3JW8A

Crystal structure of human mono-glyceride lipase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
290
structure length
290
Chain Sequence
SPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGLL protein
publication title Structural basis for human monoglyceride lipase inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3jw8A00
4QDTA 4CI9A 3FYUC 4KAFA 2XDWA 1MNQA 1CUXA 3PE6A 4CG1A 4XVCA 4UHFA 1K63A 5JD6A 3TGLA 1XLUA 4OYLA 1BU8A 2CB9A 3QMVA 1TAHA 2BUAA 4M0EA 4N8EA 2ZSHA 2V97A 3G9TA 4J0HA 3B5EA 1JJIA 1BN7A 1R4ZA 4FNGA 5CRIA 2C4HA 3ZWQA 3L1HA 3W9BA 3O0DA 3HLKA 2GYWA 4E15A 4CIBA 3F8SA 4INZA 1TRHA 3FBWA 1A7UA 1YSCA 1LPNA 1XZBA 1W75A 4C89A 3CCBA 1CFJA 1QIMA 2JF0A 3FYTA 1CUVA 2J4CA 3OTQA 2XMDA 2EDAA 2WKWA 1X2EA 3HI4A 4DNPA 4BP8A 1L7RA 2FJPA 3SC2A 4DMFA 3P2MA 3CXUA 3RM3A 1GKKA 1Z68A 2GBIA 5HF5A 1EHYA 3AIKA 1O6FA 3HRHA 7YASA 3D4LA 1LPPA 4W1QA 2PKYX 2XQGA 3GELA 3N2ZB 5ALDA 2HA0A 3R3VA 5CT9A 2XE4A 3R0VA 1N5MA 2ECFA 3E3AA 2ZYHA 1N1MA 2HU7A 1LPSA 1HDEA 4NZZA 4CG3A 1QGED 1QLWA 2XUKA 4HRXA 3A6ZA 4RPCA 5T4HA 1TKRA 3WKBA 5FLKA 3FAKA 4S0XA 1LNSA 5JD4A 4EZIA 4UBKA 4FTWA 5AI6A 3H0CA 4NMWA 5T4BA 4BRZA 3OC0A 1CRLA 3T4UA 4BCCA 2XLBA 3PF9A 1MTZA 3OOSA 1DINA 3H2HA 3WZLA 3DOIA 2DQYA 2WU3A 2XLCA 5C8ZA 4QWWA 1VE7A 3AINA 4J0JA 5HFNA 3R3WA 4FFWA 3WYDA 3D59A 5CT4A 4AO7A 3G0IA 2GBCA 4LHEA 2XMCA 3I2JA 2WG2A 2HA2A 3HC7A 2JIDA 3WLAA 4BTLA 4G9EA 1GQSA 2VJCA 3SK0A 2CZQA 5LZ4A 5CTAA 4KYVA 4XWGA 2PUJA 3G0CA 3Q0TA 5JD5A 4Q1VA 5AI8A 2E3JA 4LXGA 3DQZA 5T4FA 4G5XA 4KRXA 3BE8A 3B3QA 1BS9A 1MPXA 1NU6A 2QT9A 5AK6A 5AKLA 4AX4A 1XZHA 1CLEA 2XMZA 2BKLA 2WHRA 4QDUA 3ESCA 1BRTA 2XUGA 3H18A 1EVEA 4MEBA 5HQ3B 3WWCA 1X2BA 4C4XA 5K3EA 3FLBA 4G8CA 5ALJA 4ROTA 3WMRA 4E14A 3KWFA 2I03A 4ZV9A 5AKXA 3H1AA 2O2IA 2JGKA 1QTIA 5E4YA 2JGMA 2PU5A 4LIPD 2XUOA 2HM7A 2QVBA 4BBZA 4FNMA 1YA8A 2JEYA 4Q05A 4Q3OA 4BP9A 4MXDA 2WLSA 5A62A 5CH3A 3D5EA 4X7BA 1CPYA 2X5XA 3WKAA 4KJXA 3QYJA 2EEPA 4AB1A 1QIIA 1KEZA 2WJ3A 3GUUA 3WA7A 3K2IA 4WJLA 1MN6A 2WG1A 4YX9A 2BAGA 4B7ZA 2WIDA 4KACA 1FSSA 1EX9A 3EQ9A 4LKOA 4EUSA 2VSQA 3WYNA 3LIPA 5AHXA 4Y2PA 5K3AA 3VJMA 5HK8A 1XQVA 2RONA 2BJHA 4QE3A 4K6KA 1A8SA 3WA6A 4W63A 3DJYA 3IURA 3PUIA 5LZ7A 1PV1A 3WK4A 2QXUA 4CFSA 1XLVA 2HRQA 2XT0A 5A2GA 2PSDA 1CUSA 2WIGA 4TVKA 4A16A 4FDMA 1CUJA 1DWOA 2XQIA 4QZVA 5K3DA 1DU4A 3OM8A 1QO9A 4OCZA 5A6VA 1GXSA 1TCCA 5AK4A 4BRSA 1Y37A 5ALWA 1CR6A 3MVEA 3ZPXA 3I6YA 3M3DA 4Y2RA 1IUOA 4DMKA 4DGQA 1THGA 2AJBA 3MGAA 1C7JA 4HXGA 1P0PA 4GLBA 5LP1A 2J4FA 2GBFA 1LGYA 2YH2A 2O2HA 1QFMA 4K6HA 2XB6A 2C7BA 3M83A 1VA4A 2C5FA 3TEJA 2I78A 4EY6A 2G63A 4UBMA 3V1NA 4P08A 5E4JA 4A5SA 1K6EA 2WILA 3C6BA 4GI1A 5ALEA 5AM2A 4IH1A 4HAIA 4JUIA 3DL4A 5LZ9A 1E8DA 4Y2VA 4E46A 4PNZA 1J2EA 2QUAA 5LKAA 3KOOA 2PSEA 3W04A 2CKMA 1BCSA 1CUEA 5KREA 1VKHA 4C88A 2Z8ZA 1MX5A 1XZIA 4P92A 2VT7A 1UOOA 1BN6A 1YAHA 4PQEA 1DT5A 1K4YA 4RE6A 1CUGA 5ALMA 4BDSA 5JZBA 4X91A 4EY4A 4GW3A 3R41A 3C6XA 2GZSA 5EGNA 4FKBA 1QZ3A 1UOPA 4H7HA 5ALHA 3WL5A 5BWBA 4W1RA 4XX1A 5AKHA 4CG2A 1VZ3A 3YASA 5AI5A 1U8EA 1DX4A 1JFRA 3MUNA 2JBWA 5DNVA 2UZ0A 5HK9A 5CXXA 3CN9A 1UKBA 2FX5A 5ALSA 4JYPA 2AJLI 5AKKA 4UUQA 5AM4A 4BAGA 3EIOA 2DSNA 1R9MA 4BAZA 1CUAA 1J06A 1N5RA 4OB8A 4UBNA 2PVSA 2C0PA 2XUJA 3HZOA 4UHHA 1WOMA 2Q0XA 4X6YA 4JEIA 1QIJA 3ESDA 3NUZA 5AO9A 1CV2A 4OSEA 4H35A 1BEEA 1XZDA 3U0VA 1VLQA 2WFMA 1G5FA 4MJ3A 2B61A 1HPLA 1USWA 4EBBA 1TCBA 4J0KA 5BOVA 4X00A 1QIGA 5K5EA 5FRDA 3BJRA 5KBYA 2JEZA 3L1IA 5AK5A 3ZLTA 3LCRA 3I2FA 3UMJA 2ZYIA 2V96A 5AKJA 1ODSA 3LP5A 4BVJA 5IVDA 3WKDA 5AM5A 1BROA 3G8YA 5ALXA 2IX9A 3ZI7A 4AMYA 5D3KA 3QPAA 2C58A 2ZSIA 3WZMA 2HRRA 4G4GA 4F5ZA 4UFPA 1VXRA 5ALRA 3WL6A 1J07A 1CUBA 1EA5A 4B9AA 4JYMA 4X93A 3HEAA 5AI9A 3FOBA 2ROQA 5I7UA 4H7KA 2W22A 2XMGA 1SC9A 4H7DA 1Q84A 2VJDA 2B9VA 4DTCA 1CUHA 3IUNA 5I8PA 4BYMA 1T4MA 4BDTA 1QIDA 1ACJA 4QDOA 4Y2SA 2VTVA 4I19A 2XUQA 1WPRA 4Y2UA 1ACLA 5ALQA 2HA5A 1CQZA 3I6ZA 4UHEA 1H2YA 2JGFA 5JALA 4XIIA 2OQVA 3PFBA 1WB6A 2BFNA 1A8QA 4QLAA 1JJFA 1OXMA 2OCLA 1UK9A 3VVMA 5IKXA 3VJLA 3C6ZA 4DSZA 2H7XA 3IULA 1CUWA 4AO8A 4Z49A 1IVYA 3AILA 4J0DA 5JANA 3GROA 4DYHA 3H2KA 2JGIA 4A23A 3F96A 5FPPA 2J3DA 2WUGA 5DWDA 1AUOA 3VJKA 5JIBA 4FBLA 1H22A 5HFAA 3A2LA 2WHPA 4ITVA 4Y2YA 5JAUA 3STTA 5C8XA 1AMNA 4K2AA 3C43A 5AI4A 1QIFA 1UK6A 5HF6A 5CT8A 3RK4A 3O4JA 2BUBA 2XMSA 2QOEA 3JWEA 3V1MA 2OAGA 1BE0A 1WB4A 1XRQA 5AI0A 3I28A 5FUMA 1VE6A 2OG1A 4X6XA 4UHCA 3IDAA 4ZWNA 2CJPA 4H7FA 1XQXA 5A7FA 3FSGA 3BIXA 2Y6UA 1XRNA 1F0PA 1RP1A 3C8HA 2OCGA 4V2IA 2V9ZA 1XZMA 5SYMA 1D07A 1IMJA 4FLMA 4O08A 3QITA 2PM8A 3BL8A 3LS2A 2O7VA 2DHDA 4BZZA 1XZFA 2VATA 3BWXA 3ESAA 2XUAA 2OXEA 4N8DA 1H2WA 4BATA 4BE9A 5HCUA 4ZV7A 5EIHA 1GZ7A 4DM7A 1R1DA 4C4YA 1EINA 3AIOA 5FOQA 3SX4A 2WTNA 5AP9A 2OGTA 3WWDA 3M81A 3AUKA 1GPLA 3O95A 2H7YA 2XUPA 2K2QB 1ZJ5A 1QIEA 4AZ3A 4U2EA 4N5IX 5AKIA 1QTRA 1RYYA 4IQ4A 3PI6A 4BC0A 2VEOA 4ZREA 1DQZA 4ZRDA 2C5GA 3IUJA 3WI7A 5K3FA 3G0DA 4KE7A 4FHZA 4RNCA 3IIIA 1SCKA 4H7JA 1MU0A 4B85A 4L72A 1EB8A 4PSUA 1VOTA 4C01A 4KAJA 3H2IA 2HA4A 3A2MA 3BIWA 2HFKA 