3JW8A

Crystal structure of human mono-glyceride lipase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
290
structure length
290
Chain Sequence
SPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for human monoglyceride lipase inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords MGLL protein
total genus 99
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3jw8A00
1W52X 2V97A 1LBTA 1L7AA 4KEAA 2WG1A 4G5XA 4ZWNA 3KOOA 2XUJA 4I19A 5AH0A 1YB6A 1F8UA 1QO7A 1JT2A 4X71A 4Q34A 4ARBA 1ZD4A 4U2GA 1Q0RA 5HCUA 1QZ3A 3AFIA 4EBBA 3OG9A 1DWQA 2OAGA 4DTCA 1CIJA 4KACA 1M33A 2HDWA 2J4FA 3TGLA 2XMSA 4IH9A 3ESCA 4AN0A 3NWOA 3E0XA 2WTMA 2HIHA 4FDMA 5ESRA 1XQYA 4P92A 4AO8A 4EA6A 2Z8XA 1LPNA 3C5VA 1ZJ5A 5ALKA 3STVA 4GBGA 1ZOIA 3H17A 3F9CA 5AKLA 5D3ZA 2JEYA 3A6ZA 1J2EA 4RE5A 4MJ3A 3KXPA 1TCAA 1QIEA 2XMZA 1E3QA 4RE6A 4RPCA 3U0VA 1YCDA 1XZIA 1AC5A 1BRTA 2C4HA 1VKHA 1VZ3A 2WUDA 5D3KA 3PFCA 1ZGCA 1LGYA 3G0CA 2H1IA 5EFZA 4DMHA 4MQLA 3G7NA 1CVLA 1P0IA 2Y6UA 1VLQA 4W63A 1E89A 2OCLA 5ALOA 1EX9A 2VTVA 1XZBA 2QUAA 5J3JA 2GBFA 2Q0XA 4L9AA 5C8VA 3L1IA 2QRUA 1WM1A 3G9TA 5JASA 5CURA 4JH0A 1GPKA 1QE3A 3BIWA 4MWTA 3I6ZA 4IHAA 1RWQA 3R41A 1XRQA 3HI4A 4WFKA 1XZLA 3D4LA 1H23A 1CLEA 4LYEA 5FPQA 4IQ4A 4JEIA 1C7IA 1YA4A 1X2EA 1CUJA 5JARA 5KWJA 4G8BA 4WFIA 1HQDA 4G1FA 3WKDA 1FSSA 1GPNA 3I2KA 1UOPA 3N0TA 2P8SA 3FVTA 3FSGA 4C4ZA 2WHRA 2OCIA 2RHTA 1LBSA 3OM8A 1HLGA 5AKIA 3HLKA 1P0MA 4OUKX 2QXUA 4OSEA 5IVDA 2XE4A 5CT5A 3V1NA 4ROTA 5HFAA 4W1SA 2WTNA 3D2BA 1LZKA 5A6VA 3FVRA 4HXGA 1HKHA 1YASA 4C4XA 2Y6VA 2WHPA 4X94A 4WJLA 3RK4A 5T4EA 5ALFA 1G66A 1CUCA 3L1HA 1U2EA 1QIHA 3D59A 2NW6A 3DEAA 4UBJA 5HF6A 2PPLA 3H2KA 5JD4A 3QZUA 4X97A 3BIXA 5CT4A 2ONCA 5CXXA 4BP8A 3DL7A 3K2IA 4OYLA 2WLSA 2JGLA 3R0VA 3DNMA 5YASA 4DNFA 4FNMA 4BB0A 5E4JA 4JNCA 2DHDA 3AUKA 1CRLA 4KR0A 4GECA 1E8NA 5DTIA 2WFLB 3WWPA 4BYMA 2HA7A 5ALHA 3IUMA 1LPSA 3I6MA 4UHFA 2DFPA 2XUDA 3WIBA 1DINA 4H18A 1IZ7A 4FMPA 2PU5A 2QZPA 5EIEA 5ALPA 5AM1A 3EQ8A 2X5XA 3R3YA 5I9IA 3DDUA 2R8BA 4KRYA 4QE3A 1VA4A 4FNGA 1YB7A 3HRHA 4K6GA 4EHBA 3YASA 4F21A 2XUIA 5AKJA 2DR0A 1N5MA 4G4IA 3F97A 4H7KA 4B0OA 3BWXA 4B84A 3PDCA 2VQ6A 3WKBA 3AZOA 1HDEA 3MGAA 1FJ2A 2B9VA 1XZAA 1E8MA 4GXNA 2DSNA 3AINA 1AURA 4EUSA 1MT3A 5BOVA 2XT0A 3FNBA 4RGYA 1AMNA 1EXWA 3RM3A 5JADA 4BVKA 4HVTA 3GA7A 1K8QA 1I6WA 4Q1VA 2D0DA 3EF3A 4FTWA 1EDEA 4EY8A 4N8EA 3SK0A 2OXEA 4HTAA 4BC0A 4FWBA 3DLTA 1CUYA 4GW3A 4OB6A 5FLKA 3EQ7A 2VSQA 3WKCA 5JZSA 3GZJA 4H7JA 3WK9A 1G5FA 1YAJA 4Q82A 2HL6A 4KE6A 4Q05A 5DTJA 3W06A 2WIDA 3OTQA 4CFSA 4FLEA 3ED1A 6YASA 2EDCA 5T4HA 1UOQA 3G02A 1ODSA 3FCXA 5ALXA 1MJ5A 1XLUA 4ZRDA 2AJ8A 2LIPA 5K3FB 5K3AA 1ZICA 5IVHA 3ZPXA 2PM8A 2JIDA 3BE8A 2C58A 2C5GA 4WDRA 1Y7HA 4OU4A 3C6XA 1QONA 3QPAA 3FOBA 4BBZA 4UPDA 4X90A 4OYYA 3WK5A 3AIOA 3CN7A 1HPLA 3TJMA 4WFJA 5EIHA 3STUA 4H7EA 1XRMA 3H2JA 3ANTA 5HQ3B 2XUPA 3KWFA 4U2BA 3FYUB 3IIIA 5DJ5A 5JD5A 4X6YA 1U65A 2XQKA 1PJAA 1E5TA 2GBCA 4E14A 1AKNA 1VOTA 2O7RA 5AK3A 3P2MA 1SC9A 3D7RA 4N5IX 4PSUA 3BF8A 2I3ZA 5ALZA 4QDXA 2HU8A 4G8CA 4BTLA 1TCBA 4U2DA 5EHXA 3WK7A 3V1MA 5I8PA 2EEPA 2W22A 4DMFA 2XQJA 1MAHA 2RHWA 1K4YA 5K3CA 1NX9A 2XQIA 4XX1A 1ZD2P 3E3AA 4PSCA 5EHNA 2VF2A 3OOSA 3K6KA 5JD6A 2PSDA 4NS4A 1B6GA 3IUJA 5DYWA 4UBLA 4FBMA 2WJ6A 4H35A 4UHCA 5DNUA 2B61A 3D3NA 3LCRA 2ZVDA 3R3UA 5AM2A 3BJMA 4QLAA 1H2XA 1QGED 4PNZA 1WPXA 3H19A 1K5PA 4EY6A 5LYYA 2QJRA 1EHYA 5AOAA 3IUQA 5T4BA 4E46A 4KE7A 4QWWA 3HSSA 1X2BA 4JYPA 2BKLA 5C8XA 1PFQA 3DCNA 1HBJA 5DYTA 3C87A 2FJPA 1VXRA 5AM4A 4OPMA 1BCRA 1W6RA 2BGRA 1C7JA 1R3DA 4X00A 5K3DA 4TGLA 1OXMA 4CIAA 3GROA 2OPHA 4Y2XA 4Y2TA 1L7RA 1CUZA 1EI9A 2QOEA 3FLEA 4MQMA 3SX4A 4B0PA 3IB3A 3ZLUA 1RYYA 2BFNA 4YX9A 3M3DA 2C0PA 1LPAB 4BZWA 1GZ7A 1YS2X 3NGMA 1GQSA 2BUBA 4UUQA 1BN6A 4QDUA 5FRDA 1Q83A 3R3WA 4DIUA 1AUOA 4INZA 4UHEA 4UBMA 1EB8A 3JWEA 1DU4A 5E4TA 1YAHA 4QWMA 3W9UA 3ZLVA 4KYVA 1ACJA 1YR2A 4I3FA 4QZVA 1FFBA 1CUDA 5AI0A 1IUOA 1QFMA 5SYMA 5K3EA 1DWOA 2I78A 2I03A 3E1GA 1JMKC 3WK4A 4BAZA 1TK3A 5ALIA 3F67A 1N8SA 1J1IA 4WY5A 1EINA 2EDAA 5ALMA 4OB7A 4XIIA 1ISPA 1R88A 1CUEA 4KRXA 1TAHA 1TIBA 3W04A 2GBIA 1DX4A 2JGFA 5CBKA 4FKBA 1QJ4A 2O7VA 4BRSA 3O95A 5HF8A 3WYDA 2QVBA 1E8DA 3I1IA 4ITVA 4FBLA 4B9EA 1GT6A 1GKKA 3W05A 4N8DA 4J0DA 1ETHA 5HKBA 5ISMA 3PE6A 2PSHA 1ZIXA 5CRIA 4AZ0A 2ZYRA 2XDWA 1VE6A 3O4HA 5CT6A 4A23A 1DT3A 5IKXA 1XRPA 1AQLA 2Z5GA 3B5EA 3VDXA 1ODTC 1CUFA 4ARAA 2QM0A 3QYJA 5SYNA 3HXKA 2JGMA 2Z3ZA 3EBLA 1THTA 2OQIA 3QMVA 5AIAA 1EVQA 4F60A 1S8OA 3UUEA 4L3WA 4W9RA 1XLWA 3MUOA 3F8SA 5AI9A 1QIFA 5A71A 2PUJA 2HADA 1R4ZA 3IA2A 1ORVA 4MEAA 5KBYA 5AIBA 4Y2UA 1EVEA 2IITA 4CCYB 3H2HA 5AK6A 3N2ZB 2ZJ7A 1L7QA 3UUFA 5LKAA 5F4ZA 3I6YA 3WL6A 4DMKA 2AJDA 2ES4A 1FFEA 4J0HA 2VEOA 4XJVA 4JYMA 4U2EA 4X7BA 1XRLA 2WUFA 3ANSA 5AI8A 2H7XA 4LKOA 2GYWA 1BEEA 5K3BA 1MN6A 3O0DA 1G42A 1GXSA 2G4LA 5JANA 1ZI8A 3LP5A 5ALJA 1ZD3A 2WIKA 4DNOA 2XUAA 3DYVA 2R11A 5AKHA 4CG2A 2ORYA 3ESDA 4J0KA 3I2IA 3FYUC 2WHQA 4K2AA 1UXOA 2Y2UA 3X3HA 3GUUA 4QDZA 5AICA 4BP9A 3FSGD 4U2CA 2BGNA 4X85A 1CPYA 5HK8A 1LPOA 