3JW8A

Crystal structure of human mono-glyceride lipase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
290
structure length
290
Chain Sequence
b'SPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGLL protein
publication title Structural basis for human monoglyceride lipase inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3jw8A00
4BCDA 5ALRA 1IUPA 3FYUA 2HFJA 2JGJA 4UUQA 1LPNA 2XMBA 4QDXA 1J2EA 2AJCA 1BE0A 1CUGA 5EI5A 4UHDA 3V48A 5I8PA 4QE3A 2DQZA 3R41A 3LLCA 3M83A 1AMNA 5LLSA 2VT7A 2XQKA 3F8SA 1VXRA 1FFBA 1XZGA 5HK8A 1WB5A 5D7BA 1DU4A 1Q0RA 1CUVA 2XUDA 2RAUA 4M0FA 1DTEA 3QYJA 5LZ9A 2XUGA 4H7KA 1XZIA 4W1RA 4LHEA 3WI7A 5K5EA 4FNGA 4KE7A 4UBLA 4KE6A 4QDTA 1L7AA 2WTMA 2H7XA 2WFZA 2QJWA 4X71A 3KWJA 2HRRA 1G42A 3VVMA 3VJKA 2WU3A 5HZGA 3I2KA 2WG0A 4CI9A 4AB1A 4X93A 4QZVA 4MWSA 4X3CA 1IZ8A 2BJHA 4L72A 4EY6A 4GDMA 1LPOA 1UK8A 4QEKA 1ZD2P 3CCBA 3QMMA 2XQFA 4F60A 1XZDA 2GBGA 4F5ZA 2XQGA 1DWOA 3GBSA 1JT2A 3PE6A 2XUHA 1YB6A 3IULA 4G9GA 4H77A 1Z68A 3I6YA 2X8BA 5C8XA 4X92A 3F98A 4FLEA 5JALA 1SC9A 2HA2A 2JGFA 1E66A 4FFWA 4UBMA 3WA7A 2ZJ6A 3IBTA 5LZ7A 2WHPA 2WFLA 3LS2A 1EH5A 5AKHA 1YR2A 2CZQA 2XMCA 1ZJ5A 1CUAA 4NVRA 4H7DA 4QA9A 4A5SA 2QXUA 5ALIA 3BIWA 3PI6A 4Q3LA 1MTZA 2XMSA 3FSGD 4WY5A 4MWTA 2ZYSA 1EHYA 4Y2QA 4Y7DA 2BAGA 3ESAA 1VA5A 2W6CX 1SFRA 4IH9A 1QZ3A 4RGYA 1EXWA 2I3ZA 4CG2A 2WUDA 1GPNA 1JU3A 2JGKA 4X97A 3VJMA 2HHAA 4BE9A 4KRXA 4UBJA 2Y1KA 2HM7A 5YASA 4IH1A 4K6HA 3I2HA 1ZOIA 3GZJA 5ALPA 5CT5A 5T4HA 1F6WA 1W1IA 2GYWA 4OCZA 1CPYA 3KXPA 2PX6A 2Y6VA 5T4BA 3QZUA 1CR6A 1ORWA 4J3JA 4ZRDA 1EINA 5AIBA 5AI4A 1J06A 1QO9A 5JAHA 4H7IA 3I2GA 4WY8A 3WL6A 1BEZA 2QS9A 3IVMA 4AO6A 1QJ4A 1QIIA 5AI0A 4UFOA 1HPLA 3CCCA 4L9AA 4Y9SA 2XUAA 1QOZA 1EX9A 1CUCA 1EB8A 4IQ4A 5HF5A 2WG2A 3SK0A 3A2LA 4DGQA 3AIKA 4UFPA 4M0MA 5AM2A 4PW0A 1NU6A 1J1IA 1CUDA 2QVBA 5LZ4A 3WKAA 2VJAA 5HKAA 5FPQA 3FBWA 1HKHA 5CBKA 1Q84A 1QIGA 1ZJ4A 3ZLTA 4X00A 4LYEA 5ALVA 1XZJA 3WWOA 4BAUA 4KAFA 4OUKX 2WLSA 1UZAA 5SYNA 2HU8A 4U2BA 1CUJA 2C0PA 4GXNA 3G9ZA 1BRTA 3MUNA 5CT9A 3M82A 4QLOA 2HDWA 5FUMA 4I3FA 3WL5A 2V96A 1LLFA 1KEZA 5DJ5A 5AP9A 3WLAA 5AKLA 4E11A 1XFDA 4DSAA 2BFNA 2VAXA 4X6UA 4A23A 2HRQA 1DX6A 1GXSA 1PV1A 3I2FA 1LPAB 3DD5A 3BF7A 3B5EA 3AILA 5A2GA 1YA8A 1XZHA 3WZLA 4K5QA 1H2ZA 2PL5A 3R3XA 4OB7A 1N1MA 1B6GA 4QDUA 5JAUA 2Z8XA 2GYUA 4MQLA 1JJIA 4J0KA 4YK7A 4I4CA 5AM5A 4OU4A 3HXKA 3W04A 2WIKA 1XRQA 1ZGCA 3F67A 2HA4A 4Y2YA 3C43A 3RLIA 2H7CA 3BXPA 5ALEA 4J7AA 4QDOA 1UKBA 1LZKA 3G0CA 1BCSA 3K9BA 3QITA 2OQIA 4KACA 1XRMA 1W4LA 4FMPA 4UBIA 4G4GA 4OSEA 5AO9A 2AJBA 1ODSA 2GBCA 5ALFA 5FRDA 2RIPA 5ALZA 1DQYA 4DMFA 2HA7A 3WK6A 5ALXA 5LZ2A 4XVCA 5HF6A 3A70A 4PO3X 3NGMA 5I7UA 5FDFA 5LKRA 3HRHA 1AGYA 1Y7IA 3V1LA 4TGLA 1THTA 1FSSA 4G8BA 3AZQA 3WMRA 4G9EA 3DNMA 4Q34A 4XWGA 3BF8A 1JU4A 4BP9A 3FYUC 5CT8A 5ALMA 3VVLA 2HU5A 2HIHA 3IIIA 4B84A 3U0VA 5AOAA 4GLBA 2RI6A 5BV7A 3D3NA 2X5XA 3DKRA 3D2BA 4N5HX 4UHEA 2VSQA 2BUCA 4F0JA 3A2MA 2CMFA 1ACLA 4Q05A 3QMVA 3R3ZA 3H1AA 4XJVA 5C7YA 2J3QA 3E0XA 1N8SA 3SX4A 2R11A 4KE8A 2OQVA 3E3AA 3G7NA 2W22A 1XZAA 3GFFA 2QRUA 5A6VA 1DWQA 4XX1A 3E1GA 2FX5A 3X3HA 4BBZA 1A8SA 2RONA 3FYTA 1W6RA 2B61A 4CG3A 3LIPA 2QUAA 3O4JA 1P0PA 1R50A 5ALQA 2HA5A 1GPLA 4B6GA 4C88A 4Y2JA 3ANSA 3EIOA 3WWPA 3G0IA 3FNBA 1S8OA 5ALNA 2OLEA 4BTLA 3ZWQA 2ORYA 1G66A 5ESRA 2XUOA 3H1BA 2B9VA 1LPPA 5JASA 2HA0A 5HFNA 4JEIA 1GZ7A 2WIFA 1KU6A 5ALGA 2QT9A 4WJLA 3MUOA 2OCGA 4N8EA 5CW2A 4BCCA 1U2EA 1YA4A 2JGLA 4PSDA 4U2GA 5JZ9A 3ZLVA 2JGMA 1VJ5A 4EY5A 2RHWA 2VJCA 5AI8A 4HRXA 3I2JA 4QWWA 3C8HA 4B9AA 5BWBA 3H2HA 4DM7A 2HA6A 4FTWA 3HLKA 2GBIA 4UPDA 2JBWA 1QTIA 3LCRA 4DIUA 3ZI7A 3V1MA 1GKKA 3UUEA 5KBYA 5LIPA 3WJ1A 5CXXA 1MX1A 4PQEA 4B0PA 2PVSA 3AJAA 3H2KA 5E4YA 2XQJA 3JYHA 4B80A 3EQ9A 2O2GA 4W9RA 3G9UA 5K3FB 3ESCA 1QIHA 1MX5A 2OCKA 2VT6A 3I2IA 1E89A 2BGNA 4MXDA 4GI1A 4G4IA 2ECFA 2ZJFA 3AIOA 1PJAA 4OB8A 5A7FA 5ALYA 2YXPX 2NW6A 2YH2A 3L1HA 2WIGA 3STWA 1Q0ZA 4IH4A 1K5PA 4EZIA 5AM1A 3K2IA 2PU7A 2VJBA 4WCVA 5K3BA 1R9MA 5IVIA 1BS9A 2PUHA 5ISMA 3YASA 1W75A 1ZD3A 2X76A 2B20A 1T2NA 2OGTA 3FCXA 3SC2A 4JUIA 3W06A 4DNFA 3DS8A 4W1SA 4JH0A 3H18A 1UKCA 3HI4A 3F96A 2AJDA 4YASA 4KRYA 2BCEA 5AKZA 4OYYA 1AQLA 1VA4A 1EA5A 2DSNA 1YCDA 3KOOA 5FP0A 1UK9A 4B81A 2XUPA 1ZI6A 3IURA 1MJ5A 2XUKA 1TRHA 2B4KA 1X2BA 3LIIA 2CBGA 5C81A 5ALWA 3W05A 3KD2A 1CUIA 4BZZA 5FPPA 5IVDA 3VISA 3DEAA 1ACJA 5JAOA 5JANA 5AHXA 2ZJ7A 5IKXA 2CJPA 3VXKA 3RM3A 2ROQA 1FFAA 1ZIYA 5CT6A 3I1YA 4P08A 3WKBA 2CKMA 5EIAA 3OC0A 2V9ZA 1RP1A 2QZPA 4AQDA 3S2ZA 2R8BA 2WJ4A 3I28A 4U2CA 3OTQA 1GQSA 1U4NA 5KREA 4U2EA 3SWWA 1BCRA 3ILSA 4IO0A 4KYVA 3V9AA 6YASA 1BEEA 2VA9A 4DMCA 4JYMA 3O4IA 3S8YA 4J0GA 5HFAA 5AOCA 3UMJA 1GQRA 4X90A 4H18A 5I9IA 4JYPA 4C4XA 5DLPA 3R0VA 2J3DA 3ZLUA 3AINA 1CUUA 1MT3A 3FCYA 4GWLA 2I03A 4OU5A 4G1FA 1OCEA 4MYSA 1MX9A 1YAHA 3FWHA 1UOQA 4ZI5A 2ZYHA 2PKYX 3JW8A 4MEBA 5CMLA 3AZPA 3DQZA 3I1IA 3WK9A 4AMZA 4AZ3A 3FLBA 2WHQA 2IIVA 1E8DA 3C8DA 4JNCA 1ZD5A 3DL7A 5ALLA 2PSFA 3DKKA 1CUZA 2YYSA 1WPXA 2OPHA 1D07A 4EB0A 4CCYB 4LIPD 5CH5A 4H7FA 