4LHWA

Crystal structure of rab8 in its active gppnhp-bound form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
171
structure length
171
Chain Sequence
DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-8A
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 58
structure length 171
sequence length 171
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhwA00
3TSWA 3GLFB 1KDPA 1IOZA 4DZZA 4Q19A 1OLOA 4YXWA 3L0SA 3QEJA 4TQ9A 4LOAA 3CRVA 2MSDB 5KOYA 1MRSA 3BB4A 2QEQA 2BOVA 5FR2A 5J40A 1W0JA 4UNQA 2PZEA 1SVOA 2ZQ5A 1N0VC 2XXAB 1U81A 3R8CA 1P75A 3K8YA 1ONBA 3NKVA 4IEIA 3RS4A 1VPLA 3EWSA 2WHXA 3QPWA 3LAWA 4MUBA 2LKCA 2QE7A 3GEEA 4FW9A 1YZKA 4YC7A 1NL3A 3LWNA 1W0JD 2W83A 4FINA 3QKSA 4NTZA 2ECKA 1YHNA 4G1UC 2PT5A 4PC3A 5A4JA 4D0GA 2EFGA 3LO5A 1Q0UA 2PCJA 2GJKA 5DHFA 5EQTA 1KSHA 3PUYA 1W36D 2ZYVX 1P2VA 2EVWX 2WOJA 2WSSD 3IQXA 2ZRPA 3RDPA 2QPTA 2XTNA 1KKMA 1KDOA 4OHZA 1WF3A 4NL4H 1FTNA 5KNCA 2NPIA 4B3XA 1OHHA 4DCVA 5DN6A 2B7BA 3IO3A 1AZTA 1RRPA 1MV5A 2BBWA 4YMSA 4LK2A 3WXMA 4CF7A 5CYPA 1Z28A 1NMZA 1S8FA 3FB4A 3OIVA 4IDNA 1TPZA 2HV8A 2OFOA 4QC2A 2PEYA 2KJQA 4TL9A 1YVDA 2C9CA 4Y0AA 1L2TA 3QXJA 2ZYWX 3NBXX 4M1TA 3TK1A 1N2CE 1P5ZB 4S2EA 1WCV1 2GESA 1E9SA 4A6PA 4D4MA 4A1FA 2RHDA 5G53C 3IEUA 4HAXA 1E9BA 2JLSA 3A4LA 4C0QC 4C0AC 5EXPA 4E09A 2BVNA 3LLMA 4EKDA 2WJGA 2EFCB 1SKYB 521PA 3TLXA 2J0QA 2C77A 2QSZA 4JSTA 5LB4A 2XJ9A 5K8TA 5D3QA 1ZIOA 3WRXC 4DVGA 2GNOA 2RHMA 3C5CA 4U00A 2ZR0A 1R0WA 3DDCA 1CR2A 1E2FA 2BMFA 1ZIPA 4W5JA 1UF9A 4XWKA 1D2MA 3EWAA 5FOWA 4US1R 4NYMR 3SEAA 3PR1A 2ZM5A 5KPDA 3PUVA 2NGRA 3KJGA 1NKTA 5TDHA 4AYTA 3BFXA 2FPLA 2NO1A 1EGAA 3L0IB 4QNMA 3FPAA 3EIEA 4HAYA 1U8AA 2VHJA 1X8LA 1T0JB 1G6HA 3V4FA 4Q03A 5FR1A 4C0JA 4Q4HA 5GJBA 4UQOA 1IY0A 5DH9A 3AVTA 4YMVA 5EXXA 3FMPB 1SVLA 3IHLA 3MWJA 2NPFA 2JLZA 4PSVA 1HQYE 3PITA 3EPKA 3OEED 2JGNA 2RGCA 1G7CA 3UPUA 4B3DA 2XNDA 3T1OA 4DLWA 4E07A 1VDZA 1TUEA 1DTSA 4OJKA 1SXJC 2FSFA 3QPUA 4MGIR 3AH8A 2BMEA 4NYJR 3CF0A 5FOUA 1KJZA 1W4BA 3BFKA 3GLIE 4MGZR 3KB2A 4FMBB 2PZGA 2DPXA 4XIGS 2C95A 1G64A 3L43A 4AC9A 3ASYA 2QBYA 3HYRA 4OHXA 1NLZA 1HURA 1UDXA 1E2EA 1Z3IX 2DY1A 1G20E 2QN6A 1SVKA 2CLSA 2Z6VA 3G5UA 1VIAA 3MJRA 4M1KA 3PENA 2HEIA 4EIWA 1NIJA 1ZRHA 3T35A 2ZETA 3FKSD 1Z08A 4DC9A 2GA8A 4JLKA 2JA1A 1P62B 3BXZA 2KWIA 5AUPB 5BN4A 4EJSA 1HE8B 4WOPA 1OSNA 2G88A 4TQUS 2VHUA 2H57A 1XD8A 3I3SR 4NP6A 4BWYA 3T12A 1E2QA 4UNPA 1VHTA 4M9ZA 1D2EA 5JJLA 3GMTA 3E2IA 5EP3A 1TUIA 5HE9A 3B82A 3A4MA 5AR1A 1KDTA 4A82A 4BECA 2QPAA 4D4LA 4L16A 4HAUA 4M1WA 2V1XA 4OJQA 1G8YA 4NE2A 1PV4A 2ZRNA 4EPVA 3IILA 2W0MA 1HY3A 3HJNA 2GZAA 4B2LA 2Z83A 1E1RD 2Z5FA 4II7A 5AUOB 2ZXUA 4K8OA 4B71A 2GXAA 2O8DB 4QXAA 4Z1MA 3KTAB 1ESMA 4TQAA 4KLNA 1HYQA 3KKQA 3M4YA 4JLMA 2AD1A 3I8XA 3QNUA 3B1XA 1Q57A 4L4UA 1T5IA 2KB0A 3B60A 2EYUA 5CB6A 3HU2A 2IYWA 2IYQA 1I2MA 2GVZC 2P5TB 3CR8A 3L2OB 1GNRA 5E95A 3H84A 4QG7A 5FTLA 1CJKC 1KMHB 1OXVA 1S9HA 2MMCA 2VYFA 3L8ZA 3DKPA 4XVRA 5KSPA 5J4YA 1E0SA 4Z1MD 2GZHA 3C41J 3GLGA 4LHYA 2YWFA 4B6EA 4EPYA 3HR7A 1VHLA 2NO9A 3QUSA 4JVNA 1G3MA 3UK6A 3HR8A 1ZD9A 3Q85A 1NBMD 4R2IA 1OKKD 2GCNA 4GDFA 3BWDD 1E2DA 2QT1A 4DEYA 2ZRKA 3O8CA 2CLDX 1W44A 1BH2A 3TUIC 3WMEA 3QKRA 3RS3A 2QT0A 1BOFA 1BO6A 1R8SA 5KUTA 3E70C 3LW8A 5JRZA 2GTPA 5L3VA 1NY6A 1S2MA 2JLYA 4A2PA 2P5SA 4A8JC 4LI0A 2J9RA 2V7QD 2HJGA 5GADl 1OXXK 3B9PA 3U6KA 2BDTA 1WE2A 4Q4AB 3N2IA 4RKFA 4Q4JA 2R6FA 4HDQB 3TKLA 2ZUBA 3LLUA 5F9HA 3K0AB 2IW3A 2QGZA 3L0PA 3GJ6A 4NYMQ 4PO1A 4ASUA 5H8WA 5UKDA 3LA6A 3SOPA 4P3YA 2PJRA 4TL7A 4DKXA 2PBRA 2F9MA 2RGDA 2RMKA 2P65A 1T9HA 2HLDA 1F60A 4WXRA 5J4KA 1DAKA 2W2XA 3GLFA 2J7KA 4N3NA 4C0HA 2CJWB 4RD6A 1XPUA 4O3MA 3BS4A 3I32A 2H8KA 3OE7A 4LC0A 1XU4A 4LJ5A 2HLDD 4WIAA 2IUSA 1MT0A 4U02A 3GLHB 4A6XA 2XXAA 4U7DA 2ODWA 121PA 1PLKA 2OZEA 5DYGA 1HT2E 1NRJB 3TE6A 3ZD7A 3OFNA 3B8HA 1NI3A 3ZQ6A 2QNRA 3SN6A 2R8RA 5IRCD 4JYBA 4BFXA 2QTHA 4JBXA 3NH6A 1WA5A 2ORVA 4XOIA 4DSUA 3THOA 1LVGA 3KDSE 3TR5A 1IY1A 2JLRA 4OQXA 1IN4A 1T3SA 3Q9LA 1G4AE 3OFND 4IVRA 4C7OB 3MRSA 1LTQA 3VR5A 2P2LA 1YZTA 1HA3A 2Q3MA 2RGXA 3VR3A 2NG1A 4MKGA 1M7HA 2CVHA 4N0DA 1XNJA 5KNDA 3Q5EA 5B2ZA 2HXYA 2FFBA 2OLKA 1R5OA 1XBTA 2GBLC 2ZROA 4PHGA 3SBDA 4YONB 2YZ2A 3EARA 1MR3F 3PCRB 1M8PA 5L8VA 2BM0A 3NDBB 1S1MA 721PA 1Z63A 1BYIA 1E2IA 2ZU6A 3I1FA 1CJTC 4M8NE 4C4PA 4RD2A 4G5QA 1J70A 2QTVB 3SHFA 3K70C 4ON9A 2YWEA 1Z0FA 5BN5A 4GOXA 4B3BA 1OT3A 3WYGA 3R7WB 3U60B 3WMFA 4QL3A 4YQFA 5C4MA 3GFTA 2O8FB 5ANRB 5TMPA 3EASA 3FKQA 3VR1A 4Q9JA 5AJVB 1TNDA 1B23P 1OV4A 4TYPA 1SKQA 2P6NA 3LVRE 4BLPA 1NJFA 2FX3A 2YC2C 1L4UA 2I3BA 1UKEA 3NEYA 3ETLA 4BZPA 5KSZA 4BE7B 5HZHA 4XWAA 3P32A 1II8B 3C8UA 2JDIA 1H8ED 2VH5R 2BWJA 2WWIA 2OLJA 2NOAA 4IDQA 4MITA 4NU0A 2Z4RA 4G5GA 1NVVR 3IEVA 2LCFA 1W36B 2GRJA 4WZAE 3A4NA 2A5DA 1NMXA 4KYIB 3BIFA 1G18A 2CCGA 2IUTA 4LHWA 1LB1B 3PUWA 4HUQB 4URUR 4YMUA 2IK8A 1XDBA 2JEOA 1LF5A 4BUJA 2QRZA 2WPDA 1I4DD 3N5CA 1AK2A 2AX4A 1PUJA 1KSFX 2DWOA 5FPYA 1XXHB 1R4AA 3UIEA 2A5GA 4M21A 4GP7A 5LD2B 3VMFA 3KXLA 2R6GA 4XWOA 1D6JA 4LPKA 1E2NA 5K8UA 3AVXA 3KKOA 2E1RA 