3BF7A 1X70A 4MYSA 2ZJFA 3FYUA 2BCEA 3IUMA 1NU8A 1ZGCA 4H18A 1XZKA 4HZGA 1MJ5A 4KAAA 1BCRA 3BXPA 3F67A 4RGYA 5CW2A 2BUCA 4J0CA 4EY5A 2JGLA 4MQMA 3HACA 5DJ5A 5C7YA 5KWJA 3DYVA 4B9EA 3ED1A 1WM1A 4Q34A 5CT5A 2H1IA 1CIJA 5ALGA 4FBMA 3C6YA 5LIPA 3HSSA 1Y7HA 4QDZA 4HXFB 4AMZA 4J0GA 4BC1A 4UPDA 1I6WA 2IITA 4J3JA 4WY8A 2ACKA 5JYCA 3GA7A 3RKSA 2VA9A 4C87A 1F6WA 1XZLA 2D0DA 5JATA 5ALUA 3OG9A 1W1IA 2NW6A 1XKTA 1WPXA 5FKJA 4MWTA 3OPMA 2PSFA 3PDCA 1ZJ4A 3UUEA 1FFDA 4G1FA 4D9JA 2OCKA 3QMMA 3N0TA 4M0MA 2HA7A 2Z5GA 1XZEA 2RGUA 5AM0A 4OD0A 5AOCA 3F98A 2Y6VA 4EY7A 3LLCA 5LYYA 1LPMA 3STVA 1CUCA 3WKCA 3I6MA 1QIHA 1YR2A 4X90A 1XLWA 1MAHA 4UBJA 2QS9A 2XQJA 5LZ5A 1QIKA 3ICVA 4GHWA 4Q3KA 2AJCA 5ALLA 2HIHA 2RAUA 4QNNA 1KU0A 2WTMA 3OURA 3WIOA 3WK8A 3R3ZA 3STWA 4WDQA 4F60A 4W1PA 2XMRA 3PFCA 1ZGBA 3X3HA 2XI4A 2VAXA 4DNQA 4J0IA 4KRYA 1UWCA 3IVMA 4BAUA 1CEXA 3HABA 1W4LA 2HDWA 4OYYA 2XUHA 1J1IA 4OU5A 3D3NA 3ZLUA 5AIBA 1K5PA 1XFDA 2OQIA 1E8NA 4DIUA 1GT6A 5EIEA 5JASA 3DEAA 2B4KA 1B41A 3TRDA 5AICA 3IUQA 5FP0A 4X3CA 4KEAA 2IIVA 1UKAA 5DYTA 2WIJA 3DD5A 4X92A 1G42A 4ZI5A 1Y7IA 1UXOA 2J3QA 3CCCA 2HFJA 1UZAA 3KDAA 1EDDA 4PSCA 4B0OA 3KSRA 4Q82A 1B6GA 4QLOA 3SWWA 3WL8A 5CT6A 2O7RA 4GDMA 2ZYSA 3NOXA 4J7AA 4KR0A 5AIAA 2YASA 2QUBA 5AM1A 3DNMA 1XZCA 4BE4A 4UBOA 1E89A 1ZICA 3WIBA 2D5LA 3FWHA 1LLFA 4UHDA 4MQLA 3I2GA 3FSGD 4GXNA 5IVHA 4X85A 1E3QA 4UFNA 3G0GA 2GBGA 5ALTA 1HBJA 3M82A 4WCVA 1DX6A 1ZD2P 2JGEA 2CBGA 3QVMA 3AJAA 1GQRA 4Y2JA 5HZGA 5JADA 4FLFA 1ETHA 4QDXA 1G4HA 2VAVA 5AKYA 1XRMA 3G0BA 1VJ5A 5DYYA 2GYUA 4UHBA 4B81A 1YB7A 5FV4A 3QM1A 3D2AA 4EY8A 2W6CX 5ALFA 3W9UA 2WFLA 5CH5A 3H2GA 1M33A 1S8OA 3AZQA 4I3FA 2JGJA 4L9AA 3D2CA 4E11A 5CURA 2OAEA 1TCAA 2FJ0A 4AZ0A 4EB0A 1CUZA 3WJ1A 1ZI9A 5K3BA 3K9BA 3FVTA 3IB3A 3I2IA 3QBJA 3BJMA 1L7QA 1JMYA 2Z8XA 1ZI6A 4DSAA 4WY5A 2ORYA 1YS1X 1L7AA 4OUKX 3HYSA 5BV7A 3MUOA 1CUIA 4CCYA 1QO7A 3FLEA 3UUFA 2BGNA 2DQZA 3GBSA 2X76A 1UK8A 4BCBA 2HADA 5ISMA 3O9VA 2WHQA 2H9YA 3I1IA 4Y9SA 2HA3A 2QJWA 5EHXA 3HJUA 4AN0A 1FFBA 3I2HA 1LPOA 4BZWA 1JJBA 4C6HA 2C0QA 1XKLA 4H0CA 4XJVA 4TGLA 4BTVA 2BGRA 4U2BA 4HTAA 1ZI8A 4U2FA 1W52X 4Y2QA 1R50A 1XROA 2P8SA 4EHBA 3S2ZA 3E4DA 3DOHA 4B84A 1C4XA 2WU4A 2WJ4A 2PSJA 5D7BA 3H19A 4WFIA 4ETWA 2WHPB 2VF2A 3G9UA 5ESRA 4MYDA 2H7CA 1N8SA 5A7GA 3B12A 1YCDA 4GBGA 4Y2TA 3VISA 3S8YA 4PW0A 5FDFA 1CVLA 1THTA 1C7IA 3DYIA 3ZV7A 5EI5A 2Z3WA 5T4EA 1QFSA 5LLSA 1BEZA 4FWBA 1XZJA 5DNUA 1SCQA 1DTEA 3KWJA 2OGSA 5JARA 3QZUA 3PUHA 2QM0A 4B0PA 4I4CA 4TPKA 3FLAA 2QKYA 3QMWA 1PFQA 3BDVA 1YB6A 1XZGA 5DTJA 1ISPA 3V9AA 4QEKA 5ALNA 3WL7A 4RE5A 3NGMA 1U4NA 2O2GA 2Z3ZA 5YASA 4KE8A 5CMLA 1UT6A 2CEKA 1E8MA 1XRPA 4K6GA 3G9XA 4FMPA 1EDBA 4M0FA 3W05A 2VT6A 3VVLA 5AJHA 3DKKA 2OLEA 4LXIA 1MX9A 1VZ2A 1OCEA 2CMFA 2YYSA 4DLNA 2ZJ7A 4WFJA 1QONA 3D7RA 1AZWA 1FFEA 3HXKA 3VKFA 4OB7A 1MX1A 2DCMA 1W6RA 1IUNA 3QPCA 4LXHA 5AH0A 3DKRA 2ACEA 5E4TA 1UK7A 4HRYA 3WK7A 4DMCA 2I3ZA 1GPNA 3AZOA 5BWCA 3WWPA 4YPVA 5ALVA 1U65A 5C81A 1T2NA 4FFVA 2Y1KA 1AQLA 5ALKA 1IZ8A 2RHWA 1ZD3A 5K3FB 2HA6A 3LIIA 1MT3A 4BB0A 1OILA 4WFKA 4F21A 2ZVDA 3R3YA 5ALIA 3R3UA 1FJ2A 2VJAA 1JKMA 1WCYA 2DFPA 3STYA 3ANTA 3G7NA 4IH4A 1XZAA 3FYUB 3CN7A 1AX9A 4PF1A 4NVRA 5CBKA 1HLGA 3VDXA 4HXEB 1E5TA 2FUKA 3QH4A 4OB6A 4H7IA 1LZKA 5EFZA 2ES4A 5KWIA 1CUDA 2HU8A 1QJ4A 4B82A 2PUHA 1YAJA 3K6KA 3TJMA 4BCDA 5JAHA 3I1YA 4AO6A 4G8DA 4AXBA 1CUUA 3DL7A 1DWQA 3R3XA 3R40A 3A70A 2VJBA 4H7EA 4CIAA 3EQ7A 3W2TA 3H1BA 1E66A 3ZLVA 2HU5A 5LZ8A 5IVKA 5FPQA 1H23A 1H2XA 3O4IA 2X8BA 1FFCA 4U2GA 4BVKA 2XMBA 3W06A 1AGYA 1YS2X 4JH0A 2VQ6A 2PBLA 3O4GA 2PX6A 4UBLA 2XUIA 1EK1A 1UFOA 4IHAA 1ZD4A 2OCIA 4BVLA 4CCWA 1EDEA 1A8UA 3ANSA 1Q0RA 1JU3A 2I3DA 1QOZA 1NX9A 3BF8A 4PO3X 4ZXFA 1W76A 3KXPA 2QR5A 3JYHA 2ZJ6A 4X71A 4P93A 4HS9A 5HKBA 3G02A 5A7HA 2RIPA 4DNFA 2PSHA 3G9ZA 5JZ9A 2PL5A 2QMQA 5D6OA 2RHTA 3L1JA 4QA9A 1ZD5A 3AFIA 4LYEA 4ZGBA 1XQWA 4KE6A 3WWEA 2WM2A 5F4ZA 4HVTA 4FLEA 3Q8WA 4ARAA 5JAOA 3FCXA 1QE3A 2WUFA 5E2IA 4EA6A 1IUPA 5AK3A 1O6GA 3C45A 3VXKA 3U1TA 2WIFA 1KU6A 4F0JA 1VXOA 2B20A 1UOQA 1P0MA 2G5PA 1TQHA 2G4LA 2Y2UA 5HQ3A 3F97A 4YASA 3ILSA 1HKHA 2WQZA 4Q3LA 1EXWA 1PJAA 1Q0ZA 3QPDA 5EIAA 2QZPA 5JAPA 3JW8A 3FVRA 1IZ7A 1ODTC 4H77A 1H2ZA 4UBIA 4B6GA 2XUDA 1WHTA 1AKNA 2QRUA 2GZRA 4N8SA 1UKCA 3F9CA 1ORVA 4PV7A 4U2CA 2XQKA 4U2DA 2XMQA 1CUFA 2QJRA 4G4IA 5A71A 2OPHA 3KD2A 2XQFA 1ZOIA 1DWPA 5DNWA 3DLTA 4X95A 4WDRA 3EBLA 5LZ2A 1MNAA 5AM3A 1YA4A 3BDIA 3WJ2A 1CQWA 1A88A 3H04A 1AURA 3E1GA 1LPBB 1JT2A 5DYWA 1R88A 1WHSA 1YASA 4G8BA 4AQDA 2WIKA 3DDUA 2GYVA 1EVQA 4NS4A 5ALOA 3T52A 4QWMA 3D0KA 4G9GA 3V1LA 4OPMA 2WJ6A 5HF9A 3DCNA 3FNBA 1F8UA 3IA2A 1ZIYA 3GZJA 1R3DA 1G66A 1DQYA 2AJ8A 5JZSA 1P0QA 2WUDA 1LZLA 1ZIXA 2AXEA 2ONCA 4OU4A 2LIPA 2WFLB 2OGZA 4L0CA 5EHQA 3A2NA 3EF3A 1TIBA 4K5QA 4C4ZA 4ARBA 1GPKA 5CH8A 5K3CA 4B83A 2Y2VA 5DTIA 2WUEA 5ALZA 5FXMA 3WKEA 5ALPA 2QTBA 5AKZA 1F0NA 1HQDA 2DHCA 3STXA 4MWSA 2WG0A 5I9IA 6YASA 3AZPA 4IH9A 1LBTA 3WWOA 4CCYB 1GGVA 5EHZA 3C70A 4N5HX 5J3JA 2ZYRA 3RLIA 4UFOA 1P0IA 3ESBA 5EHNA 5HF8A 1GKLA 2R8BA 4Y7DA 1XQYA 1XRRA 3C5VA 4G4JA 5SYNA 3C8DA 5HKAA 2PU7A 3ICWA 1SFRA 1SCIA 3H17A 3WK5A 1SOMA 5AOAA 5IH7A 1MAAA 1JU4A 1R9NA 1WB5A 4LYDA 4L3WA 3V48A 2HHAA 3D2BA 1VA5A 1EI9A 2EDCA 4JNCA 4X6UA 3C5WP 2DHEA 3E0XA 5H3HA 5CXUA 4IO0A 1MO2A 1XRLA 3O9MA 4FOLA 1Q83A 2RI6A 1EK2A 3IBTA 4DNOA 1EB9A 3NWOA 3WK6A 1ORWA 5D3ZA 4KE9A 4MEAA 4GECA 4GWLA 2V98A 1EH5A 1FFAA 4AN1A 3FCYA 3WQHA 1LPAB 4W9RA 1TK3A 5AKEA 1RWQA 5DLPA 3V1KA 5C8VA 2PPLA 4X97A 5LKRA 1K8QA 3RARA 4B80A 2WSLA 4DMHA 3I2KA 3STUA 3PICA 3O4HA 4W1SA 2CUTA 2WFZA 2AJDA 3DS8A 1JI3A 1CUYA 1AC5A 3H2JA 4P9NA 1HL7A 2HL6A 5AKGA 2XUFA 3PF8A 5IVIA 1LBSA 4YK7A 2G5TA 4PSDA 1JMKC 3WK9A 4X94A 3EQ8A 2QXTA 1U2EA 2DR0A 5AOBA 1DT3A 4J03A 3GFFA 4GEGA 1ODCA 2R11A 4Y2XA 3AIMA 3C87A 5ALYA 2YXPX
