4LHWA

Crystal structure of rab8 in its active gppnhp-bound form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
171
structure length
171
Chain Sequence
DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-8A
total genus 58
structure length 171
sequence length 171
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhwA00
1Q1ZA 1JPNA 2VP9A 2A3RA 5D3MA 1ZD8A 1OKKD 4PSKA 3WHKA 4AYXA 2BJVA 5EP3A 4LHXA 4Q4AA 3NG1A 4A8JA 2W2XA 4FMDF 3GJ8A 3AVVA 3CLVA 4M4SA 1GFIA 1HV8A 1DADA 2HEIA 3CF6R 4GNKA 1TNDA 1JB1A 1E9RA 4DCTA 1ODFA 3VR5A 3UMSA 2JLUA 4HUQB 2AFIE 4PO1A 4GPTA 3VX3A 3U61B 1E9EA 2SHKA 2ZUDA 4OQNA 2IEZA 1EFCA 1KGDA 1US8A 2GWHA 1ZUNB 4DUGD 1E1RD 4TQUS 3UG7A 4B3DA 1ZC3A 3L0SA 1KDPA 3L0PA 4QHTA 3QKRA 1Q1EA 4FMCB 1DAFA 3U4QA 2O8CB 3X1ZA 1GZSA 2ZU0C 2EFGA 1SZPA 2CHGA 2CVFA 3KQKA 4CEIB 2IHBA 5E7JA 4GRAA 3VR6A 3KZ1E 4GP7A 3VR1A 4NYIR 4DIEA 3SBDA 5FOVA 4MRPA 1VTKA 3OIVA 221PA 4TMZA 3PJRA 2IWRA 4XSHA 2DFTA 5FUWA 2MMGA 1D6JA 1EWRA 2YINC 5GJCA 3GLFA 2GBLA 2HCJB 1II8A 4NMMA 3MD0A 2GJAA 3CRQA 3KJEA 2YOHA 3P4XA 4HYYA 2VP4A 3KB2A 4HLQB 3CX7A 1E79A 3KUCA 2ONKA 4DSUA 1EGAA 2MMCA 3Q8XB 5JCPA 2VSOA 4XVRA 4XSGA 4BLRA 2ZJ2A 1KI6A 3QG5A 4HB3A 2XTZA 2O8FB 1CF4A 2ZI3A 4IXMA 4E09A 4D26A 3IIKA 1VHTA 3CW2A 3WHLA 2G6BA 1MABA 4NCIA 2ODEA 1W48A 4MYHA 4YLGA 5J4VA 1TX4B 4K46A 4FINA 1ZNYA 1GNRA 4EJSC 1AS2A 2ZITA 2HYIC 1J2JA 4Q4HA 2P0EA 1OH6A 4M1KA 3BXZA 5EZ6B 3FWYA 5AR1A 4DSOA 2HJVA 2IK8A 3K0SA 4TMWA 1OPXA 1R8QA 4HAUA 4AY2A 1E1QA 4RSGA 1ZM2A 4IDPA 4JLKA 3VMFA 3PEWA 3JZMA 2GXUA 1W0KD 1OV4A 4NBSA 1NNEA 2NO6A 3RSLA 1E2EA 4LJ4A 421PA 2ZIAA 3FFAA 2NO9A 4XOIA 4DCNA 2J87A 3E1SA 1RRPA 2PZGA 4HUQA 3SNHA 3T35A 3S1AB 4QXAA 1XEWY 2CCGA 4TLAA 2ZI6A 2HLDD 3AV0B 5ELXA 2R44A 1FNNA 5H8WA 4IDHA 1DPFA 3BS4A 5JRJA 1KMQA 1X8LA 3X1DA 5BXQC 4C3ZA 4QGHA 1L4YA 2OZEA 3EZ7A 1Q20A 4TMVA 1GITA 1QG4A 2CL7X 4QM6A 2ZI4A 3QF4B 4I81A 5LB4A 4CYMA 4XVQA 3EASA 2OLJA 3PQCA 1F3OA 2NMVA 4QGAA 1K5DA 1KKLA 1ZIOA 1TUIA 3HU3A 3ZQJA 2OSBA 2WZQA 1B0UA 4JLNA 4DLSA 4IVPA 2IXGA 1N25A 1I2MA 2Q9BA 1Z6GA 2H17A 4FCWA 4X8LA 1Z5ZA 1GIAA 3K9GA 2W83A 4BQSA 1GAJA 3LWNA 3WMFA 2WKRA 1E2NA 5BYKA 1F2TB 1NVUQ 3FHTA 1VDZA 2N1BA 1FQKA 2ZANA 4LV6A 4URYR 3LBNA 3R7WB 3U3KA 3F8TA 3REFA 2QM8A 1NLFA 3BBPA 4BRUA 1IJEA 1VYTA 3U7GA 4Z51A 3ND8A 1GL6A 4CEJA 5DH9A 1EFRA 1KY2A 4QBHA 4NYJQ 5KYKA 1SVLA 2DB3A 1IXRC 4PHGA 1BYIA 4ESVA 4G1UC 4YMUA 4M9ZA 3B7GA 2V1XA 5FR2A 1ONBA 2EVWX 2JLSA 3U44B 3I8SA 1E2KA 4Q1BA 2AWNA 1PJRA 1KJWA 2WKPA 2XZLA 1OXSC 2CXXA 2QTHA 4TLEA 2JIZD 1JR3D 2FWRA 4RKFA 2LCFA 3FMIA 3THXA 1WBBA 4CGZA 5CDFE 1JEEA 3B78A 1SXJB 2DPXA 2X2EA 5F9HA 3SJBA 3EIHA 3V4FA 1W36C 5KNDA 1G8HA 2YYZA 3EZ2A 2OCPA 4WAUA 5H1YA 1RYFA 4BECA 3QKUA 4AK9A 3P26A 3AVOA 1KK1A 3AVPA 4JT4A 1P9RA 4AKGA 1R5NA 2L0XA 1KI9A 2D2FA 1YE8A 2D74A 3RVBA 2ZRPA 3OAAA 5DYGA 3LX5A 4QL3A 1E9BA 3DL0A 4OQLA 3ZQ6A 3O8RA 1AS3A 2W6ID 3T06B 1IN7A 621PA 3KQNA 4AKHA 2ZI5A 3KTAA 4MKHA 1Z0KA 1K6MA 1FOEB 1G64A 4OI4A 3ZH9B 5C2JB 4US1R 4PC6A 5JMTA 2FF7A 2JJ2D 2VP6A 1AIPA 3ZIAA 3BIFA 4EPVA 1OFIA 1S1CA 2B6HA 3SJZA 4YC7A 1NY5A 1RE0A 4IFBA 4ASUA 1I4LD 1UPTA 4TYQA 4QG7A 2G9NA 5KO2A 1GILA 1S4QA 2CDNA 3PG5A 5AUPB 3GLIA 4US2R 2PX0A 4JLBA 4BFZA 2ONJA 2W6JD 4B6EA 4IEIA 4Q1FA 2VH5R 5EE5B 1OFUX 3BOSA 3PUWA 1RFLA 1XEWX 1AGRA 2P6RA 1MO4A 2XGJA 4KYUA 4Q9JA 4F7WA 4C7OA 4ERNA 4C7OB 2DWQA 3AP1A 1XTRA 5B2ZA 1DG1G 2QGZA 1NMZA 2OILA 4ZO4A 5DN6D 3LFUA 5CYPA 2ZQ5A 5DNYB 2AWOA 4Q4HB 1TADA 2A78A 2B7CA 3C41J 4FMDB 4UJ3A 1QVRA 4QFMA 4XWKA 2BKUA 5JSZB 1RRCA 1KO7A 1YQTA 2I3BA 1WQ1R 5A0FA 3VR3A 3NWJA 1E2IA 1NMXA 2OT3B 2QUZA 2ODNA 2ZS8A 2C2HA 1N6OA 1P72A 1Z0AA 1XEFA 4FW9A 4Q1EA 4QBGB 2QTFA 4WA7A 1W44A 3TQFA 3EZFA 3MWYW 4GI7A 2FU5C 2VL7A 4A8JC 2GVDC 2LWIA 3KJIA 4KLZA 5TDHA 1RRGA 4IDNA 2CCJA 4OQXA 3EPJA 4QGGA 3G0HA 4DSNA 1G4UR 4TYYA 3O8DA 5FBVB 4QM7A 1A82A 2Z4SA 4IHQA 1IN6A 4V03A 3U2QA 1ZMXA 1H65A 4RFSA 3U60B 2QSZA 4ZV4A 2J9RA 3AVQA 5IDVA 4HLCA 3QOFA 1OF1A 4URZR 4NYMQ 3GEEA 1Z3IX 2G1KA 3TAHA 2OG2A 4BFWA 2OFOA 5K8IA 2IWHA 4HI0E 2JA1A 2R6AA 4BFSA 2OHFA 2CJWB 4G01B 4Q9HA 3B1VA 3GJ0A 4PO9A 1OFTA 2ZREA 5CIQA 2DCUA 1RVDA 4B6FA 1JXOA 2IHYA 2QRNA 4M1OA 1F2UB 2E9SA 3A1WA 3SYLA 3CBQA 5L3SB 4ZCIA 4UXJA 2GCPA 2KBEA 1M1YE 3UXMA 1HA3A 2J59A 4TSFA 4NKRA 4OK3A 2ZYVX 4UNNA 4GZMA 2ZAOA 5KUTA 5C4MA 3U3RA 3T61A 3QKSA 5BQ5A 2FFHA 3BE4A 4DT1A 1ZD1A 1CEEA 1FTNA 2AN9A 3IIJA 3IHLA 1R0ZA 2FG5A 4AIIA 4LBYA 3RS3A 5JRZA 1TPZA 4NDZA 4LPSA 4HAZA 1IHUA 3BGWA 1U81A 3PEVA 1XPOA 3AKDA 3A1TA 3JVUA 3PR1A 4HB2A 3TUIC 4LJ6A 3U6KA 4CT5A 3P20A 3FTQA 4LRWA 3FGNA 1NJGA 2OBNA 2XEXA 4PQFA 3TBKA 3BH0A 1J99A 2REOA 4DIDA 3IKJA 3TVTA 1G18A 2FV8A 4Q7LA 2WJYA 5GVSA 4EPYA 2NZJA 1XXHE 1SVMA 1PV4A 1P7CA 4PAOA 2ZRGA 4DLXA 1XXHB 1PLJA 1NG1A 3THWA 2ZE7A 4D25A 3MSXA 4U7DA 2HF9A 3GLGB 4AG6A 1ZCBA 2J0SA 3PFIA 5CDFA 1U9IC 4RCYA 1EFRD 2ZJAA 1I4TD 5IT5A 4I99A 2JLXA 1TMKA 1G8PA 1E6CA 2V6IA 1Q3TA 3Q9LA 1CP2A 2WKQA 2F7SA 3HPRA 3EWAA 4OQMA 4PHTA 1ZAKA 4ACBA 4OI2A 4RFVA 2JLRA 2PLFA 4GBMA 4A1FA 1QHHA 4Q66C 3TH5A 1KI3A 4DDTA 1E9CA 1ZM3A 5DI3A 1JQLB 2HXSA 