4LHWA

Crystal structure of rab8 in its active gppnhp-bound form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
171
structure length
171
Chain Sequence
DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-8A
total genus 58
structure length 171
sequence length 171
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lhwA00
5BQ5A 4XTCS 4DBLC 1ESNA 5KNBA 2PT5A 3NVAA 3AGPA 4IVQA 1ZRHA 2O8BA 1NVVR 3FMIA 1U0JA 1OJLA 4MDEA 5BN3A 1U90A 5G53C 3IO5A 5LB4A 1OH8A 3CRW1 1BYUA 3DKPA 4PAMA 2EFHB 1OB5A 1DELA 3RNLA 4Z51A 1P9WA 4TLEA 3ND9A 1KDTA 3H2YA 2FV8A 1MO5A 4TL9A 4EPRA 1OW3B 4KCGA 4IVPA 4PO1A 4DCVA 5DNYB 3THOA 3QSYA 4GSYA 2GCPA 2VA8A 2FFAA 4K8OA 1AIPA 1T8TA 3CM0A 4D0NA 1I4DD 3EZ7A 4A82A 2QE7D 1CR1A 3F0TA 1EK0A 4E07A 3THWB 1S3GA 1II9A 5CJPA 1HTWA 4Y0AA 1RJ9B 5AUNB 5TMPA 1NN5A 5DN6D 5D3MA 2QP9X 2B7BA 5FBRB 5JJIA 3DEFA 5BN4A 2FU5C 3LBNA 5FTKA 4W5HA 4XJXA 2ZE7A 4DLSA 4IOLA 4M1KA 3ZDQA 1OIXA 1U98A 3X2SA 3QG5A 1IONA 4IVRA 2ZROA 2FN4A 3KJGA 1NN1A 3M1IA 1G16A 2IT1A 3K0AB 1U94A 1ODFA 4D4LA 5A5GA 3I8SA 3BS4A 3A4NA 4HAYA 3D31A 1OFTA 4IEEA 2BVNA 4KLZA 3P1JA 1KKMA 4RZ2A 2P3SA 1N5LA 2Q21A 2W6JD 2QQ0A 1YR7A 2RH5A 5EZ5A 5TDHA 2WKQA 4MUBA 3THWA 3A6PC 2R2AA 2XSZA 1DVRA 4PO8A 4Q9KA 5KDLA 4ASUD 4XWOA 3NXSA 1TUIA 3QF4B 5TY0A 1UBGA 2QTFA 1MOZA 1X1RA 3QOFA 4EPWA 5IHPA 1HV8A 3UANA 2XGJA 1M7GA 5DN6A 1CR0A 3EWSA 1U0LA 1J2JA 1R7RA 4HZUB 3SS8A 2IUSA 2ZVQX 5CLQA 3FMOB 1R4AA 1JBKA 2HF8A 4JL5A 4Q1BA 2KJQA 1AS0A 2OBNA 1TQ2A 2QRNA 3DOFA 1T6NA 2VTKA 3OIVA 1BKDR 1LV7A 4G3XA 4PSKA 1KO5A 1OV4A 4W5WA 3ZVMA 1XX6A 4MA4A 4A2QA 2ZR9A 3K70D 1ZW6A 2PBRA 1GG2A 3U7EB 2ZYVX 1NVVQ 5JRZA 1RRGA 5IF9A 2JEOA 2ANBA 1I4TD 4M9XA 3A4LA 2EW1A 2AKAB 3T5DA 4NPHA 4WZAE 4DIEA 3TUIC 3CX7A 3PITA 2ZRFA 4OKSA 1M8PA 1JECA 2G88A 4TQUS 1II8A 2BBTA 2C96A 2BHRA 4BEJA 1KJWA 3MWLA 3B5JA 2GAOA 1A82A 2G0NA 2GXQA 3BH7A 4RD1A 3UWOA 1NSFA 4ZDKA 1QHYA 1G3MA 1E9RA 2GJ9A 2QGNA 1AQYA 4HLUA 5C46F 1QHGA 2Z43A 1GWNA 4MKIA 2Q0HA 1WB9A 3AVPA 1K6MA 3QVUA 4PXAA 1GM5A 4B3XA 1XZQA 4N3NA 3CF2A 1ZMXA 3GLIA 2J3EA 4LV5B 4PHHA 2AD5A 4P4UA 3RS5A 3IEUA 3R8CA 3VNVA 1G5PA 4OI1A 3RWOA 4TL7A 2FZ4A 4LI0A 1M7HA 2ZI5A 3OZXA 5G3ZA 2BMEA 4BFZA 2OCPA 3PR1A 5P21A 2VHUA 2VIIA 3QKSB 1XD2B 4Q4HB 3LQRA 2J41A 3BJIC 2F1IA 3VU9A 4LJ8A 3TLXA 3K09C 4UXHA 2O8DB 2ZRCA 1QRAA 2FSHA 4RCZA 2W58A 2IYQA 1N6LA 4GOKA 4LBZA 3MAAC 4NYMQ 5CIQA 1KMHB 2AFIE 4ZI2A 1JR3E 3FDIA 1AJEA 2R6GA 1YQTA 3OHMA 1NVXQ 1ZD8A 2I1QA 3S1AA 2WAXA 1E9FA 5KSPA 3FHCB 4DCNA 3Q5DA 3DMDA 3AKYA 5L3QA 3AV0B 5DGXA 3KX2A 4IDHA 3X1DA 2IYSA 4HAUA 3E5HA 4LHVA 2XTZA 4X8MA 4Q1DA 4AKIA 1G9XA 1E2EA 1AN0A 1L4UA 4JKYA 4MGZR 2PLRA 1F6BA 4YQFA 1GOTA 1X6VA 4UNNA 5GADl 1GL6A 4JVLA 5G40A 4TTRA 3SR0A 1XD8A 4QL3A 4B48A 2RHMA 1G8GA 2VSOA 4LC1A 5FUWA 3TK1A 4D4KA 1KI7A 3BIFA 4HLDA 2UZ3A 4QOSA 3THYB 5F9FA 4Z1MD 1NY5A 4CEJA 2YWEA 1FNMA 1Q1QA 4AG6A 4LX0A 4P4SA 5A4JA 5JWRA 3VTKA 3I61A 1XTKA 2JGNA 2ZRLA 2C99A 3LD9A 2OCAA 2BWJA 1OXVA 4RZUA 5LD2C 2V6JA 4Q03A 2REOA 3B13B 2IC5A 4BZXA 3NHAA 4FMDF 1A2KC 1VECA 3EAQA 3WMEA 4DCTA 2ZRKA 3SNHA 1HUQA 2R6CA 4HZIA 2GZDA 1NKTA 4UJ3A 2PZEA 1KDOA 2BCGY 2VF7A 3EASA 2VPPA 2B92A 4DRZA 2IF0A 3RRNA 1AA9A 3A4MA 2IXFA 1DAIA 1A2BA 1W4CA 2PCJA 5EP2A 2FSGA 3QBVA 5CYPA 1NG1A 2W6ID 3IHLA 4XD7D 1FTSA 1ZJ6A 1KMHA 4B43A 5CLLA 1MKYA 1JXOA 2VHTA 3E1SA 2J9RA 4AYXA 4NU0A 5FL7D 5FBLB 2ANCA 3GJ3A 3PCRB 3EZFA 5GJVC 1XTIA 1NMYA 4ILEA 2XZLA 3NDBB 1N2CE 1KSFX 4JLKA 1GDDA 1ZVQA 4GP7A 5FH9A 2A2ZA 4HAVA 4L9SA 3EC2A 1FX0A 4M22A 4Q9LA 1A5TA 1R0WA 2WWYA 1WE2A 2CE7A 4GI7A 3I8XA 4DDWA 3FE2A 4B34A 4XVUA 2RCNA 5FTJA 3AF0A 5FTLA 2CHVA 4RVCA 1XF9A 1EG7A 2W00A 3OFNA 1NNEA 1XCMA 3ADDA 2YWGA 4OHWA 1JI0A 1Q21A 3B7GA 2VSXA 4LCBA 1JXMA 3EWAA 1G7RA 2IBMA 2ORVA 3MJRA 4TZ6A 4TWZA 1N6RA 1Z29A 4XIGS 5H68A 2WPDA 1Z6GA 3Q85A 3R9XA 3SQXA 1F48A 4AWXA 4AKEA 1M2OB 3KDSE 1E2JA 3LXRA 2P6RA 1ZD1A 4TL6A 4D25A 1CKEA 2B8WA 2IXGA 4JL6A 4KU4A 4M8NE 2W83A 4C2TA 2OLKA 4ON9A 1J90A 5FUXA 1W2HA 3V4RA 1VYTA 5JJKA 4IEIA 5LPNA 5DSZA 4XVQA 2IEYA 5BW8A 2GAAA 1G5TA 1GL7A 2BCJQ 4YLGA 5HE8A 4EPVA 3G82C 3JZAA 1S1CA 4BLQA 2GJ8A 2YKGA 4CW7A 5DHAA 1DG1G 1YRAA 1Z6TA 2KI5A 4B73A 1J8YF 4Q4AB 3ZS8A 2ZYTX 3BFKA 4DJTA 3SN6A 2OBMA 2GZHA 3SFZA 1E2IA 2WOOA 3OESA 1FUKA 2QMEA 1VG1A 2YWHA 2WV9A 4AYTA 3ZD6A 3BGWA 3W34A 1WA5A 2QSZA 1E9SA 1HE1C 2BKEA 3WHLA 1RE0A 1E96A 4FCVA 2GXUA 1O87A 1FFHA 3LLUA 4Q21A 2ZUCA 1E2KA 1NN0A 4KFTA 1TTTA 1R0YA 3QKRA 4L15A 5B58C 2GJSA 2OXRA 1DAEA 1XEWX 3U6KA 5F3WB 2V4ZA 2BMFA 1S9HA 4PPFA 2VSFA 1XFAA 3NBZC 2J7KA 2YC2C 1D9XA 2ZJ8A 4FMCF 2GRJA 3AKDA 3UMRA 2MMCA 4GBMA 1KI9A 5AUQA 3LWNA 5L3SB 1DPFA 1MRSA 3WHKA 2XB4A 1GKIA 1H8ED 2XJ9A 1RRFA 4DLTA 3BB1A 4URYR 3KQNA 2BMJA 3C7KA 3CO5A 4IXMA 1LTQA 4GT1A 2QROA 4A8JA 2JLZA 4NTZA 1JR3D 1G7TA 1IJEA 2YWFA 1X1SA 3AP3A 5BN5A 5FBVB 4RD0A 2QAGC 2J1LA 4PR0A 1YZGA 1P73A 2DY1A 2B8TA 3KJEA 2O8CB 2HV8A 1CJUC 4Q9IA 4BLPA 3I73A 4TYNA 4F4JA 1T5LA 2ZSFA 2VP5A 1IY1A 3AVOA 3OFND 3VR3A 1OFUX 1Z83A 4F38A 4D2IA 3MCAA 3TJZA 4JLMA 3UG7A 1KNQA 2DWPA 3QF7A 5H1YA 2AXNA 4TTPA 2OCBA 1GVNB 5GVRA 2WSMA 4Q7LA 