chains in the Genus database with same CATH superfamily
2C9YA 1I6KA 2DMRA 3EXEB 5A1TA 1E1CB 3FZNA 4ND1A 4QDTA 1SULA 2BI8A 2QN1A 1DCTA 2VYNA 4KFCA 4Y6PA 1B42A 4CM7A 5DHAA 2FSHA 1FPMA 1R66A 2BR4A 1OWLA 1B1CA 1SHJA 4LMBA 1ZA1A 1IY9A 4AG5A 2B99A 2QORA 1QRSA 1MNQA 3BB3A 4KIUA 4CG1A 3GV0A 3JQQA 1XDSA 3AUJB 5FBRB 2I2XB 1QRDA 4JQSA 5H70A 3V1TC 4QRDA 3CVVA 1XLUA 1RACA 2P2SA 2CB9A 4ID9A 3SBOA 2GVZC 1SOUA 3KQLA 5EZYB 4N8EA 3NTUA 4MX8A 5AJWA 5DX8A 2Q8NA 3SD7A 4DUGA 2EWWA 3JQ8A 1CJBA 1G98A 4KVAA 3B5EA 4NJMA 521PA 3T7TA 5EIBD 3MCTA 4C0LA 4WAUA 1R4ZA 3BKXA 3IMCA 1GUAA 4R8RA 5EE3A 1GSOA 2VQ3A 5TGDA 3N9IA 4IQFA 1H4QA 2K6GA 4P34A 1QU3A 1PP4A 1U3WA 1RJFA 1W1UA 2E49A 4TM8A 5CFLA 3L1HA 4YUWA 3PLRA 4E08A 4RXMA 1P3Y1 1XXHA 3EFEA 1LS6A 3O0DA 3WGQA 2GYWA 5B4TA 2ZAOA 2FG7C 4IVQA 2JIPA 4FYXA 3BERA 3PX3A 3IOCA 3N58A 1EJ2A 4INZA 4UCFA 1V4VA 2CXOA 4ZOLA 4LWZA 5J2TB 1ZK3A 1JSZA 4EVSA 1IG0A 1L4BA 1Y5RA 3MRSA 5GP1A 3FI9A 4JT2A 3GLHB 3UXEA 3ZE1B 2A9RA 1B8UA 3COWA 5B6JA 1U2QA 5FUYA 1CFJA 2J7PD 3PDUA 1GO2A 1QIMA 1QH1B 2DWQA 3BQ9A 3PFKA 1YQQA 3DZIA 3E3NA 3KKEA 2WTAA 4YJKA 2C2GA 1QUEA 3PB3A 5FFFA 2XMDA 1QHYA 1XEAA 4TUYA 2I80A 2J9RA 3HI4A 3KB6A 4IMJB 5CAEB 3ELWA 4DN6A 4DM4A 4DNPA 5JY1A 2DM6A 1PJTA 4IKOA 4Z8XA 4OHBA 2CCJA 2AUNA 1RU3A 1KY2A 1S7CA 4IZOA 4QXRA 1MW9X 3SC2A 4C2BA 3GJ8A 5LMUB 2JCYA 5JRJA 1A9TA 3CXUA 3ML1A 3A27A 4LDJA 3MNFA 1PUXA 4EL5A 1ZR2A 2Q4EA 1ID8A 4I6EA 2AG1A 3C4JA 4RSRA 3LM8A 1EHYA 1PQYA 2R6JA 3AIKA 3W9SA 3WGLA 4N54A 1LBEA 1P4SA 1SUAA 3TCXB 4KXNA 5CIYA 3NDPA 4AFNA 1DB3A 1SC6A 1G3QA 2XQGA 3GELA 1JG6A 2C07A 3AU8A 3OLCX 2PD4A 3K16A 3N2ZB 1D0SA 1Q92A 3L7AA 3S99A 3KRTA 4K46A 5IF9A 2Q5CA 4L8WB 3R3VA 3N2KA 3HGQA 3GG2A 4ZVNA 3RW9A 3DB1A 4LF9B 2C31A 3OFSA 4GKKB 4A0RA 1CRQA 5BYJA 3E3AA 1CZLA 3OY2A 1ISGA 3BM5A 1N1MA 1HE3A 1OASA 3N2NA 1J99A 4R7ZA 3ITNA 2HU7A 3KEMA 1KEEA 5IBCA 1PJ3A 3PI7A 1BDJA 1LPSA 2R751 3PG5A 4XSVA 3PYXA 4M0UA 3ZHBA 2ODNA 2RHMA 2NT3A 3CRMA 5J43A 1ZD1A 3OX1A 1JR3E 4ED9A 1OZHA 1KDTA 2H9AA 13PKA 4JBIA 5AVYA 5F78A 2I34A 1TKRA 2Y4OA 3C1AA 3I05A 5FLKA 1PVDA 1RVV1 4B2PA 3KDSE 3GBVA 4KNYA 4S0XA 3WLQA 4B40A 3AR6A 5ITZB 1Z88A 1LDGA 2QY9A 4UBKA 1K2VN 3KVYA 5WRFA 2YWXA 3RS5A 1I36A 4GM1A 4TKUA 2EJBA 3TR0A 1CLUA 4BRZA 4FMCF 2PLFA 4QASA 2H51A 3OC0A 5U1PA 2ZK7A 2ZBDA 2G28A 3EXIA 4GZ3A 3LPAA 2F43A 4XEHA 3T4UA 2ZRJA 1MTZA 2JKVA 2ZSKA 3LQFA 2XE7A 3L0OA 3PF9A 4G4SP 4F5YA 1A5ZA 2OY0A 5AW2A 5ILOA 1KGSA 1B8VA 4X61A 2PR7A 1ZC3A 4WZ6A 2H11A 3HO1A 2IDKA 2Z2JA 4IUBS 4YHBA 4FM9A 3JWGA 2J0UB 4DLPA 3DXYA 3DOIA 1T4GA 4HNSA 3C74A 2DQYA 3QWAA 4K3UA 1MOSA 3AKEA 5C8ZA 1PWYE 1WPQA 4UNPA 1BD4A 3O1HB 3AINA 3BB4A 1G63A 3JD1A 5HFNA 4P4TA 4X44A 4ZEOA 5GVSA 3R3WA 3TXYA 4AF8A 4WBNF 5CT4A 1PT8A 2WMOB 3PXCX 1WW3A 3OZXA 4DMRA 4PGGA 5C18A 4R2XA 3QOXA 1L5SA 4LZZA 1BW9B 5H3CA 2B3DA 1P39A 1YUMA 2CCGA 2ZCVA 3CLRC 1TM1E 3MHPA 4GU5A 2HCFA 2XMCA 1ESZA 4RMJA 3GCXA 1EVJA 3RSOA 4RJLA 3HM9A 1NL3A 2V4UA 2WG2A 3I2JA 4DY4A 4Y9DA 1P4JA 2I66A 4MRNA 5EY5B 1MRZA 1CDDA 1A9RA 2R3SA 1A95A 1N3LA 2FUNB 1K8RA 4G9EA 4QJ4A 3RFTA 4BLVA 1WKVA 2ESRA 5BSWA 1HM5A 4Q3BA 3U31A 3KSUA 4PRZA 1VHTA 4NYJQ 3SPXA 1GDHA 3PUXA 2VJCA 4YONB 4I66A 1H0SA 2GNPA 2IT1A 3PZBA 4XUEA 4OHOA 2W6JA 2PRIA 3X44A 1KDVA 3KEFA 5CTAA 2MU1A 1FUYB 1GRRA 1NFRA 4XXHA 4RDIA 4XWGA 1QHGA 3N8GA 1X3SA 4TRMA 1Q20A 3ZWKA 1PJZA 5ENZA 1VB3A 2C77A 3EARA 3CM0A 3QWIA 3IKVA 4G85A 1W94A 3DQZA 5T4FA 5EJEA 4KRXA 3QLTA 1A9PA 4LZOA 4Y9RA 2I54A 1GZ3A 2NV0A 1O6ZA 2B7BA 4Q00A 4U9IS 1W25A 2ZETA 5EOVA 3T5GA 1G5HA 4KV7A 1M2NA 1AH2A 1XOIA 3NX4A 1JEAA 2VCEA 3T3MB 3ND7A 3CH4B 1PWXA 4JU8A 1XVLA 3ROTA 4F9GA 1XZQA 5C1IA 1CLEA 3WV4A 1ZH0A 1JMVA 2C8LA 3L4BA 1N2GA 4MJXA 2IHBA 3AR5A 4PN7A 2H1RA 2I4NA 4BV8A 2Z95A 1L5RA 4R0VA 4OQZA 3FKSD 1DCMA 1CS0B 2Q46A 4R54A 1OFTA 2DUUA 3SVLA 2AOXA 2XUGA 3TL2A 4M7RA 2AMLA 3HJHA 4XWWA 1PYOA 1FP6A 1DAGA 4M9ZA 4PIVA 4AZWA 3EIHA 5JJBA 5F7XA 4KFSA 2AN9A 3NIDB 1JDJA 2ZW9A 1VMKA 4NYIR 4WN3A 1E9EA 3R7SA 3ROQA 3WWCA 3AGQA 4C04A 5CA1F 1EFPB 1X2BA 3ZZUA 4EX6A 2PFKA 4L8YA 4G8CA 3O75A 1RXUA 1JLSA 4GBMA 4IDQA 5G0TA 2DR2A 2CLLB 3LQ2A 4OHRA 4ROTA 3OLQA 2ZRIA 3Q7SA 1LFDB 1MXHA 1QH8A 3ZU5A 4C78A 3KWFA 3GEBA 1Z26A 5J4LA 1X7WB 1H4TA 3KFXA 5BMVA 1VG8A 4ZV9A 1DBRA 3AESB 4G67A 2ZYVX 4Z3KA 3WLTA 1K5DA 1TFUA 1ZVMA 2WMYA 3R20A 4TV8A 2Q7DA 4CKEA 5JFOA 