFA 1S8AA 1SVLA 3DFZA 4LNHA 1YZQA 4UQOA 5FJIA 1AK9A 1Q84A 1BD4A 1DARA 3DFKA 3DUFA 4FGUA 4FJ2A 5IN4A 4M1KA 3D3WB 2XWPA 2O4UX 4RL4A 1J06A 1BS2A 4IZIA 1KMHA 4E5DA 4US2R 1W19A 4BQSA 5COAA 4HV4A 3THSA 3B7PA 1U5CA 4H4CA 2C94A 5EZ5A 4FDLA 3V4FA 2N1MA 3HE3A 4CL3A 3FN4A 1JE1A 1YE8A 4GG1A 4RD0A 4S24A 4TV9F 1NVGA 5MGBA 2HKIA 2R65A 2Q7DA 2PRJA 3EAQA 4DM3A 1F3LA 3ZTWA 3CJTA 1A1SA 1JZSA 2BONA 4EYQA 2XA9A 3NWJA 1H4QA 3VPFA 4G0UA 1B41A 2IHKA 4PANA 3RO7A 3SVZA 2Z08A 1FUIA 5EUQB 1PKXA 4LDQA 1KOLA 1YKSA 3QELA 4UC0A 3HY6A 4YRZA 1VC2A 4LVOA 4PQGA 1GY8A 4XDHA 1EK2A 3H9UA 1TU4A 2DY1A 2ZS7A 3PYMA 2ZAIA 4L78A 3WBBA 3ZOZA 2OKGA 1CF4A 1FRZA 4J2TA 2A88A 4M89A 2OCIA 4OSPA 2CVZA 1BEUB 5IDYA 3SP1A 1YZ3A 2FR8A 2Y2VA 9MHTA 1N3LA 1TX4B 3BORA 4ENSA 4LGCA 2HRDA 3T54A 2AQKA 4OMFG 5JCOA 1PK8A 4XGIA 5KYXB 3PNMA 3F7MA 1QIJA 1SRQA 3PUIA 1MGOA 1FUYB 2QJOA 4RQTA 3WLSA 1U6KA 2NTYC 2OO5C 3BXFA 3PGJA 3Q1KA 3ELUA 3P4YA 4L16A 3RRFA 1BCRB 1LW6E 3FRIA 3NONA 4Q3CA 2Y2UA 3EFBA 3PEWA 1QRSA 2H0AA 4GOND 3DEKA 4TQGA 1NV9A 4OFXA 3AQ4A 5B37A 2RSLA 4PSDA 3REFA 1V8OA 1NJ2A 1V4VA 4C0QC 3QHQA 4B71A 2JK0A 3FDJA 4PU0A 3R44A 2AOTA 3N2KB 4KRXA 4RD6A 1L7PA 2HO4A 2R6JA 2HJRA 4GPBA 3GARA 4IGIA 3SXPA 2IS2A 3R3VA 4LNAA 2TRSB 3SJUA 2R66A 3ZU4A 3E18A 4WAUA 1JIVA 5BN1A 1PJAA 1FBTA 3QPAA 2GPAA 3ILYA 3I64A 3ESQA 3PT9A 5KNBH 3BVPA 2QW8A 3EG9B 2V7GA 3DOFA 3KFVA 4EF4A 4F4FA 1JXOA 1L7VC 2YYZA 3OE7A 3PA6A 4M7WA 3I6ZA 4DBLC 2WQ7A 4R2MA 3G0HA 2J09A 1GEGA 4BZQA 1CY2A 1XVVA 1GZ7A 1ZCZA 2GZ2A 3I30X 4KPFC 4HCJA 1NONA 4TV8B 4BZWA 1T2FA 2BJWA 4E12A 1BMTA 1O8CA 1XE3A 2OK7A 4EGJA 4KXXA 3P9CA 5CCXA 1B4DA 4EYOA 3AF6A 3QENA 3UTDA 1I6WA 1Y3FE 3BBPA 