1FFCA 2C0QA 3ICVA 2ZVDA 1AZWA 2WQZA 1W52X 4N8SA 3BJRA 4NZZA 4ZXFA 5ALSA 1H23A 1NU8A 1A88A 3DYVA 3IUMA 3PUIA 4BTVA 3R3VA 4XIIA 5CRIA 1R9NA 1LGYA 3ESDA 1ETHA 3OURA 3PICA 4J0CA 1YB7A 3EQ8A 3I6MA 1MNQA 5C8VA 1QIDA 3TGLA 4FBLA 3FLAA 1EI9A 3BIXA 5AM3A 2OAEA 4EY7A 4J0IA 1EK2A 1R88A 3WKEA 1ISPA 1GPKA 1WHSA 5DYWA 2XT0A 1XRRA 2XUQA 5FOQA 2WIDA 1O6GA 2K2QB 1P0QA 1CRLA 4WFIA 5JZBA 4C01A 1DQZA 2VATA 3AFIA 1CUHA 1EDEA 1BROA 1TCCA 5ALJA 3M3DA 1TCBA 4BRZA 2OXEA 1F8UA 3IUJA 3NOXA 3WK7A 1C7JA 1C7IA 2Y6UA 3OPMA 4LKOA 2AXEA 2DQYA 4A16A 3IUNA 4L3WA 5JARA 4EY4A 4AX4A 1JFRA 3D2CA 4C89A 3RKSA 1OILA 5K3FA 1GGVA 3RARA 3IB3A 1JMYA 4QNNA 4UBNA 4W1PA 2C7BA 1VKHA 1X2EA 1WHTA 2Y2VA 1R3DA 2JEZA 5EIHA 3WJ2A 4ZREA 4GEGA 4BDTA 1CVLA 3WWDA 2VJDA 3H19A 4UFNA 2PPLA 4I19A 1HLGA 3EBLA 5E2IA 3C6XA 5AK3A 2BUBA 4Y2VA 1DWPA 3ZV7A 5EHQA 4BVJA 1H2YA 4ROTA 3KWFA 1PFQA 3FVTA 2QMQA 2AJLI 1HBJA 1EK1A 1UK6A 2CUTA 4ARAA 1E8MA 5ALOA 3GELA 4UBOA 4OYLA 3MVEA 5ALTA 4P93A 2Z8ZA 4FDMA 3W2TA 1QTRA 1G5FA 1R1DA 4EBBA 3H0CA 2Z3ZA 4LXHA 4HS9A 1WB6A 4Y2RA 1MO2A 1IUOA 1NX9A 2O7VA 5JAPA 5T4FA 2FJ0A 1QIFA 1SCQA 2GZSA 3DLTA 5JADA 5E4JA 2XMQA 2FJPA 2ONCA 3L1IA 4Q82A 2V98A 3G0GA 1P0MA 2G5PA 1K4YA 1H2XA 3P2MA 4X91A 2Z3WA 3D4LA 2VTVA 3HABA 4NS4A 2XMZA 2QOEA 1YS2X 4CIAA 5ALHA 4DNQA 2GYVA 3O9MA 1YASA 4FOLA 1LBTA 5DYTA 1SCIA 4UHHA 1TK3A 1U8EA 5C8ZA 3I6ZA 5SYMA 2I3DA 2WTNA 4C6HA 2PSJA 1EVEA 1CQZA 1LPBB 1J07A 4QWMA 2E3JA 4UHFA 2PUJA 4UHCA 1T4MA 3T4UA 3WK5A 1UXOA 1UOOA 3D2AA 4WDQA 4J0JA 3D0KA 4RE5A 4U2DA 2J4FA 4B9EA 2EDCA 1QONA 4ZV9A 5JATA 2VEOA 5DYYA 1MU0A 5DTJA 3PFBA 4O08A 3V1NA 4DSZA 4X7BA 1YAJA 4FHZA 2G63A 1XRLA 4P92A 5EFZA 5AI6A 1AC5A 3R3WA 1CEXA 1XLUA 4EY8A 4DYHA 1CUBA 4AO7A 1HDEA 2QM0A 2Z5GA 5CT4A 4PSCA 1C4XA 1U65A 2OAGA 2H1IA 4HRYA 3STTA 3O4HA 3RK4A 4J0HA 5CTAA 1K8QA 5DTIA 3QMWA 4BVKA 3G9XA 4CCYA 4AN1A 3PUHA 3FSGA 4B85A 5BWCA 3WL8A 5ALUA 4K2AA 2DFPA 3WYNA 5CH8A 2O7RA 4Q1VA 3JWEA 4YX9A 1LZLA 4D9JA 5D3ZA 4BAZA 4E46A 3PFCA 3R40A 1QIJA 4ITVA 1ZI9A 3L1JA 5F4ZA 4BP8A 1CUFA 1IMJA 2XLCA 2H7YA 3QM1A 2XUJA 1CQWA 5IVHA 3N0TA 1CFJA 4E15A 4AMYA 2EDAA 2HADA 2O2IA 2OGZA 3A6ZA 5HK9A 4C87A 1JMKC 2GZRA 1XLVA 4WDRA 1Y7HA 4MQMA 3QPDA 2D5LA 4CFSA 5AI5A 3H2IA 4X95A 1XZMA 5AOBA 2PSDA 1TCAA 2ZYRA 4LYDA 4QLAA 3WL7A 3ANTA 2WJ6A 4X6YA 4AZ0A 1Q83A 3ZPXA 2WFMA 4FWBA 4M0EA 1EDBA 3WIOA 5J3JA 1QFMA 2V97A 3WWEA 5LP1A 1JI3A 4G5XA 3FAKA 2QTBA 2OGSA 1VXOA 4MEAA 1B41A 1WB4A 5AKXA 3HJUA 1USWA 1A7UA 4BATA 4TVKA 1QLWA 5D3KA 3PDCA 5AK4A 1MAAA 4ZWNA 2O2HA 5DNUA 4KJXA 5AKKA 4QDZA 4BB0A 5HQ3B 1A8QA 2BKLA 5K3CA 4BE4A 3D7RA 4J03A 2WJ3A 4HXFB 4GECA 1EDDA 5AK6A 4KAAA 5FV4A 3VDXA 4C4ZA 4Y2TA 1XKLA 2PU5A 1YS1X 5K3AA 5A7HA 1ZIXA 2WUGA 4FLFA 4S0XA 4H35A 2C5GA 5IVKA 3G9TA 3UUFA 2OCLA 5KWJA 4W1QA 2Q0XA 4H7EA 1XZLA 1UWCA 4BZWA 2HL6A 4FFVA 3C6BA 2WILA 7YASA 3FVRA 4RE6A 1K6EA 1G4HA 5BOVA 3WYDA 5E4TA 4B0OA 2XDWA 1W76A 1EB9A 1XQYA 3B3QA 1XQVA 2XI4A 3STVA 4ARBA 4X85A 3R3YA 4U2FA 2JEYA 4EHBA 1E3QA 3H2JA 3D59A 1CUYA 3VJLA 5EHNA 1ORVA 5JD4A 2XE4A 2XMDA 2EEPA 3NUZA 5CXUA 4FLMA 4MYDA 1DT3A 5A62A 2P8SA 2LIPA 5ALDA 1DX4A 1GKLA 2DCMA 3O9VA 4X94A 5AK5A 3HEAA 5HCUA 3DOHA 1OXMA 2D0DA 5AI9A 4W63A 3CN9A 2PSHA 5AM0A 3AZOA 2ZYIA 3IUQA 1IUNA 5AH0A 1UK7A 1KU0A 1UKAA 4NMWA 1ZI8A 5AKEA 3B12A 3G0DA 4X6XA 1XZFA 4Q3KA 5H3HA 1O6FA 2VAVA 2QXTA 1XQWA 2WHRA 2QKYA 3AIMA 4EUSA 1VLQA 1TIBA 4P9NA 3DYIA 3ESBA 3HC7A 5AM4A 3EQ7A 1XRPA 2DR0A 4HZGA 3H17A 2PSEA 4AXBA 4GHWA 2QUBA 1I6WA 3WA6A 2FUKA 5D6OA 4GBGA 1MPXA 1FFEA 2Y2UA 2JGEA 5K3DA 4RPCA 5JD6A 2HA3A 5HKBA 1WPRA 2DHCA 3BJMA 5AKJA 2ZSHA 4HTAA 2IX9A 4B82A 3C6YA 4J0DA 3DJYA 5K3EA 1QGED 3WZMA 3CN7A 2XQIA 3C45A 5HF9A 4N5IX 1DINA 5T4EA 1MAHA 2VF2A 1QIKA 2QR5A 4GW3A 4DNPA 4UHBA 5JIBA 4BYMA 4K6GA 1A8UA 5FLKA 3PF9A 1CLEA 1ZICA 3WKDA 3F97A 3O0DA 3C70A 4B7ZA 2XUFA 4B83A 1M33A 2XMGA 3O4GA 1UOPA 3GUUA 4FBMA 3D5EA 3R3UA 1F0PA 3WK4A 3DDUA 1IZ7A 4WFJA 3FYUB 1THGA 4KEAA 3Q8WA 2CB9A 2ES4A 4RNCA 3U1TA 1LPSA 4DNOA 3QH4A 3HSSA 3W9UA 4BC1A 1HQDA 4V2IA 4MJ3A 2WUFA 1DT5A 2J4CA 1L7QA 5LKAA 3STUA 4L0CA 4HXEB 3G0BA 1GT6A 3QPAA 4PSUA 4BC0A 4LXIA 2RHTA 1LPMA 4FKBA 2H9YA 5AIAA 5DWDA 1TKRA 1E5TA 3QBJA 4ETWA 4BVLA 4AN0A 4BRSA 2G5TA 5IH7A 3C5VA 3IA2A 2XMRA 1XQXA 2G4LA 2JGIA 4BCBA 4EA6A 3DOIA 1XKTA 4AO8A 1QO7A 1ZD4A 1JJFA 5EHZA 2JF0A 2WG1A 1UFOA 1H2WA 3C87A 3BE8A 3TEJA 1ODCA 3ED1A 1SOMA 4K6KA 1XROA 3N2ZB 1QFSA 2IITA 4TPKA 1IVYA 1BN7A 3WIBA 1Y37A 1WCYA 3BWXA 1XZCA 5EGNA 4G8CA 2AJ8A 5CURA 1QIMA 4Y2SA 1ODTC 3BDIA 3MGAA 4INZA 3DL4A 1XZKA 5JD5A 1N5RA 3H2GA 5LYYA 3W9BA 1K63A 5EHXA 1RYYA 3C6ZA 3BL8A 4PV7A 1P0IA 3GROA 4IHAA 4G4JA 4H7JA 5AKGA 4Y2XA 5HQ3A 4PF1A 3AUKA 5CH3A 1TQHA 1MNAA 1VOTA 1WOMA 2ZSIA 2WM2A 4HVTA 1XLWA 4OB6A 3HACA 1XZEA 4Y2UA 2I78A 1AURA 4CIBA 3GA7A 2WHPB 2WFLB 4ZGBA 2PM8A 2CEKA 3KSRA 3E4DA 5LZ8A 3WWCA 4CG1A 1F0NA 4F21A 3LP5A 4FNMA 4BDSA 2OG1A 5FKJA 1E8NA 5AJHA 4CCWA 1SCKA 1XRNA 1VZ2A 3V1KA 3STYA 3TRDA 4DTCA 4DLNA 4LXGA 3K6KA 3OOSA 1QE3A 4Z49A 3G02A 1VZ3A 1WM1A 1TAHA 2XB6A 3C5WP 1R4ZA 2WU4A 3QVMA 3CXUA 2WKWA 3HYSA 5DNWA 2GBFA 5JZSA 3DCNA 1MN6A 1HL7A 3F9CA 3A2NA 2VQ6A 1AUOA 1AKNA 1FFDA 4HAIA 3G8YA 5JYCA 4UBKA 2HFKA 1FJ2A 4KR0A 3WK8A 3EF3A 2XLBA 2C5FA 5FXMA 3BDVA 4Q3OA 2WIJA 4ZV7A 4C4YA 2JIDA 3KDAA 5EIEA 5AKIA 4HXGA 4OD0A 5HF8A 1CUEA 1JKMA 3M81A 2ACEA 2OCIA 1VE7A 3OG9A 3T52A 4PNZA 5A71A 1QIEA 2RGUA 5AKYA 3TJMA 1BU8A 3O95A 4KE9A 2DHEA 3Q0TA 4H0CA 4E14A 4G8DA 2BGRA 1H22A 3FLEA 2WSLA 3ICWA 5A7GA 3STXA 1JJBA 2C58A 2BUAA 3PF8A 3VKFA 1N5MA 1LNSA 3FOBA 1X70A 3WKCA 1CUWA 1CIJA 1ZGBA 4YPVA 2DHDA 2YASA 4H7HA 1CUXA 1CV2A 1UT6A 3HZOA 2ACKA 4KAJA 5DNVA 3WQHA 4N8DA 2QJRA 3NWOA 5ALKA 5LZ5A 4Y2PA 2HU7A 1YSCA 5AICA 2UZ0A 1AX9A 1CUSA 1EVQA 3IDAA 3OM8A 4BAGA 4OPMA 1XZBA 1BN6A 4DMKA 1RWQA 1LBSA 1VE6A 2WUEA 5KWIA 2PBLA 4DMHA 2XUIA 1L7RA 3H04A 4WFKA 3QPCA 2C4HA