3LRPA 1KZGB 3MAAC 4QFMA 5KO2A 2C03A 3GEIA 2YOGA 4CEIB 5JWHA 5AJWA 3VNVA 1U8YA 1E0AA 2Z0MA 3H2YA 1T8TA 3GJ5A 4RZ3A 2F43B 3AF2A 2WVJA 1G1MA 2IYZA 3WRYC 2EWVA 2FJUA 2FWRA 5LBIA 3ADKA 1Z07A 4BFVA 4F4CA 1KI3A 1XEXB 3GD7A 2ONKA 4Q1EA 1P4SA 1W0KA 2KE5A 4RVCA 1FP7A 2G9NA 2XAUA 3CF6R 3X2SA 2HT6A 2Q0HA 1YR9A 3QKUA 4E03A 621PA 2EFDB 1R2QA 1X1RA 1G8PA 1TADA 3BB3A 4OQNA 4B35A 2WZQA 1ZMXA 3ZS9A 1EX7A 4TYYA 5FFMA 1GL9B 2QI9C 3UG6A 4OK5A 4DSTA 4PQFA 1R5BA 1FFHA 3CZPA 2KI5A 3KFVA 4M1MA 1YZNA 1OB2A 1U98A 2WJVA 3AKEA 5FOSA 1D2NA 1H8HD 2B92A 4BQSA 4R71A 4AURA 3KXKA 3QY0A 1BIFA 1W1WA 2OCAA 3AVYA 3AP3A 2IEYA 4KXFB 2FFAA 2VHQA 2XITA 1YRAA 5JMTA 2H16A 3BAFA 3ZJYA 1AS3A 2UKDA 4OI1A 1XEWX 4JKYA 5JSZB 4I99A 1CLUA 1DAMA 1NVWQ 1J8MF 3DL0A 2W2TA 3Q7QA 5BN3A 3QF4B 1U2RA 4QBGB 1KO5A 3D6TB 2J3EA 2O8DA 1GL6A 2IBMA 4DSOA 1WBBA 1YJ5A 2TMKA 2HYDA 3KTAA 3A1TA 3TH5A 1UEJA 1KI4A 1KI7A 1GZSA 5G3ZA 1TQ6A 3U7EB 1N0WA 3FFBA 1RZ3A 4IKEA 1KMHA 821PA 4OYHA 3ZGXA 1IN6A 1JB1A 1S3SA 2BEJA 1TQDA 2QORA 4Q9HA 3C5HA 4LJ7A 1F5NA 3SR0A 2YKGA 1GSIA 1US8B 1ANKA 2WWWA 3QI2A 3K9GA 3MFYA 2ZANA 5K8IA 5DI9A 4PHHA 4JYCA 3THXB 1FNNA 3IBGA 4ARZB 4LBZA 1XZPA 1VTKA 4IDPA 1XTSA 1KK0A 2GF9A 1G8HA 1LS1A 2ODEA 3I61A 1OH6A 4F4IA 2Q9BA 4C9BA 1NG1A 1GG2A 1T3HA 2AFIE 1QDEA 3ZVLA 2A7QA 1W4AA 1W46A 1EFRA 1UPTA 3AUYA 3EAQA 4PAOA 4JBYA 1F2UB 1NJGA 1N5IA 1QHXA 1T4GA 4FMCF 4DB4A 4A0FA 3QXCA 3SJAA 1CTQA 3ND9A 4Q4AA 2JLUA 1A2KC 2WBLC 3H86A 1XMVA 2PMKA 4BLQA 2B7CA 3PEWA 1ZBDA 4URYR 4TWZA 2OBMA 3EPJA 3IQWA 3K0AA 3GJ8A 1CIPA 1KHTA 2WWHA 1EFRD 3D8BA 5IT5A 2P67A 2ZR9A 4TTRA 3GP8A 1T6NA 1W7AA 4TL8A 2BMDA 3P20A 1UBEA 3T15A 1G3UA 1KNXA 2QL6A 1R0XA 4Q7MB 3BB1A 2EQBA 3QKTA 2IX3A 2CJWA 1GKUB 2QMUA 2W0SA 1OIXA 2O0JA 3VX3A 4JLPA 1NVXQ 3CIOA 4JIMA 1F2TB 4PX9A 3P1JA 3ZIAD 1QVAA 5EP1A 2IXGA 2FZLA 5K8LA 1E69A 4PSAA 2CE2X 2OE2A 4KJZA 3ADCA 221PA 4GFDA 3B2EA 4PC6A 2YC4C 2RGAA 4S35A 1E3MA 2MMGA 2XZLA 1Z0DA 3KKPA 2DYKA 3MCAA 5F98A 2YWGA 1KI6B 2F1JA 2FG5A 2OESA 2ZJAA 1Z29A 1G8FA 2ZRGA 4B6FA 3O8DA 4RCZA 4TMZA 4ZCLA 2NZ8A 3PJRA 4PQRA 2ORWA 5EZ6B 1ZM2A 2CDNA 4LHVA 4QGAA 4E22A 3GPLA 5ELXA 1UAAA 3DPUA 4QBFA 3B1YA 1PJRA 2A5FA 1KMQA 2OCYC 2W6IA 3PUZA 4C7OA 3CX6A 1MKYA 5EE9A 2BKEA 8OHMA 4Q00A 1VCNA 1FTSA 1Z22A 2RGEA 4BFYA 2RKOA 3EIHA 2RGGA 1CBUA 1F48A 3BBPA 4IOMA 2W6ID 1U99A 2CNWA 1HEIA 2Q21A 3A8TA 5KDDA 3U7FB 1LV7A 1E2JA 1YQTA 1E0JA 4EJSC 1G291 3FVQA 1JI0A 3GLIB 2JLXA 2GXQA 1G8GA 3W34A 2FA9A 3B13B 4MH0R 1DAGA 5DE3A 4EQ6B 1Z6TA 4Q5IA 1DAIA 3MGCA 3Q7PA 3CKLA 4CT4B 2F7SA 4OBEA 3VHLB 2ANCA 2VHTA 1QVRA 4J0QA 2XZOA 2ZS8A 3R7WA 4MKHA 3T5DA 1CR4A 3IO5A 2O8FA 4HLDA 3OAAD 5AJYA 5AUQA 2IYUA 2W2VA 3N70A 5BWMA 2CE7A 4DRZA 3OIYA 2CXXA 1CR1A 3W8RA 1J7KA 1NLFA 4P4SB 2BBSA 4IXMA 1EFCA 5DYIA 5L3SA 3DMNA 1Y3AA 2X1VA 5CJPA 5JLJA 4B73A 1OYWA 1II8A 1O87A 3QBTA 4DLZA 3RC3A 4OL0A 3MUFA 1UFQA 1Q21A 2XB4A 4DHEA 5DHAA 1E2MA 2JIZD 5CM9C 2QM7A 1ZAKA 1G5TA 3WNBA 4EDHA 2C2HA 2WSSA 3VR2A 1KY3A 1FZQA 4UJ3A 1NNEA 3AUXA 4IRUB 4V0ME 3RC8A 1KO8A 5M04A 1ELOA 4PSKA 2N46A 2QSYA 4HUQA 4QHTA 3I4LA 1RW4A 3QXXA 3U7GA 4TT3D 4LY6A 4PPFA 3T34A 1Z2AA 3IPYA 4GPTA 3AVWA 2CHGA 5E4FA 3TMKA 4IDOA 5SZKB 3S1AA 2VP4A 1PUIA 1JPJA 4ZO4A 3P4XA 3CX7A 3AF3A 3U3MA 2DFNA 2X2FA 4NCIA 2R6DA 4QOSA 4X8OA 4YMTA 2P6UA 1JECA 2HT1A 1X1SA 2GAOA 1GKIA 2IEZA 1AQUA 1TU4A 1MO6A 3X1DA 1FX0B 3D3QA 4CEIA 5J4VA 1S4QA 1D8TA 4LUCA 2VIIA 3GEHA 2F43A 2FSIA 3P4YA 1EESA 4O2RA 4KCGA 2ZJ8A 1XEXA 1OYYA 3U3KA 2FPMA 1QZXA 4UNNA 4UNRA 2YWHA 5FUWA 3K0CA 1JAIA 4AKIA 2UVQA 1QG4A 1ZM9A 4M9SA 1IXSB 1G6OA 1N5LA 4US2R 4D81A 3T1QA 2ZREA 3TVTA 2NMVA 3CWQA 4LWZA 3DMDA 3AKDA 1CP2A 3KKNA 4TMKA 4D4KA 4AD8A 3K09A 1S96A 3RS7A 3LBNA 3SJZA 5B58C 3VX4A 1UDWA 2QMHA 2EYQA 2VSOA 1WRBA 1V43A 2IS2A 4LYAA 1WP9A 2YYZA 2H18A 2ZI9A 1AIPA 5CLLA 5KSOA 3AKYA 3THWB 3ZVRA 2ONJA 4GZMA 4MYCA 4V03A 3FDIA 5FUXA 3QF7A 4A0HA 2ZPTX 4FD2A 5JSZA 4PC7A 2OG2A 2CEAA 1TL7C 3NDPA 2ZRDA 3OEEA 1P9WA 3QF4A 2WWYA 2ZJYA 3FWYA 3RWMB 2AKYA 1UJ2A 5FBWB 2A5YB 4BGDA 1R10A 4D6PA 2ZSEA 3ZQJA 2G83A 5FTJA 3CUEF 2GEDA 2JLWA 5IK2A 1KYIA 2V8OA 1N0UA 5EE1A 4R9UC 1UKYA 1VCMA 5SZHB 2CCJA 1KSGA 4AYXA 4LJ9A 1OB5A 4OI2A 1XFAA 4RY2A 2GJ8A 4XSGA 2ZJZA 4JT2A 3W6NA 4GI7A 4Q47A 4K81B 2DR3A 1L8QA 1US8A 4ZIRB 1H65A 2MSEB 2J7PD 5IK2D 1W4RA 1GRQA 2R62A 5JS8A 3FKSA 2O8CB 5EZ5A 5FPSA 1K5DA 3U44B 3THXA 2IYRA 3BE4A 3NWJA 2ZRAA 4RD3A 3P26A 4ARZA 2CHQA 4AIIA 1TF2A 4NH0A 2ZTSA 3D31A 1ZUIA 1NVUQ 2R6AA 2IL1A 1TX4B 2IC5A 5FOTA 3X1ZA 3T1TA 1OFIA 2R9VA 3EPHA 1VMAA 3QXHA 4ZPXA 2RGNA 5AWFC 1GNQA 1Z83A 2ZJOA 4DEXA 2WJHA 3DM5A 5F2EA 2J0SA 2F3RA 4B2PA 1F2UA 2X77A 1UBCA 3AGQA 3UWOA 1E9RA 3B6EA 4BEJA 1W49A 2AXPA 2IYXA 3ADBA 2J87A 1DAFA 3H0KA 5HZKA 3KJHA 4M22A 4AY2A 1AGRA 1IHUA 1Q1EA 2QMEA 1E1RA 1XX6A 4I1VA 4Q1FA 1ZD8A 1FNMA 1GILA 3MSXA 3BERA 1E4VA 2X2EA 1W2HA 1KK2A 2DHRA 2PZFA 1DEKA 2CL6X 4IDHA 1RIFA 4FI3C 4PR0A 3SC3A 2HCBA 1X8JA 5IHPA 1Z6XA 2G77B 3QVVA 3W6OA 4WXPA 2YJTD 3F5FA 4DIEA 3U4QA 5CYOA 1VIYA 2DFLA 4F92B 1F2TA 3IGFA 5IDVA 1OE0A 1SVMA 1DOAA 3EC1A 1FMLA 2VL7A 4DT1B 1HQCA 3PFIA 4FMDF 1NBMA 5FBRB 5C18A 