4LHWA

Crystal structure of rab8 in its active gppnhp-bound form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
171
structure length
171
Chain Sequence
DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ras-related protein Rab-8A
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 171
sequence length 171
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhwA00
4A15A 4NYMR 2OAP1 1W4CA 1W5SA 1HE1C 1SVLA 1AIPA 1GL7A 3L0IB 3GJ0A 4KVGA 3HYTA 2OFOA 3FWYA 3HPRA 2YOFA 1A5TA 3NBFA 1G6HA 1E9SA 3OZXA 4NPHA 5KSYA 5HE8A 1XEXA 2F9MA 1OLOA 3U44B 1R8QA 2CHGA 2Y8EA 4JMPA 4EQ6A 1OE0A 4AG5A 121PA 4E09A 4E5UA 4GDFA 3P1JA 5FUVA 4QFMA 1RPZA 1OFIA 2A5JA 3BB1A 1P2VA 1TQ2A 2OO7A 4DB2A 2V6JA 1YQTA 2PX3A 4AI6A 3K0FA 1N6IA 4YMTA 2H57A 2RGCA 1W46A 1XJ0A 1CLUA 2GJAA 1VCIA 4TYPA 4B34A 1KI6B 4AG6A 5CIQA 3LWNA 4DUGA 4C7OA 3NDPA 2YWHA 3MJHA 1FUUA 1KTVA 1YE8A 3KKPA 4ZCIA 4IVRA 5CM9C 3I5YA 2ZRJA 1XF9A 3UATA 2GCNA 1TF5A 3REFA 2QAJA 4LPSA 1ZM9A 4GRAA 4OJQA 4DCVA 1Q12A 2V55B 4JLOA 2VEDA 1G291 4DRZA 1XJQA 3KB1A 1UBCA 3GLHE 3OAAD 5J5CA 4AURA 4G5RA 5KNBA 1CJTC 5H68A 4DT1B 1XTJA 3FHOA 3TMKA 4CEHB 5C2JB 5CLLA 3HU1A 2XJ4A 1DADA 3L43A 4URWR 2ZITA 2J59A 5G3YA 1W0JA 2EFEB 2RAPA 4TL7A 3RS0A 3AVWA 3TQFA 2F7SA 3GEHA 4NH0A 3BAFA 1IN4A 1F2UB 4Q9KA 3FMOB 4MGIR 1DBSA 5KSPA 3VKWA 4XVRA 5GJVC 4ZI2A 4TLCA 1E2EA 3A1TA 4JT2A 1NMXA 1KO1A 4A36A 4NCHA 4HB0A 4YMUA 4OQNA 4PSVA 4Q1AA 5KU1A 1XMSA 2R62A 3DMDA 2HT6A 3EASA 2ZJBA 4YDSA 1RIFA 4V02A 2BMFA 3W3ZB 2WIBA 1YVDA 4Q1BA 4BFWA 1RE0A 4LJ7A 1E9CA 2OXCA 3DPUA 3QKSA 1AZSC 4TMTA 4M9QA 3U3KA 2GJSA 4RCZA 2Q9CA 4Z51A 1HA3A 1DAHA 2A5GA 3TRFA 1YRBA 5GVSA 1G8PA 4M0LA 2VHUA 1UDWA 1Z0JA 1H8ED 1MRSA 2J45A 1TUIA 3B9QA 4FMCF 1NIJA 3H84A 5FI0B 2IS4A 2GXSA 3JVVA 4PC7A 3GLFE 2AWOA 2ZRDA 2YV5A 5JHHB 1JEEA 1E0SA 2C9CA 2CE2X 2DWPA 1TADA 3LBNA 4UJ5A 5IRCD 2NQ2C 2W83A 1EFRA 4JVSB 3VU9B 4W5HA 2QAGC 1QDEA 1YZGA 3V00A 4BECA 2C99A 3TIFA 4M1OA 4YLGA 4Q01A 4LHZA 3QKRB 1ZNYA 2J5XA 4GOJA 4MGYR 3ZLJA 2IC5A 1ZW6A 3FHCB 2G1KA 3BB3A 2FNAA 4PR0A 5TARA 4WXRA 1B0UA 3B1XA 4RFSB 4Q4HA 3KXLA 2NPFA 3ZZ0A 3EPJA 2XXAB 4OQLA 4HAYA 2ZRCA 3TGPA 2VBCA 5E4FA 2WTUA 4US2R 2YC2C 4OQXA 2EWVA 2PCLA 4HDCA 1HTWA 4DLSA 3V4FA 3TNFA 4F4IA 2NGRA 1Q1BA 4RZ3A 1DEKA 3QOFA 4LC0A 1U8ZA 3GLGA 1YZUA 4NMMA 2D06A 2ZE5A 2VHQA 3DL0A 3I8XA 1XJCA 1ZUIA 4AIIA 2FX3A 2C03A 4MGZR 4B3DA 2GZHA 2FF7A 3ZVMA 1JEDA 4HZUB 2A9KA 1Z3IX 2GETA 3PUYA 2YWEA 4B73A 1VECA 1G3UA 4CT5A 4I1UA 1CJKC 3RANA 1A2KC 3TW4A 1E2IA 5L3SB 4Q9IA 1IN5A 3CR8A 4ESHA 1QHGA 4JJKA 2IX3A 4BEJA 2IA5A 4LOAA 4LJ9A 4LYFA 3LY5A 1QHHA 4QJ4A 4XIGS 1P72A 1KGDA 1I4DD 3P20A 4FCWA 4P4TA 3OFND 1EFHA 4IEEA 3U3RA 4DLTA 1KY3A 2QORA 5DI9A 1CP2A 2XJ9A 3AVOA 3DZDA 3AM1A 2VYFA 2RGAA 5JEEA 3QI2A 1FL9A 3MGCA 3P27A 2IYVA 3TSWA 2PBRA 3D31A 4Q00A 521PA 5EUQB 4HAUA 4MA4A 2CEAA 1OHHD 4KBFA 1CULC 3DDCA 3BE4A 3BORA 1S1CA 4Q47A 4QHYA 1ZUNB 5HZKA 2VPPA 4DEXA 2IEZA 2LCFA 2ZJYA 1U81A 1FUKA 5F3WB 3SFVA 3UMRA 4H1UA 4B3BA 1GDDA 2O8CA 3K9NA 4DSNA 4B71A 1B23P 5HE9A 3PUWA 3BXZA 2DYKA 5A4JA 3IBGA 3Q9LA 3U7EB 1QHSA 4ZO4A 1OH5A 3OEEA 2G0TA 2YOGA 1ZIOA 3E2IA 1HE8B 3O8DA 5H70A 4PFSA 4A4DA 5JCPA 1F48A 4KLZA 1LF5A 1BH2A 1VG8A 3QNUA 3QJYA 3GJ6A 1EX7A 1LY1A 1S3SA 3LXRA 2HCBA 2QM8A 2QUZA 2OHFA 1WRBA 4LK2A 5BYKA 5EP3A 4FW9A 4Q1CA 1CJUC 1HUQA 2P0EA 1KMHA 3RYTC 1L7VC 4TYQA 3WHKA 3GD7A 3EWSA 2AFIE 3C4JA 4TSFD 4QRHA 3U7GA 2ZI9A 2W2VA 3B60A 4JL6A 1FOEB 1ZINA 1EXMA 2VO1A 3EIHA 5E7JA 3T5DA 1N5IA 3W9YA 2ZRPA 1VIYA 5KPJA 4CEJB 1ZM4A 5F9HA 4D80A 2NMVA 3N2IA 2UZ3A 4ARZB 4PZZA 4EPRA 3K0AB 2BV3A 1G64A 3F0TA 4HDQB 3K9LA 4EDHA 4M1WA 3AF2A 3UK6A 1P4SA 2O0JA 2KWIA 4JLVA 4OHZA 5G3ZA 4LGMA 4NCNA 4W5JA 4B48A 1JR3E 4BFUA 4HI0E 3RSOA 4EPWA 1KI8A 1IBRA 4HLDA 2ZS9A 3CONA 4PQFA 1OXUA 4K8OA 3GLHB 5AJYA 1II8B 1SVWA 4S35A 1G3QA 3P4XA 4HUQB 3KDSE 1RFLA 4A1FA 2O8FB 1U8YA 1DTSA 1YR7A 4ACAA 4ON9A 2R44A 3PEYA 1P62B 1KYIA 5JHGB 3U7HB 4TLEA 1QRAA 3FPAA 4PX9A 2ZUBA 4K81B 5G40A 3IHWA 1ELOA 2BKUA 1G18A 3KKQA 2B7BA 5BN4A 4JJZA 2ZJOA 2H7VA 2VH5R 3FKSD 3ZJYA 2FFQA 3ND9A 4JBWA 2WBLC 1VMAA 3BB4A 1HEIA 3CNOA 1GITA 4K46A 4Q7KA 1DELA 2XNSA 5TXGA 2BCJQ 1E2GA 3K09C 3K70B 2J0UA 5FL7A 3SJAA 1YHNA 3AKCA 2FU5C 3QVUA 1J99A 3MFYA 1OPXA 2HYDA 2XNDD 4KJZA 3WNDA 2FG5A 3IPYA 4L16A 3MWYW 3SNHA 2HF8A 2G0NA 4V0OA 4WZBE 1T3HA 1NN5A 2WJGA 2QPOA 4PC6A 3W34A 4M4SA 1T8TA 2VHJA 3GLFB 4LJ8A 4ASUA 5LPNA 4FIDA 2F1RA 3CNLA 3NTUA 3PUZA 3E5HA 4EUNA 5IK2A 1TEVA 4Q1DA 5CM8B 2BM0A 3K70C 2B6HA 1Y3AA 1KI4A 2BVNA 4GBMA 4IFBA 4RZXA 3T06B 4GP6A 4EJSA 4D4LA 2IL1A 2O0HA 1JXMA 1GRRA 1AQUA 3TR5A 4GZLA 4LYHA 5A5GA 4NHOA 3B5JA 4D4JA 1Z28A 1GNRA 2QZ4A 4A2PA 5LB4A 3NHAA 4G1UC 3Q7PA 3AP1A 2IWRA 1Z6AA 2WWGA 3CLVA 4ZIRA 1J90A 2ATXA 2HLDD 3HU3A 3M6AA 3KTAA 3L0PA 3A36A 4HB3A 5KNDA 1NP6A 3M1IA 4GFDA 1MO6A 2BBSA 1IY2A 2LKCA 4G3XA 3FMIA 4BEBA 4XJXA 5B57C 1XEWY 4CT4B 1U99A 5EP2A 1S3GA 4YMSA 4G0NA 4GZMA 4TQ9A 3R7WA 2NO7A 2ZYVX 3NC0C 4RD4A 1M7HA 1S9HA 1P60A 1UEJA 3L2OB 3KQLA 2EFCB 3NH9A 3IBYA 3GJXC 1NSFA 1GM5A 5J4VA 1UKZA 2UZIR 1DG3A 3U6KA 1GUAA 2ODWA 2VP9A 3UG6A 3AVPA 