1Y7IA 1USWA 2ZSIA 1XZHA 3QMMA 5AJHA 2VJCA 1WHSA 5DYYA 3CCCA 1UWCA 1QIIA 2XMQA 2WUEA 4K6HA 1CQZA 1JJIA 2JGEA 2QTBA 4C4YA 2PU7A 4DYHA 4X6UA 1LPMA 1E66A 1BS9A 2YYSA 5ALUA 2VA9A 4QDOA 2AJCA 4Y2VA 4Z49A 4Y9SA 4ZI5A 1GGVA 2RONA 4BCDA 3QBJA 1EK1A 1GPLA 4M0MA 1T2NA 3WZLA 1CUBA 1SCQA 3ICWA 2WIJA 5CW2A 4ZV7A 3HABA 4ZV9A 1MU0A 4XWGA 3I28A 1OCEA 2WKWA 5FPPA 4Y2RA 4Q3OA 3SC2A 1CUVA 3VJMA 1XZGA 2VAVA 1T4MA 4J03A 3AIKA 1H22A 4PF1A 1CQWA 1H2WA 1ODCA 5AM5A 3H2IA 4L72A 3E4DA 1LNSA 4C89A 3IVMA 5T4FA 3JW8A 2XLBA 4OB8A 3BXPA 5LZ4A 2GYUA 3M81A 1A7UA 2VT6A 1DT5A 1VZ2A 5H3HA 2FX5A 4J3JA 5FUMA 1SCKA 5K3FA 5ALDA 3WIOA 4BRZA 5IH7A 3KSRA 1UKAA 3HYSA 1ZJ4A 4N8SA 4PSDA 1O6GA 5AKGA 4B82A 3C5WP 1QOZA 3C8DA 2H7CA 4ETWA 1NU8A 2ACKA 4C87A 1WCYA 5A7HA 5LP1A 5FXMA 2XI4A 5DNWA 3A70A 3WMRA 1B41A 5ALRA 3DL4A 3G0IA 5ALNA 3EQ9A 1A8UA 1GKLA 3PICA 3GFFA 4OU5A 4E15A 4CCWA 1BEZA 1MO2A 3FWHA 3VJLA 4DMCA 3R3VA 2HRRA 1R50A 3T52A 1ZGBA 1NU6A 1BU8A 1EA5A 2CUTA 4X95A 4UBOA 3ZLTA 1IVYA 2WUGA 1BROA 2VATA 2RGUA 4B7ZA 2BCEA 4V2IA 4AO7A 1W76A 4P93A 3T4UA 4HZGA 4HAIA 1XQWA 3C43A 3QVMA 1CUUA 5AOBA 5E4YA 2X76A 3WJ2A 3STWA 3IURA 2XUGA 2K2QB 5CXUA 1WB6A 2WG0A 3SWWA 5ALGA 1G4HA 4B81A 4GI1A 3ZWQA 1JI3A 3G0BA 1QIDA 4UFPA 3FLBA 2CEKA 3QITA 4XVCA 4PO3X 5HK9A 3I2GA 2JEZA 3H1BA 3EIOA 2HA6A 2GZRA 2PUHA 3C45A 3V48A 1QTIA 3O9MA 5FOQA 3O4JA 3AJAA 3BL8A 1UFOA 2QS9A 2J3QA 5FKJA 3LIPA 4UHBA 4AQDA 1J07A 2WIGA 2G5TA 1SCIA 2JGIA 4BAGA 5ALYA 4HS9A 1BE0A 1MX5A 2HM7A 4FLFA 4B83A 3OPMA 4QEKA 1EB9A 1QFSA 4W1RA 5CT9A 1ZD5A 1XLVA 4GEGA 2XUKA 3FAKA 3R3XA 5LZ8A 5LZ7A 4LXIA 1VJ5A 3DOIA 2CMFA 3WA6A 4UBIA 3FLAA 2DHCA 2VAXA 2XLCA 4ZGBA 1CUAA 2ZYIA 2XUOA 2DQYA 5C7YA 4PW0A 1QIJA 4BCCA 4E11A 3HC7A 3RARA 3K9BA 5AKEA 4A16A 1VXOA 4AMYA 4C01A 3VKFA 5EHZA 3B12A 1CV2A 2JF0A 3HACA 3G8YA 4NVRA 3IBTA 3FCYA 1UK6A 4LHEA 1UKBA 1VA5A 2O2HA 2DQZA 3JYHA 2B4KA 2V9ZA 4DLNA 1LPPA 1MNQA 3I2JA 5ALLA 3VISA 4AO6A 4F5ZA 4GLBA 5HF5A 4FFVA 3C6YA 1MAAA 3G0GA 2G63A 2HA0A 3DS8A 4F0JA 1QTRA 1UKCA 3Q8WA 3I1YA 1F6WA 3WZMA 2OAEA 3WWCA 5AK5A 3PFBA 4BDTA 1AX9A 1UK8A 5IVIA 1K63A 1R9NA 3R3ZA 2CKMA 4PQEA 2PSJA 3RKSA 4W1QA 2WILA 1IMJA 3STXA 4X91A 2X8BA 4G4GA 2HU7A 4G9EA 3VVLA 4GDMA 5HZGA 5AO9A 4P08A 4DM7A 3H0CA 4J7AA 4CG1A 3WA7A 4HRXA 2XB6A 3PUHA 2WHPB 1ZI9A 3OURA 5JIBA 4KJXA 3DD5A 4CG3A 1WB5A 4YPVA 2JGKA 4MYDA 1VE7A 1XQXA 5FP0A 4J0GA 3A2MA 1KU6A 3S8YA 5AKXA 2G5PA 2VJDA 1MX1A 4B6GA 2VT7A 3TRDA 4TPKA 5BWCA 2AXEA 5ALEA 1WOMA 3PF8A 3IULA 4EY5A 5CH8A 2OLEA 4IH4A 5ALQA 3DYIA 2OCGA 2RAUA 2Z3WA 3DKRA 4LXHA 2QKYA 1EDDA 2UZ0A 4EY7A 5JAHA 3TEJA 4HXFB 4K5QA 1BN7A 2V98A 1MX9A 2PSEA 4BDSA 2XMBA 4BVLA 1YSCA 3FYTA 5ALSA 4UFOA 3KDAA 1A8SA 5C8ZA 4IH1A 5HF9A 4BATA 5LIPA 3H2GA 3WLAA 2OG1A 4UHHA 4O08A 3IUNA 2Y2VA 1P0PA 4C88A 1TRHA 5AKZA 2BUAA 3B3QA 4D9JA 5BWBA 5A62A 3BDVA 4DSZA 4J0JA 3LLCA 4IO0A 1WPRA 5AHXA 5JZ9A 4BCBA 1KU0A 1XZJA 4X3CA 1O6FA 4X93A 1ZI6A 4H0CA 2AJLI 4MEBA 2DHEA 3WYNA 2W6CX 2ZJFA 2Z8ZA 5BV7A 2HHAA 2PL5A 4EB0A 1DWPA 2QT9A 1XRRA 3QPCA 3GELA 2OGTA 4YK7A 2CB9A 1F0PA 3DOHA 2PSFA 4AB1A 1FFDA 2XMCA 4EY4A 2YASA 3HEAA 5HFNA 1UZAA 2VJAA 4M0EA 5KREA 5EIAA 2YH2A 4NMWA 4KAFA 1Q0ZA 4CCYA 2ACEA 2XMDA 2ZYHA 4W1PA 4HRYA 5D6OA 1JJFA 3DQZA 3KD2A 4J0CA 3ZI7A 3OC0A 5LZ9A 1XZFA 1XZMA 3O4IA 2QUBA 2Y1KA 2JGJA 1JJBA 2HA3A 2WFMA 2H7YA 2O2IA 5I7UA 5CT8A 3A2LA 2PBLA 2XUHA 4L0CA 3NUZA 2OGZA 3H04A 3STTA 1FFAA 1CUIA 3D5EA 3AIMA 1EDBA 4LIPD 4Q3LA 5FDFA 3D0KA 2DCMA 3V1KA 2YXPX 1X70A 5EHQA 1ACLA 3WL8A 5AM3A 1JU4A 1U8EA 2XMGA 4WCVA 3DJYA 5AOCA 5LKRA 4EZIA 4Y7DA 2O2GA 5CH3A 3QM1A 1QIMA 2B20A 5D7BA 3WKAA 2J4CA 4CI9A 4QLOA 4DNQA 2RIPA 5JAOA 4A5SA 1Q84A 1Y37A 3ESBA 2IIVA 3DKKA 1QLWA 3RLIA 2HA4A 5IVKA 4Q3KA 1ORWA 1H2ZA 1TKRA 1LLFA 3C70A 4BZZA 2WM2A 1P0QA 2C5FA 5AKKA 4AX4A 3FYUA 2J3DA 4UBKA 2GYVA 5HQ3A 3O9VA 5CH5A 3R40A 1K6EA 4JUIA 4X6XA 4C6HA 4Y2YA 1CUGA 1WB4A 4B80A 4OCZA 5CMLA 3WWOA 3ILSA 5AKYA 3LS2A 4Y2QA 5LLSA 4WY8A 2XMRA 2GBGA 5ALWA 4B85A 1AZWA 2QXTA 1IUPA 2WSLA 3G9UA 2WU3A 2WJ4A 2RI6A 3HJUA 1XQVA 1SOMA 4MYSA 4H7FA 3ESAA 4UHDA 4HXEB 3W9BA 1W75A 4P9NA 1XKLA 2CBGA 3C6BA 3PUIA 2BAGA 3FBWA 3WQHA 3A2NA 1PV1A 1CUXA 5AI5A 1W4LA 4H7IA 2GZSA 1KEZA 2HA2A 3M83A 3S2ZA 2CZQA 4UBNA 3H1AA 1H2YA 3NOXA 4KE9A 5EGNA 2WFZA 4UFNA 3QMWA 4U2FA 1IUNA 5EI5A 4KE8A 3STYA 1DQZA 3F96A 1A8QA 1EH5A 1OILA 2C7BA 1CUHA 4I4CA 4LYDA 4ZREA 2JBWA 1F0NA 3VVMA 3H18A 3V1LA 2PX6A 5FV4A 1C4XA 1BCSA 3AILA 3QH4A 5JYCA 3WWEA 1XRNA 1RP1A 1SFRA 3VXKA 1TQHA 2CJPA 3AZPA 2IX9A 5E2IA 3I2FA 4AMZA 4AN1A 3D2AA 3CCBA 3V9AA 2WU4A 2HRQA 3C6ZA 4BAUA 3AZQA 3ICVA 5DNVA 1EK2A 3WJ1A 2H9YA 2WQZA 1ZIYA 1CFJA 7YASA 1YS1X 2WJ3A 2OQVA 5ALTA 4DNPA 4GHWA 4H77A 5AP9A 4YASA 1XZEA 2BUCA 3WWDA 4BVJA 1GQRA 3L1JA 4BE4A 3WKEA 2I3DA 1IZ8A 4GWLA 1XZDA 5JZBA 1XROA 1JMYA 1HL7A 2V96A 3F98A 1MTZA 1DX6A 5A2GA 3D2CA 2ECFA 4X92A 4K6KA 4LXGA 4KAAA 5CTAA 1TCCA 5ALVA 4J0IA 1A88A 1THGA 1R1DA 4FLMA 4FOLA 2ZJ6A 4MWSA 1R9MA 4KAJA 1Z68A 4QNNA 2PVSA 1DTEA 4DGQA 1MPXA 2WG2A 3WL7A 1YA8A 4BTVA 3G9XA 3BDIA 2QMQA 4QA9A 2FJ0A 4H7DA 5DLPA 4RNCA 4FHZA 3Q0TA 5JAUA 4TVKA 5AK4A 4PV7A 