chains in the Genus database with same CATH superfamily
4FSHA 1XELA 1DG9A 3N0XA 1Q1ZA 3E53A 4BNZA 1LJ8A 3FPBA 2V59A 2D2VA 5ALRA 1CR4A 1I4EB 1OZ0A 4CKWB 5JPIA 4OHCA 3WL3A 1WXHA 1HYBA 6REQA 3TGPA 4GS5A 3UAOA 1SCBA 2G80A 4JB3A 4TLMB 4B4DA 4CT5A 4MRVA 2NAPA 3RSCA 1JDJA 3BQ9A 2WAXA 4D4GA 4ZPXA 1BE0A 1D4ZA 1GHTA 1T1SA 4WZZA 5JXIA 1A95A 5D7NA 1DQSA 5CNKA 3EQ2A 4DKXA 3NLLA 2GASA 3DDHA 1CEYA 3SKYA 1VB3A 4TT8A 3L4JA 3KR9A 1G5PA 2DQZA 2XT6A 3L6UA 3N8DA 1PG2A 3OF5A 3PGJA 5LDGA 2YRWA 3LLCA 1V9SA 3MTGA 1JAHA 5IZCC 4M0DA 1AMNA 5LLSA 1MB3A 2VT7A 2QLBA 3CBQA 3F8SA 4M1EA 5G0WA 5K0NA 2GN6A 3HS3A 4K2HA 3JZMA 4HLNA 4PYNA 2CUNA 4M8IA 2P6OA 4L73A 4EQ6B 4LYHA 4DN6A 3DTYA 4RLHA 2EERA 5AUOB 3PXEA 4TL7A 4YVFA 2VDRB 5LOVA 3LGXA 3JY6A 1DTEA 4YN3A 4M9UA 1NM5A 3E1SA 3RAFC 2XUGA 3ENWA 3RC8A 4I4TA 4K9PA 3RS9A 2YNMD 4FNGA 1HZZC 1GA1A 1K8XB 5JC1A 4AICA 4LCEA 4IHJA 4LK3A 3QEJA 1NP7A 3CMMA 1OB2A 2H7XA 3TR5A 2ZGVA 1NYRA 4L4RA 3M34A 1O97D 1X1SA 4OYRA 3CB4A 2D7DA 3MIZA 2WFZA 1YHNA 3BRCA 3M6FA 3MT8A 2QJWA 3NC0C 1RLMA 3WGQA 4MYRA 4DBLC 1JT9A 2R7MA 3AF0A 2O3TA 1PX0A 2G7ZA 2B37A 1T9ZA 2HIGA 4HI0E 2BE7A 1KRHA 2ZRBA 2ZSDA 3TTWA 4PR3A 4QTYA 1DIHA 4WNCA 5JE8A 3MFYA 4AG6A 4HH4A 3V2UA 5JRDS 3GLHE 5I7RA 5DIFA 1XHFA 2C2GA 2DF8A 2BGGA 4RAQA 3PTAA 3R8CA 3T5TA 1Z7BA 4MA4A 4PZUA 4WFQA 1KMQA 4WXPA 4HFJA 4FN5A 4X93A 5AVOA 4QZVA 5G0SA 1W48A 2BM9A 2CF6A 4LBVA 5CPFA 5F3DA 4P7JA 4BBJA 4KVFA 4C3OB 1Z13A 3OCCA 5D3MB 3L7AA 5TF0A 4X3CA 1IZ8A 4DLUA 3IR6A 3BWEA 4GR5A 4LZAA 3KLNA 3G2LA 3EC7A 1H6DA 3MCWA 4FC6A 4GDMA 4R98A 4YHBA 1MORA 1YQ9A 4HH0A 5ETJA 3T8YA 4AKGA 2CHGA 1ZD2P 2P6NA 1A7AA 4HY3A 1DJLA 2HGZA 2XQFA 1JHQA 2GBGA 3L9WA 3NPMA 4AKEA 4F5ZA 4YMWA 1J9ZA 4TTIA 4DZRA 3KHTA 5LB4A 3PE6A 5FTLA 1Y5IA 4DDTA 4CDNA 4KXWA 4JI8B 4DYVA 1IULA 3C3MA 4UM5A 3I6YA 3RSSA 2X8BA 3TMKA 4B6SA 3E7PA 2WP0A 1TEXA 1QUEA 2DULA 1I4LD 2RBGA 2PUGA 3AVTA 1XMXA 3RSLA 4EPYA 4X92A 3F98A 3H3XA 1D04A 1N2ZA 1NRJB 4OI0A 2HKIA 1C7QA 3LBIA 1XCGB 3NTRA 3PZRA 4LQDA 1TJNA 4E1VA 3I5AA 4IUBS 3K9NA 2HA2A 3HWWA 3QW2A 1TTTA 1ZXBA 3UTCA 2HSZA 3EIFA 3B8HA 3KKNA 4OOFA 3HUTA 3JQFA 3PV0A 1WRBA 4GOXA 3IBTA 2E7ZA 4OMUA 2EBUA 1CFZA 2GNAA 2HBZA 2FPRA 1MVOA 2A67A 4AF8A 3U09A 1PJ8A 1J7JA 2C2HA 2WAOA 2GJAA 2WJPA 2YCBA 3LPLA 3N7TA 3OLVA 1VI6A 4DADA 1XMQB 1SAYA 3UCEA 1EH5A 3H5AA 1IEVA 1N25A 3I4LA 3SSNA 2HLDA 2NAFA 2CZQA 5BSUA 4BEBA 1D7OA 2GJKA 3GRPA 4G1BA 1NJ5A 1CUAA 1NXSA 2F43B 1FXSA 3NU1A 3RWBA 4BB5A 1U8FO 2FPSA 5F12A 3NVKI 1NNI1 1YZ3A 5EMHA 5BV8A 1ZXXA 5C3UA 4QA9A 4I55A 4M6WB 3D8BA 3GJ7A 5KYXA 5CB4B 4A5SA 1NVDA 2Q1XA 3DVAA 3NWPA 3ZE8A 3BIWA 1BGXT 2QVYX 4GP9A 3EVGA 1JHVA 3BVPA 1LKZA 4AUEA 1UCFA 2D0IA 5CU7A 4C6SA 4J1SA 4F1KA 4H1UA 4QOJA 1MO6A 5BYAA 2NADA 1R8YA 3GVIA 3OT1A 4BV8A 2HMSA 1JIKA 2B1IA 2QN3A 4WY5A 4Q9JA 3G5UA 2VQ3A 4JOSA 4CLRB 1RXSA 1ADGA 2EZUA 2YR0A 2ZYSA 3H6GA 3O31A 4QFDA 4YT2A 5DN6D 2OK7A 4Y7DA 1ULSA 1UBTS 3AUXA 1IMOA 4FDLA 4PYMA 5IS2A 4YR9A 1UC4B 1KQFA 3IP6A 5AVYA 2B9EA 1QZ3A 3O4RA 2HO4A 3DZGA 4MQEB 2HWKA 3KP1A 3ZXUB 5I7HA 3E8XA 2I0FA 4P82A 3I73A 1XTQA 2PJRA 5FTKA 1NJ1A 3K09C 3GQBB 5J2UA 5PNTA 3CX3A 1P2VA 1D2GA 4KRXA 4UBJA 4FP9A 1UMCA 1IXZA 2PZLA 2Y1KA 3MMZA 1GA4A 3FAZA 4IV8A 4K6HA 4RWEA 5J2TF 1ZOIA 1TZMA 2ATXA 1VIAA 1YVUA 1B6SA 2VS1A 3G17A 5JSZB 2PQ2A 2COUA 4PX5A 3RF7A 3KXPA 1SU8A 2XKBA 1Z7YA 3HDJA 2FOXA 3WE7A 4CJXA 5EAIA 5EJ2A 2OAQ1 2V6IA 2R00A 2VSXA 2F9FA 2Q1TA 1RVV1 4XLZA 5JTTA 5DNEA 5F21A 1KRWA 1QC5A 1W9HA 2G04A 1UJMA 2XMPA 3FHJA 5EWJB 3BAZA 2H4ZA 1BD3A 1Y6FA 4C06A 1R0SA 1K75A 5LVAA 2WJYA 2IH2A 1CRZA 5GP1A 3PVCA 1P2SA 3B20A 2BR4A 2IYSA 2WWIA 3MG9A 4P83A 5AI4A 3ZE9A 4D6XA 3O8DA 4C4SA 3DB1A 5KINB 1TF5A 1ILEA 3A9UA 3L8GA 2FUG6 3EGIA 2XZDA 3ODPA 2VZ8A 4H7IA 4HZUB 3U3OA 2R4QA 3P9QA 4Q3CA 1M1YE 3UT6A 2XEXA 3X1XA 1W85A 1QANA 5LPNA 2IYOA 1KOJA 3WL6A 5F3RA 4YCDA 2PN1A 4ZI2A 3IVMA 2D5CA 4IIJB 5GONA 1PN3A 1VPDA 4ER5A 5AVTA 1DKNA 4FYYA 4NAHA 1QIIA 2XDQB 1KTVA 4F04A 2TMGA 2SECE 3LT0A 2H4HA 4K7JA 1E3WA 2J6CA 4WVLA 5CFZA 2BEWB 3IR7A 1QOZA 1CUCA 1HTWA 2C03A 2R97A 1UFQA 4YJGA 3BXFA 5BR1A 3KNZA 1Q15A 3MCVA 5GZ6A 2DTXA 3O73A 4DGQA 4Z7JA 5ICCA 3AIKA 4JJGA 3C97A 3PEYA 2HCBA 3GLIE 2VH1A 3EIUA 4Z7OB 2ZTSA 3ISVA 1QGAA 5CEFA 3DR5A 3RUEA 3SEFA 4IUCS 3ZJTA 3IA7A 5LZ4A 4WNAA 5BO5A 2AE2A 4D3FA 1A9TA 3FBWA 2VBGA 5FPQA 4ZVUA 1AO0A 2R2AA 