4LHWA

Crystal structure of rab8 in its active gppnhp-bound form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
171
structure length
171
Chain Sequence
DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-8A
total genus 58
structure length 171
sequence length 171
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhwA00
2I3BA 3RS7A 1E1RD 1ESMA 4TQ9A 3UMFA 1CJVC 1GFIA 3U6BA 3BWDD 3TAHA 3BB4A 2D06A 2OFXA 4EQ6B 5LD2B 4AURA 3QBVA 5IHPA 2J9RA 1CU1A 2WPDA 4A8JB 5JS8A 1R5BA 1CRPA 4Q21A 4EPRA 2QP3A 4TMKA 5CB8A 1E2JA 3K0FB 4PPNA 2V55B 3FPAA 2XXAB 1QRAA 4B35A 5L3VA 2AN9A 3DMNA 2FSGA 1ZBDA 4JLNA 5CK4A 2FGJA 4C30A 1RFLA 2ZRBA 2QI9C 2HLDA 1A82A 1KDOA 3UMRA 3JZMA 4GOXA 1KSGA 5AJWA 3OEHD 1YKSA 2AXNA 2F6RA 2WBLC 2ZI7A 1G8GA 4X8OA 4EUNA 2QA5A 2UZ3A 1SKQA 4QM7A 2ZI4A 4B73A 2OO7A 4DUGA 1OFUX 2IWRA 5EXXA 4W5JA 2H16A 4B3CA 1PVOA 1OXTA 1UM8A 4PO9A 2B21A 5HZHA 3A4LA 4JJZA 4OI4A 2QP9X 1YZLA 1R0WA 2QZ4A 1NMXA 1HE8B 1II8B 1N6KA 4MUBA 1XCMA 2IYUA 1BKDR 2QP4A 3HJNA 4OQNA 4URWR 2ATXA 2EYQA 5KNCA 1HQYE 3X1ZA 4QFMA 1XTIA 5FOTA 5FUVA 1KO7A 1W48A 4NYIR 2IWHA 1NG9A 1KSFX 1OIXA 1QHXA 1UDWA 5KNBA 5FOWA 2J0UA 4TL7A 3GJ3A 5J4LA 2ZYWX 1CXZA 1DG3A 1X8JA 2ZRKA 3L43A 3MGCA 4RKFA 4CEJA 4KBFA 3KDSE 2H8KA 4EJSA 5A5GA 1AIPA 4QBFA 4DEYA 3HU1A 3SQWA 2QROA 1R0YA 1DS6A 3EZ7A 1FMLA 2B92A 2NG1A 4EPXA 2D62A 1EX7A 2C98A 3W9YA 3K0EA 1H8EA 4LJAA 1KMHB 1NVVQ 1OH7A 4XOIA 4CEIB 5HE9A 1Z22A 4D0GA 2J0QA 2IC5A 4LHWA 1E79A 1ZIOA 2ZYVX 5H1YA 1NMYA 3VAAA 1DBSA 3B1XA 1FX0A 3A4NA 3FMFA 3AUYA 4TTQA 4EIWA 2XAUA 1U8YA 3QG5A 3AKEA 5FTMA 1FL9A 3MRSA 2WJYA 3GLIB 1QVRA 3GLGE 1TADA 2C96A 5AUQA 2WSMA 4BLPA 5FUXA 4QJ3A 1F6BA 4RCZA 1R6BX 1G3IA 4EDHA 2VRWA 1IN4A 2F3RA 3PUWA 2GDJA 4LUCA 1WP9A 3PUYA 3EZ6A 1IY0A 2LWIA 4PZZA 4DLTA 2CHQA 2BEKA 2QMOA 4HB2A 2CK3A 4B2LA 4BLOA 1XTQA 4DZZA 1NVWQ 2ZM5A 4RD2A 4OL0A 3NC1C 5DGXA 4Q9LA 2IUSA 4MH0R 3H84A 1KIMA 3PEWA 2Q9CA 4LX0A 4F4IA 1NMZA 4EQ6A 1YZNA 1S2MA 4KLNA 1YRAA 1C1YA 4GZLA 1JR3E 3CRW1 5EE9A 1Z47A 4JSYA 2V9PA 3FHCB 2YNMA 4G01B 4M1KA 4O2RA 4PPGA 4ABYA 3W34A 2SHKA 2BMEA 2IS6A 4YXWD 2Z5FA 3EARA 4XH9B 4AKHA 2QORA 3NXSA 3RRNA 2WJGA 1UEJA 5EJEA 1R8SA 2VH5R 1JR3D 1MO5A 2GZAA 1HT2E 3H1TA 2NMVA 2D2FA 2A3RA 3KXIA 1Z6XA 1WQ1R 1UJ2A 4DB4A 2V1XA 1GNPA 2EWVA 3CH5A 2NIPA 2AHOA 2R62A 4DJTA 4TQUS 1NN3A 3EPKA 1ESNA 2ZAOA 4U00A 1N5JA 2GBLC 4GP7A 1S0UA 5FI1B 1Z83A 2Z6VA 1IXSB 4OI0A 4LBWA 1CBUA 1F5NA 1WDTA 3VFDA 3S1AA 1E4VA 2UKDA 4CIDA 1WCV1 5E7MA 3AVWA 3RYTC 4MITA 4BECA 4D4MA 2GA8A 3UANA 1SKYE 2BJWA 2NGRA 4EPYA 1FP7A 1CR0A 3DDCA 3THXA 2XZLA 3TUZC 1QHIA 2XSZA 2DY1A 3CX8A 1FFHA 4ZI3A 3MMPA 1N25A 1PLJA 2YHSA 4OK5A 3HP1A 4LJYA 3TRFA 1F2TB 1JR6A 1M6NA 3DM9B 2VP9A 5EP3A 1XJQA 2J0SA 4RFSA 3VNUA 1K6MA 2RGXA 1E9FA 4DT1B 4NCKA 5LBIA 3UIEA 4TYQA 3VHXA 2GK7A 5LD2C 4YDHB 1D9XA 4L16A 4QHSA 3TW4A 1DARA 2A5GA 3IHWA 1R8QA 1T3SA 1KI6B 2IW3A 1E32A 3KXLA 2JJ8A 3JVVA 3JVUA 4QOSA 3ZVLA 1KSJA 1Z2AA 3B82A 1KAOA 2H92A 1OT3A 3PUVA 1XFAA 5BN3A 3BXZA 4LBVA 1E9RA 4HLUC 2JJ2D 5FBRB 4ZV4A 1DAKA 1G16A 4ON9A 2DR3A 4IXNA 4LJ5A 3DM5A 4MGIR 4FWIB 3R8CA 5JWRA 5BYKA 2CMKA 2REBA 1RYFA 3OHMA 4QL3A 1T6NA 1WA5A 4N0EA 1Q1QA 4G5SA 4B6FA 3K70D 3I5XA 2OLKA 2PEZA 3FOZA 4HLUA 4AD8A 4A0GA 1CR2A 1RPZA 3SN6A 5L8VA 3TE6A 3RRMA 3QOFA 3ZVMA 1E1QA 3ZZ0A 2A30A 2ZJYA 5JMTA 2A5DA 3F0TA 1D9ZA 2Z0MA 2ZU6A 3K09C 4MQBA 2XB2A 4TL6A 4EFNA 2H5EA 5KO2A 3O8DA 4D6PA 3QEJA 2ZI5A 1E9CA 3PXGA 3BD9A 1OFTA 1Q0UA 1Z07A 4H1VA 4IOMA 4Q4JA 4XD7D 5AJZA 3SYNA 4AG5A 5JEEA 5KSPA 3U6KA 2RGBA 2FSHA 1R7RA 4GSYA 1COWD 2J7PA 2NZJA 2OE2A 2QAGB 2ZSDA 4GL2A 2GNOA 3QE0A 4OQMA 3ZJYA 4NCHA 4NE2A 3IEUA 4C0QC 2G88A 3I8SA 3K9LA 1VCMA 3HYRA 4JKYA 3TUIC 4JVMA 4I99A 1R5OA 1SXJB 2ZQ5A 3W8NA 4L8GA 1RE0A 2BM0A 3GJ6A 3KJHA 1IJFA 2CBZA 3X1XA 2BBSA 5TDHA 4P0TA 2G1KA 1KI4A 3KZ1E 4AYXA 2WWIA 2YV5A 3G82C 5FL7A 4F93B 2H17A 2CHVA 3UWOA 3K1JA 1EWRA 2JIZD 1TQ4A 1P4SA 3CRMA 1QF9A 2OFWA 4IHQA 1GUAA 4MDEA 4C0AC 1AM4D 2W58A 3U61B 1SULA 4ESVA 1H8HD 4YC7A 1ZNXA 4Q1CA 2FEOA 1NLYA 2RGCA 1XXHA 5FBQB 5KNDA 3U4QB 1ZCBA 2V4ZA 4OHYA 1RVDA 5KPJA 2OLJA 4BPBA 1KSHA 2JJ1A 4QJ5A 4QC2A 3GD7A 1NG1A 1KDRA 5JS7A 1SVOA 3SJZA 1G5RA 2IYWA 3KQHA 3BS4A 3BJIC 3GPLA 4B34A 2TMKA 3KUDA 4KSBA 2P6NA 1CJTC 5ANRB 1H8HA 3B8HA 2WWFA 2Z4SA 4US1R 1VYVA 4Z1MA 2C9OA 1N0VC 3CUEF 3K0FA 4RJLA 2JLXA 2JJ1D 4PO1A 3ICQB 4F92B 3CPEA 4TMZA 1KTVA 1W2HA 1QHHB 3KFXA 3SEAA 4PX9A 5JHGB 2PZFA 3HPQA 4QGFA 3P4YA 4A1FA 1OYYA 4BEJA 2D2EA 4A8JC 2QTFA 3VKGA 1U2RA 1AS3A 1KK3A 1S1CA 1GWNA 1P2UA 1G6HA 3Q85A 1JALA 4G1UC 1G8PA 1X1SA 4PC7A 4N3NA 1LB1B 3FB4A 4BFXA 1O87A 4NL4H 2XZPA 3WYAA 2BKEA 2Q21A 3DZDA 3OZXA 3WY9A 4A0RA 4EFLA 2WM9B 2IUUA 3FFBA 3R7WB 521PA 2GRJA 1OPXA 5CYOA 5JSZA 2V54A 1NL3A 3AVTA 4BEBA 4URXR 5JEDA 1SZPA 2DBYA 2JCSA 3NBXX 4B3DA 3E70C 1JXOA 4IOKA 1DAIA 2PJRA 3X1DA 2EFGA 3AVQA 1W4BA 3T1QA 3FMOB 1H8ED 4OYHA 3BORA 2ANCA 1CRQA 3AF0A 1WRBA 4B44A 4RZXA 3HR7A 1NVXQ 1LY1A 5CM8B 2GCOB 3FTQA 3WRXC 1XF9A 2UZIR 2OM2A 5EE1A 3LA6A 4YMTA 1GG2A 3IPYA 4YMSA 3IPXA 3CZPA 2ZTSA 2KWIA 4OI2A 3RSLA 5CITA 1G9XA 2IT1A 4URZR 3N2IA 