3NBXX 2DWOA 1UAAA 1IQPA 1CJVC 4LWZA 1KI6A 4EJSB 1TQ4A 2GNOA 5SZHB 1U9IA 2PCLA 1G64A 4XWAA 1I2DA 2AXPA 1JJ7A 2CCGA 5EP3A 5JI2E 4TMZA 1F2UA 5AJXA 4KITB 1IXZA 1XB2A 1T3SA 2VP2A 4Q1CA 3N70A 1XD2A 3TUJC 4C0QC 4TL8A 1VPLA 2IYRA 1ZUNB 1O3YA 4OYHA 5DIFA 2UKDA 4LK2A 3QNUA 3Q5EA 2ZEJA 3UATA 5K8LA 4JS0A 2BC9A 2R8RA 2FF7A 2NG1A 1JAHA 3NTUA 4H9GA 1OXSC 4D4MA 1HYQA 4B6FA 3PFIA 3SC3A 2NO7A 2YNMA 1D8TA 1P72A 3DHWC 4BLOA 4AY2A 2JLSA 5AJYA 3K53A 1GRRA 4HDOB 2XSZD 1KHTA 1X8LA 2CNWA 2JLRA 3HPQA 3QVVA 2OFXA 1SVLA 4IRUB 3PXGA 1ZU4A 4A0FA 2GWHA 4P32A 4KHZA 3AVTA 2F43B 1F60A 4ZKEA 3WP1B 1IXSB 4M21A 1OHHA 221PA 3BOSA 3LO5A 4MGKR 4ZDWA 1CRQA 3E2IA 2OO7A 1G4AE 2HJVA 2YINC 2X8AA 3VR5A 2PX3A 4TSFD 2ZPTX 2G3YA 3IO3A 1CF4A 4KBFA 3CLVA 4B75A 3HP1A 4DT1A 1G20E 2YYZA 2Z4SA 1DAMA 2QAJA 4YDHB 1Z47A 3EZ9A 3SHFA 3P20A 3FHTA 4D0LB 4EPXA 2FZLA 3KZ1E 1FUUA 2C9CA 2IXEA 4YC7A 4QG7A 1ZNXA 3W5JA 3AVYA 4C7OB 4LSGA 1HEIA 5E95A 3TAHA 1XMJA 5TV2A 4MRSA 3ZIAA 2P5TB 3AVWA 1IAQA 3RHFA 1XPUA 2DB3A 4AURA 3BFVA 1X8JA 4Q7JB 4AD8A 1MRNA 4XTRA 2QMUA 1VIAA 1VG0B 1LF5A 1A7JA 2WIBA 3ZQJA 1NBMA 2ZS9A 1H65A 2FFQA 1CR2A 1KI1A 1AGPA 4IOJA 4TLAA 4OHXA 3BD9A 4URUR 2ORWA 4JYBA 1E6CA 2BEJA 5D3QA 2WJVA 1R8SA 1P62B 2NGRA 3WYAA 5JSZA 2DR3A 5KPDA 4OQNA 5AUOB 4OI0A 1GFIA 2J5XA 4ZCIA 3GP8A 4R9UC 2G0TA 2W6IA 5CK4A 5FPHA 5H8WA 2CJWB 1Z8FA 2ZUDA 1AM4D 1NLFA 1OFIA 2GCOB 3D8BA 3HU3A 2NTYC 1II0A 5FR2A 1KO7A 4MYTA 1E2LA 3TRFA 3WRXC 5DO9A 2XZOA 3NEJA 2REXB 3C5HA 5B30A 2O8EB 2GCNA 3F5FA 1FTNA 1SVOA 2XZPA 4P3YA 3IQWA 4HDCA 2FA9A 3I1FA 5KUTA 2JJ2A 1PUIA 1S9DA 4OQXA 3GFPA 1SULA 1TMKA 4B3GA 3BE4A 3NKVA 1XTRA 2LWIA 3WRYC 1KAOA 1QHHB 3ICEA 3BC1A 4L4UA 3AB3A 4GOXA 1Z0IA 4US1R 2C03A 4Z1MA 2F1JA 1DE0A 4OJKA 1ZAKA 1YE8A 3GLIB 4GFDA 2QMHA 3U3MA 3QPUA 1Q3HA 2CK3A 1G18A 1QDEA 4QFMA 1E32A 2R9VA 3AP1A 1NRJB 1SXJE 4AG5A 4BQSA 3UXMA 5CJ2A 2WJHA 1CXZA 1RYHA 2JDIA 5JCZA 3CH4B 4NKRA 2W0SA 1ZIOA 2H17A 1X3SA 4BWYA 1R0ZA 4IW3B 4A4DA 1Z0KA 1EWQA 2NPFA 4PPQA 1NSTA 3RRMA 1N6PA 2ZE5A 3BK7A 2ZU0C 1AGRA 4JLJA 5TVKA 2CLSA 2BBSA 1GRNA 1P2TA 3QE0A 3EX7C 2AL7A 3BERA 5C2JB 1SVWA 3B1YA 3QPVA 3FTQA 3A1WA 2QPTA 4V03A 1W47A 2ZRPA 3NIBA 4O2RA 1G7SA 1D2NA 4TMXA 4CIDA 2F3RA 2WICA 2AD1A 3T12A 4JJZA 2CDNA 4UNRA 1QHSA 2SHKA 4NMMA 1QHXA 4DSUA 3AM1A 2ORIA 1GP2A 1R8QA 2QPOA 2JATA 2MSDB 4JZKA 3U4QB 3IEVA 3N2EA 4A2WA 3Q7PA 3FKSA 4ZKDA 4B32A 1E1RD 3HR7A 3MWJA 3WYFA 2WMNB 2IS6A 4G5GA 3IHWA 2YOGA 1NBME 4HAWA 4YMVA 1NG9A 3ZH9B 2YHSA 1RRCA 2GXAA 4D81A 4R7ZA 2O5VA 4GZMA 1G8HA 2EFEB 1E9CA 1QHHA 2VQSA 3BXZA 4IOKA 1ZNWA 2JLUA 1BIFA 3PIRA 2FDCA 1D2MA 4BPBA 5GJBA 4PZZA 3AVVA 3EPHA 2FEMA 3CNLA 2PMDA 3CKLA 1KI3A 4I1OA 1RC8A 4R2HA 1JQJC 5JMTA 3KKOA 3NBFA 3L43A 1FQJA 3K8YA 3SJBA 1KY3A 5FOSA 3C14C 3MLEA 2O8FA 2OV2A 2CEAA 3KL4A 2NMVA 3H4MA 2H57A 1XP8A 2QSYA 3ZVRA 4DDTA 1B23P 1Z6XA 1TQDA 1LS6A 1K5DA 2JIZD 4HLCA 3VR4A 1ZNYA 2JLYA 1OF1A 4NE2A 1EXMA 4FMBB 1HH4A 2GHIA 1NJFA 1ANKA 2NZ8A 2VEDA 3LQQA 2GXSA 3OEHA 2J46A 2BBOA 2A30A 4KO8A 4QC2A 5JEDA 3V00A 2A9KA 4HAXA 2JIZA 3EZ2A 2P5SA 3W6PA 2QU8A 3ONWA 4U02A 5FFMA 2WWHA 1ZM4A 5L3VA 3QJYA 4KAXA 4QGAA 1TNDA 2CHQA 2IL1A 2JJ2D 2RGDA 2HF9A 3W5IA 4DLUA 2DWQA 2G1JA 1XPOA 2GA8A 1NBMD 1KOFA 2XTMA 4KJZA 4ESHA 1QHNA 1P60A 5TARA 3T1OA 1E9AA 1CU1A 2G1KA 4B44A 4DSNA 3OAAD 3L82B 3HYTA 1Z0DA 2A5GA 2C78A 4NYMR 1RZ3A 2V7QA 3HDTA 3MWKA 4OBEA 3UKDA 2PL3A 3K0FA 2GEDA 2ZR7A 1EX6A 4EUNA 2AFHE 4PO9A 4DIDA 1ZM9A 1Z06A 2Z6VA 4LYFA 2REBA 2QM7A 3NDPA 2ONJA 4OI4A 3WNCA 4IKEA 5DISB 3F8TA 3Q8XB 1E2GA 1FZQA 1MO3A 3B1XA 4MUAA 1E9DA 3C4JA 4WZBE 2GK6A 1E98A 3QY0A 4PQFA 5KYKA 3T15A 5LB2A 2QBYA 3TW4A 4M9ZA 2WAYA 2V6IA 3JZMA 1OYYA 2Q9AA 2W6JA 5CM8B 5JCPA 1G8YA 1Z5ZA 2YOHA 3IIMA 3RRZA 1D5CA 1OHHD 1SVMA 2ZIAA 3B82A 3ZIAD 1GIAA 1D6JA 3SBEA 3U7GA 3T61A 1KI8A 1N3BA 1I2MA 1TX4B 3IBGA 3I92A 4JBYA 3CUEF 4A1FA 2NO1A 2ZJ2A 4AKGA 3KQHA 2NPIA 2QE7A 2XAUA 3L8ZA 4Q47A 4K81B 2WJYA 4F93B 2WPDD 3VKHA 4P33A 3FHOA 1Q3TA 1IXRC 3DOEA 1CS4C 5FBWB 2IYWA 1U2RA 4JLDA 4LJ6A 3AF3A 1KO8A 4XD7A 3SEAA 4QXAA 2OM2A 2ZR0A 3CW2A 4P31A 2A5FA 4M1WA 2JCSA 5FTMA 2GZAA 2IYVA 4B2IA 1N0VC 2P67A 1TU3A 1W0JA 2XOKA 3IPYA 3RC3A 1XXHB 2GKSA 3TAUA 4A92A 3O8CA 3DKVA 4G5QA 2ZREA 4B3BA 3EARA 3HU1A 3OEED 4JJKA 1GNRA 1U0HC 5K8IA 4HAZA 4RD3A 1YR9A 4BEBA 3QI2A 3QXXA 3VR6A 821PA 5SZJA 4MKGA 5AWFC 3FGNA 4TQAA 1JB1A 2IK8A 4HB2A 1SVKA 4W9MC 4KLNA 4LHZA 5HTKA 2C8VA 3CRMA 3TVTA 3LVRE 2V1XA 3K1JA 5EUQB 1QBKC 3BWDD 2ZI4A 2DYKA 2VLIA 2ZTSA 5DLQC 1ONBA 1IJFA 3RWMB 2EYQA 3J81k 1Q44A 3IILA 1XBTA 2Q9BA 1W2GA 3OF5A 4Q5IA 1Z6YA 1Q12A 4XH9B 2OG2A 2ZJ5A 4LZZA 5B64A 4ACAA 1KK1A 4G1UC 1JAIA 2ERYA 1DO2A 4D82A 2D3WA 2VH5R 2F3TA 3UPUA 3W9YA 4TYWA 3CRRA 3W3AA 2XOKD 2J7PD 1YZTA 1S2MA 1PZNA 4YXWD 4CEJB 4ACBA 1E94E 2OHFA 4C3ZA 4NCIA 4PHFA 3W8RA 4B47A 1JQLB 2ZM5A 4UXJA 5KSZA 2HJGA 3GEHA 1LVGA 3GFOA 1Y63A 1VG8A 2I1VB 2R6DA 3W6OA 3CX8A 5KU1A 3VX4A 1KO1A 2CE2X 1SKQA 4KVAA 5BYKA 2D2EA 2VHJA 3EA0A 4FIDA 3ND8A 2EWWA 4ARZA 3DL0A 3QEJA 1OKKA 2A5DA 2FGKA 2ODWA 1KGDA 2JJ8A 1XEXB 4O25A 4RJLA 4Q9HA 1SHKA 3TE6A 1Q20A 2A5YB 4OJQA 2ZRDA 2BIFA 