2VWPA 2JGKA 4MV6A 2A5JA 5E4YA 2FB9A 3DBVO 1WHTB 3O8BA 3VFDA 5HILA 4BBZA 3JARA 3L7MA 5FA6A 1VRVA 3ENKA 4ZEXA 2JEYA 3ZCPA 4QTZA 2X2PA 3LQ1A 2K7FA 2M9MA 5CYGA 1RLJA 4Q9KA 4H59A 2PX8A 3FF1A 9LDTA 1ZSYA 1ZUD1 1U28C 2YNMC 4EFKA 4HYEA 5IKMA 3L4JA 3ICPA 1W48A 2W2NA 4PG5A 2ECKA 1IM5A 1CJKC 2ZM5A 3EEBA 2WLSA 2J3IA 5EYPB 5A62A 2ZREA 3NTOA 1AGPA 3NKVA 3RT7A 4CMCA 3QFFA 4PANA 4XJXA 1EXMA 1NIPA 4YGYA 1Q6YA 4RGQA 2A9PA 1CPYA 2AX3A 3OICA 2GAAA 1D1PA 3PRHA 4BVBA 5HGXA 1DARA 4B47A 1JKJA 3HXPA 2Y0BA 1POXA 5EESA 2FZEA 4LG1A 1QGUA 2BCGY 3H1GA 3LDAA 2EEPA 4DFDA 2HUPA 1QIIA 2RHBA 2YZGA 2FI1A 3B13B 3AR3A 1SIUA 2EG5A 3A4NA 4NY1A 4EJ0A 1ATZA 3UPDA 3GUUA 4GYYA 1RI3A 1WHSB 1YL7A 3MTEA 1MN6A 2WG1A 5HBGA 4YX9A 1VG0B 2PTHA 1TU3A 3AFOA 3HU5A 3OM1A 2ZT8A 4I6JA 4YDHB 1II0A 2IDZA 4A2QA 1L5GB 4QBGB 4B7ZA 5BORA 3QG1A 3PT9A 2AR0A 4OAOA 1X19A 1ECLA 1FSSA 1WY7A 3F5DA 3U60B 1RXIA 2VJMB 1FRFS 1P17A 5DPMA 4LKOA 4Z8YA 5B37A 1F6BA 1V39A 1UBCA 1XNQB 3N8NA 1T1JA 4UM9B 2VSQA 3WYNA 1SRRA 4RO0A 3NWJA 4KDCA 4PCVA 3TLBA 1KP9A 4ZHSA 1W0KA 4D4HA 4ND7A 5JNRA 4DB4A 1G8JA 3DCIA 3LIPA 3GGOA 1O8CA 1C1DA 1E3WB 4R9UC 4TVSA 4Y2PA 1YNSA 3HFGA 4AY4A 1FRNA 1PFKA 3BILA 1U3UA 4TT3A 2QEQA 3IEPA 3GEMA 4J2TA 4KN6A 1A8SA 2YRWA 3HL4A 4F3TA 2BGKA 3WA6A 1NOJA 4YYZA 2HDNB 3LCCA 2NQTA 721PA 2VDWB 4MDEA 2H4XA 3FWPA 3IURA 4FYPA 1ODFA 1DRKA 5FNVB 4LTDA 4B6OA 3K5HA 1UBHS 3P20A 1RLTA 1IHDA 3A1EA 5JH7A 3COZA 4D1YA 2QXUA 3UJCA 3DAYA 1EFKA 1L8OA 1XLVA 2OCAA 3U7JA 1SC3A 4MRRA 5A2GA 3IC5A 1G8PA 4M38A 2P2YA 3UWDA 5LDDC 3MT7A 5J9FA 2QL5A 1L1RA 1Z6XA 2V5UA 3ZY2A 3TGPA 1RLOA 3TLAA 1JLHA 1KI6B 3C3JA 4LE2A 5H5JA 3RF6A 3AQIA 4LPSA 4V1CI 5HFJA 5ITWA 1DZIA 2QX6A 2QG4A 5HQTA 4MIEA 2JBAA 2B1GA 1XMVA 2P2DA 1BVRA 2C4UA 3F46A 2RI0A 2QL7A 3O3CA 3Q2OA 5BURA 3TQOA 4BKRA 4L85A 3M6LA 1T4CA 2YV4A 1AIPA 4MHOA 4XDZA 2JHAA 2D7DA 2JZCA 1YVRA 1C3OA 1HNNA 4TQ9A 4L76A 1CR6A 2H92A 2V58A 3AXTA 3VI3B 4D25A 4N9QA 4X8LA 3RJTA 4K2HA 5T41A 1E79A 3MIZA 4JA2A 3OTOB 2FPSA 9ABPA 4IX9A 1W9MA 2Q41A 1T6XA 4RC9A 4DGQA 1IHXA 1SBZA 3EQ6A 3Q3JB 1HFWA 5A4AA 3SHVA 1WULS 3V4SA 4G37A 4Q93A 4R9VA 2XH8A 1GM5A 5JISA 3KZVA 2W2OA 4MYRA 3CLTC 1VHJA 1T5SA 2V65A 4G0PA 3LECA 4P8RA 3RCBA 1P5RA 2GERA 4YPOA 3AEUB 3V97A 3WWZA 2JIOA 1QFXA 1U2PA 1JSLA 1UBSB 2CHFA 2OD9A 2W6ZA 1RIIA 3KLMX 3M5WA 2DPLA 4KGVA 1QFMA 4Q4JA 2XXAA 2PZ8A 5GJWC 2BEWA 1VA4A 3K09A 1RHUA 3NHPA 3FIUA 4K6CA 1MZVA 2C5FA 1AZSC 3COJA 3U16A 2G63A 4L51A 3CZRA 3EVZA 1ZINA 4D4LA 1TX4B 1ZU5A 2R1UA 4JB0A 1KJNA 3KZNA 3DDOA 5DCUA 4A5SA 4ZK2A 3M3HA 5DXFA 3MTJA 3W0LB 5EWJA 1K6EA 1OFUA 3ZDAA 4U7WA 2WILA 4QXMA 3I30X 4OFXA 1RYDA 1YR8A 5ALEA 4IH1A 1V5IA 1GFSA 2O23A 1R9JA 4E07A 3IEXA 1LK0A 2N3ZA 4JSTA 1V6CA 1E8DA 2ZBEA 3EODA 1BHJA 3G85A 1D9XA 3JASB 2FMUA 1XHFA 3IBSA 4JASB 3BMOA 4PR3A 4RACA 5D2CA 1C5KA 2QG9A 4KAXA 4DE5A 3KOOA 2PSEA 1NQVA 4M8KA 4YRKA 2EX0A 1BCSA 1CUEA 4GRAA 4NI5A 2HMWA 3CO5A 4AG6A 3AR4A 2QV0A 5KREA 1QG4A 3AYXB 3BWMA 1OLUA 4QOGA 4RPLA 4C9BA 1GITA 3H16A 2LXNA 4ZOAA 4KQIA 5FH9A 2C4VA 2VT7A 1QF7A 1PUJA 1UBFA 3WGJA 5IEJA 4NARA 3T61A 3OJLA 5HUJA 1BN6A 1P1HA 3EUWA 2YJ5A 1K4YA 4RE6A 4O29A 1T8WA 3KM0A 1E1MA 1KO4A 1MP0A 2VLBA 3LUCA 5K01A 1HMPA 2HRBA 1UXHA 3EHEA 4NPAA 1NV8A 4ATNA 1U0FA 4EF5A 2CLKB 3UGQA 1DQSA 4MUXA 4ERNA 5AVTA 2BLNA 3ORYA 3H1TA 2HLDD 3C6XA 5B55A 3C4VA 3DF9A 3ZUGA 3IEMA 1Y34E 3FYCA 4GOND 4G5GA 1JQEA 1DGQA 1L5YA 1LRLA 3RS7A 1FMJA 3I6BA 1FFHA 3H5RA 3GBPA 3T5BA 5AR1A 2RGDA 2O3UA 2PZFA 3BTUA 3HCFA 4H7HA 2QUHA 2R6AA 5BWBA 4W1RA 4XX1A 1HYBA 3BXGA 3QX9A 4DM3A 1GZVA 4ARZA 4CU2A 1USUA 2VHWA 4N7MA 4BFSA 1E60A 4ZCMA 1DQRA 2GF2A 2XOKD 4M2LA 2ZDGA 4P1ZA 3YASA 5AI5A 1IRXA 1IB0A 1P60A 4C7MA 4DV7B 2MYNA 1JFRA 4QAQA 4OI4A 3D6UA 4A2CA 2QRVB 1HMYA 1XMOB 1XPJA 3UAWA 5C2JB 5CYFA 2FX5A 1C50A 5ALSA 4KPFC 3ZV3A 4JYPA 4B3CA 1SQGA 5IDYA 3TIIA 3WNBA 2QMYA 4DILA 1M6WA 1E4EB 4QBHA 4W5TA 1TEHA 4Z6KA 4BAGA 3QE4A 2Q4OA 3A28A 3EIOA 4WBXC 5AQ1A 3KCQA 4BQIA 2P0EA 2P77A 2FR8A 5TRTA 4O2BA 4JI3B 3RHFA 4TKLA 3HB0A 2GDZA 1O77A 1U0NA 4NNOA 4N39A 3UMFA 4UBNA 4D02A 4JKOA 3D3EA 2PVSA 3AKCA 4UHHA 5LUAA 3JQAD 3W4IA 3OWHA 3IVXA 2HT1A 4YCSA 3KLPX 1U0JA 4ECAA 4D97A 5DI9A 1WMFA 1O89A 1UPTA 1YKFA 4O25A 1UEJA 2C1XA 4C3UA 4OK5A 2OYSA 2Q0XA 4X6YA 4ZEMA 1Y3FE 4COOA 1JHXA 1XYYA 1QIJA 1X80A 3FGOA 3QQPA 4KWTA 5JCXA 3ESDA 5JO0A 2XKKA 3ORQA 1COWA 5AO9A 5I7WA 2DH5A 3CMMA 4AS1A 1VLQA 4DDKA 1DFGA 2KPOA 4BRUA 1Y9JA 2YHAA 1H6CA 1XXLA 1C8KA 4K9QA 3I5AA 4H4DA 4I9GA 2OENG 2D7CA 4X00A 1BE8A 5EZ5A 1Y9AA 1QIGA 1VBFA 3FSEA 5FRDA 5IUNC 3BJRA 3OP4A 3RAGA 5A04A 2WKPA 2P35A 5IFKA 5EGSA 3FIJA 1L4HA 2FAXA 4WN9A 3HY4A 1MQSA 2XHEA 2IELA 2COEA 4QUBA 4HRVA 2VPWA 2MMGA 2ZYDA 2BGUA 4MVYA 1FXUA 1I6MA 2V1XA 4P7FA 4X1KB 1EAYA 5E7QA 4Z9XA 3L1IA 4Y67A 4TROA 3VX4A 2FH5B 3DKIA 3F3KA 3GUHA 4HFMA 2YCLA 4KV9A 1CJTC 5LMCA 1L3BA 3E81A 3P0FA 3JTEA 2V96A 3MD9A 4JI2B 4XFKA 4A6PA 1TF7A 2OV6A 2LDXA 3OQIB 1CHNA 4NXNB 1ODSA 2ZDHA 3EMVA 3D3KA 3NH6A 5DW0A 1TXGA 1PSWA 5FWYA 4ITUA 4I55F 4A8JC 4DDTA 1R6VA 1CZUA 2J0SA 3FZQA 1BROA 1ZH8A 2HSWA 3QU4A 1XWWA 1V8OA 3FUXA 4LFCB 3WYGA 2C92A 