2V1UA 4BEJA 1XTSA 3GFTA 2AD1A 2F6RA 3D8BA 2ZSDA 4JLOA 3VAAA 2D2EA 4DLWA 1W36B 1TF7A 4ZIRA 2VHUA 3MAAC 1S3GA 1XU4A 1U0HC 1XMIA 3BH6A 4FWTA 1UBCA 4DLZA 5SZIA 3G82C 3LNCA 3SC3A 4PPFA 1W5SA 2ZSEA 2VLIA 4P3YA 4OJKA 1XD2B 1SVWA 1ETUA 4MUBA 4PPGA 2ZJBA 2WJVA 3IPXA 1Z28A 3ONWA 3VKWA 3NXSA 1ZM7A 1KO8A 2Z43A 3KQHA 4MKIA 5KHOC 3HP1A 4JVLA 4TTRA 1CULC 4RD2A 5B57C 1M6NA 2J1LA 1CBUA 3CB4A 1R4AA 3GLFB 5BN5A 1Q22A 4EFNA 2VHCA 1O87A 2IYRA 2C8VA 5J47A 3JZAA 1UADA 2OXRA 1U9IA 1GM5A 1T3SA 2ZR7A 1A2KC 2VTKA 3GFPA 4KVGA 3SYNA 1AQUA 4PQYA 3SEAA 3KXLA 3QKRB 5G3ZA 3TE6A 3EIEA 5JJIA 4FCVA 5DN6A 4B34A 4MRRA 3FMPB 1NLZA 4KV9A 4KITB 4QJ4A 2XJ4A 2QT1A 2WWIA 2O8EA 3THYA 3AP3A 2WWXA 2QP3A 1VCOA 2GCNA 1NRJB 2XZOA 1ZRHA 2O0KA 1BIFA 1ZM9A 5JHGB 1OXTA 2C78A 4C4PA 2GKSA 4BLPA 4KXFB 4S35A 4CEJB 3NEYA 1DTSA 1F2TA 1KNXA 1DE0A 1GL7A 2ZVPX 4OI1A 1E99A 3CR7A 2IYWA 3V00A 3AQ4A 2DY1A 4MH0R 1RJ9B 4HUTA 2ZRHA 1T3LA 2XXAB 3V9PA 1BMFA 1KDTA 1Z0IA 5TXGA 2ZM5A 4B74A 1ZYUA 3OHMA 1E9FA 4NH0A 1U99A 3LVQE 4I1VA 4KBFA 1C4OA 2XZPA 3AGQA 2ZI9A 3VNVA 1P9NA 1N6NA 4HB4A 1G291 4A0HA 1K8RA 1D9XA 4DSTA 4OBEA 3PENA 3T5DA 1YHNA 3PITA 4E22A 3VTKA 1E3MA 1E9AA 2ZJ5A 2DFKB 2CMKA 2XTMA 4M9QA 2AK2A 3DVLA 1OLOA 3I5XA 2WAYA 4G5SA 4K8OA 4DEYA 1MT0A 3N2IA 5IF9A 1OW3B 3KJGA 2FSFA 1BS1A 4Q19A 3EPHA 2E1RA 3U3JA 3GP8A 3EWSA 1E1QD 4MRSA 1ZBDA 1X1RA 4TQ9A 2GRJA 3FDIA 4JL6A 1VMAA 5TY0A 3AKEA 4TT3A 1G5PA 2QG6A 2EWWA 3KXIA 3TW8B 2XAUA 3KFXA 1QDEA 2O8DB 2RGXA 2QL6A 3B9PA 4KODA 4A0GA 3FKSD 2GDJA 4OHZA 1UAAA 4M8NE 4FI3C 2JLWA 2RHMA 1KK0A 2KWIA 3W8RA 3UK6A 2ANCA 2Q9CA 4C0SA 5GVRA 3P1JA 1WE2A 1W46A 3QVVA 3A58B 1E94E 2FFBA 4LHVA 1YRAA 2IYVA 3THWB 1QZXA 2W0MA 1E0JA 1T91A 4LBVA 4NL4H 2WJIA 4AYTA 1KI1A 2VP5A 721PA 3NBXX 1S1MA 3CPHA 1S3SA 1KDRA 1OIXA 2AXNA 4B35A 4PHHA 1SHZA 3CPJB 3GEIA 2O8BB 2Q0HA 2YV5A 4HZUB 1IXSB 2EFCB 2WICA 2BV3A 1G7CA 5D3MB 3LW8A 1HQCA 4NCHA 4EPRA 1MABB 4EJSB 2ZVQX 3TR5A 2W00A 1N6PA 5BWMA 1OYWA 3DOEA 3QY0A 1T3HA 2GETA 5EXSA 1VG0B 4PC1A 1XMVA 2ZRDA 3K0FB 1VPLA 4H1UA 2ZRCA 5LDDC 2YHSA 2A5JA 5GJWC 3T15A 3K9LA 4OHWA 1YVDA 2A5YB 1P9WA 3HPQA 5AUOB 4YQFA 1E9SA 2W2TA 4Q00A 2C03A 3IQXA 4Y0AA 1P73A 1KNQA 1LFDB 1D9ZA 5EQTA 3H0KA 4JLPA 4DC9A 5FBWB 3H4MA 4FN5A 3GCGA 3MG9A 1U8AA 4NCNA 4UXIA 1W4AA 4ESHA 4XVUA 5J4YA 3UPUA 3ICEA 3OFND 4BFYA 4BWYA 5B58C 3QF7A 3IO3A 4Q47A 2VYFA 3EC2A 4YDHB 1Y63A 2GZAA 4WZ6A 3LO5A 1US8B 1YZKA 5F9FA 4IOLA 4JLVA 2F43A 3KUDA 3QXJA 2O52A 5M04A 4V02A 3D3QA 2A5GA 1AKYA 1EG7A 3NBZC 1YZLA 1IN8A 1BH2A 1FPMA 1W7AA 1NSTA 3ADBA 1T5IA 1OIWA 1XZPA 3MWJA 1KZGB 2IBMA 4F91B 1PVOA 4B2IA 2C04A 3I1FA 4IOMA 3QPWA 4KAXA 4N3NA 4RJLA 5HZHA 3KL4A 1KIMA 2XOKD 1WXQA 3VU9B 2XB2A 4YXWD 3R8CA 1W4RA 4P33A 3UMFA 1JALA 1G7TA 1G3IA 4QRHA 2BEKA 5GJVC 2V7QA 4A82A 5B64A 2FX3A 2ECKA 3EG5A 4Q9KA 1IY1A 4ZCLA 2X8AA 1G8FA 2VHJA 3CX6A 5FOTA 1ZIPA 2OESA 1L7VC 4NCKA 1HUQA 4AD8A 2RB4A 1AS0A 3AKCA 4HSEA 2YWGA 3RS5A 4EPWA 2FOLA 1IM2A 2LKCA 2NQ2C 3DM9B 2J0QA 3K9NA 5CJ2A 1NL3A 4ZI2A 2GXAA 1TF5A 4HEJA 4TTQA 1LF5A 3ND9A 4OQFA 3R9WA 4GP6A 2D7DA 2RCNA 4JLAA 4KVAA 5FOXA 2BBSA 1N6RA 3QXHA 4BLQA 2G83A 2HT1A 2H57A 1OIVA 4RD3A 4RKEA 3U4QB 1AZSC 5JI3E 2D06A 3RRZA 3BORA 3CH5A 2ANBA 1NVXQ 1QHIA 2FSHA 1XPUA 2R6GA 3AUYA 4WBSA 2JJ2A 2EQBA 1G3MA 4JS0A 1U94A 1R2QA 1Z0FA 4LX0A 2OAP1 1P62B 3PIRA 3WXMA 3LDAA 4IJMA 4TLDA 4UJ5A 3AUXA 4R2HA 4GL2A 3ETLA 1NN0A 3CONA 3AF2A 3WMEA 3CO5A 4EFMA 3QUSA 2OFXA 4OYHA 3FPAA 4FMBB 3PEYA 3OAAD 3TSWA 3NHBA 4URWR 3D7MA 2NIPA 3G5UA 1CRQA 1U2RA 4A2WA 4Q7KA 4RZUA 3GFOA 1WP9A 3U7EB 1F5NA 3KTAB 4POAA 1P3JA 1W47A 1E96A 4UNSA 4GFDA 5FOWA 2AHOA 1QRAA 5FI0B 4YDSA 1QVAA 2NPFA 3BJIC 3W5JA 4TTPA 4WIAA 4Q9IA 5KOYA 3VKGA 2CVHA 4FD2A 3GLIE 2MSDB 5G3YA 2GJ9A 1UBGA 4HATA 4M9SA 1OH5A 2AL7A 2OCBA 3QJYA 5LBIA 3M0EA 2HT6A 2EWVA 4CVNA 2AKYA 2NO1A 2QE7D 3LY5A 4IEEA 3QVUA 2BMEA 2X19A 2HYDA 2PCLA 4II7A 2LKDA 1N5IA 1Q3HA 4J0QA 4QHSA 1N5KA 2F3RA 3C16C 4PZYA 4RD0A 1AKEA 2PT5A 4ARZA 4LJ7A 1XDBA 3WYFA 4RZXA 3ZZUA 1P2VA 2IEYA 1KZ7B 2KBFA 2QI9C 2GJ8A 3CRW1 5CB6A 2ZRBA 4WXPA 4MRNA 3CR8A 1ELOA 4QC2A 2DR3A 3IILA 1UM8A 4UNPA 3CM0A 2F1HA 3WP0A 1GKUB 3EX7C 1DAGA 4OHVA 4L5BA 5DE3A 4MDFA 2IYTA 1VIYA 2PCJA 1Z06A 4IDQA 4A4DA 2WIBA 2CNWD 2IF0A 2JASA 1YKSA 2MSCB 4PZZA 4M1WA 1B23P 1YR9A 2JJ1D 3Q7QA 2BMJA 5LPNA 1WCV1 4C0QC 3OEHA 3U6BA 1XCPA 4HDQB 3UIEA 3DPUA 2E87A 1Z22A 2WPDA 4P4UA 3W6PA 1XPRA 4I4LA 1ESNA 2NO0A 3GLHA 4OJQA 3RS4A 4TLCA 3N70A 3MRSA 3Q5EA 2GXSA 4R2IA 5SZKB 1G7RA 4IFEA 4QBFA 4D81A 4B44A 3QEJA 4OKSA 5AJZA 1Y3AA 4ILEA 3CNOA 3BD9A 1XTJA 1M8PA 3QXXA 2PZFA 2Q3MA 3HU1A 1SXJE 2CBZA 1IN5A 2QSYA 3RS0A 2VP2A 1OT3A 3Q3JB 4KI0A 1E2MA 3B8HA 3REGA 1YZNA 4B32A 3EPKA 5J4HA 5AUQA 2RGNC 3H84A 1JXMA 1Z8FA 2YOFA 1LW7A 2WSMA 5JSZA 1M74A 3MWLA 1OYYA 3GPLA 2C9OA 4XTRA 3W90A 2WIAA 5DIFA 2XOKA 3OE7D 2H18A 2QY9A 2C9YA 2I1VB 3LXXA 4UNRA 1T0HB 1QHXA 4IKEA 4V0OA 1TQ4A 3B1YA 4KO8A 2WSSD 2GNOA 3KKNA 5CK4A 5ANRB 3KKMA 3EC1A 5HE9A 3R9XA 2OM2A 3FVQA 3GJ5A 5EP2A 5FTMA 3B85A 4Q7JB 1JNYA 1EK0A 2IF2A 4DDUA 2R2AA 3LQQA 3PCRB 2FSGA 2JAQA 3L8YA 5LD2C 4IRUB 3NBFA 3PUXA 1Z0JA 