4UTXA 4EHAA 5LZ9A 1R3UA 4CTJA 5E6RB 1RP7A 3ZC3A 5I7EA 5C52B 4EEZA 1JNXX 2PA0A 1DPGA 2CBGA 3PUJA 3PQ5A 4YQYA 1KDOA 2Y9PB 1YBHA 4PSAA 2I1QA 2YWDA 2CLCX 3LQYA 2A1UB 2P5YA 4RENA 4ZI2A 5IHXA 1ZNQO 1EM8B 1WCYA 4INZA 2OV4A 4ZKEA 3S81A 1XFAA 4FSXA 4A2PA 1WHTB 2Y1XA 4TWBA 4KYIB 5L3VA 3MBKA 3IPCA 3Q8XB 3OZAA 4OQDA 2QV7A 3AB7A 3TBFA 1ORRA 2WSLA 3OVMA 4FI3C 4ZI5A 4GSLA 4DB4A 2LPMA 4ZO7A 1AQLA 1D2CA 3MNFA 1Q92A 5FX2A 4FJ0A 1O3YA 2BEVB 4G5XA 2YJ4A 2J0VA 1AURA 4ZCLA 4ZYUA 1WV0A 4BJ5A 1BA3A 4JA0A 3IP7A 2WZBA 2NYUA 2Q6TA 1SHTX 1WXEA 1Q74A 3AF5A 3CWZA 2G4VA 3FTCA 4KMSA 3DZFA 4DQXA 2PGDA 1US8B 4ZEVA 3UMYA 1PJ8A 1WG8A 3QLVC 1DELA 1KMQA 2JEZA 3O91A 5HM8A 4P0TA 2VJQA 4Z2AA 1LDYA 1OGYA 5C37A 3OC6A 3X1MA 3PXXA 3OLWA 4GRAA 4IGFA 3WJAA 1G6Q1 2Y93A 3WL3A 1NY5A 4UBOA 4HSGA 5D7BA 5IZCA 2CFTA 3NAMA 3CU5A 2PUWA 2AN1A 2NZVG 5LQDA 1NTRA 1HE2A 2GN0A 2JJ2D 4CTKA 2TS1A 2XQKA 4AWBA 3NHWA 3HPQA 1O94C 3RR2A 1JYSA 5HCIA 6AT1A 5C53B 4TXMA 4MH0R 3R7SA 1IQ0A 1G8PA 2QPTA 2MTBA 3LQFA 4HHEA 4RY2A 3UUEA 3IDAA 3VV2A 5JAPA 2EZ8A 2O8BB 1UBMS 2QMZA 1FFSA 3MUOA 3NTVA 3C3AA 3HJGA 4YK7A 2BFMA 1W0KA 1Y8AA 1Z5PA 2P6PA 1W76A 4JMLA 4XJXA 3RS5A 4UBLA 3ZI7A 3I39X 3MW8A 3QF4B 3NZEA 1X1DA 4MCHA 1R0CA 1XLTC 4ICIA 4IDCA 4JKIA 5HFAA 4DLTA 3CVWA 2ZYTX 1J25A 2O05A 3MTJA 3RTAA 2ZYHA 1FP7A 2UU9B 2C5FA 4ND4A 3GWGA 3NEYA 4JJKA 4NK4A 5BW6B 1FJXA 1U5AA 5HKBA 5ESRA 2B83A 1YRAA 2HCFA 2ZUBA 4DFDA 1HORA 1TLTA 2QJWA 4KIGA 3ROKA 2YXLA 5T67A 3L43A 3MHPA 4OQMA 5KNLA 4N9WA 2C4UA 4QDZA 1DEAA 5IJWA 4QLAA 3PQ2A 3DBLA 1SG0A 1XI2A 3INTA 4V0QA 4B84A 5E8RA 2F7SA 1U2ZA 2R79A 4QXQA 5F1YA 3AUJB 3GGJA 5IJ0B 1JAYA 5F35A 5EMKA 2HAEA 3OG9A 5DP2A 