1OKKA 2BIFA 5FL3A 2VBCA 5JRJA 5TXGA 1G5RA 2VSFA 6Q21A 2V4ZA 4HAVA 5CIQA 2QENA 2Q6TA 5CJ2A 2CBZA 2GJ9A 2WAYA 4QJ3A 2DFKB 3OIWA 1KI6A 3ND8A 1E9CA 3LBIA 3SBEA 3NBFA 5B64A 3I8SA 4ZCMA 3HU3A 3KQHA 1Z0JA 4AG5A 2QP3A 2Q3HA 4KSBA 3WNDA 1XMJA 5DI3B 2F55A 2FN4A 1JALA 2V7QA 1Z0KA 3EZ9A 3EG5A 1SVIA 1Z06A 4WAUA 3LW7A 3HYTA 4EUNA 3WP1B 1A4RA 3I62A 2FNAA 5TB5A 4I81A 4V02A 1XCMA 4DCSA 5CITA 4C2UA 2ZSAA 3DOFA 2DFTA 3OEHA 3I92A 1QHHB 3DZ8A 1SXJE 2ZRLA 3RSOA 3GLIA 3R8FA 2C78A 3BGWA 1BS1A 1T5LA 2GKSA 1SVSA 2ZI5A 3DO6A 5G40A 4JLOA 1UM8A 2A3RA 2HF9A 4EQ6A 2P3SA 4N0EA 2ZRHA 4W5HA 1GKYA 1JR6A 1Z0AA 1ZC3A 3OEHD 5FTKA 3NH9A 2Q9CA 3C15C 3JZMA 2ORIA 2C5LA 1TF5A 1G7TA 1QHNA 2OBLA 5FPHA 3Q5DA 2XTZA 5BYJA 4FCTA 5EXSA 2B6HA 3CPJB 5E7MA 4HLUA 2GXUA 1HE1C 5H70A 4UXHA 1IN8A 4P4SA 5DGXA 4IFBA 1E1QA 3U3JA 2BMJA 1XZQA 2BBTA 4RZ2A 5JS7A 2KBEA 4ABYA 1YZQA 1P73A 2G3YA 2G6BA 1N6KA 2WKQA 3Q3JB 1E0KA 2VP6A 3QG1A 4L5BA 1E1QD 1YR6A 4HDOB 4NYJQ 4C2TA 5KTYA 2ATXA 5G3YA 2GWHA 3BH0A 1K5GA 3GJXC 1BKDR 2HCJB 1Z0IA 1QHGA 3M0EA 3RS5A 3SU8A 2W6JD 2EWWA 1ZCAA 2FU5C 1GFIA 4A92A 3C4JA 4MGKR 5B30A 2IHBA 3QQ5A 2IHYA 2CK3A 2C96A 4KV9A 2AR7A 1RE0A 2C9OA 4TMXA 1JNYA 5B57C 4B34A 5FL7D 2N1BA 2DCUA 2PLFA 4HB0A 2YV5A 3LBHA 1G9XA 3WBJA 3KUCA 5JEEA 2ZS7A 1FL9A 4MQBA 2N42A 3A6PC 2NZJA 1NMYA 4TN1A 3D7MA 2V3CC 4X8LA 1IXRC 4OHYA 2QU8A 3X1WA 4BLRA 2CK3D 3SJBA 1L4YA 1LW7A 1E98A 4AKEA 1UADA 2I4IA 4U5XA 3MLEA 1G16A 3TUJC 3AKCA 2ZRMA 2NQ2C 2JCSA 3TIFA 1RYFA 2R2AA 1KJYA 3U7HB 1ZINA 3O8RA 4B74A 3T1VA 4DCUA 4EPRA 4QHSA 2IT1A 2BKUA 3FGNA 4Q9LA 1ESNA 4C0SA 1XEWY 1XB2A 3TQFA 1H8EA 1OFUX 3VR4A 4URVR 2F1IA 4JLNA 3PEVA 1VCOA 4BFZA 4HB2A 1FUUA 1IXZA 1QG2A 5GJCA 4A36A 1NG9A 1IY2A 5KU1A 3EA0A 1N5JA 3QOFA 1KK3A 4I1UA 1CJVC 3HPQA 4NBSA 5KHOC 4AG6A 3AB3A 3HP1A 4GBMA 1VYUA 1Z8FA 4URWR 4KFRA 4OQMA 1SXJD 4TMVA 1E9FA 5EE0A 3REFA 4IFEA 3THWA 2F1RA 3WYAA 2WJJA 4IW3B 2ZE6A 4FXPA 4BLSA 1TU3A 2JJ2D 3CB4A 1Z6GA 3KQNA 5EJEA 2ZS9A 2VEDA 2AWNA 3L82B 1VECA 2O8BB 4KLZA 1AS0A 4MRRA 3LXXA 1Q44A 1GAJA 1RVDA 3MMPA 3SQXA 3BORA 3MWYW 4DUGD 4FN5A 1Z2CA 4W5WA 4DLYA 4NYIR 2J45A 3BK7A 2RAPA 1FP6A 1QBKC 3CWZA 4QKQA 1S9DA 2QAJA 3NTUA 5HR5A 1B0UA 2E9SA 2G0TA 3U5ZB 3QG5A 1PLJA 3QKSB 5FTMA 2NTYC 1ZM3A 3CBQA 3C7KA 2J5XA 1XTRA 4KYUA 4K46A 4G5SA 4ZIRA 4F91B 1NP6A 3SNHA 3KKMA 2ERYA 3UATA 4QHYA 5JCPA 2J0UB 4CZ2A 2O8CA 5FI0B 2F1HA 1DE0A 3BFVA 3A37A 3IIJA 3U44A 1DS6A 2O5VA 1JEDA 3VQTA 3I5YA 4QM6A 4TLEA 4ZCIA 4KO8A 1H8HA 5C1BA 4TZ6A 4QBIA 5JJKA 1WQ1R 3M6AA 2BCGY 3NBYC 3CPEA 4A15A 5JI3E 2FEOA 4QRHA 1EWQA 1S0UA 2BC9A 1FMJA 3EA5A 2R65A 2VO1A 4Q4LA 3W3AA 4C0KA 1I2DA 2R44A 1IN7A 1P60A 3X1YA 5J4LA 4DLVA 5L3QB 4B3GA 2VA8A 5CDFE 1E2LA 1CEEA 2GETA 2PCLA 1DELA 1X3SA 5EP2A 1ZW6A 421PA 1ETUA 1JPNA 1E96A 2HDNB 4TMTA 1IBRA 4UJ5A 3KJIA 1ZVQA 1WXQA 1W36C 2OHFA 1RRFA 5TY0A 4Z8XA 2XOKD 1IJEA 2SHKA 1KSJA 2FFHA 2Q3FA 3MWKA 4Q48A 5DISB 5EXTA 4D0LB 1G19A 1YRBA 4LJYA 1NF3A 1QHIA 1MO3A 5DLQC 5BYKA 1DG3A 2AFHE 1LY1A 1UBFA 5IF9A 2QUZA 3Q8XB 2YNMA 1UKZA 3VAAA 2UZ3A 3IIKA 3U6BA 3DEFA 4IOKA 3KXIA 2ZUCA 2H92A 3IIMA 4DT1A 5LD2C 1GRNA 2VPPA 3FOZA 4AYWA 3WYFA 3AVUA 1CR0A 2BHRA 2F9LA 5CIWA 1P2UA 3CLVA 4LRWA 2O52A 4BRWA 5J4HA 1A1VA 3CX8A 1KDRA 1R5NA 1Z5ZA 2CVFA 3VU9B 4KFSA 1IN5A 2XJ4A 1JJ7A 1IQPA 4BZXA 3BH7A 3ZVNA 1XEFA 2CHVA 1P61B 4Q18A 4Q1AA 4BLOA 4G3XA 1GDDA 2ZSDA 4V0OA 4XTCS 5DI3A 1JR3E 3K0CC 2IS6A 5HPYB 2F6RA 3AQ4A 2OAQ1 3UMSA 4D2IA 4A4DA 2IWRA 4DIDA 2QA5A 5LDDC 3KFXA 3MD0A 4KVAA 1X6VA 4LJ4A 4PC1A 1FOEB 1IONA 1ZUHA 3GJ7A 1E79D 4TTQA 4HYYA 1EK0A 4LBVA 4EPXA 1QHHA 2WMOB 3K09C 1GUAA 4LYHA 4M9XA 3TRFA 1GITA 2QBYB 1NVVQ 2OXRA 1D9ZA 1XMSA 2VP5A 5J5CA 4MYHA 4CYMA 2H1LA 3WMGA 4CVNA 4OKSA 4AWXA 3AF4A 1XWIA 1X8KA 1RKBA 3CRMA 1X86B 4HAWA 4LCBA 3ZS8A 2XSZD 2ATVA 4DLUA 4BFWA 2H7VA 4DCNA 3ZIAA 2WAXA 4DLTA 3HU1A 3NG1A 1Y63A 5KPJA 3W90A 1IJFA 1A7JA 2DB3A 2ASEA 3TAHA 1K8RA 3AVOA 4RZUA 5H68A 1HV8A 2ZE7A 4NZYA 3AP1A 5JEDA 1C1YA 1OF1A 1TEVA 4KSCA 1GVNB 2H17A 3SYKA 3VTKA 3PIRA 1EG7A 4CRWB 2F3TA 4V0KA 2ZRJA 3GLHA 3PQCA 1M2OB 2KSQA 2QAGB 4G5OA 1OIVA 1NKSA 3NXSA 4Y0VA 2D4HA 3K70D 1VG9B 1VG0B 1II0A 2RCNA 1XP8A 2DWQA 4DLRA 2JJ1A 1ZM4A 4KBFA 4UXJA 2IF0A 4HDCA 2EFEB 2BJWA 1AKYA 1JEEA 4PZLA 4XD7D 3SDZA 1DG1G 2GEUA 3DKVA 1LF0A 2AK3A 4JL6A 4DJTA 3ZD6A 4NCJA 4IVQA 2PJZA 4D25A 4GNKA 3AVQA 2PL3A 3UANA 3QPVA 2JJ1D 2ODNA 1M34E 1SULA 4ITRC 1J8YF 2QY9A 3B78A 1G41A 1T3LA 3ECCA 5LPNA 2RGNC 3LXRA 1BMFD 1G3RA 4JVSB 1NN0A 1E2KA 5JHHB 2GILA 4TYQA 1KGDA 2BV3A 4LV8B 2D06A 2WJYA 3F0TA 3TQCA 1SVWA 3OAAA 1M7GA 4JL5A 5GJWC 3J81k 2G1JA 1W2GA 2VTKA 2E87A 1ZCBA 4IOLA 1FQJA 2OSBA 4GOJA 1N6OA 3PUXA 2CMKA 4MRVA 2REOA 1U9IA 1JXMA 2G0NA 4PXAA 3NHAA 4PFSA 2HUPA 2OO7A 1N6PA 1TQ2A 3WNCA 4O2LA 4V0LA 1QF9A 3MG9A 2WV9A 4A0GA 5HTKA 2GK6A 1COWD 1YZLA 3FYHA 3CNOA 1R6BX 4KHZA 3RRMA 4RD0A 2YOHA 1JR3D 4BZQA 3A1SA 4URZR 4ZV4A 1ZJ6A 3V00A 4UNSA 3EIQA 2CL7X 2JIZA 4GOKA 2G1KA 4F4JA 3WHKA 4OI4A 3H1TA 2W58A 2XGJA 2O0KA 2C99A 1E6CA 1I4TD 1YR8A 3WHLA 1FUKA 4BEBA 4CW7A 3B85A 4Q21A 5A5GA 1A5TA 2PMDA 3N2EA 4ESVA 4PHFA 2Y8EA 1OXTA 1XCPA 4TT3A 