3OESA 1XTKA 2ZR9A 1E0SA 2ZRKA 3SQXA 2IYQA 4URXR 3SQWA 3LQRA 3R7WA 5DYIA 4EQ6A 5F2EA 1JECA 1R6BX 4OI0A 3H86A 5C1BA 3MLEA 3AM1A 3RSOA 4ITRC 3FHOA 4LC1A 4L9SA 2JGNA 4DCVA 3T1VA 1LTQA 4HAVA 5FBLB 1OB5A 2RHDA 3AVTA 2ZRMA 4TZ6A 1NN5A 4DLRA 4R9UC 2J7KA 5TMPA 2P3SA 1EFUA 1EXMA 1KOFA 4JBWA 2IS2A 4NHOA 1DOAA 2IXFA 4A6PA 3HYTA 3SOPA 3I8XA 1QBKC 3FB4A 1GSIA 4QGFA 3K0CC 4A15A 3TVDA 1TEVA 2ATVA 3T5GA 1BYUA 1GL9B 2QM7A 2RGNA 3NBYC 2OUKA 1WDTA 5IK2D 5DI3B 4HB0A 2QN6A 4KFTA 3U7FB 2QBYB 1FP7A 4LBZA 3U44A 3AP2A 3PUVA 4Q5IA 2O8CA 4ZDIA 1NY6A 4JJZA 5BN4A 3WYAA 2BHRA 3KXKA 5HKKA 2AR7A 4N0DA 1N5LA 2A7QA 1YRBA 4QBIA 4FMCF 2QP9X 2VF8A 4WZBE 4DZZA 4HDOB 1N3BA 4UQOA 1CS4C 4AURA 2ZE5A 5JHHB 5JJKA 1CJMA 3MMPA 3LD9A 2NPIA 1CKEA 3IUYA 4ZDKA 4GMXA 2IA5A 4NPHA 2ORIA 3FYHA 1XXHA 3QPUA 1EFHA 5EE1A 5IK2A 1DEKA 2VSFA 3J81k 1T8TA 4G3XA 3T34A 1I4DD 2BWJA 3BB1A 3WNBA 1DARA 1EESA 2BJWA 2Y8EA 4DKXA 2AXPA 3NVAA 4MYCA 3C7KA 2YC4C 3C5CA 3QNUA 2VRWA 3R20A 4PC7A 4E5UA 1N5JA 4M1TA 4PSAA 4EKDA 4Z1MD 4LJ8A 3DKVA 1SKYB 1X1SA 4JL5A 4LCBA 4N1AA 1G9XA 3P4YA 2QA5A 1RW4A 5AK0A 1ANKA 4LYHA 1NBMD 1R0YA 1AA9A 5AUNB 4IOJA 2QMEA 1GKYA 4Q02A 1E98A 2ZTSA 3QKSB 4D4MA 3IHWA 4Q4JB 1NBMA 1A5TA 3IGFA 5FPSA 5JEDA 4TMKA 4D0NA 2VQSA 4CW7A 2J7PA 2R9VA 2VEDA 4Q9LA 3BFVA 4B3XA 5KSYA 2PH1A 2UVQA 5DHAA 4LC0A 5JEEA 4V0MA 3IEVA 2OXCA 4TWZA 1E2PA 5EXTA 3ECCA 3MUFA 3A37A 1XMSA 4ON9A 1S0UA 4DUGA 5DO9A 1CJUC 1R0WA 4IVRA 1L4UA 2GEUA 4DB2A 3DHWC 2QPAA 2CHQA 3A4MA 2W6IA 3BWDD 1NLYA 2BCGY 2XITA 4Q1DA 2ZUBA 3PUZA 5KU1A 2ZPTX 2EFHB 4UNQA 1P61B 4B71A 1QG2A 3K09A 1G1MA 1MOZA 2HUPA 2KB0A 3QG1A 3EA0A 4PR0A 5KPDA 4RD1A 1VCMA 5H70A 5FH9A 2G77B 4QNMA 4DJTA 3BFKA 1N6LA 2UZ3A 1D5CA 3TJZA 5C18A 4DB4A 1X3SA 4PSVA 2DFLA 1KTVA 1CR1A 2HDNB 3EIQA 1SQ5A 5J40A 4US0R 1KSGA 4D82A 2C95A 5FPKA 2QRZA 2B21A 2IYYA 4RZ2A 2W58A 2ZUCA 4M1MA 1MV5A 4K81B 1T5LA 1T9HA 3A6PC 2H16A 4NYJR 2GJKA 3ZZTA 4AYWA 2O8FA 3B60A 4I1OA 3LW7A 4MGYR 2ORVA 2FN4A 5KPJA 1JR6A 2QP4A 3K0EA 1NG9A 1OH7A 1DELA 1R10A 2QROA 1XMJA 3QPVA 5EUQB 1M7GA 1NF3A 2IYLD 4KFUA 4U00A 5DHFA 4MQBA 5FPHA 4CEIA 1MO6A 2W6JA 5HPYB 3SFZA 4NYMR 2GCOB 2R65A 5FBQB 4D4JA 3V4RA 1KKMA 1R5OA 4Q48A 4Z8YA 3L82B 4BEBA 1OHHA 2P6NA 2REBA 4CEHA 3KDSE 3T12A 3QSYA 1P75A 3PV0A 1N0UA 1KO5A 3UKDA 2IUUA 1ZM4A 4YONB 4ZIRB 1Z6AA 1T6NA 3EXAA 1CJKC 4C0BA 3K70C 3IBGA 4R98A 3ZD7A 1FX0B 3DMDA 1A1VA 2CL6X 4JBXA 4XWOA 1NN1A 4CF7A 1CU1A 1G6OA 2V4ZA 3CPEA 2ZYWX 4P32A 3TRFA 2XB4A 4JVMA 1VKJA 3QXSA 1COWA 4D4KA 4ZDJA 4A2QA 2WWWA 4MUAA 1HTWA 1SULA 4PZLA 3UG6A 2O8DA 3CRRA 1QHSA 1C1YA 3R8FA 1UKEA 1WRBA 2PMDA 4F38A 1ZW6A 3OIWA 4F4CA 5E95A 4O3MA 4QJ5A 3QBTA 1X86B 3SN6A 5KTYA 2ZSAA 4MGIR 3L0OA 1SHKA 2IS4A 4JLJA 4DVGA 2JLZA 4LYFA 4Q4JA 4MYUA 3B9QA 1GKIA 4ACAA 4F93B 3X1XA 1VYVA 4V0NA 1SXJC 1XRJA 2P67A 3LA6A 3LH5A 2IYSA 2GK7A 3IBYA 1GVNB 2FPKA 1FQJA 3TW4A 3CF0A 3PVSA 2KI5A 1DS6A 1KDOA 2FZLA 3CWQA 4L15A 1IAQA 3AVYA 2AD5A 2GAAA 2X2FA 4HZUA 4O2RA 1Z07A 2JDIA 2GESA 4LK2A 4BRWA 1CXZA 3B1ZA 3C15C 4E03A 1VYUA 3B1XA 1HE1C 2ZS7A 4GMDA 1X8JA 1H8ED 1MRSA 5FTJA 2GAOA 2FGJA 5JCZA 3TUZC 1EFTA 5FL3A 4DHEA 1E2DA 1GRRA 1P60A 2YWFA 4EIWA 2XX3A 3HR8A 1UKZA 1YR8A 4IVQA 3KX2A 3F5FA 3THOA 1J7KA 1FUKA 3OF5A 3RABA 3THYB 1QHHB 5DISB 1EWQA 4P4SB 1NN3A 3RWOA 3UANA 2ZRLA 3WY9A 3UWOA 1AM4D 4JYBA 1XWIA 5KSOA 2MSEB 1GRNA 1N0WA 2D7CA 1OHHD 4A92A 2PJZA 2GTPA 2J0UA 4KSCA 2FMXA 1P5ZB 4MGZR 1HT1E 5JFGA 1V43A 4U02A 1E4VA 1ZNZA 2F1IA 1II9A 3CWZA 3UATA 4NYIQ 4G5RA 5HTKA 4WW0A 1XEXA 2RAPA 5KNCA 2DFNA 1GOTA 3VX4A 4TYNA 3ADCA 1P2TA 5BN3A 1G16A 1YZUA 4M53A 2HV8A 2X77A 2OLKA 1Q44A 2WPDD 3DZDA 1IOZA 4JL8A 2C9CA 2I4IA 3L43A 2G1JA 5CLQA 1CIPA 2R6CA 5EP1A 2ZAMA 3RHFA 1Q1QA 3BH7A 5GADl 1R7RA 3KQUA 1GNQA 1ZUIA 3TR0A 4TLBA 3JVVA 4NU0A 4YMTA 2CNWA 2WOOA 2O5VA 3MFYA 5EE3A 1P2SA 1E2QA 1XD2A 1OFHA 5KDOA 1T4GA 1XNJA 2YC2C 3OIYA 2WJGA 2OBLA 2PEZA 3RC3A 4NCJA 4BE7B 5FOUA 3FKSA 1VCNA 5BYJA 1P2UA 2BOVA 3ZGXA 4Z8XA 1Z47A 3RDPA 1MKYA 4XJXA 1Z29A 1UFQA 1QF9A 3RRYA 3AH8A 4UKDA 2ZSFA 3SFVA 3W34A 3UWKA 1D2NA 1M7HA 1XX6A 3DDCA 1WA5A 2FA9A 3ZVRA 2QTVB 4GT1A 4DWJA 5JJLA 1SKQA 2PJRA 1F2UA 2JJ1A 3SBEA 4A9AA 1KO1A 1N2CE 2WM9B 2ZRNA 2VP0A 1KI8A 3MGCA 2QQ0A 3I73A 1EX7A 1KHTA 3SE0A 1TTTA 2CJWA 1W2HA 3TKLA 1CR2A 1S9DA 1NJFA 4HAYA 5HZKA 5HR5A 1KSHA 3L8ZA 1G8YA 4A6XA 3TLXA 2P2LA 3M6AA 4H1VA 5L8VA 2GF9A 3DO6A 1O3YA 5SZHB 1UBEA 1YR6A 1ZNXA 5A4JA 2ODWA 4W5JA 3NH9A 2JLYA 3RANA 4OK6A 2FPLA 2V9PA 2QORA 4C0KA 1XCMA 5D3QA 1Q12A 1TU4A 1KI7A 2F3TA 3GQBA 3M4YA 4LGMA 1DO2A 4BLOA 2V8OA 3NTUA 4CZ2A 1X6VA 2R62A 2WOJA 4AI6A 3QQ5A 1IONA 4QNRA 4BUJA 1CLUA 3VKHA 1E2LA 2QPTA 1U8YA 5G40A 5JS7A 3CKLA 3LBIA 2WWYA 1CTQA 1E0AA 3Q7PA 1W4CA 3DOFA 3ZDQA 1VG9B 1U98A 1ZU4A 2G3YA 1DG3A 4HAXA 4DT1B 3VU9A 3B5JA 1G19A 1MO3A 3W3ZB 3ZS9A 4CIDA 1HURA 3RLFA 5FOSA 5DLQC 2H92A 2NTYC 3GLHE 1K5GA 5FTNA 4NTZA 4FCTA 3PXGA 5L3RA 3WRXC 1LY1A 5FL7D 2F43B 1WBDA 1S9HA 4DDVA 3VNUA 3M1IA 2TMKA 4DLUA 4JVSB 4XIGS 1XBTA 5EE0A 4IXNA 1KO4A 4S2EA 3GLFE 1E2HA 2A30A 4D80A 2EYQA 3CX8A 4B76A 5L3QB 2IS1A 2FPMA 1Z6TA 4RD6A 1RPZA 1JBKA 2D4HA 