1E99A 2VP6A 4L9SA 3F5FA 4G5QA 4M21A 3MCAA 4M1MA 1DE0A 2CL0X 3SS8A 2IYXA 2IXFA 1EX6A 2QE7A 2R8RA 4Y0AA 2QSYA 2QU8A 1I2MA 2IEYA 2ZAOA 4RCYA 4B3FX 4QHSA 4X8HA 5CYPA 3A1WA 4HAWA 4YQFA 1JQJC 4URVR 3KJGA 5E3HA 1YZLA 1MRNA 3K8YA 4OQMA 5E95A 4H1VA 1WCV1 5FPYA 2C96A 3JZMA 4Q4JA 3I62A 1GG2A 2O8BB 4FMDF 3AUYA 5DIFA 3S1AB 4PQRA 1F60A 1A2BA 2H1LA 1T5IA 4B44A 4UKDA 2CLDX 4HLUC 1DAKA 3CRW1 4JLKA 2GJ9A 4M53A 3WRXC 5SZKB 5IF9A 2KB0A 2E87A 1G5TA 4WXPA 1E1RD 2JLRA 1ZVQA 4W7SA 4DZZA 4A0HA 3AKEA 1J8YF 1NLZA 1P73A 1RYHA 3QVVA 4CDGA 3W6OA 5JI2E 5SZJA 4Q7JB 1Z63A 2OFWA 4JVNA 2Q6TA 3FVQA 3W90A 3ADDA 2WZQA 3ZVLA 3A1UA 4LYAA 1NLFA 3X1WA 2P6UA 3IO3A 1KY2A 3SJZA 3ICEA 3Q5EA 2XEXA 1XCGB 1T9HA 1VYVA 2XOKA 1XXHE 1SVSA 3FB4A 1XPOA 1AA9A 1HT1E 4RD3A 4B47A 3D6TB 4C0SA 5IDVA 1W4BA 1T0JB 4XD7D 5LBIA 4HYYA 3M0EA 1Q57A 2JLQA 5C46F 2EFGA 2G77B 2VSFA 5EE3A 2GK7A 2WWXA 2WKQA 1KDOA 3WRYC 4BZXA 3WNBA 4YXWD 1K8RA 2JJ2A 2OBMA 3TSZA 2RGGA 2JASA 3KXIA 4RD2A 2VF7A 1WBDA 2OM2A 4PAOA 2O0KA 3AVYA 3MAAC 2VSOA 2IWHA 4ACBA 4F4JA 2RGXA 1Q3HA 4AC9A 4PHHA 1Z6GA 3PITA 1UADA 4II7A 2ECKA 1T3LA 3PEVA 5FTKA 2JLYA 3Q7QA 2FPMA 4TYYA 3W5IA 2Z43A 4MH0R 2OBNA 3IPXA 5A0FA 4OI0A 1II0A 5TY0A 2W00A 3D8BA 5EE9A 3R8FA 4M9ZA 2JATA 3IILA 4URXR 1JR6A 1WQ1R 4IOMA 2NO0A 5JWRA 2YVUA 2CHVA 1IONA 2GKSA 2YOHA 1ZNXA 4Y0VA 5BN5A 4B2IA 1CKEA 3LLUA 1HH4A 2CCGA 2GZDA 5K8UA 4TMKA 2W0MA 4B32A 3UWOA 1I2DA 2ZRHA 2J7PA 3BRWD 2X8AA 2VP2A 2WSSA 3VNVA 3T15A 4WA7A 1XBTA 2P6NA 1ZD9A 4A8JB 4AKEA 4HLQB 4B2PA 4KAXA 2NG1A 4YMVA 2JIZD 1I4TD 3WXMA 1NN1A 4A6XA 5DN6A 3RS3A 5JSZA 4HB4A 5FBQB 2O8DB 2GBLC 2ZUDA 2BC9A 1ZP6A 2CHQA 4V0NA 2V4ZA 4NZYA 1RKBA 1COWA 1U9IA 3WBJA 1GL6A 1VDZA 4NKRA 4FXPA 1XD2A 1E69A 3K9HA 1DO2A 2G6BA 5EE0A 2DB3A 3R9XA 2WJIA 2QRNA 1WB9A 2WKRA 4D4MA 2FE4A 4OBEA 3OIWA 2CL6X 2XX3A 3QXJA 3H2YA 2NPIA 2CNWA 2IUTA 2Z0MA 3VX3A 2AR7A 4NTZA 5LD2B 4CRWB 1VPLA 1RRFA 3C5CA 2ZI7A 3EW9A 1OIVA 2BMJA 2DR3A 3B82A 3CB4A 5HCNA 4B2LA 1WBBA 1W36B 1W4RA 1N5JA 4KFUA 2IXEA 4TTPA 3WHLA 1W44A 2VQSA 1R5OA 3RDPA 1CR4A 2KBEA 4MITA 2AD5A 1Z5ZA 4QGAA 1ONBA 5FTMA 2D4HA 2GEDA 2HT1A 3RC3A 1FFHA 1SXJD 5BQ5A 4XSGA 1KMQA 5IT5A 2B92A 4DIDA 5CB8A 3NHBA 1MO4A 5FPTA 5LD2C 2PT5A 2BOVA 2PH1A 3DM9B 3HJNA 4NYMQ 3SBEA 3VTKA 3MD0A 4XTRA 3FHTA 3PXGA 3LRPA 2PZGA 3GLIE 5FUXA 4C0HA 2PMDA 1JAIA 2ORIA 1KO7A 3DKVA 1SKYE 3BJIC 1UEIA 3BERA 4X8MA 1EWQA 1T0HB 2FSIA 1Z6YA 1FTSA 2PLFA 3JZAA 1E0KA 1TEXA 4G5OA 5EUMA 4A6PA 4BRUA 2GXQA 3BIFA 4DWJA 1CRPA 2B8WA 1UKEA 4LV6A 2ZYWX 3THYB 3T12A 1F6BA 4DJTA 4PPNA 1E2DA 1R6BX 3LLMA 1AN0A 1NVUQ 1QHXA 1AS0A 1VTKA 2IS6A 1P7CA 1NJFA 2QPAA 2HXYA 3DKPA 4NONA 4U02A 2XSZA 3B1YA 4N0EA 1UF9A 4US1R 1J2JA 4GT1A 1R4AA 3D7MA 4A2WA 1R10A 2ZAMA 1KDTA 3X1DA 1S1MA 1GWNA 2QN6A 4KBGA 5SZHB 4WW0A 3FOZA 2HJGA 4Q21A 1E79A 2QA5A 2V7QA 1VG9B 2Q21A 1NRJB 2QP9X 2Z83A 3TBKA 1N0VC 3QXCA 4BFYA 3N5CA 3LBIA 4MKGA 4Q66C 4EQ6B 2IYZA 3HU2A 3AQ4A 4TMXA 3OF5A 2VP5A 2IHBA 4GOKA 1EGAA 1F3OA 4NDZA 1R2QA 1TL7C 2O5VA 3DM5A 2WIAA 4CW7A 3CWQA 4DUGD 4Q4AB 5LB2A 1F2TB 1FQKA 4JVMA 1KJWA 3WBKA 4LRWA 2G1JA 2V9PA 1JB1A 4BFZA 1DS6A 3QPVA 1X8JA 4PHFA 3BOSA 1TMKA 4UNQA 1LFDB 4BLSA 1JXOA 2OCPA 1EFTA 2RHMA 2YNMA 4BASA 3THWB 3PV0A 4QBFA 4JL8A 3AF4A 4DDUA 1XXHB 3U44A 4D81A 4LYJA 3U3JA 2OUKA 3FE2A 2A2ZA 3U5ZB 2IXGA 4TYNA 4EPTA 3KQNA 1YU9A 1XPRA 1HURA 3B13B 3EXAA 3HPQA 1VHLA 4PQYA 5EE5B 3LA6A 1K6MA 3PQCA 1CR1A 4D6PA 2ZRNA 5CDFA 4BFVA 2XB4A 2FSGA 2OCAA 4QL3A 1XEFA 3B6EA 2WICA 4TTQA 2V1XA 1L4UA 3SZRA 5JS7A 3C5HA 1QG2A 4IHQA 3VR5A 1LF0A 2ZRBA 4IDNA 1RJ9A 2GAOA 1KI6A 5KOYA 3N2EA 3RS4A 3I4LA 5FPSA 1E2KA 4HAZA 3RAPR 2WAXA 2FZ4A 2VP4A 4JBYA 1HQYE 4PXAA 2MMGA 1K5DA 2IK8A 5FOSA 2QTHA 4I1OA 5AJWA 4CVNA 1X1RA 4RFVA 2QPTA 1KI3A 1LB1B 2OCBA 2QBYB 4D25A 1GZSA 1Z83A 2QRZA 4ZCMA 5AJVB 1VKJA 1E2QA 4DT1A 4OYHA 4CEHA 4B75A 2DHRA 1RZ3A 4EPYA 3HYRA 2J46A 3KKNA 2QAGB 1N6OA 2AFHE 2K5UA 4ZCLA 1EFRD 5JWOA 3K53A 3QXHA 4YC7A 2PEYA 1ZRHA 4M9SA 3TVTA 3LVQE 3VFDA 3ECCA 3RS5A 5KHOC 1IXRC 1KK1A 4LDJA 4KO8A 4NCKA 2XTNA 2OFXA 5FBVB 2IS2A 3TR0A 2ZS8A 1GRNA 2GVZC 3GJ7A 2BMEA 1E9DA 2GWHA 4FCTA 2RGNA 3QIAA 4PC2A 1W1WA 5C18A 1NN0A 1ZC3A 2I3BA 4DHEA 1YJ5A 1OH8A 1H8HA 1YZTA 2C77A 1P3JA 3PR1A 1JPJA 1FMLA 4EPXA 5CK4A 2GJKA 2F3RA 1G4UR 2OZEA 4DLZA 3T34A 5JECA 4TT3A 1GIAA 1IN8A 3EIQA 1V5WA 2H18A 1CBUA 2OG2A 4IW3B 3RC8A 1Y63A 4C3ZA 4I1SA 2IHYA 4B43A 3G5UA 1EESA 3I3SR 4PO8A 4P0TA 1KI2A 1ZD1A 1QVAA 2QENA 1GILA 2X19A 3HDTA 1P2UA 3GPLA 4LJAA 1H8EA 3VU9A 2OBLA 4UNSA 5P21A 3HR8A 1MKYA 3ND8A 4NYIR 1G4AE 1E96A 1KKMA 2ORVA 5FOTA 2Q3HA 4DLRA 4PO1A 2VRWA 4WVFA 1IHUA 4QG7A 3AGQA 4KVAA 3AUXA 2D7CA 4RFSA 1SHKA 1MO5A 3B78A 4FI3C 5JRZA 4X8OA 1CEEA 4IKEA 4AYXA 3RRZA 2AWNA 4TQUS 3EPLA 3I73A 2XXAA 2PMKA 4JT4A 4Q48A 4BZPA 4DCSA 5EQTA 3CH4B 2ZPTX 1US8B 3QG1A 2ZVPX 1CIPA 3E70C 2F3TA 4IEIA 1UDXA 1X1SA 4NL4H 1QF9A 2JLXA 3BFXA 3A1VA 4M1YA 4AYTA 2SHKA 1QHHB 4JLDA 3LW8A 1GKYA 1XU4A 4AKIA 1OKKA 2F43B 2G3YA 3VR4A 3GLIB 1KJYA 5FOUA 1SKYB 3ZIAA 2DY1A 3EPKA 2WJYA 3C14C 5JS8A 2FV8A 2GK6A 1QHIA 2YWGA 1ESMA 5FH9A 4HZUA 4DCNA 1I4LD 1PJRA 3EZ2A 4HAVA 