4JT4A 5BQ5A 2A2ZA 2FF7A 3VHXA 2BJVA 3DM9B 1HTWA 1FW6A 3I5XA 4GSYA 4HI0E 4XTRA 1XRJA 2I1VB 1TTTA 2O8BA 1A2BA 1DAEA 5KSYA 4FCVA 3RABA 1UKVY 3GFOA 1N25A 1XCGB 2OFWA 2FMXA 4CT5A 4XVUA 1E2PA 3RRZA 4XSHA 1YU9A 1U94A 4C0LA 1EFUA 1XXHA 2FFQA 3IKJA 4DXAA 5J47A 3RS0A 5JFGA 4WVFA 4YXWD 2QM8A 3UG7A 1AS2A 3UMFA 1O3YA 4IHQA 4ESHA 5EE5B 2X8AA 3AEZA 4Z51A 3QENA 2J46A 3DHWC 3FHTA 3EZFA 4NCNA 2O8EB 4P0TA 4RCYA 3AGPA 4L9SA 1N6RA 3CZQA 3V9PA 1AGPA 1OH5A 2GAAA 4XH9B 3SZRA 2GDJA 3AP2A 2HXSA 1CRQA 3DZDA 2QQEA 5FOXA 5JWRA 3UKDA 3PVSA 1QRAA 2QE7D 2FH5B 1XJQA 4PO8A 2J0UA 1XTQA 2OFXA 2FV8A 5KDLA 1WBDA 3R9WA 2PH1A 2D3WA 1AQYA 1U0LA 2BCJQ 1DBSA 3SYLA 4JLBA 1JBKA 5HKKA 4KFTA 1ZU4A 2OM2A 4GMXA 1HUQA 1GP2A 3H4MA 3KJEA 4YDSA 5GVRA 3CR7A 1ZNXA 3G0HA 1SXJB 1G5PA 1MRNA 4HLUC 4Z54A 3CNNA 1CF4A 2C9YA 4HZUB 2QPOA 1CKEA 4QGGA 3B1WA 2XZPA 4D26A 4POAA 3GQBA 2Z43A 1DADA 4XVQA 2FZ4A 4B43A 3IHWA 5HKKD 3NC0C 1U90A 1OHHD 4Q01A 5L3QA 5DN6D 2ZI7A 3OZXA 3W3ZB 4QGFA 4Q7LA 4H1UA 4HB4A 4ZI2A 4NCHA 4D0NA 4P31A 4KVGA 1E99A 2V6JA 4B75A 3BJIC 1XTKA 1Z6AA 2B8WA 1QHSA 2C8VA 1EX6A 4PANA 1XD2B 3U2QA 5D3MB 3U3OA 1DPFA 2OCBA 1CU1A 2HJVA 4BFTA 3K0FB 5EUMA 1G3IA 1S3GA 1RJ9B 4LBWA 2DBYA 5L3RA 4DCTA 3M1IA 3B5JA 5A0FA 2D7DA 3VKHA 1G7RA 3EZ7A 4PO9A 1T0HB 1KO1A 4F93B 3IDQA 1NBME 1NSFA 1HT1E 4WA7A 2V1UA 1ZYUA 2PX0A 2J7PA 3LFUA 3QXSA 3ICEA 3MJHA 4BLTA 1LFDB 3SJCA 4DB2A 1TMKA 4I1SA 4JL8A 4LJ8A 5E7JA 3W9YA 3WP0A 3KQLA 4CEJB 1J90A 2ZYTX 4V0MA 4TZ0A 3GLGE 2GCOB 4Q1BA 1ZD1A 1JQJC 1Q1QA 3VU9A 4EFNA 1N6NA 5EP4A 1CRPA 1XPOA 2PT7A 4PPNA 1MABB 3TJZA 4HAZA 4R2HA 3X1XA 2L0XA 1JXOA 4PPGA 4QNRA 4CIDA 3ZLJA 1W5SA 1XD9A 3CRRA 1GIAA 2IWHA 1ZC4A 1YZGA 2ZAOA 2ZUDA 2XTMA 3MWLA 5CK4A 2D74A 4LDJA 1DAHA 1Q3HA 2PEZA 2VP2A 1G4UR 1RRGA 1EXMA 2ZE5A 3RRNA 2XB2A 4DDVA 4EPTA 1G21E 4TLBA 4ZDIA 5DSZA 4ACAA 4B3FX 3PV0A 2VHCA 1E32A 1W47A 2FGKA 1E9EA 2J0VA 2XNDD 4ERNA 4AKGA 2QMOA 4Z8YA 4JJZA 2GHIA 1SGWA 4JLDA 3T06B 2ZITA 1P2TA 2D7CA 3K1JA 4DDWA 3PG5A 1XPRA 1E2HA 3THYB 1V5WA 2CCKA 3L8YA 3K0EA 4A8JB 1P72A 3K9NA 2ZRBA 5AJZA 5JCZA 3CRW1 3GLFE 3A1VA 1AKEA 2XEXA 2IS1A 1OFTA 1VKJA 1GWNA 2PX3A 3FHOA 2GEVA 1II9A 1Q20A 2O0HA 2VLIA 2ZE8A 3ZZ0A 2FSHA 4B3CA 4XJXA 4M1YA 2DWPA 1ODFA 2IXFA 2QQ0A 4HSEA 4PPQA 4LJ6A 4US0R 2OXCA 2AXNA 3U61B 2WTUA 2ZYUX 5H1YA 4QGHA 2GCPA 4Q66C 3IBYA 2VRWA 3GFPA 1KOFA 3NEJA 4LSGA 3RS2A 2IS4A 2B8TA 2QAGA 3ZDQA 4EAQA 3TVDA 4PAMA 3KUDA 4M4SA 2OAP1 1EWRA 3REGA 3AVPA 5CM8B 2J59A 2RGBA 3HDTA 4WBSA 3V4RA 1KJWA 3TSZA 3CO5A 2KBFA 4KU4A 4RFSB 3TW8B 2CLCX 1OXUA 3UXMA 5P21A 4B47A 2ZJ5A 3Q72A 1P6XA 4DDUA 4ZDKA 1KIMA 3EXAA 2J41A 3NVAA 4EFMA 3BD9A 3KB1A 5AK0A 4HLQB 2ZI6A 3K9LA 4HEJA 4V0NA 1KKLA 1TEXA 1UBGA 1DVRA 4L9WA 3KX2A 4QJ5A 3OIUA 3OF5A 1LS6A 3CPHA 1YE8A 2IYSA 5FTNA 3DVLA 1M1YE 3F8TA 4PTLA 3R9XA 1P2SA 4H9GA 4Q7KA 3RANA 1C9KA 1WB9A 5FI1B 5JWOA 2C98A 3FHCB 3BOSA 4HB3A 3KQUA 5HCIA 5TARA 1G3QA 2ZRCA 1KY2A 4A2WA 3EZ2A 1PLLA 3LX5A 1JQLB 3VR6A 4R7ZA 5AJXA 4BASA 3FTQA 1P9RA 2AD5A 3BH6A 2ZJBA 1E2GA 1R0YA 3RRYA 5JI2E 3E5HA 2PLRA 5JECA 2RH5A 2GVDC 1IM2A 4I4LA 3VKGA 3EW9A 3RWOA 1DO2A 2REBA 2VP9A 2ZVPX 4LV6A 2WWGA 3K70B 2V6IA 1U8ZA 3E1SA 3ZZUA 1SKYE 5FH9A 5GVSA 1N6HA 3SE0A 1R0ZA 4TMWA 1GTVA 4BFSA 3O47A 5JBQA 5CK5A 4LPSA 1OXSC 4OK3A 4WZ6A 2W6JA 2ZU0C 1DO0A 1KNQA 1RC8A 1SHZA 4TSFA 4DSNA 3I73A 2ZRFA 1OW3B 4PHTA 2ZR7A 4FMCB 5G41A 3VFDA 2YVUA 4H1VA 1M74A 4D4JA 3NHBA 1GNPA 2GZDA 4LC1A 1U0JA 2FE4A 1NY5A 5FL7A 1N3BA 4ASUD 2FDCA 2QTFA 4G0NA 2IYYA 2XNSA 4TSFD 4HATA 1OJLA 4YLGA 4HZIA 1YR7A 1Q22A 2MSCB 5JZVA 1HH4A 4TTPA 4LHZA 3SFVA 4CEHB 2IYLD 3FMOB 4Q1CA 4OQFA 3WBKA 2YHSA 2FEMA 2VF7A 4B44A 5HE8A 5FOVA 3F3YA 3OE7D 2B21A 4B2IA 2QGNA 4YDHB 2WWFA 2I1QA 4RJLA 2O8EA 1FX0A 4FCWA 3TUZC 2QRNA 1D9XA 4A0RA 1Q12A 4JSYA 5JHGB 2QG6A 5DIFA 4ZKDA 3ZYCA 5BXQC 2ZI4A 4MRNA 1M6NA 2LWIA 3WY9A 3CF2A 4OQLA 1ZUNB 1ZU5A 4TL6A 1Z6YA 1KK1A 2JJ8A 1PVOA 2OEPA 4A9AA 1MO4A 2A9KA 5TV2A 1YKSA 5DNYB 3NBZC 1ZNYA 4PQYA 2AHOA 3K53A 4RFVA 4MYUA 1AN0A 3W5IA 5C2JB 5BW8A 3LVQE 1SXJA 2D2FA 4HUTA 4HZUA 5FBLB 4C0BA 3ZVMA 4E5UA 1KZ7B 1XMIA 1UEIA 2JJ2A 2P6RA 4MDFA 4PZYA 2IF2A 2EW1A 3R9IA 4HLCA 4MGYR 2GK7A 1YZUA 5C46F 2IYTA 3RVBA 1IAQA 4KITB 1VG8A 3JVVA 3TGPA 1KI8A 1OH8A 1LNZA 4G01B 3KQKA 4NDZA 5FBQB 4O0MA 4DUGA 4P32A 3ICQB 3B1VA 2W00A 1NLYA 1ZM7A 1MOZA 2WKPA 4NKRA 3RLFA 1A82A 1FPMA 1OPXA 1XD2A 5L3SB 5D3MA 1E94E 2IXEA 3K0FA 4G5RA 4RKEA 4UKDA 4URXR 1AA9A 3IUYA 4QBHA 3UWKA 5KYKA 3CH5A 3QSYA 1RJ9A 3BRWD 1D5CA 4W7SA 3LH5A 4IVPA 1KI9A 3SI7A 3RSLA 2JASA 2ZIAA 4MUAA 3G82C 2ODBA 4PC2A 4LV5B 1Q1BA 3C14C 1F3OA 2AKAB 4M1OA 4NMMA 2GJAA 3CRQA 5EE3A 2YINC 3SQWA 2JDID 4RZXA 1C4OA 4CEJA 1GRRA 2YOFA 1OH7A 4TLAA 2GCOA 1WMSA 4OI0A 2ANBA 2R6CA 2ZRIA 2A30A 3TBKA 4B76A 4O25A 4QJ4A 4WW0A 2NIPA 3RNLA 3S1AB 2LKDA 1VG1A 4LBYA 2A5JA 4KBGA 1MABA 4P4UA 1JJVA 1NN3A 1U9IC 4DLXA 4ZDJA 1KAGA 1P3JA 4NONA 4LJAA 2IUUA 2GXSA 2WPDD 3KL4A 4TLDA 3RYTC 4M0LA 3ZZTA 4Q9KA 2V9PA 3LV8A 1KO4A 1OIWA 4D82A 1F6BA 3FFAA 3GJ3A 4LYFA 2IYVA 2XOKA 2BM1A 2GJSA 3KZ1E 1E9DA 4QM7A 2BBOA 1SHKA 4M53A 4NPHA 3CH4B 3W5JA 4ZDWA 4FIDA 3VNUA 