3KFVA 4ARZB 4BPBA 2P5TB 4XD7D 4ZKDA 2EFDB 4LWZA 4A8JB 4EPTA 4ZI3A 5G41A 2C5LA 2YNMA 3FMOB 2WJJA 3BAFA 3TMKA 5JWOA 2JJ8A 5KNBA 2IW3A 1OJLA 5FPTA 2BIFA 4MKFA 2G0NA 4BFTA 5DSZA 1IBRA 1G5RA 3I92A 4AG5A 4M1YA 2IL1A 2ASEA 3ASYA 1NIJA 5JS8A 5F98A 4PX9A 1AN0A 4RVCA 3ZYCA 1FNMA 1OXXK 3K53A 2FFAA 3P27A 4MYTA 4G5GA 4RD4A 5TARA 3CRMA 3WP1B 4FWIB 4B3FX 3BC1A 4TMXA 2B8TA 4BASA 4B75A 8OHMA 4JZKA 1YJ5A 4LPKA 4B33A 1NVVR 3B13B 3U7HB 1H8EA 1RYHA 3QEOA 2QMUA 4KFSA 1YU9A 1W0KA 1XD8A 4D0GA 5KSPA 1J70A 2RGAA 2PEYA 1TF2A 3VQTA 1R5BA 2QAGB 4LHYA 4C0JA 1UDXA 5E7MA 2ERXA 1ZC4A 3E5HA 4DBLC 1Z08A 2C77A 4OK5A 1E9DA 1JJVA 2ZSBA 1HEIA 2FEOA 2BBTA 2W2VA 1J8YF 1FX0A 3A4LA 1KAGA 3RYTC 1KMHB 3OE7A 1VG1A 3W8NA 3DZ8A 2QBYA 2IYXA 4NONA 5CK5A 3A1VA 2J0VA 5JZVA 2Q3HA 5J4LA 4B73A 3CZQA 1S96A 2AKAB 4JIMA 2RGGA 4I1SA 1GDDA 1D2EA 2VHTA 3GMTA 1NKTA 2WWFA 1VG8A 2BC9A 1W0JA 1GG2A 3B82A 3DEFA 4U5XA 1FMJA 5LB2A 4LZZA 2GZHA 4WVFA 3O8CA 2RGEA 3HJNA 4GOJA 2PMKA 4B2LA 4Q03A 3TQCA 4TL7A 4JVNA 1M7BA 4F4JA 5JI2E 3BB4A 1YZTA 4KCGA 2RKOA 3RS7A 4EAQA 2NGRA 1DO0A 1KI4A 3BK7A 1Z2CA 2Q21A 1E69A 4N0EA 2NG1A 2P5SA 1KSJA 5CB8A 2PL3A 3ZVMA 1WMSA 4ASUD 2QMOA 4LV8B 5EP4A 4C2TA 4O25A 3AF4A 2OFWA 4R7ZA 5HE8A 1E2FA 2PT7A 1PUJA 2GA8A 3TGPA 1NKSA 4B3GA 2ZETA 3GD7A 4W5WA 5FTLA 1XCGB 1UKYA 1Z83A 3CIOA 4IW3B 1ZUHA 4LSGA 5TB5A 1KJYA 4ZPXA 3LLMA 1OSNA 2YJTD 1LS1A 3D31A 2F1RA 1JR3E 1CR4A 2Q3FA 4LJAA 2ORWA 3AVUA 1E0KA 1GUAA 2N42A 4HLDA 1G3RA 2ZRIA 3IO5A 2AK3A 1DAIA 4KLNA 4JLDA 3OEHD 4HLUA 4PC3A 3AVWA 2ERYA 3IQWA 4P0TA 3W5IA 3RC8A 1LNZA 2JEOA 2YWEA 3BERA 4D2IA 4XTCS 5CM9C 1Z0DA 4P4TA 4DRZA 4AKIA 1E2JA 5AJYA 3SU8A 2VIIA 1HH4A 3CZPA 4IDOA 4CDGA 1DAEA 2ZJ8A 1TUEA 3IIMA 3EW9A 3MWKA 5FBRB 3RS2A 2VF7A 3F0TA 2VA8A 2CHVA 2AX4A 1NMYA 1RRFA 2V7QD 2ZRAA 1PZNA 2OAQ1 1SVIA 3P32A 4FXPA 1AZTA 2BM0A 3ZS8A 1MO5A 4Z54A 5E3HA 4KSBA 4B47A 4M9XA 2ZRFA 4BLSA 1L8QA 4JSYA 3VHLB 4R71A 1DAKA 5C4GB 4TQAA 4F92B 3KJHA 1XJQA 1A7JA 2F9LA 3QBVA 4X8OA 3HYRA 4GZLA 4M2LA 4E07A 2Z5FA 1ZNWA 2B7BA 3WBKA 4Q4AB 4KHZA 1ZP6A 1S2MA 2FH5B 4M0LA 3W9YA 2F1JA 1KK2A 1A4RA 3K0FA 2REXB 5E4FA 4C30A 3SI7A 4IOKA 3AVXA 2WAXA 1XJCA 4PFSA 4LJ5A 3RNLA 1L2TA 3I4LA 6Q21A 2CLCX 4BZPA 3OIUA 1SGWA 1RKBA 1CR0A 2QPOA 4ZCMA 4PO8A 2BDTA 5FPYA 3E2IA 2EU8A 4PAQA 3QXCA 2O8BA 2DWPA 3GJ4A 2IC5A 1G7SA 1ZU5A 1XJ0A 4L16A 3WMGA 4Y0VA 1Z6XA 2GHIA 1W1WA 3A36A 3TUJC 2IXEA 2J7PD 1ZCAA 1OXVA 3GEHA 1IY0A 4HAWA 4B3CA 1DAHA 3W6NA 3H1TA 1KMHA 1YZGA 4WOPA 1NIPA 2WTUA 2ZU6A 3U5ZB 5K8LA 2DWOA 3LV8A 2QQEA 1II0A 2CL0X 2PLRA 1FTSA 1AK2A 1EX6A 4NZYA 4PXAA 3FOZA 2GVZC 4DLTA 5K8UA 1H8HD 2N46A 4M1SA 4M21A 1UEIA 3WNCA 4DLYA 1LVGA 1Z63A 5BW8A 1X8KA 3SHFA 2QNRA 3O8BA 4EFLA 1CRPA 3LAWA 3NDPA 1U90A 3SJAA 2KE5A 5EUMA 3ASZA 4BGDA 5FL7A 5JECA 4JT2A 1W0JD 1NBME 2ZJYA 2RGCA 4JJKA 5DGXA 2BBWA 2I1QA 4ZDWA 1XZQA 3TIFA 3B6EA 1LB1B 2QE7A 2XSZD 3OEED 5KSZA 1BO6A 4MDEA 3EZ9A 4C0LA 1G8GA 3TAUA 4G5OA 1D8TA 2NOAA 4GDFA 5EXPA 2GEVA 4LUCA 1ZJ6A 4URUR 5JBQA 1JJ7A 3X1WA 4F4IA 2J46A 5IHPA 1S8FA 3C4JA 1FL9A 2FE4A 3A4NA 3CH4B 1RC8A 1CJTC 4LOAA 3TSZA 2KSQA 2VHQA 3AB3A 3GJ6A 1Z6YA 1R0XA 1IY2A 2FEMA 2QGNA 2BCJQ 1IJFA 2XXAA 2CEAA 1MRNA 4LHZA 3H2YA 4Q1CA 3RRNA 3ZZ0A 4D0LB 3QI2A 1SVOA 1V5WA 3NH6A 4Q4LA 4Q01A 1A2BA 4DXAA 4LYAA 2YZ2A 3CNLA 4TL9A 2J5XA 2EW1A 1ZD9A 2A9KA 1W5TA 4RCZA 4O2LA 4C2UA 1U8ZA 2CCKA 3TSOA 1G4AE 5CITA 4UXHA 5KDLA 1PLKA 2WMNB 4G0NA 3EARA 3C5HA 2UZIR 4MGKR 5EJEA 4WXRA 4L8GA 3DM5A 4CEHB 1G3UA 1TU3A 1HQYE 3SS8A 4C9BA 3ZVNA 1TQ2A 1NSFA 3VFDA 1LF0A 3N2EA 2C96A 1SXJD 1IXZA 2V54A 2ZE8A 4LI0A 3GJ7A 1GP2A 1JEDA 4CT4B 3OFNA 4DCUA 4LJ9A 3K0AA 1U0JA 2XNSA 4MKGA 2D62A 4DLVA 1G5TA 3IEUA 3QE0A 2IYUA 1N6HA 1UF9A 2Z4RA 5EZ5A 3WYGA 1OH8A 1E1RA 1JPJA 1YR7A 4HZIA 1UJ2A 4HLUC 1E4YA 2ZJZA 2VPPA 1TEXA 3NKVA 1P6XA 2GF0A 1N0VC 5FR1A 4MRVA 4NE2A 4PANA 3OZXA 4JSTA 3HWSA 2GBLC 3X1YA 5FUXA 1W36D 2J3EA 2NZ8A 4LDJA 4QHYA 4LV5B 2R8RA 4EJSA 5CYOA 2ZXUA 3U3OA 2V6JA 4QKQA 2F55A 3QENA 3VR2A 4RZ3A 1RZ3A 4XH9B 5EXXA 4JBYA 5J4KA 1ZVQA 5FI1B 2HLDA 3ADDA 4M22A 3GLHB 2KJQA 1GRQA 2XTNA 1UKVY 2A2ZA 2CE7A 2WV9A 5FUYA 3HDTA 3SDZA 5L3QA 3RRMA 4OHYA 1U0LA 2V3CC 2HJGA 1HE8B 2ZI7A 2C99A 1T0JB 1FP6A 3FFBA 2BMDA 1BOFA 2Z6VA 5J5CA 2K5UA 2GJSA 4P4SA 4EDHA 2UKDA 4QJ3A 3PUYA 4B2PA 3LXRA 3T1TA 2CLSA 1GTVA 4QOSA 3X2SA 3ZJYA 1N6KA 2EYUA 2WWHA 3DKPA 1UEJA 3PEUA 5E7IA 5HCNA 1JAHA 2G88A 2EFEB 4CRWB 2WMOB 5UKDA 4A0RA 5CLLA 1SKYE 2FDCA 1KAOA 2QMHA 4KFRA 2RGDA 4W5HA 2FSIA 4D4LA 2IUSA 5JWRA 2PZEA 3AGPA 4LJYA 2F9MA 2OEPA 4MITA 3T1OA 2CK3D 1F60A 3L0IB 1W2GA 1DAMA 2BVNA 5TVKA 2ZE6A 4PC2A 4RFSB 1XB2A 1H8HA 2Q6TA 2WWGA 4EUNA 2IS6A 2ZJOA 2CK3A 2NO7A 521PA 3SJCA 3SYKA 1TQ6A 1KY3A 4YMVA 4ABYA 1NVWQ 1F48A 2RGBA 3E70C 4A2PA 4BZQA 1DBSA 1Z2AA 1F6BA 4RY2A 4TMTA 3I61A 1SXJA 4TL6A 2WVJA 4PPNA 1IN4A 1HY3A 3I72A 3I3SR 1XEXB 2JLQA 2R6FA 4XD7A 1FMLA 3IPYA 5B30A 4L4UA 2ZRJA 2WHXA 5CJPA 3FE2A 3R9IA 1J8MF 3CNNA 4DDWA 4JKYA 4P31A 5C46F 2FFQA 4GSYA 4XWAA 5AJVB 3WRYC 1Q1BA 4H9GA 4BFVA 3BFXA 1WF3A 3N5CA 3CF2A 1XTQA 2H7VA 1AJEA 2RH5A 1RJ9A 2IYZA 1QHNA 3ZVLA 3RWMB 2Q9AA 3NDBB 3T1QA 