1VHLA 4PTLA 5EE5B 3EPKA 4TLBA 4H1VA 1F3OA 2ZSAA 3VFDA 1GSIA 1FW6A 4M1TA 1F5NA 3ZQ6A 4EFLA 3FOZA 1D2EA 1VCIA 1KJYA 3NC1C 3FPAA 5FPTA 1KMQA 2RGBA 3ETLA 4HDQB 4W7SA 3B9QA 4GZLA 5FPSA 3SFVA 3WMFA 4M4SA 3PEVA 4QGHA 4RFSA 3SZRA 1WQ1R 1UDXA 2DFLA 1GUAA 1GTVA 3A37A 2V9PA 2VO1A 2BKUA 3U2QA 3TQCA 4EAQA 5KNCA 3P32A 1EFCA 1GNPA 1S96A 2CHGA 1G3RA 1J8MF 2BDTA 1NL3A 2AN9A 1AKYA 3T1VA 1T0HB 1MR3F 2P65A 3GJ0A 3HU2A 4D0GA 4L5BA 3L0OA 4S2EA 1Q1EA 1UKZA 2QTVB 2C2HA 3SU8A 4HEJA 4X8OA 3GQBA 1OT3A 2ECKA 5FI1B 3X1ZA 1E0AA 3CH5A 2IHBA 4TMKA 3WYGA 2ZQ5A 2H7VA 2FEOA 3EC1A 3VNUA 3LBIA 1IY0A 3IIJA 5B57C 1J99A 2AR7A 4GL2A 1GNQA 4LUCA 2Y8EA 3EZ6A 4UJ5A 1XZPA 1G6HA 4R2IA 4RCYA 4QHSA 4V0OA 1SKYE 3R9WA 1W36B 3GLHB 3D6TB 4Q18A 4PSVA 4JVNA 2GETA 3U7FB 4TQ9A 1HY3A 5TB5A 1NKSA 1GKUB 1W0JD 3OEHD 3RABA 4C0JA 4DUGD 3K0SA 3U5ZB 1NLZA 3I5XA 1MT0A 2HCBA 4AYWA 1E2FA 3LW8A 3L0IB 4C0LA 4FMDB 3MFYA 4URZR 1BOFA 4YXWA 4CYMA 1XEXA 4CEHB 4JVMA 4O2LA 3A1SA 4HB0A 4FCWA 1QZXA 1PLKA 1W0KD 2RKOA 3OE7D 4IFEA 1LY1A 5KDOA 3U60B 3BB3A 4NBSA 1DAGA 2QGZA 3P4XA 4JVSB 4C30A 1OPXA 4LJAA 3LX8A 4LHWA 2V1UA 2JLVA 5HCIA 2ZRMA 2QT1A 2HT1A 1PV4A 2WSSD 3K0CA 1SGWA 1UBEA 2FWRA 5HPYB 4RY2A 2ERXA 1QF9A 4PC3A 4BLSA 3L0PA 4U5XA 2J87A 1NI3A 3KKMA 1TADA 3H0KA 5UKDA 3SI7A 4IDPA 5IK2A 1M34E 1XJ0A 5FOXA 1HT1E 3CPEA 3ZZTA 3LW7A 2V7QD 4IFBA 5GJWC 3ADCA 1RYFA 3NG1A 1YZLA 3CZPA 1AS3A 1NMXA 3U3KA 3GJ4A 4MRPA 3B85A 2CLCX 5J4VA 3SOPA 4OK5A 4KV9A 1XMSA 2NOAA 2VYFA 3K0AA 3OEEA 1T5IA 4QJ5A 4TYPA 4BGDA 2KWIA 2Q3FA 1A4RA 4BRUA 2QN6A 4YMTA 2G77B 3DMNA 1CJKC 1NIJA 3KFVA 4URXR 1MO6A 4EFMA 1RRPA 2XNDA 4GPTA 4C2UA 3O8DA 4A6XA 3L0SA 4NYJR 3IDQA 1CRPA 1IOZA 3B8HA 1PUJA 4MYCA 1QHIA 4OI2A 1UBCA 4MH0R 1DAHA 1ETUA 1G3UA 2BM1A 2C95A 4HI0E 4V02A 2GTPA 5JFGA 3GLGB 2DBYA 3KKNA 2JJ1D 4JL8A 2AX4A 1D9ZA 1UJ2A 4M0LA 4QGGA 2D7DA 2ZU6A 1Z3IX 4KSBA 5BYJA 4B74A 1J7KA 1KSJA 1ZP6A 4US2R 2HEIA 4MKFA 4I1VA 2OAP1 2QPAA 1W1WA 2B21A 2R62A 4G5RA 1NIPA 5CDFA 5HZHA 2IWRA 4GDFA 2YJTD 3FYHA 3GMTA 3SJAA 2CBZA 2OZEA 4DCSA 2GILA 2WJIA 5L8VA 1P5ZB 5EXPA 4BECA 4D80A 3O8RA 1CIPA 2OBLA 2XTNA 4NCKA 1EFRD 3WXMA 4LBYA 4KXFB 1N6HA 3AVUA 2CLDX 2A3RA 1XMVA 4NYJQ 4HYYA 2RGXA 1OKKD 2WKPA 3L2OB 1WBBA 3SJZA 4BZPA 3CRQA 5JS8A 2CL6X 3A1UA 3TBKA 2JJ1A 1MH1A 4DB4A 3UK6A 1XDBA 4JSTA 3RYTC 2BBWA 4N0DA 4OQMA 1UKYA 4QHTA 4LC0A 1N6OA 2V55B 3ADKA 3I4LA 3GJ5A 2D4HA 5HKKA 4TTQA 1AZTA 1KAGA 4F4CA 2YVUA 1XWIA 2HXSA 2ODNA 3LY5A 4PQYA 1WRBA 3NHBA 5LD2B 4RKFA 2QTHA 1YJ5A 2D2FA 1UADA 4I99A 4II7A 4NCHA 2FNAA 3KKQA 5KNDA 4HB4A 3GLFA 1W49A 2HYDA 3NC0C 1DG3A 1XNJA 1LB1B 4QKQA 1T0JB 1VYUA 3EPJA 3R20A 1NJGA 4Z54A 2IX3A 1NY6A 3KB1A 2J45A 4EIWA 1US8A 2AWOA 2OXCA 2WJGA 1M6NA 2MMGA 5F2EA 5FL7A 4YMSA 1XEFA 2J0VA 1U99A 2J59A 4MGIR 5E3HA 1KDPA 4DCUA 3K0FB 5KSOA 4CEIB 2EFGA 1Q57A 2C5LA 2GEUA 2OEPA 3TH5A 4E22A 4TT3A 2O8CA 2QAGB 3PEWA 4GOJA 1FQKA 4JT2A 4LYHA 4EPTA 4Q4JA 3RDPA 1XCPA 2Z83A 3UMSA 2BMDA 1KIMA 2JLQA 2P6UA 1DO0A 4JBWA 1SXJB 5EP4A 3LAWA 4HLQB 2XXAA 3VR2A 4B2PA 1UBFA 4GMDA 3M6AA 3X1YA 1G19A 1Z22A 2O8DA 1Y3AA 4JBXA 4YMUA 2CNWD 2RGEA 1WMSA 1TQ6A 1W5SA 4TYQA 2R65A 4CEIA 5KHOC 3CWZA 3VX3A 1DARA 3DM5A 4LJ5A 2VP0A 4Q02A 3NBYC 4M1MA 2ZVPX 5KSYA 1U81A 2UZIR 2WWXA 5C4MA 3SQWA 5ELXA 3P27A 5FOTA 1XTJA 3T1TA 1V5WA 2KB0A 3X1WA 2RGGA 1P3JA 3OAAA 1IBRA 1G291 3IQXA 2ZJOA 2C77A 4DC9A 3MSXA 3WNBA 4IXNA 3TSOA 3KUCA 2Q6TA 3ZVLA 2ZRJA 5HR5A 3EIEA 5L3RA 1TF5A 4F4IA 2IYZA 1HQCA 1VHTA 3MG9A 4LHYA 1X8KA 4ZV4A 1G6OA 2CJWA 5LBIA 2FFBA 4PFSA 3ICQB 3HPRA 3ZYCA 1UKEA 3REFA 1KK2A 2HDNB 2XNSA 1N6KA 1DAKA 3K0EA 5E7MA 1GZSA 3GLHE 1T3LA 1Z0FA 3QIAA 3CNOA 1U8YA 2KBEA 4K46A 4RZXA 1GKYA 4FWIB 4U00A 4CDGA 4A0GA 1KKLA 2HLDD 4O0MA 4ERNA 1SQ5A 1S0UA 3SJCA 3GLHA 1MABB 3PV0A 3TNFA 2CCJA 1UEJA 2P6NA 1KNXA 3P26A 2IYTA 3Q3JB 4NZYA 3TSWA 4RZ3A 3I5YA 5JHHB 1W46A 1F2TB 1VMAA 3CR7A 4DHEA 1CP2A 1Z2CA 1YZQA 2HCJB 4KVGA 2ZI3A 5JSZB 1KJZA 3PJRA 4TLCA 1HT2E 3WMGA 1GILA 4TMTA 4WOPA 2GVZC 2RGCA 4LDJA 1AQUA 2ZS7A 3OIUA 5AJVB 5GJCA 3HWSA 4HUTA 2VP9A 2CVHA 4OL0A 3CPJB 1IN6A 1JALA 1ZIPA 2BOVA 2EYUA 2OSBA 3KXLA 4XSGA 4DT1B 3UG6A 2RB4A 4WIAA 3GLGA 4NYIR 2AK3A 3E70C 4BASA 4BFTA 4B76A 2H16A 4KYIB 5C1BA 3U3RA 1S1MA 5JEEA 2AK2A 4EKDA 4LGMA 3CNNA 5M04A 1E4VA 1W4BA 2X77A 3ASZA 4PC2A 4B3CA 2N46A 1XCGB 4ZO4A 2O8EA 4Q4LA 2CMKA 1JPNA 3LH5A 4DLVA 3AVXA 1SHZA 2C9OA 5J4HA 3HJNA 4P0TA 2VBCA 2DFNA 2OFWA 3O47A 4IHQA 1SVSA 2A78A 4JT4A 3CBQA 4DLRA 4E03A 1YKSA 5KDDA 1ZINA 4F92B 1JR6A 2EFDB 4DWJA 3BAFA 2Z0MA 1LFDB 3GFTA 2OESA 4MRVA 5CDFE 1M7BA 4Q1EA 3W8NA 2V3CC 3KTAB 4EJSC 5G41A 1VDZA 4KODA 2IW3A 3Q9LA 1L7VC 4DEXA 4JKIA 1LW7A 3U61B 1MABA 4OHYA 4DLWA 3A58B 3W90A 2FGJA 2OCYC 1ZCAA 1L4YA 3B1ZA 4BFSA 2F7SA 1E1QA 2CK3D 3K9LA 5G3YA 5J4KA 1KI2A 4Q7MB 5JECA 1Z0AA 2D06A 2FJUA 5CK5A 3FMFA 1W5TA 1TL7C 1R6BX 4GMXA 3W6NA 2FSIA 2W0MA 4UNQA 1H8HD 1NVWQ 2WWGA 3FMPB 2Q9CA 3I72A 3B6EA 4FCTA 2QQEA 4LV8B 5IRCD 4B71A 4HLUC 3U7HB 2GJAA 4V0KA 3F3YA 3ADBA 5FUVA 3R9IA 4QBGB 1E0SA 5FTNA 2GESA 4PAOA 1KI6B 2QUZA 4EJSA 3I62A 2BJVA 2XJ4A 2ZYWX 1UFQA 4Q1AA 2R44A 2CVFA 3MUFA 1EFHA 