4OHVA 4R98A 4MRSA 1AJEA 4DDTA 5JJIA 3QBVA 3THYA 4LZZA 4GMDA 1W0KD 2V54A 1K6MA 2WICA 3FMIA 4JS0A 4IJMA 4A8JA 4B48A 3K0SA 1T91A 2OCPA 4IOJA 3FMFA 3AV0B 4KFUA 2RB4A 2Q9AA 5SZJA 4AKHA 1BYUA 4TYNA 2FGJA 5LB2A 2JLQA 4C3ZA 2EFHB 2ZVQX 4KI0A 4MRPA 5AUNB 1TF7A 5F3WB 3C16C 4TLCA 5E7IA 5FUVA 5SZIA 4X8HA 4AK9A 1DARA 3GJ4A 1L7VC 1N5KA 2QROA 3GLHE 1SQ5A 4OHWA 4Q02A 3LX8A 2Z4SA 4Q1DA 3ONWA 4FWIB 3SHWA 4KODA 2OUKA 1XJ0A 2WIAA 4GT1A 2J1LA 2OILA 3NC1C 5GJVC 2NO0A 3EX7C 3I72A 4M2LA 1E9AA 1U0HC 3L0OA 1R7RA 3K9HA 3OHMA 3PEUA 1T8UA 1VYVA 4P33A 3EPLA 3W8NA 2C04A 1M7BA 4BRUA 2OBNA 3P27A 2HYIC 1N6LA 4RFSA 4B33A 4Q4HB 1EFHA 3CM0A 2XX3A 3ZH9B 4GZLA 1E79A 1PZNA 3CW2A 4JMPA 3W6PA 4MKIA 5TVKA 4LHXA 1Q3TA 1RYHA 2ERXA 5F9FA 1KI1A 4JLAA 3AF0A 1RFLA 1OFHA 3A58B 2HF8A 3R20A 2ZI3A 4GP6A 1I4LD 1NIPA 1KO7A 2OV2A 1GOTA 3QE0A 1VYTA 3DOEA 4KAXA 4L8GA 1NN1A 4UXIA 1RRCA 1S1CA 2WWXA 4IEEA 1KI2A 4RD4A 4JBWA 1QHYA 1CJMA 2XSZA 1NSTA 3HWSA 4JVLA 5FBVB 4EPWA 4D80A 1XTIA 1J99A 2VP0A 2FOLA 2ZJ2A 2FSGA 5FPTA 3VKWA 4LYJA 2JATA 1AM4D 2FPKA 3B1ZA 3LD9A 1WDTA 2ZEJA 3FE2A 5CLQA 1G7SA 1XF9A 2GBLA 3ASZA 3CNLA 3EC2A 3TW4A 3HPRA 3O8BA 3TSOA 3B7GA 2AK2A 3LY5A 4LGMA 4RD1A 1W48A 3CONA 4GL2A 3GCGA 2JAQA 2WJIA 3A36A 3RHFA 4EJSB 1NN5A 3TNFA 4F7WA 2ZAMA 4MDEA 2AWOA 4AI6A 1ZNZA 4NYIQ 4JJKA 2D62A 4Q7JB 5CDFA 3T61A 1RPZA 3ADDA 4IXNA 3EZ6A 1XJCA 2WSMA 3AF1A 3LQRA 1J2JA 4CGZA 2VF8A 2A78A 1MH1A 3JVUA 4NHOA 1ZP6A 4XD7A 5C4GB 3OESA 4JKIA 4DWJA 2JLVA 5KDOA 4JVMA 4ZKEA 1CULC 3B9QA 5FPKA 1CJUC 2WMNB 2EU8A 2K5UA 4OK6A 4W9MC 2GF0A 4MYTA 4PZZA 3U4QB 4C30A 2WOOA 3QEOA 4M9QA 4MA4A 2ZSFA 4TYWA 1G17A 1CS4C 3A1WA 2IA5A 4X8MA 4DBLC 2D2EA 4MKFA 1BMFA 2X19A 1XXHE 5E3HA 2QZ4A 3TAUA 4A2QA 3QVUA 1N6IA 2OT3B 1E4YA 4L15A 4BPBA 2REXB 4CEHA 1KTVA 4RSGA 2BEKA 1MO5A 4WZBE 4PAQA 1R8QA 3SS8A 3GLGB 4ILEA 4I1OA 4F38A 3JZAA 4BFUA 1GM5A 3NIBA 4N1AA 2V55B 3BC1A 3PXGA 4FMDB 3LQQA 4ZI3A 2ZSBA 3RAPR 3AM1A 1VCIA 1GL7A 1KAOA 5DO9A 5HCNA 4CDGA 1COWA 3A1UA 3QJYA 4FWTA 3QKRB 1XTJA 4P4TA 1JR3A 2AN9A 3SFZA 1Z47A 1W4CA 1P9NA 3QIAA 2WIBA 4LX0A 2UZIR 4JLVA 4Q9IA 2VQSA 4EFLA 2H5EA 2WKRA 3IPXA 1ZNWA 3LNCA 3LDAA 4B32A 1AZSC 1W5TA 4ACBA 4GRAA 5EUQB 2QP9X 2NO7A 5CB8A 2P0EA 5FUYA 3GJ0A 1CXZA 1EFTA 2VSXA 2QP4A 2CL0X 1Q1ZA 4Q4JB 2WM9B 4JZKA 3TR0A 4NCKA 4DLSA 1SZPA 4YMWA 1TQ4A 3U3RA 3SYNA 2AL7A 2CNWD 5KNBA 2NO6A 4JLJA 1JAHA 1FQKA 3AVVA 1TAGA 3PEYA 1P7CA 4M1SA 3T5GA 3UMRA 2QAGC
chains in the Genus database with same CATH superfamily
1H5NA 4G8CA 4B09A 5I9BA 3AK4A 1KC1A 3CJRA 5KTMA 1A9QA 1Z56C 4QSMA 2OYRA 2JHCA 2X0IA 3L0SA 4N03A 4WACA 4YAOA 3U4GA 3A6GA 1TW3A 2Q1WA 1MIOA 4LOAA 5CW2A 2IOQA 3V7WA 2C2WA 4KSYA 1CPYA 1V1MA 5C35A 5FR2A 1W0JA 2FG6C 1SVOA 2VHZA 1L3BA 1M3SA 1MDBA 3GCWA 1U81A 3TNJA 1ONBA 2I4NA 2GB4A 2NSJA 3AY3A 1I6WA 1P6UA 2CXSA 2WHXA 3EWSA 3EFOA 4J76A 2DPYA 3Q3EA 2CVPA 2HPVA 5CH8A 3M9LA 2YFYA 2R66A 3HXLA 4LQCA 5IH3A 3RSZA 1QUEA 1NL3A 3HB9A 5K6TA 1K6XA 4CMAA 2PSFA 4NTZA 2ECKA 1HZZA 3QBJA 4PC3A 4MICA 4TWJA 1VE3A 3OFKA 3FTCA 2JCYA 3OPVA 2XRMA 3OZGA 2B4RO 3L8MA 4G0UA 1QX3A 3IQXA 3DBRA 5C8XA 1FP4B 1J9EA 2QPTA 4N12A 3RDPA 3U37A 4QUKA 5AVQA 1KKMA 4KRYA 4OSPA 5F35A 5LBTA 1M34A 5BYBA 2HQSA 3HJAA 5FI3A 2VN8A 1AKQA 1V26A 4C01A 4XRGA 5KNCA 2Z57A 2HHAA 4XIIA 5CJJA 4ONEA 3WLHA 1GSOA 1V48A 4MDHA 3TCKA 5ICSA 1HXHA 3AIKA 4DCVA 3JQAB 1L7AA 3D6NB 3SR4A 1M67A 4IR7A 1MV5A 3HDJA 2BBWA 3GFRA 3PBKA 4K40A 4CF7A 1Z28A 1NMZA 2INGX 2YMQA 2H1VA 1D7AA 3WX0A 1E3EA 1OLUB 5BN5B 2VWPA 2C9CA 5J5AA 1L2TA 2PD4A 2FZGA 3IAUA 4X1KA 4G0ZA 3NBXX 3PJDA 3P0IA 4M1TA 4Z0TA 3EY9A 4ZEVA 1JKIA 1P5ZB 3C3WA 3QX8A 4ZQHA 3DKRA 1MC8A 3HBAA 1D6NA 3UY4A 2NZ2A 3WB2A 5IKPA 3TZ6A 2P0YA 1HNZB 3KNZA 5G53C 3IEUA 3GIDA 2GM4A 1LI5A 5HQ3B 2JLSA 1VPVA 2C3MA 1XR3A 1ZRSA 3DNFA 5EXPA 1WDKA 3BDAA 3VVCA 4EKDA 3VAZA 3EOZA 3EYWA 3K32A 2YXBA 1XL1A 2J0QA 1ATZA 4IIHA 4BO0A 1G8AA 4OFWA 2QSZA 1TYAE 4JSTA 2XIJA 4QGBA 3IQIX 1ZIOA 3LTEA 5ALFA 5E9QA 1WW8A 3WRXC 4D45A 4EAAA 4U00A 4MCJA 2JAHA 4MWZA 4BX3A 3EGCA 3UQYS 4EECA 2RHTA 3DDCA 4W1SA 3RS9A 1ZIPA 3B3FA 3S28A 1OWLA 1UF9A 3C45A 3I0ZA 3RRFA 4DPLA 1PG0A 3DZFA 4XWKA 5KQRA 5BWNA 4XDYA 2JIRA 5JQGA 2QN9A 2ZM5A 1S02A 3CUYA 3PR1A 2HSWA 1T6XA 3PUVA 4ZC8A 1WHTA 1GG5A 3SEAA 2NGRA 3OC6A 1YCFA 1J42A 4LJKA 3OFVA 3PNQA 1LK0A 2A94A 5GONB 2PLNA 3BXOA 3SVTA 4QNMA 2G9ZA 3BJRA 5AM2A 1YONA 3U4MA 4HAYA 5AVTA 2VHJA 1X8LA 1FK8A 2DMRA 4RKWA 3I58A 5FAKA 3H1PA 4Q03A 5FR1A 3RU7A 1QTNA 4F9EA 3H5NA 5E4JA 4QZVA 4EL5A 3AVTA 3MTJA 4HNAB 5GJBA 3Q8KA 2GBFA 3IHLA 1SVLA 3MVEA 4QU0A 3S2UA 2FN3A 3WB0A 4MR9B 1JIVA 2EGGA 3AI3A 3GLTA 1HQYE 1ONNA 4Y2PA 1VGVA 1V16A 3JAWA 2JGNA 3GEPA 2RGCA 2WKSA 1DHTA 4FFLA 1AO0A 4NK5A 4RJJA 1KOJA 5C32A 2FX5A 3T1OA 3UPUA 3OHPA 2GFHA 3IE0A 4MRMB 4GEKA 3SXPA 4OJKA 4KGZA 4PSDA 4PYNA 4Q05A 4WNIA 2KYRA 5KYUA 2BMEA 3ZR4B 1UKAA 5FOUA 4J2HA 1W4BA 4RV5A 5JC1A 2I65A 1Z4OA 3DXXA 3KB2A 3AHCA 4GI1A 4XIGS 4M0MA 2O5EA 4AC9A 4FLMA 5EIHA 2I4MA 1JIKA 2H2IA 4FDVA 4OHXA 5AFSA 2ZJ6A 4QPPA 1HURA 4MAFA 3T54A 4DYHA 2Z6VA 3MJRA 5KJEA 1F2VA 2HEIA 1NIJA 1ZRHA 1SIWA 1FDIA 1NZJA 1IBKB 2AN4A 4RXMA 2XNKA 