5K8TA 3ADKA 3LVRE 3HU2A 4LHWA 3I5YA 4C0HA 2BMFA 4Z1MA 5CM8B 2XSZA 4Q18A 4DEXA 4B43A 2XNDD 4AKEA 2A5FA 5L3SA 2BBOA 2D3WA 2O8EB 2YWHA 1PLLA 2JLVA 3WNDA 3K0CA 2GEDA 2WSSA 4V0KA 1FUUA 2JCSA 2YVUA 4D6PA 2HF8A 2OCYC 3NHAA 2HCBA 2O0HA 5AWFC 1FW6A 4A36A 1G20E 2IT1A 4TT3D 5LD2B 3BRWD 2GCOA 3U3MA 4A0FA 2WBLC 1OB2A 4AC9A 3LBHA 2G0TA 4PQRA 3DMNA 1E2GA 3OEEA 2OE2A 1Q0UA 3Q72A 3W3AA 4OL0A 1XD9A 3Q5DA 1JQJC 2ODBA 3K1JA 2C98A 1D2MA 1HT2E 1COWD 2PX3A 3EA5A 4PPQA 3CUEF 1G6HA 2B92A 2CLDX 4PHFA 4BFXA 5G53C 3A8TA 4URVR 821PA 4WZAE 1M2OB 1Q57A 2GK6A 3K0AB 2YKGA 1RIFA 2HXYA 5A5GA 1WB9A 1E79D 1ESMA 1G41A 2PBRA 3ZIAD 5JLJA 2OV2A 4JMPA 4W7SA 3MCAA 1II8B 1XP8A 1N6IA 1J90A 3A1SA 2XJ9A 1JI0A 2H1LA 4B48A 4DCSA 3ICQB 3NC1C 1JAIA 4EQ6B 2P65A 1OE0A 3THXB 1Q21A 2FZ4A 4TSFD 3WBJA 2O0JA 3CRVA 4TL8A 4L9WA 1NVVQ 3SHWA 1I2DA 1SVSA 2J0UB 1ZINA 1W4BA 4LY6A 2JATA 3L2OB 2W0SA 2A5DA 3KB1A 3K09C 2Z0MA 5SZJA 4HDCA 1OKKA 1JR3A 3FKQA 1E32A 3SR0A 4Q21A 4JLMA 1TQDA 1R8SA 2H8KA 3GJ3A 5DI9A 3GLIB 2ATXA 3W6OA 5JWHA 5P21A 2YOGA 4JKIA 2FNAA 3EPLA 1TAGA 2QU8A 3B1WA 1NI3A 3LX8A 3NIBA 3AKYA 1AQYA 2GXQA 3K70B 2QAGC 3GJXC 5L3VA 3GLGE 5KDDA 3RAPR 1TL7C 1XFAA 4PTLA 1BKDR 4BFUA 3C8UA 2CE2X 2QAGA 1G17A 2QT0A 3KKOA 5EE9A 4LYJA 2BEJA 4C0AC 2OO7A 1XF9A 2AFHE 1KI6B 4TYWA 3NEJA 2QZ4A 2QEQA 2FJUA 3MJHA 4KU4A 3TNFA 1IQPA 2ZYTX 3MJRA 2BKEA 4GOKA 4ZKEA 1GWNA 4KYIB 2OCAA 3KKPA 1UDWA 1OXUA 2OBMA 3O47A 4GOXA 1KSFX 5AJWA 3KQLA 1VHLA 2V55B 3FHCB 1FFHA 3K9HA 2X1VA 2Z83A 3KKQA 2GILA 1MH1A 2QENA 3LLUA 1YZQA 2ZR0A 3I62A 1QHGA 3LRPA 1PUIA 3BB3A 4G5QA 3NC0C 2ZS9A 4X8HA 4W9MC 1G21E 1NP6A 1T8UA 2B8WA 2DHRA 2XNDA 5AJXA 3QKTA 1VCIA 4B3BA 4YMSA 2VBCA 4NP6A 1LS6A 1MR3F 3K70D 3F3YA 4PAMA 4YMWA 2J41A 1AGPA 3EAQA 4AWXA 4TN1A 3AF1A 3S1AA 5FFMA 1KYIA 5FUVA 2DYKA 1QHYA 1KJZA 5GJBA 2FGKA 1W49A 5H68A 3SZRA 4KBGA 3I32A 4TZ0A 4LBWA 1HYQA 5F3WB 3AEZA 4I1UA 4JYCA 3AF0A 2ZROA 3D6TB 2R6DA 3UMRA 3ZLJA 4BLTA 3K8YA 4X8MA 4YXWA 121PA 1KI2A 1VECA 2GZDA 2VO1A 3VR4A 4EPXA 1P4SA 4BZXA 1KK3A 2BM1A 1BMFD 4Q1AA 4V0LA 5HCIA 5IRCD 1LV7A 2QAJA 3VHXA 3GLGA 3TK1A 3HR7A 4O0MA 5TV2A 1GNPA 1DVRA 1FZQA 4FIDA 2DBYA 5CIWA 3FMFA 4Q7MB 4TYPA 2J45A 2ZYUX 2JIZA 3B2EA 3Q85A 1G3QA 1C9KA 5HKKD 1CJVC 2WJHA 3AF3A 4OHXA 2P6UA 3QF4A 4KJZA 1M34E 1UBFA 2IUTA 4V0ME 3IDQA 3EZ6A 3A1UA 1VIAA 5FTKA 2IX3A 2VSXA 2H5EA 1SVKA 1XTIA 2JDID 2ZEJA 2RMKA 3ZD6A 3C14C 4MA4A 3QIAA
chains in the Genus database with same CATH superfamily
4ECEA 1JPNA 1DBRA 5EFZA 5D3MA 1ZD8A 1F6WA 1K9SA 3PHIA 4PSKA 4WK2B 1QS0A 4ML3A 3I58A 3RC1A 5EP3A 1QIFA 3JYNA 3OCVA 3OZBA 3BAZA 4Q4AA 4UM9D 4FMDF 1PWYE 4KR9A 1T1RA 2G07A 4RL6A 5BQFA 3JRNA 3H1GA 2PNFA 2VRNA 3MUEA 1P0IA 4YUZA 2P11A 2B94A 2F67A 3FWZA 3JD0A 4LXYA 3CF6R 4BWFB 1RIIA 4EW6A 5EMNA 5AOVA 1TMOA 4L51A 4DCTA 2Z8XA 3FPCA 3O2JA 3CT4A 1C4XA 1QH0A 3ZCSA 2VJPA 4GPTA 4AJHA 3WBFA 3H9JA 4AVYA 5AXBA 3HRIA 5DK6A 4OQNA 4PO3X 4DFDA 2GWHA 1KGDA 4DUGD 3QTLA 5C5IA 4NRDA 1J39A 3H2GA 4CI0B 3MF4A 5AKIA 1BAPA 4B3DA 1B2LA 5WRFA 5F7XA 1ZC3A 4YROA 2JFOA 3L0PA 3GN2A 1Q1EA 1QCZA 5BR8B 3U4QA 2O8CB 4KO1S 5BO5A 4ZOCA 2GM5A 3X2FA 2JIRA 3KQKA 2G9ZA 4ZWNA 4DIMA 2IHBA 3A4YA 4KH0A 2OV8A 3VR6A 3KZ1E 1GG8A 2EHDA 3RYFB 2UYCA 4MRPA 2FETA 1VTKA 3OIVA 4LKRA 1P1FA 2BFNA 5MGBA 1JIXA 2WYIA 1AKWA 1RAFA 2DFTA 1B3RA 1FFAA 2MMGA 2XADA 4PLYA 5GTDA 2HCJB 1SBTA 2WNHA 1EK2A 5TQ0B 2PRJA 1VJ1A 1BQ4A 3P4XA 4MLPA 4B3IA 3KG2A 1F8FA 4LY0A 5FJJA 3KB2A 1EU1A 2VDMB 3CX7A 1HRKA 1N2OA 2IEIA 2JZOA 4RL4A 2MMCA 1J2RA 1ORRA 4J3NA 2UZ4A 1BKYA 4XVRA 4KXQA 3CIFA 2ZJ2A 1KI6A 2P27A 3VH3A 2VPYA 4OFXA 4HB3A 4TUYA 4TUYB 1KRXA 4BKPA 3ZZ1A 2R5NA 2O8FB 3KXPA 1CF4A 4XDYA 5LA6B 1DEXA 4IXMA 2ILVA 3SKVA 4E09A 4D26A 3GCXA 1O77A 1F38A 1LDGA 2PUVA 4PIVA 1RWPA 1V9CA 3RJMA 2N47A 2HN9A 3VDMA 3WHLA 5LYJB 3V1LA 4NZNA 4RTJA 2ODEA 1W48A 4MYHA 4DUGA 4YLGA 5J4VA 2JIDA 4YRGA 1ESZA 1RJFA 3AUFA 1JKMA 2C4KA 2O2EA 3PNBA 2CY0A 1J2JA 4Q4HA 2HYIC 2P0EA 4EG0A 1NAHA 1RZRD 1GFSA 2RC5A 5EZ6B 1KPIA 1ZXXA 3D1LA 3B3GA 3FWYA 4LNUA 2C2BA 3K0SA 2H4JA 1UXKA 2AVDA 3EIFA 5AXAA 3GEDA 4WH0A 1NE7A 2F1OA 4MWCA 4JLKA 1JL3A 3VMFA 4B6OA 3YASA 5C5CA 4OX9B 4K86A 1OV4A 2M1ZA 1AQ6A 4NBSA 1N7JA 2NO6A 4M83A 2VQEB 1CF2O 4ZC8A 1C8BA 3H9EO 4RK5A 4IZHA 2VK1A 3UWSA 4LJ4A 1NJ5A 1SUBA 4N0QA 4B79A 1RLIA 1A8HA 4AS2A 1U3WA 2I2CA 2A0UA 2XIJA 2ZBFA 1N77A 5FBZA 2W2OA 4A03A 4TMFA 3INTA 5A0VA 4MINA 1MJHA 1WLSA 1VIVA 1V8BA 2ZI6A 4YPFA 3FXAA 5EJ5A 3AZQA 4Q12A 2IEDA 4RMJA 4JD5A 3K8ZA 1IBCA 5G1NA 5H4GA 1FNNA 1NOIA 2A9VA 3L92A 3HKCB 4DJFC 3L6DA 3RRJA 4ZGWA 4W5QA 2J07A 4WMLA 1VE9A 2G09A 5JRJA 1MG0A 2V6BA 3PDIB 4JP1A 3X1DA 5BXQC 4D4IA 3GGJA 1V2HE 3E0XA 2BF4A 1QG4A 4EH1A 2NUPA 1QIMA 1I0IA 4ND1A 2DMRA 3LPMA 3TCXB 4NCAA 5LB4A 3K31A 3R41A 4MQFB 3WLRA 4BCBA 4CYMA 1A98A 1RYEA 1U3TA 3EASA 5EIWA 2RH4A 1F3OA 1KEEA 2VYNA 4CL0A 3F96A 2ZWMA 1BMQA 2OSBA 2WZQA 4JLNA 4MVWA 3WIEA 2CXUA 1ZEJA 3DQZA 4K9MA 2NZUG 1P2GA 2P79A 2Q9BA 3LUDA 3DE2X 2ZIUB 2FVXA 4R8MA 4FCWA 4YEDA 5K0LA 5BVGB 4BO7A 1XRSB 1QDLB 3PCXA 1MZVA 1E2NA 1NVUQ 3K9QO 2XPCA 1U1DA 4J1TA 1BU8A 2J6BA 3LBNA 4FFDA 1G59A 2IY9A 