5FFNA 1NF8A 3UMBA 3T0GA 3GD7A 1LW7A 1QIGA 3TW4A 3WLKX 5FX2A 5LDHA 3QVSA 2FMHA 3QVLA 3RAPR 1OF1A 1YZKA 4MR9A 4X1YA 2P0AA 3R2JA 4BAUA 4B31A 4EKGA 4OUKX 2WLSA 1RHRA 1UFRA 3JAWB 2AYXA 3N05A 2HUNA 4Q00A 4U2BA 4LSWA 3TW0A 1N3LA 1U0HC 2EVWX 1PKXA 3N7AA 4HAVA 1SR8A 3MD0A 5HMMA 5IAAA 2R6GA 3G9ZA 3PHGA 3K20A 3A3PA 1XVIA 4URUR 4OMFG 5FLXA 4C6TB 4EAQA 1R0XA 2PGDA 2HDWA 1OH6A 2E87A 4LF8B 4HDRA 3ANNA 3CSDA 1DE0A 4J9VA 3EC2A 2P40A 2Z4RA 1BC5A 3FB4A 4ZZ0A 3LT1A 4ONEA 4M8SA 3CRVA 5EJ8A 3O2NA 2FUG1 1L4KA 1MJHA 2JK1A 3N8NA 1JE0A 5AKLA 1AKVA 3BH7A 4E11A 1NT4A 5FNVA 1IEWA 1NJ6A 3PXCX 3FHCB 1DRKA 1RJFA 2MR5A 1YZYA 1SCNE 2ISSD 3EISA 1WR8A 1CQXA 4UKDA 1SHTX 1EGHA 3I2FA 1HO3A 2C7VA 2JLCA 3L5KA 1QFYA 3MSXA 3B6EA 3B5EA 2C3OA 3ASVA 4O8ZA 1Z4KA 1U3FA 1JHXA 1PJLA 3DE5X 3BE6A 1KMHA 4P33A 4XD2A 3AL2A 2WU1A 3GZTB 5DW0A 3D6HA 1CJTC 4LF5B 1F7UA 1YQEA 2OA0A 2O4CA 3IP7A 4BNGA 2V7VA 4CKWA 1TX4B 4OATA 2ZXUA 3L8FA 4UNIA 3JQEA 4F6LA 3KXLA 2GYUA 1JJIA 2FUEA 4Y7CA 5A0TA 3H99A 4PN3A 3QNUA 4RF4A 4I4CA 4YRAA 1DCTA 3AL3A 4P31A 3VSCA 3ZE2B 3HXKA 4DEVA 4E1AA 1JFSA 2WIKA 2Y71A 4KPUA 1DBSA 4IZIA 5CGQB 4ZVOA 3HJRA 4PC1A 4V39A 3RAEC 4OJKA 2Z9BA 4TKZA 2O4UX 5ICGA 1M6NA 3O9ZA 2PZBA 3TLAA 3C5EA 4HNSA 3PWZA 1YC5A 3EQZA 3RLIA 4RIGA 4EP1A 4Z4FA 3BXPA 1T1GA 2FG5A 2HLNA 5ALEA 1U0FA 4KV9A 4KPFC 4FQ5A 3A05A 4LDPA 1GPMA 2WMNB 4QDOA 3PPYA 1E99A 5KHLB 1JXQA 5CK4A 1LZKA 3FRIA 3G0CA 1BCSA 1DAGA 3DFZA 2P3LA 3K9BA 3ZZUA 5JNTA 2OQIA 4ZYWA 2QX4A 3GCXA 4D4KA 1KH2A 2XJ4A 3BD6A 1Y3BE 2DQKA 3DYBA 4JLDA 2C4KA 4HMOA 1TUIA 3RTGA 1MQSA 2CXHA 4JHXA 1IM2A 3VNBA 4EQ6A 4YAGA 1I7LA 1VHLA 4R3UC 2GCIA 4HV4A 1EXDA 1BKYA 4G4GA 4JUBA 1EUQA 3TQCA 2BDEA 3AUUA 4GMXA 4U6NA 3EJWA 3T95A 3VO1A 4N48A 1RWBA 4ALJA 3QE0A 3T34A 3ZNPA 1G5TA 2HU2A 4BEJA 1O8CA 2RIPA 3FR8A 1R5OA 4UNQA 1DQYA 2QRJA 4L5IA 2G70A 2ODEA 2GBPA 1NBIA 2H51A 2JEOA 5LZ2A 4CKYA 3ENZA 3CUSA 5D5PA 2A0XA 1Z6QA 3D3QA 2IZ5A 3LDHA 1QH1B 3MT7A 3A70A 1GUAA 2DY1A 4PO3X 3ZK9A 5I7UA 1FP1D 3RRXA 1JX6A 2IZ7A 1E7SA 1IQRA 1V8BA 1PW7A 2PRZA 3KUKA 1MDBA 5FWDA 3CNNA 3KJXA 5TLSA 1WXIA 2EBHX 4BO0A 3L06A 1FA9A 3JWIA 4Z4GA 1XC7A 5LD2C 4JVNA 4URVR 3SDBA 1AUXA 5CVEA 5B64A 4C07A 3V1LA 1P5HA 5IASA 4RA6B 1THTA 4BWYA 3AKYA 2OCAA 4W7IA 4BASA 3VR5A 3O3OB 3ENQA 2ATIA 5ADUS 1K6JA 1LQTA 2W6NA 4QOEA 2AKEA 4GP6A 4LHYA 3QJYA 4G9EA 3DNMA 2WK1A 4FHDA 1D6NA 2WPNA 4XWGA 1JSXA 3PQDA 3O2QB 3JARB 2R8XA 1G1MA 5D3MA 4DRXB 1GD1O 2A3RA 1VLJA 4BLQA 3I8OA 3MUEA 3ETGA 2NSDA 5FBRB 4BECA 5EKXA 2JLWA 3FYUC 5B12A 5CT8A 2NSHA 3H75A 2JJ1A 5ALMA 3U17A 3VVLA 4LZZA 1QZXA 5C1PA 1VB5A 2EWWA 2MSLA 2HU5A 2FVYA 3LX8A 1RZVA 2HIHA 4GQBA 4Y98A 3WHIA 3GV0A 4R1TA 3IIIA 4YECA 1OR8A 3PUZA 1D6MA 1HEIA 3ROKA 2NNWB 1KYTA 2LCQA 2Q1WA 4KWHA 3TNFA 3V8NA 4W8GA 2OT3B 1ZMXA 1FJGB 4WKBA 1JSZA 3U0VA 3SQDA 5KTOA 2AZXA 1GG2A 3TSZA 2FDXA 3P9XA 2RI6A 3OZGA 2UV8A 5T57A 4EHDA 1G7SA 4HQ6A 1IG0A 3EZ2A 4ZDJA 2BDTA 1LNZA 2DKOA 1LU9A 2HK7A 3HPRA 4C4AA 1Z39A 3U4CA 5SZIA 4BFWA 2Q5QA 4UHEA 2OD2A 3IQFA 2VSQA 3PXXA 4G37A 4HFMA 4L3OA 2ZI5A 1A4IA 2EZ4A 3T3PB 3ZCXA 2ZKIA 4CNBA 4K88A 3OVMA 1SUSA 3I09A 4EMBA 5BUZA 2FR1A 3L5OA 4K6MA 2HCTA 4B34A 5D00A 1HDYA 1X1AA 2B6HA 1KKUA 4JSYA 1MC5A 4MA5A 3E0XA 4YP1A 4L7VA 2I4TA 2OV1A 1HOXA 3DT9A 3EBOA 5A3VA 3TN7A 4C03A 4G0WA 1M34B 4PPQA 2GCOB 2BMAA 3G7NA 2FW6A 1GZDA 4CTKA 2TYSB 1H5UA 1ZVVA 3T9AA 2F43A 3ELBA 1GP2A 5L3VA 2YVUA 3BMCA 2ATVA 2C2KA 2W22A 1OHHD 4QUGA 4BL5A 1IY2A 2P77A 3HCAA 3MWKA 3SVTA 2V7QD 3HHEA 3ETJA 3LXMA 4M6WA 1QDLB 1RWVA 4WKPA 2AUMA 1YO6A 5CB4A 1XMVA 1U1IA 4Z4CA 4OI4A 3E1GA 1YQTA 3KJHA 2YWFA 3OBIA 3PUKA 4WVFA 5LC1A 1H4VB 1A8SA 5B2FA 3NTXA 1DKQA 1NBEA 2VK2A 1CZLA 4YUVA 3EMKA 2GEKA 3OEWA 1O03A 1W6RA 1Z29A 3HVKA 1VHTA 2RAFA 1E18A 3AX6A 3LRTA 1W0JD 3RJ9A 1R50A 1ZOLA 2QI9C 4AP6A 1GCGA 5GY7A 1GPLA 4JOCA 4RS4A 3W7BA 5DP1A 3AXSA 3IOBA 4RVNA 5TQ0B 4CLRA 3JYQA 1CP2A 3RV4A 4UEOA 4P7GA 5C5EA 4EJMA 4XW2A 1KK2A 1ZK3A 1UADA 4MMZB 1GPDG 3FNBA 4PGMA 5IKOA 3MRSA 1YHYA 3V8BA 5IT0A 4EPWA 5E7IA 2NSJA 3KC2A 3QI2A 4KB5A 4RGQA 2E2WA 2O8FA 1CJKC 1Y33E 1JEEA 1QS0A 2X1MA 1L7MA 2A7QA 1BAPA 2FPOA 3VX3A 2REXB 2BSXA 1TEZA 2K6GA 3VBCA 4C04A 2XCRB 2IDMA 5JCZA 2QX7A 5P21A 2XTZA 1NTOA 3GQBA 3GPDG 3NP7A 4LDRA 1G64A 3HPQA 1AZLA 3K1ZA 4BO5A 1JL3A 1JDUA 3VPFA 1ANKA 1B43A 3B52X 3FA2A 4BLVA 4BHTA 2LDBA 5JASA 3A8TA 2QUJA 4MP3A 4P5PA 1J0DA 4KI7A 3U13A 5A04A 3LUHA 3K1AB 1GZ7A 2QR2A 4CMBA 3AY3A 4N41A 5AHOA 2HREA 2PBZA 3PEUA 3MUOA 4W9NC 1I2ZA 3V8RA 5E7QA 4E33A 9ABPA 2J3JA 5E38A 2O0KA 3RSHA 1P7YA 1V8FA 4O59O 1X7DA 1SUDA 3B89A 2PUTA 1J49A 4NMHA 4RESA 4BNYA 5IJ0B 1HYEA 3PNQA 5EWJA 3KHKA 1ZRHA 1ZL2A 3B78A 3OQVA 2QYSA 4ZT6A 3RU2A 3R44A 3VOBA 1T3HA 5JRZA 4FT2A 1QBGA 4HO1X 4AW9A 1P73A 5EKUA 2BF4A 2IXAA 4QKQA 1SUAA 1T15A 4LY3A 1U98A 3C7KA 1SCDA 4MDYA 3ZK8A 4KXLA 3K35A 4HZUA 4U2GA 1A8HA 3C3WA 1CC1S 2P9JA 1OXVA 3KO8A 1FU4A 1WHSB 4O4HA 1VJ5A 1ST3A 1W49A 4EY5A 2KYRA 3I61A 2BKUA 2CFSA 3I76A 2Y1FA 1M74A 3ASZA 4HRXA 1PNTA 1U4OA 1PWEA 1VE3A 1F4PA 2XDQA 2FY8A 3A28A 3C8HA 1JHUA 4QWWA 3VH1A 2ZRMA 4RVCA 3M5WA 4M49A 1KEEB 2ZAGA 5K0BA 2XCLA 2DUUA 