3HZHA 4QA9A 3S1AA 1BHQ1 1I6KA 3C4VA 4X3PA 2BLLA 1T1IA 1IAQA 1E0AA 1K7YA 1YDWA 2YXEA 3G2HA 2FKAA 3VHXA 4Z9FA 5LFAA 5D3KA 2FF5A 2PNFA 3B3AA 4TOIA 4GVLA 4M83A 3KSMA 1KYYA 3L0IB 4EG6A 3MBIA 4K6GA 1Z47A 3KM0A 4DEXA 5LMCA 1RADA 4BXOA 3IV9A 5HIMA 4RZSA 2R1VB 5HVNA 5DV9A 1SKYE 2WDZA 4G9BA 4JJAA 1FTSA 1YRLA 3KFXA 4X66B 2WKWA 4NMMA 3UT5B 5FYDA 5K6TA 2ADOA 4MXDA 4QASA 1ML4A 1POWA 2CMGA 2H2WA 2P9EA 1L5ZA 5FO0A 1N6HA 3BG5A 1ES9A 1RHUA 2WG0A 4JBYA 3ZX4A 3UMRA 4C29A 1GKKA 4YQEA 3I72A 3I4LA 4AY3A 1XQWA 1NW7A 2D5CA 4MVJI 2QTHA 4TMWA 3KKZA 5L3SA 3WLTA 2Z3VA 1ID8A 4PHFA 1TL7C 2EJBA 1MNAA 2W37A 4BYMA 1E1CA 1YQXA 2DCMA 1S89A 2OESA 2WAAA 3IT3A 4ITRC 2Q5QA 4ACBA 4GICA 4Q15A 2IHTA 1E9FA 1UBNA 1EPUA 4F56A 4JR1A 1O97D 2RAVA 2LIPA 2E4VA 1OUMA 4HEQA 3E9NA 1LY1A 1Q14A 5AI0A 2ZE7A 2H06A 2JBWA 1RLUA 1AK2A 3EGVA 3NALA 4WOJA 3KJZA 1IJFA 4G5OA 1CR2A 1FNBA 4RJLA 2BTQA 1QCZA 2HC9A 2UKDA 5AK0A 3WY9A 1PQYA 4X6XA 2F62A 1V9LA 1N77A 1ZA1A 3EFOA 3KZVA 5E4YA 5KNCD 2G71A 1DG1G 1IN5A 2ENWA 3AEYA 3FZYA 3GEGA 2HA2A 2AMFA 3DFIA 2BSXA 2WJIA 3MOGA 4KAJA 2CXSA 1GAQA 3EMVA 2Z30A 2YICA 2EWMA 4K8OA 1ORDA 1Y63A 3LUHA 4W1RA 1L8XA 2WNIA 2PS1A 2J9FB 3DDUA 1JPNA 1OAKA 4NOJA 4RIIA 5DX1A 2CFCA 4OXRA 1KJ8A 2E18A 4RACA 5BXQC 5K8TA 2CN1A 4F12A 1CETA 3TUIC 3BEOA 4E1BA 2CXQA 3GRAA 4J43A 3H2KA 2HHJA 3K9HA 1M2EA 2WU0A 4EG5A 1K4MA 1K7FB 1W5EA 1D09A 4IIVA 1YIOA 2A9KA 3DV0B 4NR0A 1WXIA 5E7MA 2Q8PA 4Z99A 4EATA 1FFYA 3KZCA 3PDHA 3C5VA 1JB1A 4DR2B 4ISBA 2JGKA 2PA3A 3M0EA 2IYNA 1YK0A 1NI4A 4QRHA 2P41A 2CKDA 4OI4A 1UWVA 4P9NA 2WUFA 4GM1A 1F2TB 1XZNA 3EVGA 5F33A 3TTVA 5MGNA 4AZVA 1XTIA 2ZBGA 1V3VA 3DVAB 5CAEA 2CSXA 1PZEA 3H86A 2LCFA 