3TLYA 2X5NA 1SHKA 4R9SA 5CW1A 1Q2UA 2YY7A 4O4JF 2CDNA 4HNTA 4AMYA 5J58A 3QPAA 4P38A 4G0XA 4C0JA 4A36A 2C58A 3FETA 3TTTA 2PO7A 5KYXB 1PEDA 4CUZA 2JI7A 3IT1A 1Y4DE 3LWZA 1VXRA 1Z2CA 4PG7A 4GYJA 2PX2A 4ZI7A 1CUBA 3PWSA 3ZDZB 1IM8A 5CB0A 3TAHA 4U9UA 1KEUA 4B9AA 4BTEA 1UADA 2VLIA 3ER6A 1NR7A 3Q6MA 3L41A 1JRLA 4QC2A 4ACBA 1XBTA 2I8AA 1CR0A 4ZT4A 3CR7A 3U0BA 3E7PA 1PBNA 2WT4A 2XMGA 3BAFA 2JZOA 4U0KA 1KERA 4LF8B 1QFZA 4LBZA 2B9VA 4DC9A 3KSDO 3ZVKA 1ISHA 3UJBA 5I8PA 3FFTA 1KJQA 3QW4B 3GI1A 3P9SA 5C7IO 4YAEA 3IHKA 4REMA 2Y0PA 4UU1A 2W48A 1YR6A 4QQNA 3A6EA 4D5EA 1U8YA 4CEJB 4E5UA 4L8LA 2HF2A 1AO3A 4IZ6A 3TIGA 3THXA 1XQ6A 4WX2B 4QDOA 4Y2SA 4LHVA 2V7BA 3O8QA 4DVGA 4KBGA 2EZ4A 2KLBA 1E1KA 4UVEA 4E70A 1A9OA 1YS4A 2AFIB 4Z3DA 1ACLA 2HA5A 1XMPA 1G60A 4DA7A 2GFHA 1CQZA 1QB8A 4FGUA 2FSFA 3CF4A 3OHPA 4CM9D 2HYDA 1DEKA 2BBOA 6NULA 2DF8A 3EZLA 2BFFB 4RSGA 4QT4A 5JJ5A 3OLWA 2FFAA 4PLTA 4DPLA 1IG3A 1SZCA 1B16A 3ZU6A 3INTA 4NHOA 2XYPA 3LNTA 1M2GA 1KSHA 1V45E 3CUEF 5FFNA 4WBNB 3KLOA 1NY6A 2RK3A 1SCDA 3Q15C 1UAYA 2JI6A 1MJGA 4E22A 3W5HA 4BKMA 1A8QA 1JJFA 2OO5C 4CKYA 3R6LA 4RL6A 1ZS9A 1MW8X 3SF0A 4N6GA 4DLVA 1N0VC 1W0CA 2IW3A 5TNXA 1JLMA 2PUWA 2OOSA 3NOVA 1GPJA 3K1AB 1UP7A 3VV3A 3EBOA 3C6ZA 2Z43A 3LQ4A 4EHFA 3IULA 1CUWA 1R0YA 3KNZA 4NK5A 1GPBA 3SF8A 4AO8A 1OZGA 4HQ0A 2R8YA 1Z47A 1LQUA 5JSYA 2PJRA 2ZRDA 1Z73A 1N2JA 1OKKA 2UZAA 3WB9A 2K4MA 1PHRA 2YY5A 3HDGA 4J0DA 1T9BA 5DK4A 1RXVA 3W5IA 1DC5A 4RF4A 4RQAA 3GWGA 1EM6A 5EE0A 2QTHA 5J63A 3EGCA 2G4VA 3OCYA 1QYWA 3KJIA 3ZXUB 4CKBA 2C9BA 1A27A 4TSFD 1VJTA 2K7ZA 3IA7A 4TRJA 4A23A 2YIJA 3K6SA 2HT6A 2VF8A 5HCNA 5FPPA 2BTEA 2KBFA 2C84A 1RM4A 1X8XA 2IV2X 2CNDA 4XDGA 5IU6A 2MSWA 5DEOA 3JQAB 1VIMA 4YQEA 1WRBA 3KPWA 2V5AA 3VJKA 4EGQA 1NATA 2R4UA 5JIBA 2GA9A 5DM2A 1H22A 1WTAA 2OXFA 3B6EA 2DJ5A 1XHEA 1IPFA 1KVQA 3JQ7B 3ZKWB 3G2OA 2BH9A 3T1QA 1QKIA 1B8NA 1NBWB 4JB2A 5DIZA 3LRPA 4IIHA 2ASEA 4ZFNA 2G1PA 2J07A 3L1KA 2ADFA 2J48A 4OX9Y 4BNVA 2PWYA 4JELA 4JLNA 4LKRA 4LSMA 2PZBA 3DFUA 4AZSA 4TLDA 2WJJA 4J7XA 4YV2A 5ADUS 1X1RA 4AMBA 1YZUA 4LI3X 1UJBA 2ZYUX 5CA1B 4TWRA 1MGPA 1PT9A 3WRXA 4F6RB 2QPAA 4KPYA 1FE8A 2I3GA 5C8XA 3G0HA 3IB6A 2RC6A 2ZWMA 3KYDA 1JR3D 4PRKA 1WVIA 3HB4X 3N07A 1SU4A 2BC9A 1JW9B 4E7OA 1R16A 2EC5A 4D3YA 2W6NA 3O4JA 3SHWA 3JALA 3WY9A 3V2HA 1TTTA 1DO0A 3DL2A 2GD1O 5E7MA 1JE1A 3JAKA 1C0LA 1S7GA 4US0R 2FPGB 3U7QB 2OBNA 3VOTA 1LX7A 4R2LA 4YCNA 1FYVA 4QJIA 4FX5A 3NYWA 4QYSA 2A9OA 2QRLA 2YIMA 1OBVA 3DOUA 1OPRA 5EIFA 5G0WA 3CE9A 1GARA 5KOHA 4J1NA 1SCBA 1A1SA 5KSPA 4E12A 3OY7A 1ABBA 1AN0A 4GMXA 4Z1OA 3Q0IA 3IDAA 1ITZA 1KYZA 4Q1CA 3DLAA 3FUTA 2W0SA 1Z33A 3IIJA 3LA6A 4RHYA 3IUYA 4GSLA 3F6BX 3IQEA 5EXDA 1I2DA 1XUOA 1NYLA 5A7FA 2D54A 5KX5B 1X14A 2YWRA 3L0DA 3AB7A 4FGLA 1KAOA 3AHIA 4GGPA 4KXVA 4MVJH 2QAGB 2ZI5A 3CPEA 2Y6UA 3MG9A 1XRNA 5IUJC 2PKWA 3EGDB 3PR1A 1JNYA 5AXAA 3VYSB 1RP1A 2E89A 1G20B 3C8HA 4M0DA 1JTEA 2OCGA 4K9RA 4UUAA 3RS8A 2QN8A 1ZL0A 4ZICA 4JC4A 4F1WA 5FWNA 2JIBA 4Z86A 1KO8A 1PYGA 3HBLA 4R1OA 5I4BA 3BJIC 1TVCA 1ORDA 1YZKA 2DWOA 3I01A 1J8VA 2JD0A 5KSYA 3EZXA 3QELA 4GKVA 4PCUA 3A37A 4ME6A 4ZCRA 1ZQ9A 2PM8A 3BL8A 1ZSNA 1HDYA 3IE0A 5A06A 5CDGA 3FTFA 3LS2A 2O7VA 3RTDA 3BWXA 1QQTA 3ESAA 4MWZA 4W7SA 2OXEA 3ESZA 5FQNA 3O84A 4MLPA 3DO6A 4CM1A 3V6MA 3CUUA 1ORHA 5EP4A 3ZWCA 1N7JA 4BE9A 3CX7A 3K7EA 2ID7A 4K6FA 2ADOA 2HMVA 4N5MA 1TE2A 1HLPA 1R1DA 3SMVA 1EHIA 1E2IA 2VDQB 2CMHA 2X2OA 3C6QA 3T4XA 3SX4A 2BGWA 4KPUA 2WTNA 2OGTA 4EG5A 3L79A 1BMFD 1B3RA 3COSA 3SEFA 2WPDD 4N18A 2SNIE 3ZIDA 4R2MA 3CQ9A 3P4UA 1SUIA 5DMHA 4UAUA 2NUAB 3O95A 4JI4B 1OLOA 3ANLA 3L8EA 1HETA 4BV9A 2ONJA 2H7YA 2XUPA 3O8DA 4I3GA 2UYCA 1D6JA 2G88A 1IJKA 3KTAB 2WF7A 1XCGB 2EZTA 3IMFA 5TVGA 4GLFA 2A9VA 2B1QA 3IVRA 4ZXPA 3M9LA 1QIEA 1SU6A 3WQQA 3NJ4A 4V1CB 1Z74A 5BVGA 3N0XA 4JYCA 3LZCA 3RYHB 4DQLA 4A0QA 2HREA 3WRWA 4E4RA 1Y5LA 3MTGA 4WZAA 4Z0PA 5BQXA 1L7EA 2Q3EA 2YVUA 4NOLA 2R5FA 5BV1A 2VEOA 4TQUS 2NZ2A 3OJCA 2AKEA 4WA8A 5KNCA 4E94A 3VKUA 3DOCA 4LK2A 1JDUA 1VJRA 2D5AA 1KMIY 2W8ZA 3AETB 5DASA 5AJXA 5BYBA 2F9FA 1E2FA 2XWSA 4FDUA 1D5CA 3G0DA 1HZJA 4RNCA 1CDEA 1QHEA 1UBUS 1PTJA 1WXIA 3IIIA 4TLMB 2EL7A 4UE6A 1EEXB 1TPYA 1SCKA 4GSKA 2RH9B 4LXQA 1D2AA 4MVJF 1WXDA 2QSYA 3OSZA 4EHDA 3LT4A 4ZVMA 4MSUA 3T5DA 4JI8B 4PSUA 3U4MA 8ATCA 3TFOA 1VMIA 1XA3A 1VL8A 2HJSA 3EMKA 3H2IA 2I5PO 4BEJA 2Q3MA 3JAMA 1NBMA 1RRGA 4X3OA 1K7SN 3UC9A 4AMUA 2EF1A 4IDEA 4JK3A 1M66A 2G7ZA 4V0OA 4MVJI 4PLWA 5LWHA 1QMPA 3A2MA 1Z0IA 2HFKA 3BIWA 3GAAA 3VSDA 1PG5A 1X70A 3FWYA 4MYSA 4H9GA 3SGLA 4B32A 4BVHA 1CQIA 2QVCA 1MJFA 2ZROA 2BF7A 5DGCA 1NM5A 1QHHB 1O6BA 1E2EA 1QG2A 4MZDA 5T6BA 4RYDA 4MWCA 3SJBA 3MSXA 3S55A 2AUMA 2NVOA 2PA0A 3EG5A 2HCRA 2QUIA 1QPZA 1NFFA 1PI3A 3IDFA 3BGSA 1AS3A 3RSHA 3RTGA 3A0RB 1QP4A 1Q14A 1DDIA 2WA2A 3IEUA 3NTQA 2A1IA 3OEEA 4Y8VA 3U9SA 1VMEA 4LUCA 2NX2A 3UCFA 1ISMA 3G2KA 2CLFB 1YZGA 3BXPA 4ZA2A 5DGIA 1DZ3A 1V1RA 2BUCA 3W6ZA 5A2QA 3SMQA 4J0CA 2NO1A 2G1JA 2JGLA 4EY5A 3BMQB 4MQMA 3ZI4A 3GYBA 2IEBA 4ZP1A 1XX6A 2GM9A 2UXDB 4UM8B 3D3JA 3TW8A 5BPHA 2H17A 4KQ2A 4YWJA 5FHQA 