4XVUA 1MRNA 3D3QA 2HF9A 4JVSB 5TB5A 4NYJQ 3RS5A 4NCJA 1ZMXA 2XTZA 3SC3A 4AG6A 2HV8A 2FSFA 4HZUB 4JYCA 3B2EA 4HAYA 4IFEA 4LPSA 3KKPA 4RD3A 2NO6A 4MUAA 2GEUA 3D6TB 2ZYTX 3MWKA 3RANA 2DPXA 2WMNB 1TU3A 1E69A 1W4RA 1E2MA 1E2EA 2ATVA 2ZREA 2F43B 4FMDB 2VP0A 1OFIA 2CL0X 4NONA 1YR7A 3RHFA 3IQXA 4P4UA 2GILA 2JDIA 4MKIA 2HUPA 4V0MA 3T1OA 4DIDA 4K46A 4EPWA 4ERNA 3NHAA 4MRPA 2GETA 2IS1A 3FHTA 3ASYA 2EFDB 2QQ0A 2VP4A 2PEYA 4WZAE 2ZSFA 2C2HA 4DCVA 1DE0A 5L3QA 2WZQA 4BFZA 2F1JA 2O8DB 2HCBA 2FOLA 4BFWA 2AD5A 4NZYA 1Q12A 2IYXA 2KJQA 3U3MA 4AKEA 3NC0C 2ODWA 4PSAA 4ZDJA 3CRRA 4MKGA 1E99A 2G3YA 2MSDB 3QF4B 2JLZA 3UMSA 2GXQA 5CLQA 1KMQA 3ZYCA 3BAFA 3KFVA 1EK0A 3QXXA 1GL7A 2FMXA 5G3YA 4IVPA 4M21A 1VIAA 2XNSA 4PQFA 4EJSB 2AWNA 1XPUA 1US8B 1Z0JA 3ND8A 4A9AA 1KJWA 2NTYC 3U7HB 1HURA 3PCRB 4TYPA 3ONWA 2K5UA 1W7AA 4V0OA 4M2LA 3CR7A 4IDHA 1PLKA 2NQ2C 5FUYA 4EPVA 2XGJA 5JLJA 1FTSA 1A2KC 1W4AA 5CIWA 4DB2A 2GAOA 1GNRA 4TSFD 4WAUA 1NY6A 1P5ZB 3C16C 1Z0FA 4PSVA 1XTSA 4JLDA 1CJMA 1TEVA 3WXMA 4KV9A 4UNRA 2GF9A 4NBSA 5HPYB 3Q7PA 2IX3A 4QG7A 2DHRA 3NBYC 5JECA 4CEHA 2VSXA 2O8EA 5GADl 3GFTA 2WTUA 4DEXA 4ZO4A 4PAMA 3G0HA 2IHBA 2KBFA 3CWQA 4IXMA 3GJ5A 4B3XA 2VHTA 3KQLA 2HDNB 2QG6A 4D81A 1ZYUA 2QRZA 3RWMB 3GJ8A 2YZ2A 1YJ5A 2CE2X 1Q1EA 1XCPA 2ZS9A 1HA3A 4DXAA 4O25A 4QHYA 4W5WA 4Q47A 4YMWA 2RH5A 3K8YA 1OH6A 4UNNA 3ZVRA 4HAXA 3RRZA 5AR1A 5F2EA 4XVQA 2IBMA 3AQ4A 2VP6A 3I3SR 4QGGA 3B60A 3IQWA 4HLCA 5IRCD 4D25A 1OXXK 3G5UA 1Q1BA 1HUQA 1XMSA 2J5XA 3TW8B 1E94E 4JLOA 2R6DA 2PX3A 3AP3A 3I5YA 4QJ4A 1VG8A 2YVUA 3FMIA 3SS8A 3W3ZB 3MJHA 5EZ5A 4AKGA 5H8WA 4ZCMA 4PAOA 3KTAB 4YDSA 3QI2A 1AS2A 4A92A 4O3MA 4L9WA 2WOOA 2N42A 1XMVA 4KFUA 4YMVA 3B1YA 1GL6A 2WSSA 4XTRA 1VPLA 3GMTA 4TLEA 4Q9HA 3EPJA 1QDEA 1KOFA 1MO3A 3BE4A 3LW7A 4KITB 2RGEA 1CEEA 1E1RA 4YLGA 1LV7A 1GVNB 1E2FA 3P1JA 3THXB 2E87A 1U8AA 2WKPA 4URYR 1HH4A 5AUNB 2JLVA 3QIAA 3U3KA 1E9SA 3REGA 2R44A 4O2LA 2B8TA 1NF3A 4HDOB 1SHZA 4LYJA 2GHIA 3I8XA 2ERYA 2QAGA 1G7SA 1I4LD 1K5DA 3FWYA 2W83A 5L3SA 4GNKA 4DSTA 3KXKA 3NTUA 4Q7JB 3BB3A 3RRYA 2AKAB 4KSCA 2CCKA 2ZITA 4Q18A 2ZRGA 1U99A 4D26A 1NSFA 1OH5A 1CP2A 1U0LA 3LVRE 4HZUA 3W6OA 1NIJA 3D7MA 1T5LA 2A5YB 4B71A 2R9VA 3X2SA 5CLLA 2VYFA 1TF5A 5BQ5A 5IF9A 1QHYA 2IXGA 3AKYA 3CW2A 1AK2A 4QBGB 5B58C 2AL7A 5C1BA 4KAXA 3CKLA 3WP0A 4X8MA 3M1IA 4A6PA 1AGPA 4M1OA 3QKTA 4I1VA 1FPMA 4BWYA 3GLFB 4JIMA 2WOJA 3TH5A 1YR8A 3U7FB 1W49A 1ZM3A 3AVXA 2PBRA 2W2TA 3BRWD 2REXB 4DDTA 1RRFA 5KTYA 1ZP6A 3CF0A 1M74A 2IF0A 4LPKA 3MSXA 2ASEA 2O8DA 3TVTA 3KQKA 3REFA 2ZS7A 4G0NA 1W46A 4BE7B 4TMXA 3TNFA 3ADBA 1TL7C 4TMWA 5JJIA 3P32A 4LOAA 2QENA 1DAEA 2QTHA 2CL6X 3QJYA 2OCPA 1G17A 2VHQA 2W6IA 4UNQA 2OXRA 1ZUNB 3KQNA 4DIEA 1JEEA 1B0UA 1KKMA 3KKNA 3KB2A 2FFAA 1NIPA 3FKSD 1A7JA 1ZC3A 2H18A 2X1VA 2CJWA 4M9XA 4RY2A 4JLMA 2O8BA 2CCJA 3IHLA 1U8ZA 2ZJBA 1YVDA 5FBWB 3RS2A 1VG1A 4BLTA 2ZE7A 3EAQA 3OIWA 5HCNA 1BMFA 1X86B 2WJJA 3C4JA 1GRQA 3PR1A 1E9BA 1VDZA 3A8TA 5EE5B 1IY1A 2DWPA 4P33A 3K09A 621PA 5JCPA 1GKIA 2CLDX 2OFOA 1CULC 2ZI3A 1J70A 3M4YA 1KJZA 3MAAC 2IS4A 4TSFA 3RAPR 1N5IA 1XTKA 1VG0B 2BIFA 3RS4A 4BRUA 1KO4A 3SE0A 4QXAA 4CRWB 4U02A 4EAQA 2ONKA 2ZEJA 3PG5A 4PAQA 2PMKA 4MRVA 3K70B 3AM1A 4UNSA 3U7EB 121PA 3KL4A 3KJGA 4PC6A 1L4YA 4TYNA 3P20A 4EFMA 1XWIA 4GOJA 1KZGB 4IDOA 3R9XA 1E0KA 1NLZA 2P5SA 3A6PC 2XX3A 2W00A 4HAWA 1TUEA 1MH1A 3GLHA 3U5ZB 4V0NA 1E98A 5BN5A 2IHYA 2DB3A 4IFBA 5SZIA 3DOEA 3IUYA 3T34A 1JJ7A 5FOXA 4Z54A 5IDVA 4QGAA 5FR2A 2VBCA 2GF0A 1FNMA 4E22A 2GZDA 1G64A 2B7BA 4C3ZA 2WKRA 3EWSA 2WIAA 1GNQA 1WMSA 2HXSA 3LXRA 3R20A 1A5TA 2PCJA 4LBYA 3VR6A 5K8IA 1NY5A 4DKXA 3GLIE 2OG2A 4P4SA 1JI0A 3GLGA 2Q3FA 3KTAA 4TLDA 3Q8XB 1KK1A 2WMOB 1Q22A 3VTKA 4RKEA 3LLMA 2HCJB 1R2QA 2J3EA 3F8TA 2FX3A 1G18A 2QE7D 2VP2A 2V6JA 1SKYB 3QXHA 3GLFA 1QZXA 5BXQC 3IO3A 5P21A 2VIIA 5SZJA 3EXAA 2IYLD 4GDFA 1CJKC 3K0CC 4IEEA 4B74A 2RKOA 1T9HA 2JLUA 4IJMA 2BBOA 1TQ2A 2EU8A 3HWSA 2FPMA 5C4GB 5F3WB 5GJBA 2OBMA 2XNDD 1F2TA 2PCLA 4ARZB 2Q0HA 5FPKA 1TUIA 2GEVA 4AKIA 1LFDB 3EX7C 3OF5A 4JLAA 4ZIRB 1M2OB 2QGZA 3IBGA 5DN6A 2B8WA 4RCYA 2OCAA 5J5CA 1M7GA 4V0ME 1IBRA 1IJEA 2G83A 1TQ6A 3THWA 4IDQA 1XX6A 3ADKA 3OIUA 1IONA 2JA1A 3L0PA 421PA 2BBTA 3T35A 3HYTA 4TT3A 4I81A 3PENA 2QAJA 2ZYUX 1D2EA 3LWNA 3PV0A 3OEEA 1XXHE 1F2UA 4B48A 3QXJA 5FTKA 5J4KA 2QBYA 1VYUA 1JJVA 4TYWA 4FI3C 3VR5A 1M8PA 1NKSA 1TF7A 3BH6A 3ZH9B 3PEYA 3O8BA 5KPDA 2Q3MA 2YC2C 4TL9A 5KSYA 4LJ6A 4UXIA 5LB4A 3ZD7A 1YZTA 2QGNA 4KJZA 1EXMA 1XNJA 2D4HA 1VHTA 4FCWA 4IOJA 1HTWA 2DFNA 2FFBA 4ZI2A 2ECKA 5BYJA 1KI9A 5CJ2A 4OI1A 2J0UB 1W4CA 1L8QA 3EASA 1RRCA 1RC8A 2ZE5A 3NDBB 2RHDA 1CF4A 2ORIA 3THYB 5L3QB 1IN6A 4AWXA 2AFHE 4HDQB 4IEIA 2MMGA 3CR8A 1HEIA 4OQFA 4A6XA 5DYIA 1KJYA 4JT4A 2CL7X 2GXUA 1QG4A 2XOKA 3AP1A 4TT3D 2ONJA 1KKLA 1W0KA 1YZKA 1A1VA 2REOA 1KZ7B 4PC2A 2ZRNA 1EFTA 3VR2A 2D7DA 3AP2A 2QRNA 2QSYA 5DISB 4B33A 3THWB 1WE2A 4C7OB 3QQ5A 4IVQA 1VECA 2ZRIA 3OIVA 4E5UA 2GK6A 3JZAA 3THOA 1BIFA 5JHHB 2JAQA 2F1IA 2IYSA 2QPAA 1F2UB 3U44A 1KI6A 3KKOA 2G0TA 2CNWD 3RS3A 2ZE8A 2Q6TA 3MD0A 4B2PA 2IL1A 3CZQA 