1YZHA 3DFFA 2DBRA 1QF7A 1VSBA 4MJ7A 4JLPA 1X3SA 3LBIA 1UOQA 2VPWA 4FP9A 4TTPA 1PAUA 1UZAA 4A3SA 3M5CA 2Q9UA 3PD7A 3OM1A 2FCAA 2H4FA 3WDKA 2PMCA 1EWRA 2LXNA 3DE5X 2FSUA 3L8GA 2A5LA 4MQ5A 2GAAA 4HYEA 4C6RA 5DHFA 1YMVA 2BRUA 3E05A 3GL9A 3OEHA 4W5HA 4DSTA 2JATA 2IYQA 3ZH9B 3VOSA 2NU8B 4BKMA 1FCJA 3SHOA 1Z0ZA 1TADA 1V7PC 2P30A 1Z2NX 2RHJA 1CSEE 3EIEA 3EBOA 1I7SB 4DDTA 1BH6A 3PFBA 3HVRA 4XQEA 1VJTA 2WSBA 3A6EA 2HZ7A 2Q3BA 4DSUA 4EG3A 1T1GA 2XGJA 2Z43A 3ORRA 4BASA 1NRXA 5KU7A 1IIRA 2CJWA 5JISA 1KO7A 1ZKMA 1YI8A 4MVJD 3O03A 2FPXA 4HGOA 1KMHB 2P8SA 1CUWA 3GFFA 2O3SA 1M7GA 1PQUA 1P0FA 3ZU2A 4CHGA 4CKXA 3IAS6 4BKQA 2DY0A 4CZ2A 2CLSA 1XL1A 5KSPA 3SC6A 2Q28A 1KAMA 1AKWA 4EKYA 1EA5A 3FVVA 1D8AA 1QV7A 2I8CA 1KKMA 1U7WA 5FPHA 5IC6A 4EYEA 2P77A 1XKXA 3SFZA 3EC7A 1N6LA 3QU2A 1G5TA 4WY5A 4NBSA 4BO5A 3LQRA 3CNOA 4YIHA 5FNZA 2VTEA 3UPDA 2CCGA 1XFDA 1ENZA 1P5RA 2ZB7A 2ZOSA 2WUGA 4MLCA 1T2EA 1TYDE 1QG6A 2YZGA 4MDHA 3FXAA 4RK7A 3S1LA 1ABFA 2J3DA 4JNCA 2A5FA 1I7NA 2QRKA 1XU7A 4KB5A 5JPIA 4M99A 2DMRA 3R7BA 3RG2A 4I55A 4NZYA 3UJ7A 3WSWA 5K0GA 3S8MA 4NAUA 2XMPA 3PL5A 3SYMA 2PGOA 4J6FA 1N2ZA 5FIUA 2VK8A 3NPAA 2J7PA 4JEHA 4R9RA 4OI0A 1OFGA 2HF8A 2XVMA 2FPRA 3VNQA 2P7IA 1ZGZA 3AINA 3ZJVA 4MGKR 4DR4B 4I3FA 3VAZA 4GR4A 3U7FB 4Z8XA 1KWGA 1THMA 5E7JA 1QIIA 2PPVA 4EA6A 1HEYA 3EXIB 1W85B 3EFOB 1A7UA 4J9VA 5EE3A 3HO6A 1C1XB 3ZW7A 4BWVA 1JIKA 2G63A 2VSFA 3U4CA 5B64A 5IXJA 2JK1A 2OZKA 1J0BA 4O5OA 1KXJA 2XBMA 5JSKA 1A96A 5K1ZA 4MW0A 3R3HA 4YP9A 2ZQYA 2FZVA 5HKOA 2Q3FA 3FUWA 2GZHA 3DL2A 1XXHB 3SZOA 5LNK1 3PGA1 3MYYA 2H3HA 2ZZNA 3C5CA 1KQ3A 2G9UA 4M0LA 3OTOB 3IE2A 4N0PA 4YYEA 3T3GA 3FM9A 1Q1GA 