3HM2A 1KZ1A 2GA8A 1E8NA 4ZYXA 4R01A 5BSTA 3I2FA 3A28A 1AKRA 1WXWA 1LTHR 2KWIA 2TYSB 3GRVA 3OVMA 4Y6GB 4DDMA 5BN4A 4DMFA 2VHUA 1ESEA 2QRVB 3NTRA 4BWYA 5KS2A 3T12A 4G65A 2PWPA 3AB7A 4ZAZA 3TG2A 1J4AA 3P5BA 1C1XA 1OZ0A 5JDCC 2Z6UA 3EQ9A 4AROA 3QTTA 3ZHCA 1FSGA 1KDTA 2FQ1A 5TEWA 3PC8A 5JJ5A 4O0LA 3EEBA 4LOHA 3IAAA 1IZYA 1CJCA 4JGIA 4QLBA 5CXUA 4KPUA 3MJEA 3CWCA 5JAQA 1UDBA 2X0RA 3IILA 5BN3B 1QK5A 2GZAA 3MB8A 4W5QA 1K9SA 4MV1A 1E1RD 2Z5FA 2ZB2A 3CR3C 2ZXUA 4MPTA 3R6WA 2AEJA 4OMDA 1TO6A 4HNRA 4Z1MA 3RHSA 3EMBA 3KTAB 5LP6C 2Z98A 4XX1A 1EE9A 3SHOA 1AXGA 3RVPA 2XMPA 3FBTA 3I8XA 4MUJA 5JVDB 1Q57A 3HHEA 3B60A 1E3DA 2FWJA 2KB0A 3PDIB 4YCJA 5LYJA 5CB6A 5AESA 4ZZ1A 2IYQA 1I2MA 3CR8A 5KYYA 1WETA 3STTA 3DVAA 1KMHB 1S9HA 3L8ZA 2MMCA 4XVRA 4QUAA 2I4OA 5J4YA 1RTTA 3JALA 2GZHA 1T3ZA 4LHYA 4PS1A 4KAJA 3DP7A 1VHLA 1RI4A 3EXHA 3QUSA 1G3MA 2I03A 4HQFA 3S5UA 4MCAA 3UT6A 1JIJA 4LJLA 5F1OA 4Z7JA 1UQTA 2DHQA 1CY0A 2DTEA 4KMMA 4EELA 4AP9A 2P91A 1TZCA 1VBKA 4DEYA 2FMUA 1SOMA 1YS4A 1DAOA 4KE7A 5JHHB 4Q3KA 5BN1A 1BH2A 3MT7A 2FW8A 4KUGA 3IV9A 1B6TA 3NJ4A 2XNCA 1BO6A 5KUTA 1N3LA 3LW8A 4UBJA 5JRZA 4IIVA 2ZJ7A 1M2VA 2JLYA 4H35A 1WDMA 4J0CA 3FYCA 4ZI7F 8MHTA 1HDRA 2HC9A 4Q4DA 1YS1X 1GR0A 2P5SA 2R5FA 3UTCA 3DNMA 3PC3A 1YXMA 4HH3C 4F45A 4LN1A 4YJFB 4NU5A 4I9FA 5FNVB 1OXXK 3F1KA 4JZYA 4EKNB 3U6KA 3L5OA 4QASA 2GVNA 4RKFA 3WGUA 1XZDA 5KC9A 4H27A 3GHHA 4HDQB 3T7RA 3LLUA 3A05A 3PUKA 2QZPA 1U2DC 2CF5A 1XN1A 2ZSJA 5HFAA 5H8WA 2BSQA 1HORA 5UKDA 2PMBA 1KTIA 3LA6A 1ILWA 1Z0ZA 1TLFA 4NU6A 2PJRA 1PS9A 1QO7A 1B74A 1U80A 2PBRA 4TL7A 3PNLA 2LNDA 3V97A 3IKTA 3RARA 2AEEA 1F60A 1H2XA 1PR3A 3DD5A 5CB4B 4N3BA 4HGZA 1XHEA 4HX2A 2D5CA 2J7KA 2R6HA 4N3NA 4C0HA 4RHYA 3F97A 2CJWB 1NUQA 4H6VA 4NESA 4HGPA 1MAUA 1JW9B 4KXQA 1S7GA 3BS4A 3C3PA 3KR0A 4ALJA 3ROQA 3O73A 4B1FA 3KTFA 1JPUA 4M8KA 4E30A 5G1OA 3DJFA 3WSTA 1U9CA 4YCLA 3IQFA 3GNSA 3BREA 4OIFA 5AKZA 1RWOA 1R9MA 1SY7A 4U02A 4WIAA 4CKZA 3QE2A 3A6DA 3K3PA 4A6XA 5CLIA 4AECA 4ZOCA 3LSYA 4JY7A 5DYGA 4G5FA 5K4GA 5IKXA 4Y1EA 5AM4A 4HX9A 4PCLA 4BB9A 1CEQA 5E6RB 1O08A 2B1GA 4BFXA 4JBXA 3NH6A 3T8YA 2L19A 3C7AA 1YQXA 3ZZMA 4IQ0A 3KDSE 3VSAA 1Y3DE 3B1JA 1QH1A 3QVGB 4IMRA 3TR5A 2JFOA 2Y2VA 4PM4A 1OZGA 3Q9LA 3JRWA 4OQXA 3I6MA 1ESZA 1BXKA 1H42A 1MX9A 2H4YA 5DM2A 4LGVA 1YZTA 3WGZA 2H2HA 4BY9E 1M7HA 1Z37A 2YVLA 3N0TA 5CLGA 4ZEXA 3F6EX 3IJ5A 4LS3A 2BHLA 2GHQA 2HXYA 2OLKA 3BSFA 3H4VA 2PFGA 5E2BA 2PG3A 2VPTA 1QGED 3EARA 4YONB 4CM4B 1L7OA 3C0KA 4EYSA 4UHCA 4JQSA 2BM0A 4B5KA 3D7KA 2EBHX 4O4LF 3OD5A 4KUEA 4DCPA 2VJCA 1BXZA 3TSYA 3ZD9A 1PDWA 4S1WA 4DM4A 4I4TB 1TK2A 3GX1A 4FB5A 3IP9A 5WRFA 1Y8RB 5HF9A 4R9NA 1Y3BE 2COUA 1M1YA 2FB9A 3PHCA 2QIPA 5J3JA 1J70A 2CB9A 3TB4A 1ZI9A 3SHFA 3K70C 1XWWA 3D81A 1BC5A 3WI7A 3ZXYA 1ZXLA 3QWFA 5CVEA 5AT1A 3NBAA 3X44A 5CB0A 2RIRA 4D9MA 3HKDB 2Y1OA 4HNTA 4ENPA 1YUBA 4I6EA 1C9MA 4YQFA 3ZH2A 4LZNA 2O8FB 3EASA 4HEA6 4MV8A 5DM1A 5CFLA 1S6YA 2GT1A 2Z3VA 4ND7A 4RV9A 1A1SA 3BRWA 5AVUA 4JU8A 1QYDA 1THGA 3F7TA 1OV4A 4TYPA 3IR5A 5H4HA 4FEEA 2PN1A 1L5GB 2P6NA 4BLPA 1R18A 2QX4A 3GJRA 5FV7A 3WE7A 5IT9A 1UKEA 1IVSA 4BZPA 2VDWB 4BUCA 1LBIA 1VSUA 5C8VA 5HZHA 2PUTA 4MV9A 5U4XA 1V47A 4XWAA 1FX1A 1H8ED 4EJMA 2BWJA 1SOVA 3QUBA 2OLJA 2NOAA 4U2KA 4NU0A 3IEVA 2RKBA 3CH7A 4ZVNA 1SCBA 4IDEA 3UAYA 1RXIA 4ZAFA 2GRJA 2IELA 4XEHA 5KVVA 5LP6F 4WZAE 4G9GA 3A4NA 2A5DA 3KO8A 4PVCA 1NMXA 5KTSA 2PUFA 4KYIB 3BIFA 2IUTA 4NVRA 1CUEA 3PUWA 4Q16A 4CTJA 3FZQA 4HUQB 1ABEA 1LKZA 1Y82A 3AZQA 4L78A 1E3TA 4YMUA 4TS9A 2JEOA 3G0IA 1BU5A 2V4UA 4BUJA 1INLA 2QRZA 2WPDA 2AX4A 3RRXA 4C08A 2FKAA 2XMQA 2DLNA 3ET5A 3IODA 2A33A 5B3AA 3PNYA 5EUCA 2PZMA 5JZSA 1TZ2A 4RVFA 4R83A 3KXLA 2PS9A 2UVPB 2P3LA 3BD8A 2L42A 4EEXA 4O4JB 5K4HA 3LQFA 3FCYA 3HDVA 4CXMA 4WZBB 3AVXA 2JVKA 3LRPA 2CFCA 4IBOA 2C03A 3GEIA 4NQZA 1QYVA 4RMIA 4X61A 3GRYA 5AJWA 3VNVA 2C29D 3RYFA 4BNDB 2Q99A 1M73E 3H2YA 3WRYC 1QE0A 4MR8B 1C0PA 1TIBA 1ZN9A 1PYOA 2G09A 3ADKA 1SXGA 4XQGA 3PPXA 5IBPA 2XHZA 5L4LA 2XEDA 4JV5B 1KI3A 1IUNA 1QP4A 1XALA 1PS0A 3N86A 3T3HA 2KE5A 5JS7A 5HJ5A 2G9NA 1U2TA 1CNEA 5CX4A 1Q1AA 5JO9A 5FKJA 2Z09A 2HT6A 5AK4A 3QKUA 1NQOA 1TYZA 1WEKA 4AMGA 1NDUA 3BB3A 1G8PA 3WA7A 1BVHA 1YASA 2WZQA 3ZS9A 4ZU1X 3BCUA 1DTWA 4PZUA 3WGJA 2HO4A 2Q6VA 1PHPA 2A0WA 4PLHA 5HIAA 2VCEA 3WYNA 4EHHA 2XBLA 2WUGA 3UPDA 2GMWA 2H00A 3WOVA 3DT9A 1Z33A 4TKLA 4EOGA 3CZPA 3LTNC 4BV2A 1OB2A 1QQ5A 2Z95A 3KVNA 3MWEB 5FI5A 4TXLA 4BQSA 3EOAI 4ZAYA 4AURA 3OUTA 1FFCA 3ETDA 1U6JA 4KP7A 5CX1B 3U7JA 3LC1O 4EK9A 1J2YA 2PNFA 2R1VB 4KXFB 1K1EA 2OWDA 2I6UA 2XOEA 3AEUA 3C1AA 1YRAA 2H16A 3TNYA 2H31A 4X1OA 5BR4A 3D0RA 5JSZB 5JVDF 1CLUA 3H2GA 4CMEA 5F4BA 1T29A 2OZLB 3RTBA 5TX7A 4WWHA 4HH1A 2QRGA 2XXBA 3DL0A 2W2TA 2QZSA 5CXQA 2Y1KA 3RQSA 1PZGA 1KO5A 2NXEA 3D6TB 3QBDA 2O3UA 4S24A 2O8DA 1YI0A 2CXPA 4DSOA 1BEZA 5FD8A 2GFQA 2TMKA 3TH5A 1Q0TA 5CMLA 1PK9A 1YS2X 1KI4A 1KI7A 1YV9A 3EUAA 4NMXB 5JJBA 1GGHA 3GV0A 4FKBA 2PE5A 4GICA 1WU8A 2AOVA 3MCVA 2PO7A 1BZYA 1NW8A 3FFBA 2B1JA 4EVIA 5T7BA 4L07A 1XKLA 4NFLA 3IV7A 3B89A 2R751 4OYHA 3ZGXA 821PA 1FYFA 2J5RA 