4LHWA

Crystal structure of rab8 in its active gppnhp-bound form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
171
structure length
171
Chain Sequence
DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-8A
total genus 58
structure length 171
sequence length 171
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhwA00
1AGPA 3F5FA 1S3GA 1CJTC 2P3SA 3M0EA 4RD1A 1Z63A 2ZR9A 1NVXQ 4KBFA 4KVGA 3B78A 4S35A 4BWYA 4LHXA 4XD7A 2BBSA 4NONA 2C9OA 3ND8A 4MGZR 2G83A 4DBLC 3AP3A 1XTIA 2Q0HA 4JYCA 1KI2A 4A2WA 3CRW1 3AB3A 1TQ2A 1NJGA 4NTZA 3QUSA 5K8TA 1FTNA 4DCTA 5IF9A 3AUYA 3LXRA 1DS6A 1OV4A 1FW6A 1R2QA 3U7FB 1XTSA 2FEMA 2QZ4A 4QBHA 4NCIA 1GKUB 3CR8A 1T4GA 2VL7A 1L2TA 3SI7A 5FOSA 3KB1A 2J5XA 1SXJB 1Q1QA 3T5DA 2BEJA 2ZRHA 4L4UA 1LV7A 1Z07A 4LOAA 2G9NA 1JECA 1E9RA 3PUWA 4ZV4A 1VDZA 2VP5A 2ZRCA 1Z22A 3VTKA 1Z5ZA 1N2CE 3QKRA 3UPUA 1N6PA 5BYJA 5AJYA 2L0XA 4GP6A 5CDFA 4CF7A 3R9XA 1CKEA 4PC3A 4M9XA 3KTAB 4QBFA 1T9HA 3GLHE 1TPZA 3IPYA 3K0EA 1NF3A 2IYXA 4GRAA 4EIWA 5L3RA 2ZI9A 2ZYUX 2VP6A 1GL7A 2DFLA 2D3WA 2FMXA 2REBA 2WKQA 4BRUA 2V3CC 5EUQB 4DLSA 5J4LA 3SYKA 1YQTA 3DKPA 4DT1A 4EFNA 4QJ3A 1CBUA 1CJUC 2XB4A 1XRJA 3NH6A 1D2MA 4EKDA 2ORIA 3LX5A 4TWZA 2ZRNA 3ZS9A 1NMZA 3RRYA 1ZU5A 2QG6A 2JCSA 5J40A 1E9SA 5AUNB 1OH8A 1W36D 5HKKA 5CLQA 2FZLA 2WWFA 3B6EA 3CPHA 4MKFA 2R2AA 4QBGB 1XMSA 2I4IA 4WOPA 3BERA 1B23P 4A4DA 1J70A 5A0FA 1L7VC 5SZIA 1KI6B 2J7PA 2YWFA 3B8HA 4WW0A 2OCPA 4EPRA 3TMKA 4V0MA 4HZUB 3ZH9B 1TU3A 1EX7A 4G5GA 4JS0A 1F2TA 3FPAA 3LNCA 2OUKA 5LB4A 4DB4A 1TEXA 1U99A 1TQDA 4CT4B 3AVYA 2H8KA 2RGBA 4TLBA 2C8VA 5CM9C 4DVGA 4KV9A 1RJ9A 1TF2A 1ZVQA 5FBWB 4ZPXA 1N0VC 4QHTA 4DJTA 3A6PC 2ZJBA 3O8DA 1LY1A 2OT3B 2PJZA 4IEIA 4IXNA 1WE2A 4BFYA 1ZNYA 4ZI3A 4FW9A 3BH0A 4KLZA 2NPFA 4C30A 2Z43A 4TZ6A 2W6IA 4IXMA 2CE2X 5DYIA 4QGGA 1KYIA 3AF2A 2JJ8A 2UZIR 3EX7C 3W6OA 2IWRA 4DUGA 4OYHA 1XCMA 2ZR7A 4JLNA 3EARA 4DHEA 5A4JA 2K5UA 3T15A 4NDZA 2VHQA 3HPQA 3G82C 1X1RA 1AS0A 1S2MA 2GXUA 3B1VA 5JJKA 1II8A 1W4AA 2HEIA 1YU9A 1E2QA 4C2TA 3U44A 1G5RA 1G7TA 4CVNA 1T3SA 4YMSA 4EPVA 4LYAA 2F9LA 1WF3A 721PA 2WSMA 3EC2A 3A37A 3GJ7A 2XJ4A 2REOA 4UNNA 4A36A 3EW9A 1LTQA 3DO6A 1YRAA 1XZQA 4I1UA 4HLQB 2QMEA 3IIMA 1J7KA 3MGCA 1WMSA 3EIHA 4QFMA 2A5YB 2YWEA 2BM1A 5EP2A 2I1VB 4IW3B 5CM8B 5SZKB 4CEIB 5EXTA 3EZ9A 4Q01A 1NLYA 1NP6A 3WMGA 3T34A 4DWJA 1GNQA 1BIFA 5L3QB 3N2IA 3GPLA 3LA6A 1ZD9A 4Q7LA 3THWA 5JEEA 1KNXA 1SVKA 1T0HB 1Z0KA 4GOXA 4DSOA 4F7WA 4RFSB 2NTYC 1K5GA 5CB6A 3I1FA 5FBRB 1JAIA 3CR7A 1K6MA 4JVLA 3AF4A 2R8RA 1UKZA 2HXYA 1M7GA 4MRRA 4XWOA 1U8AA 3HYTA 3LX8A 4US2R 2WMOB 3RYTC 4M1TA 3LXXA 4X8OA 2ZU0C 4BLPA 1AKEA 1XD9A 3UKDA 1RRGA 1TQ4A 2RGXA 3CWQA 2XZOA 1EWQA 1MV5A 2BCGY 3OIWA 1CULC 1ZNXA 2EFEB 3F3YA 2Q6TA 2C96A 3O47A 2JLZA 4JZKA 4B76A 5LD2B 1R10A 2CLSA 1UEIA 3ZGXA 2BJWA 4TQUS 2BBOA 4IJMA 5AR1A 5JSZB 1Z8FA 2ZSAA 2CJWB 2X2FA 3CX7A 2PL3A 1Q1BA 3WHLA 4C0BA 1NRJB 1HTWA 1F60A 1SQ5A 3TUIC 4ZKDA 2GZAA 1G3MA 1G4AE 3L8YA 4NYJR 1OXTA 3SZRA 3O8BA 3NEJA 4D2IA 1NL3A 2QTFA 4CZ2A 1G7SA 1Z28A 1SXJE 1ZU4A 2A78A 5C4GB 2GWHA 4LYHA 3UG6A 4EJSC 2FF7A 1W0KA 4LDJA 3BFVA 4L9WA 3ZJYA 5BXQC 4B3BA 2GCOB 3EA5A 2LKCA 3OEEA 3AV0B 2ZUBA 3BFKA 2KJQA 1UKEA 4UNRA 2NO7A 5JJIA 3TVTA 3RRMA 2OZEA 2EFCB 3ZVNA 3EIEA 3KXLA 4C9BA 3A1WA 3CRMA 4Z54A 2AD1A 2RMKA 2BKEA 5EP1A 1LFDB 2WBLC 3CX8A 4GMDA 1T8UA 1TUIA 1D9XA 6Q21A 4GMXA 2HT6A 4RZ3A 3DKVA 2RB4A 1ZCAA 4G5QA 2J41A 3SE0A 2WICA 1XPRA 3ZQ6A 4YONB 2OV2A 3Q3JB 4AKIA 3CO5A 2ZI5A 3D31A 3T1VA 4NMMA 3WP0A 1Q1EA 5FPYA 2VO1A 5F98A 2QROA 4C7OA 1KTVA 1DVRA 5IK2A 1NN3A 4YQFA 4F4IA 3GEEA 1G18A 2RGCA 2OESA 4IOLA 4DLRA 2RAPA 1B0UA 2QRZA 3IO5A 4YLGA 3TKLA 2IF2A 5TXGA 2JATA 4YXWD 1OFIA 2KBEA 3D8BA 2D4HA 1AQUA 4G1UC 4PHHA 5KSYA 4BPBA 2CE7A 1KDPA 3SEAA 2JA1A 3PCRB 4EPXA 2IYYA 1IY1A 1Q20A 3GFPA 3KJHA 4JL6A 2LCFA 4FCWA 3AH8A 2VHCA 1OPXA 3IPXA 3ZD6A 5C1BA 2PEZA 3MLEA 3CUEF 4PAQA 4EDHA 4ILEA 2WJYA 5EE1A 5BWMA 3ZIAD 3AP1A 3DVLA 3M1IA 4US0R 1A7JA 1QHHA 5FL7D 5KDDA 4OQLA 3VU9A 2OFWA 4NCNA 1ZJ6A 2EVWX 4Z8XA 2VA8A 1HYQA 3KJGA 5K8UA 2QBYA 1KO5A 1N0WA 2NO6A 4JSYA 3QKTA 1G5TA 4C0AC 2ONJA 4Q7KA 121PA 2DBYA 5CDFE 4W9MC 1P9RA 5AJXA 2PZFA 3MWYW 5AUPB 4B33A 3OIVA 1TAGA 2FE4A 2GBLA 1L4UA 4B44A 5KPJA 1VCOA 3GEHA 1E2JA 2ZTSA 4RVCA 3GJ8A 4WXPA 3SS8A 2GJKA 5J5CA 1J2JA 3R7WB 1U90A 3FE2A 4C0LA 2QRNA 3MWLA 4OHYA 2OLJA 1SULA 1JR3E 1NVWQ 3RSLA 4YDSA 1II9A 5TY0A 5FBLB 2RGDA 2QBYB 1R4AA 3H1TA 4PAMA 2V7QD 2AN9A 4U02A 1NIPA 1QG2A 2QM8A 2PCJA 4JMPA 3RABA 2W83A 1P6XA 1YZLA 3U5ZB 4QGHA 4NL4H 5F2EA 1ZM3A 2AK2A 4LWZA 2OAP1 4A0FA 2VHUA 3OEED 2XNDD 4LJ5A 1HQCA 2Z5FA 4LV5B 1E2PA 3I72A 1N5KA 3KJIA 2ZJ8A 3WMFA 3OEHD 1R5OA 4B43A 3PJRA 5GADl 2F55A 4Q4AB 2GJSA 3X1WA 5JCPA 1E98A 4L5BA 2NO9A 5BQ5A 3EWAA 2OBNA 2QTVB 3QY0A 3LVRE 4URZR 1OFTA 4D82A 1N6HA 1PLKA 5EE3A 3QBVA 1GVNB 4PAOA 4C7OB 2YYZA 4M4SA 2J59A 4P33A 4HUQA 3LFUA 1GRQA 3AVVA 1NMYA 3SJZA 1DAEA 2NOAA 1E9FA 2RGEA 3GEIA 4RSGA 1X8LA 4PHFA 2JLRA 1YZGA 3U2QA 2G77B 3QKUA 1JR3D 1GUAA 4DDTA 4HI0E 3QPVA 4M1YA 2AHOA 2HLDD 3CPJB 2QEQA 1RRCA 5DE3A 4CYMA 2HCJB 5KDLA 