1UT5A 3UH0A 3U4QB 2XD4A 3PC8A 1VLJA 5K01A 1ZNXA 5J2TF 2AQHA 4FQ8A 1PS8A 4PHHA 4ZA2A 1VZ2A 2YV5A 4AK9A 4R31A 5HJ2A 4B1FA 4BE7B 4EYGA 5AO9A 1GPDG 2NSYA 3KVRA 4JJZA 5DBOA 1OBFO 3BB3A 4QYTA 5AQ1A 3R5KA 1T4DA 4HQFA 5BSEA 4CGZA 3G2JA 3CONA 4R83A 4UAGA 3RYHA 1V7CA 2XMQA 2FHSA 1OF1A 2B98A 1T3HA 3NETA 3H5RA 4GMKA 3SOPA 1QIEA 3I01M 2ZRQA 3V6LA 2LUOA 1GR1A 3SR0A 2KMLA 2PLFA 2ADMA 1E58A 3IILA 3DGFC 4TWZA 1IOWA 2YHBA 2GF2A 3TXXA 1TW3A 4BAGA 4FFMA 4HR7A 2NYVA 1JGTA 1SG6A 2JKYA 2NVUA 2ZKLA 3DYIA 3QTLA 4ND7A 4PGHA 4BGIA 5ADHA 5T64A 4ZT5A 5CVEA 2QWXA 5EXDA 3SZRA 1GWNA 1QR6A 1I30A 1OKKD 4ND1A 3CR7A 2H4WA 5DXAA 3L8EA 3T61A 1WLSA 4NU6A 3A32A 2VPXA 3JARA 4D5GA 4V2UA 4HWGA 4DT1B 1CJSA 1A4IA 2NUAA 2Q45A 1Y1RA 1F12A 1ZX1A 2J0UB 3EGOA 3N8DA 4S3MA 2GVDC 2X3FA 4KR0A 4HEA1 3QVUA 2QRLA 1P7PA 2VJMB 3QJYA 1DIOB 2XYRA 2CHEA 5EP1A 2DE0X 2CUTA 2XCIA 2XMDA 3IJPA 3A9RA 3ELBA 4YJDA 1BXRA 2JI7A 1UZMA 1NZDA 4E7OA 3IIJA 3V32A 4MW5A 2ZWPA 2QDXA 1K88A 1XXLA 5AKIA 2YVQA 3M9XA 4PFJA 1F0YA 5MF6A 1R5JA 3C3EA 5FBRB 5B7NA 2W2NA 1TYZA 2VWQA 3PVSA 4BTVA 4CI9A 2WWVD 3ITDA 1WE2A 3U09A 5D00A 2JVKA 1U3CA 1ZVVA 1QLHA 4KQXA 2WTUA 3O5AA 2F17A 4ARAA 4NAHA 3GG9A 2VHZA 4LC0A 4CQMA 1C4OA 1KO4A 4S1PA 1TCAA 1G8AA 3ESXA 4F9TA 2OMEA 3QE4A 1XL0A 4XASA 5IJAA 4XCVA 5IM4A 1OXBB 3EUAA 3KEFA 2XE6A 3HO1A 3MWEA 4IWXA 4MQFA 3EXHC 5EJEA 2OAQ1 1G98A 1Z38A 3NTRA 4DLZA 1GARA 4YXWA 2ST1A 1JH9A 3Q3EA 1X1AA 3IAEA 3KEGA 4HZIA 4LYEA 2HQ1A 2IEBA 3G0GA 4RLFA 4O1MA 5JAIA 3IR6A 2ZUUA 2AOTB 1S7GA 2Y1KA 4TLAA 4HDSA 4K9LA 1GO2A 1QQ5A 2DT8A 2ETVA 3CHYA 3L4BC 4W4TA 4BDSA 3K09A 1GNLA 1TO2E 1YCHA 4NENB 4P4SB 1V5GA 4GWLA 2GZDA 1YV9A 5TMDA 5IBQA 1T5LA 