1U4NA 4AZ3A 1QIGA 4Y2SA 2OGSA 5K5EA 1JU3A 5HKAA 1CUWA 5JATA 1CEXA 2OCKA 3G0DA 3BJRA 3MUNA 3M82A 1J06A 5LZ5A 4Y2PA 4N5HX 1XZCA 1N1MA 3CXUA 2FUKA 2E3JA 1QO9A 4BC1A 1N5RA 4NZZA 4G8DA 2PKYX 1LPBB 4CIBA 1QIKA 4MXDA 3O4GA 4G4JA 2C0QA 1UK9A 3UMJA 1XFDA 5AI4A 4H7HA 2ZSHA 2HFKA 2BJHA 4BE9A 1JKMA 1W1IA 1XKTA 4B9AA 2XQFA 4DSAA 5JALA 1D07A 1FFCA 5AI6A 2VJBA 2WIFA 3WK8A 2HU5A 3CN9A 2QJWA 1WHTA 3KWJA 3PI6A 1AGYA 5AM0A 3BF7A 3PF9A 2XUFA 4AXBA 4ZXFA 1MNAA 4FFWA 3WL5A 2HFJA 4G9GA 4OD0A 3C8HA 2D5LA 3HZOA 2XQGA 3W2TA 5C81A 4WDQA 5JAPA 3VJKA 3QPDA 5A7FA 5KWIA 1CR6A 1CUSA 3ZV7A 3U1TA 2ROQA 3WK6A 4Y2JA 2WFLA 1UT6A 3I2HA 1XZKA 4QDTA 2XUQA 5DWDA 1JFRA 2HA5A 3G9ZA 1UK7A 4S0XA 3LIIA 5A7GA 4M0FA 1DQYA 2ZYSA 5LZ2A 2QR5A 3GBSA 3MVEA 3WI7A 2AJBA 3IDAA 1UOOA 1LZLA
chains in the Genus database with same CATH superfamily
2Z4TA 1MR3F 1W52X 3DZCA 3AEUA 5G53C 3L6DA 3OQHA 4E94A 4RTLA 2AYXA 3PKZA 3U3MA 1XK6A 4G25A 1WHSB 3LI2A 4QATA 1U5CA 1OIVA 5BQ5A 2JHCA 2E37A 1ZNQO 2R7KA 1UZUA 3GEGA 4OREX 3TTXA 4I1OA 1URPA 2CXPA 3PQEA 4ZOBA 4B7XA 4DCCA 1DEKA 4DTCA 2AOVA 4G5FA 3P9XA 3SQXA 1YWGO 4HCJA 1XALA 5KVQA 3EH1A 5KYXB 4P32A 1OF1A 2ZIFA 3QELB 1DC7A 2Z6QA 2FGKA 1D2AA 1Z2CA 4XGQA 2RI0A 4HBGA 3ZTYA 4HKTA 2IZ6A 4ARBA 3M6IA 1ZD4A 4H1HA 3T3NA 3MRTA 2G40A 4JX8A 1YA6A 4ALKA 4M1YA 2I76A 4HN9A 3GVPA 3T9AA 4G0XA 1GUAA 3AFIA 1G19A 3LBNA 3OG9A 4C6RA 4EBBA 2HQSA 4AJ1A 1INLA 1JHRA 2CLKB 3ILVA 3GGGA 5BT9A 3M3PA 2DPYA 4OH1A 4FEGA 3T7IA 2BGGA 1Z6XA 1WCWA 4YS6A 5I7EA 4WVFA 3RVKA 3TM5A 4AUEA 3QU4A 1YRHA 4AJNA 4DQKA 3HCEA 4OA8A 4DJFC 5A0FA 1ADGA 1LDGA 1ONOA 2QY6A 2Z5VA 3ESCA 2REQB 5JZMA 2CYAA 3FNRA 1QG6A 2C7GA 1RXIA 3BWCA 3EZNA 4NMLA 4F96A 2X8LA 4HWGA 4PIVA 1D2RA 1SBHA 3P9QA 5IM4A 2FPIB 1K3TA 5HKKD 4BFTA 1T36A 2BR5A 1VCIA 3ZY6A 4AO8A 2ZUDA 4QUKA 1CZKA 4I2VA 2CCJA 2FLKA 3TD9A 2AN3A 2D8AA 2Z8XA 4NKRA 1IM8A 3PLNA 5K0NA 5LJLA 4B34A 1LPNA 3ODGA 2H1RA 2IYOA 4M0LA 4BUJA 1E9FA 2XKJE 4G81A 4IWYA 3O1JC 4V1CI 2OKGA 4GBGA 1M1ZA 3H17A 3W3AA 1DADA 4DDWA 1EKXA 1N9KA 1NNUA 3A4LA 3LU1A 5D3QA 4ZEXA 3PIDA 1KDRA 4OK3A 1BNCA 1KTVA 3EWAA 3MIIA 1IVSA 1BKSB 1HT0A 1WZIA 1ZJJA 1K7XB 4XGRA 4ZHQA 4EZEA 1V3UA 4RX1A 3ZOKA 1G6OA 1OTYA 4WUTA 1JPJA 2ODBA 3DMYA 2I8AA 3B51X 3LGAA 4QYWA 4WZBE 5A5VA 3A1TA 1J9EA 1PLLA 4MJ3A 4XR4A 1M2KA 4FOSA 1TCAA 4URHA 4BFVA 2CBXA 2YNMC 4JJAA 4C05A 5B7NA 5KOJA 3S2UA 3CUSA 1E3QA 4BX8A 1EXNA 3I5XA 1Y1SA 2DOKA 5M29A 1WSAA 1F3LA 4EX7A 2BZ1A 1Q0LA 2CJXA 2VUSA 4QLBA 2NU6B 2W93A 5A9TA 3VZSA 1VKHA 1VZ3A 1X9HA 2WUDA 4B8ZA 4BQFA 5I3ZA 5KDOA 1Y1KE 1YNSA 3E84A 3BHMA 1QX4A 1JBEA 1YL6A 3KKLA 4HJXA 2JCBA 3GVIA 4LCEA 4DJTA 4REOA 2ERXA 4NAUA 3UIEA 4CFYA 1OJ7A 4MQLA 4D9BA 1O97C 2VZLA 3G7NA 2OZVA 4FKZA 3GN1A 4UTZA 1YGYA 3MZ0A 4EHJA 2NU7B 1WMDA 1KEUA 4BQSA 3KZ1E 1PTJC 3QEAZ 2AMFA 4B1FA 1OH5A 1XZ8A 2NPIA 3CX4A 5KJ1A 1EX9A 4PZAA 2YQZA 2QUAA 2I6QA 1W4RA 3FWKA 4B3FX 1E20A 2R48A 1WZUA 2K2WA 4WUVA 2Q0XA 3CIOA 4OL9A 4Z3DA 2ZAOA 3ZU2A 3L1IA 4RD2A 1HGXA 1XTKA 2RHHA 4WEQA 3G9TA 3GXOA 3X1XA 4C04A 1VE3A 3AONB 4JH0A 4E07A 1YTLA 2FW8A 1V16B 2LVBA 3RKRA 2HXGA 3S27A 2H52A 3H9CA 2YNMA 1BDJA 2FYTA 3GLTA 3GXBA 2HNBA 4KWHA 4RHFA 1MGOA 3PENA 5B2ZA 3ZWNA 3O4RA 2A2ZA 4UZEA 2AZTA 4EY3A 2QLMA 4DLTA 1BS1A 2KLBA 4PCUA 1H1LA 3CKKA 3GPLA 5AW1A 3ZNQA 4IHAA 2WPNA 1RWQA 3GJRA 1YJQA 4RH0A 1JDBB 2WC1A 3S7ZA 5F2EA 5KTYA 4MZDA 3D4LA 4FE7A 2PL3A 4R8KA 5CFPA 1SO8A 3MQFA 4TWBA 3VSBA 1L4EA 1CJSA 1I1NA 2AH5A 1SB8A 2UZ4A 1BQ4A 3R1IA 3UMSA 1PL7A 2DBVO 4LYEA 4BJHB 1OA0A 2BMEA 2ZCVA 3GD5A 4AY5A 3ND9A 2WW8A 3UT6A 3NV7A 1E1QD 4RZSA 3N0RA 2ADFA 2F67A 3K8YA 3QEMB 4LZJA 2JKVA 4P2BA 4ZTUB 3OZDA 1NNLA 3HN7A 1A4IA 2EKPA 1WPGA 1J21A 4C7OA 3H4MA 2AK2A 4KH0A 2GSDA 1GPNA 1DC3A 3I2KA 3RUAA 5DVZA 3JWHA 4MJ7A 4ND8A 3EGWA 1XL1A 2P8SA 2YZ7A 4A2QA 2QTZA 3K2QA 4RSMA 3PNSA 4BUCA 1NNSA 1Q50A 4C4ZA 1Y63A 2A3NA 5KTSA 5FTJA 3K16A 1T5SA 4JVMA 2RHTA 3N70A 1LBSA 3DE3X 4OQFA 3O8OB 2R00C 5J4HA 1RRMA 3DMDA 4CKCA 4BWVA 4FKMA 2RCYA 2TMGA 3ACDA 2ZRGA 1L5HB 3WNCA 3HXMA 4D26A 2BFPA 1W1WA 1BEUB 1UXHA 2PGDA 4MP6A 1KE1A 1YRLA 2CVQA 4NOLA 3ETLA 3X1WA 2BFEA 1QHHB 4LDZA 4WACA 3V1NA 2JHGA 5TGZA 3SOZA 1SOAA 2JAWA 4W1SA 4LQLA 3D2BA 1LZKA 1P0FA 3FVRA 4QOFA 1N8TA 3KJGA 1PKEA 2G08A 4K1XA 4C4XA 4CMEA 2RGAA 3MILA 2R79A 1UKEA 2VAPA 3IKLA 5DHAA 3A6PC 2XRMA 3SF0A 5AT1A 1W29A 4RUKA 4ND1A 2PHZA 3QJGA 5DBHX 2AMJA 4QXPA 2MYTA 3K0FA 3RK4A 4MH0R 1JJ7A 1QF7A 5T4EA 1RAFA 2ARKA 3GLFB 4IJKA 2RHDA 4WD3A 1MFZA 1DZ3A 3PS9A 1VKRA 3B8HA 1FVXA 4HAOA 4UULA 5KYKA 1I94B 3L1HA 1VPVA 4GPD1 4RENA 4RY2A 2UXDB 1EAMA 2OO5C 1U2EA 2JZOA 2CK3A 3BHJA 4IIUA 1FIUA 2NW6A 1A98A 2XGJA 1SC1A 3L8MA 2MT9A 3A2KA 1N9GB 1X86B 2C1ZA 3LZDA 2COEA 2PZMA 1QGZA 2PPLA 1L5QA 4IFIA 2CLDX 1XZNA 3S2GA 4XZ3A 3C3WA 4P4UA 5A5DA 1G2PA 1LI5A 4MYRA 3AR4A 3R5XA 3OJCA 2BFCA 3DZHA 1FDTA 1B2RA 3CEMA 1JR3A 3OE1A 4NG5A 1IBLB 3DBRB 4KO4S 1K88A 4NXMB 2W11A 4KMMA 4QUEA 3BRCA 1S89A 1RIIA 4FUQA 1IQPA 1YQDA 2OPBA 4XASA 4D8UA 1BVRA 2GYYA 2Z57A 3AF6A 4ODIA 4R3NA 4R0VA 3K2IA 5LQKA 5EC8A 4LXTA 4O3MA 2JI7A 4WA7A 4ICIA 4OYLA 4TSRA 3VR3A 1DEOA 2CFIA 2WLSA 3NFYA 5J40A 