4OI4A 2D7DA 3LQRA 4PPFA 5L3SA 2HF9A 2OCYC 2Z4RA 1D6JA 2JLSA 2ONJA 2ZI6A 2W58A 3T35A 4DSOA 3U7FB 2RGEA 3LFUA 1E1QA 2AD1A 3O47A 4JLPA 1TF7A 4A9AA 4IRUB 5L3QA 2O8CB 2QI9C 4LJ5A 4KSCA 2VIIA 2WMNB 5J47A 3EG5A 4TMZA 4A0RA 2QP4A 3PFIA 4KV9A 1AGPA 3R9IA 3MMPA 1FNNA 2VF8A 2DFNA 3CZPA 3P4YA 4UQOA 4LBZA 2GCOA 5EXTA 4ITRC 3SR0A 3OFNA 5EP4A 5JMTA 4A0FA 4M1SA 4P4SA 1XCMA 4QC2A 2IUSA 4WZAE 3MWLA 2ZUCA 3RS2A 1HV8A 3EWAA 4R7ZA 1VCOA 2YHSA 1G1MA 4ZPXA 3JVUA 1OHHA 2BBOA 3LBHA 5KPDA 2JDIA 2ZS7A 3CRQA 3UMSA 4KODA 2X2EA 2C95A 2JGNA 4HATA 3LD9A 2QTVB 4TWZA 3V9PA 3A58B 3EC1A 1WA5A 1G9XA 1LW7A 3SYKA 2QM7A 2WSMA 3T1VA 1HT2E 3Q85A 2BBTA 2AK3A 3RNLA 1ODFA 2R6DA 3NH6A 4DEYA 3B1ZA 3A8TA 4RVCA 1FX0B 4TLAA 4B33A 5DYGA 4JBXA 4V0ME 4URZR 3BD9A 4TN1A 4B3GA 1G19A 1SQ5A 2RMKA 2FFBA 1OFTA 3AB3A 5AUQA 2REXB 4LX0A 2CVHA 2X1VA 3CRRA 1E9FA 1TQ6A 3TUZC 1PLKA 3OIUA 4OL0A 3ADCA 2EFHB 4ZI3A 1E9EA 2ORWA 1KDPA 4TLDA 3VR6A 4WIAA 2DFTA 3K0CA 2V8OA 3SI7A 1G8GA 1XCPA 2A7QA 4ERNA 4KSBA 2ODEA 3PCRB 1TQ4A 1NMYA 4CEJA 5EZ6B 1XX6A 1ZU5A 4GOXA 1FP7A 4ARZA 3L82B 5DLQC 5FTNA 3K0AA 3NKVA 5KDLA 3PEWA 1G16A 3AF0A 2VA8A 2ZRFA 3A6PC 5EJEA 1L8QA 5DH9A 4C0KA 1WF3A 1GFIA 2X2FA 4OJKA 2GVDC 2ONKA 4I1VA 2JEOA 3FFAA 3QE0A 4HAXA 5FR2A 1XTRA 3GLHA 2ZE7A 3LX5A 4M22A 2J0UB 4QGHA 1N6HA 1M34E 4HUQA 5HKKA 2O8FA 4ASUD 2ZJAA 4Q1FA 4DSUA 3TSOA 1UM8A 3K09A 5IK2D 4JLBA 4CEIB 5B58C 4DC9A 2NO1A 4OI2A 1SULA 4MGKR 3QBTA 3ICQB 1Q3TA 2FOLA 1PLLA 3RWMB 1Q20A 1E9AA 4A2QA 2ASEA 1X8KA 2ERYA 2ZSAA 1XTSA 4DIEA 3AF3A 1DARA 2D2EA 3GMTA 4GMXA 4RD1A 2QMUA 1SZPA 3OEHA 4DDTA 2QG6A 5AR1A 5BWMA 4BQSA 1M74A 3FKSA 3TE6A 1G7TA 3WNCA 3R9WA 3AVVA 4RZUA 3I92A 4GPTA 4W5WA 1PLJA 2MSEB 4PSAA 4WOPA 3AVXA 1Z6XA 3KTAB 3R20A 4P3YA 3ZS9A 1RC8A 2QT1A 2VHCA 2ODBA 3CH5A 3HP1A 5FPKA 5HZHA 3QG5A 2CK3A 2R65A 2R6AA 5FOXA 4BFSA 4BFTA 3GLFA 5J4KA 1E9BA 3FMPB 4EJSC 2XNDA 4F4CA 1DG1G 1P5ZB 2P5TB 3MWKA 1XB2A 2ANCA 2BBWA 3WYGA 4GMDA 3GQBA 4ABYA 2QMHA 5JJLA 1SXJE 2RH5A 4F38A 4B3CA 2FH5B 3VR1A 1GKIA 2QE7D 4RKFA 1FPMA 3LAWA 1Z0DA 1VCNA 2FJUA 1ZCBA 2EFDB 4FCVA 2C9YA 4FMCB 1IXZA 2GTPA 2ZVQX 3TAUA 3ADKA 1Z47A 1QHYA 4EFNA 4NBSA 3B8HA 1OV4A 4UJ3A 5B30A 3VR2A 5EXPA 3GEEA 1UAAA 1YR6A 5FL3A 4C2UA 1N6KA 2NTYC 3C8UA 1P9RA 2CBZA 3ZZUA 4MKHA 3K9GA 4MQBA 3TVDA 1ZC4A 3H0KA 3IQXA 1CJMA 4PSKA 2J0SA 3SHWA 8OHMA 4B6FA 2ZXUA 3KQUA 3I5XA 2XTZA 3THOA 4QXAA 3OIYA 3CO5A 3A1SA 1KJZA 2GF9A 5LDDC 5DI3B 1W0KA 4TYWA 4TL6A 4YDHB 4NYJR 1GVNB 1SVIA 3PVSA 1IXSB 4MKIA 5EE1A 4KYUA 4MUBA 1Z6TA 4KLNA 2ZQ5A 2D2FA 4C2TA 1E4YA 2I1QA 4LCBA 1E98A 4HLUA 4O3MA 2GILA 1NKSA 3BH6A 2O8EB 4R2IA 5DNYB 1U0JA 1MABB 1ZNZA 3QXXA 2QGNA 1ZD8A 2XOKD 4C30A 5ANRB 1Z07A 3VR3A 1M2OB 3EZ6A 1GKUB 4OK6A 3B2EA 2QTFA 3QKUA 4Q03A 3U3MA 1M6NA 3PENA 1Z06A 2ZROA 1ZM7A 2O8BA 3SHFA 1FTNA 3X1ZA 3S1AA 1L4YA 3CZQA 2OXRA 4IOKA 3QF7A 1NMZA 2DCUA 3IQWA 2QROA 5C1BA 3KXKA 5DISB 1N6LA 1BMFA 2JJ2D 1KSHA 2ODNA 3RRYA 3BK7A 4N1AA 4PPGA 4V03A 4Z8YA 1XNJA 1P75A 4MDEA 1LS1A 4OHVA 4ZKDA 4D4KA 2GXAA 4PAQA 5FR1A 1G20E 1KI7A 2O52A 2LKDA 1QBKC 1X3SA 3ZS8A 2IYQA 4L8GA 3LV8A 3GFPA 1A1VA 3QF4A 2ERXA 4BRWA 5K8IA 1AZTA 2RB4A 3W8RA 2ZSEA 1E3MA 1UJ2A 2REBA 3MLEA 2J0QA 4OK5A 2ZSFA 3FFBA 3FDIA 3PG5A 1XDBA 3BC1A 5CB6A 4TMVA 3U3OA 2WWWA 4MYHA 421PA 1U8AA 4KFTA 5EZ5A 3RS7A 2R6CA 3RHFA 2L0XA 2BMDA 2DWQA 1ZJ6A 3TLXA 2WPDA 3EA5A 1GOTA 2JLZA 2D3WA 2AL7A 2XTMA 1NI3A 4TMWA 3AH8A 1AS3A 3O8CA 5FBWB 1YZQA 1EFCA 1ETUA 2GAAA 5JFGA 1VYTA 5HR5A 1JJ7A 4M2LA 5K8TA 2J7PD 2WSSD 3IHLA 4FMBB 1CRQA 4EIWA 1G17A 1W2HA 3I61A 1XTIA 3W3AA 2UKDA 4LZZA 5HTKA 1OXXK 5DN6D 5GJBA 5JEDA 1BYIA 4HEJA 1WMSA 4OI1A 3VHLB 1TF2A 3KB2A 2OEPA 1R0WA 3CKLA 1P2SA 2H17A 4GL2A 3U4QA 2FPKA 4LJ6A 3W8NA 3BS4A 1OSNA 2OV2A 3CX7A 1COWD 5J4YA 3NXSA 3UWKA 4TZ6A 1JR3A 4XTCS 3KJIA 2OAQ1 5EXSA 821PA 2CDNA 3LX8A 1KAGA 2D62A 4POAA 3RLFA 2XZOA 1MR3F 5KDDA 2V6IA 1GP2A 5AUPB 1N5KA 3SDZA 1T91A 2A3RA 3EZ7A 4Z8XA 4Z1MA 3THXB 5JJKA 5KNCA 2CNWD 4NU0A 3M4YA 5D3QA 4J0QA 3TQCA 4DXAA 1GNPA 4NP6A 3KL4A 1Q0UA 1QVRA 3AGPA 1X8LA 1OXSC 3RABA 5JWHA 1OIWA 1DAMA 4GI7A 5FOWA 2CLSA 2PT7A 4QNRA 4S2EA 5DYIA 4A8JA 1Z0FA 1ZIPA 3CF0A 1KKLA 2W6IA 1G3MA 5TDHA 3SEAA 3UG7A 1M7BA 3GLGE 4O2RA 1S4QA 1KI9A 1UPTA 4RD6A 4DDWA 2P6RA 4LUCA 1U90A 4BWYA 4XSHA 2O8DA 1U9IC 1E0JA 5IHPA 1T6NA 1WE2A 2CCJA 4OKSA 1ZU4A 5F98A 5HCIA 4QNMA 3CX6A 1DAEA 2H8KA 4DLXA 5KUTA 2F1IA 4G01B 4JVLA 4N0DA 4EPVA 5KSZA 2G88A 2XZLA 4Q9JA 1LNZA 3KKMA 2NOAA 3EZFA 1RRCA 4B6EA 4WAUA 2JJ1A 3CF6R 5H1YA 1XP8A 4LY6A 4PANA 5D3MB 2IYUA 3FYHA 1G7CA 2GA8A 1VHTA 2WJJA 2WKPA 2ZETA 1XZPA 2ZI5A 3ASZA 3IUYA 3QEOA 3ONWA 2J1LA 5GVRA 4AK9A 2OLKA 1SXJB 3QENA 3AVQA 2F55A 4XVUA 1YR8A 2N46A 1X6VA 4B74A 1NBMD 3B85A 4Q19A 1NJGA 1A82A 2UVQA 5SZIA 2ZYTX 1NNEA 1DAIA 2PLRA 2XSZD 1KDRA 3FGNA 1YZNA 2CLCX 4RKEA 2I1VB 3W6PA 2B7CA 2QQEA 1J8MF 3K1JA 3UXMA 4PHGA 2C8VA 3PEUA 2W6JA 3NG1A 4M1KA 3O8BA 2ZE8A 2HDNB 3BFVA 3DOFA 1SXJC 1CR0A 3TKLA 2IYTA 3A4NA 3CPEA 1E79D 2V7QD 4YONB 4UNRA 3EIEA 1DVRA 4IFEA 3LW7A 3B7GA 2ZJZA 4JKYA 1RRPA 2ZREA 1G5PA 4IXNA 3DEFA 3WP0A 1JI0A 3F3YA 3LO5A 2G83A 4DB4A 3WYAA 1E2FA 4MRRA 