4CWAA 1ZOSA 2EBWA 4RSMA 4QOHA 2OSBA 3V8BA 1QYDA 2A9JA 4Q4HA 3UUWA 4B9EA 5HRUA 3GQBB 4HNHA 2CNWD 3CVOA 2OGUA 5ALGA 4BQEA 1TT5A 3GA5A 4YH1A 1SO8A 1ZOPA 1UMCA 4GLLA 3NDRA 4MUAA 4BMPB 3LAWA 1SUSA 2YC2C 4KMSA 4PSVA 3A4YA 5HG0A 2GN0A 4HXFB 4M88A 1C8VB 1O57A 5KC9A 5HVNA 1QYRA 2GEDA 5IK2D 3Q8KA 3VC1A 3KR0A 4Q24A 3IQDB 4IMRA 3HVJA 1A82A 2QM8A 4Z4IA 3IQXA 1I9GA 2ACKA 2X9NA 5JYCA 2C9ZA 4CL3A 4F4JA 4ETIA 1VYVA 2W4QA 5A05A 1IM2A 1L5NA 5CCEA 5BV0A 3VQTA 2NP6A 3FDIA 1CULC 1Q5PA 4XSHA 4YNBA 4B46A 2BFCA 1VECA 3DZHA 4D3SA 3NHZA 2P9CA 1FNSA 3MRXA 1Y8ZA 1XKTA 4XQEA 4GM0A 3GJ0A 2IIPA 3E27A 3SC3A 4MV8A 4HDRA 1Z5OA 2PSFA 1ZJ4A 2A5FA 3PLNA 4KYUA 4G1FA 2IPXA 4N7BA 2AZMA 3DH0A 3MJVA 4RAOA 1E96A 1CZNA 3N0TA 3GU3A 4JQCA 1MRSA 1KMHB 4FFPA 4S1WA 1DEOA 2OBFA 2V7QA 4M0MA 2XXBA 3KKNA 2XCOA 1A2QA 1YVEI 3QWBA 5IJ0B 2FVXA 3GLFB 3MHTA 2C0CA 1TVMA 2ZRKA 2V7WA 3FTNA 1J56A 3MS4A 4JCCA 2IKSA 3FNGA 3R7NA 1DLJA 2Y6VA 4NULA 3STVA 1LPMA 2RH4A 2VYVA 4RIGA 4U7JA 2HWYA 5FADA 3VTFA 5MGNA 4M9QA 4YJDA 1IOZA 2YFKA 4FT2A 3EAQA 4AICA 3OJWA 3PE4A 2H54A 3AY6A 1VBNA 3NHLA 4FCWA 4LW8A 4UBJA 3EISA 5FI3A 3SAJA 1R6AA 2V8OA 4R9RA 3ZCSA 1FUKA 1QCDA 3Q10A 4N01A 1PNRA 4YS6A 4C0AC 5KTYA 3A0UA 2DSTA 2M2IA 2CN1A 3RG2A 4MB6A 1WD7A 2A2ZA 4HH3C 2LVBA 4EHKA 2IC5A 1JHVA 2BGTA 1H93A 5T57A 2H1OA 2Y1CA 1FTSA 2F1JA 5G1NA 4I3HA 1UPAA 2ZANA 1PFYA 3D6AA 1NFQA 4LOLA 2C5LA 4U3JA 1QUFA 5JZVA 3U44A 1WDKA 1DKPA 1TJ3A 4OI0A 2OYRA 4YEDA 2KS6A 4I8DA 2IZ5A 2JAHA 2WSYB 5DLDA 4NFLA 1FLVA 4A26A 1VKOA 2Q3JA 2VXOA 2R9VA 3PNOA 3VTZA 3A6FA 4L50A 3ZWYA 3SIRA 1YQEA 3A6GA 3BRWA 3QVJA 3WFJA 5EJFA 5G4KA 1O96B 3CJQA 3WGYA 1G5PA 3LGSA 2CCKA 1LI4A 2CNLA 3CRNA 5F3DA 4Q37A 3WK8A 5LN1A 5F9MA 3AUYA 3KB2A 4KI7A 4F93B 3PQ4A 5CEFA 3ETLA 4H6WA 2IKQA 1UBRS 2O06A 2C57A 4FN5A 5HKLA 2XMRA 4LNHA 4D6XA 4D3DA 4TTSA 3HU2A 4PONA 2VAXA 2YTZA 1MXFA 3C3XA 4ZO6A 1JEOA 3D4OA 5L3QB 2FSVA 2P4EA 2ZE8A 3L6UA 4UXJA 1I2BA 2P9GA 1PZNA 3GRPA 2KM1A 4PM4A 1CEXA 1B6SA 1TCUA 1OZAA 2GVNA 2MJLA 3U80A 1HYQA 2HIGA 3R0QA 3SE0A 1SOVA 3W3AH 3D3NA 3ZLUA 2IQ5A 5J2UB 5AIBA 5J4VA 2CD7A 1E8NA 1G7TA 2ZI9A 2WT9A 2A0UA 3C15C 4B3XA 1M6HA 4DIUA 5CJJA 3C3PA 1ZHFA 2BSAA 3FDJA 4L8VA 5J5AA 3T7EA 4RHTA 1SK8A 2OECA 3DEZA 4KH0A 1R0CA 4KPGA 5CNIA 3KQVA 3RAJA 4EGFA 5EIEA 2BZSA 4PGAA 1IBCA 2ZPTX 1DHRA 3CGWA 1RQRA 3IKMB 5JW6A 1W7AA 4YRCA 3ELBA 2WWXA 4K9MA 5FBQB 2YVKA 5JPCA 3AEZA 4I55B 4B73A 2HQBA 4LX8A 5FP0A 4UATA 2BEUB 3S2UA 1DIBA 1KI8A 1YMVA 1PFGA 4TLBA 4U00A 4DAEA 4L15A 4RUKA 1UXJA 3MWEB 3Q6IA 4GQIA 2HPHA 4ZALA 5BPFA 4O4JB 4X7RA 5BR1A 4JIGA 2EQ5A 2IIVA 4C0XA 5BXQC 3HMQA 3OETA 1LSSA 4QD3A 4E33A 1ZXXA 5K6RA 2P9YA 2WIJA 3GD5A 4M87A 3Q7EA 3PR3A 1GFIA 3R5KA 4HN9A 1JUDA 3KQTA 4O1IA 5EQTA 1EE2A 1M2OB 4UEWA 5JZMA 4DMGA 3DBOB 1W1WA 2X9VA 3CKYA 1CY1A 3CCCA 3TRJA 3OKPA 2RHLA 1QFYA 2CXRA 4IOMA 3SZLA 4OQDA 4PSCA 3U62A 1DG1G 1WF6A 1SXPA 1N6OA 1DBQA 3E9CA 4ND4A 1WVGA 1I7NA 1ZYUA 4NBSA 2D1QA 2PGXA 4Q82A 3WGVA 1J2RA 2OD2A 1P1KA 3A1FA 2FQYA 4EAAA 5FAKA 5T7BA 1X8JA 2WSBA 1UP4A 1SCAA 1GZ6A 4Z9FA 3I5MA 3PYLA 1ZCZA 4MMYB 5CT6A 4OHVA 4WGGA 3WL8A 1T8RA 1PJQA 3MCZA 3SP1A 2ZYSA 3DEKA 2GJ8A 3N76A 4TMVA 2D00A 3TKYA 1U4SA 3UNXA 3V80A 3IGFA 4RK7A 4IDGA 4ZYXA 1E94E 3S27A 1GN9A 2OT3B 2ETXA 4JL8A 1JECA 5AM1A 4JT9A 5TARA 3VUEA 3CVWA 1ONOA 2EYUA 3B70A 3DNMA 4HZUA 3S44A 4BE4A 4EPYA 3WIBA 1C2YA 2JL1A 1IQUA 1PG0A 2D5LA 4I9FA 5MFPA 2VFAA 4FHEA 3QE9Y 2GJAA 4UXIA 4QSMA 1RCFA 3FSGD 3ENWA 3LP8A 5IVHA 4KLNA 2H1SA 3R1IA 3F9RA 1JEJA 3QTTA 3OE7A 3W2EA 4L4ZA 2XNKA 3BEDA 4DIDA 1IQRA 2M1XA 2XRFA 3CBGA 3M82A 4X62B 2GRAA 2DP4E 3DDSA 1ZD2P 4BLWA 2W2LA 4BY9E 1W2WB 4TYYA 1OH7A 4EHAA 4YCLA 4FSHA 1Z13A 2PX4A 4V0RA 1Y3HA 3NS7A 1U5BA 3QVMA 1S2MA 1RQGA 4RABA 1KAMA 4ZAXA 3REQA 5HZGA 3WIVA 5JADA 1TA4A 2G6BA 1EDOA 4QDXA 4MLZA 2ZPAA 3WADA 1FA9A 4H2DA 5AKYA 2X19A 3NHWA 3A4IA 2OFOA 2XITA 5DOVA 4UCWA 2GJ4A 2GYUA 2HGZA 2HCBA 4L75A 1H1LA 4B81A 1K0FA 1VKJA 2R4TA 4J29A 1YQWA 2FWNA 3KQUA 3D2AA 3TYXA 5DHUA 3AP2A 2AOTB 1YFKA 2W6CX 3FPAA 1E9SA 3AF4A 5I7EA 2HY7A 4MLCA 2P3LA 1M33A 4P7KA 1YOVB 4RLFA 5LQSA 3TPCA 5DLQC 2O5EA 4L9AA 1IN7A 3K71B 2GN9A 3D2CA 1E1RD 2HWXA 4L5YA 1SQ5A 1FQOA 3BVPA 4CQLA 4I2NA 3KQPA 5CURA 2VDVE 3BWCA 2OAEA 4QGFA 2YQ4A 1C14A 1DC3A 3LRXA 4Q4AB 2QZSA 3GT3A 2WKQA 1ZI9A 4JNKA 4V3BA 2IUFA 1R0WA 3PEVA 4Q1FA 2D2FA 2R4QA 4ZT3A 3K9BA 4ZU3A 3TQSA 4CLRA 3JD2A 3OMWA 4LECA 3UICA 4POOA 1I0LA 4EW6A 3AR9A 1GG5A 3JXEA 3BJMA 1J1ZA 4GOOD 4KXXA 2IYSA 1B0ZA 3RVDA 4MGIR 2QE7D 2B21A 2DUMA 2J9FB 2ORYA 2Q2OA 3NWEA 4K28A 4L6IA 4WY5A 1YS1X 3TTYA 1ZFNA 3X0DA 2V6GA 1G59A 2C98A 2P9HA 2BSXA 1T36B 1X7ZB 2CFSA 1E92A 4X1IA 4GAEA 5JO9A 5B2FA 2IE0A 2IY7A 5LBUA 5BN1A 1N9KA 2MYPA 3UUFA 4IS2A 2BL4A 3IPAA 1DOAA 1ZUNB 2G4CA 4FDLA 2A5LA 1NRJB 4URVR 2WOJA 3O7WA 4LOHA 3GBSA 3NXKA 3Q8MA 1NLFA 5DXJA 2C8KA 2ZIZA 1VTKA 3L0ZA 5ISMA 2LDBA 2WTBA 3JVIA 4YRZA 5CITA 1ZKDA 2XHZA 4HAUA 2UXCB 2H9YA 1WNFA 5JCPA 3EW9A 3PGA1 4Y9SA 3GVXA 3AL2A 4JB3A 4V0KA 1V9SA 3EF1A 4KB5A 1JIVA 1IPEA 2WWGA 3HJUA 2J41A 4NU6A 3UV6A 1CE8A 2EJCA 4U02A 2ZSUA 4C4RA 2G1AA 3I2HA 3PNBA 2REQA 4NDNE 3SCZA 