4CM9A 2D2EA 1YFKA 3GEEA 4WL0A 3TSWA 2PGXA 3DNMA 3K7EA 4S24A 3LK7A 5YASA 2JLZA 4RIEA 1Q5PA 2FFHA 3LXMA 1XXHB 2H8KA 3AG6A 2RMKA 3S68A 3JYOA 3F6YA 3NMUF 4OP3A 4PN7A 3RUIA 1CS0A 2N1BA 1G98A 5E4JA 4LJKA 5JXWA 4BMDA 4YMVA 4GXQA 5K4GA 3DFZA 4ME6A 1RLUA 1QHEA 4XIYA 1CRLA 4KR0A 3SKYA 3UB4A 2PUAA 1VKNA 2HK8A 4D9NA 4GQIA 3IQIX 3ZE1B 2GD2A 4BYMA 5A04A 1QXSA 3AVVA 4EKDA 2C94A 1QZTA 4FFMA 1VG8A 1UT5A 2GWRA 2XSZD 1E1DA 1MORA 3GZNB 1Z26A 2BBOA 2VKQA 2BGIA 1ZCZA 4JB0A 3EVDA 1YV9A 2IZ5A 1H42A 1IZ7A 2YUTA 3NHSA 2EF0A 3AW9A 3B82A 2E85A 3H11A 4EKYA 3VU9A 3AM1A 1TYEB 1XPRA 4KXFB 5ALPA 1BFUA 3DEKA 3NRBA 4MV1A 4OI1A 3MUFA 3OEHD 1N6PA 1K27A 3R3YA 1VM6A 2YC4C 3S2FA 4QE3A 3FETA 1ZN8A 1L4HA 1XYGA 3LDFA 2FZEA 5DWVA 1NKSA 1XXHE 5KOHA 1VLJA 3HRHA 4EHBA 5HZHA 3O2SB 3ZY3A 1KAOA 2MSDB 2I8CA 2EL7A 2V74B 3M6UA 4KVAA 5I7SA 4UDOA 4NBWA 4D9EA 3C97A 3N86A 2PIAA 1N5MA 3OPVA 3P4UA 3PUWA 3ZD9A 1ZNWA 3KJHA 4TMTA 4XVQA 4FDAA 2CHGA 1KZGB 3D9QX 4FHCA 5ER9A 2GJKA 5K0BA 4JL5A 4OATA 3JPWA 4GX2A 3SYLA 5IJ0B 2DPMA 2HJGA 3F6EX 2B7CA 4N4AA 3EWNA 2R6AA 2HBRA 3ORHA 3KALA 2P1DA 1ML4A 2QR3A 4TXLA 5LB2A 3BB3A 4UEJA 3S29A 3VTKA 3K70C 3PDCA 2XCTB 3B70A 3HSKA 2ZR8A 2WJHA 4UMVA 4WE3A 4OBBA 1U99A 3WL4A 1FJ2A 2WPDD 3DD1A 3FWYA 4UJ3A 2B9VA 1XZAA 2RK3A 2ICAA 3NU1A 2OYCA 4D6YA 4GXNA 5IYZB 3AINA 2BGMA 3PIRA 4J3FA 3P2YA 3LX6A 2YJTD 2I1QA 1YB2A 3MWYW 2BTEA 3G88A 2P0AA 5IAGA 1OLUB 5BSEA 1NBMD 4JLSA 1KY4A 4LRWA 3BMCB 1RTKA 2QRQA 4LDQA 2AFVA 5DW0A 1WXEA 3IR7A 3GFPA 3SS7X 2UXBB 2BIFA 2OKCA 1TMGE 4AY4A 3FNBA 2DR3A 3GUZA 4N41A 3ANLA 3F4KA 1AMNA 1GDTA 1EXWA 2ZJZA 4M1TA 2A58A 2W2TA 3HPRA 4FHGA 4J1TA 4WOCA 4Y6LA 1C4WA 1Q0QA 4XAQA 1I9CA 4BNJA 3HV0A 4P4LA 2ZK7A 2VDWB 3GA7A 2D0DA 4JJEA 4YMWA 3A1EA 4N8EA 3FMPB 3SK0A 2ZJAA 4NZYA 2BGTA 1XTIA 4AP5A 3L0YA 4CUJA 1WCXA 2VDUE 4TXJA 3EPJA 2FUNB 1IN4A 2FTKE 3ASVA 2ZXEA 4Z9YA 3UGJA 3TF5A 8MHTA 4L50A 4F6CA 4LF4B 3UJ3X 3L92A 3ZV3A 2LIVA 2QI9C 3VC1A 3N0VA 4NU6A 5FYDA 1E7QA 4OJKA 5AUPB 4JI8B 3EVGA 4OB6A 3H84A 3I4CA 2QJFA 3BTOA 1HFJA 3KKPA 3P2EA 5FLKA 3RUEA 3RYIB 3WKCA 1P9WA 2QMOA 3A05A 3BGDA 3G5MA 4U5XA 3WK9A 1FL9A 3F2VA 2YJ3A 1EFAA 3ETJA 3QWAA 5EKUA 2OHOA 4PZUA 3LT1A 2IVFA 3THRA 1OU4A 2HL6A 4TKMA 4YQFA 5KOIA 4C21A 4HYEA 4KE6A 1NG9A 4QSHA 3P32A 3ZJVA 1Q16A 2HSZA 1H65A 1GNVA 1XVTA 4US2R 2XZLA 2OM6A 1RLMA 4WXEA 1T9AA 3PPXA 4AC9A 4HX2A 5D51S 4FLEA 1CD5A 3K8ZA 3PC4A 3U1BA 2ADOA 2QTNA 3CG0A 1D6SA 2HDOA 1IG0A 2O6HA 3OEYA 5K8TA 3W5DA 5KNLA 4HEA1 5DMXA 5LN1A 4GE3A 1JKXA 3DCJA 1KBZA 3JQ7A 3G02A 1ODSA 4ZVOA 4MVJE 2NTJA 3UOGA 4IXWA 2HMVA 3FCXA 4C03A 3N6VA 2V6IA 4RPKA 2NUPB 2J0SA 2GEBA 4BFCA 3O21A 1JEQB 5BR8B 1WUIS 3O74A 1SA0A 4FGWA 1YIOA 2PZ8A 5K3FB 4HWSA 4A27A 3G89A 1X1DA 2O7NA 4P80A 3IEKA 4G09A 4TVOA 4DA6A 1G8HA 3UC5A 2P91A 5FBHA 2FW6A 4R9SA 5IVHA 2A59A 4KGDA 4D3SA 3I1JA 3VI3B 3DHNA 4DBVO 4Z3OA 2XOKA 4G89A 4ZOLA 2XWJI 3W4IA 1C9JA 1QHHA 3RJTA 4HF7A 4UE6A 3KCNA 4MHTA 1RKUA 2IDZA 4XGIA 4WFQA 4CR7A 3OE7A 1GILA 4JSTA 4DYDA 1Y7HA 3C6XA 4JKIA 2HQRA 4OU4A 4LCBA 3N7TA 4RA9B 1TAUA 1IAQA 1ZA1A 4FMBB 1L5LA 1GD1O 2P5UA 3WFIA 1OZAA 1OFTA 5HQTA 2CNLA 5E6RB 4CDRA 3OWXA 4NABA 2FPPB 4CQJA 3AIOA 3IMEA 4OOEA 1HPLA 2B69A 3FNGA 2HT6A 3SVZA 1NN5A 1KKMA 1DG3A 1ZHHA 4RWZA 2WOOA 4WFJA 3T3DA 1BU5A 1W36B 1KP9A 3RK1A 1JG6A 3FPHA 3VU0A 3STUA 5BOSB 4H7EA 1XRMA 3MYRA 3DMHA 4FGJA 5IWAB 1IXYA 2CJWB 3A14A 1N4DA 2CL6X 3WDKA 3KVNA 3H2JA 2YZKA 4IDGA 3WB0A 3L1VA 1LV7A 2G5CA 2ZIWB 3HGTA 3KTOA 2ODAA 4P7BA 4U2BA 5D3MB 5DJ5A 1W9HA 1UAYA 3NTVA 3RRJA 4AW9A 4L9RA 2QN1A 1SU6A 3JQGA 3S2IA 3VR5H 5BPFA 1GU0A 4ZA2A 4X6YA 3RC1A 2J07A 1E5TA 1OBOA 1ZOOA 2FWNA 5IPFA 4FZ3A 5G0VA 3G8BA 2IU3A 4UUNA 5HRUA 4MA4A 1TO6A 4YA6A 2JGAA 1PSDA 3U7JA 4N5IX 2IELA 2MSNA 3OOHA 3CO0S 4TSKA 3THWB 2NAFA 4QDXA 4FW8A 3AYZB 4NRDA 1AXEA 1LNQA 4TTRA 1ZJYA 1GGFA 5CJ2A 2C7QA 4XCXA 1Z38A 4KO1S 3CNEA 3JQ9A 3URMA 3O92A 5JAIA 1Z63A 1RD4A 1QS0B 2G77B 4JWTA 1X9GA 4YO7A 5TPWB 3GB9A 4HAUA 2YFYA 1K1EA 1TZJA 1SMKA 1YS4A 4M21A 5JRJA 1F1BA 2XQJA 4B7CA 1MAHA 1D1QA 1BJKA 1NHWA 2RHWA 2I33A 2WYWA 4P0TA 2NN3C 5KWSA 1N3IA 3DOCA 5IK2D 3W5AA 4BNMA 2XEDA 2XQIA 3KXIA 5KTOA 3OQMA 3QNUA 1Z5UA 1Q2XA 1U2QA 5KS2A 2AKYA 3E3AA 5E6SA 1TD9A 1KMIY 5SV2A 3LYHA 5EZ6B 4JFAA 3OOSA 1KSGA 2POQX 3G49A 3K6KA 2Q9UA 5JD6A 1JG4A 2RGCA 1EFTA 1FUEA 3GBPA 5CA1B 1YJ8A 3LP6A 1L4NA 3RO7A 2QROA 4OMCA 2ZIEA 1VIDA 2JH3A 3BB1A 4DIDA 1FRVA 2M6SA 3BH0A 4UHCA 1OFGA 1NLZA 3HRKA 1LH0A 1YZVA 3O75A 5DNUA 621PA 5IKOA 2B61A 1AH2A 2BH2A 4FCCA 1QCCA 2FDRA 3LCRA 2PL9A 3IJPA 4CKBA 1RE1A 3HB1A 2ZZMA 2NXCA 4ND6A 3AKEA 2C00A 4JQOA 4TTIA 1LY1A 2B30A 2X0JA 3D3JA 4OVKA 3UWMA 5EYPA 4WBNB 3F6RA 3ZE2B 2ORIA 4Q7EA 1AXRA 1NXPA 2JJ8A 3ZLBA 3FKSD 1RVDA 4ZAGA 1W49A 3ICPA 3HH8A 5HUHA 2FPLA 2JA2A 3WWYA 1ECFA 3Q7PA 4BNDB 2FZCA 3H19A 1K5PA 1Q1NA 3NHAA 4NYIR 3R3JA 1ZK0A 2QYSA 2GAFA 4TKLA 2EV9A 2H2GA 5LYYA 4QU8A 2H0QA 2QJRA 5GONF 1EDOA 1ZD9A 1EHYA 1PP4A 1IY0A 2ZRPA 4W9NC 1NQXA 2QHXA 4E46A 4QTZA 4RD1A 2FW1A 3SKVA 3H6KA 1X2BA 4M4SA 1JDSA 4TOIA 4UZFA 4WZBA 1J0AA 2C77A 3MJEA 3SD7A 3HI6A 5I7FA 4QQKA 1ECPA 3A04A 1PFQA 1SUIA 3DCNA 