4C0JA 5KTYA 3VKHA 3WY9A 1Z0AA 4OK3A 3THYA 2NZJA 1D9ZA 2WOOA 1XEXB 1E6CA 1AGRA 2CL7X 1VG1A 3EA0A 3QKTA 2BEKA 3KQHA 1GAJA 1ZM3A 1M8PA 1U98A 2CJWA 3AP3A 3BWDD 3U6BA 1Q21A 3EX7C 3W5JA 1XRJA 1Q22A 1HQCA 2ZRGA 2AK2A 6Q21A 1XD9A 2FSFA 3K0SA 1KZGB 4XWAA 3ZD7A 2EW1A 2Q9BA 2ZYUX 2N42A 3K0FB 4A82A 2ZSDA 1IN7A 2IUUA 3V4RA 4US0R 3OE7A 2XAUA 2FZLA 1IJEA 3A37A 3KZ1E 2YYZA 1Q1EA 2KSQA 1U0HC 3ZH9B 2C04A 4XOIA 3GJ5A 4C7OB 1JECA 1XMJA 4L4UA 1G41A 3BBPA 3LH5A 4UXIA 4UNNA 3REGA 2WWIA 1YR9A 2HJVA 4JLAA 1DAGA 1W36D 1TNDA 2J0VA 4GP7A 4Q1EA 4QBGB 4AY2A 1W0JD 4IXMA 4Q4AA 1F2TA 3QEJA 1NY5A 1S9DA 4DCTA 4C0LA 1NVVR 1XEWX 4TLBA 1OH6A 1W48A 1KSJA 5M04A 1RJ9B 3N70A 2ZTSA 4MKFA 4PTLA 5J40A 4FMDB 4B35A 1E2MA 2GDJA 3THWA 1N0WA 1G3IA 3IIMA 1XXHA 1M1YE 4JS0A 3L0SA 2IS1A 3NBXX 2NO6A 1IQPA 2GESA 2GJ8A 4KHZA 1TU4A 3EARA 3PUXA 1Q1QA 2ZJ5A 4MDFA 5K8LA 4R9UC 1NG9A 4KU4A 2R2AA 4Q7LA 4MUAA 3RVBA 1D2EA 1R5NA 5FTLA 2YINC 4PO9A 2X77A 2Q3MA 1A4RA 4E03A 2I4IA 2QNRA 3GEIA 1W36C 1D2MA 3ZZTA 2W2XA 4DSTA 5AWFC 3X1XA 1ESNA 5H8WA 1ZBDA 4I99A 3QKSB 1OB5A 1Z2AA 2F1JA 2KE5A 4JSYA 2OE2A 4EKDA 3CPJB 5JZVA 1L2TA 1H8HD 4URYR 5GJCA 1T8UA 1UKVY 2AKYA 3OAAA 3A4MA 3CRMA 1F2UA 2G9NA 1YRAA 1MOZA 3L8ZA 1E94E 4O0MA 1JAHA 1W2GA 3GFTA 4NYIQ 5J4HA 3VKGA 5DGXA 4TT3D 5TV2A 2OESA 2PCJA 4KXFB 4HUTA 2QBYA 2IF0A 2QT0A 4FWIB 1DPFA 5FBRB 2GXUA 4KFRA 3TK1A 2WAYA 5FUWA 4QJ3A 2V1UA 1NF3A 3VX4A 1RRGA 2HYIC 2QAGA 5CK5A 3J81k 2WJHA 2WJVA 4LBYA 2Q9AA 4OQFA 1KNQA 3EAQA 4C0QC 3CNNA 3LQQA 2NZ8A 4Q4HB 3UANA 3DZ8A 4FINA 1CU1A 2BWJA 1N5LA 2RGNC 4ILEA 4MYCA 3T5GA 2PX0A 5C4MA 2RKOA 1IY0A 1KAOA 2NO9A 2Z4SA 5JRJA 5FI1B 1OJLA 2PZEA 1ZMXA 4CF7A 3GLGB 2YC4C 3LDAA 5GJWC 4HZIA 2AXNA 4MYTA 1D8TA 1LVGA 4PHTA 3QKRA 5CLQA 4EAQA 4GSYA 1W4AA 1TAGA 2VTKA 2KI5A 4C0AC 1Z0IA 2F6RA 4IVPA 2D74A 1XWIA 1OKKD 4AYWA 3I72A 2JAQA 1P61B 4JIMA 1G5RA 2BKEA 1BO6A 5EXXA 2KBFA 3X1YA 3QUSA 3AVTA 4QJ5A 3UKDA 3HR7A 3ZIAD 3WP1B 2VL7A 2B8TA 3CR7A 3TUJC 2J87A 2FGJA 4IOLA 1JQLB 4RZ2A 721PA 1ANKA 2YZ2A 1OFUX 1XTKA 1KSFX 2A5FA 2QMOA 4AWXA 1CXZA 1E1QD 1OYWA 1FW6A 1N6PA 2HEIA 2HXSA 1XTQA 2AXPA 2ZEJA 4PZLA 1VCMA 3F8TA 3LVRE 4N3NA 4JYBA 5L8VA 3CW2A 4RJLA 1Z29A 2R9VA 1D9XA 1Z8FA 3X2SA 4D26A 1P9NA 2RGDA 1G7SA 4JLNA 4TL8A 2WWYA 1US8A 1Z22A 5F2EA 1G8YA 1N6NA 4BLQA 2Q3FA 1NLYA 1X86B 4QGFA 1KI1A 4TTRA 2R6FA 5E7MA 5KO2A 1KK2A 2GRJA 2WV9A 1OT3A 1ZUHA 3LXXA 3MUFA 3NBZC 4HDOB 3Q8XB 3OEED 4F93B 5L3QB 2ZU0C 2BCGY 3FMFA 2FEOA 4KYIB 2F43A 2P2LA 4GNKA 4BLTA 4ZDKA 3BGWA 3GLIA 4XWOA 4TZ0A 5TMPA 2P3SA 5G41A 2RHDA 3DO6A 2GCPA 1KK3A 3BFKA 2ZIAA 4HSEA 2ZRLA 2GHIA 4DLYA 5AUOB 1NVXQ 4MYUA 2ZRIA 2EQBA 1K5GA 3NC1C 2ZM5A 3P32A 2GCOB 1ZAKA 5GADl 5DO9A 4B76A 3GCGA 5UKDA 2AX4A 2JDID 1SGWA 4P4SB 4BLPA 4Q18A 1BIFA 2ANBA 3L0OA 2IW3A 3FTQA 4TQAA 4O25A 3H86A 3IO5A 3C7KA 1T3SA 3NEJA 4I4LA 3G0HA 1KMHB 5TB5A 2N1BA 4A0GA 4LHVA 2BJWA 1IAQA 4M8NE 2A30A 2ZR9A 3CPHA 2ZRKA 2FGKA 2AHOA 3NDBB 2IYWA 2PL3A 4ZDWA 1Z0KA 1TU3A 5B2ZA 1E4VA 4BFXA 3NEYA 4ZDIA 4LHYA 1GRQA 1N3BA 2REOA 4E07A 3WMEA 4JYCA 2F1HA 4F91B 1KNXA 3Q72A 1EFUA 1E2NA 1SVKA 3RWOA 3TAHA 5FTJA 3WMGA 4NE2A 3E1SA 4WBSA 5F9FA 2ZSBA 1SVMA 1YZKA 1AQYA 4XVQA 3UPUA 4I81A 1SVOA 3ZQ6A 4P4UA 2VLIA 2V54A 1D5CA 3T1TA 4AD8A 5AJXA 3ZVRA 1Q44A 4UXHA 2KJQA 3A4LA 4MRPA 3WMFA 4DVGA 1G7RA 1LV7A 5G53C 2C98A 1FP6A 3PIRA 1ZYUA 3B9PA 4L15A 2FEMA 1OXVA 3D3QA 4DLWA 1A7JA 1OFHA 4TSFA 3P26A 4BGDA 1N6RA 1R0ZA 1TX4B 4BLRA 3SYNA 1FX0A 2CE7A 1G3RA 1OB2A 2R6GA 5HKKD 3ZQJA 3DHWC 4D0LB 5FL7D 1JNYA 2VP0A 2JLWA 5KYKA 3C16C 3K0CC 3DVLA 5AK0A 4MRSA 4JLMA 2V3CC 2IF2A 1XD8A 2OSBA 3ZYCA 3AKDA 2JLVA 4LI0A 4U5XA 1N0UA 1KSGA 1QZXA 2A5DA 1II8A 4KITB 4XH9B 2BIFA 4DKXA 1CJVC 4Q9LA 4D2IA 4D82A 5KSOA 1FQJA 4CGZA 2CCKA 3K70D 4DCUA 2HUPA 3CM0A 4JSTA 4JKIA 3OEHD 3NVAA 1WP9A 2FFHA 3AV0B 2XB2A 1C9KA 3UIEA 5JBQA 2FSHA 2ATVA 2WOJA 3VAAA 1UBGA 4UXJA 4DLUA 1XMVA 4EJSB 1NKTA 1V43A 1E2JA 2H16A 2CK3D 3QY0A 2GF0A 1RYFA 3QPWA 1QG4A 4CEIA 2ZR7A 3AP2A 3C15C 4ZIRB 2OLJA 5TVKA 1JALA 3Q3JB 1SHZA 4XWKA 1II9A 1WDTA 1J7KA 3ETLA 3B1WA 1C1YA 3U60B 4QBIA 1FMJA 4JLJA 4D0NA 1W7AA 2A5YB 2VSXA 2Z5FA 3TUIC 5E7IA 4ESVA 1Z08A 3CX8A 1MH1A 1TUEA 1M7GA 4NYJQ 1E9RA 3R7WB 4NCIA 1VYUA 4P31A 3SOPA 2DBYA 5L3RA 3ZVNA 1N25A 1S2MA 1JBKA 5DE3A 4LPKA 1QHNA 1RVDA 1CF4A 4LBWA 1AKEA 2P65A 3GFOA 2GZAA 221PA 2QMEA 1LS6A 1OIXA 2MMCA 2IBMA 1GL9B 1AM4D 1NBME 3UMFA 1E32A 1Q1ZA 1W0KD 2EWWA 1G8FA 1R0YA 3IGFA 5AJZA 4PC3A 4CYMA 1C4OA 2MSCB 2BHRA 2HLDA 3I8SA 2RCNA 2XITA 2PJRA 3R8CA 1NSTA 4FD2A 1PVOA 3KUCA 2JJ8A 3ZDQA 2C78A 1EWRA 3IEVA 2YKGA 2Z6VA 4OHYA 3T1QA 4QHTA 4TL9A 4Q4JB 4CZ2A 1TTTA 3PJRA 1BS1A 1E2PA 2OT3B 4NCJA 3SFZA 2GEVA 2P67A 4HB2A 1RW4A 4ZV4A 1NN3A 4U7DA 4V0LA 2WWHA 3LNCA 1AJEA 4M9XA 3KX2A 1TPZA 4P32A 3SQXA 4QGGA 2ZU6A 4IJMA 3CF2A 1UBFA 3NBYC 2C2HA 1J70A 1OXTA 4BZQA 3W6NA 4IVQA 4KFSA 1W47A 4DDVA 5BN3A 3KFXA 5KDOA 1HYQA 1BMFD 4X8LA 3SJCA 1S8FA 2QL6A 3T1OA 2WMOB 5AUNB 3G82C 5DI3A 5FBLB 4PC1A 4WZ6A 1KHTA 1MV5A 5BXQC 3SU8A 1KK0A 2ZRAA 1EK0A 3CWZA 4QBHA 1ZM2A 3SYLA 4Q02A 2C9OA 3FKQA 3GJ3A 2CVFA 4W9MC 2MSDB 1EG7A 1KIMA 4R2HA 2WM9B 