2CL7X 4Q1AA 2AL7A 2ZQ5A 3RSOA 1XTJA 3GD7A 4BFUA 1P3JA 3PFIA 1HE8B 4KSBA 1H8HA 3UG7A 4AIIA 3H4MA 2ZI4A 2WMNB 4IVRA 3ECCA 2XB2A 4B35A 1OYYA 4ZCIA 3W6PA 3LBHA 3RS5A 4MUAA 2ZJ2A 3Q7QA 3SR0A 2RHMA 2FEOA 4LV6A 1SVLA 2JJ1A 4I1VA 1JR6A 4NU0A 4DLYA 3NWJA 4X8HA 2W2XA 4LSGA 4EUNA 4KCGA 3VX4A 5KOYA 4MRSA 1NLZA 5AUOB 2ZVPX 3I5XA 2Q3FA 1OYWA 3P4XA 3BGWA 3S1AA 3U61B 1RKBA 3MJHA 4Q9IA 1TX4B 3DL0A 1C1YA 4JVMA 4UNPA 3ZVRA 4ZCMA 5EXPA 5JSZA 2W2TA 2REXB 2WZQA 2RCNA 1HY3A 3CZPA 2H17A 2GXAA 3KKPA 1G9XA 5J4YA 2F3RA 3TJZA 2Y8EA 3AVPA 3KXIA 4B32A 4BGDA 4O25A 1KAOA 4Q1FA 2QQEA 1ONBA 2ANBA 1M1YE 1U9IC 3MRSA 3VQTA 1DARA 3QJYA 4O2LA 3IILA 2PZGA 3B1XA 2XSZA 1NVUQ 3VFDA 1QHIA 1YR6A 4MKHA 1E79A 4KI0A 1G19A 3CWZA 5P21A 4JL8A 3GLFA 1G3RA 3ZLJA 2ZI7A 1YZNA 2FH5B 4LK2A 3KQNA 1EX6A 1VCIA 3CKLA 4RZXA 3WNCA 5TB5A 3Q5EA 1ZUIA 4LC0A 2ZS7A 5HPYB 3CH4B 5TV2A 2GDJA 1AIPA 4ZO4A 3AKCA 1HUQA 2VHJA 4RFSA 2HXSA 2OBLA 2B7CA 5KTYA 3VKHA 4TTRA 2ZU6A 3THWB 1VECA 1LF0A 2AK3A 2ZSEA 3KXKA 1MR3F 3U6BA 2IEZA 1E0JA 3ZS8A 1W2GA 4FMCB 2JLQA 3TBKA 2J0UA 4HAYA 2IS2A 2GK7A 1MT0A 4PHGA 2R62A 4WAUA 4CEIA 4D6PA 3D3QA 4JLAA 2WIAA 1KMHB 1ZD1A 1ZMXA 1AJEA 2FZ4A 1IN5A 1OIXA 2AX4A 2XTZA 4IOMA 3BB4A 3CH5A 1JR3A 2OSBA 5CK4A 3SFVA 4QOSA 1Z2CA 2HUPA 1G8GA 2G1JA 2FFQA 4C3ZA 2ANCA 1N5LA 4V02A 2J0UB 1ZM2A 1XX6A 1GTVA 2GCNA 2GEDA 3C14C 3MUFA 1OFUX 4EPWA 3THYA 3FHCB 4UKDA 2ZRGA 1R0ZA 3VHLB 2ZJZA 1IBRA 1NVVR 1HT1E 2O8EA 3QKSA 2WPDA 1Z0AA 5F3WB 4LYJA 3TAUA 3NEYA 1N5JA 2XOKD 3SQWA 1LB1B 4LBYA 1P5ZB 1XMIA 2EW1A 1DAMA 2ZE6A 2VTKA 1P73A 4HLCA 3GLFB 4QGAA 3NXSA 1NSFA 3Q7PA 4HSEA 1PLJA 4CW7A 2GVZC 2QPAA 5CIQA 4NZYA 2OBMA 3CRQA 4JBWA 4BLSA 4LJ7A 2ZRFA 4X8MA 3WRYC 5EE9A 1COWD 4C0QC 5F9HA 2XOKA 4Q4JA 1KSJA 3BK7A 2RGNC 2O5VA 2WJHA 3A1TA 2ECKA 4P3YA 1OW3B 3TW8B 5UKDA 5JECA 1E0KA 3I61A 2F1RA 1GRNA 1BKDR 2WJIA 4F4JA 4ZDIA 1CR2A 2NPIA 3LQRA 3EPJA 3WYGA 3SYLA 2H92A 1EK0A 2ZANA 4JLOA 4XWKA 4K8OA 1Z0FA 4B6FA 1K5DA 3FYHA 3PEYA 2CVHA 4MQBA 2IXFA 1FQJA 2YJTD 4JIMA 2VP9A 5AUQA 3OIYA 2PEYA 4PC6A 4DLWA 1JPNA 1QHGA 4AYWA 1PUIA 3OESA 1JEDA 2VF7A 2BMJA 5BN4A 5L3VA 3KUCA 1W5TA 2RKOA 2EU8A 3SHWA 1DAGA 3D7MA 3ZYCA 1NBME 1XEWY 3U3MA 4KITB 1IHUA 2ZS9A 4MITA 2ZM5A 5JFGA 4KFRA 1W0JA 2QL6A 3KKNA 3UWKA 2BMFA 3AKDA 4HDCA 2QGZA 5FPSA 1KIMA 4MYTA 4TMZA 5FTNA 3KTAA 3K9HA 1QG4A 1IJEA 3BAFA 4I99A 4A1FA 3HP1A 3VR3A 3AVOA 3RVBA 1NVVQ 1UJ2A 3DHWC 1E79D 2OCBA 3VMFA 2GCPA 2R6GA 4KFTA 2FNAA 1XCGB 1SXJA 1XMJA 5M04A 3C8UA 4MRNA 2C95A 2ZEJA 1KO1A 4RZUA 4LRWA 2RGNA 3QXCA 2VRWA 4BLOA 2IC5A 1G20E 2XX3A 3EXAA 4YMUA 1M6NA 4G0NA 3QQ5A 3T5GA 3QPUA 1XTKA 3K0FA 1OH6A 1TF7A 1DOAA 1Z83A 4ZIRB 1G41A 2WAYA 3U7GA 2CXXA 2VPPA 5EXSA 4Q4AA 3TW4A 1NY5A 1RYHA 1DO0A 2YOFA 3PR1A 1YZUA 1DAKA 2ZAOA 2ZI3A 1S9DA 1CEEA 2QTHA 3BH6A 4M1MA 1U0JA 1G8PA 3OAAA 3U3JA 4Z1MD 3HDTA 2V55B 3W5JA 5L3SA 1W4BA 3I8XA 3QVVA 3U7EB 4QBIA 1NJFA 2PZEA 3P32A 1AZSC 3RANA 3NG1A 4TYYA 5E95A 2YNMA 2IL1A 1EXMA 3PIRA 5JJLA 2WJJA 2ZRIA 4DC9A 4JLPA 2EWWA 2KB0A 2IS1A 4MGKR 4I1OA 5G53C 5FH9A 2VBCA 4BUJA 2WJVA 4AYXA 4KFUA 3GLGB 4DIDA 4QKQA 1XTRA 4P4SA 2FN4A 3SBEA 1GDDA 4A0GA 4TTQA 1C4OA 4TQ9A 3T1OA 1G1MA 1RIFA 4D25A 4Q47A 3ONWA 3NTUA 2ZRLA 4KYIB 1NI3A 4NKRA 4TT3D 2J0SA 2P5SA 2PBRA 2GETA 5FOUA 2BV3A 4AK9A 1TMKA 4ZKEA 3MJRA 3OFNA 1IJFA 4PR0A 2Q9BA 3QE0A 3C4JA 2OXCA 3FHOA 1E94E 1M8PA 2ZUDA 2JJ2D 3QF4B 2GAAA 2YKGA 5G3ZA 1Z0IA 1FNMA 1OXVA 2B92A 3VNUA 2ODBA 4UJ3A 4NP6A 4Q9KA 1KI7A 3K0AA 4II7A 1FUUA 5E7JA 5J4VA 2C04A 3DEFA 5LDDC 1P7CA 3RS4A 4LJAA 3IBYA 3KKQA 3H2YA 3LBIA 1X8JA 1V5WA 5TDHA 1G6OA 4LY6A 2EWVA 4ZDWA 1KJZA 1ZINA 4NYJQ 5KYKA 2ZREA 4M8NE 3L2OB 2H16A 3PUXA 5GJCA 3VX3A 1P9WA 3FMFA 5GJBA 4AKHA 1N5IA 2KE5A 4OHWA 3RHFA 4UXIA 3RAPR 3X1ZA 1VHLA 3T1QA 3RRZA 3W9YA 3CZQA 3L82B 2J3EA 2O8CB 2VSXA 4BECA 2PLRA 4BFWA 4GZLA 1E2LA 3AVQA 1H8ED 1ZM9A 2ZYVX 2ONKA 3SN6A 3I8SA 5K8IA 2W6JD 3EA0A 4DKXA 1D9ZA 2BEKA 2W2VA 1RE0A 3REFA 4N0DA 4KXFB 3KB2A 3QVUA 4G5RA 2A2ZA 5LB2A 4FXPA 1GILA 2NO1A 1OLOA 1NKTA 1GSIA 1SHZA 2DFNA 3OE7A 4TL9A 1E3MA 4HLUA 3C7KA 1NLFA 2Q9AA 4J0QA 3TAHA 5F9FA 3LW8A 3A58B 3VR2A 1Z6YA 1XWIA 2D2FA 3L0IB 2YWHA 1KK1A 2O8FA 2CHGA 2ZSDA 3JVVA 5E7IA 4BLTA 1DG3A 3Q5DA 2C03A 4LPKA 4LC1A 3CONA 3GQBA 2WKRA 2FSIA 2ODWA 4HATA 1R8SA 1H8HD 1WQ1R 2GILA 4N3NA 3X1YA 4E5UA 3AKEA 1GKYA 3DZDA 1BH2A 3LDAA 3K0CC 4C4PA 3WNDA 2ODNA 2HV8A 3C15C 1S4QA 3HPRA 3QSYA 3NHBA 1MRSA 3TSOA 2I3BA 2P0EA 2JEOA 3GP8A 1X86B 3FMIA 3W8NA 3CLVA 2C98A 5DI3A 2IHYA 4FINA 3ZZUA 3MSXA 4V03A 3B13B 1XEFA 4FMCF 1W2HA 4A9AA 3RC8A 2YC4C 4NPHA 1Z0DA 4Q66C 2PLFA 4K46A 1DELA 1E9EA 4PC1A 2E1RA 2QU8A 3B9QA 1FQKA 3LVQE 4TMVA 4PTLA 2CK3A 1E9BA 4Z8YA 2C9YA 3QG5A 3KKOA 3P4YA 1UBEA 3BE4A 2BDTA 4XOIA 1XP8A 3KQLA 1EFUA 3QF4A 3PV0A 3G5UA 5FTLA 2AWOA 3WHKA 1JALA 4EFMA 2QAGC 4BASA 1OB5A 1XXHA 4LI0A 2FPKA 1LS1A 4JKIA 5FTMA 2ZRBA 4MGYR 2FJUA 3V4FA 2VP0A 5KSPA 1YKSA 3I5YA 2V1UA 4QNMA 2YZ2A 2VSFA 4HAUA 1PVOA 4F91B 2W0MA 4HAWA 3LW7A 1TL7C 3PVSA 4OK3A 1W0KD 1PJRA 3EIQA 4DCSA 4DXAA 4Z51A 4LHWA 1W0JD 4A0RA 3PEWA 1JJ7A 3GMTA 4CRWB 1AA9A 4Q18A 3GLGA 2O0KA 1VKJA 2WWWA 2OO7A 