4S2EA 3UC9A 3GEPA 3RRBA 2F8MA 4NTZA 1KDVA 4YJFB 1GG5A 1W59A 2UXCB 3TO5A 3PLAE 5FWXB 3R7LA 1R8QA 4DXHA 1G1MA 1DBIA 3RYFA 1ZW1A 2FJPA 4O33A 4ARVA 1VGQA 3LL7A 6Q21A 1Y6GA 4OPMA 2KI5A 1WG8A 3AEXA 3NB0A 3RSSA 5KOHB 4Q3AA 1R3DA 1SVOA 3RVNA 7MDHA 3V1TC 4A0SA 1AMOA 2PXAA 2C8VA 2C20A 1OXMA 4EL5A 4BO4A 2FPMA 1ZMOA 1AQJA 3U7HB 1YVRA 1Q12A 2BFOA 1XG5A 2YRXA 2W4IA 4L4XA 5IF3A 3VSAA 3SQOA 1L7RA 3D0QA 3ONDA 4J75A 5HTKA 5DCYA 3X0DA 3H1TA 2Q29A 2IUTA 8AT1A 3M70A 1G5TA 1KFJB 2WJAA 3QVJA 1AKEA 1W30A 1XNHA 4FFBB 2NQTA 4M0PA 5GV8A 2EKBA 3FLEA 3FUTA 4QFDA 5FFMA 5B3JA 2XRZA 1XTBA 3R75A 2IHNA 1QRRA 5BYBA 4ZT2A 1PNOA 2WWGA 4MCHA 5IN4A 3EDRA 1U3CA 4E1BA 3S5JA 1TYBE 3MQ4A 2P7HA 1QRSA 1HC7A 1TU3A 1LPAB 2VHXA 4BZWA 3CJRA 3OQOA 4NX2A 2A86A 3NGMA 1JFVA 3GZTB 4JSRA 4F4CA 2J9ZB 3EIXA 4WLEA 1QBGA 3K73O 4FNAA 3QVGA 4RIHA 5DH9A 5FRDA 1Q83A 3DC7A 1KP2A 3ZZTA 2AOUA 2VK2A 1HORA 3N05A 2H17A 4WPGA 1YZUA 3R3WA 1M7HA 2FLWA 2QAIA 3RRZA 3ZDZB 2WMNB 2ATXA 3DDHA 3RYIA 4AMUA 4EYEA 3HVKA 4LW8A 4UHEA 2OYSA 2D5IA 2PMBA 2PJUA 4D0SA 2VBCA 2CL7X 4JLMA 521PA 2F9FA 2EWMA 3IC5A 4P5PA 4UBMA 5GZ1A 5HJ2A 1G8YA 1V4VA 1DHTA 3NIDB 2ZXFA 4CMCA 4KOEC 1X6VA 3NBMA 1AE1A 1DU4A 3HG7A 5FL3A 3E7FA 2XDYA 3OQJA 3HP1A 1UBSB 1IY2A 4M6WA 5EWJA 4FDTA 5M5BA 3W9UA 3ZLVA 2XE6A 1VMDA 4KYVA 2WKRA 3ZQ4A 2Q5LA 3IIMA 1P4RA 3ER6A 2CV0A 2BE7A 1IJEA 2EF1A 1U4SA 1TO1E 2ZVQX 2Y71A 4J90A 1T5IA 1JWLA 1NRWA 5I9MA 1T13A 3VX4A 4OQEA 3ERCA 4P98A 2R751 3KU4A 4P6VF 2B37A 3Q3HA 4ZI2A 2VSXA 1YHYA 1OWPA 3QGMA 3JVDA 3PUYA 1N92A 1NI5A 4KXUA 1QYDA 4OXYA 5CM8B 2PX5A 5GJWC 1YS7A 2JASA 1IHYA 1JMKC 3BDAA 3F67A 3I73A 4FCTA 5THKA 4BKRA 1E1LA 4XWTA 1QLHA 2Z5FA 3NR2A 4LXYA 2UU9B 1BRMA 1KO4A 2EDAA 4QBGB 3MS4A 3DKPA 3PHBE 2QVGA 2X2EA 1LBQA 3GRUA 4XIIA 4ZCMA 1D2NA 1HTBA 1TDJA 3WLLA 2A33A 3GGJA 1ZO8A 1Y8AA 2IE0A 4PSVA 4RTQA 5DM4A 1AGXA 3CH6A 1OHHA 2NUPA 1TAHA 3TZKA 3W04A 2WYVA 2GBIA 3KB6A 3MA0A 3ZWBA 3I72A 1J2RA 2G80A 3K09A 1G20B 2X4DA 2JGFA 4RV9A 3RS3A 2AN4A 3LOUA 4H1WA 5LCXA 1WUYA 2H07A 4UREA 1XTSA 5DK6A 5DSTA 4BRSA 1L4LA 1RAAA 1ZUNB 1LK5A 1HA3A 4JEUA 5DXFA 1U9IA 2A67A 5MN6A 2NVBA 2ZTMA 4KNVA 5EXTA 2JJ2A 3ZHRA 4EA8A 3PGLA 4BX0A 2L18A 3CWZA 4PLFA 4Q1EA 1JAZA 1Q1BA 1VMAA 1XWWA 5J9FA 2AMLA 4LFAB 2NT4A 3DTNA 3E4CA 3FGPA 3H1EA 4IS2A 4FBLA 4B9EA 1OLXB 3CWCA 3I6BA 1GT6A 3GEDA 1ZONA 4AICA 3T9CA 4M88A 1Q3TA 3C39A 1T9DA 2HJWA 5JVDB 3ZV4A 3TJZA 2OAQ1 5HKBA 1PJ4A 4MB6A 5B53A 5ISMA 2BSQA 4QYMA 5C18A 5IM5A 1HR0B 4OM7A 2HCTA 2O3SA 3CUYA 4LOAA 5K2OA 1ICIA 4XDHA 1CRWG 3AY7A 2V9CA 1FP4A 2GN6A 4XRGA 4DCNA 2QORA 1YDHA 4OXIA 5M34A 1LWOA 4MV9A 3SHWA 4NOKA 1B3RA 2GPAA 2BISA 1SVIA 2PR7A 2ZJ3A 4TSFA 4NEHB 3DGEC 4HQLA 4J1SA 4WT7A 1NNI1 1P19A 3CONA 2FPXA 3RT9A 5IMSA 1MO5A 3VPBA 2O05A 4D3DA 2P78A 3ZTTA 1XRPA 2OCPA 1A8IA 2L17A 4RMIA 2Z5GA 4Q03A 5DM70 2V7PA 5B58C 1CUFA 4M60A 4ARAA 1DIAA 3NBZC 1AUQA 3GT0A 3NC1C 2NNWB 4MP8A 2QM0A 2QW8A 4WNCA 5F51A 5SYNA 1EZ1A 1A0OA 5ERXA 2D7CA 2JGMA 1WY5A 7GPBA 4HRAA 5BWMA 1AY0A 3DDSA 1T2EA 1Q1GA 1LA2A 5LLDA 4JT2A 1GNSA 1ZXXA 2J5BA 3CURA 4CTMA 5IAAA 1UJNA 3EISA 1YZQA 3PR3A 3GDOA 4NQRA 5AIAA 3WYGA 4O59O 2OBFA 1EVQA 1CLUA 1YDWA 1HX7A 4ARIA 3WP1B 1MO3A 2MSKA 1UMCB 2LCQA 4NZ9A 4C4PA 1A3CA 4F60A 1U2GA 2R9VA 2J85A 3CE6A 1MQ8B 3HL0A 2IWHA 2GVZC 1WNTA 1XLWA 2W43A 3HS3A 1K5DA 3L0IB 3LCVB 4UAUA 4ZZ2A 5KNCD 1PD1A 4NIMA 5FLYA 5AI9A 1LVHA 3GAZA 1EFLA 1YRBA 5A4MS 1O57A 5A71A 4PR0A 1O3YA 2CLIB 1FLAA 5DP1A 2EWWA 3E5MA 3BQMB 3TD2A 1R5JA 2HADA 2J6CA 4UEQA 4EJSB 5CD1A 3MWEB 4MEAA 3R9KA 5AIBA 1QZZA 1PDVA 3VVBA 4EMSA 2Q46A 4HR7A 1EVEA 3H7AA 1MEEA 4Y2UA 4CCYB 2RE8A 1KVTA 5AK6A 3LW8A 2RJOA 3DM9B 1S3GA 3N6XA 1O95A 1RAIA 2COUA 4AULA 4HY3A 1C2TA 1N2HA 4FW9A 5DFAA 1GZHB 4JC4A 2AD1A 4MUGA 1ATZA 3AVOA 1RLOA 4UJ5A 1E79A 4EFNA 2P2ZA 3DE2X 5HE8A 1M6VA 1TTHA 1WUTA 4GMKA 4M37A 4Z8XA 1DAMA 2GVNA 1GGHA 1YFZA 4MVJD 1R8XA 1NLMA 4JBLA 4Y18A 3LHFA 1DFGA 2VEOA 3MWDA 3U7RA 3RTEA 3WS7A 3ZZUA 3R6WA 3AETA 1JHAA 1XTVA 1N5OX 1QB8A 3A8TA 2F4NA 2B98A 2Q4DA 1XRLA 3Q72A 4E03A 3FI9A 3MJFA 2QPLA 3CFYA 3CEHA 2V8BA 2WF7A 3ANSA 3FTPA 3IP5A 3NNNA 4AYTA 1NMEA 2VUHB 1Q77A 1M2GA 2WE7A 1ZITA 3QTLA 1T36B 2AW3A 1DPGA 2VNKA 2GMWA 3GWZA 3F3KA 3N7AA 1JIUA 2HF9A 3ZV6A 3DT6A 1E9CA 1U0EA 2V54A 5JVDF 5K3BA 1G42A 3E5RA 1VI6A 2VHUA 2ZKIA 3KFLA 4CW7A 2GCNA 4KQ6A 1AKYA 4EEXA 3LUDA 1ZIDA 2FWRA 5HWSA 3LP5A 1HOTA 1ZISA 1TEHA 4R5HA 3T7DA 4X54A 3MINB 5A0VA 3NQ41 3QKSB 4P7KA 1QF9A 4MIKA 2O0KA 3D0OA 2VDWA 4E32A 5KYWB 3JAMA 5AKHA 4YCNA 4CG2A 3OJOA 2ORYA 4MR7B 1MH1A 4NEQA 3ZJ4A 1NVFA 2NLOA 4J0KA 1P9RA 1DRJA 1OASA 2JRCA 3I2IA 4I1YA 4REMA 3ABQB 4MYHA 2Q5OA 3JQAB 2WHQA 3W4JA 4BNXA 4K2AA 1UXOA 3DW1X 2CHVA 4C3VA 3MB5A 3QLVA 4A3SA 1X1CA 1QU2A 3TNLA 3OOJA 1Q21A 2ACVA 4OAOA 1MVOA 4CLOA 3I4FA 3DZFA 1IK6A 3TGWA 1RM5A 4FFRA 1DRWA 3EXEA 2BGNA 4RHUA 3VMMA 4F3RA 3CR7A 4FD2A 1CPYA 4PZEA 3WLHA 5IDYA 2C03A 2VRCA 3NT5A 3D8BA 3U7QA 4F84A 3VPXA 3IUBA 5HKOA 4JMPA 3QMMA 3TM4A 2VJCA 2ID9A 4KVZA 4JLVA 3WQRA 1VTKA 4BFWA 3F46A 3L0CA 5IUKC 4EHAA 4OBXA 3UWPA 4GH5A 4O2BF 4P7FA 3JWIA 3ZWCA 5T67A 1MA3A 4NBVA 1JJIA 2C8JA 4IZ6A 2JL1A 