3F8TA 3FUWA 2AQHA 4K6MA 1S6YA 1NLFA 2QM8A 4UVIA 1K98A 1LX6A 5G4KB 3REFA 3ZK7A 4BNHA 5F64A 1J24A 4RV4A 5CXUA 1M2VA 1SG0A 3ND8A 1BE0A 5CG2A 4CEJA 5JJCA 1T35A 1DKRA 1OBHA 3E3MA 1A9TA 1KY2A 3OFKA 2ZT6A 5KYKA 2Y1LA 1BXKA 2IXAA 3H5OA 3QBEA 5HK8A 1YOVA 3KXDA 2NTJA 2V3WA 2E4YA 4G41A 5CX1A 3GEGA 4ZEMA 5BT9A 4RIEA 1TQ8A 2P6MA 1PJRA 1WL8A 2BR3A 1GKKA 1OXSC 3IA7A 4XM1A 3DMHA 2FRVA 2QTHA 1DKPA 1JMYA 1FW8A 1A5AB 4K3VA 1P1KA 2YVKA 1XP5A 2LCFA 2NSJA 2Y1WA 3A9WA 4H15A 5H0IA 4DWVA 3THXA 4J7UA 1RJWA 2WU0A 2NAFA 3L6CA 3MJEA 5ECWA 4B3FX 1YB1A 1GTZA 2V7EA 1LDYA 3RWBA 1UXOA 2CLHB 3EIHA 4UHBA 4OHOA 5JAHA 1SOVA 4M37A 1G8HA 2O2JA 2WF7A 5KNDA 1W36C 3R0VA 1YQWA 4F4DA 5TS2A 1RYFA 3OIDA 3QKUA 1SUEA 5CVVA 2AQ8A 3P26A 4BAZA 1KK1A 4JT4A 4Q0MA 2K4MA 3LE8A 4YJFB 1HOXA 1UKAA 1ZCJA 4RE6A 1OX6A 3OAAA 3KZKA 2E2WA 4QL3A 1E9BA 4OQLA 2WHYA 3OIFA 5DYGA 5FFNA 1AS3A 3M1YA 3T06B 1IN7A 5I5GA 5DWDA 4AKHA 1O4WA 1KVTA 1GZ7A 1WPGA 2FEXA 1K6MA 1FOEB 4OI4A 3ZH9B 3WLFA 4US1R 1A9PA 1W9MA 4PC6A 2GZMA 3F1LA 3BTSA 2VP6A 4WOBA 2Q4RA 1EB9A 4II3A 2ISQA 2B36A 3BIFA 1S1CA 3SJZA 2QRHA 4AB1A 1ZD3A 1NY5A 1RE0A 3E2MA 1UQUA 5EIAA 5HQ3B 5LQAA 1I4LD 4OYYA 4PLWA 2P1DA 2G9NA 2ETXA 4A27A 1WUHS 1EA7A 3P52A 1CHDA 2NT3A 4ZVRA 1P4AA 4G5XA 4YVFA 2BMWA 1E20A 3TLGB 5CGQB 4IEIA 2OD9A 3HKDA 1X9IA 3KLNA 3QWBA 4Q1FA 1DCKA 1QBGA 4TV8F 1RFLA 2ABWA 4L0QA 2WG1A 4Y2GA 5C51B 4JVOA 2XGJA 2LVBA 4KYUA 5EWLA 4F7WA 4C7OA 5IN4A 5GOZA 4EUSA 4CL2A 1XTRA 5B2ZA 1TU0A 1NQTA 2D13A 4FJ1A 2ZQ5A 3DW1X 2EX1A 1RACA 3GF4A 3KKEA 4JJAA 3TZQA 3QRWA 2O19A 4KWCA 1MW9X 4KXLA 1C1DA 2XWJI 2DPGA 5EHXA 1F2VA 3M9XA 4QFMA 1RRCA 4IH9A 3RIGA 2VPXA 3KOMA 3PHGA 5LDDC 5B12A 5FQOA 5A0FA 2NUAB 3PZBA 4JBLA 1NMXA 2FDXA 2OT3B 4S1PA 4D6YA 4YX9A 4JI4B 2C2HA 2D5BA 4LOIA 1N32B 1N6OA 1Z0AA 4GUDA 5GONA 1W44A 4OM8A 2FU5C 4A8JC 3HXKA 5IFKA 1T43A 4UMVA 4ENTA 3VTFA 2JBAA 5TDHA 5LYJF 2ZQYA 3IAS1 1PX2A 5I6DA 1U9YA 4HTFB 4IDNA 4PAWA 3ZJUA 5J2UF 2I33A 4DSNA 3DFIA 4IH4A 4TYYA 4H31A 2Y71A 3O8DA 1WPXA 3HKBB 2JANA 2B1IA 3HUTA 3U2QA 4QYWA 3NB0A 4NEHB 1A3CA 4BQNA 2QSZA 3NFRA 3RUHA 5KQSA 4EYKA 4G85A 2PGLA 1JWBB 1YXMA 4G4JA 3D4OA 2NXNA 4R51A 1P81A 4DC1A 3TAHA 2Y0BA 1X9HA 4NBVA 2IWHA 5HMMA 2HWYA 2PH7A 4HI0E 2JA1A 2R6AA 1RQPA 4JENA 1WHTB 2OHFA 3EZGA 2VRCD 4R1SA 3X44A 3W9UA 5AESA 2PK3A 5JCOC 2Y0PA 3HU5A 1AQLA 3E7PA 3H6HA 4HL6A 2AZXA 5GOTA 4KQIA 4G2NA 2OD2A 5CIQA 3W0LB 2FPIA 1IOLA 1JXOA 3DTVA 2QRNA 3OKCA 3KAPA 4HCJA 4G4GA 3ESYA 3OQPA 4C4RA 3WLMA 3KL2A 1PBNA 3TYXA 3P2MA 3CMCO 4GPBA 4ZCIA 2Z2XA 1P7VA 3ZR4B 3CLHA 1R3UA 4UXJA 5JAUA 1IQRA 2GCPA 2KBEA 3UXMA 1FX1A 2J59A 3DVAB 4UVGA 4DIBA 4NKRA 2FX2A 4I6GA 4OGWA 3TLGA 1BE1A 3ON5A 4UNNA 4D8WA 3IDAA 5C4MA 2JBWA 3H0CA 4G0MA 5BQ5A 3KAJA 1UFKA 2CUKA 2VQDA 4EGCB 1F8YA 2PRZA 1FTNA 1YWGO 4QWWA 2ZQZA 1ZH6A 1RYNA 1XKTA 3IHLA 1R0ZA 1JVBA 3IAAA 3IIJA 2FG5A 5J2TF 4CMJA 4R9NA 5JRZA 4NDZA 3RUPA 1AY0A 5KIAA 1R6VA 3A6HA 2PTHA 3I28A 2AOUB 5GWXA 1AHHA 3AKDA 5JV5A 1E6LA 3JVUA 3PR1A 4GM0A 3ZV6A 3IQHX 1CNMA 2M98A 1GYPA 1YB4A 1PG0A 3AI1A 3AF5A 1H2AS 1MOPA 2OBNA 1I33A 2CWDA 3EFHA 2J9FB 3AZPA 1J99A 3BH0A 4QE3A 4BMDA 4DIDA 1ISGA 2RE8A 2PIAA 2G5CA 3SMQA 2POCA 1EGHA 2XUDA 3IKJA 1FRQA 2P3QA 2Q8PA 4M87A 3X1JA 4ER7A 2CJYA 4R1NA 1B2RA 3QHQA 2XVXA 1DQPA 1ZK1A 3QU5A 3S40A 1P7CA 1PJ3A 4PAOA 1OXKB 1XXHB 3THWA 4U7DA 4OHRA 1GNLA 3G1UA 1ZJ4A 4MVJM 4BMOB 4LJLA 1DKNA 2NW6A 4K26A 4N5HX 3AV3A 2H4HA 2JEYA 4P83A 1B0AA 3NAMA 5B1EA 2OORC 2Q29A 3PKJA 4XIIA 4KXMA 4BNZA 4CLDA 1Q3TA 2Y0CA 1CP2A 5JQGB 3ED1A 1TYCA 1JG7A 1JGTA 3RODA 1HYGA 2PLFA 2GF2A 4A1FA 3KKZA 3S2IA 4Q66C 1R4MB 1LSSA 3DE4X 3IAEA 4PSUA 4P3OA 2DC1A 3JYOA 5DI3A 2HXSA 3LZ6A 2AI3A 1JEAA 4WFQA 5J9FA 2AD1A 2FQQA 2WSYB 1XIVA 3D8BA 4MVJE 1ZN7A 1LW6E 2D2EA 3OE4A 3P8ZA 1YGYA 1YIAA 4IDGA 5ER9A 5G4KA 5LQCA 1C1XA 1C7EA 3PNMA 4V3BA 4Y9RA 2J4DA 5J58A 3SF0A 4O4IB 3BH6A 4QJBA 2VTBA 3QNMA 4WHMA 3LNCA 1X7XB 1XQWA 1IG3A 4HDMA 5IBPA 4QDZA 4TRRA 4MUBA 3M4NA 3QEMB 1K89A 1FNBA 2WYWA 3SKXA 5AM3A 5LYJA 4JK3A 1Z28A 1TM1E 1JKIA 3EHDA 2B1JA 3Q6MA 3R6GA 4YV0A 1JXQA 3ZZNA 5KHOC 3RARA 3GCZA 4N4AA 1PT8A 2P9CA 2WF6A 1JHRA 1WKBA 1C3VA 3QFTA 1SC3A 2H1WA 4GPZA 4OXKA 2ZTHA 4QATA 5B57C 5EY5B 3GLFB 1CG6A 4KXVA 3LBYA 1OI3A 3Q9NA 3MGGA 2ZSJA 4R9RA 5J47A 2JCBA 5A7GA 3DHYA 3M3DA 3W9BA 3CLUD 1CQJA 1UOOA 4NIMA 4Z2AA 1J8DA 2QLMA 3N2LA 3IP8A 4QTZA 5I47A 1C4KA 2FEAA 2VTKA 5INTA 5KYUB 4KVGA 5E4YA 1LKZA 3K35A 1AOXA 4BVFA 3FAZA 1K3TA 3QKRB 4PQYA 5CD1A 4ARCA 1SKMA 1NRIA 2CFTA 3PA6A 2HA7A 4FCVA 3NNNA 1JJBA 1MC5A 1P17A 4MV5A 2B2NA 1MDBA 2ZK7A 1YJCA 1SD5A 3I2IA 3LFTA 4KV9A 4EDFA 4QJ4A 4MCHA 4ZQIA 1Y7PA 3D3WA 2Y68A 3ZHRA 4RJ2A 4NAHA 5REQA 4YPVA 2WWXA 3NM4A 3A6EA 3HP7A 4GKJB 2XZOA 4G1VA 1Q0RA 2ZULA 3OCZA 1BD3A 1QMGA 5JHGB 1OXTA 2C78A 4MP8A 1IZ0A 1H2WA 3KU1A 2JK1A 2GKSA 3JQ9A 5D85A 2WB4A 1QP0A 5EJ2A 5MFPA 3P0FA 1ZK0A 3MJVA 1VE1A 1F2TA 1KNXA 4FX2A 1DE0A 1GL7A 1IHYA 1P39A 2BHSA 2HWUA 1KZYC 3CR7A 1IM5A 2IYWA 1GT6A 1VP3A 2DY1A 3PQFA 4MH0R 5D1HA 5K1ZA 3UV6A 4E5VA 1M8GA 2QDXA 2GRAA 1O96B 1PRYA 2ZM5A 5K9ZA 3CC8A 3O7WA 3NYRA 3OHMA 2A86A 4LOLA 4R8RA 4RK0A 5AHOA 4UMDA 