1S3SA 4Q9HA 1OUMA 1TQDA 2BEJA 1JAXA 1DC3A 5EMMA 4YS6A 2W2OA 3AR6A 1LWNA 1SQGA 5EVCA 2PR2A 4YCBA 1G2OA 1ZONA 1ANKA 4A1OA 3QI2A 3K9GA 4P58A 4DV5B 3DBLA 1G2IA 2NAPA 4RESA 3PGXA 2ZANA 2ZB7A 3OQIB 4CMIA 4EKYA 5JNLA 4PHHA 4U6QA 2GM5A 5GZ6A 2GYUA 3ICWA 3A9VA 4QDUA 1VJTA 3GMIA 5JG7A 2GRAA 4IDPA 2I6XA 5CCBA 3EUFA 4GYYA 4Z2AA 4LTDA 1LS1A 5KYXB 3NUQA 4F4IA 4A6EA 4JUDX 2Q9BA 2JHPA 1QM5A 3OLQA 4C9BA 1HMPA 3UUEA 3ZVLA 1D0VA 1LLCA 2BEUB 3WV4A 4DL9A 2VYNA 3STXA 4B3FX 4WKPA 2IPNA 4X66B 2FVXA 2ZTVA 4X41A 5K2OA 4RTMA 1JQDA 1EFRA 1UPTA 2IHJA 1GNVA 1K2VN 5KJ6A 3HBNA 1CYEA 3OKCA 1QHXA 1T4GA 2X5NA 3UAXA 4A0FA 5HDQA 5CB4F 2VTVA 1DC8A 5EWMB 2JLUA 4MHTA 3OE4A 3E0XA 2DH5A 3NTQA 1Y37A 1FJXA 3H86A 4ID9A 4BLQA 1ZDMA 2B7CA 5KYVA 2FI1A 3V46A 4AO7A 4CMKA 2OBMA 2DKNA 3IQWA 3K0AA 3S81A 4ESEA 1TM1E 1LSSA 3O4FA 1F3LA 4N5IX 3VAYA 5IT5A 3Q3CA 3SQDA 1XRNA 5M5BA 3LVBA 4UFNA 5LM3A 1XC7A 4KTVE 2PUHA 2VXBA 1BMTA 3BE5A 1PL6A 4E2XA 3TI9A 2BMDA 1UBEA 3J81A 3FPGA 2HA2A 8ABPA 3UJHA 3EVFA 2QL6A 3D6AA 4YB8A 3HJUA 1L7NA 3AMVA 3GAFA 3QKTA 5CA0A 1PZHA 2JIMA 3IOBA 5AVJA 1NVXQ 3NIWA 1LC3A 1F2TB 2BHNA 2PUWA 2XYPA 3P1JA 1UJ6A 4JIMA 4NICA 4ENRA 1EVLA 1BSVA 1ZY2A 1K66A 5EP1A 3QJ5A 2NW6A 1OFGA 2P9TA 1LW6E 2QL5A 3GW8A 1XVIA 2QXTA 4GP9A 4MWBA 1HG1A 2LIVA 3FLAA 3GFBA 1QQAA 2JGAA 2YC4C 3BWVA 5DX8A 3TLYA 1ZD2P 2MMGA 2HHJA 1RKVA 1Z0DA 2R6JA 3I9NA 3MGGA 3V4PB 1WMAA 3L3BA 2C7VA 3KKPA 4AZ3A 1Y8ZA 5F98A 1OYVA 3L4EA 5AK6A 4GRDA 3OOHA 2P90A 4FCCA 3E2PA 1VLHA 2PGLA 2ZRGA 3SEFA 3NHSA 5JJKA 1SCKA 3LY9A 2QF7A 1QRDA 4RXTA 3OJEA 2I22A 2OCLA 2ZZNA 4XYBA 2HSJA 4P3NA 4Y2UA 1JFVA 1RLUA 3DEYX 3DPUA 1PJRA 5H4GA 4RHTA 2W6IA 1SHUX 2ZTHA 3HVIA 3PUZA 2BISA 4C7OA 5EE9A 4EYEA 4QYMA 8OHMA 4TKUB 2XGMA 3DB2A 2B83A 4KGDA 3OLCX 4Q00A 4IIUA 2P9EA 1VCNA 1EEXB 2AMVA 3EDRA 1BHSA 1IQUA 2RGEA 4BFYA 1QFZA 3BEOA 1Z5UA 2O0MA 1JAYA 3CH6A 3D4OA 4FC7A 4GX5A 2JFFA 4ZYZA 3KP1A 1WCIA 4QWWA 1CBUA 2NUPB 3JZIA 1RPJA 2FWBA 4YQEA 1H2WA 1U99A 2GAJA 1SURA 2C1ZA 2PO5A 1JMKC 4UUBA 3RG8A 3U7FB 1ISGA 4EA8A 1Z82A 1E0JA 3KRTA 4ENWA 2JLXA 1KPHA 4MWOA 2BLNA 3M5PA 2QTBA 5AVSA 1E59A 4KIJA 4MH0R 2YDXA 3SXUB 1DAIA 2Z3WA 4ENUA 5CD9A 2IDKA 4OBEA 4FEGA 4LW8A 4MV7A 4CNBA 5FDFA 1G20B 3DCYA 5C3UA 3WLKX 4REQA 1QVRA 2ZS8A 4MKHA 1V5FA 3P5SA 1CR4A 3IO5A 4PNEA 1DJLA 5G02A 2C5HA 3AO0B 3GVPA 4HLDA 2BMVA 4JWTA 1YSCA 4PZEA 3SX4A 3OZIA 3OAAD 3GDWA 1OWNA 3NAGA 3N8KA 2OO5A 4AMBA 4MUMA 2AB0A 4JQYA 1TLLA 3OIYA 4DRZA 1CR1A 2IPMA 4UHEA 3IUQA 4D99A 2XTAA 2I3GA 2BBSA 3ILHA 2DHDA 4YUZA 1EFCA 3FUXA 3EH2A 2EARA 5E6SB 2JGDA 3DTYA 2G67A 4BZWA 4JUCA 2X1VA 5CJPA 1XVTA 4I8XA 3FGOA 4B73A 7ADHA 1II8A 4I19A 1M75A 1O95A 3RC3A 5KAPA 1NLMA 4L74A 1IDN1 4CL0A 3RU3A 2XB4A 2RSLA 4P3XA 4AO6A 1BQEA 3DBHB 1JYEA 5AKHA 2M6KA 2JIZD 2QM7A 1ZAKA 1G5TA 1XZ8A 2ZATA 2FFRA 3NHPA 4BDTA 1FZQA 1YQUA 5IJWA 3C5WP 4IRUB 1D6SA 2EBFX 1TUGA 3PFFA 4KQIA 1KO8A 2I4TA 4G8JA 5C53B 2N46A 3FOBA 3HA2A 2G9UA 3OJOA 3ZLVA 5FWNA 2PY6A 1EFAA 3P9SA 3QKIA 2C2YA 4MIYA 5EIOA 3WNVA 2M98A 4GMFA 4RPHA 3HK2A 1X77A 2YUTA 2PGOA 3IPRA 1KZHA 5E4FA 3QFSA 4LXHA 5SZKB 2C9ZA 2J3MA 3BILA 3TM5A 1SUPA 3LCVB 3ZWKA 4MULA 3F5MA 4NCIA 2R6DA 4YMTA 2P6UA 1BXGB 2JVIA 3FTPA 2GAOA 3ZTWA 1LI7A 4C4ZA 2Z8ZA 3V2HA 1MENA 1QO0D 4WGFA 5AMXA 1FX0B 1X7DA 5EJGA 4CEIA 1C9YA 5J4VA 5IZCC 4LUCA 4UPVA 5H3CA 2VIIA 2F43A 1KYTA 3P4YA 2UXCB 1EESA 3MOSA 3ZXIA 1Y3FE 3OFJA 1EE2A 1EHCA 5DHQA 3D6VA 4DLLA 3ANTA 3TB6A 4GEGA 1NQTA 3F6RA 2ECPA 4RK1A 1GGNA 1N9GB 3INGA 3VC7A 3ZNOA 3NDBB 3U3KA 2FQYA 4J0HA 2IOFA 3H9UA 1QZXA 2FZWA 1ZUWA 1RYMA 2YN4A 5A4KA 1IATA 1LA2A 3D3WA 2D4AA 4C78A 4CMHA 3GU3A 3W5UA 4JX9A 1BAPA 2RHHA 3KZXA 4DWVA 4TS1A 4JMLA 2E21A 3KSZO 3WFIA 3F8WA 4D81A 4YUYA 1BMQA 3HGQA 1XGKA 1E20A 1FC0A 3TVTA 1TM7E 1UJNA 1UKBA 2YMPA 4X97A 4HRYA 3VOSA 1DQNA 4L8YA 4E88A 4D8VA 2HCTA 4DQKA 1WMBA 4BBZA 2V7BA 5AJUA 1V5IA 4DIMA 4CV2A 5B55A 1UT8A 2DLDA 5C1IA 3T9CA 4C1BA 4YDRA 2IS2A 1UDCA 4PFKA 3QLUA 4WEOA 1NZDA 3UAVA 1WP9A 2YYZA 3BAZA 3GGJA 5CLLA 3KWMA 1LFAA 5TEVA 3W79A 1KE2A 3ZVRA 2CMHA 2RG1A 4GZMA 4G5XA 4OAQA 1JIXA 2ONJA 3SE7A 1KU6A 2EIHA 3HJBA 2A7XA 2AG5A 4F2DA 4OA8A 1MG5A 3KT6A 4PC7A 3U40A 2OG2A 4OXKA 2CEAA 5L53A 3SG0A 3G8BA 4TN5A 2HDWA 2B98A 2OB1A 3RUDA 3HDGA 4EGSA 5EHGA 2BTQA 1P9WA 1YJAA 3O9VA 3OEEA 2ZJYA 4DNOA 3JVEA 1G6KA 1N7GA 4E1AA 1UJ2A 5BYAA 2A5YB 4BGDA 3NZEA 5DTIA 5JNWA 4GE0A 1NWCA 1JHZA 2ZSEA 3HCRA 4UM7A 1A0OA 2HWWA 1QJ4A 5DWVA 4B8YA 2B5VA 1RC0A 1YJXA 2HJSA 3CUEF 4YJHA 4DQVA 1U0NA 2JLWA 3OZFA 1KYIA 5IK2A 1N0UA 4FZVA 4WUTA 5SZHB 4AYXA 2CCJA 1OB5A 1XFAA 4FT2A 2EAUA 2PH7A 3CKMA 2GJ8A 4XSGA 3ZNPA 3OTOB 3PQ3A 2FHPA 3VISA 2QD4A 3VNAA 1Z5OA 1L4GA 5I7VA 4NATA 3CS3A 2DR3A 2PXAA 1US8A 4OGFA 4OUDB 3O4VA 1W4RA 1CUUA 1GRQA 4D3XA 2JB9A 2Z56A 4IH9A 2Z6QA 1I2ZA 3FKSA 4R3NA 2MWMA 3WQRA 3PLAE 4H7FA 5FPSA 4BU1A 4WRRA 2SKEA 5KWEA 1MT3A 1Q7GA 2JGEA 3U44B 2IYRA 3THXA 4NF2A 2ZRAA 3QPBA 4W63A 3UOAB 1IYZA 3GPBA 2AI2A 2JARA 1TF2A 3M5CA 5LN1A 1FTWA 1NJSA 1RRKA 4GDMA 3D31A 1ZUIA 5HS6A 3ETHA 3LRTA 2VATA 5LL6P 1XNRB 3T1TA 4ME6A 4EY6A 2R9VA 3GEMA 5BSWA 1WPRA 1VMAA 2ZUSA 4HP8A 2C84A 3RIXA 