121PA 3K0CC 1RWMA 3I64A 3HGMA 1G3IA 1OX6A 2HLHA 4DYHA 1DB3A 5G4LA 3G6WA 1U3DA 3PCRB 4X6UA 4EH1A 2JKYA 4YXWD 3K70D 4CMAA 4Z53A 3T3GA 1GR0A 3PWSA 3OFND 5ALUA 1JL3A 2PZAA 4PXAA 3RS4A 5JROA 3CNOA 4G5YA 1RRPA 3HMQA 4HLDA 4HNGA 2AJCA 3ZE7A 5GADl 1FW8A 2Y1GA 3BXGA 4NULA 4ZMRA 1NASA 1H0RA 3MJTA 2GBLC 1N0HA 1XDZA 3D6NB 4KDEA 1GGVA 2RONA 3A1SA 3VU8A 2AQKA 1EK5A 2OZLA 3EBPA 4FBGA 1FBNA 5DM60 4OQMA 2FQYA 3KDPA 3RT1A 2ZIAA 5BSUA 1H4SA 1YRQA 1VE5A 3TKAA 2EZUA 1GUZA 4P4TA 3W5JA 3AI7A 4B32A 4ZALA 1T2NA 2O8CA 3ZU3A 2WNHA 1CUBA 1SCQA 1SRRA 3ICWA 2JVKA 3A9RA 4ZV7A 5KDLA 3UZUA 2R8YA 4FVTA 3MTIA 4D9IA 3UCXA 1SXQA 2IDJA 5FQOA 3VH3A 1D09A 1QQBA 3ORSA 1JX6A 3E27A 3K94A 3KC2A 4PINA 4A92A 1QHGA 3AF3A 4XFKA 2CFRA 3DFKA 5D01A 4Y2RA 1OVGA 4Q3OA 2YS7A 1ULHA 1RW4A 2FSVA 2KYRA 2QSUA 1STOA 2VXOA 2XT6A 3CJQA 3DZ8A 3KOXA 4GPZA 4L1KA 5E9AA 1CUVA 4BECA 1I51A 4IKPA 5G3YA 2VNSA 4QXMA 1KVUA 4OKNA 2NVUA 2FR8A 4J03A 2OXRA 4OP2A 4V0RA 4B4WA 5KEIA 1BHO1 4KPUA 3V7WA 4G97A 4Q9AA 2PJRA 3WGYA 1NN3A 4PF1A 1XJ0A 1YUBA 4U7PB 3V80A 1CQWA 3I62A 2PUGA 1HYBA 4YRSA 2HSEA 3H2IA 4RS4A 4V39A 2JEOA 4L6CA 4F04A 3VR5D 4FX2A 4B3JA 5ELXA 1EUDB 1LNSA 5GGXA 2F3RA 4R4JA 4MVJP 1FUIA 1P7VA 3OZWA 4U8HA 1Z4LA 4O4IB 2FVXA 2D1QA 4I50F 4UCQA 4WXYB 3V97A 4RZ2A 4K9SA 3Q8XB 5JBQA 1IN1A 5C34B 5T4FA 3JW8A 1TLTA 1PT9A 1UFKA 1Y3HA 4K9PA 3OI7A 3MJRA 3QKIA 1GADO 4M8LA 5E1BA 1RQLA 1EBUA 3F8WA 3STHA 4W6ZA 1V8BA 5LZ4A 4C7KA 3KKQA 3E6AA 2PLAA 4K9LA 3ZXYA 3IV7A 2FP3A 2GYUA 3I5AA 3MHPA 4PBRA 2P2LA 4Z54A 2D6FA 2VT6A 2OHGA 1DT5A 3NIFB 3O90A 4HDSB 4BPRA 2GEFA 4HNUA 2C98A 4MV5A 4GBED 1CY8A 1F51E 2R1VB 3KKMA 5HBRA 2REQA 5HFJA 1VZ2A 3HNRA 2V7EA 3I9KA 5HX7A 1A82A 1Y3CE 2G1KA 3UA3A 3G5AA 3UXEA 5H3HA 1E1YA 2FX5A 1MAVA 1MB4A 1OA1A 2PWZA 1Q17A 4YR7A 5ICGA 2WT8A 4PFKA 4D3FA 2IFTA 3D4OA 2IOFA 5JVDA 5HIKA 3WP0A 1ENYA 4GKAA 4BEWA 4QTTB 3WIOA 4CEJB 1QQ7A 3HA7A 3KSRA 3N2LA 1UKAA 3DEHA 4K3VA 1B15A 5EXPA 5BSTA 5GONB 1ZJ4A 4NDAA 1TVMA 4N8SA 3VNBA 4N7BA 1GTZA 1DUVG 1IHXA 1XMVA 2O4CA 2QM3A 1R27A 2OXTA 1I7DA 3D8HA 4PQGA 1FSPA 1L6IA 2II6A 3EJ6A 1I1QB 3QHPA 2Y1EA 3TX6A 3PUZA 3QXCA 4O2AF 3GJXC 3BWBA 3DSRA 4PRLA 1YO6A 3QRWA 4ETWA 5KMGA 4HZIA 5ESXA 4PHGA 1AK9A 1S4MA 4F6LA 1CQPA 1CQIB 4BQOA 3QSYA 1ESCA 5CJPA 4KMRA 4QUAA 1WCYA 4GXTA 1QFYA 3TZ6A 5FXMA 3INYA 3AOEC 1W4ZA 3PYXA 1Z0ZA 3F0TA 3VU1A 4BIIA 1IY8A 3IA7A 4U0KA 1VE9A 3DBVO 2ZE6A 3GPIA 4D3YA 1U28A 4K6CA 3NNDA 4M9ZA 5TQVA 3UHAA 3LWDA 3V8BA 4BKMA 2ZJYA 4CM5A 1E3SA 1B0ZA 2SBTA 1C7RA 1GCOA 3UXYA 3O8RA 3DL4A 2IX3A 1BMDA 3BIOA 1E9VA 5IHXA 3EIUA 3MRSA 2ORED 3L0PA 3ZBUA 4HV4A 1GKLA 4F2GA 5C7IO 13PKA 3DZDA 4YV7A 5C1BA 4UCXA 4JVOA 3MJHA 4N5DA 1ZH8A 3B3JA 5KJCA 3EIHA 4OU5A 1YFJA 4IZOA 1GFIA 1BEZA 4RHCA 3KKOA 3UXMA 5IULC 1QRDA 2OSBA 4H3KB 4HFNA 4A91A 4B43A 1QQTA 3R3VA 3QBEA 4I08A 2WAOA 4JLDA 3F1LA 3H5IA 4PHFA 2A92A 3P0HA 3ZGOA 1NXSA 4ZDIA 3NUGA 1GG2A 3CU5A 1NZJA 3AEZA 3NAMA 2RH8A 3E7PA 1YR1A 1EBBA 2CUTA 4F8EA 1ANKA 4X95A 4K9MA 4P4GA 1L4GA 1ZN2A 3L7IA 2ZCJA 2Q5JA 4PNPA 1SM4A 1W2HA 5IJAA 1Y8RB 2JLCA 4GLJA 4KWEA 4RADA 4KGXA 4EF4A 4GPTA 4O4JF 3AQIA 2HMYB 1VYHA 3L0BA 4Y2HA 2RGUA 1KVQA 3AIIA 3FA2A 5CFMA 2BCEA 4O4LF 1C14A 4WZBB 1CZHA 3LXRA 2G76A 2XODA 4ZCTA 5KYXA 3DXZA 5CNIA 5JBIA 4TMZA 4RBNA 2V0GA 2PANA 5GIOE 1A71A 2QGFA 3IAM6 4GP6A 5H83A 4AO7A 2WWYA 3ZJTA 4P93A 1AN9A 1HE4A 2DBYA 2PNFA 2Q3JA 2YW9A 5I5EA 3MTBA 1KZYC 4HEHA 2W2KA 3RSCA 3V9PA 1CJMA 1WDWB 2FSPA 3ZDYB 2R62A 2HWXA 3EGIA 5E4YA 2HSJA 1OGJA 5EKTA 2QA5A 2YS6A 3M6VA 2K2QB 5CXUA 1DJOA 2J30A 1UQUA 2OO5A 4QPJC 3QJ5A 4CQMA 1OWMA 5AVVA 1H0SA 4BVHA 4WBNA 2XVAA 1EA7A 2VH2A 3GLHE 3L0DA 5AUNB 4I81A 3U13A 3SWWA 3VHXA 4P5EA 4B81A 3C98A 4ALJA 2BSXA 1D1SA 3G0BA 5BV1A 2FRDA 2A9PA 2H2DA 1P2DA 4OK5A 2FWIA 4MCJA 1M8GA 4KQEA 4OM8A 4YDHB 4ZANA 2VYVA 4RF4A 4FEEA 3LKVA 4YRBA 1JN0A 4M0KA 4YJDA 4D92A 3QVGB 2PBFA 4IILA 4GRAA 2RAVA 3SM3A 2V7XA 4JJ4A 4QQFA 1QPGA 2PRIA 3MLEA 3VDRA 3ILHA 3VZCA 4QX6A 1YACA 2JEZA 1GAJA 3KAPA 3TIIA 4BEVA 4UOEA 2VHQA 3QNWA 3VM6A 5JSHA 2IU0A 2EJWA 3JY6A 5KTKA 3DBOB 4C2TA 3LPAA 3GPCA 2GZRA 4E12A 1P2TA 3MT7A 1TMKA 4YRTA 3MAJA 1Z6AA 2B92A 3RVRA 1KDYA 2PUHA 3WFJA 3C45A 1WSWA 3FPSA 4M7OA 1OAAA 3V48A 3SOPA 2AFIA 1HDGO 3U37A 5AVJA 4POOA 3H5RA 3O9MA 1Z6TA 3MGKA 4FZRA 2BFDA 2FZ4A 3AJAA 2J31A 1NXWA 4NNJA 4UAVA 4YREA 1U7WA 4L57A 2CZGA 4I5GA 4BFYA 4XLZA 2QS9A 2J3QA 4Y9TA 2PR2A 1KRWA 2AYYA 1SWVA 3KSUA 3C3YA 1J07A 3JS5A 2QYTA 1WXWA 4DLXA 3GJYA 1FDIA 4UMFA 3EZ2A 1SCIA 5E0OA 2JGIA 1CK4A 1QHIA 1XTJA 4E33A 2ZWVA 3QG1A 3TDNA 4BAGA 1OFIA 3JZFA 3QKRB 2MYUA 4YRAA 2BEWB 1A8HA 2HM7A 4YAWA 2VDOB 1ZCAA 3O8CA 4QEKA 5E6UB 5A02A 3KCQA 3JTMA 1KWKA 2P41A 2FQQA 1E0JA 4COOA 3I1FA 5LMUB 2Q8QA 3UAYA 5IDWA 2VH1A 2YMPA 3NHPA 3DG9A 1TCUA 1XMPA 1ZD5A 4HMOA 1LRKA 1P5HA 1JXOA 4AP9A 3FAKA 1DAIA 2GERA 4BMVA 4EPVA 3IP7A 4JBWA 2X40A 1W0JD 1ZS9A 3L06A 4GUAA 4TT3A 4PVDA 5DBOA 5LZ8A 3C41J 5LZ7A 3QEJA 4QXAA 4TM8A 2VF7A 3UW1A 2VK1A 1VJ5A 3Q6IA 1T4GA 2CMFA 3Q9UA 4I4TB 3T3MB 5G0TA 5F5LA 3WA6A 1MZPA 1TZMA 2VAXA 4MI1A 4EHIA 4YQZA 4EPTA 3OJLA 1RI3A 2JI9A 4JT4A 1A2QA 1RM0A 4ENUA 6PFKA 