5EXXA 1RC8A 4LPSA 1ZM7A 3QXJA 1E2HA 1QHNA 1IY0A 1N0UA 2VH5R 5FOWA 3QXXA 1XXHE 4OQNA 3HU2A 3U3KA 3CNNA 2HLDA 4TMXA 4LJ9A 4Q21A 4I1SA 1KK0A 4R71A 3B1ZA 1M74A 5IT5A 3PUZA 1Q57A 1G16A 1I2DA 3GLGE 5L3SB 1W4RA 5JBQA 2KBFA 1OJLA 3D6TB 2F1HA 1S8FA 1QF9A 2GA8A 5G41A 3QXHA 2BVNA 3SHFA 2ZE7A 4HB2A 1SKQA 2FGKA 2OHFA 1S3SA 1CRQA 3OZXA 4HB4A 3LWNA 4ZIRA 5JI3E 2HYDA 4BZQA 2GKSA 1OT3A 4BFTA 5JHGB 1XB2A 3ADKA 3QENA 4LZZA 5FI0B 1E2DA 3EPKA 1E1RA 5D3QA 1L8QA 3MD0A 2EFGA 5FI1B 5AWFC 2OM2A 4F4CA 3K09C 3V4RA 4LBWA 2QORA 1IY2A 1XJQA 4OBEA 5KNCA 4R9UC 3VR1A 1CU1A 521PA 3ZIAA 5DN6D 4MH0R 1KZGB 2GXSA 4KODA 1HT2E 2MMGA 4QJ4A 4URVR 4YXWA 1W47A 3WY9A 3FOZA 1OXXK 5CLLA 5EP4A 1P60A 2OLKA 4ASUD 3EZ2A 1AS3A 2CHVA 4TL8A 2IS4A 1N6IA 2GVDC 1KKMA 4XVRA 5J4KA 1E32A 1Q3HA 2ATVA 1W36C 2QAJA 5D3MA 5JCZA 3AF3A 2QMUA 1PLLA 3X1XA 3IHLA 2WJGA 4HB0A 1EFRA 3GLFE 3RS2A 1R5BA 1E6CA 4CEHB 2GF9A 1Z06A 5FBQB 4BQSA 3M6AA 3SBDA 3ZVLA 4CIDA 2VIIA 2QE7A 4OK6A 4TZ0A 4W5HA 4P32A 5DH9A 4PHTA 4B3GA 4OHVA 1GFIA 1GOTA 1PV4A 4BEJA 4V0LA 4M9SA 4DT1B 3AQ4A 2FOLA 3K70B 5FTJA 5KSZA 4TYPA 4IOKA 4U5XA 4B75A 1UM8A 1W7AA 4OHXA 1WB9A 1BMFA 1QZXA 1JNYA 1XFAA 5H1YA 4NE2A 2QSYA 1JXOA 3L0OA 2FSFA 4CT5A 4DLZA 3O8CA 1X1SA 1QVRA 1F6BA 3DMNA 1TTTA 4OI2A 1VG9B 1E4VA 1SHKA 2ZRJA 3LAWA 3NH9A 3E5HA 5CYPA 3WRXC 2NGRA 4YC7A 4QM6A 1D2EA 3BB1A 1OXUA 1S1MA 4Q4HB 1ESMA 1CS4C 4AY2A 1CJMA 4TSFD 5BN3A 4XSGA 2QN6A 1NKSA 3ADDA 1EFCA 1IN8A 1VCMA 3BOSA 2J1LA 2X1VA 2WWGA 3QKSB 3TGPA 4I81A 5E7MA 4LX0A 1MABB 3UATA 1A5TA 3K9GA 3ZVMA 5DYGA 4RD3A 3VR5A 4DRZA 1DAHA 1HA3A 2R6CA 4KAXA 1D8TA 4C0JA 5HCNA 3TSZA 4QNRA 3AVXA 4D81A 2A3RA 5HTKA 1XPUA 4TLCA 2OXRA 1SKYE 4QL3A 1T5LA 2IF0A 1SXJD 4AYTA 1DEKA 4F93B 4Q00A 2J45A 2NMVA 1QHXA 2Q9CA 2QPOA 3U7HB 4DDVA 3FMPB 3OFND 2R6AA 1DAIA 2A5DA 4PPFA 3Q85A 2CL6X 1W4CA 1Y63A 3GJ5A 3T61A 1UKVY 4TTPA 1ODFA 2IHBA 1W5SA 4Q48A 4NCJA 2A30A 2F1JA 4JBXA 2WWIA 4URUR 5HCIA 1SZPA 1LW7A 2FFAA 2QUZA 3P20A 4A6XA 1AZTA 5C46F 2AFIE 4DEYA 2ZSFA 2QSZA 4GBMA 2F3TA 4XWAA 3CRRA 1CLUA 2EYUA 2W00A 1U81A 2F7SA 5EE0A 1C9KA 1CR4A 1DG1G 3P26A 2XEXA 1XXHB 2D06A 2O8DA 3CF6R 1WBBA 4GPTA 5E3HA 5AJWA 5C18A 1GWNA 2FFHA 2AFHE 2GBLC 1OFHA 1G3UA 1FMJA 4QG7A 3ADCA 3NIBA 3BJIC 2ATXA 2AD5A 2Z4SA 3NC0C 2MSEB 3CX6A 1E0SA 1KJYA 3IIJA 2RH5A 1IONA 3I4LA 5ELXA 2RHDA 2OILA 5DHFA 2QE7D 2WOOA 1H8EA 1XJ0A 1P2UA 3VKWA 4LBVA 4ZDJA 3OF5A 2J7KA 2GF0A 1G8FA 2JIZA 3NHAA 3Q9LA 2IS6A 3T06B 4GOJA 4FN5A 3ICQB 1UBCA 4KYUA 2IXEA 2DYKA 5AJVB 1RZ3A 3TQFA 2XNDA 4RD6A 2RGAA 4DSTA 4CEJB 1X3SA 1U0HC 1DPFA 3S1AB 1NBMA 2P6RA 3AEZA 3UMRA 3LRPA 4UJ5A 4P4UA 5CIWA 3WXMA 2JGNA 2WTUA 2Q3MA 3OHMA 2BKUA 1KOFA 1NY6A 1RRFA 1FMLA 5CYOA 2FFBA 1G3QA 3RNLA 5EQTA 1WBDA 1F48A 1SVMA 3WBKA 4N0EA 4ERNA 3DDCA 3W6NA 1GL6A 1KY2A 1OF1A 2QT1A 4G01B 2R9VA 4D4KA 3B82A 1XD2B 3OAAD 4DIEA 1IN4A 2IUSA 1FX0B 5FOXA 4HEJA 2ASEA 1RW4A 4Q1DA 2O8FB 2W58A 3EC1A 3DZ8A 4JL5A 3AGPA 1WCV1 2OG2A 4HZIA 1T5IA 2IUUA 4FI3C 4LCBA 1XNJA 1CXZA 2QM7A 4KO8A 4R2HA 4U7DA 1CF4A 3TSWA 1CR1A 5FR2A 3AVWA 3P1JA 2IYUA 3FKQA 1E0AA 1AGRA 1JJVA 4WZAE 1OIWA 4LHYA 3ASYA 4AC9A 2BWJA 3C5HA 4IDNA 3EASA 1XTQA 1FTSA 2CHQA 4HUQB 4OL0A 2GJAA 3GJXC 3QNUA 1AK2A 2IYQA 4F92B 1Z47A 4EJSB 2QY9A 2FG5A 2H57A 3TUZC 2JDIA 3RWMB 3CRVA 3KZ1E 3QBTA 4XVQA 5FL7A 2CLCX 3UMFA 1P62B 1AN0A 1N6RA 4HAVA 3RS0A 1P2SA 3WP1B 4KJZA 1ZBDA 1LVGA 5IHPA 4OQMA 2FX3A 1KO7A 2ORVA 1ZW6A 3N2EA 5AJZA 5J47A 3RWOA 2OFOA 4AI6A 4PQFA 3T1TA 2ZE8A 4XTRA 1IN7A 3LY5A 1EGAA 4JT4A 1D5CA 2WWHA 4E09A 2OEPA 2WKPA 1IOZA 3K0AB 1ELOA 4FMDF 5FBVB 2Z4RA 4PPNA 2A9KA 3K0CA 2IW3A 1P75A 3TUJC 1NBMD 3X1DA 1XF9A 4B34A 1SKYB 2QGNA 1QDEA 3W3AA 4B3XA 1SVWA 2PT5A 1VMAA 3HR7A 1I4LD 1X6VA 2XGJA 3VAAA 4BZPA 1HE1C 4L8GA 1MO3A 2R44A 2D2EA 2JIZD 3K1JA 4JLKA 2JLVA 2XXAA 1SVSA 1OKKA 2E9SA 1D6JA 1JB1A 2QP9X 2PMDA 2C2HA 2ZRPA 4TL6A 4M21A 4MDEA 2WM9B 2ZE5A 5FUYA 3FMOB 2XJ9A 5DHAA 3ZZTA 1NG1A 3LQQA 4YMWA 1EWRA 2F43B 2ZR0A 4CDGA 5DLQC 2NZ8A 1BYIA 2BM0A 2IYLD 1ZYUA 4NHOA 1Z3IX 1G291 3VHXA 1GL9B 2H7VA 1KI1A 4DB2A 1OHHD 1FOEB 1NN1A 2VP2A 4TMKA 1BMFD 1E9DA 3IO3A 1Z6GA 3NDPA 4MUBA 3PQCA 5DO9A 2X19A 2GK6A 4DZZA 1J8YF 3KJEA 2IWHA 4O2RA 3U4QB 2C5LA 4QHYA 3TE6A 3R8FA 5EUMA 5BYKA 5KNDA 1MO4A 2QPTA 2J0QA 1T3LA 1QHHB 4M53A 4MYHA 5TARA 4FCTA 2WSSA 4MRVA 2IXGA 3EG5A 2ZROA 3GCGA 4FIDA 2GRJA 3E2IA 1ESNA 1P72A 4HAXA 4WZ6A 3RRNA 5BW8A 4JLJA 2SHKA 1R0WA 3DMDA 1ZIOA 4LUCA 2BMDA 3EAQA 4UNSA 2DCUA 5KNBA 2UKDA 2CCJA 2PX0A 5TVKA 1DADA 2NIPA 4LJ8A 1ZIPA 2MSCB 3IDQA 4JT2A 3IBGA 4R98A 1NG9A 3NVAA 3K0FB 2O8BA 1KO4A 1G4UR 4WIAA 1GNPA 2MSDB 2ZIAA 2X2EA 2W6JA 3PEUA 4JVNA 2IYVA 3KX2A 3HYRA 4M1SA 3BORA 2BHRA 4RY2A 1J8MF 4B2IA 2IUTA 4TMWA 3K70D 3E1SA 3K9NA 4RCYA 1I2MA 3U3RA 2J46A 3KQHA 1Q44A 1Q22A 1EFRD 4NCKA 4YDHB 4B6EA 3SNHA 1NSTA 4LJ4A 4LYFA 4RD0A 4PPGA 2QAGB 3A4MA 1VYUA 2OE2A 4D0NA 4RKEA 2RGGA 1GM5A 1G7RA 1VHTA 2Z6VA 3VNVA 5G3YA 3R9IA 5JMTA 1UBGA 4GP7A 3KFXA 1XEXB 2QMHA 2A5GA 4Q7JB 2HJVA 3TR0A 1OXSC 4JBYA 4B3CA 5CITA 1KDOA 2GJ9A 2Q21A 4B47A 1KMQA 2HCBA 2GCOA 3MFYA 3KKMA 2NO0A 4IFBA 4JJZA 4YMVA 2V9PA 4A82A 2WWXA 