4FTWA 3K8OE 3TQFA 3AGPA 3E9DA 4P0TA 4EKIA 4QLBA 5FWXB 5KCZA 4PO9A 3O74A 3B48A 5ILGA 5CA1A 4WCFC 1QPZA 3B3AA 2MMGA 2AI2A 3LCRA 4YQEA 3E05A 1R64A 3ZI7A 1L8XA 4AL4A 1GKKA 2R8YA 3WNZA 1KPHA 5HWSA 1X87A 3UUEA 3H3JA 2YHIB 1XAGA 4HS4A 1ABEA 3WYEA 1Q95A 4BV2A 3IBGA 3RC1A 1WDWB 5FIUA 3S29A 1NMQA 4G4SO 4PLWA 1FDOA 1XUOA 5KU1A 3AJAA 3UM9A 3NALA 4BLRA 4JLMA 5EXDA 1Z6AA 2BR3A 4L85A 5E4YA 5JNLA 4YFYA 5D84A 1BJRE 1E1RA 2C9MA 2YJZA 3EQ9A 3MN1A 4B80A 4BFSA 3O2JA 4DBZA 2AZTA 1C2TA 5BR4A 4RZIA 2NVOA 4W9RA 1QIHA 1K6IA 4NDZA 3MWDB 4ZP1A 5K8IA 3JAWA 1YJ8A 1MX5A 4NJOA 4F7DA 2P5TB 4P80A 4R1PA 1LTKA 5EVCA 2CWWA 1J09A 1E89A 1NGSA 2QI9F 3CG0A 3E8SA 1GARA 4MA0A 4NU6A 3W6NA 3ORHA 4G4IA 3TPCA 2ECFA 3AIOA 2DGDA 2H1HA 1PJAA 2J9FB 4OB8A 3K0HA 1X1EA 2ECOA 2NO6A 3A32A 3RVRA 1M5TA 3CZMA 5AW9A 4EUEA 1CB0A 3EEIA 3KVYA 1F20A 3MMSA 4PQFA 4Q7QA 1RYNA 3NHUA 4WI1A 4RFVA 1AQ6A 2H0RA 3BGDA 4PYJA 3DR3A 1MENA 1SJ9A 2AHRA 1GPUA 3BEOA 3STWA 2IY8A 3QVJA 4HVAA 4ZRMA 2X58A 1AK1A 3RKRA 3DBVO 1Y9DA 2BL4A 3N6XA 3I32A 4IH4A 3HSKA 4L27A 5GM1A 1IH8A 4E0BA 3K2IA 5ENVA 2DWQA 5HJEA 3W5HA 5DIZA 4DCOA 5I9LA 3KZKA 1KEKA 2QT0A 2PTGA 3IODA 3PC4A 3V4RA 2C92A 1U8UA 3E61A 4YCSA 4N0PA 4IIEA 2DWPA 4Z54A 4J4HA 1RWWA 1U5AA 3L1VA 2PT7A 3BCUA 1ZONA 1UMDA 1FTQA 3A4IA 4RVGA 5AVXA 1PVDA 2Q3FA 2COKA 3FHLA 1DC3A 4I5FA 3V4OA 3COYA 3CTPA 4LW8A 3SJCA 3F6CA 3PJDA 4JKIA 2O8EB 3OZWA 3ZH2A 1XLTA 2NQ8A 2H2HA 4NARA 5G4KB 4FYVA 1KVTA 4HGYA 4YO8A 1EIWA 4RETA 1NVVR 2X76A 3U4AA 4CBVA 2X9GA 2XRZA 2CLEB 2N46A 1BVHA 2PIAA 2VEDA 1DKMA 2OGTA 3QRWA 2AN1A 1ZSYA 4G0PA 4BMPB 4MZXA 2CXUA 3GVHA 1GY8A 2CFCA 1BIFA 3HGQA 3PNMA 1Y9AA 3PUYA 2AK2A 1FCJA 3IQZA 2ZSFA 4I1SA 2QNBA 3TI9A 2TS1A 1Z0UA 4XVQA 1H9BA 2IPOA 3QX8A 2ZJAA 4U7PB 1UKCA 5CLQA 2NU9B 2AFIB 3FY4A 2LKDA 2O3SA 1RKXA 4L15A 5B7QA 1N1GA 3TLEA 3DP7A 1Z36A 4M55A 2CFIA 4LXUA 4W6ZA 2AJDA 4YASA 5K01A 4JZKA 3J80A 3EEYA 1QZTA 1YL7A 1E9AA 4DDWA 2X6RA 3FG9A 1IOZA 3OTHA 1WUJS 2XYRA 3HXPA 4N9WA 5IPFA 1TAUA 4CKCB 3S1AB 4O1HA 4KNYA 3FNFA 4AZVA 1H4SA 3AR4A 2CCJA 4RVOA 4PM4A 2VUSA 5AKZA 4OYYA 4D82A 1YCDA 3AP3A 4HK4A 1HKUA 3J7TA 1LSJA 4B81A 2JFOA 4UU8A 1BRMA 4BBAA 2GARA 2ZRCA 4WOJA 1AU9A 1U3DA 2C4NA 2X4IA 8OHMA 4J0EA 1SHZA 1MJ5A 2IP4A 3COPA 2BRUC 4C1NA 2B4KA 4QU9A 4HZIA 5HKKD 4R3NA 2TMKA 3B9PA 1QH1A 3RFFA 4HNGA 5C81A 3HFSA 4NOJA 3GP8A 3MHTA 3NKVA 3LPAA 1G0OA 2FG6C 3KD2A 3K73O 1CUIA 2BFEB 1YR3A 3GLFB 5FPPA 1G8PA 4NJEB 4IGEA 4NEHB 3UO8B 3VISA 2Q3CA 3BMQB 1DAOA 3PQ5A 1ACJA 5A3JA 1EFPB 3WBFA 4D2IA 4FZJA 4L8VA 3FGOA 4RK7A 2GHRA 4B2IA 2C82A 1XAIA 1SBQA 1OC2A 1J8VA 3LHIA 3W3AA 2DG2A 5IMSA 1ZGJA 2OSVA 3KM0A 1HTBA 4Y6QA 3VKUA 3AVVA 2C54A 1I1QB 2B1GA 3TB4A 2IXDA 4OXRA 1G19A 2I1QA 2X8AA 4RA6A 3OO1A 1MW8X 2ROQA 1H9AA 2COEA 1U02A 1FFAA 5F77A 2WWXA 4RZXA 3X2SA 1LBEA 1DQRA 1JFFB 1LH0A 1ZNWA 3A2KA 2GZDA 3I1YA 1NW6A 2CY0A 3JYOA 1LNQA 3LX4A 4R01A 4U0KA 4GNKA 3WKBA 1TRKA 2OKGA 2UZ1B 2W98A 3JARA 3BCHA 1WU7A 4GUDA 1HRKA 2QZPA 3PX2A 3PVZA 3KE8A 1VI5A 4NMMA 4ECAA 5G41A 4HLQB 4EABA 1H0HA 1Q11A 1WQ4A 3UK1A 1H3EA 4UTPA 2YMPA 3JATB 2EIXA 3WB2A 3Q2OA 1O4WA 5HA5A 1EFCA 3LFTA 1L5KA 4DIOA 4DLPA 2CCKA 1FLAA 4E1BA 4YMUA 1GADO 2YS6A 4U2CA 2HJWA 2Q0QA 3LRPA 1GQSA 3NHRA 4RD6A 2QNRA 1XK6A 2D5BA 3T1OA 5EY5B 2WSSA 4F92B 2AR9A 1PNVA 2EKDA 2EBWA 3CVJA 1W2HA 4G23A 3EYWA 3IP8A 3BXOA 3EGDB 3WDSA 4W4TA 1WZUA 2E0IA 1EJ6A 1S3FA 3B7GA 3D4NA 1DZIA 1RRFA 3CHYA 1AQIA 3V9AA 4RHXA 2VQSA 3LPCA 3MXTA 4DCTA 2NVUB 4M88A 4AG3A 1LLDA 4TLDA 3U31A 2PKQP 2PS9A 3FMGA 4JYMA 4KQFA 2V8BA 1DBIA 4LI3X 3V8VA 5A5DA 3HBLA 5T5QA 5L4SA 1LV7A 3ROFA 4EUFA 1KY4A 1VHJA 3UMJA 4CN9A 1VECA 1ENZA 4C2AA 1F6DA 3COWA 4EF4A 5I9IA 4JYPA 5IDQA 4LY9A 1OIWA 1M1NB 3R0VA 1KO7A 1OPXA 1XA3A 4Z0HO 5FORA 3NCHA 1E2PA 2W4MA 2GCOA 3AINA 2SKEA 5K8JB 2WJGA 2I03A 3KKLA 3QWAA 4G1FA 4OU5A 3RHZA 3M6AA 2A9QA 5F5LA 1W2WB 3UFXB 4UPEA 1H1DA 1UOQA 3MC1A 4BFXA 1IPEA 2CBZA 2O9JA 5ER6A 2JLRA 1EWVA 1RYFA 2ET6A 4OBXA 5JS2A 2ZYHA 3NT2A 3VR3A 2B25A 3A6HA 3VSBA 3OZ7A 3NHLA 4LDZA 4XUGB 5CMLA 2AB0A 3EAFA 3L4BA 3OMXA 2Q45A 2VK1A 4TV8F 1MR3F 3VR4H 1BHJA 3QENA 1MF7A 2F2TA 3AZPA 3I1IA 3DSRA 4LDAA 4OB7A 1RKQA 4UZEA 4WW0A 3VOSA 1MB2A 2CL7X 1ZNZA 3WK9A 4TVSA 1G8JA 2YQ4A 2YJ3A 2XYHA 3L04A 3LVRE 1D0SA 4YV2A 4A6PA 4INOA 5FPYA 2GA8A 3CX4A 5DHSA 3K9GA 3ND9A 2BD0A 3TRFA 1VTKA 5TQ0A 3NEAA 4N82A 3W77A 1R3UA 3RVMA 3CH5A 1Z33A 1YRBA 2IJGX 2PSFA 5LNK1 1K27A 3IAFA 3RSFA 2J9ZB 3G59A 1R6UA 1G3QA 1K5DA 2NXWA 3PRJA 5DBEX 4JQSA 3ROZA 5C35A 1QUFA 2QM7A 3QKTA 3RSOA 1WPXA 2C78A 2PRKA 2GD6A 1D07A 3G2KA 5H70A 2IP1A 3QU2A 1LRKA 3AQIA 3OLYA 4BJ1A 4B6PA 3BFXA 4CLHA 3U7IA 3AUYA 4MVJH 2OILA 4KR3A 3WDMA 1RCTE 4H7FA 4N6OA 1XTTA 3ZS9A 4RH3A 1U04A 4UW9A 4QJ4A 1KARA 1OFHA 4XX0A 5IVPA 4KXVA 4Z86A 3K1JA 4FFLA 3R4CA 4IXDA 3EA5A 2ZVDA 2OC9A 4ZCIA 1FK8A 2WQZA 1P17A 2TMDA 1P9RA 3GJ0A 3VRHA 4BFCA 1L8AA 3HKEB 2QQ0A 3CUVA 3EG9B 3ANXA 4B4VA 5K6AC 1XNGA 3K1AA 4BFTA 3N87A 3FFWA 4NE9A 2P91A 4TT3D 3DYVA 3PUIA 4BTVA 1TKAA 2R44A 2NUBA 3NNSA 5B1EA 3AQ4A 4PS0A 4Z4EA 5SZHB 3ESDA 5TB5A 4YCMA 1X7WA 1IYZA 2GETA 2P5SA 4FKMA 1S4QA 4LGVA 3AHFA 5IJ0A 