1LF0A 3LVQE 1V43A 3K9HA 2J0UA 1TEXA 1HA3A 5AJZA 3CPHA 3A8TA 2IHYA 1KSGA 1E2QA 5ANRB 3SBDA 3KFXA 4FI3C 4Q01A 1NMZA 2PH1A 1OXXK 4I1SA 3X1XA 1AZSC 2W2TA 2X19A 1ZUIA 3WBKA 1OSNA 1Q22A 5HZKA 1PVOA 4MKHA 4RFSB 1G3IA 4JLAA 3KJIA 4QNRA 3ZZ0A 5JS7A 1OH6A 1DEKA 2GK7A 1Z6AA 1KDRA 1GAJA 5DI9A 4I1UA 4ASUA 2G83A 4PC1A 5EE0A 5A0FA 3V9PA 1QG4A 1E2NA 1SXJA 2ASEA 2ATXA 2IUTA 3EW9A 4JMPA 1II8B 4BFXA 1GRQA 2HUPA 3GLIE 1P9RA 4Q9JA 5EE3A 4M9SA 1Z0JA 5AJWA 1P2UA 3R7WA 1RJ9A 1RKBA 1CJMA 4M1OA 3BB4A 2O0HA 3DO6A 3MGCA 2F1HA 3U44B 2OT3B 1TF2A 4DDVA 4QHYA 4C4PA 3LNCA 3QKSA 1G5RA 3QUSA 4DXAA 4W5JA 3RC8A 1WP9A 3FKSD 2ZRIA 3ZGXA 4N0EA 1Q1BA 2JA1A 2FX3A 3GLGE 721PA 3VHLB 3VKWA 4BLTA 4JLVA 1C4OA 3IBYA 2HYIC 2FH5B 2CL7X 1KTVA 2ZYUX 2FMXA 4OHVA 2BJWA 2CXXA 3NEYA 4C0KA 5LDDC 1YU9A 4ZPXA 1IN7A 4JYCA 4U7DA 1OLOA 1T91A 4WBSA 3QXJA 2EFCB 4RFVA 4CEHA 3B60A 3ZJYA 1G4UR 3C41J 4PZLA 3A1TA 5JJLA 5FUYA 5KTYA 1G8FA 1TUEA 4ZDJA 2GDJA 3AF2A 3VMFA 4BUJA 4TT3D 1DOAA 1KK0A 1ZNZA 4UKDA 5AUPB 2NO6A 1QVRA 1NP6A 1P9NA 1TU4A 1E9EA 1XRJA 4EFNA 3THYA 2C98A 2DFKB 4I4LA 3KB2A 3RRYA 4M1YA 4DEYA 4C7OA 2LCFA 2UVQA 2WWFA 3RVBA 2W2XA 6Q21A 4RSGA 5DI3A 5EXXA 1DAFA 2E1RA 1FMJA 3FFBA 1K8RA 1W36C 4AKHA 4LYAA 4BFVA 4PX9A 1NLYA 4ESVA 4JLBA 2QP3A 1MO4A 2NZJA 3AKEA 4ITRC 4XSHA 3VQTA 2ZAMA 4IDQA 3UWKA 1R10A 5HE9A 4ZCLA 2J7PA 2Z4RA 3GJ6A 1VCMA 4V0MA 1DS6A 4NCJA 4HZUA 1OE0A 1P2SA 1Q0UA 1QVAA 2O0JA 1N5IA 3QKUA 4V0LA 3SYKA 1IN8A 2H18A 1C9KA 2F9LA 5SZIA 2R6AA 3LV8A 3VAAA 3GEEA 3B9PA 4D6PA 2ZSEA 3IGFA 3FKQA 4QBIA 1COWD 1T9HA 2ZSDA 3C8UA 4US0R 2P2LA 3LX5A 4Z8YA 5E4FA 1S4QA 2Q3HA 3KQKA 5EP1A 2J0QA 2NQ2C 2ZRAA 4AI6A 3WP0A 1HQYE 1KYIA 1Q1ZA 2ZSBA 2E9SA 4QBFA 4CRWB 2PJZA 2XEXA 4EDHA 1NVUQ 4WAUA 1BO6A 3L8YA 5F98A 3TIFA 4LY6A 5EUMA 3T34A 4A15A 4HATA 4ZI3A 1F2TA 4M9QA 5H70A 2J0UB 3G5UA 5FPYA 1G1MA 5EE1A 4Q1FA 3RANA 4A0RA 2IS1A 3IPXA 4QNMA 2AKYA 3D3QA 1J70A 1US8B 2FOLA 4KFSA 4MRNA 3PUWA 2QBYB 4A36A 4NYIQ 4D26A 2DPXA 1QG2A 3ZLJA 4WVFA 5C4GB 3BH6A 2HLDA 4IJMA 4P4SB 1E9BA 2A5JA 4AIIA 4RD4A 5FPKA 1IM2A 1W4AA 2ZANA 5GVSA 2ONKA 3TVDA 2ZRBA 3AKCA 3MJHA 1SXJC 1M1YE 2VRWA 4HB3A 3AQ4A 3PQCA 4OK3A 2VHQA 3CRVA 1BS1A 2H92A 3CR8A 1P2VA 3H84A 4J0QA 5EQTA 4C9BA 3B78A 3U3OA 1YHNA 2XB2A 2RGNC 3MRSA 1Z63A 1MV5A 3GLFB 1WF3A 5KPJA 1E2MA 1FX0B 4RKEA 4JLNA 1EFUA 2H5EA 4ZDIA 5BXQC 1VCOA 2OUKA 1JEEA 1IHUA 2B7CA 4KSCA 3UIEA 4CVNA 3OIWA 2H1LA 3H1TA 3W3ZB 4DLZA 2JLXA 3AUXA 2ZRNA 1E1QD 1F2UB 4PQRA 4Q4HA 2VP6A 2WHXA 1WDTA 5J47A 4FINA 1CBUA 4GNKA 521PA 3FB4A 2WWWA 5HCNA 5IDVA 3RS7A 5J4YA 1P75A 4DZZA 5JZVA 2O8BB 2I3BA 3O8BA 2B6HA 1UPTA 4R98A 1RVDA 3RS4A 3T06B 1KO4A 2WVJA 4M2LA 4CF7A 3ZVNA 3QF4A 4NL4H 4PPGA 2WM9B 4FD2A 1ESMA 1YRBA 3QXCA 2FPLA 2O8FB 3DZDA 4A2PA 2IS2A 1M74A 1PLLA 5DYGA 4FWTA 1AS2A 1TPZA 2PMKA 2PZGA 3EIHA 2RGNA 3GJ8A 3PUZA 1XPRA 1E2HA 2MSEB 4LJ7A 1N5KA 5B2ZA 4C0AC 4KI0A 2QI9C 4C0SA 4WXPA 4BZQA 2QAGA 1U8AA 2OILA 3D7MA 1YZNA 3TR5A 4LJYA 4QJ3A 3SHWA 2F6RA 2F43A 2IA5A 4TSFA 2WOJA 5DI3B 1TAGA 2ZE8A 4YDSA 5L3QB 5JI3E 5HKKD 4XOIA 1BH2A 5CIWA 4JLOA 3AGQA 4V0ME 3PUYA 2YC4C 4B3DA 2GVDC 1ZBDA 3GJ7A 1OYWA 3QKTA 1E1RA 3U4QA 4FN5A 4TMWA 2IEZA 2ZE6A 4LJ4A 1SKYB 1EWRA 1DTSA 2IYUA 4UNSA 4B33A 5JRJA 5K8TA 3U44A 1XXHA 3G0HA 1P61B 2QL6A 3RS3A 3TR0A 4L9WA 4PANA 1CTQA 4LRWA 1XMIA 5K8UA 1XXHE 3THXA 4QJ4A 5F9HA 4BFWA 2NO0A 2WIAA 3CF0A 2QNRA 4QM7A 1XJQA 3SYNA 1T8UA 3LBHA 5FBQB 2IF2A 2L0XA 4Q4AA 3I32A 4URWR 1E99A 2AWNA 1YVDA 3RSOA 1CLUA 1CULC 3DDCA 5TXGA 3ZZUA 4OK6A 1RW4A 2G9NA 3RS2A 4OHZA 3C5CA 3RSLA 2MSCB 3TQFA 3QG1A 1T4GA 4BFUA 4TZ0A 3CF6R 1P7CA 5J4LA 3T1QA 1GITA 5CB6A 4DSTA 4MDFA 2ZUBA 2ZXUA 1G7CA 3BBPA 2KSQA 4HUQA 1JJVA 2V54A 2VP4A 1EESA 3THXB 3NH9A 4DB2A 3N2IA 4NCNA 2WKRA 4PPNA 4MGYR 2PT7A 2EVWX 2C9YA 2AHOA 1UEIA 2NO9A 1XJCA 3B1WA 4Q19A 1GL9B 1R5BA 2RGAA 1XD9A 3EG5A 4X8HA 5L3SA 1E69A 1EGAA 2OLJA 4A8JC 4B3FX 3CWQA 3QXHA 3TSZA 1OXTA 3KTAA 4LV6A 3S1AB 3QXSA 4HSEA 2RHDA 3K9NA 3KKPA 4ZIRB 2EU8A 3DZ8A 3EXAA 3LXXA 2ZJZA 3QBTA 3KQUA 4CGZA 4WZ6A 1W7AA 3MMPA 2IYXA 2O0KA 1CR4A 1VKJA 2D7CA 2WSSA 4L8GA 4NDZA 4PC6A 2DHRA 5JWHA 4DVGA 1I4LD 5KOYA 1OB2A 1ZCBA 5FOUA 3C16C 4RD6A 2IWHA 4MITA 1JNYA 1PLJA 1E2DA 3JVUA 4Q66C 2JLWA 4G5SA 2IUUA 4JLPA 2X2FA 1W36D 2YZ2A 1BMFA 1W48A 2OAQ1 4C0BA 2KBFA 4UNPA 4YONB 1JPJA 1P4SA 2RMKA 4A6PA 3QKRB 2CL0X 3RAPR 3TKLA 1E3MA 5EXSA 5C18A 2O52A 3K09A 1HE8B 1BMFD 4AK9A 4B6EA 2F55A 2ODEA 2ZJBA 4LBWA 1UKVY 5EZ6B 3VR1A 3K70B 3M0EA 1RPZA 4TYYA 2E87A 4LPSA 2XX3A 4TMVA 1EX7A 3CZQA 2QA5A 4V0NA 5AK0A 3B2EA 4DKXA 1YZKA 4EQ6B 1VIYA 2WWIA 3U3JA 2WMOB 3A36A 1NN3A 3BORA 1COWA 4I81A 1VG9B 3CONA 3SE0A 3QQ5A 1AKEA 4MRRA 1XTQA 3LRPA 1TEVA 2PEZA 4B2LA 3MWYW 4URVR 1UM8A 3BFXA 3PUXA 3AP2A 2GCOA 2EQBA 2N1BA 2IS4A 1E4YA 2K5UA 3QPWA 1EFTA 3EPLA 1VTKA 1OIWA 2X1VA 1G8PA 2TMKA 421PA 2QZ4A 1PJRA 2FFHA 1N0UA 2ODBA 3TGPA 3MD0A 3UMFA 3BRWD 4N1AA 1N0WA 4DDUA 4POAA 3K9GA 2WZQA 3WNDA 4FW9A 1ZD9A 4LJ9A 2FSFA 3FVQA 2BV3A 4EQ6A 1YR6A 1SXJD 3H86A 1R2QA 4G0NA 4AC9A 3T5GA 3C15C 1UF9A 1E0KA 2BM0A 4S35A 1T3HA 2QP4A 3AUYA 3DVLA 2GEVA 2N42A 3GD7A 2C04A 1W44A 1ZM3A 