4M1WA 1A2BA 2P2LA 4PX9A 3THXB 2FPLA 4HLDA 2YV5A 4MA4A 1DE0A 2JLYA 1KDRA 3HWSA 3DOFA 3REGA 2QAGA 3HU3A 2KSQA 1N3BA 1A4RA 621PA 2GHIA 3NBZC 4E07A 2WIBA 5DIFA 3BD9A 2BBWA 4QXAA 1UDWA 2CJWA 4EFLA 1VIYA 1CP2A 3PUYA 4PXAA 4YMTA 2IYTA 2WHXA 2ZJ5A 1R7RA 3QEOA 4PZZA 4V0OA 3K9LA 4DDUA 1YVDA 2CCGA 4B3FX 1FUKA 1E99A 4V0ME 3I73A 2R65A 3GLIA 1MOZA 4ABYA 1EG7A 2E87A 4Q03A 3RDPA 2O8BB 2BMEA 4LHZA 3T35A 4Q4JB 3KQKA 2C9CA 2G3YA 4GT1A 4JLBA 2XTNA 4JLDA 2QA5A 4OQXA 4PC2A 5FR1A 4LGMA 5KU1A 1TQ6A 2JLSA 4URWR 2CVFA 4Q9HA 4OJKA 2CNWA 3A4NA 3IIKA 2AR7A 4DUGD 4C2UA 3AVUA 1UPTA 3FKSD 5B57C 3CNOA 2GZDA 3SDZA 5JS8A 3TRFA 1AS2A 2J0VA 5KDOA 2GESA 4Y0AA 3C5CA 1E1QD 3F0TA 1T6NA 4WA7A 4HYYA 3W90A 2G0TA 4QM7A 3U4QA 1Z2AA 3LLMA 4BLRA 3GLHA 1GNRA 4EAQA 2YC2C 2A5JA 4IVPA 4TLAA 1GG2A 3N5CA 3THYB 2PT7A 4HDOB 2CL0X 4OQFA 4XSHA 3B9PA 4DLUA 5K8LA 1XDBA 3PENA 2J7PD 1UADA 3QOFA 3FGNA 3X2SA 2WPDD 2H5EA 5H68A 5FPKA 2HT1A 4NYIR 4IDHA 4H9GA 4C0SA 5ANRB 1KMHA 2CK3D 2WAXA 2XXAB 1VTKA 5JRZA 5EE5B 4BFXA 3U44B 3V9PA 1JXMA 5AK0A 1S0UA 1KO8A 3BIFA 3JVUA 5DN6A 3EZ7A 1IAQA 1JQJC 1MO6A 2W0SA 1XCPA 2BOVA 2VP4A 5CJ2A 4BE7B 3ASZA 3DOEA 3E70C 2I1QA 1ZC4A 1AM4D 4QC2A 2TMKA 2D74A 2GEVA 4URXR 3B2EA 4PZYA 1QBKC 4B74A 1KAGA 1ZNWA 3L43A 3L8ZA 2FPMA 2ZRDA 3ZD7A 3IKJA 3MCAA 1KI4A 2O0JA 1W46A 3BRWD 4P0TA 5CK5A 1BO6A 1YHNA 3LO5A 4PFSA 3AM1A 3IGFA 2EQBA 4X8LA 1KY3A 1XD8A 2ZRAA 5FPTA 3KQUA 1AQYA 3KFVA 3R8CA 4ACBA 5B58C 1Z6XA 3CM0A 4LBZA 4BFSA 4DCVA 1E9CA 1R8QA 1UF9A 2IYSA 1OHHA 3AUXA 1XZPA 2IX3A 3RLFA 1T3HA 3R20A 4PANA 1TU4A 1O3YA 3MAAC 1KNQA 2VSOA 4L9SA 5KPDA 1M2OB 3R9WA 1GKIA 2DR3A 5KUTA 4MYCA 4QJ5A 1KI8A 3O8RA 4HZUA 2CEAA 2G88A 3P27A 2JASA 1JI0A 4NH0A 2IEYA 1I4TD 2HF8A 5FFMA 2A5FA 1W44A 1FPMA 2YHSA 3B7GA 5H8WA 3GLIE 1RRPA 5IK2D 2DWQA 4Q02A 3B85A 4Q19A 4KHZA 2PCLA 1JBKA 2OCAA 3BXZA 3CBQA 3CIOA 4GI7A 1F2UA 3HU1A 3SJAA 1FP6A 1R6BX 2MMCA 1FX0A 3CB4A 5SZJA 3Q8XB 1XD2A 3BS4A 5FOTA 5JWRA 2ZYWX 1K8RA 4Q4LA 1Q3TA 3VKGA 1JAHA 1E9AA 1UDXA 4OJQA 1KK3A 4QGFA 1PUJA 3TR5A 1D2NA 1F2UB 1KGDA 1GITA 3PG5A 4N1AA 4TLEA 1F3OA 3I92A 5HZKA 3DPUA 5JWOA 3BWDD 1MRNA 4ZCLA 1KI9A 1P61B 3AVTA 3GJ4A 1E1RD 4B73A 3NKVA 3W34A 1ZC3A 3QKRB 4DEXA 2ZVQX 4XH9B 2ZUCA 3SJCA 4GZMA 5HR5A 3WMEA 5L8VA 4CEJA 2IBMA 4DLXA 3EZFA 2VF8A 3IQXA 3SJBA 2LKDA 1DO2A 2HYIC 5JRJA 4OI1A 4M2LA 4P4TA 1Z0JA 1R0YA 4NBSA 2C99A 3K0SA 3MG9A 2HF9A 4LV8B 4OHZA 4G5OA 4QRHA 1G8YA 1TNDA 1R5NA 4IHQA 5DGXA 3EPHA 3NBFA 1HQYE 2V6JA 3ETLA 2WWYA 4ESVA 4H1VA 1QRAA 3WBJA 1E2NA 3OIUA 2ZJYA 4PSKA 1FZQA 4O0MA 3BFXA 4D26A 3G0HA 1DBSA 2B7BA 2IT1A 4HB3A 1U98A 4R2IA 5GJWC 1II0A 5LBIA 2B8WA 2EFHB 1ZD8A 3AGQA 2P67A 2XITA 2Z83A 2ZETA 1E69A 4GL2A 4D4JA 4NYMQ 4DSNA 2ZPTX 3UK6A 2EYQA 1I4DD 4JYBA 2X8AA 3GJ6A 4IDPA 4DSUA 3CF2A 3SYNA 1LF5A 3CNLA 4PO9A 5SZHB 2ZYTX 1NN5A 4GNKA 2ODEA 1E2MA 3R7WA 2V7QA 3NDBB 1IM2A 2Z0MA 3GFOA 5FUWA 1TUEA 2FU5C 4AG5A 5JHHB 3UANA 5JZVA 1WA5A 1CTQA 1YZKA 2X77A 2ZS8A 3A36A 3BC1A 4WZBE 1ZM4A 4POAA 4URYR 4B3DA 4UXHA 5DNYB 3GJ0A 3KDSE 1G3IA 1VG8A 1EESA 1RYFA 4FMDB 2ZRMA 1G7CA 1U2RA 2BJVA 3OEHA 4PSVA 2ZI6A 4BFZA 5H70A 4A8JC 1MABA 1S1CA 1YR8A 3GLHB 5C4MA 5JS7A 3C41J 1G8HA 3PITA 5DISB 2JLXA 2IYRA 4IKEA 4RKFA 1Z6AA 4E03A 2ZITA 2ZJAA 3VU9B 2GEUA 4TMTA 3B1WA 4HLUC 2WOJA 4RZ2A 2DFTA 3FKSA 4D80A 3H84A 4Q4HA 3J81k 4IOJA 1BS1A 4R7ZA 3L0SA 4A2QA 4A2PA 4C0KA 4MKGA 4F38A 1VG0B 1MH1A 4RD2A 4IEEA 2BCJQ 4O3MA 1Z08A 2ZAMA 4LJYA 4OKSA 4DDWA 2QP4A 3ICEA 4JJKA 1ZCBA 3V00A 2ZRKA 4OI4A 1NIJA 2DFKB 1BOFA 3EWSA 4ARZA 2GAOA 4BLQA 1G17A 3B1YA 4RD4A 3BH7A 3AF0A 1T8TA 5LD2C 1S96A 1HH4A 4W7SA 3ZQJA 3Q72A 4Z1MA 1ZUNB 2H18A 4BEBA 2BC9A 5KSOA 3GLIB 5KO2A 1GRRA 1E2FA 4PZLA 3DM9B 1OSNA 1NMXA 5JLJA 4GFDA 2P6UA 4GOKA 3JZAA 5A5GA 4DLTA 2C77A 5IRCD 2LWIA 4XVUA 4WXRA 4XIGS 2XTMA 5HZHA 1TF5A 1P9NA 2B21A 1YZQA 1UEJA 2XZLA 3ZZ0A 3UMSA 1N6KA 1CR0A 2PMKA 4JLMA 5EJEA 3A8TA 4B2LA 3TVDA 4CEHA 4AD8A 1U8YA 3THXA 4GDFA 5GJVC 3W5IA 2V54A 2DPXA 2QQ0A 4MKIA 3LLUA 3UXMA 3FDIA 1VG1A 1WRBA 3MWKA 2CDNA 2F6RA 1COWA 3A1UA 3ADBA 5IDVA 5D3MB 1KKLA 3SOPA 3H86A 2DWOA 4KLNA 1SVOA 4TT3A 3LBNA 4AKGA 3ND9A 1U8ZA 1XEXA 2C78A 1Q1ZA 3FFAA 1SGWA 4TLDA 1Z29A 4HDQB 4ASUA 3U3OA 2VHTA 3K70C 2AXPA 2ERYA 4A15A 3QEJA 4ACAA 3PXGA 2CBZA 1VIAA 4JSTA 1HEIA 2CNWD 1UFQA 3FHTA 4B2PA 4TL7A 4L15A 2GXQA 4ESHA 3QIAA 1W36B 4EPYA 3I32A 1U0LA 2HDNB 2VQSA 3WNBA 1FP7A 1A1VA 3SQXA 2HJGA 3B60A 4FD2A 4FCVA 221PA 2BIFA 4MYUA 1ZNZA 1OB2A 821PA 3H0KA 1G6HA 1FFHA 3AP2A 4RJLA 5B30A 3A1VA 5DI9A 1JPJA 5FL3A 1XBTA 2V1XA 4TQAA 1WP9A 4D0LB 4EQ6B 4D4MA 1J90A 4PQRA 5EZ6B 1CJVC 2NZJA 5FUVA 1US8B 2VLIA 2IK8A 4PPQA 2QI9C 2J9RA 4XTCS 2CLDX 3IEVA 4Q9LA 3GJ3A 5DSZA 1MKYA 4CGZA 5FUXA 4FWTA 3NBXX 2UZ3A 4KVAA 2DB3A 3C16C 1Q21A 4G3XA 1VPLA 2PX3A 4IVQA 4XD7D 1YJ5A 2KWIA 2DWPA 3N70A 4IRUB 2O52A 2WSSD 1GP2A 1RVDA 1ZP6A 3FB4A 1G21E 5C2JB 1UBFA 1KHTA 4RCZA 1Q0UA 3SC3A 4Q1CA 1G5PA 5GVRA 3L0PA 1IXSB 1Y3AA 1TEVA 2YVUA 2FDCA 3RC3A 1H65A 3VR4A 5FPHA 4C0HA 1E1QA 2AXNA 2D62A 5L3QA 1CRPA 1XU4A 3TLXA 1SXJC 4V0NA 4TYNA 3THOA 1KI3A 4EPTA 5HE9A 3IEUA 4GSYA 2EFDB 4D0GA 1KSGA 4FMBB 