1XZPA 3TJZA 221PA 2R6AA 5KSOA 4IW3B 3TQCA 2QMHA 4C4PA 1F48A 2ZRPA 4OKSA 3M0EA 1WF3A 3SBEA 3SNHA 1G4UR 1S8FA 2RGNA 2G9NA 4D80A 1N0UA 2FV8A 2WWXA 2IYYA 2WSSD 3UXMA 3LRPA 5FL7D 1XBTA 2RGDA 3L8ZA 4JBYA 4MYHA 2F1HA 2HJVA 3THYA 2DWQA 4GBMA 3W90A 4DBLC 1RW4A 4UXHA 4X8LA 3PITA 4RFSB 4ITRC 2P65A 1ZD9A 2OCYC 1YRBA 2VLIA 4Q4LA 1QHNA 2ZJ2A 4URVR 4P32A 2GEDA 5KYKA 3C8UA 2F9LA 3KB1A 3HDTA 5KDOA 3EIHA 1SXJC 5KSZA 1E9AA 1HT1E 3C41J 3DKVA 5EQTA 1TQDA 5KDDA 3U3RA 2NPIA 4TTRA 2NOAA 3Q3JB 4P4SB 4M1YA 4EPTA 3FE2A 2QAGC 3QKRB 3TLXA 3H4MA 1GAJA 1OXSC 2H57A 3LV8A 1TMKA 5JJLA 1N3BA 3SHFA 4JBWA 1Y3AA 4Q1EA 4LC1A 1E4YA 1XDBA 1TX4B 1US8A 3FHOA 3BB1A 5CDFE 3FVQA 3SQXA 1OLOA 2IXEA 4HYYA 3ZGXA 2A5JA 1KK2A 1R0XA 1N5KA 1NN0A 1LF5A 3FGNA 2ZSEA 1Q1ZA 4UXJA 2QMUA 1ZM7A 2BMDA 2VF8A 1DVRA 3CBQA 1D2NA 2O8CB 4F4JA 3MWYW 1AQUA 4JKIA 5FUWA 4ZIRA 1VHLA 1X8KA 1X8LA 3CLVA 3DPUA 1HYQA 1U0HC 2N46A 4JMPA 2ZUCA 4GP6A 4D0LB 5CM9C 1X1RA 1WB9A 4OK6A 2AWOA 4IDPA 3Q72A 5JRJA 2ZSBA 1IY2A 2R8RA 3LX5A 4Q1FA 3VX3A 1Z29A 5KDLA 5HKKA 1GKUB 1P2VA 2OEPA 3WHLA 4C0BA 4KYIB 4A8JA 4H9GA 4KLZA 3V4FA 3LBIA 1MABB 2XZOA 2QM8A 2OESA 1SVWA 5TV2A 1OYWA 4B47A 1GZSA 1TF2A 4C0JA 1PV4A 4MKHA 3MJRA 2CHGA 3ND9A 3IBYA 3AUXA 4PFSA 3GFPA 3T1TA 1FUUA 4LV5B 1J7KA 3NBZC 1KY3A 3QF7A 1IHUA 2DYKA 1EFRA 1TAGA 1YR6A 3TSOA 2XTMA 4MRRA 4UQOA 4XWAA 3LQRA 3AH8A 1VTKA 4A0FA 2AKYA 2DFTA 4DLRA 2OCBA 4EKDA 4CT4B 1OH8A 2ZIAA 2QL6A 1EX6A 2WWHA 5AJYA 1UBGA 3K9NA 1OXUA 2PZEA 1N6LA 4PC3A 5D3QA 3AKCA 1M34E 3AKDA 1Z3IX 4UNPA 1KDPA 4B3GA 1FW6A 2E9SA 3EIQA 1DELA 1XU4A 3E2IA 3BERA 3L82B 4OJKA 5IK2D 1G291 4PHGA 4CGZA 4ZCIA 4C0HA 1SXJE 2X2EA 3D31A 3NEYA 3EW9A 4M53A 1Z08A 1KY2A 3TBKA 2A7QA 1P62B 2C03A 3SYKA 3SFZA 1OV4A 1UBFA 4CDGA 1E9DA 1W36C 1OW3B 1GOTA 2ZUDA 4NYIQ 4OQLA 5DH9A 2VO1A 2ZRHA 2YKGA 3NIBA 4Q9JA 5DN6D 1I2MA 4TMTA 2J7KA 2AK2A 4WXRA 1E2NA 1SVKA 3SJBA 1HQCA 2H7VA 1N6IA 5JWOA 4FW9A 5FOVA 4HEJA 1PZNA 1U9IC 4OK3A 1LVGA 3L2OB 5DHAA 1Z8FA 3SZRA 5HKKD 2CVFA 3GFOA 2NO7A 4P31A 1JECA 4ZKDA 4B2IA 2IA5A 3QKSA 2EQBA 4YXWA 4I1SA 1U9IA 3TKLA 2FF7A 2GKSA 4KFTA 3MUFA 1IN8A 5JSZB 1FNNA 1XEXB 1GILA 3X1WA 1UBEA 4M1SA 1YHNA 2W6JD 3AEZA 4LY6A 4R7ZA 3PUXA 2P3SA 4Q01A 3QVVA 1V5WA 4LYAA 4WBSA 2CJWB 1F60A 2NZ8A 2YINC 5C46F 2NO0A 4KXFB 2WJIA 3OE7D 3W5JA 3CRVA 5J4VA 2ODNA 3IO5A 3R9WA 4GMDA 4TLCA 2BHRA 2JEOA 2FFQA 3GLHE 4JBXA 1S4QA 5FPYA 1ZAKA 1Q3HA 1S1MA 2GJ8A 5FH9A 4NCNA 3K0AA 1AZTA 4HB4A 3F3YA 5EP2A 2G6BA 2WVJA 2Z83A 5FOUA 3EPLA 4LJ4A 2ZU0C 2V7QD 1P7CA 1CLUA 5DO9A 1RJ9B 1AN0A 1W44A 3AF2A 4KFRA 1T0HB 3CF6R 4PANA 1SVMA 1ZW6A 1KDTA 4FIDA 1AS0A 2VF7A 5AJXA 1G21E 4M1TA 1DTSA 1Z28A 1T5IA 2GZHA 1W0JA 4PSKA 1U94A 1TEXA 5DI3A 3LQQA 1KGDA 4P4TA 4FXPA 4Q9KA 3PEVA 3FYHA 4DCUA 4FINA 3CB4A 1KI2A 2ZRJA 2ZI6A 5J40A 1EFCA 3I1FA 2ZR0A 4OQXA 3GLGB 3WNCA 1W36D 2VSFA 3SOPA 3VNVA 2EW1A 4URUR 3GJ7A 4HUTA 2I4IA 3HU2A 2YWHA 3Q9LA 2C99A 4V03A 1VMAA 1BMFD 1DAFA 1NKTA 1NBMD 5TXGA 2W6JA 2VP5A 2ZR9A 4PO8A 1MO6A 2QPTA 1VCIA 1EWQA 4Q19A 1D5CA 4RZ2A 2J1LA 1G3UA 4RVCA 2R65A 4M8NE 2O8CA 3TMKA 4ACAA 1Q3TA 2JIZA 3AF4A 1XZQA 3NH9A 4LYFA 2LKDA 1TTTA 4NYMR 4KYUA 5G41A 3LW8A 5H70A 1G7TA 2WWGA 4AI6A 5SZHB 3KKQA 4CEJB 3TGPA 4WVFA 1FMJA 5CJPA 3FKQA 1J99A 2KE5A 2VSOA 1IQPA 3L0OA 4GPTA 3EC1A 1N5LA 1OHHA 1T8TA 3H86A 3R9IA 3TR0A 1UBCA 3QPUA 4NMMA 3I62A 1ZU5A 4WW0A 4TTPA 3RC3A 3MWJA 2V7QA 1E79D 1Z0DA 4YMUA 4IDNA 1XPOA 1P2SA 2CEAA 1COWA 1G5PA 2J7PD 3Q7QA 3PFIA 3QVUA 4DC9A 2HYIC 2QT0A 2G1JA 4Q00A 2VA8A 4TLAA 4DSOA 1MOZA 3ADDA 4LJ9A 3KKMA 3IKJA 4JSTA 1E9EA 3OAAD 4JT2A 4C2TA 1T91A 2GVDC 2C9YA 4K81B 4IVRA 1OIVA 2RGGA 1KMHA 3U3JA 1KI3A 5JI3E 5HR5A 3ADCA 4DSUA 1UDXA 4B76A 3LO5A 5E7JA 3T5GA 3N2EA 3LX8A 5B2ZA 2D3WA 5C4MA 1VCOA 3KX2A 5FBVB 4FCTA 3UG6A 1P72A 2JDID 1OB5A 3ASZA 2IYQA 4ASUD 3GQBA 5DNYB 2D74A 4V0KA 3WYGA 1N0WA 4GOKA 4WA7A 2N1BA 1SHKA 1E2PA 3TQFA 5KUTA 4Q7KA 2LKCA 4BZPA 1ZCAA 2OBNA 2GAAA 2ORWA 2EVWX 5DLQC 1BS1A 2OZEA 3CX7A 1F3OA 2J59A 4JL8A 3EZ2A 1BOFA 2PH1A 4US2R 3A1VA 3SHWA 1NJGA 1JEDA 3QNUA 4IRUB 3LLUA 1QHGA 1T3HA 2AR7A 3RABA 1AA9A 3CNOA 1NVUQ 3W6NA 4ZKEA 4TZ0A 2HYDA 1SXJD 4RZUA 3L8YA 2XXAA 4M1WA 1BYIA 3CM0A 4XVRA 2RMKA 4JVLA 1O3YA 1OFHA 1AKEA 1DAMA 3AVOA 3IDQA 1G3QA 3VR1A 5FTLA 3GJ4A 3OESA 3AVPA 2QPOA 1U0JA 4YQFA 4TMVA 2RHMA 1XP8A 4HLQB 2QE7A 3HR8A 5CIQA 2FSIA 2XJ4A 1QHHA 1ZUIA 4OHZA 2CK3D 2WJHA 3BIFA 5CK5A 5GVRA 3K0AB 1E0SA 4LC0A 1P61B 1SQ5A 3GJXC 1Z0AA 4Q48A 3TAUA 1ZC4A 3OAAA 3RWOA 4TZ6A 4DWJA 4II7A 4A0HA 1OKKD 3UPUA 1U90A 4N1AA 5HE8A 2HF8A 5JFGA 1PUIA 4QGHA 3D8BA 5TY0A 3LXXA 2BKUA 2AXPA 2VQSA 1Z0IA 4RFVA 5CYPA 3B6EA 2WWYA 2ZI9A 1KNXA 4OBEA 1RIFA 4M22A 4TLBA 1E2GA 4FMDF 1N2CE 1ANKA 3C5HA 3B5JA 5JWHA 1ZD8A 1II9A 3Q5DA 2VHUA 2WHXA 4XIGS 1FQJA 1DPFA 1AKYA 4DDUA 4Q5IA 3A36A 4Q7MB 4A4DA 1N6NA 5B57C 4ZPXA 1AJEA 5EP4A 2J0VA 5GJCA 2ZAMA 2C95A 4Z1MD 2JASA 2PT5A 3QKRA 3NEJA 4XTCS 1W5SA 3DEFA 3T15A 4MDFA 1E2DA 1NVVR 1ZNZA 1ETUA 1NBMA 1ZUHA 2P67A 3NDPA 2ZR7A 2DCUA 4JJKA 1S96A 2HT6A 2Y8EA 2PT7A 3OFNA 3L0SA 3F5FA 1MRSA 1KK0A 1XB2A 2PZGA 4G5QA 1FOEB 2C5LA 3EPHA 2YYZA 4M9ZA 2R6GA 