4MLDA 5JAOA 1N3BA 4KAFA 4TS3A 4MWOA 1G6KA 1YKFA 3ASZA 2Q5EA 5JDCC 1SK8A 1X7HA 4OH7A 4LF5B 3HSKA 2J67A 4PG7A 2O2CA 1CYDA 2J46A 4DG5A 2WTMA 1Y33E 1IQRA 3AOEA 2VXCA 5AUPB 4R1NA 1PZMA 5AK6A 1UQTA 1RQ2A 2BCGY 3GCGA 3KYBA 5JJCA 3F3MA 2AZMA 2BV3A 5I8ZA 2BKLA 4EFLA 3OTGA 2CHUA 2HBYA 2WYHA 2J87A 2XZOA 3A6PC 1N2CB 4GPZA 2Z5FA 2BT4A 3VISA 1KZ4A 4BFTA 3N6VA 3QVMA 1C7EA 4II2A 1W1UA 1PYGA 5K3FB 4C7KA 1SXJE 2SECE 4ZP1A 2XE7A 1T13A 2CT8A 3AVOA 2PR2A 1B26A 3KPUA 4INJA 2HSEA 3NTLA 2RARA 3I9MA 4O02B 5ELLA 4JI0B 2PGJA 2ZIEA 4HQ0A 3TRIA 4KQGA 3L9WA 3URKA 2IYTA 4CM4A 3KQKA 3NYQA 4QM7A 2IW3A 1QYVA 4I1IA 1Z39A 2GSWA 5KUTA 4OXXA 4FGKA 5FWXB 2OXEA 4EZEA 4P54A 3R0IA 2B4KA 1Y6GA 1VQ1A 5CJJA 1E5LA 4AS1A 3KUDA 3O3CA 1F51E 4GFDA 4E4YA 1EHCA 1BZYA 4MQ4A 2Q6KA 4PTLA 3NHRA 5A7FA 3HNRA 4U7JA 2ZB4A 2IUTA 3CF2A 2GF9A 4FX5A 4C2UA 3KB1A 2GPNA 4A8PA 1M2WA 3NU1A 4IVRA 1HTBA 2QX4A 1JKFA 4GPAA 4ND8B 1H94A 2F1JA 3NP7A 4K9DA 2RD2A 1I3LA 3BB1A 3NHBA 1KJIA 1ZINA 4BS9A 1Y34E 3CJRA 4CFSA 1UBEA 4QSHA 1DRWA 2X41A 2YV3A 3O3OB 4FR2A 2C77A 1L7EA 1KDPA 2A3NA 2QRJA 3WGHA 4GOJA 3PFCA 4RELA 1YJQA 2KQUA 2OXCA 1HNZB 1T2DA 4UM9B 5U4XA 1Z3CA 2VP2A 1KIMA 2GERA 1NHWA 4MDFA 3FZQA 4HRAA 4J1TA 1FMCA 4ARVA 1WRBA 5JE8A 4UCFA 3RGWS 4GEGA 2GHTA 4LDJA 1B0UA 2VDOB 3F3KA 4R3NA 1VZ3A 2J9ZB 4OKSA 4BVJA 4TTRA 2AQIA 2VYCA 1Z07A 1HKHA 2B8WA 1CB0A 3OLVA 1I2MA 1GTL1 1QGUB 2LWIA 1Q57A 2NU7B 1M6HA 1P81A 4TROA 5TPWA 3TPFA 3SU8A 2OBYA 1IK4A 2YNMA 1PE0A 2Z2ZA 1E6WA 2ZBUA 1XTUA 3NBKA 5SV2A 1DC7A 2VDUE 1YTLA 1PTKA 1DCFA 4M38A 3U5TA 2WINI 4YRBA 2YY6A 1J23A 2J7PD 3A4VA 1U0JA 3I3OA 3K35A 1FPMA 3Q11A 4IR7A 4WZ6A 4B40A 1AMUA 2YN2A 3Q7PA 4DXAA 