3L7NA 4KR7A 1IAQA 4M54A 5IJZA 1X8XA 3I6MA 3K32A 2B3TA 1I2BA 2IVFA 3DTVB 3GHHA 5C8VA 1KR2A 3WWZA 3GUCA 2F8SA 4UXHA 3TGLA 1Q20A 1FTWA 1PVOA 1EI9A 2OVBA 4FSXA 4O4JA 5IDYA 3OA2A 4HB4A 4EY7A 3DP9A 3SKXA 4EWLA 1VIVA 5CFMA 2G7MC 2PWPA 4MVWA 5ERGB 3T9FA 3MOIA 3HCPA 3KYJB 3JQDA 3BOSA 1P5JA 1QV7A 4WKOA 4UC0A 3EXHC 1ZSNA 2OWEA 4KQJA 5CM2Z 5DYIA 3P0IA 2W71A 2AN5A 3BGIA 1WHSA 5FWYA 1KYYA 2OM2A 3ADCA 4U1RA 2XT0A 4F3CA 1XRRA 4EVQA 4M7PA 4YIHA 3ZNOA 1TVKB 5DNYB 2QIPA 1EGMB 3IEVA 4G5FA 3NHMA 1OZHA 2JGNA 3VTAA 4XLLA 1KEEA 3CB2A 4RIHA 1PZFA 1O89A 1YVPA 1RZRA 4WOCA 4WFIA 1HA3A 1HQCA 4RDIA 1JU9A 1GITA 3FOWA 2GEVA 4FHCA 3ECSA 4DT1A 5DM0A 2Q62A 2VATA 3ITNA 1VYUA 3AFIA 2X15A 4UQPA 3ZX5A 4IVNA 4ZGGA 4QM6A 1OXBB 1AN9A 1BROA 1KFEB 3FNGA 1TCCA 2VPXA 3R8XA 5KWEA 4B3GA 3M3DA 2WJHA 1O95D 1WG8A 2PUFA 5TMDA 1NKSA 3TNYA 1JEQB 3M33A 3TFQA 3IUJA 4Z0PA 3TH5A 3WK7A 1C7JA 1DOAA 1SK8A 4CM5A 3ILVA 4UUAA 2IA5A 1C7IA 2M6SA 5ADHA 3OPMA 5JFTA 2AXEA 5KVSA 2YUTA 4HC4A 2J5KA 4MRRA 4PC7A 4KCGA 4PANA 4AYWA 4CMGA 5JBIA 1PJCA 4XD7A 1AZTA 3LFHA 3A58B 4D4JA 3LTNC 3SIPA 3DQPA 5JARA 1KYVA 2WQ7A 4FN4A 4AMVA 4CKBB 4V1CI 1RC0A 3DZDA 4OBWA 1HXHA 3ZVNA 1XQ1A 3ZWWA 4G56A 1NVWQ 1PBNA 2YYAA 2GSWA 1PZEA 4QNNA 1S7GA 5IBPA 2VSFA 1A72A 4I2VA 4AMGA 1I13A 1XD2B 1N9ZA 3W79A 3AJRA 4EOGA 2WNHA 4ZKDA 1EDZA 3PSAA 4JSRA 2N47A 2D6FA 3JCZA 3EUWA 4S1VA 3H5OA 3SMVA 5JVDF 1NMSA 4G97A 1MIHA 2HNBA 2JEZA 3QBDA 4LZJA 2GD1O 2P3OA 4WADA 3T99A 2PX0A 5FBLB 2CV2A 1INLA 1DFIA 1TVEA 2EZTA 4JXKA 3ZQKA 2VTEA 4WZAB 4HB3A 1L5NA 2GF0A 3RUIA 1X9GA 3UHAA 1XCMA 4OHOA 3VC2A 1JXAA 4IWNA 3WHLA 3BHJA 3WYFA 1XGKA 3UJNA 1HLGA 2Q6TA 5SY6A 3GJSA 6Q21A 2DJIA 3I34X 5E2IA 4E32A 1CRPA 3AWDA 1AOXA 1T4BA 2DEUA 4EG6A 3FCCA 3C6XA 2W6ZA 1WXQA 3ZIDA 1I51A 3QQPA 1IOWA 2AMYA 3MJVA 5ILQA 2ECPA 3N0VA 1V5EA 4BKQA 2BYTA 2O8EA 1DWPA 2ZRLA 4KBYA 3PFHA 3ZIUA 1OH5A 4RMNA 4YBZA 1PFQA 1R4MB 3ECAA 3FJYA 2CFTA 3FM9A 3DWIA 3PS9A 3ZWOA 3FTFA 2AJLI 1HBJA 1EK1A 2X8JB 2ZUWA 3O1LA 1JTEA 5IC5A 4UTVA 1JJ7A 1PE0A 1EM8B 2CVFA 3B9BA 1NBAA 1SC3A 4ZVMA 3K4PA 4ESOA 2ZRPA 3AVQA 3P2OA 5LQRA 2Z2IA 2LRHA 1T0PA 3DQQA 4JB8A 4HTFB 3FSRA 4N40A 4HLDA 2Y1GA 4NG5A 4ARAA 1H6AA 2X8WA 1E8MA 3DH0A 3OQ6A 3OM0A 3OTOB 2ONKA 4DR4B 2WAAA 2A5DA 1ICIA 2GMWA 5TPWA 4OYLA 3SY8A 3T4XA 4TMWA 5HG0A 1U5BB 1SUBA 1TQDA 1CIVA 1N9KA 1VIDA 2AFIA 5BQXA 4FYHA 4QTZA 3NT5A 4KRFA 3W2TA 1QJCA 1G5FA 1G20B 1VBFA 3CLSC 1J70A 3GDGA 4WUVA 3L8DA 3LWNA 3Q5EA 1ZR2A 1P4AA 3R76A 5F1YA 1ZM4A 1W4BA 4QHYA 4CKCA 3UBTA 3HO8A 4G07A 1D4OA 1SA0A 4ZTBA 2REOA 2ZUDA 1RC1A 3NI2A 3UFBA 4RAOA 3WOVA 1RPAA 3OSZA 4DZZA 3LAWA 2VVTA 1RHKA 3O4VA 4UHKA 3ONVA 4C7MA 3CVVA 1DP4A 1NY6A 2BJWA 1YI1A 4ZI3A 4UXJA 4RTQA 3D7KA 4JJFA 3G3EA 4NWIA 4W5TA 1L9KA 2JFVA 2FJPA 3NETA 3S44A 1RQNA 2OHVA 1H2FA 4DV2B 1XNRB 2V6FA 3L1IA 3G2HA 3LUJA 3D0QA 4XM1A 1VDMA 2V98A 2NPFA 1XL0A 5CIQA 1KBQA 4CDRA 1E2JA 2ZJ0A 2X9QA 3G0GA 2BFEA 2IODA 3IIEA 3PUVA 5HFJA 4NJEA 3M4NA 1P0MA 4PZZA 4EG7A 2GN9A 1K4YA 3LYAA 1M6YA 1EFPA 1OFUX 3RVQA 5C37A 3BXHA 1AB6A 3GVPA 3QIAA 1IEQA 1KZ9A 4G41A 2YNMA 2I4IA 1YS2X 4GBED 4P58A 4YJDA 4LG1A 4KO8A 1TPZA 4OHRA 5ALHA 5GQSA 4CKEA 2EKLA 3EXEB 3SVLA 3UMGA 4GC5A 1EMDA 3S2FA 3WLOA 4B71A 2QTVB 2ZW9A 3WGHA 2MSDB 4TZ0A 5F7ZA 1U2ZA 1MA3A 1L4MA 1JFFA 3T7SA 2QZSA 5AVZA 4GGPA 5AW2A 1IN6A 1VLVA 2I71A 1E9SA 3NVAA 1TK3A 2VPQA 2GM3A 3DOUA 1V0JA 4HAXA 5SYMA 1E1NA 1RPJA 3ONDA 4RKWA 1KQNA 4C6HA 4KQ9A 3TE7A 1OWPA 2C98A 4P0QB 2OZKA 3PD1A 1CQZA 4UM8B 2FNAA 1G7CA 3VNUA 3QVUA 3R5HA 3H1TA 4GSLA 3N6RA 3WLFA 2ZZKA 4RJJA 3JATA 1N2BA 3LHKA 3OFJA 2ONJA 1LI7A 5KI6A 1EEXB 1B1AA 3ROEA 1DJQA 3AEZA 5ITVA 1UXOA 4EEKA 4POOA 1GYRA 4YT8A 4R05A 2Z95A 5EE0A 3UT0A 2VAMA 4GOND 5FNZA 1HDCA 2AFIE 4J0JA 4RD3A 2ZKLA 4RF2A 1G9SA 4NMLA 2CNWD 3IP3A 2QMYA 3DPIA 2O2YA 1AKWA 1LRLA 3B8EA 3MSCA 2XDYA 3R7DA 2C5EA 4QYXA 1A2BA 1I14A 2PZJA 1FE8A 2ZPTX 1K92A 1MC8A 4DCVA 2F8TA 2NVUA 5CA0F 3WB0A 4ZV9A 2FH5B 4BS9A 4EAAA 2EOAA 2P79A 2Y4NA 1O7JA 2QRNA 1ESDA 2I1VB 1D3AA 1DDGA 2DLDA 2PXAA 2RGBA 4RX1A 2EFCB 5FFFA 3DUWA 1KHTA 4O08A 3T06B 4RKEA 4QUBA 4LX8A 3L02A 2YFKA 1OI2A 1KE2A 1K3UB 2C3MA 4XASA 2Q7OE 3NGXA 2AX4A 4K26A 4P4SB 2ZT7A 1OREA 1M1NA 5EQFA 3OAAD 3P9KA 3M3HA 5EZQA 1C3XA 5EFZA 4FCWA 5AI6A 4JP2A 3DMGA 5DASA 5HPYB 5KOYA 1F4LA 2Q9UA 3CPEA 2ZU6A 3HM9A 2WIBA 3C5CA 3M4ZA 3NIDB 3NJ4A 4XVHA 3COJA 1ZRSA 2KWIA 2R48A 3M6UA 2PV7A 3GLFE 1LDGA 3QOYA 5F9FA 3OFVA 1AZSC 1I9GA 1YT5A 2MIIA 3NWBA 4MUJA 1JJVA 1QX3A 3OJEA 4O29A 4OQYA 5J2TB 2X41A 1ONNA 1VKRA 2C8JA 5AHKA 4KG7A 5BXQC 3TECE 3TZCA 5DW3A 1M6HA 1V71A 1N92A 3IDOA 1P1BA 3IBYA 2A0FA 1EFVB 3LA6A 3UENA 3KOUA 5DF1A 1L5LA 2VDLB 3OZSA 4ISBA 4PLYA 3TTXA 1YXMA 3ICCA 4MUNA 1PS0A 3QVXA 1UWLA 3TLJA 2H00A 4M4SA 3RC2A 3WBBA 2H1IA 1XN1A 2JC3A 4BO7A 1GILA 4L0DA 2FMKA 2OSBA 5BWLA 4GAEA 5I7WA 2XOEA 4NCIA 1LF5A 4E4RA 2ZI6A 2JCXA 3O2SB 3R24A 2TSYB 2HMTA 4UULA 1DC5A 1DTWB 4P5EA 3U62A 1CNEA 2KE5A 5FV7A 2VT3A 1R6XA 3DMTC 2IK8A 3QPWA 2NSLA 1E1KA 1EBBA 3LY9A 4P7BA 5HZKA 2DETA 2I6XA 5ENZA 1QAQA 1QYVA 3PUHA 4B85A 4DSOA 4FIZA 1JFTA 2VWQA 3A0RB 1TU3A 2DFPA 3WYNA 4Q4DA 5CH8A 