3CW2A 2R6DA 3BB3A 4I4LA 1KSHA 4L16A 2FA9A 1IQPA 1T91A 4Y0VA 4AURA 1E2GA 1F5NA 2F43A 3LD9A 4E22A 2JJ1D 1QHYA 3KUDA 4OK5A 4Q5IA 1ETUA 3MMPA 1QVAA 2O0HA 2V8OA 2CMKA 1XPOA 1ANKA 1DAFA 1YE8A 1GIAA 4IDOA 5FOVA 4V0KA 1RPZA 5EP3A 2O8EB 2VYFA 1V43A 4KBGA 4KU4A 2D7CA 2YWGA 1US8A 1CJKC 1M34E 3K53A 4Q1EA 5CJPA 4BFVA 1II8B 1U94A 4EQ6A 2JJ2A 5HKKD 2NQ2C 4JVSB 2A7QA 3W3ZB 1M7BA 1SVIA 1X8KA 1XMVA 2G1KA 2V6IA 3QI2A 2YOHA 1M7HA 4IDQA 4PQYA 4RFVA 3U6KA 1U9IA 4WVFA 2D7DA 1DTSA 1E2KA 2R6FA 4BRWA 2BBTA 4KFSA 1LNZA 1W48A 2ZXUA 1G64A 1KSFX 4M22A 3RS3A 5BN5A 4LHVA 1P2TA 3HR8A 1FNNA 1FL9A 1N6NA 1ZUHA 5LPNA 5GVSA 3BBPA 2OAQ1 5G40A 2AKYA 2G0NA 5JWHA 5DI3B 4BZXA 4AWXA 3EPLA 2JLWA 3JZMA 4MDFA 2GTPA 2V4ZA 2IYZA 4ITRC 4FWIB 1J99A 1VYVA 4XJXA 3TNFA 2UVQA 1JQLB 2DY1A 1GAJA 2JLUA 4NYMR 3W8RA 4B48A 2N42A 5EZ5A 1RJ9B 2J87A 3AKYA 3SU8A 1KDTA 4Q7MB 4EJSA 4DLVA 2PJRA 4Q1BA 3QXSA 2IYWA 4AG6A 3NC1C 1R0XA 4DCNA 1UAAA 1E96A 1YRBA 4W5JA 2GZHA 2XSZD 3A4LA 3FFBA 3IHWA 3KL4A 1F2TB 4PO8A 4U00A 1HV8A 4M9QA 2NG1A 4WBSA 5TMPA 1AKYA 1ZRHA 3M4YA 4M0LA 2N46A 2JAQA 1A2KC 4P31A 3K09A 1KI6A 2G6BA 2YOGA 1KZ7B 1RFLA 3WYFA 4KSCA 3EZ6A 2QMOA 3AF1A 2XZPA 5B2ZA 2XAUA 4UQOA 4MRPA 1EFTA 1A82A 3CPEA 3TIFA 2XNSA 2F9MA 3B5JA 1L4YA 2YINC 2QENA 1TADA 3PEVA 1XEWX 2N1BA 4IFEA 4M9ZA 3TH5A 3UWOA 4OI0A 1CIPA 1N25A 1OKKD 2PH1A 3TK1A 2P65A 4JKYA 4HAZA 1IXRC 1KJWA 4M1OA 4PSAA 1MO5A 3QPWA 3SFZA 1QHSA 1OE0A 2FSHA 4TN1A 5JEDA 3UIEA 1YR9A 5FTKA 1N6LA 1LS6A 2O8CA 2WVJA 1E2EA 3K8YA 1Z6TA 2OFXA 4DCUA 3PUVA 4A0HA 4TSFA 3QG1A 4UNQA 1KK2A 3TQCA 1T0JB 1OH7A 3LV8A 1EFHA 4ARZB 1XJCA 2FSGA 4ZDKA 1JEEA 1NN0A 1O87A 2H1LA 4PO1A 4W5WA 1YR7A 5B64A 3CF0A 2F1IA 4H1UA 2QP3A 2WV9A 4MGIR 3ZDQA 1ZAKA 4Q9JA 1W49A 3MWJA 1P4SA 3WYAA 2AWNA 2B6HA 2ERXA 2GNOA 1YZTA 4M1KA 421PA 2VEDA 1HURA 1VYTA 2JDID 4UXJA 2ZJOA 3HJNA 1WXQA 3LH5A 4QHSA 2AKAB 3I3SR 1PZNA 5JI2E 1E4YA 2Q3HA 2FWRA 3OE7D 4NYIQ 2P5TB 2QT0A 4K81B 1OH5A 3VR6A 1N6OA 5J4HA 2IA5A 3IUYA 4ZI2A 2O8DB 3NBYC 4JLVA 2P6NA 3U60B 1GZSA 1WDTA 3QF7A 4US1R 1IXZA 3T12A 3FWYA 4G5SA 2W6ID 3I62A 1W1WA 2DHRA 4ON9A 4NCHA 4PC7A 3RS7A 1E2IA 4LJ6A 1Q12A 1P2VA 2CCKA 2GJ8A 2KI5A 3F8TA 1IN6A 2FGJA 2B8TA 4P4SB 4B71A 4A8JB 3A1SA 3IQWA 4HUTA 3FTQA 1VCNA 8OHMA 3FVQA 3DM5A 2ZSBA 4A92A 4D4LA 3GFTA 5CB8A 5KHOC 1BYUA 1OIVA 1UKYA 2FV8A 2QNRA 4TYQA 5E4FA 4A8JA 4AKEA 4TYWA 1NNEA 2ORWA 2OCYC 4S2EA 5HE8A 4A6PA 1S9HA
chains in the Genus database with same CATH superfamily
2XI4A 3GFFA 1CJTC 4Z49A 4GZ6A 3P2MA 4A73A 4CCYA 1Y42X 2XE7A 3LCRA 2VJQA 1JVSA 3P96A 1PFUA 4LHXA 4XD7A 2BBSA 4J43A 3VSCA 4MGZR 1FDIA 2G83A 2Y2VA 3CINA 3M1LA 3HCFA 1RQ7A 3HZZA 4U5QA 4UHBA 3A4IA 1KI2A 4UTNA 1W73A 4F3RA 2C84A 1Q7BA 1G42A 1NJGA 2G7ZA 5HBRA 4YRKA 5H02A 1Z3CA 4L9AA 2J33A 4DCTA 1YJCA 4B4KA 2BJHA 1DS6A 4X1OA 2A9QA 1R2QA 4RABA 4Z0TA 2AYZA 4AO7A 4JBGA 4N5LA 3D6AA 2QRVA 4QBHA 2FUG6 2BEWB 3JX9A 2VL7A 2EAUA 1GPKA 2D5IA 2PBLA 1GGFA 1X1TA 3LF1A 3ESBA 3NHMA 4ZT6A 5FOSA 1HDYA 4DWOA 1EAMA 2CNOA 3AU8A 2I3GA 2J5XA 3NT4A 4IDEA 5BN3A 2ASVA 1XWWA 2JFOA 2QLFA 3SEQA 2BEJA 4EGQA 3GPCA 2G9NA 1TRHA 1MBZA 2GBCA 4UUOA 1VDZA 3FF1A 1Z5ZA 2K2WA 4W1QA 1VLZA 3E1KA 3QKRA 2NU8A 3D2LA 3REQB 4AJPA 1BVUA 1NJ2A 4GP6A 1EK2A 5AJYA 1Q50A 1TCUA 1X7WB 3WLTA 5JH7F 3R9XA 4NG5A 4N54A 4PC3A 4M9XA 2QAIA 4MJLA 4QUGA 5JBIA 1DWOA 3GLHE 3NHFA 4RVUA 3RTDA 5BSHA 3F8SA 5L3RA 3LLSA 4C43A 3VR2D 3TTWA 2ZI9A 5KOHA 4KE6A 2DFLA 3OZIA 4BRUA 4DLSA 1YQTA 4DT1A 3P9ZA 4EFNA 2BZSA 3BIOA 1CBUA 1YMQA 1L7BA 2XA2A 1QH1A 5IKEA 2ETXA 2J6IA 3N05A 2ZZNA 4U7PB 4ZRMA 1QLHA 2H1FA 1NPDA 3PLRA 3Q1LA 1XIVA 1JQAA 4LJSA 1DTWA 2JL1A 4AT1A 2BGKA 2YR0A 1IXKA 4UOQA 2WHYA 4G67A 5TMDA 2QG6A 2N47A 4FXOA 5AUNB 1E9SA 3HCPA 1W36D 1K3FA 1W96A 3V2HA 3RIXA 3B6EA 5KQSA 3NIFB 4M83A 4QBGB 5ALVA 3R5SA 3HWRA 1TM4E 1WDMA 3TG2A 3FUUA 1CY6A 4MV5A 5TX7A 3RE1A 1O6CA 2B98A 2NVBA 5T5QA 1KI6B 1DFGA 1YE5A 1PRYA 2D8AA 1SOUA 3I28A 4OREX 4S1NA 4WW0A 3HRIA 5IVDA 3V8QA 5KEIA 2DQSA 4HZUB 4MWSA 1TU3A 3QJGA 5JAIA 1F2TA 1IH8A 2VAPA 1W4LA 3H9GA 3WGKA 4DB4A 2VCYA 3ABQB 4QTTB 8ATCA 3BDVA 1TQDA 1Y5LA 3AVYA 1MX9A 1ZZGA 1A5BB 1N9GA 1SC6A 3CGWA 4H6VA 4IMRA 4HYTA 4MUFA 5CM9C 3VU0A 1KXJA 3EDOA 3GRKA 4KV9A 4ALKA 1ZN7A 1ZEJA 4C7JA 1XNQB 4NU5A 1IJKA 3O75A 4U63A 4WK2B 1LRLA 1D4ZA 1L7XA 5CT5A 5IANA 1U2GA 4DJTA 3A6PC 3QHPA 4Y2QA 3O8DA 2OT3B 2NSDA 1PQPA 4D3ZA 4D9FA 1HX7A 4ZOEA 3HGMA 4BFYA 3WIUA 3BH0A 3A1DA 2V3WA 4Z7JA 1BJRE 1W87A 3LOPA 4ILKA 1MB2A 4J9UE 1WDWB 1V6AA 3O73A 3FF4A 2W6IA 4BVBA 1EM6A 1AF4A 2Q5QA 3GPIA 1PR5A 4FHDA 3I04A 3ENVA 2IU3A 2Q4RA 2UZIR 3DFZA 3ZGZA 1XMPA 3NTVA 4G25A 2DT8A 5JSYA 4AMGA 2ZR7A 3D7KA 3COVA 1MW9X 4IF6A 4DHEA 5A4JA 5KYTA 3T15A 5EWLB 2QJFA 4OU5A 4LZNA 3HPQA 3QUBA 5D6OA 1DC3A 1AS0A 4Y6PA 2GXUA 5L7YA 3GWGA 2OPBA 3RGWS 1CRLA 1E2QA 4N7JA 5F2NA 1T2AA 4NRDA 1JMYA 3DCYA 4M6WB 4EPVA 1VDMA 2QX8A 3Q5GA 4KV7A 3QH4A 4N48A 3EC2A 2QYHA 2XAAA 4QX6A 3I01M 2YASA 1T13A 2I2XB 1LTQA 2ZAYA 5ITWA 5IUNC 5J59A 3WB0A 3FNQA 4L27A 3BMCA 1ZVMA 4DV3B 2ZUUA 1CP3A 4YVFA 4TXLA 1KYYA 4QE3A 1XN4A 6CHYA 3T9FA 2DGDA 2X76A 3A27A 4IW3B 1CR6A 4TXHA 2CLIB 