1T0JB 2F43A 4LBZA 1G20E 1JPJA 3WBKA 3ZQJA 4ZCLA 3AVUA 3ETLA 4F4CA 1ZIPA 2JGNA 1G41A 4PTLA 3U2QA 2FNAA 3UKDA 3FKSA 4E09A 3WBJA 3LNCA 1JNYA 1N6HA 3P27A 3ZQ6A 5FPHA 3IILA 4MGZR 1II8A 1GM5A 1QVAA 1UKEA 2F7SA 1E2HA 3PVSA 4PC1A 5D3MB 4QM6A 5JI2E 4LV8B 1DO2A 1J8YF 3BH0A 3O8CA 1QBKC 3AGQA 4LJ8A 1MT0A 1EGAA 3AB3A 4D4JA 1IN5A 2KBEA 2FZLA 2FA9A 3CNNA 3NKVA 4AYTA 3BFKA 3K70C 1OXVA 3KUCA 5G53C 4HB3A 3W6PA 2NO1A 2GXSA 1XJCA 4RD6A 2W0SA 5J4YA 3CH4B 3SBDA 3E1SA 1NSTA 3GJ0A 1XTRA 3B13B 2QBYB 4HSEA 1XD9A 1E2KA 1Z6YA 3QKSB 4MYTA 5EUQB 4OHVA 4DDWA 4M9SA 3AVVA 5A4JA 2BEJA 3LH5A 4Q4JB 3WMEA 4HUQA 5M04A 3B7GA 1RRPA 4NH0A 5J4HA 5AUPB 5AWFC 1OE0A 2I1QA 4KHZA 2P2LA 1TPZA 2PMDA 2WAXA 4TWZA 3BGWA 1R4AA 2EFEB 4B32A 3KJIA 1BH2A 4G5OA 4K8OA 3LDAA 4R71A 1GTVA 1UKVY 2RAPA 1T8UA 2O8FA 1V43A 5HCIA 3HPRA 3VX4A 4KCGA 4B6EA 4BLSA 1X3SA 4NHOA 1CIPA 1GSIA 2E1RA 4V0LA 5AUOB 1EG7A 2Q9BA 5DIFA 2ZVPX 4PHHA 1PLLA 2A5FA 2P6RA 2DFKB 2IEYA 4CW7A 1NLFA 4QKQA 2GWHA 2YOHA 1R10A 2BMJA 2EYUA 4LCBA 2IUTA 2IEZA 3S1AB 4DVGA 3ZZTA 1KI8A 1M1YE 5J47A 2AX4A 4MA4A 1W5TA 2ZXUA 4MYCA 2IYZA 4A2WA 4F91B 4TL8A 2BVNA 3PIRA 4M1MA 2GCOA 2ZPTX 3PEUA 1OF1A 2HT1A 1CR1A 2HEIA 4HATA 5AJVB 4PPQA 2CCGA 2XNDA 3GLHB 1XPRA 4AY2A 1SVIA 2GXAA 1KO8A 3L0IB 2HLDD 3DOFA 4FD2A 3DHWC 5L3SB 3M6AA 4KFSA 3V9PA 4ASUA 2YOFA 1YE8A 2MMCA 5IK2A 721PA 4QBIA 4DCNA 4EJSC 3TK1A 4BZXA 2I1VB 3R7WA 3VHLB 4C0KA 4DHEA 2XTNA 2ZANA 2QTVB 2ZROA 1IXZA 5F9HA 4NPHA 1K5GA 3WMGA 1DADA 4WIAA 4PQYA 5FPTA 3SJCA 5B30A 3O8RA 4G5GA 2ZRCA 1Z6GA 5JBQA 1RKBA 1T4GA 3T12A 4W9MC 2OAP1 1PJRA 3OEED 4MGYR 3H0KA 1G3RA 1WXQA 5FI0B 1L4UA 2ZRAA 1P75A 4RD0A 5TVKA 2L0XA 5JZVA 3W3AA 1IXRC 1JBKA 2CDNA 2XJ9A 1XMJA 5EXPA 2KSQA 1ZJ6A 4Q1AA 3VU9A 4ZDIA 1VKJA 3CF2A 5L3RA 3AGPA 1FTNA 2JLYA 4DLSA 4Q66C 4LSGA 1YU9A 1ZNYA 1XD8A 1TU4A 3OFND 3I4LA 4MGKR 2HXYA 4LHXA 2DFLA 2J46A 4NYMQ 1SVLA 2OILA 4O0MA 1W2GA 1KO5A 1GIAA 2FZ4A 2QMEA 3LAWA 2ZJZA 4BASA 4E07A 1P6XA 5DI9A 1VYTA 5A0FA 1DAHA 4ARZA 4BUJA 1OSNA 5JRZA 1G1MA 1ZD1A 5ELXA 1UKYA 5DI3B 4JZKA 3A1TA 4NDZA 1UFQA 5BN4A 4HAZA 1A4RA 4TQAA 1Q21A 3B1ZA 3WYFA 1PUJA 1GDDA 4LK2A 8OHMA 5EZ6B 4KU4A 1E0JA 3CPJB 4N0DA 1NBME 3EZ9A 1GITA 1DAGA 2NPFA 2J87A 5K8UA 3PUZA 1AZSC 1Z0KA 2JATA 2X19A 3RVBA 5BWMA 3LBHA 5HTKA 1N6PA 3IIJA 1HY3A 3NH6A 4L4UA 4Q4AA 4HZIA 1W0JD 1LS1A 5BW8A 1ZRHA 3DKPA 4XWKA 2ANBA 2CLSA 3SU8A 2R6FA 3B78A 4C0SA 3EC2A 4Q1BA 1G8FA 2FN4A 2XEXA 4LDJA 4M9QA 4X8HA 3MWLA 1U98A 2CLCX 2OXCA 4DRZA 3VKHA 3EWAA 1CR4A 2BOVA 4QBHA 1G7RA 3OEHA 3GEEA 1SGWA 3LVQE 4Q9IA 2F3TA 1WBBA 5KU1A 3U60B 2ZRLA 3IEVA 4F7WA 1CJUC 4LI0A 1KNQA 3SI7A 1IM2A 4JLPA 4KODA 1ZNWA 4GZMA 3CONA 1M7HA 3X1YA 3U4QA 3GLFE 3QSYA 2IK8A 2O0KA 4LZZA 1KO1A 3TIFA 4LHZA 2PLRA 2H1LA 2KI5A 3PQCA 1P9WA 2AD1A 4IOLA 1Q57A 4LJ7A 2D7CA 4FMCF 3EZFA 3QF4A 1P2TA 2QQEA 3A1WA 3KQUA 2J45A 4FMCB 3ECCA 4QNRA 2AK3A 2EFHB 2VL7A 4W5HA 4KVGA 2QY9A 3FDIA 5E3HA 1W47A 1XXHB 2CXXA 4HB0A 1YZGA 5G40A 1KAGA 1E1QD 3NWJA 4XJXA 4G5RA 4BGDA 3V4RA 4Z8YA 4D4KA 4D4LA 4XSHA 4ACBA 5KOYA 1NN5A 4CEHB 2O8EB 5DE3A 1GKYA 2XB4A 4NYJR 2V1UA 1EFHA 1E0AA 2HJGA 3TUJC 1S9HA 4LRWA 1P9RA 3MFYA 4Q7LA 3UWKA 1E3MA 4HLDA 3TSWA 3CIOA 3AF1A 1UEIA 2PLFA 4TN1A 1S3GA 1J8MF 1GRRA 2A2ZA 2FH5B 4XSGA 2BDTA 1NNEA 3H2YA 2FE4A 4JL5A 4Q1DA 3C5CA 5EP1A 5LB2A 1XRJA 3T06B 5E95A 4UJ5A 1P73A 4Y0VA 5UKDA 4NCIA 5E7IA 3BH7A 2XOKD 3ZS8A 1JQLB 1KHTA 2B6HA 2QNRA 2RGAA 1D6JA 3UATA 4RD1A 5EUMA 3DL0A 5GVSA 1FQKA 2OBLA 1MV5A 2IYRA 3QBTA 4CF7A 3K9HA 4LWZA 3CPHA 3RDPA 2ZS8A 3A58B 2FPLA 3BBPA 3EA0A 2IXFA 4DSNA 1VG9B 2QU8A 3LBNA 4US0R 2WJVA 4HAVA 1G3MA 2JLSA 5FL3A 1OJLA 4Y0AA 3CWZA 4S35A 3RC8A 1J90A 3P4XA 1TNDA 3QY0A 2JLQA 4G3XA 5GJWC 2BWJA 2GJKA 5K8LA 1A2BA 1YZQA 4DLUA 3BFVA 3CO5A 4WZ6A 4CEIA 3BK7A 4BLQA 2V8OA 3C7KA 1EFRD 1XD2A 1OHHD 1LF0A 1DEKA 1I4DD 1LW7A 2ZVQX 2C04A 1C4OA 2QUZA 1Z63A 821PA 3ZLJA 5GJVC 4E03A 2BMFA 3B1WA 3OIYA 1JR3A 1Q44A 1CKEA 3HU3A 1MR3F 4IKEA 1RJ9A 2ZE6A 3EA5A 3SDZA 3QPWA 4FCVA 2RCNA 1XEWY 2UVQA 5JJKA 2OT3B 4H1UA 1ZVQA 5FFMA 1JPNA 2V3CC 4DLWA 4Q02A 4B3FX 5EXSA 2C78A 4JVNA 4GT1A 2ZRMA 2FG5A 1H65A 4D0NA 3VU9B 2QM7A 4ESHA 2OAQ1 2F55A 3SFVA 3CNLA 1E96A 1ELOA 4ILEA 1S3SA 4OJQA 1G19A 4MKFA 3I72A 5DYGA 4C7OA 4P3YA 1OB2A 1G4AE 4HAUA 4BFYA 2GJAA 2A78A 1E2QA 2CNWA 4Q4HB 4RSGA 3AV0B 3QXCA 4FMBB 4PXAA 4Q03A 1P9NA 4A2QA 1W36B 4Z8XA 1DO0A 2QEQA 3PJRA 2J41A 4DDVA 4L5BA 4M4SA 3WP1B 3ZD6A 5HZKA 4I1UA 1ODFA 2A9KA 2IYTA 4JLVA 4UJ3A 2CVHA 1ZINA 1XJ0A 1II0A 3QEOA 4CT5A 4DLVA 2P5TB 5TARA 3TR5A 1S9DA 2ODBA 2MSEB 4Q4AB 1OKKA 3VR4A 1E6CA 2O8FB 3WNDA 2QT1A 1JAHA 2C9CA 1IAQA 1RZ3A 3DZ8A 3FMPB 4GFDA 4I4LA 2G77B 1JXMA 4MRNA 5EE0A 2X2FA 4J0QA 1NRJB 2ZJ5A 4BFTA 5K8TA 4KI0A 1AQYA 3U7GA 4PPFA 3ICEA 3NHBA 2ZETA 2IYVA 1I4TD 1IN7A 2YWGA 3QUSA 2GCNA 2R2AA 2OSBA 2GTPA 2P0EA 2FPKA 1GRNA 3UG7A 1N6OA 3VR3A 4ZDWA 2IF2A 1R0ZA 2XITA 3DVLA 4MRSA 4JYBA 2Z4RA 3I73A 4KBGA 2FWRA 4U7DA 2O5VA 4B43A 4PR0A 1J2JA 2BC9A 5FR1A 4DT1A 3LY5A 3W8RA 4JL6A 3WRYC 1W0KD 1E2LA 2F1RA 2YWFA 1Z5ZA 5CB6A 2VTKA 3VQTA 4D82A 4V02A 1WBDA 2ZJAA 3NBFA 4QNMA 3B1VA 2RB4A 3RLFA 2YWEA 1UAAA 