2IT1A 1AK2A 1E2HA 3H1TA 2FA9A 1DAFA 3NWJA 2ZJ2A 2W2TA 2YJTD 3CRVA 4LHXA 3BH0A 4Q5IA 2O8EA 4G5SA 5FUYA 5CDFE 1MABA 1Z2CA 3VMFA 4A92A 3L8YA 4D0GA 4AKHA 1VG0B 3I1FA 1KOFA 2F9LA 1YKSA 2PJZA 3PUVA 3QF4B 5JLJA 2CMKA 4BLOA 3AVUA 1DO0A 2WPDD 3MG9A 4L9WA 3EPHA 2JA1A 1IY1A 3IKJA 2HV8A 2EYUA 1MO3A 1E1RA 2DWOA 3KUDA 1VIAA 3RRMA 1NG1A 2W0SA 2EU8A 5ELXA 1BYUA 4HLCA 2J3EA 1XPUA 4EFLA 3IIKA 4C9BA 4BUJA 4URUR 1CS4C 1KO4A 1PUIA 4MRVA 3MJRA 1OW3B 1E2LA 1XMIA 1O87A 5JCZA 4BE7B 1S0UA 3QBVA 4LWZA 4F7WA 2QP3A 2ZE6A 3IEUA 1WXQA 1NVWQ 3AKYA 3U2QA 1W49A 4XD7A 1O3YA 1XZQA 4PPQA 1GTVA 4LBVA 1E0AA 4LV5B 1CTQA 1JR3D 4YMWA 1OH7A 1HY3A 3ZGXA 1R5BA 5CITA 3WYFA 3CIOA 4M1TA 2E9SA 2ZR0A 5J4LA 3DOEA 2H92A 1BKDR 2WWFA 4B3XA 5JI3E 1MT0A 2BEJA 4LJYA 2A78A 3MSXA 4YXWA 2J9RA 4V0MA 1U0LA 3SE0A 3U4QB 4Z1MD 2B21A 3MWJA 2FDCA 2XZPA 4Q7MB 1PUJA 3OHMA 3ADBA 4H9GA 1LTQA 4QM7A 4LV8B 2QGZA 2WVJA 1IJFA 5JSZB 1T4GA 3I32A 2J7KA 3RSLA 4DBLC 3MRSA 4P33A 1R8SA 2BM1A 4OHWA 2JCSA 5EP1A 1KO8A 2EYQA 2J41A 2RGBA 3KJEA 3TJZA 2EVWX 3CUEF 5C4GB 2CXXA 3RRNA 2W6ID 2DFLA 1R7RA 2GBLA 5L3VA 2XGJA 1P2TA 4G5GA 3QQ5A 4RY2A 1XD2B 4C0BA 3B1VA 5DHAA 2LWIA 4AKGA 1IOZA 3KKOA 1P6XA 3VNUA 3H4MA 2QSZA 3EC2A 2H5EA 3ASYA 2QQ0A 3GJ4A 3SC3A 3OIVA 1PV4A 3Q5DA 5FPHA 2BJVA 4FWTA 1UFQA 2GNOA 1NL3A 1G8HA 3U61B 3VHXA 3SJBA 3BH7A 5CYOA 3KFVA 2QEQA 4V0KA 3KQKA 2JJ1D 2TMKA 2DPXA 2QY9A 2DFKB 2C5LA 3THXA 2GEUA 3HWSA 5DHFA 3ZD6A 2JIZA 3KJHA 1G6OA 1U94A 3IIJA 1UKYA 1F5NA 4A8JC 4O2LA 2PEZA 3QXSA 4IDOA 4ZDJA 4PZYA 2P5SA 2Q0HA 3SBDA 1W5TA 3AEZA 1FNMA 2ZI3A 1UBEA 3C41J 1ZNWA 1BOFA 3SQWA 1PZNA 4PAMA 4Q9HA 1IM2A 1S96A 3OESA 4IDHA 1IN6A 2PZFA 4UNPA 3SN6A 4LC1A 2FWRA 5FFMA 4LSGA 3IDQA 1GSIA 2ZRMA 4LJ4A 1JPNA 2NIPA 1OF1A 3DMNA 4Q4LA 4R98A 4EFMA 4QOSA 3QSYA 4JL5A 1NIPA 5JJIA 1OYYA 2W6JD 4U00A 5CJPA 3VQTA 4QM6A 4F92B 1G21E 1FZQA 2IYLD 4RSGA 4KCGA 4LHWA 3CBQA 4R71A 3NIBA 1GNQA 1SKQA 3QPUA 4CIDA 4QKQA 4IDPA 1KO5A 4BPBA 2ZJ8A 3K0EA 3GJ8A 4ZKEA 2VHTA 5D3MA 1AKYA 1ZCAA 1JJVA 2IYYA 2FPLA 2BDTA 4L5BA 2IYSA 1KZ7B 3T61A 4FN5A 2ZANA 5BW8A 3GP8A 1SXJA 1R0XA 1TQDA 1U2RA 1P9WA 4RD0A 1H65A 4IDQA 3TW8B 3TH5A 4E22A 4Z54A 2FFAA 4KI0A 2OILA 5HPYB 5BYJA 2AN9A 5CJ2A 3O8RA 2FMXA 2JLUA 1NY6A 5FOVA 5B64A 1D2NA 621PA 2E1RA 3AF1A 2YWFA 1DOAA 1XFAA 3EZ9A 3OE7D 2FN4A 5CIWA 1AS2A 1T5LA 1NBMA 2CJWB 2AKAB 4DLVA 2HCJB 1NVVQ 2ZI4A 4C4PA 4JZKA 4IOJA 4MRNA 4OHXA 2IYRA 1N2CE 2WHXA 5DSZA 1CR2A
chains in the Genus database with same CATH superfamily
3SC2A 2OAP1 4LWOA 1YB5A 3BIOA 1TW3A 4OJNA 4N5MA 5BUCA 1GL7A 1J33A 3L0IB 3OM1A 1ZIXA 5J2UB 3PC3A 4FQ7A 2WAMA 1WZCA 1O94C 1ZD3A 1PR3A 3GFRA 3UV3A 3IKTA 5EJGA 4PLVA 4TTVA 1L4HA 3E18A 1JRLA 1X7ZA 2AC2A 2JAWA 4FJ1A 4Z0PA 1MIHA 3VBEA 1GUZA 3GYBA 3PRYA 3C6BA 5CB4A 2IY7A 2ST1A 4M60A 4R5HA 2IIBA 3NTXA 3FI0A 4CQNA 3WAKA 3ANNA 5DKFA 1OE0A 3AUUA 121PA 3B3QA 3HJRA 4AG5A 4E09A 3P1JA 1GCOA 1HT0A 5JSFA 1N78A 5IKXA 1OFIA 1G59A 3S5UA 3BB1A 4Z4QA 2H7YA 2CKMA 1SB8A 4PE5B 3OZUA 4IH9A 5ES3A 5HP4A 3GZ4A 5HUHA 1DX9A 4JWKA 5IS2A 3D5TA 3NJ8A 4RGYA 5K3FA 2H0AA 4YMTA 4IMIB 1NUTA 1PQWA 1CVIA 2BSAA 2C59A 2PIDA 2ZYAA 3GT0A 1CLUA 1TEHA 2GJAA 5D01A 5NLLA 4QWWA 3O9VA 4DN6A 4B34A 1SKAA 5F77A 3PQ3A 4NPCA 3TFOA 3IUJA 3LWNA 1PEDA 1L5HA 4YT5A 3HSKA 1ARZA 1DUVG 2YWHA 3LOUA 9ABPA 4NJMA 5LZ9A 1FUUA 2DVMA 3E3AA 4GVXA 1CUFA 2VJKA 1QHEA 4OXQA 5CM9C 3T3OA 1YJAA 5GOZA 1TF5A 4RE5A 4DA9A 1BS9A 1Q12A 1T34A 3HEBA 1HFJA 2VVTA 3Q2OA 4JLOA 4MUYA 5DGCA 3KB1A 3A4TA 4G1CA 5ICSA 1C9MA 3E82A 2ACVA 3GLHE 1P17A 1IZYA 1QH8B 4MPJA 3GT3A 5H68A 1XTJA 4TKUA 1FMCA 3SEZA 4CEHB 5AI6A 4L6AA 3FPHA 2ZYRA 5CLLA 5U4XA 1FSGA 1U3FA 1DADA 5LDGA 3KELA 4EI7A 1KRXA 1QRDA 3AHFA 5G3YA 2RAPA 3PLRA 5T64A 2Z4TA 1A9PA 3IVXA 3TQFA 3DE1X 5JARA 4M7PA 2RKBA 3KVRA 4I9FA 4ZI2A 1CY8A 2XVAA 4NCXA 4Y2GA 1G8AA 4KVFA 5CHYA 3RBZA 3SBXA 3H9GA 5KNBH 3GL9A 3LDUA 1IIBA 1KO1A 3D6HA 1H2AS 4NCHA 5KU1A 4OQNA 3UHJA 1D7AA 1XMSA 5FIUA 4AJIA 1B93A 1I3MA 3DB2A 3L7DA 1BW9A 5C81A 1SHLA 4HDMB 4UVDA 2WIBA 1FYWA 3DBRB 4DY6A 3VU3A 1D1SA 1Q14A 3TDNA 1RE0A 5FLEX 3T3PB 4CLOB 2GPNA 2ZZKA 2OXCA 4DIFA 1YFLA 2WQ7A 4M9QA 1PNVA 1UDAA 2IOHA 2PGAA 5COQA 1WUHS 4M0PA 3TAXA 1DAHA 1LPMA 2A5GA 5EUBA 5GVSA 4M0LA 1LUAA 2GN1A 4W8OA 4WEOA 1MRSA 1TUIA 1J8FA 3B9QA 4Z1OA 1RD4A 1CHNA 2QR2A 4BNDA 2DUMA 1RCFA 1BWSA 5ELMA 1NLMA 1P6UA 4JBIA 5JHHB 1JEEA 2AHRA 3FZYA 1E0SA 3LP6A 4ZQFA 2CE2X 3FD8A 3VSCA 2AQIA 3LVBA 1D0VA 4PZ0A 2NQ2C 4M1ZA 2PFGA 1EVJA 1F6WA 3FYTA 2E4VA 1NBAA 1OZHA 3F2IA 3V00A 4Y6SA 4JOQA 4M1OA 5FCDA 3S5JA 5CBPA 4M9RA 4GOJA 3ONVA 3ZLJA 4GR4A 2ZBFA 3K0BA 1K27A 1RAFA 4MGHA 2G1KA 4L4ZA 5ERXA 1NI5A 1VL6A 3B1XA 4I36A 1Z12A 1ZK4A 2QIPA 3FNRA 4EJFA 2C5SA 3PX3A 4V1CA 1W59A 5IAOA 4HAYA 2WYOA 4WEQA 3DP9A 4BGEA 1JU9A 1LJUA 1Z4NA 4GC5A 4US2R 4WTOA 2PUGA 3FNIA 3E2MA 4DM7A 5HJEA 1E63A 1Z2NX 1HTWA 3MWEB 1PR9A 2CJPA 5EWJB 2J9ZB 4NK4A 1Q1BA 4L7QA 3EODA 3ZGOA 3VMMA 2H1CA 2D06A 2ZE5A 2VHQA 3F7MA 1P4HA 4BRZA 1KYXA 4EGQA 4F8EA 4ZTZB 3AESA 2HXGA 4GF5A 1HWYA 3QEKA 5EVCA 5TQ0A 1PZHA 3SG0A 4MGZR 3TIVA 3NT2A 3ZEAA 3SZOA 3OTQA 2A9KA 1NQOA 4QOEA 2XKAA 2WTUA 1G3UA 