1DOZA 1NLYA 4S04A 4U4AA 1NP6A 2DBRA 1W9MA 4LDQA 3WMGA 2CSXA 3OCZA 5BURA 2C3PA 4LWQA 1GNQA 1R16A 4P84A 3D1JA 2GSDA 2XMQA 2XVYA 3WKBA 3PR2B 1GTG1 4MVJH 1TQHA 4GOXA 1T4DA 3NHYA 3FSGA 4I5GA 2NTYC 1K5GA 4RFSB 5IKOA 3I1FA 1AKRA 1AUPA 4MR8B 4ZALA 5FBRB 5JALA 3CR7A 1F4LA 1PUXA 2D13A 4MW9A 4BVJA 5BMVB 1XMOB 1LQUA 4L3VA 4MRRA 4DNFA 3D3EA 1SQ6A 3VYRB 4XWOA 4ZO9A 5CDYA 4H77A 2E6UX 1V8BA 2FX5A 1PWXA 1HQKA 2ADOA 5TIIA 1JFFB 5CFZA 3UKDA 3ZGVA 2RGXA 2XZOA 3ENQA 4LX8A 1J1UA 2IXBA 5FTWA 1FLAA 1EWQA 3FOWA 3OIWA 4OLAA 2DKOA 3IOEA 1CULC 2EFEB 4J4HA 4GR4A 3MCZA 1XN1A 4UW9A 2Z2YA 1MXHA 1N36B 4MW5A 1IB0A 2Q6TA 2FP3A 5JASA 1H0SA 2XWQA 3R3ZA 2UUBB 3FIUA 4JQSA 3DNFA 3S27A 4N5DA 3O47A 4M1QA 3ZV5A 4GWKA 2JLZA 3AHFA 4FJ1A 4JZKA 1EZZA 3UICA 3ZY3A 1R10A 3I2GA 4MX8A 1UZMA 1HSZA 1TM5E 4YHBA 5D5PA 1W25A 4ADSG 3E9NA 1N4DA 2SECE 2WE7A 4D02A 5JSZB 1Z8FA 5FNVB 2GYWA 3R23A 1CJBA 1ISFA 1AN9A 2ZB8A 3CEMA 2PL3A 5DM4A 2FMIA 1Y8RB 5E38A 2ZUTA 2R11A 3R6LA 1C3XA 1T3TA 1Z4IA 2QN1A 2BAGA 4KXQA 4KPFC 3TUIC 4CMAA 4FSHA 4ZKDA 3IMEA 1DMSA 1JMVA 2H6EA 2PHZA 3GEGA 3KV3O 5GMOA 1UJ4A 3NEJA 2FZEA 1XCLA 2FN8A 1RSZA 2M2IA 2XECA 5G0SA 4P5EA 5BSGA 1Z28A 1N2CA 1KEVA 1SXJE 3MYRA 5DGCA 5CVTA 1FFDA 1Y1TA 1MAWA 3T7DA 4EHKA 3H2SA 4N8DA 1P45A 2H5IA 1NLMA 4GIBA 3ZJYA 1CT9A 3IPCA 2GCOB 3EA5A 3LHSA 1KRHA 2LKCA 3C70A 3IAXA 3MLBA 5EZSA 4RIHA 1QF7A 3EQ8A 3N75A 1U0GA 2FN3A 4DIBA 3HBMA 3T94A 5JJIA 1MJHA 3CR3C 3H8WA 5BT9A 1F51E 3EIEA 1S8NA 3I6IA 4C9BA 3R3JA 3KWLA 3FROA 1ENYA 3N2KB 3BMOA 3IQIX 2BKEA 2GASA 2HXGA 4FFPA 4MUIA 4OHFA 1Q16A 1TUIA 1D9XA 1YDEA 1LXCA 1COZA 2CBXA 2FZGA 3Q15C 4RESA 1L5HB 3O92A 4KMSA 4RZ3A 3VPFA 2RB4A 5CTAA 3SE0A 4CCWA 3ZV4A 5LOVB 4LDAA 1C7QA 1U6KA 2OV2A 3QFRA 4XR4A 1RPAA 5DCYA 2GN6A 2ZRQA 1CY7A 3D31A 1TK3A 4V0SA 2Q6OA 3OPMA 1KOJA 1Q1EA 4TOIA 5FPYA 3WP0A 1Y6FA 2VO1A 3HUFA 2Q99A 3DTVA 4Z2YA 1KTVA 3VGPA 1DVRA 2WM2A 2ZYDA 3NBMA 3GEMA 2H1SA 4F4IA 1V3VA 1U80A 2OESA 4DJJA 1GZ7A 2JIQA 2P2NA 3BKXA 3TKLA 3SY8A 5TXGA 2JATA 4LHSA 4E6PA 5KSYA 5FV4A 3VR6D 3G89A 1I5OA 3I9JA 4ITUA 2MSNA 2C3YA 2Z2JA 4IZ6A 2F62A 1PT7A 4QUBA 3EBLA 2VHCA 1E92A 1V26A 4XYEA 1LA2A 1A5ZA 2Q5OA 2PEZA 1JWAB 2X9QA 2UZAA 4PAQA 4KLAA 4EDHA 3KPWA 2WA2A 1K06A 4I36A 5EE1A 2WJ3A 3CNHA 4JUBA 3L4KA 1PZXA 3OWHA 3ZE0B 1DC6A 4GNRA 4EAAA 1TZ2A 1YUMA 2ZZMA 4NCNA 1BC5A 1ZJ6A 1RP1A 1XZGA 3DOCA 1F8UA 1X2BA 1EGVB 3DO8A 3KJGA 3DW1X 4K6OA 3TMYA 3N87A 4AJIA 2XNCA 2QBYA 1KO5A 3TDNA 3A0RB 1N0WA 1U3TA 2NO6A 8MHTA 4JSYA 5ALZA 2O5RA 4YRJA 2XMSA 1N5MA 4BX2A 4C0AC 4RTQA 121PA 3D6HA 2YQZA 3ONEA 3PNSA 3JQEA 1IG3A 4H7EA 1NWHA 3QTLA 4IG4A 4LW8A 3A11A 5LDHA 2DWUA 3MWYW 3E27A 4L6AA 1X3LA 4V1CA 2GBLA 2H08A 4LCEA 1VCOA 5ALNA 5LA6F 3S68A 4OG2A 4RVCA 3O1LA 2ETVA 3LBAA 1LLCA 1UMDA 4V1CB 1U11A 4O4JF 1NYQA 1RQGA 4WXPA 4TTTS 2NU7A 1N8TA 1DKPA 1U3UA 4HN4B 5J5CA 3R7WB 3DCJA 2NP6A 1U90A 4AUKA 2Q8NA 4JLSA 1CF2O 4XIFA 4WKPA 2QVGA 3QUCA 1FDVA 1NVWQ 1D6NA 2YUIA 3GZTB 3MWEA 3GVPA 3DJFA 4P58A 1FP1D 2RGDA 4UZSA 3K5PA 4D7AA 2QBYB 1PWYE 4XLLA 1R4AA 3CEHA 4YDQA 5F12A 1H5UA 3MTEA 3CCFA 4DADA 3ZWVA 1SD2A 4EMTA 2PTGA 2QM8A 5T8KA 2IUYA 2W83A 3GQVA 1P6XA 1LSOA 3FCAA 3G2LA 2GERA 4DUYB 4QGHA 4DIMA 5F2EA 4PZ0A 3U4CA 2IH2A 2EKZA 3FWHA 3LX4A 1HQCA 5JDIA 3HCRA 1PR2A 1SCDA 1SHTX 3KJIA 1NXQA 4Y6LA 3T9CA 1K4MA 4KQWA 1UAGA 2B0CA 2MYTA 5GADl 4PXSA 1MEJA 3UZUA 1VE5A 4TV8B 4ZOLA 4D9KA 4L5BA 2H2DA 1Z4LA 2XE4A 3OJWA 5BQ5A 5IEJA 3QY0A 1SEVA 1EGQA 2WTAA 3LUGA 3RUCA 3ZHBA 3E8XA 4D82A 5KREA 1PLKA 3A9RA 1GVNB 1NYLA 2HNKA 3ZU4A 1I7QB 1W30A 3FPSA 5WRFA 1QRRA 2VNSA 3AEUA 1KY5A 3DGFC 3CVUA 3RC7A 1GRQA 4RJKA 3O2QB 1NMYA 1IEWA 2NOAA 2QYSA 5JPDA 3PNBA 2PV7A 2VHZA 1CW2B 3IVCA 4G5XA 3C7TA 3A9TA 3L07A 3QBJA 3SJ7A 5DXFA 4OIMA 2GPSA 1V16B 2ZIZA 2DAPA 3GUYA 4MCHA 4DDTA 5BOSA 5EJ5A 2RGUA 1J25A 2B1QA 4G6ZA 4NPAA 4CF3A 5HW0A 4ND2A 1C3LA 1FDOA 5DE3A 3W2GA 3BMOB 3WYEA 4CYMA 5KDLA 2CL7X 3CBGA 2AL7A 2AZXA 2UZ0A 4MIOA 4MVCA 1TT5B 1QBGA 3UG7A 2PRIA 4JC5A 2OVFA 3WNVA 5FD8A 1NWCA 3H2IA 3SMVA 3ECCA 1CZHA 1OZHA 1MAUA 2XB2A 1KJJA 4ZCIA 5GTDA 3W6PA 3PTZA 3RS5A 2ZJ2A 3CZCA 4BVGA 3PYXA 2PQMA 3GL9A 4OSOA 1SVLA 2JJ1A 4JUAA 5HOQA 3NVDA 2C3OA 3M83A 3DMYA 1UQUA 3B6KA 3K15A 3GJQA 4ZODA 4NI5A 4MV1A 4RA9B 5KOYA 1I7LA 3D6MA 1QQ5A 4RLSA 1Z88A 3C8DA 3M5WA 4WERA 2NX2A 3CLSD 3LCUA 1BMQA 3K9WA 1VBKA 2Z04A 2ZVPX 4NOMA 3UTCA 3H8VA 4P08A 4B46A 1OYWA 2JJYA 4Y6QA 1UIMA 1RKBA 4F4HA 3OCXA 5EJ7A 1NU6A 5KJ1A 2GBGA 2Q5EA 3W6UA 1YE3A 2PUHA 1YOBA 2C4WA 4RIIA 4WFKA 4CIYA 3PTAA 5JSZA 1BFDA 2VK8A 5KVCA 3KSMA 4A6DA 4HRAA 2CXOA 1BQEA 2H17A 2IGTA 1OI4A 1M2OA 4QU5A 5P8WA 1GCUA 2E82A 2GOYA 5ELLA 1VA5A 3WV4A 5J4YA 5K0BA 1LU9A 1SG9A 4KLCA 2Y8EA 3AVPA 3KXIA 3PPWA 1JFTA 1JLSA 3BEDA 4LEIA 4WCFB 3NJ4A 1DIRA 2O2IA 2AA3A 4BO5A 2B4AA 2H8GA 2QQEA 2PUWA 1NBAA 3T54A 1UXJA 2V8BA 2Z3ZA 2ZULA 3JQFC 3MRSA 5AI4A 1DARA 4O2LA 3IILA 1YFJA 2PZGA 4KACA 3O8NA 5L40A 2B1JA 1OTHA 4EVIA 1UT6A 2Y0EA 1YR6A 3VFDA 1O4WA 2V7GA 3ICCA 1FDWA 1UJNA 3GLFA 2Z2ZA 3I5AA 4AM8A 3GFGA 3TDMA 1Q77A 3HL4A 4CIXA 3ZLJA 2GYYA 1I3KA 1O97D 4ALNA 1T29A 5THKA 1EX6A 4G41A 4RZXA 2XUFA 3WLFA 2WDPA 