4D0RA 4D8TA 2XV1A 4H0CA 3TFWA 2NV2B 3NIGB 4RS3A 3OZDA 4ALJA 1P1JA 3SJ7A 4E4TA 1O6CA 2J3HA 4HTAA 4X60A 1CIVA 1V9CA 1QOQB 1C9DB 1VSQA 2IYAA 3ZHQA 4ZHQA 4K0KB 1JIQA 1ZI8A 3NM6B 4U2FA 1YRAA 5AVJA 1SA0B 2NQ8A 3OQOA 1DIAA 1ML4A 1W52X 5EXPA 4ZN6A 3L6BA 3PGXA 1F9EA 3W6PA 1IN5A 1B74A 2ADMA 1SVWA 2OVFA 1R9GA 5D51S 3MAJA 1C4XA 1HOTA 1N6IA 1Y1TA 1ZCFA 3DBLB 3PFNA 4QEZA 4XYBA 2VL7A 3HPQA 1I1QB 3MAAC 1O03A 5I3CA 3A6HA 1OH6A 4FFMA 2JH9A 4N5NA 3ZZNA 3GX1A 4DZRA 5LB4A 2DG2A 1SCJA 2Q1XA 4NZMA 5DVZA 5ESRA 5IAOA 2H29A 2H7CA 5LNK1 1RJGA 3QXCA 5B2EA 3JAWA 2P5TB 5CVUA 1UUFA 5ELMA 4CMGA 4ND2A 1LI5A 4OQYA 1YFLA 2NU6B 2WZCA 1H8EA 4N3NA 4GBGA 4GVLA 2INGX 4MVWA 3UYKA 3VISA 5DHFA 2ZWOA 4HDNB 2CDBA 6LDHA 2HMUA 1CVIA 1C1XB 4PW0A 1CZOA 3TTXA 3AI1A 2GTPA 2Z2YA 1FVXA 3GFVA 3OCXA 5TY0A 1ZP6A 2IWHA 1FLAA 2C3UA 2QNRA 3ZV7A 2C9DA 1NY5A 3IAM1 3FFXA 1MOZA 1PK7A 2HSJA 1BXRB 1O58A 3K6JA 4WADA 5E1DA 1MVLA 2Z3WA 3IHLA 1U7TA 1QFSA 4TV9A 3TQCA 3G2QA 3P4YA 4IMPA 3DAFA 1O9HA 4KIFA 5EJ9A 2WTXA 3VPHA 3K9NA 3QYAA 3MTAA 2I2DA 1BEZA 4ENSA 5BW5A 4FIDA 1GLNA 3GLIA 5DNUA 4ZDIA 3KWJA 5CX1A 2CVPA 3FPFA 4LI0A 4BMNA 5JWOA 3PUHA 3PNLA 4FHDA 1MFZA 3IH5A 3O8OA 5D6NA 4MRAA 5IXSA 1UJNA 2KBEA 2NU9B 3UFXA 1KFBB 2QKYA 5E9AA 4OHCA 1YB6A 3PVSA 4C6SA 1U8AA 4RTPA 4Q5IA 1XZGA 4LYHA 4EFMA 821PA 1X7GA 3WOVA 1T5IA 3G8DA 2RGCA 4CLOA 4CEIB 1UMDB 1OBCA 5JR3A 5CR9A 1ZM9A 3G8BA 4ZOEA 5I7VA 1MR3F 4FIZA 1WBJB 4CLXA 2PT6A 4EZEA 2EGGA 3FF4A 3JY6A 2FWJA 2O2GA 3WGOA 3WGTA 4E5MA 1M6NA 2IOQA 1TYEB 4LDAA 2AHOA 3HCAA 1G8MA 1Z08A 3H5AA 3CH6A 1U90A 2DFDA 3O5AA 4QBKA 4RMGA 4S35A 1XEXB 2HXGA 4REQA 5BQOA 5SZIA 1QVWA 3VNQA 3BC1A 2RHJA 3EK2A 2OTCA 3NBUA 1SKQA 3PITA 4FMPA 3U4QB 3FY4A 5KYGA 5KYUB 2XVMA 2PKQP 3I8SA 3SXUB 3UANA 1R0ZA 3VYTB 4DIFA 1J23A 1JHYA 3UAYA 4FT4A 4ZVRA 2GKGA 4J1QA 2O0HA 4I1PA 4Z53A 1H2HA 4KMMA 2VT6A 1QYXA 4HVLA 3OPQA 1BJRE 4L16A 3DKKA 2QRNA 4EX7A 1E9CA 2RG1A 3PWKA 3ITDA 2Q4TA 1ECGA 1H6BA 2HGSA 3T5MA 4DPMA 1PGPA 1MX9A 5KYNA 1XNHA 4GRIA 1RP7A 4XIGS 1JKFA 3QF4A 4GE0A 2O2XA 1WSBA 4IV8A 1TO1E 3P27A 2OWEA 4G23A 4BFXA 1E1NA 2ZJ7A 3EXEA 1E1CA 1TO2E 1U3CA 3PQ5A 3D7RA 1XRJA 1AZWA 1G5IA 3REFA 3VKFA 5BMOA 2BGMA 3H87A 5JXJA 1C3XA 4C5BA 1MX1A 2E7ZA 2DQSA 2GWHA 3WO1A 2DCMA 4O63O 3I5YA 3MT8A 1JKIA 1IUNA 2A33A 2JJ1A 3I53A 3QPCA 4LCJA 4W8GA 4RD2A 3DKRA 1KFJB 5AH0A 5NULA 3RFFA 4A8JB 2VHJA 3BXHA 5THXA 5DFAA 2JIZD 3KKOA 3LDUA 4EPWA 5EZYA 3AZOA 2KLHA 4P7GA 4EUKA 3QEMB 5AOVA 1ZN2A 3SR3A 2WU1A 5IWCA 2VQEB 1U65A 1XJ0A 2WSIA 4ZOLF 3PFGA 1L7OA 1RM5A 2COKA 2HUNA 4FFVA 4ZAFA 5FAXA 5IW8A 1EFRA 4P2GA 2BBSA 1VGVA 1ZVQA 2AQKA 2HJVA 4LQDA 2PYIA 4RF5A 2F55A 2O4UX 3GFGA 3RYCB 4JDUA 3UW1A 1NJ5A 4UD6A 1N6HA 5FTWA 1U81A 4F3KA 2I33A 2Q5IA 3FVVA 2H2HA 3AM4A 4K87A 4GUDA 5DYNA 3RBXA 4IIBA 5C1BA 4G0YA 1QAQA 1L2TA 3HBJA 3IXMA 1MQ8B 2GCGA 1RYMA 1NIJA 3K94A 1P6UA 4DCVA 1I5RA 2V8BA 3A4VA 3CR3C 4OQFA 2FZWA 1YB4A 3C1UA 1SVSA 3HYNA 4QECA 5ALIA 1JSXA 1U2GC 3AX6A 4DJTA 3DMGA 3S29A 4LRTB 4XYLA 1R8SA 4YMHA 5I7RA 3ER8A 3RT1A 1XC7A 9LDBA 4JDPA 2YOFA 4B8ZA 4A15A 5J2TA 2IA5A 2NSJA 4XPZA 1JBKA 3QE0A 3HXMA 3W5VA 4ROSA 1JKMA 1E64A 1E99A 1U2RA 4XJSA 5ERXA 1UKEA 1WCYA 3T1OA 3HU3A 1QQ5A 1SR8A 2LV8A 3GLHA 3H2SA 4BIIA 3QVSA 3SFVA 3FYUB 4MVCA 1R5OA 2O5RA 3CN7A 3OBIA 1AX9A 5FO1A 3UAOA 4OOEA 3QRWA 1QH1A 1U3FA 3BH6A 3FXAA 2YBEA 3BYZA 4H6XA 3V1UA 4BLQA 4EQZA 5CBKA 1C0IA 3W3AD 1HLGA 4FC6A 3LYHA 1N5KA 2OZLB 3H97A 3K09C 5EL0A 5I7SA 5CAEA 3RD5A 1C1HA 2XYGA 3ZE6A 1M2EA 3D0OA 1S3GA 4ZKDA 5IG2A 3DZGA 3QSYA 1DOZA 1WA5A 2D0IA 2GJSA 3BS4A 1BCRB 1DRJA 1KFEB 1T0JB 4TTPA 4V39A 1XALA 4MQEA 5HCIA 4A1FA 2O0LA 2O2ZA 4JP2A 2QI9F 5F73A 5C4GB 1NF9A 1O3YA 1KC3A 5EJ2A 3H75A 4C4PA 3ISTA 1H5UA 1RWKA 2O7SA 2QNIA 4QNRA 3L6EA 3C3BA 4WINA 1IXYA 3R5FA 3DOFA 4AUNA 2BDEA 2HU8A 3AW8A 3JQBA 3K1JA 4TLCA 3SXJA 4RHUA 1CY7A 1XLTC 1NUQA 3KKMA 1ISRA 3HCPA 5BWMA 3OZFA 1M10A 1ZJJA 3LC0A 4P0PB 5JFTA 1XL0A 7REQA 3GCGA 3M3PA 2FCRA 3F4KA 5EMKA 5SICE 4BCDA 1QLHA 4RLQA 3T4PA 3FTEA 3DHEA 2SKEA 2XT9A 2OE2A 4NXMB 5IBQA 4D4GA 2M32A 4HGPA 1U3VA 2J9XB 1KR5A 3CIFA 5JCOC 3TCKA 4BKQA 1CUUA 1KZ1A 3RODA 4G0ZA 1ODIA 2AA3A 2VK2A 5HE9A 1EVIA 4DEYA 1Q3TA 3WAJA 4JI1B 3EXHC 3JPWA 3JX9A 4F91B 2N1BA 3A1TA 4U39A 4H7EA 4CIAA 1AF7A 2PGLA 3A9SA 4F2HA 4XIYA 1QP0A 4ZJPA 4MV9A 2HCJB 5M29A 1EFDN 1HFEL 3OU6A 5BUZA 1QG0A 5FPQA 3O4IA 2L0XA 1M2KA 1XF1A 3FWZA 3K0BA 3LXMA 3B7GA 1UDAA 4HN4B 1ODKA 4L02A 5ITZA 1FFCA 4JAVC 2E4AA 4X64B 4U2GA 4RPGA 4BAZA 1MAUA 2GH1A 4UOEA 3TBFA 1JFTA 1AGYA 4ON9A 1YS2X 1FIUA 3CU5A 1Q22A 1TF5A 2VQ6A 2PBLA 1RPZA 1QV6A 4MI6A 2A78A 2IU6A 1GZHB 4QG3A 3I61A 4NAUA 1SURA 4HX5A 3H2ZA 4FDVA 1T3SA 4XIFA 2VPPA 4CCWA 2DFNA 3AGPA 1Z6AA 3E5NA 2FW0A 5TXGA 4D9KA 3ZHTA 4KGZA 1Y1PA 1A8UA 2X40A 3BEOA 2J0UA 3TL6A 4XUDA 1RI2A 3W78A 5SV2A 3QNUA 4YCCA 1GNSA 3W79A 1TJYA 2JCGA 2X7XA 3DAOA 2GPSA 3DDZX 4ZZ2A 3NYIA 5A3RA 5BW4A 2XEXA 2FR8C 3AY3A 3INRA 3E23A 1NVUQ 2FUG1 1IL0A 3H42B 3KJZA 2AZXA 4QQ8A 4MQ4A 3EH1A 1AKQA 1IY2A 5ED4A 1BW9A 4P93A 4PC1A 3G68A 4RX1A 1GGJA 2ZJZA 4HS9A 1CJCA 4MQUA 3D9QX 4AZVA 2V7PA 5HKBA 3S6JA 5F77A 4KN5A 