4V1CA 3RCBA 3HA5A 2F90A 1JTVA 3LYLA 3MTDA 1JHVA 1W34A 3L7YA 2FN4A 2PD4A 1QIJA 2GCPA 2XX3A 2ZAYA 3DFFA 3NAGA 1ZYUA 2IV3A 3RFVA 4E11A 3HC7A 4C20A 1RMTA 4YXFA 4EF6A 3RI3A 5JBNA 2GZDA 2VJNA 4A16A 2R0QC 1YR9A 2BMWA 4G24A 2YZNA 3L6CA 4DBLC 4IXDA 4LHVA 3BMQA 1FFHA 3ZE8A 5LYJB 5EHZA 2WTBA 5FIUA 4FT4A 1JLLB 1JQBA 1TB4A 3JAKB 3HACA 3QG5A 1GPH1 4ZVVA 4B7UA 1WS6A 3IBTA 1F0YA 3DFUA 4R9UC 4AI6A 4JGBA 5A4FS 2AX3A 3GFGA 5BR7A 3GCXA 1AF7A 1SEPA 3NFRA 3WBKA 3TCNA 1Y82A 1QV7A 2CLCX 1OX5A 5FBKA 3O7MA 5IW8A 2B4KA 2V9ZA 4OFZA 3WYBA 3VJRA 4KDRA 1FNDA 1MNQA 1RPAA 3ED5A 4R9RA 3X1KA 4J1TC 4GR4A 4JCCA 1XO1A 3I04A 5B2EA 2HHLA 1ZD1A 2A5YB 3VISA 4AO6A 3WQQA 4F5ZA 2Y27A 1LB1B 5DNEA 2BOVA 3GFQA 5EUCA 5CB4B 1M1XB 1HE8B 3C6YA 4MGHA 3G0GA 3KQKA 3SXPA 1TQDA 2C5SA 4XB1A 3ID6C 2QX4A 3MFQA 4CLEA 4TYWA 4U1RA 4Z0HO 1D7AA 1T4BA 1PRYA 3Q10A 3P97A 4B3GA 3Q8WA 3I1YA 1MXFA 1F6WA 2HWUA 2WKSA 3QVOA 2NO4A 1L1EA 1PUJA 3WZMA 5F23A 1O5OA 2OAEA 4PG4A 1VKZA 1E7RA 3DTYA 4PLYA 1I4WA 3P7MA 4JJ7A 3WMWA 4EO4A 1SBCA 1K2WA 3HVHA 3PFBA 3WB2A 3ZWYA 2WF5A 1GQOA 2A35A 1AX9A 1UK8A 2A9JA 4LWQA 1K63A 3P9IA 5K8UA 4D4JA 4Y8VA 4MWCA 1R9NA 3AKDA 3NBFA 1VJ1A 1NP6A 4WHMA 1JP7A 4Z9XA 4ZOCA 1UODA 1JQDA 2PSJA 5EP4A 1JDBC 2VTEA 2CZCA 3KB8A 4W1QA 4IDAA 4EB6A 3CLTC 3PFWO 1RYEA 1X7HA 2AF3C 4U63A 3UUWA 5F7OA 4JDPA 2Z6UA 4TL9A 3ZCPA 5EIBD 5GONA 2D2IA 2XBLA 3RRFA 3V4RA 3KLOA 2EBWA 1DC6A 1GY8A 2Y93A 2ERCA 5C52B 1NFFA 1YZFA 4MULA 3VHRA 2HU7A 4D0NA 1DNPA 2R6R1 4B45A 4JL8A 5E3HA 1AMUA 1EVJA 4HOYA 2UUAB 2AXPA 1LRLA 3AF5A 3IAS6 1BIFA 2QE6A 4OXQA 5DGIA 1CYEA 3H0CA 1KR2A 6REQA 3KJFA 3RUDA 5EWLB 2AFIE 4B44A 2YYYA 4QXQA 3E9NA 4ZICA 1ZWKA 4Q0MA 2O8CB 3LX5A 2W58A 2LKCA 3OURA 4IQ8A 1Z0IA 5FLEX 4D4HA 3JX9A 1ZM7A 2YIJA 3DD5A 3GK3A 3W5HA 1OB2A 2P4EA 2ZG6A 4WKNA 3CVYA 1WV1A 1R4MB 4MYDA 3Q6MA 1E0KA 4UAJA 5CB0A 1JA0A 1NLUA 2YIMA 3PUXA 4N0DA 4J0GA 5BR4A 3MXTA 2ATVA 1KU6A 1NE7A 3PUVA 5AJZA 5G02A 4IIYA 3CLTD 3R44A 4P7GA 3BMNB 4PC3A 3WFZA 3KQWA 2H1CA 4DDTA 1P18A 4OQXA 3ZOZA 1HOXA 2F1JA 4HI0E 2ZBUA 1A1VA 1MT0A 5DU2A 3FTCA 2HW8A 4OHRA 1YMQA 2VT7A 3TRDA 4BMSA 5BUZA 3MK31 3LHKA 5BWCA 3CVOA 2QBYA 4EG5A 2VDQB 3OPQA 2BKEA 4AUNA 3PF8A 2PD6A 3IPLA 5ARBA 5JSQA 2OHFA 1C5KA 3KR9A 2PY6A 2VBGA 4OY3A 4IXTA 3UWDA 2FN7A 2WQ7A 2OLEA 4RC9A 4DZZA 4ECAA 2I6FA 4XJXA 2QW0X 1T8WA 3MJVA 4Q1FA 3E61A 1AU9A 1E61A 5P21A 4AKTA 3IVAA 3VOBA 3U4QA 2VNJA 3B1KA 1S01A 1PGJA 2DVMA 2I2XB 2Y4NA 1IJFA 2HH9A 2IXBA 4CG0A 3SYKA 1FX0A 1UQTA 2Z3WA 3GOHA 4LXHA 3L8DA 1D2HA 4TLAA 5D84A 2UZ0A 3MMZA 1D9XA 2V55B 2GJ9A 5JAHA 1R15A 3DZJA 4D0GA 3R9WA 2WZBA 3GT3A 3OX2A 3RFFA 3R3SA 1CULC 4HXFB 3A1CA 1A4UA 1W36C 1MD9A 1Y6FA 1GNRA 2O1WA 3BD6A 4Q7JB 1L4KA 3O82A 4BKPA 5C37A 1E59A 4BDSA 4HN2A 1W5TA 2XMBA 1T4DA 1P3Y1 1QGAA 3FYTA 3QFRA 1U5AA 4XQ9A 1VCOA 2RD2A 2C2YA 4UFOA 2QLBA 4ML3A 3FKQA 4G56A 4GP7A 3D1VA 4DR2B 1DIGA 2XXAA 3FD8A 3LBYA 4CM6A 5CCBA 1C1DB 1WEHA 3GRZA 3IAM1 4KK4A 4MR8A 4R1MA 4ARUA 4UQOA 5LIPA 5FI5A 2LW7A 3SBOA 3K1AB 1J22A 3TN7A 3OQNA 1KY3A 3WLAA 1RDFA 3CEPB 4JI6B 4LPKA 3PQ7A 1WXQA 2BFCB 2R65A 4QNRA 3DMTA 3PNLA 4X7RA 1L7VC 4O08A 2B6HA 3WYAA 1YOVA 4RORA 1X1TA 3WRYA 1TRHA 3B3QA 3EUAA 1ULUA 2H31A 2XAAA 1OT3A 3B3AA 2ZRFA 1KOFA 1VL0A 3EAFA 3JWJA 5BSRA 2X7XA 3VPSA 4FB5A 3U48A 4BVEA 4INJA 2VVTA 4DLVA 3K0EA 4RDCA 4JLJA 1J2TA 3AV0B 1W9MA 3IIEA 4ZVMA 1QDLB 2HF2A 3RRXA 2BCGY 4FGUA 3NWEA 2I3BA 3AP1A 4IIBA 4MQFA 4W8GA 3U4IA 3VYWA 5JZ9A 2EJBA 1XZJA 2KBFA 2W6JA 1JHYA 3PX3A 5BMOA 2O2EA 3GEHA 3MWGA 3MCVA 1A9PA 1Z5ZA 4H0CA 3EXFA 3GQVA 1A9OA 4ZO9A 4C29A 1WIWA 2GPWA 2WOJA 1WO8A 2D3WA 2W6CX 5D5QA 2RI1A 1GYQA 4LYJA 3WRXC 1V7QA 3IV6A 5BV7A 1D1PA 2HHAA 4PLGA 5F76A 3ZV5A 3EN0A 2JS7A 1HEIA 3V4SA 4EB0A 2O7SA 4RPJA 3KV3O 1OFHA 1UBUS 2FKNA 2ZI6A 3G8CA 5TMBA 2IEGA 1HFEL 2XKKA 1ESNA 1NW3A 5DTEA 1SKYB 3TOCA 1PNRA 2V5AA 1IM5A 4XYBA 1C4OA 2FJUA 2FSUA 2F48A 2INGX 3USCS 3OZGA 5COAA 1NXQA 3RTGA 4O4HF 5C1IA 1SZDA 1J42A 1LKZA 2V6JA 2VYVD 5DGXA 4YUAA 2PSFA 4DV7B 3LFTA 3N39C 2O20A 1FFDA 4B2IA 3ZVRA 1MP0A 2AI3A 2YASA 2ZYAA 3VSEA 3WLFA 3GCDA 4F56A 2E5FA 5JS6A 2CL0X 2QVYX 3GRFA 3IDQA 3I5UA 3Q9SA 1VRWA 5KYVA 2PMEA 3TZLA 4L8YA 4CIXA 1UZAA 1HE5A 3P52A 4AG3A 5DNCA 2HWWA 1H8HA 1N2CE 1LBIA 2FFJA 1F2TB 3CZ9A 2B4TO 3HBLA 2DH6A 4N0EA 4BRUA 2YH2A 1JB9A 3ESZA 4KAFA 3E22B 3EZ9A 3Q7IA 1IH8A 4LQ4A 3R76A 1M75A 5JNSA 2OO3A 2D1SA 2ACEA 2JK0A 2MOKA 4L3OA 3IERA 1XXHA 5DE3A 1JHMA 2BRUC 4TTVA 4MQUA 5LOVB 2VFAA 4GI3A 4O0LA 1Q6ZA 2ZYHA 4I14A 4HRYA 1CS4C 5D6OA 1ZVQA 5HM6A 1UPTA 4GE0A 2IEBA 1GPYA 4C4OA 4HUTA 1JJFA 3NTUA 5A3QA 4J0CA 4MQEA 1VHWA 3TW0A 3TS1A 4DQ0A 4LSMA 4ZDJA 5IUJC 5LZ9A 1MDBA 1C50A 2QUBA 2Y1KA 4NPHA 2JGJA 1JJBA 4F3KA 3EWIA 3D3EA 3Q5EA 4X61A 1OBCA 3FRIA 4QOHA 5LOVF 4G5SA 4L0CA 1U8AA 3FN4A 4HYQA 3L7AA 4P33A 1XYYA 2QZ9A 2HHCA 1HK7A 3I09A 1TT7A 3EMKA 5FTNA 4J43A 4DC0A 1VL5A 2P4HX 4H60A 1E5VA 2MHCA 1V2GA 1UBTS 3WB1A 3I83A 2Y0PA 3W8DA 3IOMA 1RP7A 4E5VA 5I8WA 3QIAA 5LQNA 3RIYA 1FZTA 4HGPA 3TGPA 1FMJA 2DCMA 1E9SA 4DLWA 1RYFA 2BDUA 2WE8A 2X4IA 4JKOA 1YOBA 3G59A 1I2CA 4QJ4A 4QOEA 3JVIA 5T3YA 3VRHA 4QO8A 5G4KA 1KJJA 4N76A 