3Q5EA 1JLRA 3BDAA 2ZS7A 1P0MA 4Q4CA 5HPYB 3ZDFA 4ZREA 4QDTA 5BVHA 2PGNA 1GPWB 2VHJA 3PXCX 4LDPA 2HXSA 3GDOA 2UYOA 3I6ZA 3NNDA 4RFSA 3E5RA 3HADA 4YACA 4IFIA 3VKHA 2AK3A 1IOLA 1U7WA 1U7ZA 3WIDA 1ORTA 4RK6A 5KIAA 5JV5A 2PGJA 1W2GA 3KT3A 1X1AA 1IB6A 4MVXA 5ALLA 1PDOA 2QLBA 3BFJA 1CY1A 3IKLA 1T25A 1MT0A 2OV8A 4LZJA 4JSRA 3PC8A 4UVDA 3KYJB 3WYBA 2I6SA 4JHLA 3LBFA 4I4TA 1ABFA 1QCDA 2WIAA 3RCBA 1VXRA 1QFXA 1XK7A 3QWHA 4UMEA 3T9BA 1ZMXA 1UXOA 2Q3JA 3GAZA 1AJEA 4GLLA 1OIXA 3ZWNA 5TQ2B 3CE6A 4A10A 2AX4A 2XTZA 2JAHA 3ZQ4A 5HUQA 1JR3A 3PEFA 1C7IA 5CK4A 1X13A 3DVRX 4INJA 5ADVA 4QOSA 3G9UA 4XUCA 1H6BA 2FFQA 4LRTB 4L78A 1VJ5A 3HJAA 5JXWA 1GTVA 3C14C 5H9VA 3FHCB 2DQZA 2VDWB 3WK8A 4CI9A 2EOAA 2ZRGA 3IVRA 4CMEA 1XNRB 2BSQA 4F2GA 3SAJA 2BFEA 4AXBA 1EJ0A 4R05A 1I1HA 3E3MA 1BA3A 3T4EA 4D3YA 1N5JA 4HDSA 1R4NA 2V6GA 2QVZX 2O0MA 3QWIA 1EUDB 3H6GA 3FVRA 2J67A 3QEMB 2VNHA 4XAQA 4GXQA 2R0QC 2E55A 2H5LA 3Q8KA 4OXNA 1Q91A 4LBYA 4U2GA 3O26A 5JFTA 1YAJA 3E18A 2JK0A 1VRWA 2JRCA 3GLFB 4JA0A 5EVCA 2BE9A 2GLTA 3FSEA 2XVXA 1ZGZA 1PLJA 3HNOA 3RVLA 3TOCA 4EFKA 4ND8A 5LQMA 2BGLA 2YZ7A 2WVAA 1FPQA 2ZRFA 2QVCA 3JYNA 5CR9A 3WRYC 3KEMA 4A27A 4QUKA 4ZTZB 3ZCRA 2EP5A 5EKXA 3VKVA 4CMJA 5CFNA 2C7QA 4RVNA 1COWD 4MPJA 4WNAB 2XOKA 1GPNA 1K5PA 1KSJA 3NU1A 4Q4JA 3U48A 2O5VA 1IZ0A 2ZVDA 4RMJA 2WJHA 3A1TA 3RHSA 1R00A 2Z6QA 4P3YA 4IUBS 3QELB 5UKDA 5JECA 2YJNA 5IFLA 5LMNB 2F1RA 3C3EA 1RWPA 3FNFA 3WLAA 4G4GA 4GUAA 4ZDIA 2NPIA 2XLCA 4RXUA 1G21A 4HHEA 5TGTA 1SUEA 2CXNA 1FYFA 2R8BA 3E9MA 1JEYB 4CU5A 2NPOA 1FRQA 4D45A 5EIXA 4WQMA 2Q6KA 3GAMA 3SYLA 5C1DA 5GQSA 4QJBA 3WLNA 2H3HA 1XYYA 2A88A 5CFPA 1Z0FA 2PMEA 4RDXA 1IPFA 2W6CX 5BW4A 4GOMD 1SB9A 4I5EA 4Q39A 3OUZA 2CVHA 4YA6A 5CJJA 1FQJA 1AQNA 2VQ6A 1UBRS 1QGDA 3RVQA 1I30A 2HDOA 5FWNA 4OGWA 3ELWA 4PGFA 3AYZB 5CXXA 1JHYA 3EVBA 1ADGA 3DZIA 1J2TA 5IKXA 1H22A 1LK7A 2BMJA 2VF7A 2WTMA 4G2TA 3BTVA 1KZHA 4RH1A 2H54A 2W6NA 4Z0NA 5LLDA 1RMYA 3D7MA 2VXYA 3IEXA 3ZYCA 2PKQP 5KTPA 3KVYA 1NBME 1LNQA 5AI8A 4PIMA 1XEWY 3U3MA 4B6SA 5A4MS 1IHUA 2FUKA 3OA2A 4KITB 1XZCA 3AUFA 2CMFA 2J85A 1W0JA 2XVZA 3H83A 3W5VA 4N0MA 5JFGA 4M3NA 2PUJA 3DC2A 1N2IA 2BMFA 3CLTD 4HDCA 1DZ3A 3P0HA 1JTFA 4IX9A 4TTAA 3KTAA 3BX1A 1SC1A 3WBBA 4IVQA 3BAFA 4U39A 4D0RA 1AA6A 3HJTA 2WSLA 3QW4B 1ZN2A 3HP1A 5EUBA 4RTJA 1NVVQ 1MOQA 1OGIA 2FZWA 1UJ2A 3GFQA 5ICSA 2OCBA 4RADA 2H4JA 4MUKA 4KFTA 4WXYB 2JZOA 4X20B 1H0RA 1D2RA 1EFDN 3C8UA 3Q3EA 1EVJA 4QYTA 4GLOA 4DF3A 1WY5A 1KO1A 2WF7A 3AEUB 2HADA 1E3IA 3KEQA 3QYAA 4BZZA 4EITA 4D8YA 2RHOA 2X5NA 4IX1A 3H8JA 3QXCA 2VRWA 1BWSA 2IC5A 1HNWB 1G20E 1BRTA 2ZSKA 1OA0A 2EFYA 4G0NA 4E70A 2QTVA 3MELA 1OH6A 1DOAA 1MP0A 1Z83A 2WAYA 4OY3A 1FNBA 2CXXA 1DV1A 2VPPA 3HJRA 4L2IA 3TW4A 4DV6B 2WUVA 3G49A 2YOFA 2ARKA 3OM0A 3PR1A 3QXGA 1DAKA 4FM9A 3ZHRA 3VH3A 3NPMA 4NZ9A 4PU0A 5D85A 1C7RA 1NULA 1R18A 3OAAA 3U3JA 4Z1MD 3HDTA 3GJZA 3W5JA 1H1LA 2AFIB 3L1KA 4CLOB 4CMIA 2C2KA 4YRMA 1Q2UA 1QZZA 2PR7A 4QBIA 3C0KA 5AKLA 1EP1B 3N2LA 5AVUA 3HK2A 3RANA 3PFCA 3NG1A 4BFCA 1V8FA 2OM6A 1UC4B 4J1TC 5E95A 1B3RA 4PFJA 4JVOA 1O89A 4YP1A 1EWYA 3QFFA 4HH4A 5H16A 2WJJA 4OLBA 2VHEA 4X63A 5AJHA 3IQFA 2Y4NA 1UJ5A 3KHTA 3GWZA 3MTGA 5G53C 4Z7QB 4PLVA 2AOUB 5FH9A 5ALWA 4BUJA 4WKNA 1GTSA 4KFUA 3LSYA 2HZ7A 1WMAA 3GLGB 1XTRA 3BCRA 1IRIA 1NMQA 1JJAA 1UXHA 1ZD4A 4QPZA 4Z9YA 4NFHA 2CHFA 3SBEA 1ONSA 3HFGA 1BS9A 2CZCA 2IIVA 3RYHA 1C4OA 3LP6A 4TQ9A 5BUSA 5GZ1A 1UMDB 3T1OA 1G1MA 1RIFA 1B4DA 2EL9A 1HE4A 1SG0A 1X7GA 2NZ2A 3OTQA 1SVUA 3JVDA 3PRYA 1XMXA 2J0SA 5GONB 4TV9F 2GETA 4FU0A 2BV3A 3TZKA 3DBVO 1U9JA 3WMXA 4JGGA 4RVDA 4U7TB 3WXBA 1AZWA 4C06A 3E7FA 4J1SA 4JNCA 4PR0A 3C4JA 5D1HA 2OXCA 3U7RA 3C3CA 5DGDA 3FHOA 3EEFA 4GBGA 1DIOB 1E94E 1ZRSA 3K0KA 3GT4A 2GRUA 5KOJB 1H2XA 1M8PA 1T8YA 1JAZA 3NHZA 1YB4A 4L4ZA 1B8VA 2A0YA 2DM6A 4MIYA 3UMCA 2QJRA 4AO6A 4D9CA 4F4FA 1Z0IA 5HIKA 4F5EA 4WBNA 4ITVA 2VYCA 1IL0A 3VPHA 2RBGA 4QXOA 2AG5A 3DUFA 4NP6A 4Q9KA 1KI7A 4W63A 5E7JA 4W5NA 3DEFA 2WUWE 2XT6A 4WLNA 3I01A 1P7CA 3ORFA 2C4NA 2IPXA 2K4MA 3I1JA 3IPLA 4GE3A 5J5VA 1IHOA 5TDHA 3KRTA 4QVGA 2BN4A 3KIPA 1Q7EA 1ZINA 2RBEA 5CNKA 2OY0A 5FJJA 1JV2B 4DMUB 4LWPA 3DE1X 2H31A 3L2OB 3PUXA 2X7XA 3KLNA 5FAXA 3ZD8A 3V80A 4AKHA 1N5IA 2YFHA 3RHFA 1PJZA 1VHLA 3T1QA 3TJRA 4BJ1A 3CZQA 2ZTMA 2C54A 3GNLA 1QZUA 2J3EA 3SHOA 1AH2A 2DTDA 4QICA 4BKRA 3G0BA 4MUGA 5A0TA 1TYEB 2PLRA 4QG3A 4GZLA 4DN6A 4KH0A 4EW6A 1ACJA 1TKCA 3ZWWA 1UBUS 1AY0A 1S2GA 3S2FA 1AB6A 1OLSB 3SN6A 3I8SA 5K8IA 3DLIA 1CEQA 1D9ZA 2BEKA 2ZUEA 2W2VA 4M7RA 3REFA 4N0DA 1RXCA 1R0CA 5FI3A 1ODKA 3QVUA 2Q2OA 4OHUA 2A2ZA 3H04A 3O3OB 5LB2A 1SELA 4FXPA 5ILGA 1SXQA 4FNOA 1VMIA 1NKTA 1SHZA 2DFNA 2NO1A 3M4ZA 4UD2A 3BSFA 4UTOA 5EKDA 1E3MA 2Y4OA 4RTKA 4HLUA 1ULBA 4BV3A 1QQ7A 1L9KA 3LW8A 3WJ1A 2J9FA 5E4YA 1Z6YA 1J39A 1XWIA 3KR1A 3L0IB 1B0PA 5HRAA 1NZJA 1ONOA 1PWEA 2ZSDA 3LHKA 4UULA 5F2OA 3F5QA 4BLTA 4BRZA 1FQWA 4NJOA 1R9JA 4GKBA 2C03A 4LPKA 1N9ZA 4LC1A 5AXBA 4AUMA 4N8SA 4M7OA 4O2BB 4EB0A 2FOIA 3RUPA 2FSIA 2NV2B 2ODWA 3HCWA 3K9FC 3G5TA 1R8SA 4G81A 4R1UA 1YJ8A 1EUCA 1OA1A 3EBPA 3OHSX 