3RVRA 1FMFA 4ZTBA 1D04A 3P9KA 1RXSA 4LRXA 1BKSB 1PJZA 2X5KO 4LVUA 2H92A 4Q3LA 4QG7A 3EJWA 5D3MB 3REOA 3T94A 4F3RA 5EHXA 5LMUB 4U63A 1Y80A 1BAPA 1R2QA 1VIVA 3C6KA 3DAPA 3PP8A 5IEBA 1CUAA 4HUTA 4YJGA 5CA0B 3AHJA 1A9ZA 3ILVA 2FOIA 4F5DA 3GBSA 4OYRA 2Y4OA 4RK0A 4BQNA 4C7MA 1TC2A 4P3OA 5BSFA 3EOZA 4FE3A 4Q7MB 6ABPA 3VOAA 3LPNA 2FMTA 2C59A 3LT0A 4KMRA 3HY4A 5EKTA 1P2UA 5CA0A 1JQ3A 1W9HA 1X1EA 2YXNA 3A3OA 4XDYA 3FCXA 3SQLA 4ADSG 1WSAA 2DX7A 3FF4A 4JL6A 2GDZA 5TX7A 3T5BA 1CE8B 3VR2A 4KUEA 3V7NA 3CSUA 3G2PA 3ANSA 3JASA 3S5UA 2B9EA 4MVJA 1BN6A 4M8LA 3CRZA 1WBBA 4NECA 1BXKA 1XBTA 5AI5A 1PQ4A 2XNSA 2GEVA 3A6GA 4BFUA 1LPSA 4O33A 3OAAD 3U3XA 2O0LA 1S96A 3JVEA 3D1JA 4OREX 3QVSA 3HCOA 1YR2A 2J3JA 2ZK7A 2JGDA 3B1VA 3DMNA 1CUGA 4FGLA 3TR5A 4BVHA 2D7CA 3EMBA 5GIPE 4X71A 3T34A 1V71A 1CUYA 4LJAA 1KYVA 1J2UA 5AVUA 3BMNB 3PD1A 2LDXA 1S2MA 2XHEA 2YJ6A 1GR0A 2IDJA 5F3WB 3U4DA 1F8UA 1JEJA 1TF7A 4CEIB 4EMBA 4R4JA 5BSRA 2QLTA 4GOXA 1V9SA 3CZ4A 3QXXA 1M8GA 4KFTA 5BSUA 3TTXA 8AT1A 4EVRA 2YL2A 3TLCA 4QREA 5C1PA 1R6TA 3K9LA 4G6ZA 1ESEA 4RMNA 4KFCA 4JFAA 3HWX1 1R15A 1ZOSA 3FPAA 3QI2A 4KEAA 3VYVA 5CT5A 4EFNA 4F5WA 3S44A 1ULHA 2KW5A 4OQ4A 16PKA 4HB3A 1H8HA 4CMEC 4ZVQA 3AJ8A 3GEMA 3GAAA 3V8PA 2A59A 2P68A 4NOMA 2GN8A 2A5JA 1KYZA 3U7QB 3W06A 2EG5A 1FTGA 1Z6ZA 3EYAA 4PGMA 3VTAA 1ACJA 1P2DA 2ZB2A 1YIAA 1KC3A 4S05A 3FYUC 4QC2A 4ZOQI 2QRMA 1RU3A 3OFNA 2OORC 1Z2EA 2WJ3A 3MK31 3OE7D 1NATA 3JQFC 4NNPA 3PU6A 2Y0BA 4G0OA 4R98A 3ZZUA 4A92A 1SBHA 3I42A 4LSWA 2G67A 5FJJA 3WBFA 5JR3A 3O8RA 4K9KA 3DXYA 4W8GA 3G2QA 2PANA 4S1WA 3PRJA 2BM1A 4G0MA 3UMCA 2O2HA 3WGOA 3M6IA 3K6RA 3PNPA 1VLZA 5HBRA 4ZAWA 2XIJA 