1YWGO 4G4SP 3RANA 3TI9A 3ZZMA 4F11A 5EEHA 4YT2A 1JYSA 5L3SB 4Q9IA 4DWOA 3CR8A 2RHRA 1CUSA 3LT5A 1HSZA 4E5SA 1MVLA 3QEMB 3MCUA 4TXHA 3EXFA 2Y0BA 4UHCA 4LOAA 4YUVA 4NHEA 3LZCA 3CISA 4X1KA 3RREA 4KUHA 3OFKA 4XCVA 4F72A 4MWGA 4XIGS 1ZZGA 3MAJA 3UYKA 4FCWA 3PC8A 2EP5A 1T5OA 1EQUA 3OFND 1XLVA 2CZGA 4R0VA 3CSDA 2GGSA 4HH4A 4DLTA 2QORA 5DI9A 2XJ9A 3QY9A 1OCEA 1BD3A 1XA4A 1T3TA 3DZDA 1VSVA 2CEKA 2RGAA 2VPWA 3H6KA 1H6CA 3MS7A 4RAOA 2CBGA 1TMOA 1Z7EA 5JEEA 1LI4A 4DS3A 1PTJC 3HUTA 1U02A 3M6XA 1Y5RA 3KCQA 4Q00A 3NV9A 1NW8A 2HQBA 1OHHD 3SMQA 1M75A 4ZWNA 2C7GA 3WAGA 4XQEA 3JQ8A 3BORA 1DZIA 3L7LA 4Q47A 1FDTA 1QH0A 4XASA 4WCVA 2FMTA 2IEZA 4C7BA 1U81A 5F3WB 3UMRA 1V8OA 1EQ2A 2D4AA 1HLGA 3EH2A 3R3ZA 3WRWA 2VPXA 3OQIA 4JI1B 4B71A 4L0QA 4CQMA 4ALKA 3PJGA 3E9QA 2B82A 3BXZA 5F9MA 3U7EB 2C2ZA 2E89A 1PWZA 1Z2OX 3WWZA 2ZZNA 4ZO4A 4DA7A 3M33A 3V34A 3BL8A 2PSSA 1A0OA 4OU4A 2IOFK 2ZJ7A 4WCDA 4GYJA 4KLZA 1BH2A 1VG8A 2B1RA 4HWOA 3QNUA 1U1GA 4QELA 1EX7A 4NU8X 1LY1A 4OFZA 2G1UA 1EP3B 3PJDA 1BEEA 1O95C 4AG3A 4BTLA 2HCBA 4E5NA 1O2DA 5BWCA 1SZDA 4Q1CA 2H2GA 2H9AA 1HUQA 4MWSA 1XWWA 1I9CA 1P74A 3GD7A 3H11B 3IVAA 4N7BA 3UICA 4YUYA 5AVWA 2JIPA 4FOLA 4N0MA 3P71T 4MS4B 2Z98A 3PA6A 5ES4B 3U7GA 2RBEA 2W2VA 4BV8A 4MPRA 1FS6A 3FW1A 3DMTC 5B6JA 4H16A 5E9JA 5A3JA 4KOAA 3KOUA 2BFFB 3VH1A 3FJOA 1DKUA 2ZRPA 3MF4A 4FNMA 3W9YA 4AZ3A 1PFWA 4CEJB 3GZJA 5K6AA 5EJFA 5IT4A 1W75A 4K05A 3I6BA 4EPRA 1MIOB 2CYCA 3K0AB 3ZKWA 1HL7A 1A2OA 3A1CA 4P0QB 1WV0A 1WB4A 4TLMB 1B8VA 3GFSA 2DQSA 3AF2A 4M1WA 4BO2A 4EDHA 5H4GA 3NBUA 3F6RA 2OKGA 4JLVA 1FVHA 2QGFA 1MQ8B 4LGMA 5IDYA 2GZ1A 2ZG6A 4A16A 5K9ZA 5KTMA 1QGZA 1ATZA 1DAOA 2ZCVA 3QVSA 4HI0E 3ANXA 3HE3A 2JCXA 3CONA 4PQFA 6PFKA 1DOHA 1XZKA 1R1DA 4Q4DA 2UXDB 1P9OA 1ORVA 2P6PA 4K8OA 2UVPB 4BNVA 1ZH2A 4G4SO 5AJYA 3WYBA 4EHFA 1HX7A 1M1NB 2V9CA 1A50B 1II8B 2BF4A 2ZP1A 4KQ1A 4HUQB 4MARA 3KDSE 1RFLA 1BN6A 2OCLA 3TW0A 3WIEA 1PJAA 4D9FA 3ROFA 5JPDA 1X94A 3MGKA 3D6MA 4KFCA 4IJ6A 3ZU6A 2R44A 4NCBA 1P62B 4ZOLA 2GFIA 4TLEA 4HTAA 1QRAA 1M1YA 3QLVA 3AV3A 1R88A 3A25A 4PCVA 1JHRA 2VQ6A 2Y71A 3PNYA 5KINB 1G18A 2N75A 2B7BA 2WFAA 1TJPB 1OQAA 3V2GA 2YH2A 4BLUA 4EB6B 3PDCA 4JBWA 2WBLC 1GITA 1W5FA 4I4TB 1DKNA 1S2NA 3DC7A 4QGBA 5KB3A 1PGPA 3GDGA 3K09C 3K70B 4R69A 4GX2A 1UINA 2WAAA 1MAAA 3AKCA 4Y9UA 4F3YA 1J5XA 1FDRA 4JUBA 1YKGA 4C6HA 2HHHB 1C7JA 1N2JA 4GX1A 3IPYA 4P35A 1LRJA 2QUHA 4ZHQF 3SNHA 4YCAA 5EA2A 2G0NA 2Y99A 4FM9A 4HYQA 1CY1A 3JQAB 3X44A 2BTQA 4MXDA 3W06A 2XD9A 1T8TA 2E0IA 3HVRA 4ASUA 2XUPA 1OBHA 3CNLA 3E5HA 3E5RA 2BLLA 3UPDA 2VP3A 4DYDA 2GD2A 1THGA 4HDKB 1I0LA 2CFCA 3PKZA 1ULHA 2H4FA 3T06B 4D4LA 2O0HA 2B1GA 4B0PA 5A62A 4XD2A 5LU9A 5A5GA 4L5CA 3P0EA 3SVTA 1C14A 4JP3A 3OT5A 5BSMA 2ZYSA 4AZ0A 4LZLA 3JCZA 1O1YA 5KJEA 4P82A 2QZ4A 4H7HA 4QDKA 4CI0B 4PFQA 3UY4A 4IGKA 5EJMA 2PZLA 3C7CB 1Z5OA 1J90A 1YZ3A 2CFIA 2HLDD 3GRPA 3M6AA 4KNVA 4LVCA 3KTAA 4E70A 2PXXA 4O0LA 5KNDA 1FCJA 4XGNA 2P7IA 4MP8A 1NP6A 3M1IA 4JYMA 1U2DA 4G3XA 3EVDA 4J07A 4JJAA 3UHPA 1NUSA 4WNYA 3A0UA 3HVHA 5BUQA 4I9UA 2AKEA 2AV6A 5EP2A 4IS3A 1FFYA 1UJNA 2VTEA 4XZ3A 1FS5A 1XZDA 4DWWA 3Q6IA 4TQ9A 4JV5B 4CMEC 4JU9A 2NYAA 3R7WA 2BAGA 3P2IA 4IJKA 3L7BA 2X5OA 4O4LB 5I7FA 4FYHA 1WXDA 3HWRA 4FVTA 1WEHA 5A5DA 1KVTA 1QO7A 1QSGA 5JXJA 2FMHA 4EZEA 1QZUA 3GA7A 3U39A 3W9SA 1IXYA 1UKZA 3NXKA 4M49A 3KLMX 3ONNA 1GUAA 3ENWA 2VP9A 3UG6A 1A4IA 3AVPA 2V4UA 1K7YA 1E99A 1L7AA 1X70A 2ADMA 2VP6A 1P3Y1 5FADA 2I3ZA 3F5FA 4G5QA 5BO5A 3A10A 4TVKA 4YRQA 1DE0A 2CL0X 3PPIA 1DT3A 4DFDA 2IYXA 4XA8A 2IXFA 1ZO8A 2QSYA 2ZAOA 2VJQA 4U6SA 1P77A 2A9OA 4REOA 3EF0A 2AMLA 3ZLBA 4FDLA 5E3HA 1E6LA 1B3RA 1LNSA 1QONA 1YZLA 1GEEA 1XMOB 1Z39A 2ZVDA 1LBTA 3DTVD 3UJAA 2F59A 4DG5A 3I62A 1GG2A 5P8WA 4BNTA 1VZ2A 3RHTA 3IKMB 1F60A 3LCCA 2A84A 2QD2A 1KEVA 4KQFA 4M89A 3KIPA 4N54A 1QE3A 3NRCA 4L8WB 1U9ZA 3EVCA 3CRW1 4FCCA 3U4CA 1N33B 5ESWA 2NUTB 3K9CA 1EWTA 3PWSA 3ON5A 4XUGB 1E1RD 2JLRA 3ZHYA 3UXYA 5BR4A 4A0HA 3WGLA 5CDHA 3QPDA 1RYHA 3QVVA 4CDGA 3NTRA 4Q7JB 3CMMA 3W90A 3QVMA 1KH1A 4GGMX 3ADDA 2WZQA 3A1UA 4FHEA 5AW3A 4PZCA 1L8LA 1O89A 2C4UA 2O4UX 2Q2VA 2V9ZA 3SJZA 3ICEA 2HCFA 1GR0A 4MW4A 4EHIA 5CD1A 1WF6A 3Q5EA 4FFRA 4BO5A 2XEXA 5J5AA 2H1FA 3AB8A 1QK5A 1ADGA 2XOKA 3KLPX 3ORFA 3I9FA 1OLUA 4CCSA 3OZWA 1VPTA 3GMIA 1L7RA 2WHQA 1UPBA 2VS1A 3MGGA 3PUIA 2UV8A 4K28A 2R8YA 1C30B 3EC7A 4Y1EA 1KAEA 2JLQA 3AERA 4C76A 2FMKA 4EB3A 4XGIA 2JH3A 5G4KB 3HB9A 1RRVA 2G77B 3OZRA 4JDUA 3TLYA 4BV3A 1RBMA 1MO2A 1Y9DA 1YCDA 3L93A 3SHTA 4AFNA 5AM2A 1G1AA 5C8YB 5HZGA 3C8MA 4QUHA 1MPXA 4IV8A 1RI3A 1PKEA 1VMEA 3LCJA 3ZV3A 1XQWA 2RGGA 1RJEA 2JASA 4BGVA 5EFOA 1WBDA 3V8EA 4UFPA 2G6TA 4FBLA 5THQA 4QYTA 2DKNA 2HU5A 2I6XA 3BWEA 5E8RA 5JNTA 1UWKA 3MAAC 2VSOA 3QV1A 1J2TA 2IWHA 4ACBA 4EGSA 4AC9A 1UT8A 1QWSA 1AUQA 4Z9AA 3RUFA 3VH2A 1NE2A 3HI4A 4RV5A 1Z6GA 4TTSA 4F9FA 3TWOA 4F97A 5I7WA 4AJKA 2XYRA 2FK8A 3H9BA 2J9FB 2FPMA 2C2BA 2HJWA 4MR7A 1ISGA 2EZTA 2GLUA 4INAA 2Z43A 4I6EA 4RHCA 3UAYA 3W5IA 1KRHA 1THTA 1AN9A 1FJHA 1GUFA 2FR8A 3QA3E 5DNAA 1A96A 1II0A 3WADA 3UMVA 1KJ8A 2W00A 4ND4A 3D8BA 1Y8ZA 