4XARA 3HY6A 1Q21A 5DN6A 2YXNA 3QXGA 4YJHB 4BZPA 4YX9A 4FB4A 3UICA 1ZK0A 4Y18A 1WS6A 3ZGZA 4JI1B 4IWYA 2C04A 2C4TA 4LMPA 3EG9A 1Q6ZA 1S8AA 3C1UA 4A8TA 4WOBA 4F11A 5SY9A 1EG2A 3FBTA 1FBNA 1YA6A 2IBTA 1CUFA 2UVPA 2JIZD 3LPMA 1WW8A 5DHRA 3AKEA 5JI2E 2Q21A 2BBSA 2D1RA 4IJVA 4CV1A 1N5KA 4NJMB 4XEHA 1CQWA 3CISA 1XPUA 4GDFA 3DTVA 3KQWA 1BKSB 5AXBA 3KYDA 3AW9A 3NIFB 1CT9A 1GYQA 1WA5A 1ZJJA 2AFHB 3DW3X 3MMPA 3OPNA 2CZGA 3N0TA 1JB1A 1FLDA 1K9VF 4KIJA 4YROA 3TG2A 1A50B 3L0SA 5T3YA 1F6BA 4BNWA 5CD9A 1NUHA 4B73A 3A6ZA 1C9MA 2AI3A 2B4RO 2W8BB 5LR6A 4A36A 1L3BA 3RSGA 3U7EB 2PS1A 2XBLA 4GZMA 1VPLA 2NLOA 5ADVA 2BELA 2D5LA 4QDJA 3IP5A 4D3XA 1OWNA 3RS5A 4GICA 3PQ6A 1GDHA 16PKA 1X1BA 3EZXA 1VLZA 4MYCA 1X0VA 3H2IA 3OX2A 4IEEA 1XZMA 4TROA 2GTPA 3GG2A 1TCAA 1QNLA 4L4ZA 2J3LA 3K53A 3WL7A 3N2LA 6ABPA 1R66A 1E9FA 3ZPXA 2HSWA 5JG7A 3FH0A 4FWBA 4G67A 4RZHA 3R7SA 4D9HA 3WIOA 1E1MA 2JAXA 2O5CA 1UDXA 2OCDA 3OU7A 4KH1A 4CQNA 1ND5A 2JGDB 3NAMA 3WWEA 2ZTMA 1ZVQA 4AJIA 3KS9A 1HURA 1TB4A 2PYZA 2QP9X 5K99A 1I7PA 1RYHA 1AK9A 2HLHA 3Q3JB 3O1JC 4AJLA 2QTBA 5K4GA 1OXXK 2DPYA 2OGSA 1KWKA 3EPLA 1WB4A 5K4HA 3HJUA 1NL3A 3THRA 2O0JA 2V6JA 1GFWA 1USWA 2ZUCA 1N6OA 2O19A 4GFDA 4ARIA 1UJBA 4QT0A 3MJHA 3CW9A 2N9UA 2YY5A 1DJNA 1ZK1A 1T43A 4YR7A 4O02B 1Z8NA 3PDCA 4YCCA 2X6TA 1KAEA 1HETA 3DAYA 4ZIRB 3NM6B 4H15A 4YMHA 2ATEA 4LEIA 1J00A 2B83A 5JXHA 3PEWA 1VQ1A 4NICA 5CB8A 4YDHB 1YOVB 3GAFA 1EX1A 1XD2A 5HQ3B 2C59A 2Q4TA 2QV7A 4DCSA 3V4LA 3D4PA 3D6NB 1GSHA 1R0CA 5ELMA 1PG5A 3OFND 3HA3A 3HWSA 1Z4MA 1WMDA 3DXXA 2NU6B 3RIYA 4WINA 1C30A 1RHQA 1K0FA 2BGTA 3W2IA 4BXOB 1PT6A 3FIJA 1PFWA 4GECA 4B8YA 1ZGGA 3N39C 3TLKA 1Q5PA 3FR7A 3W5UA 3G8DA 4DC1A 1KY2A 2FX2A 3L3BA 4C4ZA 5A6SB 1A9RA 1YKFA 2BMDA 2Q8NA 2A1IA 4WZAA 3H8SA 4F91B 1IZZA 5E0KB 4HG2A 2QUKA 3UUWA 3LXUX 3OQNA 1DKLA 4RS3A 3OF2A 5NLLA 4E3ZA 1J2YA 1HZJA 2B0JA 2VCEA 3OM1A 2JD1A 1W29A 1AXRA 5AVJA 1WKVA 1NC3A 3CR8A 4DOMA 4EO9A 5ITWA 2IX3A 1SY7A 4MO9A 2A94A 2GCNA 2NXEA 3LCMA 5A4FS 5M04A 1AQNA 3JV7A 1O0CA 1A9YA 2W8ZA 4DLTA 2JFGA 5IVKA 4Q19A 3OCZA 4UREA 3DBHA 3G9TA 5C4GB 1I2MA 4YP5A 5FR1A 3LXXA 3L7MA 1R4MA 4ND8A 5H8WA 2IKQA 4ZVQA 1WPQA 2NZUG 1N7JA 4YRFA 2X8JA 5EHIA 2P4QA 2KS6A 4ALMA 2WVHA 2ZRJA 2BMJA 1EM8A 4IL5A 4Q7LA 1EJ0A 4FDUA 1ADFA 3IXQA 3C6BA 1G18A 3OCUA 5FTJA 1K6EA 5BOVA 1F1BA 3NV7A 1QRTA 4HTFA 3HADA 1GUYA 3W6PA 3WYDA 4RU1A 3WICA 5AVQA 3F5MA 4H31A 5E4TA 4AWXA 4G8JA 3B3QA 1VM6A 1ENPA 3INTA 4Z9AA 3KX2A 1U5BA 3PNKA 2Q07A 4ARBA 4X85A 4Z2YA 3E9QA 4C3ZA 2JEYA 1FX1A 1QGUB 5DX0A 1OAOA 3ZJVA 1G20A 3QU7A 4I6GA 1Z83A 4IMPA 3U4MA 2H4YA 1ORVA 4N1AA 5BNIA 2ERXA 2NO9A 2QE6A 4UEJA 4V0OA 1RRPA 2VG8A 2XMDA 1R0BA 4M1WA 4YRQA 5KAPA 3ZIAD 1PFKA 1NPDA 4FWIB 4MW1A 4Q12A 4BQOA 1O9GA 1ADJA 1ZBQA 2MR6A 3NUZA 5JDIA 4UM9D 4TQAA 1Z2PX 1RQ7A 4LQCA 1YGYA 4B43A 5DCYA 4AT1A 1YKSA 2YWRA 2W2MA 2IYUA 4JLUA 2N3ZA 2OGWA 4MQ4A 2CSUA 2BBTA 5I5GA 4PZLA 5A62A 4ES6A 2FPGB 3T9CA 5B6JA 1JAZA 2DCMA 3Q1KA 3O9VA 4UAGA 3DAFA 4OJMX 3CF4G 4X94A 2GAIA 4LRSB 4DJJA 3HEAA 4REQB 2Q1UA 1LBIA 2PE5A 1OXMA 4Q1CA 3F49S 5AVRA 4GVPA 1KEUA 1T6BY 2BP7B 4W63A 3UBMA 4RJKA 5EUQB 4C7KA 4J0FA 3QBEA 3EW7A 1RAHA 1IUNA 1DC8A 1ONPA 3Q5DA 3TKYA 5H68A 4E5UA 2F8LA 5KZMB 2JLQA 5E6SB 2OOSA 3H7AA 4JSTA 3UWKA 1FFGA 1H93A 1QWOA 3L4KA 3P94A 1DBPA 4UMFA 2P8JA 1KI8A 2ICAA 2IOYA 3MTQA 1ZI8A 2QTVA 2BFCA 4HGRA 4OV6B 1V7QA 5CR9A 3W9SA 3V1YA 1NNSA 1V5IA 3K2QA 2E9SA 1GLNA 4DIDA 2BM1A 3GP5A 3WGNA 5EZYF 3HFRA 3AR6A 3FIUA 2JFFA 2IZZA 1OTYA 2VAVA 1V26A 3NTVA 5D8DA 3MWEB 3CLSD 1G3RA 3H6KA 4EEXA 5KSOA 1KK3A 3PR3A 5KSWB 3MS4A 4ZEMA 3AIMA 2ZDHA 3N8KA 1ZUNB 4EYGA 3UN1A 1TIBA 1XA0A 3L9XA 1PEDA 3CSSA 5F5NA 2C95A 3HC7A 4TRJA 3EQ7A 1QYRA 1WIWA 4N0DA 4XR9A 4GVLA 1Z6ZA 1HE4A 4I6EA 2XGOA 5GOTA 5K6TA 3F2VA 3H4IA 4ZQGA 1AN0A 1TYBE 1DAPA 3UH0A 3QVOA 3SHTA 1B0UA 3WR5A 2PJUA 1WZEA 1TT7A 2OWDA 2QUBA 2YIVX 3A10A 3A3OA 2QORA 1CLUA 4OIMA 5IF3A 1QG2A 1U6JA 5IZCA 5MFZA 1IBKB 5D6OA 4Q7MB 4CT4B 2E48A 4Y30A 3PTZA 2C8KA 1F51E 1Y8CA 4KK4A 3WLHA 1OROA 4FFBB 1UXHA 1Q0TA 1G20E 5KJ1A 1H1TA 4MINA 4U8HA 2RAPA 3DOFA 3U19A 3TR6A 3GLFA 4JXZA 4BLOA 3WV4A 3VU8A 2ZSHA 3L8MA 1XPJA 2W00A 3D6UA 4DR3B 2H4WA 4LBWA 1G21B 1V39A 2G72A 4HTAA 2FOLA 1HZZA 2OD9A 2PGIA 4P53A 2BJVA 2VT2A 5JSYA 1VE9A 4PR0A 2OXFA 3JSAA 3PHIA 3IXLA 4KQWA 2XQIA 3C45A 5HF9A 1BMFD 3HJTA 1AS3A 3K4HA 4IEIA 1QZUA 1ESZA 3BBPA 2RGYA 2PGLA 2QN8A 3N59A 3GLTA 1QMGA 5G0VA 1AHIA 5LD2B 1WNFA 1M2FA 4BQQA 3V4ZA 4TWAA 4OHFA 1MIOB 2FFQA 2QR5A 3C3KA 3UAZA 2WYWA 3QGMA 1T8RA 2UVQA 3HP4A 5J2TA 3QXCA 1W87A 4GWKA 5DHUA 2FWJA 2VRWA 3HWX1 4RSGA 4DLRA 2X1LA 5B3LA 4I9GA 5G2OA 1I80A 3EGVA 3NUQA 3O0DA 4UATA 5FWNA 4CMAA 4B2PA 5KJFA 1MOQA 1AM4D 1BDMA 4D0GA 1KAMA 4JYCA 2R8RA 1Z4OA 2OM6A 2VBCA 1P8AA 2ZSUA 3UQYS 1OHHA 2D3TA 3WVNA 2A0UA 4ZCRA 5GVSA 1N2GA 4DB4A 1HTTA 2V7QA 4RZ2A 2WMYA 5BV0A 3CJTA 3FYUB 1NVTA 2VIIA 4X54A 5CCDA 4EJ0A 1PR6A 3KKOA 2C61A 2CB9A 2QPOA 3OCJA 3Q8WA 4P98A 4U7JA 3W8EA 1AQJA 4GD3Q 5DNDA 3QH4A 4EL0A 1DTWA 3PQEA 2QLMA 2IIBA 5FB3A 5KSZA 1MH9A 2RB5A 5EINA 4CLXA 1HQDA 1WE2A 1C1XB 3JQRA 4MJ3A 4HBZA 