5FTJA 2Q3HA 3A4MA 4FWTA 4B75A 1ZM9A 1NJFA 1EFUA 2KB0A 2ERXA 3GLIA 1VIYA 3B9PA 2BM1A 2JJ2A 2C77A 3WNBA 3T61A 3B85A 4A15A 4L15A 2GJ9A 4QRHA 1NP6A 2IS2A 1KI1A 1Y63A 5B64A 4AYWA 3CX6A 2C8VA 5LDDC 1RYHA 5D3MA 1IOZA 4NKRA 1BO6A 4Z51A 2F9MA 1YZUA 3BFXA 3K9GA 3ZVNA 4KO8A 4B3BA 5LPNA 1NI3A 4PZLA 1R5NA 4ZDKA 1YR9A 1XEWX 4BRWA 3R8FA 3I61A 4PZYA 4R98A 3EG5A 4A82A 3Q5EA 1C9KA 4C2UA 4AIIA 1L2TA 2ZRFA 4M0LA 1MKYA 4PHFA 2ZSAA 5G3ZA 5IT5A 3DMDA 5AK0A 2XSZD 3ZDQA 2PX0A 3QKUA 1U81A 1UF9A 4DCSA 1T3LA 3V00A 1D2MA 2GVZC 1UKZA 2ZRDA 5FOSA 4WOPA 1OIWA 4KVAA 3RSOA 2YC4C 4NTZA 4RZ3A 2ZJ8A 5FTNA 3SYLA 3I92A 1XD2B 1SXJA 4CZ2A 1Z2CA 2YOGA 5EXTA 3CRQA 3J81k 3QPVA 1D8TA 5F98A 1K8RA 2YJTD 1XCGB 1UADA 3RNLA 1ONBA 2Q9AA 2WICA 2PJZA 3A37A 3N70A 3K53A 1CTQA 4LV6A 1N6RA 3N5CA 2BCGY 4CVNA 3NG1A 2FDCA 4DLYA 1RRGA 5JCZA 4Q4HA 2RGNC 3O47A 4HI0E 3LD9A 2OHFA 4NP6A 2BJVA 2WAYA 4C9BA 1P60A 3ZIAA 1ZM4A 4BQSA 4HDCA 2Z43A 3BOSA 4PQRA 4U5XA 4NU0A 5FPSA 4AK9A 1KYIA 4JS0A 1Q20A 3GP8A 3QENA 2G0NA 1W1WA 1P3JA 3MG9A 4GMXA 4JLBA 1LNZA 3EIEA 1DOAA 1QG2A 3TSZA 1KI7A 3GEIA 2FU5C 3RS0A 2MSCB 4S2EA 6Q21A 1AGRA 2CE7A 4GRAA 4HUQB 1Z06A 1G6OA 4MYUA 3WMFA 3AF3A 5C18A 5C2JB 4YONB 5KHOC 3ZS9A 1I2DA 1ZM2A 1MABA 3IGFA 4JLKA 1SVSA 1JQJC 3NVAA 4RD4A 5F9FA 4R2IA 5CDFA 2BCJQ 4DLZA 2R6CA 4LYHA 3IIKA 4BZQA 2WKQA 2X77A 1HV8A 3I32A 1FX0B 3U44B 3FFAA 1FZQA 1LS6A 2ORVA 3KJEA 4CYMA 1BYUA 2VPPA 1E2IA 2ZUBA 2GBLA 3A1SA 2VHJA 1UPTA 2GCPA 4XD7A 4XWOA 2GJSA 4DCTA 2QN6A 1L7VC 3QXSA 2V6IA 1LTQA 2PL3A 2EFCB 1QHSA 2W0MA 1Z6AA 3C14C 5DSZA 2JLRA 4WZBE 3DO6A 4BFUA 4OHXA 3AVYA 3VMFA 4UKDA 1VCNA 4F38A 4LHVA 1FP6A 3B9QA 4FN5A 4BLRA 4C0LA 3MLEA 3OE7A 4PHTA 1X6VA 2WWWA 4POAA 3U3OA 3VKWA 2VHCA 2EWWA 4I1OA 3TVDA 3QG1A 5EE3A 2WIBA 2OUKA 3MCAA 4BFSA 4TYYA 2FFHA 5TMPA 2FJUA 3E5HA 1JB1A 4LGMA 3T1VA 4A36A 2OV2A 1GL9B 4AC9A 2DWOA 3A1UA 4L9SA 3SR0A 1ZU4A 1G8HA 2ZJOA 1B23P 2O8BB 3ZIAD 3GEHA 2B7CA 2O0JA 4R2HA 2WV9A 2X8AA 2W2XA 4JLJA 1JAIA 1CS4C 4DUGD 2AFIE 4W7SA 5DHFA 3SJAA 4BFVA 3K0SA 2O0HA 2FEMA 4LHYA 2W6ID 2BV3A 2LCFA 1HE1C 3BC1A 2QSZA 5E4FA 2NO9A 2O52A 1XMIA 3IIMA 3P26A 3UK6A 4DLXA 1EESA 1DG1G 1GP2A 4A2PA 1XEXA 1XEFA 5FBLB 3W5IA 1MO4A 2ODEA 3LFUA 4GI7A 2JLWA 1XTJA 4R9UC 5SZKB 3T5DA 3K0CA 3GCGA 1M7BA 4QHTA 2VEDA 1FUKA 1G5TA 1G8YA 1YQTA 3C15C 4WXPA 2P6UA 2BBWA 1NN1A 5H68A 3WHKA 3ZZUA 2WPDD 2FGKA 4OHWA 4D2IA 1G7CA 2W2VA 2GESA 1Z6TA
chains in the Genus database with same CATH superfamily
1GAQA 2ODAA 4PYIA 2VWGA 3PQ6A 4DLBA 4EG4A 1TFRA 2AE1A 3UMFA 1NFFA 2Q0XA 5A9RA 4ALLA 5KQRA 4HWPA 4TSRA 3BWDD 4XI9A 4INOA 4AJJA 5JCJD 1N36B 3ZDDA 1KKUA 3QEKA 4EQ6B 3PX2A 5JCJA 5LD2B 4AURA 2I87A 1ZG3A 3QWAA 1K3FA 2PGLA 2HK7A 2X5OA 2VP3A 2G6TA 2Y4NA 3DV0A 3M81A 4A8JB 4NMLA 1QH1A 4CQMB 4Q21A 1CRPA 3LWZA 1K68A 5GONF 5B37A 1XDDA 3OI7A 2V55B 1PZMA 2QZZA 5L3VA 5BN4B 3DZIA 3DMNA 3DZKA 3GLSA 2FSGA 4JLNA 1U9YA 3L4JA 2WD9A 4GD3Q 4ZT7A 2HLDA 2QI9C 3H2HA 3KEFA 3UMRA 2XWBF 3JZMA 4GPEA 4GOXA 2XIQA 4AQ7A 1KSGA 4AY3A 1IATA 5AJWA 3WGNA 3QPDA 2AXNA 4N8EA 3TQRA 1G8GA 1SBHA 4IAOA 3G2MA 4BE9A 2Y6UA 1RAGA 4YACA 4EUNA 4KO1S 4QXRA 4HGRA 3A6ZA 4X62B 3D4NA 3IT2A 2QAIA 5D1HA 2UVDA 1KIFA 4PTYA 3TQQA 4RVUA 1YT5A 3BGSA 5EXXA 2IWRA 1QNFA 1NTRA 1T9BA 2EDAA 2H16A 2R96A 3AEQA 1KQNA 4B3CA 4YIHA 1UM8A 4U7FA 1Z5WA 1PVOA 3C3CA 3DEYX 5G0WA 5HZHA 2Q46A 5F9MA 4B3HA 3T4PA 2A92A 3A4LA 5JW6A 1WHSA 1W87A 2QQ5A 4CG3A 2LBPA 3QE3A 2Z2XA 3A6EA 4JJZA 4AS2A 1H3FA 4DMFA 2FW7A 1OX5A 4MUBA 1XCMA 1W25A 2QP4A 3CLTC 4MJXA 1EVEA 2C2WA 1DFHA 2AR0A 2DKFA 3ECAA 1MPXA 5KNCA 5LZ4A 3DGFC 3FOCA 5C53B 5DYNA 4E31A 4N9WA 5KOIA 3FNGA 3U7RA 1NG9A 1OIXA 2BDEA 1UDWA 3WL6A 1UFOA 1BDIA 3FBWA 5JMOA 3L46A 2J0UA 3G1WA 3NIFB 1J6UA 2FWAA 4DM4A 1NW9B 2WINI 4JI3B 1FXSA 1DG3A 4GE3A 4HQNA 4RKFA 1UXOA 3WTBA 5AICA 2Y1LA 2C5EA 3B3QA 4F5ZA 1NULA 2X1MA 2G9UA 3FB1A 4CQJA 1GQ2A 2QROA 4AF6A 1I1HA 4DEYA 2B92A 2NG1A 4NMXB 2AEEA 4CV2A 2C98A 3W9YA 1FX1A 3L7AA 2YDYA 3WLNA 1KMHB 3T3DA 1E58A 2C84A 4MKXA 4OGWA 4C21A 2EKQA 3ZNQA 1OH7A 2FR8A 1J0EA 1Z4JA 3QFTA 2J0QA 1CQZA 1G4HA 5E8RA 2Q29A 1E79A 3H5AA 2NSYA 1B2LA 2FMIA 5JG7A 1WPRA 2QL7A 2WNSA 1E9VA 1GNSA 3HN2A 4B4KA 3VAAA 4ZI7A 1FX0A 1NX6A 1A88A 4TTQA 2XAUA 4GOMD 2RONA 3G13A 3G3EA 3NMUF 3QG5A 1PT5A 3MTGA 3P0FA 4QELA 1RQRA 3QFHA 4EGCB 5IZ4A 3NKLA 5K7SA 1RKQA 5PGMA 1XNRB 1UZNA 1QVRA 4WLOA 2FZKA 1ODSA 4DSZA 1WKVA 3CMCO 3KV3O 2F00A 2BTQA 5B1HA 2ZJ7A 1KJ9A 2WSMA 5G1OA 4AAYA 1F6BA 1GYPA 1R6BX 2PXHA 3BTOA 2E5FA 5K0EA 3OLWA 1PL0A 2VRWA 1Y8AA 2GDJA 5LZ8A 1B8VA 4ENRA 3NM6B 2WTAA 4NMWA 5AKIA 2OUIA 1IY0A 5SY6A 1NQWA 4V1CB 1TECE 2EBUA 5DASA 2CHQA 1QK3A 3BN3A 3CT4A 4IX1A 4JI0B 4HVLA 4BJ3A 4ZYWA 2RSLA 3A3NA 1R4MA 5LWHA 4RD2A 4OL0A 4U7WA 1B2RA 1J5XA 1EFDN 2IUSA 1NOJA 3GRZA 4IUDS 4KIUA 2JB9A 1KIMA 2Q9CA 4CKBB 2WUFA 4EQ6A 1SXQA 2PUTA 4GZLA 1MT3A 3GDFA 5IJAA 3O3CA 3H1BA 3FHCB 3NWEA 1RMYA 3BIWA 4XWGA 3WG9A 3WAGA 2BMEA 4ZCQA 1HNNA 2BZ1A 1VE1A 3AR2A 1LNSA 4WKGA 1M8FA 3EARA 3F8SA 4RA6B 4B4DA 5D85A 1N9GB 1I6MA 4ND2A 3MUEA 1WX1A 3ZIDA 1R8SA 1TK3A 2VH5R 3C3WA 2QTMA 1IUPA 5KKAA 4D6XA 2AUTA 3L4SO 3QX8A 