4IHJF 1BJRE 1ULUA 3L8FA 2AEMA 1E1KA 2PX2A 4IOMA 4MWOA 3RVRA 2V97A 4D9BA 2NO0A 3IUNA 1QCCA 3OFSA 4ZVUA 3T7CA 1PT9A 1PN3A 1X1QA 5ALFA 4JXXA 2Y05A 3D4PA 2CHVA 2QTTA 2YOHA 4ERXA 3MTGA 4GM4A 3HO6A 4TWIA 4RPGA 4DZTA 2X6QA 2BI4A 3CG4A 2YN4A 3NUZA 4N76A 2ZBQA 1N2IA 2B4KA 5JFOA 1AMUA 1CS0A 2EZ9A 3MTBA 4OTZA 3COJA 4J0IA 1ZOSA 2ZRHA 5BV7A 4ZVSA 2Q5LA 3AL3A 3URKA 2EX0A 1XBTA 2P6NA 1ZD9A 2CLIB 2DBZA 3A7EA 3LWZA 4K3VA 4MUFA 3HB7A 4YJ3F 2EWMA 4B2PA 2ETXA 2IHKA 5DCYA 1I4TD 3WXMA 1NN1A 4A6XA 5LZ2A 2XCTB 2VRBA 1GRVA 2QRVA 1QP7A 5FBQB 1N9GB 5KYGA 4EG1A 2ON6A 4ZEWA 2MR5A 2WYVA 1PS0A 3KEFA 4NBWA 2BC9A 4H31A 1YE3A 3BDVA 2XI4A 1YCGA 2V4ZA 5AP9A 4NZYA 1P4JA 1RKBA 3E7PA 4FGSA 3OLXA 3W5VA 4CPDA 1MW8X 3C3BA 1YI8A 3B89A 4AO6A 1E69A 5JAUA 4M88A 1R64A 2B0CA 2JGJA 4HGZA 1DO2A 5CPBA 4X61A 4AKTA 3I2GA 2DB3A 3R9XA 2WJIA 4G8DA 4WZBB 1USGA 2HU8A 4GKAA 5GOTA 1SOVA 5GGXA 2BI8A 5DK4A 3BUSA 4K9QA 1Y37A 1EM8B 2CY0A 5FRDA 3U1TA 3OH8A 3U3ZA 3UEOA 3H2YA 2BE7A 1A9OA 2CNWA 2RFLA 4C4TA 1JHXA 1N34B 1UMDA 3W2IA 3SZMA 5LD2B 5J58A 4N18A 3H0CA 2JVKA 4G37A 1KMMA 2DH5A 2I2XB 1ZMOA 3C5CA 4MWDA 5HF6A 1MCZA 1ICEA 2C3OA 2GRAA 2DR3A 3AUAA 4ZVTA 4ZCQA 4C0WA 1WBBA 4KFUA 2OVBA 1D04A 2IXEA 1TQ8A 3KE8A 3CO0S 4LZWA 2HLNA 1KORA 2AG5A 2QY6A 2ZR8A 4N03A 2AD5A 5H16A 1VA5A 3HU5A 4LTNA 4QGAA 1VJ5A 4JN6B 3B7WA 2FZWA 2MYNA 4PC3A 4ZODA 3JASA 3WTBA 5K8VA 3RC3A 4PNHA 1SXJD 4BDTA 1D4FA 4A8TA 1QTRA 2VDRB 4OA8A 4WN9A 4D3XA 3H18A 5IT5A 2B92A 3W6UA 2B30A 3BMOB 2I3DA 1MO4A 1EDBA 2BOVA 3DM9B 1CVLA 4R2WA 4Y2HA 4EA8A 5FJJA 2BHTA 2PZGA 1CQJB 3DZIA 3EXG2 2PMDA 1JAIA 3HJFA 5A0TA 3OIGA 4CFYA 3DKVA 1SKYE 4E4TA 4AQ7A 1H5UA 2CWWA 2CF6A 4G1VA 3TECE 3GPCA 1R8XA 2XCOA 3V3TA 3ZY6A 4G5OA 2B4RO 4CCWA 5T41A 1OVMA 4WX2B 5ECGC 2G5PA 1Q17A 2GXQA 5IM4A 1RLMA 4GYWA 1PDWA 3D3KA 1T2VA 3HHPA 3GUCA 2ZVJA 1AHPA 2UU9B 2ZIWB 4D56A 4DUYB 1SC1A 3KR2A 4FDTA 2W6QA 5AKEA 3RRJA 1R6BX 3JYQA 2NM0A 3ZU4A 1VTKA 4JSRA 4EARA 5JAHA 2IS6A 2B5VA 4K6GA 2C4WA 1NJFA 1QP4A 1QRTA 2DERA 1G4HA 3R3YA 3OHPA 4LWPA 4UOEA 1OR8A 3ETDA 2WTNA 3B1YA 4N0EA 4U02A 1UF9A 3DD1A 4US1R 1JR6A 4YLEA 3SC4A 3AY6A 4G63A 1X7HA 4GOND 2XE8A 4DLLA 2BGWA 4BBPA 1FVXA 1GWNA 5SZHB 1KOLA 1PL7A 3FOZA 3FB1A 1NVDA 3A0RB 3D2AA 3TKYA 2QA5A 2V7QA 4QDJA 1JIXA 2QP9X 3KJXA 2C2GA 1QGED 2W11A 2WJAA 4Q66C 3AIOA 4FJ0A 1AMOA 3OD5A 4TMXA 1NVTA 1U1FA 3VNSA 4EB8A 1VLMA 2VP5A 4NDZA 2GN2A 2YQ4A 3IP1A 5KYUB 2VK1A 3CWQA 5AKHA 4BVJA 2IPLA 1JIUA 3E9EA 4DW8A 5AW1A 1DMSA 3PEEA 3DFMA 2CXRA 5K3FB 4ZC1A 5JLAA 3MTAA 1MVNA 3BSFA 3L8CA 3DDOA 4BFZA 13PKA 2D0PB 4BLSA 1G8MA 3I30X 3JS5A 3C39A 1LFDB 3DZCA 2OCPA 1EFTA 1U3TA 1Z4LA 2QTGA 4O33A 1A69A 1EUDA 4MYDA 1PEAA 2WAOA 3WV5A 1XXHB 3U44A 5C8VA 3QP9A 3EUFA 2GAJA 3V4SA 2IXGA 2HKIA 4GS5A 2VBFA 5D5HA 3EG9B 1YU9A 2FMFA 3IOBA 3B13B 2XZTA 3DWEX 1K6MA 1ORWA 2FZ5A 2ZRNA 4Y1FA 4BFVA 5AVQA 1REQA 1R0CA 2JFHA 4HDRA 1AHHA 2YR0A 3B6EA 4NOLA 3LYHA 3RSSA 3IV9A 2V1XA 1H3FA 1WSAA 4PS0A 1DEXA 1XZLA 5DYYA 2NXWA 4ZAFA 1RHUA 4FYJA 3SFTA 1V16A 2JKVA 3C48A 3DCYA 2YX1A 5AI9A 3FYSA 1KI6A 2RGUA 3IUPA 5FNVA 3RS4A 3I4LA 4CM6A 4HAZA 4E4RA 2ORED 2WSLA 4NFLA 4D9EA 1ABBA 2PE5A 2FZ4A 3BJZA 2W43A 4MNTA 1T6YA 1HQYE 1UK8A 1GAQA 5DVZA 3QWIA 2GAFA 2B20A 3QELA 1K5DA 4KLAA 3KZCA 5FOSA 4ZRDA 3O4FA 2QTHA 1ISSA 1X1RA 2PGNA 4M36A 4E33A 3VGJA 3AR4A 4JLWA 1GQYA 1K5HA 2QPTA 5FBHA 4D25A 2H00A 2O7QA 4J8PA 5DNCA 3DMFA 1GZSA 3EUEA 5AJVB 1J2YA 2P41A 3C4QA 3KJNA 1I36A 4DT1A 4ZAGA 4YCCA 1O96A 2ZJ6A 3I01M 5HIKA 4N49A 1Y48E 5CM2Z 2O3UA 1E3WA 2DHRA 1XA0A 3IPRA 4MUXA 4B75A 3RYCB 2C7RA 4GRDA 4EMTA 1N6OA 3GRCA 2BEUA 1S3IA 4O4IA 4BNFA 3TQRA 1SCJA 1V95A 3M1YA 1KAMA 3ONFA 4WFIA 3QXHA 1ADCA 1ZRHA 3KT3A 2BGUA 1ZXXA 4QSMA 2MYUA 2QTWB 4M9SA 4L5AA 4NU5A 4IIBA 4TKZA 3TVTA 3ECCA 2AF4C 3QWBA 3RS5A 3G6WA 1KK1A 2PAFA 1EG2A 4C78A 4DA0A 1NT2A 5FBVB 1VE1A 2IS2A 1P45A 5B36A 4IO1A 3V2UA 4HNTA 1RVV1 2PZMA 1E9DA 2RBGA 4XRRA 2VDWA 1NUHA 3KLOA 2IZOA 3EGVA 5CA1A 4J0HA 3G8AA 1SHTX 1YJ5A 1GFSA 3BL5A 3ITDA 1H8HA 1YZTA 4V2UA 4Z2YA 3PR1A 1OH8A 4FBGA 2Q3DA 5I9IA 3G5AA 3PYXA 5CK4A 5HXAA 2F3RA 3FYUC 1T5TA 4YP9A 1XZHA 4ENUA 3AHGA 1D0IA 1KA9H 2H18A 3OC0A 1XK7A 4HQRA 1HDGO 1CBUA 2OG2A 2EL9A 3HMKA 3VOBA 4B45A 4E2FA 3CF4A 1QFZA 1QLWA 2AQHA 2M1XA 2Q1SA 4ZRMA 5AK6A 1TVMA 1OXMA 1WUJS 1EA5A 2XWBF 3G5UA 4B43A 3PUJA 4ZTBA 1EESA 4PO8A 3JATA 5DCWA 2B3DA 1KI2A 1ZD1A 1XR3A 2NQ8A 3H1GA 2NNWB 2X76A 2GYUA 4H4EA 4EY7A 1WOYA 5I48A 1H8EA 4WBNA 1RXIA 3BA6A 5P21A 1Q77A 3QI7A 3ZW9A 4YROA 5ABPA 3GB9A 1G4AE 1VL0A 4WKNA 5FOTA 2ISQA 1Q0PA 5TQ0B 1R9NA 4D0RA 4WVFA 1YAJA 2VUTA 4CLRB 3QYJA 1EMDA 4I66A 1T1JA 2L18A 1M6WA 3MPUA 1MO5A 3BWMA 4JH0A 4RFSA 3N28A 5JRZA 4KEAA 3RRZA 1TCBA 3COSA 4TQUS 5ICEA 5EJ8A 5AHOA 4BZPA 4EBBA 3AXTA 5EQTA 3CH4B 3R7LA 1JBQA 1US8B 2ZVPX 5LCXA 2OHJA 3E70C 3O1LA 3L0YA 1HM5A 3CVWA 1ZGCA 3LGXA 4G1MB 4AYTA 2QYTA 2ONZA 3JQDA 4B6QA 5BNWA 4OJTA 2LCIA 3CZ5A 2IDJA 3JVDA 2E5WA 1GPMA 3NM5A 1A8PA 3I83A 4LJSA 3RADC 4XYBA 3SNKA 3W5SA 2A4KA 4O2AF 1B6GA 1E6WA 2DY1A 5EYPB 3IDAA 2VF2A 3C14C 2GK6A 3A6LA 1QHIA 5IJXA 4I1PA 1CZUA 1ZK3A 4ZVRA 3SX0A 4KOEC 1ZGBA 2Q8NA 4HZUA 