1UKCA 3V4ZA 4CCAA 1N6NA 4IICA 1B6RA 1DO8A 1D9XA 1K8RA 1QGUB 5DK4A 1UM9A 2PA3A 3PENA 3PITA 2WWRA 5JZBA 1ZLXA 1JMKC 4BNTA 1P29A 2ZJ5A 4KOAA 2XTMA 4M9QA 2YWBA 1GGNA 4GF5A 4J16A 5LWQA 3D3KA 3BEDA 4DEYA 1CUVA 1MT0A 3ILSA 2ZJ4A 1OW3B 2AFVA 3NATA 3KJGA 1QCCA 4K3UA 1LSJA 1Y7LA 3VVLA 4KXYA 3CNQS 4ITUA 4EX7A 1KYZA 1CF9A 4FSDA 1OWOA 4M88A 1KU6A 3U3JA 1M67A 4I6EA 4KQ6A 5EHNA 3QH4A 1M2GA 3EWSA 1E1QD 4OQYA 4QLAA 1ZBDA 3EZYA 2YNMD 3N6VA 4I50A 3PFKA 3UEOA 2DZDA 3S99A 1I7SB 1FTWA 2ZUWA 2GRJA 2AOTB 1CHNA 1GV0A 3NGXA 2B82A 1VA5A 1G5PA 4BYMA 2EWWA 1QTQA 2YJ6A 2XAUA 4IG4A 1QDEA 2AG8A 2OXIA 5JNRA 2WFLA 3HJGA 4FW8A 1WXIA 2YJNA 1DIBA 4A0GA 2MDTA 4YHHB 3E84A 2JLWA 4FI3C 2PD6A 4LVCA 2IUFA 2ANCA 4E1BA 5IC4A 1MNAA 3LZDA 4NBKA 5GVRA 4CI9A 1TIKA 4JBHA 4CHGA 3CZ5A 1FMTA 1I0LA 1WE2A 3QX8A 1W46A 5HOQA 1NVFA 4Q3CA 1GNSA 1E94E 4QULA 5DU2A 4Q6BA 1YRAA 2VS1A 5JXIA 1TCBA 1DJPA 4IM7A 2B5OA 2WJIA 1TVEA 4FYIA 4RSMA 1JV2B 1S1MA 1ZL2A 2CLIB 3BRQA 2BTQB 1E4EA 1UP4A 2PV7A 3ZHYA 4B35A 4PHHA 1SHZA 3HCDA 3P2EA 1B8VA 4J0FA 4YASA 4DR4B 2NU9B 2HUNA 1W8DA 3LXUX 4HNAB 3L7OA 5TSDA 1IXSB 2W6ZA 2WICA 1ATZA 3O8OB 2O7VA 1G7CA 1DEOA 4ER6A 1O54A 3GLKA 4EPRA 1XQ1A 4M1ZA 1CP3A 1MGPA 3K0HA 3R7SA 4U0JA 2BF7A 3DOEA 1J1ZA 3WR5A 5IUNC 5EXSA 4PC1A 3ZLBA 4BMZA 3OCWA 4M9UA 3B12A 3ZJ4A 1ZO8A 2WAMA 2O7RA 3V4SA 2BFDB 2AE2A 5GJWC 5DW3A 3AERB 1DRVA 1GQYA 2L18A 3BD8A 4OHWA 5E6UB 2C9BA 4HDMB 2OXTA 3ZD9A 4EHBA 2A5YB 1V96A 1XAGA 1E9SA 1B14A 4OHBA 3AUJB 3DGFC 1Y8RB 1ZSYA 4Q00A 5KVCA 3IQXA 1XZFA 1T36B 1TA4A 5CT9A 5JE8A 3ZZMA 1CE8B 5AKGA 5EJIA 4JLPA 4DC9A 1YDEA 1ZJZA 3L8EA 5JOQA 3H4MA 2CF5A 4FN5A 1U7WA 2GH1A 3GCGA 1EJ6A 2CBXA 2XUOA 3MG9A 4X54A 4DEVA 1I6MA 1W4AA 2D0OB 3V7FA 3UPUA 4EGJA 2E5LB 2NPOA 1MJGA 5B58C 2C8JA 5ABPA 2WSIA 3QX7A 3F2IA 1ZAYA 3O31A 2JZCA 4N3AA 3R1IA 2Z2YA 3C6QA 1GTSA 3RIYA 3C85A 3HO1A 4AUEA 3PNSA 1BDMA 3T3IA 1I1HA 2QG9A 3PXDA 5JNTA 3UM9A 2LGJA 2O2XA 1YUMA 2JGFA 2O52A 4LY9A 1QYVA 5GV7A 4NENA 1IPFA 1H0SA 3D3QA 1EG7A 3QFHA 1IN8A 1BH2A 1FPMA 1Z8DA 1NSTA 3WZMA 3P0EA 1RZUA 3TQHA 1P91A 1XYYA 1KZGB 2H6EA 1SEPA 1PVOA 4OYLA 1M1YA 1HZZA 5LZ2A 4TWJA 3BQMB 1QGZA 3HJHA 4AXXA 3OF2A 5HZHA 4O4HF 1CUBA 3KL4A 1W2WB 1B93A 1WXQA 2QZ9A 3O8QB 3VU9B 2F64A 5B37A 3R8CA 5BY2A 1PE0A 3H5AA 3QOWA 4P33A 4FVTA 1F3LA 1G7TA 1YO6A 3GIDA 4QRHA 5GJVC 4IJ6A 1PEAA 1JHVA 4FHEA 5BN5B 5B64A 2VSNA 3I3OA 3F7OA 3EG5A 3RSFA 2RHCA 2F4VB 4B3RB 1UPAA 3R74A 1NW3A 3CX6A 5FOTA 5JD3A 3U0BA 4OBWA 5L4LA 1ZVKA 1O08A 2OESA 2X0FA 4S0XA 1DQNA 2G7ZA 1GR1A 1AS0A 3A4VA 1NNLA 4RIHA 1G5FA 3OZVA 2AEEA 4DJEC 2ZTUA 3HL4A 2FMFA 5JCJA 2LKCA 2NQ2C 5LNK1 1USIA 1QRUA 2X1LA 2WLTA 3PC8A 5C3MA 3I05A 1Y1SA 3IHKA 4ZI2A 3BFJA 3S28A 4JI2B 1YBAA 1ORIA 1RSZA 4L8WB 4TTQA 1R4NA 4OQFA 1ABFA 4UEWA 2BFAA 2R11A 4QOJA 2I5PO 1DBWA 4AUNA 3ROPA 3W1WA 4KVAA 2BBSA 1UJ4A 3QXHA 4BLQA 2P8JA 3GLRA 1RD4A 2RI1A 3UHFA 4DPMA 1T6BY 2DPYA 5LKAA 4LQCA 3FPKA 3O4RA 1M1NB 3T0FA 2CF6A 1P7PA 3L7AA 4M6WA 1DHRA 2VZLA 2AOVA 2ANBA 1QHIA 2FSHA 3FTEA 3AUYA 3MSCA 2JJ2A 5E9AA 3RVSA 5BR4A 2KX7A 1G3MA 2ODTX 4DS3A 1NXSA 3JPWA 4IDCA 1U94A 4Y2YA 4ARSA 4N54A 4KQ1A 1HNZB 2LRHA 5K4GA 1P62B 3HADA 4BN0A 3LDAA 1LC0A 3L0CA 2P41A 3AUXA 4H27A 2AA3A 4UJ5A 1BEUB 1J2TA 1NN0A 1C3JA 3CONA 3IR6A 3V7UA 4DE5A 3QUSA 3GNTA 3JS5A 4FMBB 3OAAD 1CQIB 4U3JA 3UB2A 1S2DA 4PW0A 2NIPA 1E6MA 4BMPB 5LN1A 4YREA 4YT8A 2IY7A 1I6LA 2HGSA 3JW8A 1YZYA 3ZDBA 1QCDA 1BXZA 3VC7A 4JQCA 1LSUA 3O4GA 4YAWA 1H69A 2WSBA 4RQBA 3TXXA 5JUWA 2JFXA 3KEGA 4GFDA 2AHOA 3GNLA 1QS0B 2D4AA 2XYGA 1ZISA 4NAVA 2HSJA 2MINA 1GCGA 1QVAA 2XVYA 3B5IA 3H4IA 4L75A 2VDVE 1L5GB 2OPHA 1QG6A 1O5IA 4R1QA 5GIOE 4WBNA 3D6JA 4FD2A 1THMA 3MHPA 3TBFA 3VZBA 5KX5F 1XC7A 2GJ9A 2OCKA 3H16A 4N8EA 1RAHA 3FWKA 7MHTA 2P75A 4L5JA 5K5EA 1YT5A 2AL7A 2D1FA 2YNMC 4O4JF 3Q7RA 2PUBA 2HT6A 2SCUA 1HE2A 3OCXA 3UC9A 3DV9A 3WWOA 5I9NA 2JGAA 4X0EA 1FNSA 3QMMA 1HETA 2P30A 4E4RA 2O23A 4GBJA 3ZQ4A 5K0EA 4WBNB 2VHYA 1ZH8A 1QORA 5F2KA 5FYQA 1C30A 1T4BA 2LKDA 3G2MA 3BRCA 1Q3HA 2RJ3A 4J0QA 2OB1A 3IPRA 1VKHA 1H3NA 2F3RA 5A4DA 2YN0A 4UBJA 2Z09A 4JBIA 4V2UA 4X84A 4A1OA 2PT5A 4MR7B 4ARZA 3PC4A 5IP5A 5BV7A 3BMXA 3DF7A 4RZXA 1H6DA 2HL6A 2XY4A 3DC7A 2ECFA 3EVNA 4E08A 2QI9C 2BEVB 4OAQA 1X7YB 4GPAA 5CB6A 2PYZA 2CJPA 2DUJA 1PL0A 1KE1A 3EX7C 4OU4A 1XVIA 1KY5A 1BCSA 2VAPA 3M49A 3QGMA 5EXEA 4MDFA 3EZNA 1JI3A 2CDCA 4A4DA 4E70A 2PKYX 2WIBA 1J23A 5H82A 4CM9D 4CJXA 2PGIA 4FNOA 1TZJA 3DXZA 4LJKA 5CW2A 1B23P 4NOLA 3MXOA 2P35A 2Q1UA 2ZAIA 5EJ6A 5BSEA 1UUFA 1XCPA 4YUVA 2I54A 2FR0A 2EJWA 1VPWA 4NXNB 1DKLA 3DPUA 3G1TA 4G8BA 1GJRA 4I4LA 1PTKA 2H1HA 1W1UA 4OJQA 4WN9B 3GQVA 3OKPA 2VTEA 1KPHA 5AYVA 5IAEA 7ADHA 2WMDA 5CBPB 2CHUA 2VZ8A 3AC0A 3IERA 3FLMA 2VDOB 3EHEA 4UVDA 2Y1GA 1G7RA 1QFXA 3JQCA 3E22A 4IFEA 1KR2A 4D81A 3H8JA 3TW6A 1M10A 1RTKA 3I42A 4E2ZA 3BD9A 1M8PA 1QHFA 3SICE 3TD6A 5DRYA 3WL5A 2Q3MA 1TGVA 1GPAA 4E31A 2CBZA 1Q17A 5CAEB 4NOKA 4FJ2A 1POXA 4QPJC 3RS0A 4O6VA 1OT3A 3HEBA 4CR8A 1IOWA 5KTKA 2VWGA 1YZNA 1RJEA 4E3WA 2OO5A 1LWOA 3H84A 4KIFA 1CS0A 3G2KA 5JSZA 3NT4A 5LCXA 1BQ3A 4XGNA 4HWSA 5T57A 3ZNQA 4D3YA 