3LP8A 2NMVA 1C3VA 1ZGGA 2D2FA 4LRXA 4F97A 1N1GA 4GW3A 4KLAA 2FTKE 4CL8A 4C4TA 3ESCA 2ZCUA 2NUAB 2XZDA 1PT9A 2B4QA 2EWVA 4BP9A 1DTWA 3N07A 2AHOA 5C35A 1T8SA 1UPFA 3EPKA 3KYIB 4DR5B 4U00A 3GO4A 3QNWA 3H65A 2WF5A 4U63A 1ZHFA 1RHJA 3EJWA 1O97C 1K08A 3FOAA 4GP7A 4MVYA 2Z6VA 3BQNB 1IXSB 1PBNA 4Z4FA 2WP0A 4QT0A 2BEWB 4W1RA 3MWEB 1OVGA 1WDTA 3EZXA 2OZLA 2O4UX 2UKDA 5A4KA 2WT8A 4N8SA 3HWRA 3RPEA 3QU2A 1FDTA 4MITA 3AVWA 1UPAA 3COPA 3E15A 4DEVA 3GW8A 4O33A 4OQQA 4OBXA 4JJIA 2BJWA 2VF4X 1Q1GA 3PWKA 4NATA 1W5AA 2BEUA 3AILA 3KVNA 2R87A 4OXNA 2QLLA 2QUBA 3SWWA 2QQFA 1FFHA 3AY7A 4KN5A 2VEOA 1N25A 1PLJA 1C3XA 2VI5A 4MLCA 4MI9A 1ENYA 3RFXA 4ADSG 4BQQA 3Q11A 1F2TB 5COQA 5FA5A 1L8OA 5IABA 3IUPA 1XJQA 1NHGA 4IH9A 2J0SA 3STYA 2FN3A 1EA5A 2RGXA 2JFFA 1PQYA 1MB9A 4PF1A 5LBTA 4CMEA 3VHXA 3PIIA 1TM4E 1RM4A 4AJOA 4YDHB 3L6BA 1QE5A 4FB4A 1M3SA 3OHSX 1PEDA 3I23A 1DARA 1U2DC 3HDQA 5WRFA 2PUDA 3ZE0B 2R7LA 2MYUA 1UBOS 5F35A 1X2EA 4YRTA 1H4VB 3BZUA 3KXLA 4JA0A 4MV3A 3TOCA 1QM5A 3VJLA 2CHEA 3O2NA 2FWPA 3H75A 3ZE1B 3GC6A 4H4DA 4DG8A 4D9NA 1OI3A 1KAOA 3ZLBA 1OT3A 2WAAA 4QIHA 1A5AB 2YXEA 1MDFA 2EAUA 2I2AA 5AW4A 1E9RA 2VJOA 1T0IA 2JJ2D 1BX3A 3HFJA 5K99A 4ZV4A 1DAKA 4QFDA 4X7BA 5BNZA 2DR3A 3E9NA 4G41A 5DM1A 4NC9A 3CVUA 3C70A 4MGEA 4ZK6A 5BYKA 4MVWA 2REBA 1RYFA 4PXYA 4QL3A 5JWRA 3FOZA 1CE8A 2AMYA 3AEKA 1R27A 4ZAWA 5KQGA 1CNFA 3ULKA 4A0GA 1OAOA 1RM5A 2PYZA 2MDTA 3SN6A 1RPZA 3S5JA 1FJXA 3TE6A 3IBSA 1I6LA 3QOFA 3Q10A 4O4LF 3RRMA 4BQFA 2NTEA 1EHYA 2NVOA 5ED0A 4CI0B 1V7QA 1TYCA 5DN9A 1T29A 4MQBA 3P71T 4EFNA 1FFBA 4K6CA 3GJQA 4UBNA 5H0IA 5JH7A 3CWCA 1GADO 3H1GA 3QEJA 4EYEA 2YJNA 2JRLA 1Z0ZA 1I5RA 2OLEA 3G2QA 3MQ4A 3F96A 4KKXB 4LZWA 1N2GA 5AI4A 5AJZA 2PSHA 4PLTA 1GZDA 5KSPA 4AG3A 3U6KA 3KWLA 2GASA 3HJHA 4GSYA 3TLCA 3SSAA 2XB6A 4CMKA 3J7AC 2J7PA 4P7JA 3KSBC 4GL2A 4BQEA 1LGYA 1RTKA 4OQMA 4WY2A 1KE1A 1XZHA 4C0QC 5CBPB 1JHVA 3I8SA 3HYRA 5E4YA 4YJGB 4AJKA 1R5OA 1M2FA 4JAVC 3W8NA 4HRYA 1V6CA 3PICA 1AHNA 1JIJA 1KPGA 3KJHA 1IJFA 5B36A 2I71A 2P35A 4MCHA 3A6KA 4EY5A 4MVJA 3OJEA 5LR6A 2G1KA 2X0DA 1EUQA 1RWMA 2VXYA 3LOUA 1UBLS 5D1NA 5L6MB 3VZSA 5BSHA 1V8DA 2QVXX 1CS0B 3U7JA 4DBVO 3QW2A 1G20A 2IU4A 4F93B 4UC0A 2FZWA 2H17A 4WKPA 3UWOA 1CUAA 3K1JA 3T5CA 2JIZD 1TQ4A 3HM9A 1SA0A 3MWDB 3ZCQA 2WSYB 4G37A 2I2FA 1DSSG 4HGNA 1OWMA 2CT8A 1AM4D 2W58A 2EGGA 1NLYA 5FBQB 1XXHA 4GMHA 3PFBA 3O2JA 5KNDA 3HVIA 1TC1A 1RVDA 4L50A 4Q15A 3GI1A 2JJ1A 1N1DA 2OP1A 4QJ5A 1Z75A 1XYGA 3GD7A 3NHPA 1KDRA 5AHXA 4RJTA 3NNNA 1DIBA 3ICPA 1M67A 4TWAA 4GL4A 1OWNA 3BS4A 4YMLA 2HHCA 1E6KA 2PSSA 1CJTC 4HH3C 4US1R 2WWFA 3OBIA 3ZQUA 4Z1MA 4JYMA 2ISSD 3URKA 3W7VA 3UAGA 2JJ1D 2VTBB 5CT6A 2H1WA 2JLXA 2QN2A 2Q3CA 1YGYA 1QDLB 2BEVB 3F3KA 5FPPA 4B1FA 1U5BB 4F92B 2XKKA 1PV1A 5JDIC 1GTJ1 4HR7A 4DR7B 3KFXA 4DY4A 1SXPA 2ZBGA 1RKUA 2PZFA 3HPQA 4QGFA 4A1FA 1E20A 2C61A 3FG9A 4BV2A 1Y4AE 1G5QA 5CHEA 4TS3A 3N7TA 5J2UB 2QTFA 1EJ2A 4GPIB 4ND6A 3V9AA 2PX4A 4BMOB 3PGXA 2PDAA 4QUJA 1G6HA 2P9CA 2HPZA 4PC7A 3ZWKA 1LB1B 1DWQA 1KP2A 4DCJA 4BFXA 16PKA 3WYAA 4WKNA 2BKEA 2Q21A 3WY9A 3AERB 4EUEA 5JSFA 1TKRA 3AC0A 1PS9A 3LIIA 1SY7A 2VAXA 2UYOA 2X86A 5IAKA 2GRJA 2Q3DA 5CYOA 3R7WB 3WWEA 1NL3A 5GTDA 1DGQA 5EIBD 1EAMA 7ADHA 4B7XA 4BEBA 5IJWA 4TKZA 2DBYA 3EGXB 1O5IA 2Q45A 4ZZ3A 3F6SA 4RPJA 2BFOA 5ESDA 3LXMA 2ABWA 3G9XA 4HO1X 4X6UA 3X1DA 4M55A 3CG4A 3AVQA 4QLBA 1DHRA 1F38A 2IYAA 1H8ED 4RS4A 4JOBA 2HR1A 1QU3A 4ANFA 4NDNE 1WRBA 4B44A 4RZXA 3D2LA 5CM8B 3WRXC 1V6AA 3PR2B 2UZIR 3PE3A 3S3TA 1SU6A 2A9VA 1YK0A 4Z4HA 4KR2A 5EE1A 4CKBA 1X19A 1GG2A 2AFVA 3VJMA 4BVAA 2VBIA 2OR3A 3DFUA 5AW7A 1U9JA 4KE6A 3RSLA 2KWIA 2WDZA 5CITA 1NU6A 4E7OA 4URZR 1J9ZA 3BJZA 4MUFA 3WA7A 4HXEB 3G0OA 4XX0B 2E55A 2AJBA 3EJ6A 4NYJQ 1GGNA 1ZGBA 3RS5A 4NCJA 3H1FA 3GWGA 4JC5A 3F49S 1H2XA 1T3TA 5IH3A 4MVJG 4WCVA 1JQBA 2PQMA 5I8ZA 4TKVA 1XN1A 1CIVA 1F3LA 1NI5A 2YMQA 3OJOA 1GUZA 2APJA 1WMBA 4LOLA 5ETJA 3ZNNA 2CUNA 1R0SA 2NO6A 1D0IA 5FFFA 4R16A 1DCFA 2H0QA 3MWKA 3TFOA 4OTZA 1GL3A 1XTTA 2JFVA 2WNIA 3RYIB 3FETA 1H6DA 4GXQA 3KKZA 4Y9RA 5LJLA 1P39A 2JGLA 5DRYA 3ILXA 4MW9A 1YR7A 4NONA 3RHFA 4NLLA 3IQXA 4JMLA 4OQPA 1A9RA 2IQIA 13PKA 2HUPA 3G5LA 4P4UA 3T1OA 4IIJF 4K46A 3HXTA 5FEMA 4EPWA 2I9KA 3HA7A 4KBYA 1Q0RA 2GETA 1SEVA 1ZY2A 2JG3A 1WMFA 1F8XA 4RTMA 4GXRA 3LP6A 3IESA 3TB6A 5KC8A 1V48A 4I0WB 4N6OA 3T38A 2GBGA 4Q4CA 1U1CA 2I1LA 3AM4A 5L3QA 3N8IA 4PLHA 4PLFA 1QHEA 5EN4A 2RCYA 1TZ2A 1V8ZA 4A0QA 4BFZA 2FOLA 5JTTA 1EX1A 1KQFA 4BFWA 4HRVA 5I3ZA 2QUIA 2CYAA 3HO8A 3S2GA 2KJQA 4AKEA 1QC5A 4MP8A 2ZJ1A 4YROA 4CLEA 1PGPA 2ODWA 5L6LB 4PSAA 3CRRA 1AU9A 3N0VA 1F8FA 1Z4MA 3DCNA 1E99A 1KZ6A 3EZGA 4J1NA 4MKGA 3QF4B 3I39X 3WLJA 5K9ZA 2Q41A 4NBUA 2CB9A 2RIPA 3AR3A 5IKXA 1KMQA 4F46A 1ML4A 2WDPA 3NC4A 2HNBA 2I33A 2C2XA 4MKRA 5K3CA 3TNDA 2CY0A 1GL7A 1SC1A 1KAMA 1LBIA 1Y7TA 1Z7BA 1O97D 2OL4A 4JJAA 3UCXA 3R76A 2NNLD 4RV4A 2PYDA 1R3DA 2RK3A 2XNSA 3KFLA 3R2JA 4NBRA 4XCXA 2ZKLA 4EJSB 1Z0JA 4A9AA 5DGCA 2GSDA 4GR5A 2QJWA 3C87A 3ITKA 1T0UA 3PCRB 5CDYA 1YZFA 3ONWA 4ND1A 4DNOA 2YHIB 1W7AA 1MPTA 3ESBA 2IPLA 4YECA 5IAJA 