3ECCA 4GRAA 3DPUA 2CCKA 1B0UA 2R6FA 3P4YA 5IT5A 5J5CA 3LFUA 1ELOA 4TN1A 1C1YA 2Q3MA 4Q48A 3TW8B 2F9MA 3CB4A 3T35A 5FR1A 5BWMA 4TLDA 3IIKA 2GJKA 2PEYA 5DE3A 1W4RA 4D4JA 2EWVA 3TUZC 3VKGA 2HT6A 1FP6A 2FPMA 5SZKB 2QMOA 2ZAOA 1FPMA 4WA7A 4BRWA 5IK2D 4LPKA 1L8QA 2QT0A 5FL3A 3U6BA 2GBLA 2VHCA 2GF9A 3AEZA 2LKDA 3WBJA 3GPLA 2IYLD 1S3SA 4LOAA 4CT5A 5CITA 2WTUA 4OQLA 1N5JA 1RIFA 5D3MB 4JSYA 4NONA 1E2PA 1WXQA 5CYOA 2QY9A 4F7WA 1S8FA 4UXIA 2XNDD 5AR1A 1UDWA 3R7WB 1ZYUA 3JVVA 2NIPA 5JWOA 2IYYA 1HURA 1SZPA 2LKCA 4BLRA 2JASA 3KJHA 621PA 1E79A 1Z2AA 3IUYA 3PG5A 2ZI9A 4G01B 3CIOA 1N6NA 4Q7KA 2VL7A 3M4YA 3PVSA 1XEWY 4M1SA 4LYJA 3KQLA 2Z5FA 2FG5A 4Q4JB 3PENA 4B35A 2YV5A 1E79D 3CX6A 2ZRGA 4H1UA 1TF7A 3LA6A 4Z8XA 4CT4B 4DLYA 1OH7A 2QENA 3LLMA 1G21E 5FOWA 2OFOA 3RS0A 3IKJA 1G3QA 1OH5A 4EPYA 2QRZA 1R0XA 1FP7A 1ZM2A 3GEIA 2V8OA 2ZRHA 1KZGB 2W2VA 2QORA 3NWJA 1X86B 1AK2A 4G5OA 3K70C 2BEKA 4NP6A 4QM6A 5KO2A 5FOVA 1N6IA 1LS1A 5JLJA 4IDNA 3DM9B 2JDID 4IDOA 5DYIA 4PC7A 1OFHA 4FXPA 1SVIA 3LDAA 4HUQB 1EFRA 3OE7A 1H8EA 1VYVA 2FPKA 4OQFA 3GLFE 3EA5A 3NH6A 5E7IA 3AF4A 3FFAA 4ARZB 3OIYA 3WY9A 2QG6A 1CJTC 4KYUA 1XU4A 3RLFA 3GJXC 4UQOA 4PSAA 2RAPA 4PZYA 4E5UA 2QEQA 3KXKA 2DFTA 1ZU5A 1YZUA 3QEOA 4KBGA 3SDZA 1IN4A 4BFYA 1G41A 1DBSA 1N25A 2PJRA 1DADA 2H8KA 4Y0VA 1KSHA 4PAQA 1ZM7A 2PLFA 3AVQA 1RFLA 1LNZA 2OE2A 2KE5A 4ZCMA 4PHGA 3HR8A 2I4IA 5CB8A 4LBVA 5EXTA 2PZFA 3ZS9A 5E7JA 2G6BA 4DUGA 1Z07A 2FE4A 1OXUA 2ATVA 1JEDA 3PEUA 2D62A 1YR8A 4IOMA 4ZIRA 1K5GA 1XTSA 1ZC3A 1Z08A 2ZI6A 3Q72A 1KY2A 3ASYA 4F91B 1A1VA 1FOEB 2ZITA 1Z28A 1NF3A 4R71A 121PA 1VCNA 1U8ZA 1OIVA 4KFRA 4CZ2A 4QRHA 4M53A 4P4TA 4A8JB 2X2EA 2A7QA 2J0SA 5JBQA 2ZETA 2XXAB 4NHOA 1KI4A 3EIQA 3AH8A 2P0EA 3KXIA 4JIMA 4C0HA 1BYIA 4L16A 4A9AA 3R8FA 1H8HA 2ZJYA 3BH0A 3B1VA 4WW0A 4QBHA 4BE7B 1WBDA 3QENA 2QM8A 1JR3A 1KZ7B 1ZUHA 3VU9B 4XWKA 4GP6A 5DHFA 4Q00A 1R5OA 2JAQA 1FNNA 3PEYA 4DLXA 4ABYA 2XITA 2ZJAA 2GBLC 5EE9A 3REGA 4YMWA 2PX0A 4LHXA 4MYUA 5DH9A 2F1RA 4O3MA 2WJJA 2ZI7A 3AF1A 3I3SR 4MQBA 4WXRA 3KUDA 5JHGB 4PHTA 5EJEA 4X8LA 1P6XA 2YOFA 4DSOA 3Q7QA 2DCUA 3N5CA 1W0KA 2VF8A 4KFUA 4XVRA 5CM9C 1L2TA 1IY2A 4E09A 3ZD7A 2ZS8A 3HYRA 5J40A 4NH0A 5FI0B 1WCV1 2HXYA 3VHXA 1U9IC 1ZC4A 2GF0A 4FMCB 1E0JA 8OHMA 4MYHA 3FWYA 3TMKA 1FL9A 3GCGA 3K0CC 3A1VA 1FMLA 1CEEA 3SYLA 1R5NA 2D74A 1KK3A 2WBLC 3V4FA 4A0HA 4RD2A 3PUVA 4QGFA 1IN5A 1G17A
chains in the Genus database with same CATH superfamily
3E9CA 4B4KA 2X0FA 1U3FA 5KNBA 3KR9A 4UAGA 2EZUA 2WG1A 5CH3A 3RUEA 5DRTA 1XZIA 4AUEA 3Q12A 4F85A 3AGPA 3TG2A 2PMBA 1ZRHA 2BFAA 1NVVR 4KX5A 3TPCA 3ZYZA 4MDEA 4PQEA 4DABA 3IAM6 1U90A 1QYCA 2WT9A 2W43A 3L4SO 4H7FA 3U19A 1OH8A 2WABA 2GD2A 1XU9A 3DKPA 3PQ3A 4PAMA 5D87A 3TMYA 4INOA 1LK0A 3RNLA 3FYUB 5FTWA 4AL4A 4TLEA 1HFKA 5J59A 3DFMA 5BP7A 4WACA 2FV8A 1ZN2A 1UXIA 4DCPA 4TKVB 2R6ZA 2VRNA 4KCGA 3CLSD 3MOSA 2GBFA 4J4HA 1G4HA 2I4MA 1J9ZA 3LL4A 5DNYB 3K1AA 2CFOA 1TZJA 2YJNA 2E7ZA 3FCAA 1YE5A 3MMNA 4AX4A 5I5GA 5BSVA 1IOLA 5LP1A 1BKSB 1AIPA 1QG6A 3SZGA 4D0NA 5K6AC 4PCLA 3DWGA 1LBSA 2Y9PB 4ARIA 2FZWA 4KAAA 4BX3A 4D9BA 1KMCA 3PK0A 5CXXA 4CGYA 2B1QA 1EK0A 1PJTA 4KQ6A 4D9NA 1T0IA 3P19A 5CFQA 1ZK0A 5J2TA 4UFPA 2E21A 3F9IA 1JKJB 4DDKA 3R9KA 4YDQA 1NN5A 1QKIA 3PE4A 4JJFA 1L4HA 2IDKA 5DN6D 5JPCA 4GOMD 4ZDKA 1DV1A 1MBZA 5BQPA 2JW5A 2QP9X 5FBRB 4WNAB 3DEFA 1JHZA 2IU6A 4WUTA 3INNA 5KTSA 1FDOA 4BVGA 1PQ4A 2AMFA 3N3AC 1A9SA 1ZONA 1OIXA 1VL8A 2Z57A 4IIDA 2P79A 1LPAB 2V7WA 3X2SA 1IONA 5HP4A 3AILA 1LDYA 4ZP1A 1L8XA 4RWEA 4OHBA 1B8UA 3BJZA 5REQB 3T3HA 4KWIA 5EWJB 3A14A 3HBAA 3TEMA 4JOCA 4DIFA 4IDBA 3CR3C 4GI5A 4MRAA 4HAYA 3TW8A 4KLZA 1OFTA 4YP7A 1QF7A 2D6FA 2QUHA 1KKMA 1YS1X 3P1JA 4V38A 4RZ2A 4DC1A 4L73A 5EZ5A 1HI9A 1KH3A 2L82A 5TDHA 2WKQA 3THWA 4Y30A 2HN9A 2HQBA 2R2AA 1SELA 4Q9KA 5TT1A 2UZ4A 4OAQA 1RWOA 4EPWA 5IHPA 1QGUB 1XDUA 1HV8A 3UANA 3ABRB 3FSJX 3OE5A 5HQ3A 3T3IA 5IDQA 4CG1A 1IRXA 4N41A 2XR1A 4NEHB 1VE1A 4ZOLB 5FLEX 6NULA 1GLNA 1PAUA 2DKNA 4G26A 1R7RA 4BN5A 1USIA 2FPRA 3H5IA 2QD3A 3JZDA 3TRJA 3L6CA 2KYRA 1JHUA 2CJYA 1K8QA 3IALA 1N5MA 2J4FA 2HF8A 3TD9A 4V3BA 1FNDA 1T6NA 1JDNA 1IBSA 1OV4A 3JU3A 1YB6A 3Q3GE 4UHJA 3L4KA 4KMOA 2I34A 3NM5A 3X0DA 4BQNA 1DRJA 2ZR9A 4NIMA 1UP4A 3RW9A 5KQSA 3K70D 3K3PA 5MGNA 2Z4TA 3EDQA 4IY1A 2B1RA 5I6DA 4CCYB 3C8MA 3ZIDA 5DNDA 1RAHA 1RI5A 2JEOA 4AJ9A 2ANBA 1VI2A 5AVTA 4OD0A 2EW1A 2AKAB 2VTVA 1GPKA 5JQGB 4QNNA 2RSLA 4DIEA 4RE5A 4IH1A 3M70A 4EO9A 3PITA 1M8PA 1JECA 1RYBA 1ZA2A 2UUOA 3ICCA 1KZHA 1YNOA 1U8FO 1YULA 1LK7A 4J1QA 3MWLA 4ARVA 1SXQA 3NGMA 4DR4B 2CLEB 2ZBUA 2BTQB 3BH7A 3UWOA 3UBTA 2BL4A 3WGJA 1H66A 1ULUA 1U31A 4LC9A 1TAHA 4JX9A 5E8RA 3T3MB 1QHYA 1YCGA 1E9RA 4PSDA 5DT9A 3ZCXA 5B12A 1ZGCA 4I1IA 5JG7A 2CYAA 2H5LA 6AT1A 5KJCA 3HE3A 3DOJA 1PGJA 3WYEA 3Q7IA 5JAHA 3T95A 4MV5A 4ZVOA 1IVSA 4MW2A 2Y3IA 4J7AA 4PXAA 4ZQGA 3KAJA 4TSRA 3U3DA 3Q8WA 2X8BA 5B2FA 4JJ8A 2I7VA 3CF2A 4TKUB 2QU7A 1ZMXA 3MJDA 4CQNA 5CDGA 4J76A 3V2UA 3W7BA 1FNSA 1V6SA 2AD5A 4IDEA 2YJ5A 4MQEA 3BGVA 3ZPXA 1ZR4A 1DKOA 2FR1A 1RPTA 5PGMA 4D4IA 3VU8A 4BN0A 3VNVA 