4MOWA 4DCNA 5KHAA 4BAGA 1CUEA 3EZ2A 4LE1A 4OI4A 4I46A 2Q4OA 1QX4A 1RQPA 4O1MA 5ALYA 4EYQA 1CDEA 1IEXA 2OCYC 3I6QA 3U7FB 2W58A 4PRKA 4Q9NA 3IH5A 3ODGA 2RGEA 4KLCA 5G0SA 2DU8A 2XUAA 4ZJZA 2AD1A 1BDJA 1SOWA 3OY7A 3SYRA 2N47A 4IRUB 1OAAA 3R5XA 1IG0A 4HDNA 4LJ5A 4KSCA 4CQMB 3EG5A 3CFYA 3ZXXA 5IWCA 4TMZA 1MDFA 3FIUA 2HK8A 1GQFA 1XDUA 2GPTA 2J07A 2VXYA 3C3PA 3EB9A 3PFIA 1IVSA 1THZA 1AUPA 1AGPA 3I04A 3KOYA 3V46A 3ACCA 4BS9A 5AMXA 2DFNA 3AW8A 4UQOA 1TZ2A 3FAZA 1P1CA 3L41A 4L0MA 2AC7A 4H7DA 1LBEA 5C3MA 2CXNA 4ITRC 5EXTA 1GPJA 3E22A 1X74A 1HTBA 2WI8A 1N9KA 5AXAA 4M1SA 3H2KA 1DX6A 3D4OA 3UOGA 3VNAA 2AN3A 1ZUNA 4GQBA 4M98A 5ILQA 1TYDE 4RQTA 4H1HA 4MHOA 1XMQB 3IAXA 4QGSA 4B7UA 4R7ZA 1NYQA 1QGUA 3FWNA 4RWZA 3UMGA 1K3FA 4MS1A 2X0DA 3U3XA 1Y8QA 1SC6A 4JMLA 4R0NA 2NAFA 3LD9A 1NW9B 3MWFA 1GZ7A 3A58B 2OZVA 5IDXA 3EC1A 1G9XA 1VBKA 4RO0A 3SYKA 2QM7A 1T15A 2W2OA 4ZALA 5A06A 1PVVA 3WMXA 2R7NA 4IIGA 4TRMA 4UU7A 2AK3A 1IY9A 2XKBA 3NONA 3ZKWB 3E05A 3B1ZA 3AUJB 1QBGA 3BRCA 1J39A 5ILOA 1TGYA 3N8NA 1MENA 4JBXA 4J94A 1KVUA 2QSJA 5CLGA 2CBXA 1T36A 4Z9FA 5H9WA 1SQ5A 2RMKA 5GZ3A 4N6OA 1O8CA 1N1MA 3F1KA 4Q3KA 3SZGA 1Q11A 2REXB 3LLSA 5B58T 3MS2A 1YR1A 1PLKA 2E85A 1NBOA 1L7MA 4M1EA 2CLHB 2VSNA 1OAKA 2B34A 4UBLA 3AXSA 4V39A 3U3DA 1ONSA 4AXXA 4P80A 2I6FA 5JSYA 5C7IO 1CUUA 4MV8A 2NXEA 4KSBA 2ODEA 4D3ZA 1NMYA 1RYZA 3O4JA 3G9UA 3QK7A 4OIFA 5B1IA 5EQDA 5FORA 4G9GA 1WHSB 1YC2A 3DE5X 4ZOLB 5FTNA 4BRSA 5TIIA 1FFAA 1M1YB 3E8XA 3M2TA 4C4AA 1Z15A 5EJEA 2GBIA 2J48A 2O6LA 3R7WB 5KYTA 4QFDA 4XM0A 3FDZB 4QLOA 2OUIA 3OOYA 4KQEA 1TKAA 4RORA 2PLNA 2EBWA 2XB8A 2Q1XA 2ZXFA 1GFIA 1K98A 4KTVE 2K4MA 4QO7A 4XYGA 5T8KA 3EY9A 2IUYA 2I8AA 5M3BA 3HVUA 4BVBA 5KQMA 3QFTA 5GMOA 3WIVA 3GLHA 1IK4A 2G0AA 4R7TA 4ZQGA 1SBTA 3UGKA 4UHHA 1Z5NA 4HV4A 4EGCB 2A0KA 4IYRA 3RK4A 4YJDA 2ZAIA 3L1UA 2ZJAA 2VQDA 4M83A 5JADA 1UM8A 3Q1LA 3QA9A 3AHHA 3SR4A 4LS3A 5ALXA 4CBVA 1Z8DA 5E9AA 3WB0A 1WS6A 5D00A 4P4GA 2V74B 5DTRA 2QXUA 4DC9A 5C0OE 4OI2A 2EZUA 3DYBA 2BTQB 1UK7A 1TDJA 1O6CA 2POQX 1BKSB 3DBOB 1BHJA 1NVBA 4EJ6A 2W2LD 2FOLA 3UA3A 2YFQA 4FDAA 4UM9D 1MX9A 2ACKA 3RWMB 3FMGA 5I5EA 2ASEA 1X8KA 1P6QA 1ULTA 2UYGA 5F1OA 4M6WA 4RVNA 3QUAA 3SEQA 3UB2A 3WGHA 2GNAA 2IZ6A 5KNLA 3CR3C 4J91A 4FDMA 5HF5A 1GCAA 1QP0A 2OB2A 3G23A 1R6TA 4BQSA 1VRCA 3FKSA 4B46A 5MGBA 2P1ZA 2R96A 2MSEB 3VH4A 1S2DA 2C5AA 2GM5A 1VJRA 3EDMA 2V7GA 3KTAB 3R20A 3ZS9A 3RIHA 2VHCA 2ODBA 5CMLA 4BVLA 2CK3A 1PYDA 2ZWOA 4X00A 4EW1A 1SWVA 3KHUA 2V45A 4EJSC 1DXOA 4HDSB 4X20B 2QVGA 4W8GA 2OBFA 2V59A 4YRMA 4H60A 4HNRA 1XB2A 3WYGA 3GQBA 3HC7A 4IRXA 2PRYA 3H7AA 1YZFA 1ZOPA 4B3CA 3HFJA 3B36A 5TJHA 1N2SA 4LXTA 1I94B 1H9CA 5EQFA 4FBMA 1U1EA 3OJWA 1IU9A 4BX9A 4CIXA 4C21A 1L5ZA 3NNDA 4LY0A 3ESYA 1Z0DA 1XN1A 2J3HA 4BNIA 2D54A 1E3EA 1ZCBA 1CLEA 2JHCA 3PX7A 4FMCB 3ZU5A 3TAUA 3K31A 1R5JA 3EQZA 3HCRA 3VZRA 2AJBA 4NBSA 1XZEA 4EFNA 3B8HA 4ENPA 4BMDA 4UJ3A 5B30A 5FDFA 4OFWA 2CNBA 2Q5JA 4JROA 3ZIUA 1VJGA 4R2XA 3M3PA 1U1IA 3DOJA 2BW0A 3K9GA 4LXGA 1K2VN 3UT5A 4PSKA 3ESBA 1QCDA 1OI3A 4X84A 5K03A 5K0GA 1LBHA 3UKJA 3PGA1 2P79A 1MD9A 4JNKA 4MR9B 5FI5A 5JBIA 2UUBB 2FWIA 4U7FA 1L9XA 1QDLB 1WB6A 1I5EA 5EKDA 2GF9A 4LVOA 1UR5A 4M0MA 1QO0D 3TM4A 2A9JA 1W0KA 2ZUSA 4TYWA 1OBCA 3KR0A 4YDHB 3B3GA 3D3WB 5M34A 1E5XA 1O97C 1SVIA 5EE1A 4MKIA 2OV6A 1CK4A 4YWHA 1KAHA 3PNQA 1OXBB 2OB1A 4RTKA 2PUBA 3TJRA 4PVDA 3DTVB 4V0RA 3RNOA 1NKSA 3OP4A 2A9RA 2Q2OA 3BH6A 2DHEA 3LYUA 5DX1A 1H2FA 5BV8A 1U0JA 3QXXA 3D59A 4HBGA 1ZD8A 5TGZA 4HPWA 2RHHA 1AB6A 1JKIA 3EZ6A 4KNYA 1VCHA 4BO9A 3GDFA 3U3MA 3O9ZA 3ZI4A 1XUOA 1X87A 2ZROA 1ZM7A 1WW3A 1EPUA 3U7RA 2EBFX 1L3CA 2PRJA 3CCFA 5C8DA 3GMSA 2FQQA 2PS9A 2Z8YA 1AUVA 1NMZA 1XEAA 5EIAA 1GU1A 2DCUA 1YIAA 2QROA 2VDKB 2L42A 3A3KA 1AZWA 3ABQB 2JJ2D 3COWA 3KXKA 4GSLA 4PNZA 3U4MA 4RIGA 3AY7A 2EGGA 1JX6A 3C1UA 3BK7A 4Z8YA 3AERB 4JK3A 1FU4A 3EZGA 4WZAB 4M9CA 4Y1RB 1LS1A 2PA3A 3IV6A 4OHVA 3OX4A 5DM1A 4JZYA 5FR1A 5TC4A 2WTEA 4ZKDA 1KI7A 3ZDAA 1YIOA 3DDSA 1EI9A 3FNFA 2HCTA 2X9GA 2AOXA 4WDRA 1UZUA 5LPNA 5EPEA 3RFCA 1A1VA 5LC1A 4TUYA 5L6LB 2QN7A 1PNQA 4GC9A 5IPFA 4OHKA 4P08A 2P6MA 4DJ5X 1E3MA 1SU4A 4B7XA 3O8NA 4UHJA 4OK5A 4RX1A 2ZSFA 5EIHA 1SCUA 5EINA 1FVFA 2J0QA 2QMYA 2VYVA 3PG5A 3BC1A 3DV0A 3U3OA 4A1OA 421PA 4AMBA 3WLNA 3WMRA 4KFTA 3WA6A 5EZ5A 2XTJA 4OUDA 3TCXB 1TAUA 1OX4B 1EM6A 2CMDA 2DWQA 2HBYA 3CCCA 3TLXA 2Q99A 2WPDA 2QVBA 1SMKA 2WM8A 3EA5A 2JLZA 4MR7B 3C6KA 4N3BA 4CG3A 5K20A 5K8CA 3EDYA 2AI2A 4N9WA 4TMWA 5MN4A 1AS3A 3WGJA 2FWPA 2QJWA 2H4JA 2V03A 5H3LA 1H3EA 4D41A 1DGQA 1ETUA 1FLVA 1GG8A 2CVZA 2FUEA 3H5TA 3VUEA 4R1PA 5HR5A 1WZEA 5ARBA 4B4OA 2Q4RA 3DHEA 4JUAA 5JMPA 2WSSD 3IHLA 1LPAB 1CRQA 4FMBB 2X0EA 1EEXB 5DMHA 4H18A 1E92A 4B17A 3AYZB 1BFKA 1Y7TA 2O1WA 3N8HA 1R00A 1Z7GA 4LZZA 1U2PA 5DMXA 1WMSA 1L1EA 3QUCA 3VO9A 5JH7F 1NVEA 2MWMA 1EK6A 2DPGA 2CMHA 2DJIA 2ZIXB 4RJJA 5EIBD 2OEPA 1R0WA 2NN3C 2PMCA 2HSDA 4ALIA 4UZEA 1V9CA 1NW6A 3EWNA 4UBJA 4XM1A 3UWKA 4M0UA 2HMVA 4BL5A 4TZ6A 4XTCS 3USCS 2OAQ1 2CDNA 4GXRA 1Y80A 5IBCA 5KVSA 2H06A 4HF7A 1MR3F 2RAVA 2V6IA 1GP2A 3HJGA 1N5KA 4TX1A