3CR7A 1KJIA 1MC4A 4X20B 2W71A 4PG6A 4JI1B 5B55A 2XGJA 1W4AA 1TLLA 2W2KA 3PU6A 2SKDA 3CZ9A 1ODIA 1MJNA 3QLTA 3VC1A 3FTNA 2YHAA 1L4FA 5TS2A 3EUFA 3U62A 2PKEA 1TEVA 4LRTB 4KOEC 4UNRA 3REOA 5ITZA 4WEOA 4AZ0B 3WR5A 3V32A 5JECA 4KB5A 4LRYA 2JIMA 1XGKA 2WU0A 3BXXA 3K72B 4R1PA 5ADWA 4FNGA 3DULA 1D2AA 3VV2A 4D4IA 4DEXA 1BJKA 1TYBE 5GADl 3I6QA 2WTUA 1GTRA 4O1MA 3G0HA 4JYZA 2KLBA 2KBFA 3BMCB 4LVNA 3T54A 3WIOA 1RQ2A 1X7YB 3KXDA 4EHNA 2E4XA 2BE7A 3L7JA 4JEIA 1LUAA 1ZYUA 2QRZA 3KNZA 3SQOA 4FB5A 2FPIA 4A2CA 3VNRA 2VXCA 4AL4A 3QKIA 4JUFA 1GTSA 5FADA 4IRMA 3UOWA 4Q47A 5FNZA 4OFZA 3K8YA 3I76A 2YJZA 3D3EA 1FDUA 3DAOA 3EUEA 5AR1A 4DN6A 1AKNA 1SBCA 1U2DA 1YAJA 1ZXXA 4L74A 4A5SA 3K4HA 1VP3A 2CW5A 4IQ0A 1RTTA 4FXOA 4X3PA 4DV1B 3I3SR 2R6JA 3B60A 3IQWA 2GFQA 3QELA 3WL7A 1U0BB 2PM8A 4J0IA 4QU9A 4RNCA 1ULUA 3NT5A 4ZFNA 3TW8B 4EVRA 1S8OA 2VPWA 4JLOA 1EGHA 2XQIA 1OWPA 4LDZA 4OHUA 4W82A 3I5YA 5LMNB 2I54A 5J58A 2QD5A 1JHUA 2ZBRA 4LZJA 4NABA 1ADCA 3GJYA 3MMZA 2HEGA 3SS8A 4YV2A 5EZ5A 5BW5A 5IXSA 4IO0A 4MLDA 5ALOA 4QDZA 4IUCS 2MYNA 1PS8A 3QI2A 1RJWA 3HB5X 5CNKA 2WY2D 3OFVA 4O3MA 3UWMA 4YAGA 5IANA 1ND6A 4K0RA 4L9WA 2M6RA 2WOOA 2N42A 5F4BA 4BNHA 3UOAB 3CCFA 2P9GA 3FMGA 2Q5IA 2JBHA 3COJA 5KBYA 4XTRA 3UT5A 5A4FS 3O75A 1VPLA 3OMWA 5CD1A 1CEXA 3QNMA 2E5LB 2D5IA 1OC2A 3FCXA 3DW1X 5AO9A 1MO3A 4KITB 3LW7A 2UXDB 4TSKA 1EVZA 2CVQA 1LV7A 4JP1A 2E87A 1G5FA 1U8AA 2WKPA 4URYR 1DWUA 3L18A 1N1MA 2E7ZA 5K0FA 3GAAA 4NZMA 5EMKA 3U3KA 2QIOA 3REGA 2I80A 2R44A 4JENA 1YL7A 4PN3A 1RZVA 3N76A 3VPHA 2B8TA 2YBEA 1CX9B 1DQSA 1IFXA 1SHZA 2QTCA 3BMNB 1AO3A 1J9EA 1RM3A 1V1MB 1Y1SA 1YS9A 3BKWA 1NVFA 4LCEA 4FOPA 4RV9A 1RC0A 4DWWA 2ONZA 4LMBA 3W06A 3TL6A 1U1FA 3ZC3A 3ZPXA 5L3SA 2ZZMA 2D3TA 1TJNA 3E18A 3N86A 1PWZA 3PX7A 1OXBB 2IKSA 3B36A 3H3XA 4GNKA 4B80A 2XV1A 1QQTA 1TIKA 3E3OA 2QRMA 4KSCA 5JD4A 3F5MA 5LUAA 2XMRA 5HXAA 5JE8A 1BXRB 1NSFA 1L4HA 1KRHA 2C5GA 3H1PA 4D26A 2ZZNA 3EFBA 4CT0A 2AG1A 1Z39A 3JU3A 5EIAA 4EW3A 5EWMA 1VL8A 1NIJA 3D7MA 1DT5A 4DOMA 2V9CA 3ERCA 4F86A 3V1TC 1H1LA 1P2FA 4LYGA 2IELA 3DT8A 4MO9A 4IMJB 1BD3A 1JX6A 1E1DA 1QHYA 1JFVA 2HLHA 1BCSB 3GPIA 4RJIA 5DNWA 4WBNA 5A1JA 4F1WA 4RTQA 1KMMA 1K66A 2Q6LA 1TU0A 5DM0A 3KOXA 5BR8B 3CKLA 3EXIA 2CYBA 1R00A 5KCMA 1UUFA 1U4NA 2YFHA 2YH2A 3DVAB 1XRLA 3F98A 3QKTA 4CU5A 5IFLA 2BCEA 2AS0A 5GGXA 1FPMA 2QZPA 1WP4A 2P0AA 3P0JA 1O95C 1YR8A 2J9FB 3JQGA 4M0EA 1R9GA 3U3DA 4YCNA 2GBPA 2C4WA 2W2TA 3K9WA 3MHTA 3BRWD 5DMXA 4JP5A 2H5JA 5IU6A 5B5SA 1OLUB 4H1WA 3QVLA 3ZQ4A 3ZDBA 2O8DA 1M74A 3MSXA 5KWEA 3C43A 1GT91 1POXA 9ABPA 4P58A 1DWOA 2O48X 3REFA 3R44A 1FSSA 1QR2A 3ADBA 4CTNA 4HNSA 5JJIA 4E14A 1E8MA 1E18A 1QYVA 5FEUA 2QENA 2ZYAA 1DAEA 3QJYA 1JKJB 2OCPA 2OXRA 1ZUNB 4FFWA 3PQ5A 4R84A 4BJ5A 1W1UA 5E38A 2HFKA 1B0UA 2NADA 1K89A 2GRUA 5BRJA 2XCOA 1B42A 2O2DA 3FKSD 5FPQA 2BSXA 2IIPA 4FEYA 3BZWA 1MN6A 1PJLA 1FJ2A 1PJ2A 1L5ZA 2CJWA 3BL5A 4M9XA 4OA5A 3SC4A 2AEFA 3LLCA 2ZJBA 3MJDA 4FYWA 2J3LA 4IV0A 4DCMA 3KB8A 5JY6A 1VG1A 4RKQA 5J1TB 3D54D 3PNQA 5JC8A 1FE8A 1RI1A 2IOQA 2R11A 1BMFA 3VJRA 5KOHA 4OFBA 2XPCA 3BWMA 1GRQA 4IH4A 1DZIA 1PZFA 1VDZA 5LFAA 3Q8LA 1WUKS 1EDBA 2DWPA 4P33A 3K09A 2PUCA 1U0SY 3CGWA 1AHHA 3LU1A 1DKUA 1CD5A 3OCYA 1PZHA 1FDIA 2CLDX 2OFOA 2UVPA 2YX1A 1AKUA 3Q2KA 3HY6A 1IY9A 2ZI3A 5A6VA 3MAAC 3F5SA 4HN4B 2GYVA 2C31A 5FA8A 4R3UC 1N5IA 1XTKA 1PK9A 1VG0B 3KQTA 3CU5A 3DE0X 4CRWB 1NE2A 3ENZA 3LJKA 2RHHA 4MS4B 4QXAA 5IARA 4BX2A 4EHLA 3PXEA 3RV3A 2G67A 4MUJA 2IDJA 4PAQA 1VJDA 3PG5A 4FR5A 4S12A 1FB5A 2PMKA 4BDTA 3LC1O 1JR2A 1YBHA 4GM1A 3IEIA 4A8TA 3EGIA 4KVFA 4MW2A 121PA 4XUCA 4PC6A 3SMQA 3BD7A 3WYBA 5HRAA 3QX7A 2Q7DA 1XWIA 1LRKA 1AXGA 4GOJA 1KZGB 4NZPA 4TOIA 3W5HA 1E0KA 1IZ8A 2P5SA 3O31A 2XX3A 4CTKA 2W00A 5CLHA 2G9ZA 1OPRA 3KU1A 1TUEA 4HAWA 4R8VA 2TYSB 1LLQA 1MH1A 2ZIXA 2I99A 3PD0A 3U5ZB 1SBNE 1D1TA 4V0NA 1XZJA 1C9NA 3DOEA 1O5OA 1FUYB 4JP2A 3L5KA 5FOXA 1MGOA 1NJ1A 1X7WB 1NW4A 2H1FA 4PG5A 5IDVA 1MEJA 2CMHA 2XF8A 1OX4B 3OURA 4QGAA 2GZMA 1QYIA 1ECLA 2VBCA 5T41A 1FNMA 2VUTA 1GAEO 1XQXA 2WKRA 3CSSA 3GBVA 1NU8A 4AO7A 2WIAA 3OQMA 3LIPA 3R20A 1WSWA 4GEKA 4X84A 1UZAA 3BSSA 4MKZA 3G2OA 2VZ0A 4QUEA 4TQGA 4AW9A 1AGYA 1GU0A 1JHXA 2C2KA 4P4SA 1V16A 4QG3A 3Q8XB 4F06A 1E66A 3E2MA 3HCFA 4BC1A 1Q22A 3TZKA 3VTKA 5AVOA 3LLMA 2O4CA 2J3EA 3VC2A 1A27A 2FX3A 1SKYB 4I9UA 3DDOA 3EULA 5BXQC 2PPLA 1ULTA 3OZVA 1QS0A 1QV9A 4ZT5A 4CLDA 4DA7A 2IYLD 4E13A 4C6TB 4B74A 2G76A 3ELUA 1N4AA 1T9HA 3P7MA 4D9EA 8MHTA 1PT8A 5DGDA 3LLVA 1TQ2A 4ESEA 4R2KA 4E2WA 1BXGB 1A8QA 2BZ0A 3GEPA 1QSGA 1TVEA 1X1BA 2XNDD 1X2BA 4M7OA 5H4HA 5FPKA 1TUIA 4GH5A 2GEVA 4B9AA 2H85A 3WLFA 4BNYA 4E3ZA 4ZJZA 2W2MA 4HWKA 1HO3A 5IPFA 3UMVA 4IZIA 1C0PA 3IBGA 2B8WA 4KK3A 4UARA 1M66A 2HGSA 3GA5A 2RHTA 1YRLA 5ALPA 2NZXA 3L6DA 1IBRA 3PNOA 2G83A 2AE2A 2ZIEA 4IDQA 1QWSA 3UYLA 3BULA 5C31A 4JX8A 4RPLA 2JA1A 2BBTA 5F1PA 3HJFA 4KAFA 1NWHA 2JCYA 3OWHA 2FWJA 4I81A 4XM2A 2C5FA 3WLSA 1YRHA 3LWNA 2ZYUX 1P6QA 5HKAA 1D1PA 1F2UA 7AT1A 2Q50A 3QXJA 2UUCB 1P5RA 2CJFA 2OD9A 4FX5A 3DDNA 1EFPB 3DMGA 1L7EA 1RXEA 3VH4A 1OWOA 1WB5A 