4J2OA 4QGBA 4BNMA 1DDOA 3X1YA 4D5EA 1XL1A 1SBQA 2Q1XA 1X0XA 3DF7A 4RWZA 4TN5A 3W4IA 4C08A 3WNDA 4C4PA 2JCBA 2X6TA 4MVYA 1CX9B 1BKSB 1MDBA 4TMFA 5ICFA 4GXTA 2QDXA 5JVDB 1ONPA 3TSOA 3UTDA 3AR2A 1BZYA 3HO8A 1KGSA 2QXYA 5HFNA 2YVKA 1PGQA 4JMLA 3CLVA 2AT1A 2C98A 5DI3A 4BB5A 4FINA 1FVOA 1Y8RA 3L8HA 5AESA 4DCMA 3EEOA 1XEFA 4FMCF 6YASA 4I8XA 3EIXA 5A04A 1T3GA 4F9GA 3OE4A 3S40A 1KZ6A 1P33A 2P2YA 2PLFA 1DELA 2QTTA 1CETA 3LP5A 1IVSA 2FY8A 4WUTA 2QU8A 3JAWB 1FQKA 3D6VA 4X95A 3U13A 5HXAA 1RMTA 5MN4A 4KR2A 3IRVA 2P0AA 3P4YA 1UBEA 2D0OB 3I9KA 4AJKA 4XQEA 1K7EB 1C9YA 1CS0A 2QR2A 2VT6A 3TOZA 3WWYA 2HNBA 2LIPA 2EGHA 4LJKA 4P7GA 1DT5A 2AWOA 2EP8A 3I9LA 5FTLA 3W5AA 4HQOA 4ETIA 1FE8A 1JFFA 1YC5A 2FPKA 3FSJX 3WGUA 4EO9A 4RK5A 1K7YA 2QX4A 3PGMA 4RPKA 1PKXA 1YBVA 2FJUA 3ZGLA 1GZUA 3PGVA 5KSPA 3AONB 2VSFA 3MEQA 4I5FA 4N65A 1NP7A 3L7CA 1TL7C 1X1QA 2WUGA 1W0KD 3RYHB 4DXAA 5IZCA 4MR8A 4LHWA 1OAAA 4E5UA 1L5SA 1EVLA 4A0RA 2JGMA 1P5HA 1JJ7A 3GMTA 1E4EB 1NNUA 2ODQA 4ES6A 3GBVA 1V3TA 1VKJA 4MV0A 2NADA 1PNRA 5EXXA 4BP3A 2FUNB 5DM1A 1ZM7A 4RXTA 2AMYA 3D4LA 2REQB 3C8HA 3ELYA 1P2BA 2VH5R 1YBMA 4HAOA 5FOWA 3KOUA 1XRNA 5LXTA 1XXHE 3DE5X 4Y6RA 3IXLA 3HU2A 3CNNA 2QB5A 5EJMA 2HLDA 3KAJA 4LJ9A 3LMKA 4Q21A 4I1SA 4IR7A 5K03A 3B1ZA 5IT5A 2EJCA 3ZE9A 1OUMA 1RKXA 4PTZA 1G16A 1I2DA 2ZTVA 2PZAA 2ZT6A 3TIXB 2QX9A 3GARA 1OJLA 1U3DA 3D6TB 4Y0NA 1E0DA 1YTUA 1QF9A 2F90A 3V42A 4I14A 3KZKA 3ROTA 4IH9A 1Z0SA 2AR9A 4OD0A 4B3IA 3A2MA 1FYXA 4CIWA 2GI4A 3EH1A 5JI3E 5AW5A 1KZ1A 4HNSA 3CLUC 3B52X 3R1IA 4UREA 3W2TA 4BZQA 1JI3A 4BX9A 4QO8A 4LZZA 1G9SA 1E6KA 1MRZA 3TTVA 4A0SA 2W2QA 5K3BA 1CQZA 4RVGA 1V3UA 1T1SA 2BFFA 4U8GA 3DMGA 5KVQA 3RSQA 5AWFC 4MARA 1SK8A 1XR3A 3REOA 2FMUA 4Q93A 1IY2A 1Y3HA 5KNCA 1DWQA 1R27A 2P4SA 3TEMA 2P9JA 1VHDA 2N0SA 3LUPA 521PA 4E4YA 3L1JA 5DN6D 1WUTA 2EZ8A 3A1EA 1HT2E 2MMGA 4QPPA 4URVR 5GZ3A 3WY9A 4GM0A 1DKRA 1DL5A 1L5WA 3B2QA 1P60A 2OLKA 3KG2A 4R0VA 1SCKA 4MI1A 4Y2HA 3URMA 3VC2A 4DA9A 4Y8VA 2NO5A 3KSBC 1N6IA 4FS8A 2W2MA 4FFDA 3WV5A 5JC1A 1E32A 3KHKA 4KQFA 3ZHXA 5MGBA 3NCTA 1Z33A 4NBWA 3AF3A 3BWVA 3CLTC 1SZJG 3D3JA 4LMBA 2HCTA 1H9CA 3X1XA 2CVQA 2Q62A 3IHLA 4HB0A 4P83A 4DE5A 5TRTA 4A5SA 2PZBA 1ZUD1 2JFXA 4GPAA 1WPQA 1R5BA 4CEHB 5BWLA 4XW2A 3TM4A 2ILVA 1U1FA 3M6AA 1E5VA 3R3YA 3ZVLA 4BGEA 1OBHA 1K27A 5DH9A 4B3GA 1SVNA 3I1YA 4XI9A 2O8EB 2JAXA 2Q3EA 4HNHA 1GFIA 1FLDA 3JYLA 4BQFA 2LRHA 2I0FA 4EQZA 1YQEA 2GJ4A 1ILWA 3IAM1 2ZP1A 2X6RA 1C14A 4FOSA 3DDOA 2Q29A 1F8XA 4X3PA 3HCOA 1A4UA 3RS9A 1GO2A 3D43A 2X0NA 4ZTBA 4TYPA 5KSZA 2GM3A 4U5XA 3V3KA 4A91A 5FLKA 1W7AA 3RVPA 3N53A 3U7JA 4DG8A 4G0UA 3BWMA 2O2GA 1DC7A 4GPBA 1JNYA 3GT0A 1XFAA 3ZGOA 1SNYA 3E05A 4X44A 3R9XB 4KIUA 1M5RA 4OXQA 2FSFA 2OR3A 4NMLA 1TVKB 1Z75A 2MINA 1QVRA 1F6BA 2W2PA 2Y1DA 1GA4A 4DANA 1VP3A 4OI2A 1IK4A 5CYPA 2DFDA 2NGRA 2ZUFA 3S28A 1AO3A 3BB1A 1YZHA 2YNMD 1DRJA 4UM8B 5E6RB 1EUDA 3ZI7A 3KQPA 1HZZC 3A4TA 1UFOA 5KYNA 2BEWA 3S70A 2B20A 5DEIA 4BYGA 3I76A 1JH8A 2O3RA 3CVXA 1L7QA 2BI7A 2X1VA 4TROA 2WWGA 3QKSB 4UBNA 1TYCA 2YFQA 3TGPA 1FJXA 5AYVA 2SCUB 2FLVA 3ZVMA 3QGMA 4FFRA 4IJQA 4RD3A 5DYGA 4RETA 3V2UA 4I6EA 4BTEA 4CF6A 3V1YA 2UV8A 1UXGA 2LUOA 4QNRA 3AVXA 2ZWVA 5ALIA 5JSUA 1QO0A 2JFNA 3N0TA 2OXRA 2XMCA 1L4EA 4FONA 4HWTA 5B7NA 2BGWA 4Z5XA 3IAUA 3PPVA 4KUGA 2N3ZA 1UXKA 4JGIA 4N0QA 1NW7A 1VP9A 4E14A 2I8LA 1IBMB 2QPOA 3V1MA 2F3UA 2R68A 4RACA 5LXTB 4G24A 5A6VA 1I51A 2REQA 2MSLA 2R6AA 2VK2A 2H2GA 1T1GA 4PPFA 4OJTA 4R51A 4CG2A 4IZHA 4D3SA 3T61A 3L0ZA 1W19A 3O8LA 5AW9A 1CUJA 5THQA 1E4EA 4QYXA 4URUR 4JLUA 2A30A 1VHWA 2F1JA 4NCJA 4PR3A 2XUPA 3H5RA 3HCNA 4RJ2A 4XQCA 4TYWA 3P20A 4GPIB 4XX1A 4CL0A 5BR4A 3ITNA 3FOEC 1XDGA 4LTNA 2HMTA 3F6YA 3PC8C 4CKXA 5B2FA 5C46F 4D8UA 5I4IA 5AVZA 2PSFA 2JW5A 3LKVA 1SWVA 4KAAA 5BSVA 3N39C 1G2OA 2VF2A 5EYPA 3V8NA 3F6CA 1V1JA 3IQDB 3CRRA 1JSCA 2EYUA 2C2WA 4ZHQA 3KETA 3PRJA 1H5NA 4WZAA 1C9KA 1WU7A 2VT2A 4RVOA 2D06A 4AY6A 2GA9A 3CF6R 1WBBA 2NUPB 4QEKA 4CUJA 4ZYUA 5AJWA 3OMXA 4HMOA 4U6SA 2EF0A 1HE3A 5DW3A 4KXWA 3DXFA 2ATXA 1FBTA 3NOOA 2OHOA 4RQBA 1P1BA 1N3LA 4WCFA 4XB6B 4D9JA 4JUCA 1H85A 3TFOA 3OJLA 4RHFA 5DHFA 2WOOA 4KQ9A 3VKWA 1P2UA 1I1OA 3RVSA 4L3OA 2GF0A 3Q9LA 2JIZA 3D6NB 1I0ZA 3LTEA 3QHQA 4I19A 2YHIB 3OCUA 4J9VA 4GOJA 4UHFA 5B37A 5A71A 1UBCA 3BBLA 1EXWA 2PUBA 1QQTA 2DYKA 2FZCA 4OFZA 5AJTA 2XNDA 3TQFA 5C8VA 1FRVA 2RHCA 1U0HC 3S1AB 2VTEA 3DLBA 1J8FA 2HK9A 1UM9A 1EFKA 1P77A 1RBQA 2Q3MA 3OUUA 2LBPA 1WCIA 1GZ6A 1THTA 4GPEA 2BZ0A 1JR4A 2VAVA 4NMHA 2LDBA 1KOFA 3T0GA 1NY6A 4D8XA 1H2HA 3K94A 3U4IA 5D3ZA 1FMLA 5GV7A 5CYOA 3KB8A 1JG3A 2O6HA 1PG2A 2VK1A 3I2FA 3S0JA 4KRYA 3EXFA 3ED1A 1YS6A 3O8QB 5F76A 4XRRA 4AS3A 1EBBA 5DIZA 3WBKA 2AG8A 2R1TB 4ERNA 1T5DX 3G7UA 2BFDB 2XQVA 1OF1A 2QT1A 2Q5LA 3MAGA 3B82A 5K0FA 1OFUA 3B51X 3WNQA 1XD2B 1GAXA 1UBKS 4C03A 2AG6A 3FUCA 1M83A 1IQUA 1FRZA 1PFVA 2QUJA 4NK4A 4Q1DA 2O8FB 1L8LA 1W5BA 3DZ8A 4JL5A 1Y81A 2OG2A 3PXDA 2DT5A 2J9FB 4FHEA 3LCJA 4LCBA 1CXZA 3HN6A 4KO8A 4IV8A 1NBWB 5K45A 5ADHA 2NYAA 3TSWA 3WGZA 4ZJYA 4JH0A 1C4XA 1M10A 3P1JA 3FKQA 1KQOA 3ASVA 4ZQEA