3KP1A 4DHWA 2YR0A 4X20A 3QBDA 4WGFA 3LECA 2DLNA 3VOTA 1YBVA 3Q1LA 4ZAVA 2ZI5A 2VATA 2WSLA 5DM60 2BMEA 2R7NA 2OCPA 2VPWA 2ZXFA 5ITSA 1H0HA 3QEBZ 2DOKA 1SRQA 3B36A 2YV4A 2PIDA 1DOZA 1M5TA 4LJ8A 1Y4AE 4UXHA 3TLXA 5KS2A 2Q6KA 4IZIA 1QRAA 2Q1SA 2ZBVA 1K63A 6PFKA 2O8DB 1PQYA 2J6CA 3G23A 4GOKA 4KR9A 4TZKA 2GZMA 1Q1NA 5TPZD 4CV0A 4KWEA 2P9FA 5CIQA 4JI2B 8GPBA 1FLVA 2R6GA 4C6RA 1NVXQ 1ZD8A 2QI9F 2ZBQA 3Q6MA 4FN4A 2R96A 5KSPA 3VTFA 5HKBA 3FHCB 3IS3A 4K05A 4N6GA 3DMDA 3AKYA 2AA3A 4PYQA 2X5NA 2EOAA 3AV0B 3SC4A 5L3QA 5IANA 1J2RA 1P3Y1 2VT3A 3H7AA 2PGJA 1Z0ZA 1C0EA 4IDHA 4QO8A 3X1DA 1DPGA 4ARUA 3VC3A 1Q7RA 2JKVA 3E5HA 4PR3A 4ZO7A 3R7AA 3SJUA 3T5PA 1EVLA 1W35A 4AVYA 5EFZA 3V5NA 1ZW1A 2XD4A 5EHQA 1DIBA 4HNUA 1E2EA 1J5PA 2RI6A 3D8RA 1GOTA 3TBHA 3HCBA 3VTZA 1K7EB 4UNNA 4YCAA 2JI7A 5G40A 2P6OA 4IRXA 3UH0A 1ZEJA 2BW0A 1BTOA 1GPLA 1GUBA 1G8GA 2VSOA 1KFCB 4LC1A 3D7LA 3LY7A 5FUWA 3TK1A 3UT6A 3TZQA 5LSAA 1EVQA 3PGKA 4XOUA 2PQ0A 3GGSA 2UZ3A 3IOBA 4QOSA 1J33A 4NQRA 4L9AA 5TJ9A 3G5LA 4Z1MD 5C5EA 3L79A 2ZW9A 4BO2A 1T4MA 4CEJA 2BFPA 3G17A 1Q1QA 3THSA 4P4SA 5ALPA 1X0XA 3OECA 1ISIA 3VTKA 2JGNA 5CYPA 3VZBA 3QNMA 4I19A 2BEWA 2B4TO 3ETGA 1QH1A 3I9LA 3A3OA 1MXFA 2Z56A 3LD9A 3QBJA 4B8WA 3ZDCA 1WXXA 1KL7A 1YFZA 3KHUA 2OV8A 4RZUA 2V6JA 4Q03A 4FGUA 3UAVA 3ZHQA 1N2BA 1V16B 2XYGA 4PNEA 5DWDA 1U2DC 5F4ZA 4EKIA 4EB8A 1IJBA 1IMOA 3SICE 2I2WA 4AQDA 4Z7JA 2FX2A 1YVUA 2ZRKA 3AK4A 4INZA 4P2GA 3D8HA 2GZDA 2EG5A 5HWSA 4UJ3A 3CXUA 4CLRA 1Y3CE 1E2BA 4H08A 3JZIA 1KDOA 1X7YB 2ZUVA 3ITNA 1KAMA 1RXWA 1IQ0A 4KN6A 2VPPA 3JATA 5KYGA 3A7EA 3BMOA 4JX8A 1UZMA 1GQSA 3QHQA 2M6KA 1AA9A 5JD5A 1R6XA 3A4MA 2IXFA 3S7ZA 2H08A 1XL0A 4JMLA 1R0KA 3E1KA 3A06A 3MXOA 2FSGA 3I0MA 3QBVA 1LNSA 2YCLA 4GZ3A 4IMIB 1NG1A 3E7FA 4WLOA 2CZQA 2G7MC 1LSOA 4XD7D 5KWEA 1FTSA 1ZJ6A 1JR4A 1ABBA 1KMHA 3O94A 5FWYB 4B43A 1QGDA 4ECEA 1JXOA 2AMYA 2XDWA 1X80B 3G0CA 4QTZA 2M6LA 4LF7B 4CNBA 4JR0A 2BJHA 3OY2A 2ZYIA 4LDPA 4UCXA 2GSWA 1XTIA 5E9QA 3WRVA 4IWXA 1ARZA 1ECLA 1Z4NA 2PZKA 4Z4CA 3NDBB 1KSFX 2EC5A 4HGPA 5D84A 1ZVQA 5FH9A 1SUAA 3O2SB 3NTOA 2HSDA 3VOSA 1NQAO 1XKXA 2BDEA 2UYGA 1R0WA 2ORYA 1T9BA 1U3VA 1TGYA 3F90A 1WE2A 3QMWA 4PEVA 1N9KA 1HG0A 3R0ZA 2WWYA 2J9YB 1UWLA 2RCNA 3FZGA 5FTJA 4B34A 5C8YF 3STXA 1QMPA 4FJ2A 1S5PA 3SKYA 1XF9A 3H7IA 2OCXA 4DQDA 4DRXB 2CXOA 3D7NA 3QUQA 4FYYA 4DBZA 1Q21A 1K66A 2XRYA 3B7GA 4UHFA 3TZHA 4QUHA 3THRA 3MJRA 1T2NA 2OFFA 2WFLA 2PBFA 3IOCA 3DC7A 3O84A 3AEXA 3O1HB 4AKEA 5FNVF 4CKWB 4RKWA 3U44B 4IIJA 2QTCA 4TUYF 1E2JA 3LKVA 3LXRA 3NHZA 4I4TB 5EMKA 2P6RA 4XGNA 1CKEA 2E85A 2H1FA 3WL6A 4KU4A 4KQ1A 2W83A 4MIKA 2IZZA 5HX7A 1U1FA 4W1QA 5JS6A 4MQUA 4MB2A 1JMVA 5LIRA 1R74A 2XUIA 3LQKA 5K2MA 4IEIA 4BO9A 5DSZA 2FAXA 4XVQA 4YI3A 3RVMA 4UVHA 4UBMA 1OC2A 3JZAA 1UKAA 1VL2A 2HPHA 2W6CX 3CF4A 1DG1G 5DHAA 5IAAA 1YRAA 4J4TA 4LRTB 1YT5A 5I48A 2ARKA 5LQJA 1PYOA 1K3UB 1Z6TA 2KI5A 1GO2A 3A6ZA 3IR7A 3ACCA 3NUQA 1JSRA 2YYAA 4Q4AB 5LXTB 1B3RA 2YS6A 3SFZA 3TRIA 3LUHA 3GWZA 2HTFA 4U9UA 4U39A 5TMEA 3U80A 1C4WA 4MXDA 4AYTA 4C21A 3CLRD 4TLLB 4BDTA 1T3TA 3W34A 4QAQA 8LDHA 1HE1C 1KMIY 3C3YA 1O87A 4UDNA 4Q21A 2QF7A 3B3JA 4Y2QA 1TTTA 4N4AA 3L49A 4XB1A 2IX9A 1ZGJA 2AUMA 4M8KA 1XEWX 1G8JA 4ZAZA 3U6KA 2V4ZA 2WF5A 5M3BA 1S9HA 1ESCA 1XFAA 3EVCA 3VPHA 2DPMA 2COUA 2ZJ8A 3FGZA 3G1TA 2GRJA 4FMCF 4ZT6A 3SVLA 4HQFA 1AGYA 3FUUA 1B8NA 4ND8A 4G0OA 4R8VA 4ZYWA 3AIKA 1MRSA 2AG8A 2AUTA 3DV0B 5B7NA 3EZGA 2O8VA 1KYVA 3I0ZA 3GY0A 1UBHS 3S70A 3BB1A 4DLTA 4EX6A 2BMJA 3C7KA 3KQNA 4GT1A 2QROA 2QTTA 4A8JA 2JLZA 3UUFA 1BDBA 4NTZA 3HJFA 1VLVA 1C81A 1JR3D 1Z5VA 1T1RA 2YWFA 4MJ7A 1Q16A 4L8VA 1P7VA 2WA1A 2WINI 3R7BA 4KEAA 5FBVB 1WLSA 2DY1A 1O0BA 3BGOS 1SWVA 5C7IO 5G0VA 2B8TA 3GARA 1ZXLA 1CVRA 2W4MA 4QXMA 1VA4A 1IY1A 5ADWA 4JXXA 2YWCA 2ONZA 1DG9A 1HFJA 3V1TC 2EARA 4BX0A 1SK8A 5H1YA 4ZTZB 4LKOA 4UVGA 1GVNB 2FPIB 4DZRA 3T9AA 2WSMA 4OKNA 4Q7LA 3LPLA 3EQ2A 2CWWA 4HPWA 3Q0EA 1K0FA 4ZVTA 4CKXA 1P81A 3GVIA 5LQAA 4GUDA 1BA3A 3WV4A 3O91A 1R15A 1TQ4A 3G2LA 1O9GA 3ANTA 1V71A 4NBUA 5K1ZA 3NONA 1A2OA 1M8FA 3MLBA 4TXJA 1U9IA 3WYDA 3R7SA 5JJBA 2C61A 3IDZA 1O5TA 4BP8A 1DNPA 2QRMA 2UV8A 5EP3A 4UULA 1QH8B 5DGIA 2J48A 1H4VB 4U2GA 4FYJA 1N32B 5EEHA 2FWMX 1DI0A 1AKVA 2GUWA 4W1RA 3T3PB 4J0KA 3C70A 1XD2A 5HFAA 4C0QC 5A5FA 5CDHA 1Z62A 4M0MA 1BCRA 4O29A 5B58T 2PS1A 1WUKS 5H3CA 1QO9A 4E4TA 4MW4A 1GCAA 1O3YA 5DIFA 1OGYA 2XMDA 2UKDA 4F3TA 1E1DA 1MFPA 3QNUA 3NVDA 4YCCA 5LWQA 3LF1A 4O4HB 4YUAA 4JS0A 5K8LA 1JAHA 4EKGA 4PY2A 1OXSC 1GQOA 2CXRA 3S2UA 1HYQA 5B4TA 4Z4GA 2B3DA 3F1LA 3WDSA 1D8TA 1P72A 4LQ4A 4FHEA 3T4PA 2CV0A 1A8UA 1MAVA 1E58A 2JLSA 2AVNA 2KX7A 4LSMA 4AY2A 2V9CA 3UMYA 4H35A 2VT7A 5AJYA 4ZVKA 1ICEA 4J3JA 5DW3A 2QRPA 1PSZA 1KHTA 1X8LA 2P9EA 4O0LA 3UXYA 5DTIA 1R9NA 3M82A 3T3DA 4I5EA 2WUGA 1L4LA 3B51X 4K0KB 1DQYA 1A8HA 1XYYA 2GWHA 3DLTA 3HLYA 4HNQA 1RE1A 3E2PA 1Y3DE 3QYFA 2MYNA 4G8DA 1F60A 2HSWA 4NHEA 5ALZA 1MQSA 5E6RA 4CKCB 3OSZA 3BZBA 4M21A 3NTLA 4HX2A 1O94D 1N34B 1EXDA 1JGTA 1CRQA 3E2IA 4RAOA 1G4AE 3U4DA 3W6ZA 3H1GA 3INGA 5IS2A 1QB8A 3RGGA 5LR6A 3MS4A 3WYNA 2AOUB 