3K6SA 4ZVVA 3ZXIA 3DYIA 1E5VA 1SU7A 4MR9A 3W90A 4D9CA 3MMSA 4MV6A 4NENB 1DKUA 1Q91A 2C9YA 2I1VB 1B4DA 2XQKA 3LXXA 4O4IA 4BBZA 4ZYWA 3QTTA 4FYKA 2RBGA 2X8WA 2L19A 4N5NA 2QQ5A 3OX2A 2V03A 3FPLA 5ECGC 5H5JA 2VXBA 2M6SA 1GPWB 1WM1A 3BKWA 1YR1A 3O82A 4ESOA 5ANRB 3EC1A 3ET4A 4HN9A 4DJJA 1YOVB 5EP2A 2QRMA 2B0CA 1R12A 4Q7JB 5AKEA 5GONF 4BNWA 2WA2A 4DDUA 1MNQA 2R2AA 2DCMA 4IPTA 5JALA 3PCRB 3PB3A 2FSGA 3L8YA 2JZNA 1SFRA 4GO1A 1NR5A 4BS9A 1U7UA 4IRUB 2UXBB 2AC4A 3NBFA 1PR6A 2QJRA 2RSLA 4X7MA 1UKBA 4KWIA 4PCVA 2EC5A 3HM2A 2NZ2A 2IYQA 4OF4A 1XA3A 1KZ1A 3AFMA 4N6NA 4UMEA 3UHOA 3OBIA 3GP5A 3PNYA 3R7WA 2GN2A 3O4FA 4XB2A 5ICSA 1YDFA 1NQOA 2NNWB 4J7AA 4MOWA 2Q3LA 2VT2A 1UC8A 4UOQA 3ZK8A 5LUAA 1CEYA 4DVJA 2HPAA 1SOAA 5JZ9A 2IRWA 1NW8A 4ITRC 4WRRA 1NUAA 4CU2A 1ML4A 4L9SA 4DCVA 1R1DA 3R4VA 5DM70 4RTOA 3T7TA 3T1VA 1FNDA 5FBLB 4RTLA 1OB5A 4LXGA 4FE7A 2R5FA 5I8ZA 3OX3A 1HEUA 3CUWA 3LP5A 2HNKA 5C1DA 3OQJA 4Y9SA 4TZ6A 3UT6A 4DLRA 2J7KA 2IODA 3O8OA 4WD3A 5ENDA 2NSDA 1EFUA 4UE6A 4IXTA 4KPEC 1KOFA 1V45E 5JS1A 4PN7A 2WR8A 3R44A 4RTQA 2IGTA 3SOPA 4LFAB 1O8BA 3U3XA 3FB4A 4LQDA 3D4PA 1GSIA 4QGFA 4BGUA 2QTZA 3G49A 4B84A 2WVAA 5C53B 1JFTA 1TEVA 4ARBA 1BYUA 1XNRB 4F2PA 1GL9B 2WHPA 3ESAA 1QGOA 2RGNA 2ZB4A 3JVDA 3LCJA 4GRDA 4ZAZA 3H5IA 2CGEA 1WDTA 2JGJA 4QPDA 4UTVA 4HB0A 1HO3A 5TGZA 4BGIA 4KFTA 2QBYB 1FP7A 2TMYA 3W2EA 1HDIA 5I7SA 4FFLA 1T4DA 4Q5IA 2O8CA 3VH1A 4JJZA 4ZDIA 4QYIA 1WG8A 2QT9A 3G0IA 1ODSA 5K8CA 1RQXA 2AR7A 2RAUA 5EJAA 4S05A 5K0BA 2EBHX 2CNDA 3PLNA 3UWDA 4HDOB 1N3BA 1RCFA 4KKXB 4EGFA 3LUGA 4CUKA 1JAZA 2ZE5A 2X8LA 1EBUA 1KERA 1O2DA 1Z5UA 3WRXA 3PNQA 1U9CA 3LD9A 1O94D 3MCVA 1G0NA 5CNKA 3OPYI 2ORIA 5LBUA 5KOJA 2DECA 4FC7A 2H2IA 3JARA 5HEKA 1DWOA 4M6WB 3I9NA 1OAAA 5EE1A 3REQB 3NYWA 5HJ2A 3STVA 3WYCA 1QB7A 1MQAA 1Y5RA 1FRVA 1KAMA 1T8TA 1X1QA 5DGTA 2QVLA 3BIWA 5E1OA 3RW9A 1Z6PA 1J2UA 5TJ9A 1DARA 1EG2A 3WNBA 1AMNA 3LYAA 5FADA 1B6SA 2BJWA 4FKMA 4DKXA 4MW5A 5ALWA 4BNNA 2AXPA 1JIUA 5LA6A 1AQNA 4QUBA 4PQEA 3C5CA 3HCOA 1VFNA 3E7XA 3TN7A 1VJ0A 4M1TA 4YJ2A 4CQMD 3DKVA 3M6IA 5LKRA 4WCFC 4JL5A 4Y2RA 1T0BA 3H3FA 5KEIA 2H2HA 3DXYA 1RI2A 1RW4A 1ANKA 1Q0ZA 5J2UA 1ST2A 3CSDA 1AA9A 4EB8A 4R83A 3IFSA 1KJJA 2YQZA 2QMEA 3IT0A 4XGKA 1QGUA 1EBFA 2QR5A 5H81A 3GUCA 4D4MA 2JGEA 1CUUA 1NBMA 4WADA 3IGFA 3M2TA 4J3FA 5FPSA 1FJHA 2XTJA 5JEDA 2PUDA 3FRJA 2NVOA 2GBPA 2R1VA 1K2VN 1MA3A 4B3XA 1O6GA 3LL4A 5JD4A 4L5YA 5KSYA 3KE8A 4DOMA 3HFSA 1DC8A 4V0MA 5DYYA 3DEIA 3IEVA 2OXCA 1JLRA 4RQTA 1E2PA 4X6XA 1YDHA 4B7CA 1S0UA 1JLHA 5FA5A 1KMMA 2CYCA 1XRRA 1MTZA 2ATCA 1L4UA 1MEEA 3E03A 2Q7XA 3DHWC 3PBKA 2CHQA 2R8ZA 2W6IA 4MGEA 4M8LA 1NLYA 5EQDA 2OHHA 3KLOA 5CD9A 2PMCA 4J07A 3G2HA 4J3JA 3EQ8A 3UGKA 2QUKA 4REMA 3WSWA 1OROA 3OIGA 4NMHA 5LMCA 1SD2A 1MOZA 1XCBA 2L17A 5IDWA 5K0GA 3KT0A 5B4VA 2MU1A 1I9CA 5H70A 3C3YA 3UY4A 1AO0A 3JQ9C 4QNMA 2CDRA 1NE2A 2IZ1A 3WMRA 1D5CA 3TJZA 4DZTA 2GARA 3AR8A 4YAJA 1YMUA 4U7HA 2DFVA 3JYQA 1M2HA 1W5EA 4YBRA 5JAQA 5L7WA 4WERA 2Z6UA 2FQXA 1LPPA 1SQ5A 5J40A 1CE8A 5LQDA 3TSAA 3ZWOA 3ZY5A 1YB6A 2C95A 2GHRA 2WJPA 2IDZA 2B21A 5KTPA 5MFZA 1EFVB 2W58A 4WLOA 1JQKA 1MV5A 1JPVA 4RPKA 3MCWA 3V46A 2QIOA 3GJTA 4AYWA 3BGDA 4JI3B 1TT7A 4ZAFA 3KWFA 4AJKA 4CT5A 3L8MA 3HXQA 4RMNA 2E37A 3O92A 2FN4A 4Y2VA 3SJ7A 3Q9UA 3FMVA 4J0HA 4OUKX 3K0EA 5BPFA 4FOSA 4YRQA 1ZK2A 3HBNA 3TQQA 3NMUF 4XD2A 1DELA 1WNFA 3C3EA 4TXLA 4CKWA 5HKOA 2IYLD 3L4EA 4KVZA 4MQBA 3FKJA 1EDBA 3LWDA 4CEIA 3UTDA 2W6JA 4DQXA 1B1AA 5TQVA 2Q8NA 3SFZA 1HI9A 1OBOA 3OG9A 2HSEA 2ID4A 3AEQA 5GMOA 4DV0B 4FLFA 1M1YB 4QU5A 4C05A 2I7XA 1E1CA 5KJ1A 5IZCA 2XCRB 4KI7A 3WQHA 3VDNB 4X9XA 2OP1A 3PV0A 2HZBA 2HA2A 5EKSA 3OKAA 5IS2A 2IUUA 1DJNA 4IO1A 4ZIRB 4P35A 1T6NA 3BM5A 1HSOA 2YW2A 3D8TA 3L1KA 4NNJA 4UBLA 3VUEA 1E6UA 3H2JA 4INPA 1K3FA 1EWTA 2NVUA 3ZCPA 5IYZA 2WF9A 4G0XA 4BFUA 1DIAA 4XWOA 4HMOA 1DQZA 5KNDD 3D6MA 3TRFA 3TG8A 1O58A 4C7BA 3NHZA 4TVOA 5EWJA 4XDGA 3QXSA 1C80A 3QWHA 4WTOA 5MF6A 2FWNA 5CXSA 3C1UA 1E1NA 3WRVA 4MUAA 2R4QA 1GLGA 2ZWOA 4W9RA 4EI8A 5A0TA 1GZUA 1DTWB 1NBHA 3CRRA 4L22A 1C1YA 3UG6A 1UKEA 1DZ3A 2J32A 4E5MA 3D3NA 5JSKA 4YUWA 1J7JA 5I7OA 1ZDMA 5E95A 4M0EA 2AOTA 3QBTA 1U7HA 5KTYA 3IKMB 1OLUA 3L0OA 1OAOA 3ORHA 2MOKA 2BKLA 1FLDA 1U2QA 3A6ZA 3FUUA 3KQYA 4JLJA 5CHEA 3GFRA 4DVGA 4KR7A 4LYFA 4Q4JA 3TX6A 3VZRA 4RY0A 5THXA 2PSHA 2XUZA 3B9QA 5TF0A 1GSAA 3F9CA 4OXQA 4ACAA 3X1XA 4E1AA 4YALA 1XRJA 2P67A 2H3EA 3LA6A 3H1PA 1A5ZA 1AKMA 2D3TA 3EPRA 3ES9A 3EUFA 2WHQA 4QGBA 5ALEA 1GVNB 2KI5A 1GQOA 1KDOA 3DAFA 3AVYA 1T13A 4D43A 1JYEA 1E5QA 2AD5A 1U2GC 2J3MA 4HZUA 4TVKA 5G0UA 3EMDA 4E03A 4BRWA 1OAOC 4KUEA 3KLBA 3QVOA 1VYUA 2HRRA 2BTQA 1HE1C 1NJ2A 2ZS7A 1H8ED 5FYDA 3GZTB 2V6MA 4DIKA 4MV4A 9GPBA 1N75A 2EG9A 4X1IA 5KYTA 2YWFA 2XX3A 1MJFA 2PX8A 3TSYA 3KTDA 1UKZA 3DQQA 1WMAA 1YR8A 3F90A 3WJ2A 2C00A 4PNHA 2C29D 3N8KA 4YRMA 3OF5A 5BQ3A 4V3CA 1QHHB 5DISB 2N3ZA 1W9HA 2W8ZA 4E6EA 3VSCA 2V9ZA 4P4SB 3WY9A 4R16A 3UJAA 2ZRLA 4HEA6 3UWOA 3WO1A 1RWVA 2H2GA 4F8YA 3WWYA 4V2IA 1SY7A 2HK7A 2MSEB 1GRNA 4I9NA 4O8CA 4XWWA 1HDYA 4OXXA 4A92A 3LGAA 2PJZA 2GTPA