4L08A 1NYQA 1JS1X 1G5RA 2P2CA 4RCVA 3BRWD 2YVQA 5EHQA 1RJ9A 3VZQA 4O4HB 3VDNB 3MTQA 1GEGA 1K0UA 1T1EA 1ZMXA 4ER3A 5CFZA 3FGOA 4US1R 2ZWMA 1U8EA 4JHLA 3TLGA 5AOCA 3CR3C 5LKRA 3KSBC 5T6MA 4PO1A 5LQRA 4B6JA 1JDUA 4ZJYA 5KX5B 5F98A 2CJYA 3DT9A 4OBEA 5AW0A 3PXCX 1UBJS 1YMVA 1IVNA 2ONKA 3EF1A 3AOGA 4M9SA 4KSYA 2XGMA 1S6YA 2XY4A 4PTZA 2BTQA 4GZ6A 1Y4SA 5JUWA 2DWPA 3QEBZ 2JHAA 4BLOA 1B8PA 1T1JA 2RIPA 1YE5A 3KJQA 2YX1A 2ZIVB 1LTQA 2ZJ1A 1GCGA 3VR2D 1ZVVA 4TLLB 4B4VA 1Q84A 1W4CA 3NGXA 3PXXA 3ESBA 2AG5A 3FBTA 4KIUA 1GRNA 4HNVA 1LJUA 3DKKA 1QLWA 1TKCA 1W87A 3N3AC 4KREA 2O23A 1PL6A 4JASB 4YACA 1LFAA 1VYUA 5AUQA 5CDUA 2GLUA 3FDFA 5IVKA 3QI7A 3CCFA 3QHAA 1N0WA 4LZPA 4GOOD 5HIAA 1QAQA 1I32A 3SF8A 1LLFA 3NPMA 1V6CA 3TDMA 2CNKA 4CF6A 1KH3A 3FM9A 5GJVC 4ND8B 2WM2A 4CCSA 3BTSA 4YMHA 3FDZA 2C5FA 5EIWA 1UZLA 1BXZA 4FIDA 3SR3A 4UBKA 1EIWA 4ALMA 2B0JA 4FN5A 3D6AA 4X65B 2ZWOA 3OLYA 3TMYA 1WDMA 3O9VA 3O8OA 5CH5A 2NXEA 3TZBA 4ZHQF 1QHSA 4K05A 1K6EA 4IOKA 2HTFA 3BRQA 4K9RA 2FWPA 4Z1OA 3CY6A 2FH5B 4C6HA 3HN6A 4J0EA 4OCZA 4RL6A 5CMLA 3WWOA 1ADFA 1BE1A 3ILSA 2FSGA 4JB3A 3S5UA 1TW3A 2RFLA 4G01B 2XJ9A 4Y2QA 3JAKA 2ZRJA 1NZDA 3D31A 3LUHA 1RAEA 2OTCA 3MD9A 5LLSA 3VYRB 4N48A 3CLUC 2XMRA 3COYA 2GBGA 3GT4A 4WY8A 5ALWA 2DPXA 4B85A 2AG8A 1M2FA 3CVXA 1SC3A 4Q3CA 4JZYA 3V2UA 5K0ZA 1TUBB 4CDGA 1IUPA 4P53A 3U40A 2AEEA 1Z5GA 1ZLYA 2G9ZA 3TPZA 3OAAD 3AUUA 4MPTA 2O8FA 1WCV1 1G3MA 1P7PA 2WU3A 4GR5A 1E4OA 2HGSA 4AKSA 5GP1A 1T6XA 3HJUA 1FYEA 1H9CA 1PWEA 4AVYA 2M6KA 4MUAA 5EFOA 1EP2B 4BGEA 1ODFA 3PNQA 4F5EA 1HV8A 4ZVLA 1FF9A 1HQKA 4H7FA 3A0RB 4YGXB 3ESAA 3TCKA 1NVDA 5IF9A 1SHZA 2G71A 1F4LA 4ZO7A 3DVRX 1W75A 4LF9B 1GT91 1A9QA 2GO1A 2OD2A 2GD0A 2CBGA 2RHOA 3PUIA 2D0PB 2BAGA 3D8UA 1G60A 3KQMA 2ZSBA 3WQHA 3U16A 4LNHA 3E8SA 1CUXA 4J16C 2GAAA 3AR5A 3VOTA 5KTTA 1P60A 4Z7QB 1C3XA 1EFHA 1ORTA 2ZFUA 1RHJA 2GZSA 1KETA 4OTZA 1NY5A 3ET5A 3M83A 1YHZA 1T15A 1UF9A 4AMGA 1XVUA 2L69A 4CF7A 1NBWB 4KE9A 4UMDA 3ZJUA 2RGBA 1E2JA 1FBTA 1HFKA 2G1AA 5EGNA 3VPGA 2F55A 2XHZA 3QMWA 1T91A 3FDJA 1OE0A 2DHRA 3BWEA 5DNYB 4DGSA 2OMKA 4F2HA 2OV4A 5BSHA 4KE8A 3NVKI 1Q74A 3WTCA 3F96A 1EHIA 1DOHA 3G9QA 1EH5A 2HRZA 3PTZA 1OC2A 1QPBA 1U8ZA 5EXSA 1JUDA 9ATCA 1SXIA 3ONVA 4PBSA 4LOHA 3LT5A 3MBIA 4F4DA 2JBWA 2P2DA 2G70A 1EFRD 1QG4A 1W25A 2Q4BA 2WIBA 4Z2AA 1K06A 1OHHD 2J3IA 3BRWA 4YRLA 1AGNA 4BLRA 3FPGA 1PNTA 3FYDA 1X7WB 3TMAA 3RVOA 2C1EA 4RLSA 3VVMA 3DO8A 1BXGB 1UAGA 4TWAA 3TZQA 3GRPA 3H18A 1J33A 3OKCA 4J29A 3V2IA 3BFVA 3IVRA 1CDDA 1JIVA 3REOA 2PX6A 4IICA 4B2YA 1C4XA 1I0LA 2YQ4A 4PGMA 5FV4A 1WCIA 2XNKA 3CR8A 4IV0A 3UCFA 3AFGA 4GPBA 5EWLA 2CDCA 2RKOA 4OKIA 1GA1A 1XRNA 3GRYA 4HGNA 4P5DA 3R6LA 4JVNA 4L51A 3N8NA 4HNQA 5LDDC 2E87A 1ESEA 3KIPA 3GL9A 4KHZA 3TQFA 2MDTA 5SZIA 1Q91A 2PMCA 3OIFA 1CERA 3SLKA 1ZQ1A 4ENSA 3CBGA 3AZPA 1UC9A 5E2IA 3TQOA 1V71A 4EO9A 2Y1WA 2IQ5A 5DP2A 1PJ2A 1DC8A 4FDUA 4TROA 4MIEA 1M2WA 2CLEB 3NO4A 3EASA 2UZ1B 3FUWA 3DLBA 4LMAA 1DRVA 4MDEA 4OHUA 4HB0A 4Z0TA 3T9FA 3E35A 5MGBA 4Y1GA 3ICVA 5TX7A 4JC5A 4PC6A 5FT9A 5L3ZA 1HE2A 3ELYA 3O2QB 4UTOA 1TAGA 2GM5A 2O57A 3NVMB 1N4AA 3QQPA 4DNPA 4QEZA 5JXIA 4MCIA 2VKTA 1S3FA 2BM9A 1XU9A 2BUCA 2WRZA 5CLLA 5GOZA 4DUPA 2GGSA 2Q5QA 3RC9A 3SSNA 3W8EA 3ITNA 4DF3A 1GQRA 4MLPA 5KPDA 4YPOA 4ZOEA 6ABPA 4YJFA 1I2ZA 1L4UA 2IOQA 3W77A 4X84A 1P7ZA 1IZ8A 1N2CA 3MERA 2FF7A 3SFVA 4G23A 1M76A 5EMJA 2ZRQA 4A7PA 3T9DA 1QPZA 3HDTA 4PU0A 2VK4A 4Q4LA 4E3WA 3UQZA 1ZM9A 4KAXA 3JD0A 1DBRA 4FU0A 4QGSA 4KX5A 3PRHA 2QVXX 3SXJA 3HXLA 3VQTA 5BN4B 4H59A 2V96A 3INTA 4XWKA 1B8OA 1HT1E 3OLZA 1SG6A 1IBRA 3F47A 4KQWA 4WJKB 1QUFA 5E38A 2Q3DA 3B9BA 1JHQA 3D2CA 2H2AA 1TPZA 2E4WA 2QR2A 1ZP6A 2YIVX 1TVCA 1G9TA 2R00A 1YZTA 4DLAA 2HCBA 4FYWA 3Q2KA 2VHTA 4MP3A 3OPYB 4ENRA 5ULLA 3B48A 2OV2A 4KAAA 4DB4A 4MW4A 3WLTA 3PP8A 3VNSA 4DXAA 1Y80A 3ZKAA 2B83A 5LBUA 3HY4A 1U6KA 3OJXA 3IKTA 3ZHCA 4TXNA 5J2TA 4J0IA 4EL0A 4ERNA 1A88A 3MJSA 1W0KD 2RBKA 2AI1A 5FOWA 3ZTWA 1QLJA 1SVMA 4TLEA 4HYTA 1CJTC 1O95D 4KN6A 1ZINA 4KAJA 1NVGA 5JSUA 1GRCA 4EJSC 5HRCA 4R2IA 3N74A 5UKDA 1JLKA 2CL5A 1W5FA 1S2MA 2O52A 3WL7A 1Z4QA 4D4GA 5TXGA 2DZDA 1X7XA 4R1TA 1ZDMA 1FEZA 1OIXA 2J87A 5EJ4A 5JYDA 1D2CA 2QAGA 1V6SA 2IXDA 2QMQA 4QA9A 2FJ0A 2NZWA 3GLUA 3D64A 1N5KA 3JYNA 4H7DA 4RNCA 4UASA 3AUTA 4YJ2B 2KX7A 4JLAA 3KFXA 3SZGA 1MF7A 1NDHA 1NJSA 1UXIA 2JFHA 3N8HA 3Q3VA 4FHZA 3UMVA 1Y0BA 3V7FA 2GTPA 4EYKA 4LF7B 4R7ZA 1G8JA 2XYQA 3IAXA 3GGSA 4PV7A 4DRZA 4F92B 4F3NA 1TX4B 3LYAA 2QVLA 5J43A 1WNFA 1O03A 1DO8A 4IUYA 2AOXA 1Y4AE 1JU3A 1Z6ZA 2Y0CA 3K0HA 3KYJB 3V4PB 5JS1A 1CZLA 2QD4A 5IEBA 4HGRA 2OCKA 1O58A 1XD2A 3O8QA 1V8ZA 4YRMA 3L6OO 1KOGA 1NOJA 3MUNA 3HN2A 1J06A 3KUDA 4O4JA 4QG3A 1UP6A 4FFSA 5KU1A 4B6RA 1AGPA 3CXUA 3LO8A 5CR9A 2H08A 2HYDA 4BWYA 3EOBI 4MKHA 2PSSA 4BGIA 1O5TA 4M1ZA 3K0SA 1P1KA 2W37A 1CEQA 2E3JA 3Q8KA 3ORYA 1IBMB 3DTVB 3J81A 3QIVA 2QDXA 1P1HA 3G2MA 4G8DA 2X4LA 3UMMA 4YBZA 4UTXA 4TSFD 1NI4A 1P81A 3DMPA 1ZR2A 1QIKA 4A1FA 3T7KA 1QVZA 3ECSA 3TBKA 3H5TA 1X9IA 2CWWA 1P4SA 3I9MA 3LUJA 2ATEA 3Q11A 3VAAA 5ED4A 1TVKA 2FCRA 4Q5IA 2DLCX 1JW9B