2PUJA 3IO3A 4CQMD 4RSMA 2HCRA 5JCOC 1UKBA 5CH5A 4B75A 4FGWA 4ZEWA 3ILVA 3AOGA 3RRFA 1VMKA 2JCBA 4WBNB 4LWQA 1M6VA 2QAJA 3NM4A 3QLTA 2Z2XA 3EZ9A 4H15A 3P20A 4YWJA 3SHFA 3FHTA 1AUVA 1LRJA 2HADA 1A71A 4QUBA 5JVDA 1ORVA 1K92A 2GQ0A 2OL4A 4FT2A 1HDIA 1UL1X 3JQGA 3NPMA 2X9QA 1JSCA 1GPJA 1Q7TA 1ZNXA 3P9ZA 3C8HA 1QYDA 5A3SA 1JSLA 3WLQA 5AVQA 1HEIA 1NKVA 5E95A 3TAHA 4DJJA 3BSYA 3ZIAA 2P5TB 2YIMA 3NMUF 3ULKA 3ZHSA 3R3VA 2FZ5A 1XAHA 4HQ0A 4IIVA 1X8JA 5JNWA 1XCBA 5LMUB 1J0AA 2BFDB 2ZKIA 3BK1A 2HGZA 2PWBA 2WIBA 3EQ6A 1H65A 3O74A 3DDHA 4HDKB 2FFQA 4JI1B 4AS1A 3LCJA 4LHEA 1BE1A 1ZJZA 4IOJA 3ESXA 4GG1A 1KH2A 2IYAA 1M1YA 3BD9A 4OHXA 3FRIA 4URUR 2JFQA 1E6CA 3DZBA 3IMEA 2ZIUB 5L4NA 4J0JA 5SYNA 5JSHA 3A9RA 2CUNA 4G0XA 3OM0A 1R8SA 4JUFA 1V7PC 4M37A 3IMKA 3HKDB 4FU0A 4LZNA 4X6XA 3GG2A 3LHDA 3QZUA 1EE1A 2GT1A 4G1EB 4OI0A 1GPBA 5BSRA 2JHFA 5TS2A 2C7BA 4PICA 4C88A 2Q4TA 3G9UA 4R9UC 3GP8A 4CU5A 2Q62A 2ZP1A 2W70A 5BPFA 2POQX 3OA2A 3SSMA 2P9CA 2A7XA 1Q6YA 5A4MS 1UJCA 3GT3A 2O7NA 3C7TA 2ABWA 4RL6A 1C1XB 1JJIA 4W1PA 5EZYF 5B7GA 2TMDA 4ZEOA 4KZKA 4RTOA 1MGOA 2IBSA 1PKXA 2VTBB 1HQDA 1K4KA 2W4IA 1KO7A 1OWMA 1U4SA 1V47A 1VJGA 3EEFA 3TRFA 3WHPA 5A1JA 4RMJA 3FLMA 3NEJA 3B6MA 3AEYA 3FTNA 2REXB 4JT8A 1KJQA 2ZBEA 1J20A 1V7ZA 2WG0A 2O1SA 3D3EA 4KXVA 5E8JA 1EJ2A 2O8EB 1W0CA 3A6KA 4RLFA 4LQLA 1OAOA 2CVQA 2CUTA 3OIFA 4J90A 3SQLA 2R11A 2QVCA 3MINA 4LVOA 2FA9A 2AI1A 3I1FA 4AJ4A 4XQEA 3BIJA 3JYHA 3PWZA 1V1MB 4FQ8A 2VNKA 1WKBA 5AQEA 5T4EA 3NHKA 2ZUEA 3JQAA 3TX2A 4OAOA 4U7WA 2UXCB 3BE4A 3DHNA 4JJGA 4UM5A 4RZSA 1SCDA 1USWA 1TEHA 1ZK1A 3LY8A 4XWYA 3VMMA 1KAOA 4TVSA 3ICEA 3FH0A 1L6RA 4N8DA 4Q9DA 4QVKA 4GOXA 4US1R 4N48A 4LWPA 3T9EA 4ID3A 2D0OB 5HGXA 3RASA 2F1JA 4IF4A 1DE0A 5IH3A 2BI7A 2QVGA 3GLIB 2XE4A 1AD2A 1GFZA 5A0VA 1C80A 4YGXB 3BILA 2QMHA 3L6UA 5DEIA 1DOHA 4F8EA 4Z7OB 5IVKA 1R88A 1G18A 1Y6QA 1Y3IA 1NRJB 1SXJE 4JP8A 3UXMA 4CM7A 1WY7A 4YMIA 3GXOA 1CXZA 1Y5MA 3NX4A 3ZHZA 4XE5A 2AZ4A 4KQEA 4LCJA 2W0SA 2V97A 3IC5A 4ZVQA 3REQA 1CD5A 2LNDA 1QGOA 1RCTE 4PG4A 5JY1A 1BJKA 3WK5A 2P3OA 3SP1A 3I2GA 1EWQA 3QFHA 1M2WA 4PPQA 3MA0A 5CFLA 4KB5A 3JX9A 2VK2A 1C0LA 1GV0A 4JLJA 4PLVA 1TM2A 4R40A 4RH1A 3PWTA 2C2GA 2DULA 1CR6A 4CL8A 2A57A 2HRZA 2X0EA 1J5XA 2I2DA 3G13A 3HB1A 3BERA 1SVWA 4CF3A 3GFBA 3VVLA 2RIRA 1M2EA 4TMXA 1Q19A 1D2NA 1YRHA 2D1RA 5FDFA 2OGTA 3TRKA 2F3RA 2H9IA 4L74A 2YN4A 2H31A 1WU7A 3BIWA 1RAIA 4JJZA 2CDNA 3I5MA 4L08A 3GT7A 3S29A 1QHXA 4KKVA 3ZGLA 4KN9S 3KALA 2ORIA 4DSUA 1GP2A 2FOIA 1R8QA 1QZ3A 4INAA 3ZHOA 5J1TB 2JATA 2CNLA 1HWYA 4LOKA 1ZH4A 5EJFA 3AUSA 4R6XA 4TTJA 3IEVA 4A2WA 1SH7A 4WH0A 4N76A 3GX1A 1GA1A 3FPEA 5IJ0A 2IS6A 4G5GA 4HAWA 2YOGA 1NBME 3MIIA 3OQVA 1P8JA 2JFYA 3GT0A 2CC2A 4JOBA 3RSFA 4XYLA 1UOEA 3KKEA 3PUJA 4ND5A 4D81A 1SO8A 4OQYA 1U2DA 4RDIA 4ENPA 4GZMA 2WJ4A 1G8HA 1GGHA 2EFEB 3EOAI 4F2HA 1QHHA 1B41A 4G5FA 3BXZA 1LBTA 3G0IA 4IOKA 1SZCA 1ZNWA 4QUEA 5JE8A 4N5LA 3N2GB 1BIFA 3QMMA 1D2MA 4DF3A 2V3VA 3EIXA 2D5AA 3CQ9A 5GJBA 2BH2A 3AVVA 1KJ9A 1GNTA 2QZ9A 4RGVA 4DMCA 2FB9A 3CJTA 3K6SA 1CY2A 3EPHA 3KDAA 1LBQA 1JQJC 3DXZA 5HXAA 4CIYA 3R5KA 3EQ8A 1AMOA 2XUKA 2HDHA 3K8YA 5C51B 2VBIA 2G1AA 5C8XA 4YJGB 1Z8HA 1KY3A 3L7DA 4X60A 3C14C 3MLEA 5JNVA 2O8FA 4LMRA 3LYHA 2PZAA 3PPWA 4Q9AA 1OFVA 1TFRA 1N36B 1Z2PX 2NMVA 2H57A 4DDTA 2BGMA 4YP0A 4I1PA 2OZPA 2EQ5A 2NNLD 1Z6XA 1B23P 4OQZA 1C0KA 1LS6A 1S2OA 2P8SA 3CV3A 1DJOA 2MWMA 4Q93A 4QPJC 5GOTA 5EIEA 1HH4A 3ZEIA 3EAGA 2C31A 1BDMA 2XY4A 3L6DA 4TVBA 4CLXA 2CDBA 2EXXA 2J46A 1RP7A 2PO7A 3E7DA 4RULA 1NPDA 3V00A 1W76A 1MU0A 2A9KA 2YXBA 4HAXA 4QT4A 3EZ2A 4KAJA 3EQ7A 2M1XA 2P5SA 2UVDA 2Y99A 3B9RA 5CA0B 1EIWA 1T43A 4U02A 4RK7A 3I28A 3WQRA 2PJDA 2JFWA 3QV1A 2XUZA 2VYNA 3ZUGA 5L3VA 4YV0A 2JJ2D 4MS1B 3UBMA 2HF9A 1XPOA 4ZGGA 2G1JA 4NV1A 5AIAA 1NBMD 3NWOA 4KWTA 1CZKA 2J6BA 1TM5E 4MZXA 3ZG6A 4ESHA 1RQNA 2GTHA 4D9HA 4BVKA 1AOXA 1P60A 1U6JA 1ZK4A 2I76A 3NNSA 2V7GA 2NU8A 1J23A 5EWMB 2BD0A 4DSNA 3L82B 1WU8A 3HYTA 1Z0DA 2A5GA 2PVPA 4NYMR 4R8MA 1VJRA 3DVSX 2V7QA 3CUVA 3EULA 3H8VA 3MWKA 1L5GB 3RJTA 4E2ZA 1E4EB 3FCUB 3O0DA 4S05A 3SIRA 5AVXA 1SCJA 3AERA 1NW5A 1Z4JA 3HDGA 3I09A 3QELB 4PO9A 2KQUA 3AI3A 3DEJA 3QU4A 4CKEA 5BVHB 4LYFA 5C7OO 5KHLB 3NHFA 4KXWA 2ONJA 2HIMA 5E2AA 4OI4A 4IKEA 1XK6A 4Z3DA 3MRTA 5FNVB 5IKEA 3UK2A 3BTVA 2O20A 5K3BA 1TJ3A 3B1XA 4ZYLA 4U6SA 1E9DA 3HP4A 4K6GA 4NATA 5JQGA 2V0CA 5K6RA 4I6GA 1VIMA 3H16A 3R9XB 2RDMA 2GK3A 4PQFA 5KYKA 4ITUA 2I8AA 5LB2A 1A04A 3TW4A 3EF0A 3LVFO 4BQOA 2YTZA 3D4IA 3I9V1 2KMLA 2Q2QA 1QONA 2WAYA 2RHBA 2W6JA 3HVHA 3I9JA 2TS1A 3JZMA 4G37A 1DCKA 3IIMA 4Y1FA 1PSDA 3D4BA 3GDOA 3RRZA 1OHHD 1SVMA 3TMAA 3ORQA 1KWKA 2VSYA 1D6JA 3H1AA 1KI8A 1N3BA 5E0OA 4MTLA 1ZOSA 1I01A 3SK0A 1TX4B 3NTRA 3NP7A 4JP3A 1YQGA 3QX3A 1UMKA 2GYYA 1YGPA 2ZJ2A 3ENNA 2BGKA 1IY9A 2XAUA 3AFMA 4RABA 4U7FA 5A6SB 5T57A 2B2NA 1X2BA 4AZ3A 3L8ZA 3N1UA 4V24A 2WJYA 1PIWA 3HMQA 3IAM1 4F93B 1WD7A 4M60A 2WPDD 3VKHA 4MQMA 3FHOA 3IV9A 4LYYA 4KMSA 1EFPB 1KVQA 1Z38A 1ORHA 3HHPA 2IYWA 1PGQA 1E6KA 1H69A 1V7CA 3MTJA 4JLDA 1IQUA 1GADO 5HKLA 1EINA 3DMTC 3I23A 