1SCUB 4H7FA 3ONEA 4QG3A 1Z4NA 1UKCA 2AD5A 1SOAA 1P8AA 2RE8A 4TV9A 1N5KA 1T24A 4FUQA 4P0QB 1QCCA 2AFHA 2DWPA 2WJJA 4P36A 5IYZB 2WHPB 2EIXA 4E03A 1GZ6A 2P5SA 4P31A 1L3CA 2Q2VA 1NW5A 3M3PA 4NDZA 5K51A 5JAUA 1GGJA 5EY5B 4S12A 2ZBVA 1XDZA 1N33B 3RG8A 2HWYA 2C0QA 3MRTA 3ZJYA 2ID9A 4PPNA 5C81A 3MHTA 1O4VA 1NXQA 2GTPA 2Y99A 3G8BA 3NGXA 3QKUA 4KQKA 5K3SA 4NJMA 3VDXA 1CNEA 4EGQA 2HJHA 1YL5A 3ICWA 3WYAA 3DTVD 3C1TA 3V4LA 4YAUA 3AF3A 4PLWA 3HV0A 5JASA 3HCEA 4HDQB 3ZD8A 1PT7A 1NJ6A 821PA 3ZVKA 1DGQA 4JQZA 5JMWA 1FYVA 2TMGA 2X22A 4RVFA 4F84A 5JJ5A 4NNOA 2OCAA 4ZAVA 5G0UA 4KJZA 4D2IA 5C32A 1SPXA 3CG4A 4YGXB 3MAJA 4DIKA 2BMAA 5LWHA 3A9SA 4I9GA 4TZ0A 1ZRHA 5EE1A 1POXA 1YDMA 3LRXA 2POCA 1QAQA 1ZD9A 1GP2A 3I2HA 3NHYA 4KLCA 4ILKA 5T3UA 3UW1A 5A5DA 4ZTZB 4IDQA 1TECE 4L4RA 4LJRA 2BGWA 2GFQA 2YR0A 4EB8A 4TYYA 2FPGB 3ZWQA 4CYMA 3QPDA 4EEXA 2E21A 4WUTA 3R3YA 4NE9A 4M9RA 4FYXA 1NY6A 1TVEA 2A4KA 4K2AA 5FR2A 1DZ3A 1T91A 5BSTA 3QQPA 1KS9A 1KH3A 1N7IA 3EQ8A 4NBLA 1A5AB 1J09A 1F8YA 1LX6A 1E0KA 1RYYA 2BEUB 1AVTA 3X1WA 4XARA 2EKQA 1RLIA 3ND8A 1ENYA 1WD5A 2OD7A 2HW8A 1WZNA 1N0VC 2H0RA 2JHCA 2P0AA 3N0RA 4NIMA 2JHAA 1YOBA 2C5SA 2V7QD 4ISCA 4ZOLB 4GH5A 1PVOA 2WD8A 4JYBA 3LHDA 1W5SA 3IMCA 3T9DA 1GIAA 2UVPA 1Q1ZA 3PXCX 5AXCA 1JA0A 1NVDA 4ZJZA 2CV2A 1TEZA 2HMWA 3KQTA 5FEMA 2CLFB 5JZOA 4YAIA 1PI3A 5EVCA 1DWUA 5EJ2A 1YL6A 2X58A 5L95A 1Y7HA 1VCIA 4JEUA 4GOOD 1T2UA 1JHQA 2QW1A 4NQZA 3W6PA 5FOQA 2Q8NA 3RRZA 2NSDA 2NZJA 2GJ4A 4BWFB 3CZ9A 3KR2A 2QIOA 2WTXA 3TD2A 5K8LA 1KOGA 3IQWA 2QN9A 4P32A 4XQ9A 3OLCX 3QITA 4BV8A 4AZ0B 2OSVA 3S2FA 1GGMA 5FLXA 3M1YA 1MIOA 2HJVA 5CEEA 2BZ0A 2C5EA 4K8RB 3UGJA 3OZDA 4IHJA