1Z83A 2N1MA 2VOJA 2ZJOA 5F7ZA 2WJHA 2J0SA 5L9AA 1NMSA 3UM9A 2CJXA 1OZHA 5ELMA 5KNDH 5C5DA 1F2UA 1V3QE 3O4IA 1LU9A 3WNZA 1V8BA 1E9RA 4KIUA 4L9AA 5ERGB 5A5DA 3IDZA 3U19A 2AXPA 2CNNA 4J4TA 1DAFA 4L8LA 2AC2A 2VPYA 4U3JA 3H0KA 3MF4A 4LXQA 1N2CA 1AGRA 1Q1EA 2P8SA 2E5FA 5ER9A 1Y7HA 1AKMA 3HO6A 5T3YA 1Z6ZA 2JHGA 2XT6A 3ZDEA 4CKBB 4EMSA 3KYIB 1KZYC 1FFXA 1YA4A 3KZCA 1NRXA 2VJBA 3NP9A 5T4FA 4WD3A 2DJ5A 4Z4HA 2JW5A 4JIGA 1S4MA 1KEPA 2J6BA 2YFHA 4PIPA 5F7OA 1Z6XA 3HLTA 4RLSA 5IXJA 2QTNA 2VPIA 2IE0A 2J9FA 4S1NA 1GVHA 2VXYA 2YJTD 4WXPA 2YS6A 4L5YA 1J2UA 1DCMA 1K08A 5B5SA 5F7XA 1EM8B 5CYOA 5HK8A 1LZLA 2DFLA 4UDOA 4Q7QA 4P0QB 1IIBA 3SVLA 2ZBGA 1B00A 1OE0A 2ICAA 1DOAA 3HC7A 3LP6A 5IDVA 2X5OA 4YXFA 3QTLA 5TR9A 3UFXA 1FMTA 4OHCA 4GMGA 2PM8A 5C18A 3FFTA 4BWFB 1OKKA 4C7XA 2BIFA 4UTOA 1M10A 2V4ZA 1XYYA 3R0XA 4HAVA 2OB2A 5CJ2A 2BHTA 1JFFA 1M2EA 2OORA 2ORED 3E84A 1CDZA 4QJ3A 3DDOA 4RSHA 5JH7F 2PL9A 3LBIA 4RTNA 1T8SA 1SNYA 3OF2A 4CLXA 1KJ8A 3I8SA 2O05A 4QUJA 3AR4A 1JEJA 2BGLA 2VR1A 3G0GA 3HU3A 3MZ0A 4GSKA 3HADA 4XWGA 4AG5A 4C21A 4MV0A 2OQ2A 3FTFA 4X7MA 4KSBA 4BQRA 3VZDA 1T0IA 3UH1A 1DT3A 4DAOA 1M76A 1PR4A 4EY7A 1CDDA 1JALA 2QVCA 5A7GA 1KRXA 1XP5A 3V8RA 1SVIA 4F2GA 3ROEA 4H4CA 2GKOA 4WAUA 4Z0NA 3HYTA 4MQEB 3STWA 3L40A 3DMTA 2G9QA 3SR3A 2VVTA 1A4RA 4FSHA 2FNAA 3I62A 4I81A 3M6WA 3O6VA 5CITA 2FPIA 5JS2A 2V45A 3FMGA 4S1VA 4ZAGA 1TVCA 4AX4A 2QTTA 2CC2A 4IUDS 4IIYA 4F6LA 4AQDA 3UJAA 1ISIA 4E5DA 5ALDA 3CY6A 1G21A 1T5LA 1Z4NA 1SVSA 3MERA 4E3WA 3QP9A 1HKUA 1V96A 1WPGA 1UM8A 2A3RA 2X5KO 2H9YA 3QPCA 4RTJA 1GAXA 4PX3A 1WEHA 2MINB 4J07A 4WJKB 2XWQA 3JSXA 4O2AB 1JG3A 4LDRA 5ALXA 1NX9A 3ODPA 1J8DA 1GCUA 5ER6A 5JAOA 1AB5A 5FTKA 2F8SA 4WY2A 2I1LA 2C5LA 3JD4A 3JVIA 4G4GA 4PO3X 4AJKA 5HZMA 4CG0A 1F17A 2YY7A 1FEZA 2XWJI 5G4KA 2AW5A 1NYTA 3E15A 3A4VA 1UBSB 5I4KA 1NHGA 1VJCA 2ZBUA 4FCTA 1JHYA 4CM8B 2GPJA 3RTDA 2C07A 3WKAA 4LDNA 1ZCZA 4KNVA 3GT0A 1X1AA 2WIKA 1ISFA 1HBJA 1EX9A 1V4NA 1Y5RA 3ETEA 4IFBA 4P4SA 4WCDA 3RAGA 2R8ZA 1XZQA 2BBTA 2Y76A 3IBTA 4LVNA 3VR6D 4PINA 4NEQA 5EEGA 1M9NA 3GJSA 3RVRA 1ZJYA 2LBPA 3PX3A 1KJJA 2X9VA 3OSZA 2HF2A 3BK2A 2XRZA 4R68A 1P73A 1SCQA 5IBCA 1I1NA 3A0UA 3PXAA 5CRIA 2Z8XA 1S3IA 5F78A 1OD6A 3A6EA 3R3JA 2G6BA 4BV8A 3NHWA 3Q3JB 4R69A 2G0AA 2PKRA 2H2AA 1E1QD 1FUIA 5CFMA 1Q0RA 2EEPA 5KTYA 2ATXA 1V1RB 3IB6A 3W2EA 3QE3A 2X8WA 1FXUA 3GJXC 4KMRA 5AVZA 2XW6A 3TGLA 1MIHA 1MPXA 2PIAA 1SHLA 4YRSA 2E18A 2XUQA 2P4UA 1D0IA 3BMNA 1X80B 4BVKA 3DV0A 2IHBA 1SIUA 3OM0A 1Y3CE 2QXUA 2ILVA 3A6LA 1CETA 1RE0A 4JFAA 4ER0A 3BSWA 5L7TA 2IBSA 2Q3CA 2VJAA 3LHSA 5EVJA 4ZU6X 5FL7D 2C4VA 5BNFA 2DCUA 3TM4A 1VJDA 4EKGA 5A5EA 4B7AA 4HB0A 1ZH8A 3PIDA 2R87A 5F12A 5IJAA 1ZN8A 2Q45A 1NJ6A 3O8QB 5K3DA 3ZW8A 5HXAA 4TN1A 1FNBA 3H1EA 3GELA 3PRJA 1RYBA 4D79A 1UMCA 2AS0A 1L4YA 3SJBA 1E98A 5IKEA 1Y80A 2O20A 2QJOA 3K2EA 3TUJC 2ALJA 4YRZA 3E7FA 4E08A 1ACJA 1ITZA 3JY6A 4C03A 1QMGA 1NF8A 5DMXA 1RM3A 2J31A 5EIAA 1ZINA 3UT0A 3O8RA 3S40A 3QELB 4DCUA 3H6HA 4FHGA 4PLPA 1TJ5A 4C0SA 5ESRA 5IVKA 5I4CA 2I2CA 3EXG1 1N0HA 2ZBVA 3I9FA 3MJCA 3GOHA 2EDAA 4HADA 3HXKA 4MVWA 4NZMA 1Q3KA 1TTQB 2C8JA 4X3CA 5FQNA 2WYUA 1OFUX 5CVDA 1G5HA 3VR4A 4URVR 3PEVA 3F6PA 3K9CA 3KIPA 4K9OA 4E7PA 3NIDB 2PYZA 4P4LA 5JS6A 1GGJA 4XX0B 3FX2A 4CLOB 4A36A 1PIWA 4ZA2A 3HBMA 1IY2A 5KU1A 1QUFA 1N5JA 3EQ7A 1GARA 3FWNA 4I1UA 3NHUA 1CJVC 3SQLA 1XLVA 3TEMA 4BN0A 4R8SA 3GUYA 4YROA 2FSVA 2OL4A 2X3UA 3HP1A 4GBMA 5JAIA 4KNWA 4F2HA 4RLFA 1OILA 3F7MA 1PW7A 3RIGA 5LOVF 4YJ2A 4OAOA 3MWGA 1E9FA 3REFA 2C3YA 4IFEA 4J0EA 3THWA 1Y8AA 3TFQA 1EWKA 4BLSA 2QL9A 5H82A 3CB4A 2GS9A 4D5GA 5CLFA 3T9DA 4U0JA 5DWQA 2VEDA 3L82B 4E2ZA 1VECA 2DETA 3H04A 1PX0A 2FMKA 2X9LA 4IDFA 1PEKE 4MPDA 5B3KA 2JANA 1C30A 2YJ4A 4YPOA 1ENYA 1Q44A 1GAJA 2XDQB 3DXFA 1U9YA 2NXWA 4H7JA 2VC2B 5LU8A 2D2XA 3C3DA 4UOQA 1NBEA 5JZ9A 1JTVA 1NJ5A 3A4YA 3FLBA 4F72A 1SXPA 1QRTA 1NVAA 2OP0A 3QV2A 3ZY3A 2VDRB 2Y71A 3JPYA 3PWKA 3R09A 3S2GA 3DYBA 1FP6A 2ZBFA 3HSSA 3CWZA 4LYEA 2LE0A 4N8DA 3W9BA 1S9DA 4AQ7A 1L1QA 2QAJA 1B0UA 2E9SA 2FWNA 4KZPA 3UO8B 5B3LA 1P1FA 1PLJA 2PYDA 3FF4A 1P19A 1ZM3A 3VDNB 3GF4A 5HILA 5B6IA 3C7KA 1CEYA 1C1HA 4HCJA 2J5XA 3AILA 3HCOA 1WS6A 4TSKA 1JA9A 1PQWA 1NP6A 3U7IA 3SYMA 1HPLA 1AKWA 3JD0A 2XVXA 1N2HA 5AM5A 1YVPA 3LPCA 3MD9A 4NJMA 3SYTA 3N75A 2JFPA 4WKCA 4EGFA 1YWGO 4UD6A 5REQB 1DCTA 3C98A 4ZGBA 5JALA 3IT2A 4KTTE 4DIOA 3VH2A 3A10A 1HE2A 1GR1A 3IAEA 3OIDA 4IV8A 5GAJA 2BCGY 4QOEA 1PSDA 1WW2A 2PUCA 4YRGA 3UFBA 1AHHA 2WQ6A 2IZZA 4EVRA 5DOZA 2HTEA 4J1SA 1EWQA 3GQBB 5DBFA 2BC9A 1PJBA 3R0ZA 4LSZA 2VO1A 2AZMA 2WE8A 3W3AA 4Q4LA 4UDXX 3KCNA 1I2DA 4C0KA 1IN7A 3UT5B 3GFVA 1W5FA 1GNTA 2GETA 4KWCA 4NG5A 4KO3S 3GI1A 4XWTA 5DSXA 3VO1A 3OX1A 4JJAA 1IHYA 1FJHA 4UJ5A 1E96A 2PUBA 1T0UA 1XQXA 2HWUA 3NT2A 3OI7A 1ZVQA 5T3UA 1WG8A 1WXQA 1DWPA 4ZXFA 1RRFA 3OQOA 1GY8A 5DNDA 5TY0A 5CVCA 2CUZA 1GLNA 4BHTA 1IJEA 4HAIA 2VFAA 1KSJA 2FFHA 3UH0A 4D0LB 2JLAA 5BSEA 5F1YA 3MK31 4JP5A 1EEHA 2ONZA 2NXCA 5I5EA 3CLKA 3SF0A 1IL0A 5DLQC 4UZSA 1JLHA 2II6A 4J6FA 5FNZA 5HRAA 5JNTA 5KNBH 2EX0A 4DA0A 2G8NA 1TVMA