2A9FA 1KJIA 2TMDA 3L2OB 4TYPA 4DNFA 2EWMA 4G0UA 1W5FA 3D6TB 1J9ZA 2YVQA 4L0DA 1YQDA 3SG0A 3VOSA 3HKBB 3DGFC 2RGRA 2X6RA 3AIIA 2QP9X 4RJJA 2UUOA 1J7KA 4DDVA 2X9GA 3PLAE 3AY7A 2GZDA 3IV9A 4QA9A 2OB1A 2IGBA 4BNMA 3K70D 3GLTA 4L5CA 1IAVA 2Y1FA 4LYEA 1QQBA 2C59A 3B6ZA 4ZGBA 4RBNA 2PRKA 1F8YA 3SZOA 2EGUA 4LPKA 2CF6A 2MTBA 1Z4LA 1WQ4A 2PQ6A 2XTNA 1POWA 3PKIA 4LZPA 4WOBA 5J1TB 3TO5A 2BYTA 2VZ0A 3Q8WA 3WTBA 4OIMA 3BORA 3IUSA 4CUJA 1JA9A 1T0IA 5E95A 2P6RA 1B4DA 4DMMA 1YACA 1SHZA 1NUAA 3K9QO 4PYJA 5JAOA 2Z2ZA 4YI5A 5DLYA 1DPGA 3NT4A 4HATA 4G0NA 1UT5A 2PUAA 1YQTA 2XNDD 1AA9A 4QXPA 5IC6A 3I34X 3AI2A 5BT8A 4Y1EA 5IM5A 1N77A 2R7NA 3QVLA 2G08A 2JDID 2IK8A 4FYMA 3FMOB 1E32A 3N5CA 3KQSA 1LTKA 3NASA 3KJXA 4KXQA 1XDZA 1CS0A 2WWWA 1XL1A 2ECQA 3NHJA 1TL7C 1VXOA 3DKVA 2QU7A 3EVEA 3I4LA 2IYLD 3GVIA 3OA0A 4UREA 1P0MA 4S1VA 2AQIA 4UNIA 1WBBA 4IHQA 1AVTA 4YACA 2PMDA 2Y2UA 2HRZA 2XNJA 3FBGA 3OT5A 2C7QA 2JRCA 1OUMA 1EFPA 2K2WA 1IY0A 1EXWA 1AT1A 3VZBA 3OIWA 3WXBA 2E5WA 4NLLA 1CEYA 4CZ2A 4EELA 2X77A 1AHHA 1QVAA 1X7WA 2ZJ8A 3IDOA 3ZIAA 1DXYA 3AESA 3F2IA 3JW8A 2MT9A 2I4TA 3FVRA 3L01A 3EXAA 4MUHA 1DKUA 3HE3A 4R1SA 2BFWA 2A0WA 3NEPX 5JHHB 4UBIA 1WHTA 3BMCB 2DUNA 2QD4A 3KXLA 3V46A 4N8SA 4MCJA 1OLXB 2KB0A 3G89A 1LNZA 1NOKA 1ORVA 2NVBA 3DEHA 1ZH4A 3DMTA 4HI0E 1T91A 2PLWA 1A9QA 3B3JA 4C4AA 3ONNA 5ER6A 5A71A 3UVEA 2JI4A 1W96A 2XQFA 4B6SA 4DLUA 3U3MA 5ILGA 2FSPA 4L7VA 3HH8A 5EYPA 2I2CA 3X43A 1KDZA 2W7TA 2JFHA 3QBEA 1GQFA 5K6AA 3U26A 1NW4A 2QK4A 4JA0A 3U6KA 2VYFA 1O97D 3A2KA 2V45A 2FX3A 3AFNA 6ABPA 4E5NA 4RD1A 4UARA 4I1VA 3DBHB 4CM4B 1FOEB 2EFDB 5AW6A 4JV5B 2WNSA 2OM2A 2YHSA 2OO3A 3O4VA 3H04A 4JQOA 1FMCA 4LGMA 4QODA 4R6WA 3SHFA 3PA8A 2YW2A 1N2ZA 5KYKA 1YKGA 1LPBB 4I5FA 4BFVA 2QJTA 1W4AA 3KZXA 4EAQA 2I7TA 3HS3A 1WHSA 3E48A 3GJ3A 1E98A 4ND8B 1WU7A 4O2RA 3DZJA 1JIIA 3QSGA 4OQQA 3JU3A 1BZYA 1FMLA 2ABWA 3DGEC 5ALOA 3BWEA 3GGJA 1HQCA 1C0EA 1C29B 3V1LA 4GD3Q 4P3NA 2W6OA 5HF9A 1T43A 2NT4A 2VJMA 4MRMB 3VYUB 4E2ZA 3GK3A 1IY1A 5FPTA 2ZYGA 4IJVA 1G17A 1OVGA 2WZQA 4HY3A 3BUSA 3LOUA 4IOJA 1GGNA 3U48A 2XVYA 5L6MB 3T0IA 2JAWA 3PNMA 1IMOA 3HDTA 3MQ4A 1R3DA 3PWZA 4BO6A 4DVJA 1YBHA 3L8GA 4R1PA 1XJQA 1N2EA 5TMEA 1DQYA 1E3WA 3MCWA 4JOCA 1HNWB 1P0QA 2EBUA 4EGSA 1ND6A 2JJ2A 2O0MA 2XKJE 3JRXA 3LKZA 3HZZA 5JUWA 1J25A 1K9VF 1UXKA 3RG8A 4MKRA 4DC0A 4FB4A 1U8TA 1U9IC 1FDVA 3IMKA 4DA0A 3MWFA 2WFLB 1VSBA 3LBNA 2VDWA 1IHPA 2IPLA 3NALA 1SCUB 4WOKA 1WTCA 2VKTA 4IXDA 5FNVA 4N7JA 4HTFB 1P2BA 4BO9A 4KO1S 1P9NA 4CLHA 4M53A 5CH8A 4YQFA 1EUYA 2Y2VA 2QW0X 4UASA 2H1CA 2SKDA 1WDWB 2WZDA 1WF3A 3X1KA 2PL1A 2RGXA 1B0PA 2VIIA 1UH5A 2IEYA 4L9WA 5B4UA 5L4SA 1TQDA 3BGDA 2UDPA 2JFVA 1VJCA 3MBOA 3OTIA 3W7BA 5LMZA 4CV2A 1XO1A 2FPUA 2AFHE 3F6RA 1V8DA 1KI6A 2P6OA 2ZQYA 1KP2A 3STXA 2AMYA 3GP5A 2BRUA 1HX7A 2G9RA 2ZAIA 1OGIA 3RE1A 4QUGA 3A1CA 1YZYA 4HQLA 3V8NA 2VI5A 1I3MA 1LBTA 3BPSA 4NJOA 2J5KA 4PR0A 4Z9YA 2SHKA 5K3SA 2Q7XA 5KVQA 2EJVA 2PS9A 3NHKA 4M9CA 1QKKA 2QD1A 4RLSA 2B8EA 2FEPA 2NO4A 4I1RA 4IL5A 5EHZA 5KYVA 1VFNA 4JLOA 1K6JA 2ILVA 3K70B 1XDDA 1AHPA 4XCXA 3RVBA 3TDMA 3TQHA 2ZYRA 4YLEA 3RLIA 4B3BA 1H3EA 2OC9A 4RK0A 5JBIA 4YRIA 3BRSA 2VTKA 1E59A 3TTVA 1KKMA 3QVOA 5EHNA 1AKVA 1L4FA 4NESA 2BEVB 5HF8A 3AVTA 2R8BA 1NVBA 2P3OA 4Y7DA 4UHJA 2ODPA 1AKWA 1YB1A 4PLFA 3KKPA 4S0ZA 1KOLA 4G4JA 5HKAA 3C8DA 2VK1A 3I5UA 2HRDA 2OLKA 3AEUA 1SCIA 3AUTA 4M3NA 2OFFA 2BM0A 3RYTC 1ZOLA 1PV2A 4RM3A 3WK5A 1UBEA 2G76A 4YMTA 5IH7A 5KHOC 3K73O 1NKTA 1X1TA 4MKIA 1JFVA 1JU4A 3L7LA 3D4BA 3LDGA 4L3WA 4XYEA 3FKSA 2CVOA 4PZPA 3EMDA 3H9CA 4WH0A 4AJNA 2PAFA 2IZZA 3J7AC 1GZ4A 1PGQA 2A9QA 2F90A 3CWQA 3BK2A 4TS4A 5EQJB 5G1OA 1F7VA 3AVWA 4AM8A 4DBZA 2Q0QA 2X8JB 3BCSA 2DHEA 1L5ZA 2GWRA 3KHKA 3ZDFA 2WABA 2M6RA 1KP3A 4J94A 2IF0A 5CXUA 3DXXA 4D81A 1KI9A 4IO0A 5EKTA 3U39A 1YBFA 4UVIA 5A3SA 1PZGA 4R0NA 2RAVA 2B3TA 5HWSA 3JASA 5HRCA 1JWLA 1TRKA 4F9FA 1Y8QB 1FZTA 4FFOA 1YCFA 2ORED 5FOWA 1FQJA 4Y1FA 3RAPR 3K0FB 4L6CA 3NGXA 1D09A 1EU1A 3U7EB 1OH5A 1EB9A 1TA9A 1KS2A 2OQ2A 3NWOA 2F3RA 3G59A 3G5TA 1LQTA 3W90A 3AFHA 4BNTA 1R8YA 4M6WB 1D9ZA 2PMFA 2ZE5A 1X77A 3O83A 3RWMB 2PVPA 1ZCJA 2EFGA 3ICCA 5FCDA 2XIQA 1B6RA 1IYZA 1TK3A 2YMPA 5AKEA 3QKIA 2VR1A 3V1KA 1U1EA 2TYSB 4LOKA 4QQKA 4N03A 5F23A 1ZMBA 2IYFA 1D6SA 3MB5A 3T1TA 1KYIA 3EVTA 2NXWA 2QLTA 3LKDA 4RV5A 4X97A 2NTYC 5IAKA 3TMAA 1TMYA 1J24A 3TUIC 3OIDA 5DNEA 4DLWA 3R7AA 5PGMA 1YR3A 3ITEA 4Q3CA 4YT5A 3TNDA 1YZHA 4YRPA 1TLLA 3ZHCA 1FVHA 2MR6A 4YI3A 3STUA 4YRNA 4L9RA 5AVOA 2PS1A 1ZM4A 2CUTA 3ZX4A 3ZVNA 2WFZA 2A1TS 1KGDA 4Q7KA 3I39X 3DS8A 2F00A 3KD3A 3S68A 3V5NA 4W9MC 3UC5A 4D99A 1EJ6A 2O54A 2FZ5A 4H31A 4B4UA 1V71A 2GXUA 1H2EA 4JHLA 2CXHA 3UB3A 4MUNA 4N0MA 1ZK4A 2QRVA 3GCWA 1U3TA 3K0CA 4Y6QA 4W8HA 3VPBA 3V34A 1UKYA 3VUFA 1J49A 4CFZA 1Z07A 1HL7A 1USVA 3PPIA 5IVIA 1LBSA 3PCRB 2HJGA 3LQRA 3M5DA 2OESA 2JNWA 5IS2A 3G5AA 1YO6A 5CDYA 3CLUC 1JMKC 3SEAA 1E4EA 5CNKA 2G40A 4X94A 1RFGE 1QRTA 5KQGA 1GNVA 2EFJA 3VH3A 3F3SA 4YAIA 2IBSA 4ETNA 1U2EA 1AKYA 3MELA 2XGMA 3H5LA 3JD0A 1OH8A 1GCOA 4NFHA 3WQSB 1OSNA 1Z3IX 3PENA 4NG5A