3OM0A 2HD4A 3JW8A 4PAGA 3RSHA 1REQA 1RXUA 2QTWB 2JAPA 4I55F 4TL9A 5KSYA 4QPPA 1PZGA 3O21A 4Y1RA 1ADGA 1HZZA 2E82A 3TD2A 4F71A 4DQVA 3ZD7A 3UTDA 3DCJA 2D4HA 1TKBA 4JBLA 4PNEA 3NAMA 5DF1A 2ZWMA 2AG5A 3EVBA 3LDUA 3LZ6A 5BYJA 1KI9A 1RCFA 4L3VA 4XSVA 5FAKA 4G0MA 4S2UA 2BPOA 2J0UB 2Z56A 4ZHQB 2A0KA 4FOLA 1W4CA 4GKAA 4PSUA 1HFKA 4HX5A 4KUGA 5B7PA 2ZWIA 4I4TB 3VU1A 4KMOA 1NUPA 1QGDA 1X1TA 1YFKA 2IU0A 3TTVA 4AWXA 2AFHE 4M83A 3MELA 5L3QB 5C8YF 4K6KA 3UXHA 1GU7A 1VLMA 2NM0A 3M83A 2B36A 4GKBA 2PIAA 2X3FA 5FTWA 4YRIA 4WADA 1ZPDA 3ISTA 3DB1A 5DYIA 1XDUA 3ZBPA 3E9YA 4JT4A 3KOYA 2CL7X 4D45A 2GXUA 4YAJA 2H00A 3A3OA 3AP1A 1GPKA 4PVDA 4N5HX 5TSDA 3D8HA 1N5OX 5CDGA 1EU1A 4ZQHA 2V7UA 1NLUA 1KZ7B 5IAOA 2B82A 3M6FA 4FZJA 2OGUA 4G1FA 5DIZA 2QSYA 4MAAA 5F2NA 4GE0A 2NNWB 4CHGA 3HR4A 2EDCA 3HWX1 4LSZA 1QJCA 1VECA 4QREA 4PHCA 5KNLA 3U9TA 3JZAA 4G56A 1S2IA 5MN5A 2YXNA 4P7BA 4U0KA 4BFLA 3V1YA 2CNOA 2D1RA 4L6CA 4ZI5A 2F1IA 2IYSA 3FTDA 1YONA 3EW7A 2G7MC 4HH4A 4MWDA 4QBKA 1GTL1 2M98A 3A6JA 1KI6A 5JXHA 3QU7A 3IIIA 5I9SA 2ZE8A 2Q6TA 1VQ1A 2DEUA 2IL1A 4QPDA 221PA 4P34A 1V5EA 4B87A 1SBTA 2XXJA 4W8OA 3TQCA 2HRRA 1QDUA 3H0EA 5I3CA 1NDUA 1ZITA 2HL6A 3DL7A 4QFBA 1JT9A 3SBXA 5KX5F 3QYPA 2ZRPA 1ES9A 4MQ6A 3A9RA 4GM4A 4OKSA 1WF3A 2XDYA 4QWWA 3SNHA 5EJ9A 5IVIA 2RGNA 4MXDA 2G9NA 1LVUA 1V2GA 2F8MA 2X7HA 1UM9B 2X5JO 5DCYA 4ER6A 2FV8A 2PD6A 2WSSD 4OLJA 4N40A 2RGDA 1GQRA 2G72A 4MYHA 2HJVA 3LT5A 4PCVA 3JQBC 3L7LA 1EB8A 1X9GA 1J20A 1JL3A 4DBLC 4L8YA 2Q5FA 6AT1A 3OLZA 1ORHA 3PITA 1T6YA 3EGOA 4X8LA 2VLIA 2OCYC 1YRBA 3EBLA 3GZJA 2ZJ2A 1MQAA 1OLSB 3H5LA 3GNQA 5HQTA 3C8UA 1R6UA 2F9LA 1AK1A 1WEHA 3T41A 4RIGA 4X60A 4YLYA 2B6NA 5KSZA 5EQTA 4K9LA 2ZDGA 3U3RA 1J2RA 4C29A 1S3IA 1NURA 1ULHA 3C7DB 5DK4A 2AVNA 4EPTA 2AOTB 3QKRB 1PJ8A 5KVCA 3AINA 3CXUA 3HKCB 1GU1A 1TMKA 1VSVA 5EJ6A 1ZRMA 5JJLA 4N6GA 3SHFA 5K8UA 5HUJA 4JBWA 1IOVA 3HCOA 4EMUA 1T9GS 1IXYA 4RQUA 4G1CA 3JSAA 2QTLA 3BB1A 3W4IA 5CDFE 1YZHA 3GFBA 3ML1A 3K4QA 1OLOA 2IXEA 4HYYA 4MLZA 5U9CA 1AV6A 5EEGA 1KK2A 2Y66A 3SKXA 1R0XA 1VMDA 4TZTA 5ILGA 5IUNC 3ROXA 2H2AA 2P4EA 1Q1ZA 1USWA 2ZSEA 2GSWA 4HEA6 1ZOOA 2QMUA 4Z0TA 3TAUA 3W05A 2BMDA 2VF8A 4KV7A 1DVRA 3NM5A 1NJ2A 3M2TA 3BWVA 3TNJA 1BEUB 4J4BA 1C7JA 1XRSB 2I4LA 3K6RA 3C98A 3DPUA 3PXBA 5J2TF 4I66A 3RTDA 2ID7A 2B78A 1DXQA 2Q8PA 4A27A 3HVUA 2XDWA 3B8EA 3H04A 3E7PA 2RBEA 2ZSBA 1IY2A 1K4MA 2IZZA 4Q1FA 4I3FA 1TK9A 2GI4A 3LHIA 1YBAA 3BA1A 3K71B 3V1LA 3FCCA 3R41A 3CN7A 1H5QA 4TKMA 3T95A 4H9GA 3BE8A 2JHAA 1JU9A 2OZVA 3ZW7A 3G7SA 1MABB 4ZXFA 1M2HA 4EF6A 1RM0A 4QDOA 2QM8A 3FPKA 1SVWA 4K9MA 3KT6A 2WFZA 4GF5A 3KTDA 4B47A 1GZSA 3NRBA 3H11B 1ETHA 2FPPB 1YB2A 2QTNA 4KQCA 4PCUA 3OX3A 4TWRA 4C0JA 1PV4A 2AQKA 3WV4A 1KC3A 1XZIA 3GFPA 4S1VA 3DBLB 3RE1A 4BEWA 4RMIA 1ILWA 1MXHA 3HE3A 1NVEA 2D59A 3KD2A 3NBZC 1KY3A 3CUWA 1IHUA 1AGNA 1JWLA 1EFRA 4QOIA 4LOHA 3KQMA 2GN9A 4UQOA 2UYYA 2K4MA 2ZYRA 4R1MA 2HHLA 1QQ7A 2OCBA 3KLNA 2G1PA 2ZIAA 1EX6A 2WWHA 3HL0A 2Y6VA 3IT0A 4Z9BA 3K9NA 1H69A 4N0QA 3DOUA 2OECA 4P4NA 1N6LA 4B85A 3RYFA 5GIOE 2OM6A 5IVHA 3AKCA 4N7MA 1P7YA 2IBSA 3VOAA 4S04A 2GPSA 3AKDA 3H5RA 1VHQA 2GT1A 1KDPA 1ACJA 3GBPA 4OSEA 4F9TA 2CVPA 5JYDA 1DELA 4INZA 4OJKA 2PGDA 1E7WA 5TJHA 2NVBA 1SXJE 3D1VA 2X2EA 5CBKA 4LXGA 4RF5A 1DJPA 1MD9A 1KY2A 4EHDA 2A7QA 3V8RA 2JAWA 2MYTA 2UAGA 4FYMA 1IZYA 1MAAA 2O2GA 5EHZA 3SYKA 4U0JA 3D9QX 3SFZA 3H97A 3FLBA 3OT4A 3NHJA 3TJRA 1I7DA 1GOTA 1W94A 2FN7A 4DLAA 4CTMA 1G1AA 1B3BA 3N7AA 1E7YA 3VGPA 1H6CA 1I2MA 4ICIA 5CH8A 2AK2A 4RPIA 3SJBA 4XYLA 1ZEJA 3EF3A 2H29A 1HQCA 1ZD5A 2H7VA 2BKXA 1HNZB 5T8KA 5K01A 5CFNA 4JU8A 1CPYA 1U63A 4ER3A 1PZNA 1U9IC 1E5LA 1P4JA 1Z8FA 1N57A 5K5EA 3GFOA 3NPMA 4MUIA 1E3WA 1EUDB 1O6FA 4F9GA 2X5NA 5KIAA 4I3HA 1FTYA 2R7AA 4CF3A 4ZVSA 4MQEA 5T4HA 4YXWA 4LJSA 1JQAA 2YVQA 1IRXA 1GPUA 4D7AA 2C58A 1WABA 5MGNA 5JSZB 5AD1A 4BQNA 1CUSA 1GILA 3IT1A 4NEHB 5KVVA 1Y37A 5FWAA 1XAIA 2OCGA 2CWDA 5TQJA 4XGNA 3WJAA 3AEZA 3NONA 4LY6A 5FBHA 4DLKA 4NECA 4MR7B 4EG1A 1MC5A 1MX3A 4ZHSA 2BFDA 1RXIA 3CZ5A 1V5WA 2R1TB 1XCOA 1UJ6A 4LW8A 4U9UA 1F60A 3H2SA 4XM0A 2G0AA 1BROA 4RDHA 4F3TA 1W73A 5KVQA 4KL8S 2OYCA 3SDZA 4W5TA 5ES4B 1MZVA 3E7WA 5TF0A 2ATIA 3A9TA 2GNPA 1M6VB 3P0IA 4CMGA 3ZEAA 2LVBA 4TLCA 3GLHE 4ZYYA 3QYAA 5H4GA 5JAUA 4JBXA 4HNVA 4PINA 2ZJ3A 3VAZA 2GJ8A 1P2BA 1JG4A 1XNGA 2WZBA 4FOOA 5ALTA 1A9XB 1K8XB 2VHEA 4WY5A 3IMGA 2BFPA 2D7JA 5EP2A 2G6BA 4AZWA 3GB9A 1PJBA 2Z83A 1J0DA 2DE0X 3U37A 1ECGA 4GYKA 4L4ZA 3RHZA 5IDWA 4NQZA 4LJ4A 2ZU0C 4XM1A 2GM3A 3I83A 5DO9A 2WWVD 2X76A 1AN0A 4WXMA 1K6EA 3DEZA 4KFRA 1QR6A 1GRCA 3PL5A 3CF6R 4PANA 2IEIA 5AOBA 5ELMA 5HM6A 2RGRA 7MHTA 2VNJA 4TVBA 3U48A 4F3YA 2W6MA 4G0YA 1Q15A 5LOVB 5EHQA 1YKFA 5DI3A 4WX2B 1KQPA 1NZDA 4P4TA 1SCQA 5H02A 1M1UA 3IPCA 2JNWA 3DD5A 4FINA 1H2YA 3CB4A 2VR1A 1V1RA 2W93A 3NAQA 5KOJA 2PS0A 2ZI6A 3QVGB 4BGVA 3DAPA 3JQ8B 1EFCA 3I1FA 2ZR0A 4OQXA 5IAAA 1QGED 1Y98A 1NFQA 1A8PA 3Q40A 3STHA 3VNVA 1DQRA 3GJ7A 2PQ0A 1I3LA 3N6XA 1ADBA 4KWIA 4ROSA 3FTPA 1A7UA 4JX9A 4L5CA 2YWHA 3GK3A 4NF2A 5B1DA 3VMMA 2C99A 2EEPA 2GYUA 3H7IA 4KI7A