3LVBA 4FZ5A 2OM2A 1F9AA 2ZR0A 2MSNA 4QXAA 3VTAA 3P2MA 4A2CA 5I7SA 1SZJG 2H9YA 1VHJA 4M1WA 5FTMA 4ECAA 1TKRA 4GBJA 1UXOA 2P67A 2BY4A 3CVJA 4LYDA 3IPYA 2NYAA 3O7WA 4F9EA 5HRAA 4AUNA 3O8CA 1O0CA 5MFPA 4IHJB 1GNRA 1U0HC 5AM2A 2JFPA 3O9MA 3U16A 3GAZA 1V9SA 5AVOA 3ODGA 4K8RB 821PA 1QX4A 2ZYHA 3CCFA 4AJEA 2C7QA 1FIUA 3K2BA 5SZJA 4MKGA 1EWTA 3LPMA 1JB1A 1JS1X 3F74A 2IK8A 4YT8A 4QBKA 5MN6A 4TYMA 4NY1A 4L4YA 2P2GA 4W9MC 1JQKA 3ZK9A 2OOKA 1QO7A 1CB0A 1X13A 3D1JA 2HA0A 3CMCO 3LVRE 4MEBA 5HTKA 1PS9A 4ENUA 4UTVA 1T8PA 4ARBA 4JI7B 1ONBA 1IJFA 4FE7A 1Q44A 2F8SA 5CVJA 1W2GA 1ZGGA 4G9GA 2GO7A 3RPEA 5HJ5A 2OG2A 5KU7A 4W7IA 3UJNA 3KLBA 2YJGA 2JJMA 3I8OA 1IYZA 3EZXA 5NLLA 1ISPA 1YBHA 4XKJA 1ATZA 3N87A 3OE1A 2VH5R 4JGBA 4Y1GA 3WRYA 4TYWA 3CRRA 4UMVA 1CQJA 2J7PD 1YZTA 1O57A 1S2MA 2C94A 3OQIB 2HXGA 1YAJA 2OHFA 1WJGA 3A6LA 3PXUA 1DT5A 1M34B 3NANA 3ZQKA 4C3ZA 4Q3OA 4UEOA 3IXQA 5KSZA 1LVGA 1ACJA 3V8MA 2BMAA 4MVCA 4R7GA 1TC1A 4EMUA 4D44A 3KZXA 1JA0A 4QDUA 2OD7A 3SLGA 3KPWA 5CXQA 3LHIA 4WFJA 2WLTA 5SYAA 2JHGA 3MERA 1N77A 1EUDB 5JH7F 1P2FA 2C4NA 4N0PA 1P1BA 3NT2A 4OPMA 1OKKA 4C03A 3OWHA 4JP1A 3N7UA 1E60A 4IFTA 4RJLA 4JB2A 4QOGA 1JAYA 4A8TA 4DAOA 2AW3A 4WKBA 5ENVA 1ZA1A 5TLSA 3LUPA 4DIBA 3BMCA 4ZRNA 4QUGA 1F3OA 5H9VA 1FW6A 1F5NA 1JRLA 1XPJA 2ECQA 4NBNA 4G24A 4M83A 1VCIA 5CNIA 4PX2A 4UM9B 3VC2A 4RF5A 2PXAA 3GJZA 2NP6A 2MR6A 5DM1A 1MG5A 2BRUC 2RGBA 4W7SA 5EYPB 1NT2A 2X15A 3HADA 4GZLA 4I0WB 3W0LB 5AM4A 4AROA 2J9GA 4Y6LA 1UJMA 4AS2A 4QGHA 4RFSA 3SZRA 4TS3A 1K9SA 2JVJA 3A37A 1N57A 2E4VA 2O3SA 2V9PA 4ZO8A 3ZBQA 4POOA 4MP8A 5KNCA 3AZOA 2F48A 1CPYA 3HY4A 4HWKA 2CHGA 4MS4A 4TMFA 5F1PA 3JQ9C 4EHFA 3IUNA 3IEIA 1PT8A 1N1DA 3ELDA 2JB9A 4EKEA 4BP1A 2WP0A 4B3MB 3HU2A 5K3DA 1WWKA 4FNAA 4OU4A 1V9LA 1PVVA 3DEKA 1UKZA 2C2HA 3IOEA 5JXHA 4X8OA 1LFAA 1W6UA 4URHA 1AC5A 2EBWA 2WU8A 1E0AA 4XI9A 1D2RA 3ZWNA 1GA4A 1YQQA 4R69A 1Z5UA 2QUJA 3I2KA 4AJJA 3FOEC 1C5KA 1NXXA 3WYGA 2FEOA 3D8UA 3EC1A 3IFSA 3JXEA 4D98A 3VNUA 5HDQA 1E3QA 3SPXA 2VYCA 2P4HX 1T36A 1ZQ1A 3O3CA 3TS1A 4R2IA 2H2AA 4IUDS 3R9WA 1LI4A 1ADGA 5CD1A 4X6UA 1JEQA 5CM8B 4ZCTA 3D6TB 3Q1KA 1NW6A 1OBOA 1L4MA 2HLPA 4IJ6A 3FG9A 4MI6A 4PSVA 3OEHD 5TB5A 3RABA 3U7FB 4C0JA 4DUGD 4B80A 3KSRA 1E0DA 1NLZA 1MT0A 2X5XA 3JD2A 4I2NA 2JI8A 3LW8A 4GVXA 2OQVA 4EK9A 4G81A 4O59O 1B73A 3K15A 4YT5A 3UJ9A 1BOFA 3FNGA 1TOAA 3I1YA 2I3AA 4JVMA 2D3TA 1U8EA 1FRQA 1DKNA 4C3VA 4HB0A 4AMBA 1U5BB 4FCWA 1TAUA 1W0KD 2RKOA 4IFEA 3CUTA 3QOXA 3CUYA 3I6IA 3U60B 3AHDA 1GCOA 2VHZA 3BB3A 1ODKA 2QZJA 4BNJA 1YR2A 1DAGA 2QGZA 4C30A 2IEGA 5KCZA 3LX8A 1VPEA 1ACMA 1LXCA 1N1EA 5J23A 1HDGO 2ZRMA 1A5ZA 1M73E 4KWHA 4X7MA 4MW9A 1KYQA 1IK6A 3BD8A 3CO0S 2ERXA 2NZWA 3D3WA 3H1EA 1W85A 2NTEA 4RY2A 1AV6A 3L0PA 2HMTA 4U5XA 3QEAZ 1O1YA 1NI3A 4G5HA 2FEAA 3ISJA 4HXYA 4JQYA 4QXQA 4DV5B 3CCBA 2R47A 4ZOBA 4AU1A 4IDPA 3FUCA 1XJ0A 4QODA 4MPDA 5C1DA 5KMGB 1RYFA 4L22A 4RC9A 1H6CA 2HRDA 5BSKA 3I04A 4Q3NA 1AS3A 3QI7A 3U3KA 2JAHA 4ZJZA 5J4VA 4N54A 4GPD1 1EHCA 4YJHB 4BY9E 2VYFA 2ZT7A 3K0AA 3WLKX 5F3DA 3KQYA 4ETNA 2ID7A 2X9LA 2G77B 2Q6IA 2HA6A 2P2SA 3GMIA 1H1DA 4BO7A 4AKGA 3HY3A 3K9QO 4UOQA 2OV1A 5G2OA 1P33A 3O8DA 4Y2JA 4W5OA 3T3NA 3L0SA 2RH4A 3IDQA 1O94A 4ZU1X 4ETWA 1PUJA 1JHPA 4BKOA 4D25A 3OZGA 2PQ2A 2R0QC 3ENWA 3G1WA 4MH0R 1OT5A 1PFGA 2P1DA 4FFBA 3PQ4A 4XLTA 1JVSA 1P91A 2B9EA 1ZG3A 1BWQA 1N92A 2GTPA 2O7QA 2VDPB 3N7TA 4FUTA 4V02A 3KOMA 1SBZA 4JL8A 1D9ZA 1JHVA 1UJ2A 1L8LA 3CUKA 3DMYA 6REQB 4WLEA 5BYJA 3WISA 8AT1A 3HJTA 3TI9A 2YH2A 4YCLA 3WR5A 3LZ6A 2H4JA 1SOWA 1JWBB 3R3HA 2HPZA 3V46A 5BO5A 5IASA 2VK8A 5CRIA 3G7UA 5EINA 5ESDA 5HUQA 2DBQA 3E27A 4KGZA 1W1WA 2B21A 2GYWA 4MV4A 3V4SA 3W5VA 4QUIA 1FS4A 1OI2A 5HZHA 2A84A 2YJTD 4GDFA 1DBVO 2VA9A 5INTA 1HRDA 2IHJA 4PRLA 2B94A 4BNFA 4F9FA 2NAPA 2BP7A 4BOYA 2B99A 4BECA 4D80A 1PHRA 1Q5PA 3T1YB 5EIFA 4XVHA 4KNYA 1DUIA 1JLMA 3WXMA 5L40A 4LBYA 4KXFB 5B3JA 1KOGA 5A7FA 4WJKB 2JLBA 2WI8A 1XZMA 4GX5A 4IIJF 2RGXA 4GEKA 1I51A 2Z98A 4GX1A 2OCDA 4W6ZA 2O2JA 1MZVA 2H9AA 3CRQA 3E9EA 1WBBA 3A1UA 3DZFA 3TBKA 3UWDA 1MH1A 1T0PA 2X9NA 4LVNA 1MJHA 5BSMA 3IP7A 3WGIA 4JSTA 3RYTC 4TTIA 4OQMA 2CV1A 3BL5A 3TQQA 3C3PA 1NW7A 2O6LA 3GJ5A 5HKKA 1IZ8A 4FYXA 1FU4A 2YQ4A 1RNLA 1F4PA 1KAGA 3MIZA 4F60A 2YVUA 1Q6ZA 1XWIA 1Z33A 3M4JA 1I5OA 2PX6A 3LY5A 5HZMA 4U2BA 3O92A 5A3JA 4RKFA 4LYGA 4O2BF 1U5CA 2NXCA 2BFBB 4L1KA 4TUYA 1J8FA 4KXXA 1KU0A 4XFJA 3HXTA 3GLFA 2DFPA 3AJ8A 5FAKA 3H2IA 1GGMA 3NC0C 2XA2A 2I22A 3VZDA 1XVAA 1IZ7A 2GEBA 3OBBA 4D92A 1Y4UA 5KNCD 3R5JA 1DKPA 1JNXX 1KYZA 2ODAA 3JWPA 2V6FA 3KB1A 1A7UA 1BCSA 3A3PA 4QDTA 3S2YA 2R4UA 2OC9A 4MS1A 1US8A 2OXCA 3IE1A 1HLPA 5CB0A 3E0XA 3FNBA 4IJKA 2H1SA 4LZAA 1BXGB 1Y7LA 3HZOA 2I80A 4MGIR 3GVPA 5E3HA 2WFAA 1QP0A 1JFVA 2C4KA 3B2QA 5J2TF 3MCTA 3GUCA 5K6AA 2G04A 3UJCA 4HAOA 4AWAA 3EVBA 2BEUB 4D79A 3H4IA 2FSUA 4CEIB 4G4SP 2OEPA 2O8CA 4TT3A 4WRRA 2SBTA 3IP5A 4BNYA 4PRZA 1KEEA 3FR7A 3OPYI 2EZ9A 4LYHA 5KJEA 1SCNE 3ROFA 1NAIA 4BWVA 4EPTA 5IFLA 5FJIA 4DG9A 5BMVB 5LKAA 1NP3A 1HETA 3JQ8A 3OMLA 2Z83A 3IBCA 1KIMA 3GZNB 2JLQA 2X4LA 1DO0A 3LBFA