2WUFA 2VFAA 1P2TA 2KJQA 4Q4JA 4RZUA 4ZA2A 3HZZA 1IB6A 1ODKA 1E96A 4MMYB 3UWOA 3R74A 2IW1A 3ON5A 5JCJA 2VF5X 2W6MA 2Z8YA 1MRZA 4YJHA 3IDFA 4IIDA 1PD0A 2XX3A 3L7DA 5BN5A 1FMLA 1XTPA 3QSGA 4XJTA 3T5BA 3W3ZB 4LVNA 3ZHVA 1WZIA 3D1JA 2XWJI 1GU7A 4GYYA 4BC0A 1FY2A 4LXIA 2C9CA 2JW5A 4PX3A 1PD1A 1LPMA 3D3EA 3W1VA 3WXMA 5CLJA 1J5PA 3CUEF 2GNPA 1S4MA 1QHFA 3HJCA 1HE1C 1NOJA 3KLPX 4B45A 3G2PA 4ETWA 4QTTB 4AI6A 2VP4A 3GGGA 5E6UB 3DMHA 3IA2A 4IIBA 2HHJA 2AFHA 4TWZA 4EA6A 2FETA 1AF4A 3B3JA 1WUTA 3DOIA 1KS2A 1XKTA 3SQLA 3WJ7A 2DLCX 4HWRA 1CZUA 5COAA 4KQHA 5DYGA 2G08A 3T7IA 3KPUA 2CLFB 3PC2A 2PO5A 2REQB 2W8BA 4AO8A 3QOFA 4DBLE 4TQUS 3DO5A 4CGYA 3VKVA 1QHNA 4URFA 4UE6A 4AZWA 3DCIA 1JJFA 2C9OA 1JLMA 2W6JD 2Z83A 4RQUA 2ZTVA 3NO4A 3GEIA 1DUVG 1H2WA 1SIBE 1JA1A 4F4IA 3P2YA 2JZCA 1I33A 3TIIA 5AW8A 1YUMA 1S5PA 2D0OB 3I8SA 2F9LA 2J30A 3G2QA 4H59A 1JHRA 2ZRIA 4L8GA 4MLCA 4OKIA 3RC7A 4D1YA 5JV5A 1KORA 2WUWE 5CDHA 3KQHA 2EEZA 1GTJ1 1GGHA 2EZ8A 1OFTA 3DBRB 2O3QA 3M4JA 1QFSA 4GPAA 1A77A 1IVYA 4HF7A 1BN7A 2GK3A 4I46A 5KIAA 6GPBA 2NYVA 1CYDA 1Y37A 3FOCA 1VYTA 4QU0A 2YV5A 4ZFNA 2FW8A 5LQDA 4KTTE 4D8WA 3LQ4A 4XVUA 5C7LO 1XU4A 2BGJA 4J7XA 4MR8B 3ABRB 3K09A 2GLUA 4OLAA 4INZA 3V7UA 2Z5LA 5AJWA 2WVGA 4GZ5A 2IXTA 3TSWA 1MXHA 1UBMS 4YXFA 4W5OA 3SQXA 1U8CB 2Z4TA 2GERA 1N5RA 1V6AA 3H2GA 3E0QA 1MC1A 3N53A 3DZ8A 3W9BA 4ZAYA 3B2EA 2RCYA 2HMWA 3W2EA 3IAM6 3C6ZA 4ZIRA 1SQSA 3GDHA 4OHUA 1P0IA 1Z4JA 4PV7A 2XHZA 3GROA 3TDMA 2R6AA 3NHYA 3GLGB 2ZIVB 1C8VB 1R6VA 1N36B 4B3SB 3TX6A 1SU7A 1YOVA 2YQZA 1T34A 4M0PA 2R7AA 4Y2XA 4D9EA 5T8KA 5HQ3A 2ZPAA 5EIXA 2NUPA 4LNHA 4PF1A 4DY6A 4DA4A 2OHFA 1ZD8A 3AUKA 5CH3A 2VWPA 3QUTA 1TQHA 3TDKA 1JAIA 3V8PA 1M6EX 3MS7A 2NU6A 2XBUA 1KDZA 5LDDC 2PRSA 5BXYA 2EQ5A 1BDBA 5FPSA 1TAQA 3L40A 4UDXX 4BXOA 2IXGA 4P36A 3DBIA 1Y81A 2FCAA 2G9VA 4QHTA 4LHZA 3HACA 4OB6A 2E4YA 1JZSA 1LSSA 2O7SA 2PWZA 4Y8VA 1USGA 1XZEA 1ZGAA 4R9SA 4YV1A 3GLVA 1YNOA 1AURA 1N8KA 4Y2UA 3UK6A 4F84A 5A6SA 2PA3A 3KZOA 2AFHE 3QA9A 5A5VA 2OVFA 4H9GA 2WHPB 2HQOA 4HRVA 1NUAA 5DRYA 5AR1A 2JARA 2PM8A 2WF9A 2CEKA 3OIDA 4RH0A 4N49A 4GGMX 5C52B 3USCS 2G4VA 1I32A 4LE2A 1S3GA 1OC4A 3ESRA 3PUWA 4OBEA 1CDEA 4MQ5A 1KRXA 1M8JA 2NPIA 2OK8A 4BJHB 4JA0A 1QK5A 2GRJA 5AQ1A 4ER7A 1DWUA 3OX4A 5AW0A 3HK2A 3L01A 4NATA 4DUYB 1GNRA 2WHEA 1E8NA 1KSJA 1XJWA 4LRQA 4HL6A 4U8GA 5EQJB 3OIWA 4WCFB 2Z6UA 2ZE5A 1SG6A 3HLTA 1Z4QA 1RBZA 2XRYA 3STYA 3U3RA 2PGAA 3IMEA 3TOVA 5KPDA 1U8YA 1QCZA 1SUPA 2WBLC 4A2CA 1HFJA 5TMEA 1AKQA 1VRVA 3VNAA 3OOSA 4KN6A 4U5QA 5CD1A 1DMRA 1GTSA 5J4HA 4BVGA 4XRGA 1QE3A 3D54D 4YGYA 2X0RA 3C3BA 4ESVA 1VZ3A 2O5VA 1N0IA 2IOQA 1AUPA 1PZXA 1E5XA 3HG7A 3E82A 1TAHA 3NHFA 5MN6A 3QNWA 3IUPA 2MHCA 1GGKA 2GF9A 1IWPB 1QKJA 2E4AA 1NP6A 2JASA 3D4IA 4ZVLA 4TRMA 2FN3A 4FWTA 1IWBB 1I4OA 4POAA 4N5DA 5HIMA 5MGNA 5L9AA 3TUZC 3U16A 1QGUA 2A33A 1PAUA 4NYMR 1UODA 1Q0SA 3QFTA 4MGYR 1E2NA 3E3MA 1HL7A 3O0TA 3U56A 2QTGA 2VF7A 2D13A 5LJIA 1TM3E 2VQ6A 4DQUA 1EG7A 1K5GA 4MVYA 3ISTA 4RKFA 4XIYA 1AUOA 1YRWA 3IKLA 4NY1A 1BJKA 1R0KA 3AEXA 4RK4A 3UHPA 3D1LA 1H2RS 2ZJ5A 3V3KA 1CZHA 3GEHA 3HO1A 3H84A 2VTKA 1C8LA 2PD4A 3W6UA 4LXQA 3WLRA 3FGNA 3ETHA 1TFRA 3ST7A 1A5ZA 1P2DA 4HAIA 3AFMA 4RIIA 4NBWA 3LT4A 2HFKA 4I4NA 1ZO8A 2FPGA 3F3KA 4FU0A 4KR0A 2XLBA 3BZWA 1PYOA 3KV3O 4DQKA 3T5PA 1KEWA 4MWBA 1ECPA 3KLOA 4REQA 8GPBA 3BDVA 4KPEC 4CTOA 2WA2A 4Q3OA 3OD5A 5I4BA 3TOZA 2BP7A 4ZV7A 4EENA 3MLEA 4HWPA 3NATA 2Q3LA 3OWHA 5JAQA 5CFOA 2CHEA 1X1QA 9ATCA 3P9RA 3MPOA 2JIDA 1FYXA 3IOMA 2W90A 4ZKEA 1SXGA 2D5IA 4OD0A 2VA8A 5E6SA 3NTLA 4QGBA 2CMDA 4K8OA 3EVTA 3ZU3A 3V4FA 3N2GB 4GM0A 2OCIA 3NIBA 2BFAA 3AOGA 3PPXA 2DQ4A 1K5HA 4AU1A 1DUSA 3KQMA 4JT8A 1P77A 2HDHA 3V55A 1BMDA 3D6MA 1LLQA 3KIPA 3TAXA 1HDXA 3MCUA 1N6LA 1XTVA 2UYCA 3O83A 3TJMA 3HXOA 4KE9A 4CV2A 3JQBC 3TZKA 3ZYZA 2QRMA 3QTBA 2R3SA 4BLTA 3OHSX 2MYUA 4G8DA 5CFRA 3DFMA 4RMHA 3E3OA 4HUQB 4NH0A 5EMJA 2MT9A 4QC2A 2IV2X 3W1EA 3I6BA 1NLMA 2QZ9A 1OT3A 2ZDQA 1KPGA 1DKRA 3DCYA 2GOYA 1UZMA 3GA5A 2RFLA 3RPEA 3ICWA 5KNBD 1DHRA 2J85A 1TECE 3UMMA 5E4FA 1KFCB 1ZW6A 2BUAA 1ZDMA 2C5HA 1X94A 4MI3A 3TBKA 4IJKA 2IYRA 3ABSB 3OJOA 1Y1SA 1OLUB 1VJCA 2A6PA 3C15C 1PV4A 4TV8B 3QE2A 1LNSA 1G5QA 3NBZC 4URYR 3KXDA 4AURA 4GOMD 1V25A 2IDKA 3OQPA 4TRRA 4YJ3F 5CDYA 5A2QA 2ZIZA 4HDAA 5JCOA 4D9CA 4FFBA 2V9PA 2FG7C 4L0QA 4JLKA 1E7MA 1RVDA 4YMLA 2DHDA 1HV8A 3L07A 4LJ5A 4PZ0A 3MTJA 4YI3A 4F4DA 1RWNA 3EOBI 4H7HA 4L2IB 5KWSA 2FWPA 1G21A 4Q9DA 1CV2A 2HSEA 1W1UA 3HZOA 1WQ3A 3TRJA 4HBGA 1GZHB 1C4WA 4KAJA 4F4JA 4EYOA 5L7WA 1HGXA 1KAGA 4M60A 2QJRA 4HSEA 4QOGA 1NVEA 4MLPA 1V43A 4S35A 1XRJA 3LECA 2XQVA 1SULA 2GM5A 1ULBA 4EKYA 2QSZA 3OQBA 5COQA 4G84A 1H65A 1GGJA 3NONA 1B73A 2HU7A 1YSCA 3B1JA 4LWZA 4RF5A 2ZRAA 5GMOA 4CCSA 4H1TA 2ANBA 5DT2A 4JEMA 3SIXA 2AZ4A 3WHKA 3WNCA 3U5ZB 1AX9A 3QEOA 4WGFA 2WD7B 3RBVA 4YUZA 2BFBB 1P1FA 1B8UA 4KQMA 1FQKA 4O5OA 4TYQA 3TQSA 2EGHA 1L5QA 3KPYA 3KEOA 1VPTA 2Z6AA 3OM8A 4W5JA 2IHJA 4D46A 4OPMA 5IKEA 3AVUA 3ZW7A 4Q48A 2J48A 2VNKA 1Y5LA 1VE6A 2XVXA 4S2UA 5DXJA 2PBLA 4NHEA 4Q02A 3M2TA 3R09A 4DMHA 2XUIA