3JW8A

Crystal structure of human mono-glyceride lipase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
290
structure length
290
Chain Sequence
SPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MGLL protein
publication title Structural basis for human monoglyceride lipase inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3jw8A00
2XMBA 3E0XA 1DINA 4IH1A 4B84A 2WUFA 1O6FA 1UOQA 1BCSA 2XMCA 1CUCA 2QUBA 1W75A 2XB6A 5ALXA 4TVKA 3GROA 5E2IA 2CJPA 1XKTA 1P0QA 1F0PA 5HFNA 4BC1A 4AO7A 4ZGBA 2Y2VA 4YK7A 1SCIA 5CT5A 3FAKA 3G0GA 4DMFA 3R3VA 2XQFA 5LZ4A 2YXPX 2QXTA 4BP9A 4AO8A 4DMHA 4AB1A 2H7CA 1M33A 2AXEA 1N5RA 2HA7A 4GWLA 4K6GA 3PDCA 4P93A 3SC2A 5JD6A 3HEAA 4J0HA 3A70A 2HRRA 3V1NA 3AIMA 3C6YA 2CKMA 4F5ZA 4KEAA 2VJCA 3HI4A 1UKCA 1ZJ5A 3HJUA 2WSLA 1GKKA 1TK3A 2JGJA 1E89A 5AHXA 1I6WA 1DX4A 2ZYRA 4HAIA 1EK2A 2XMQA 3BF7A 5CH5A 2PPLA 1XZEA 1GPNA 3BF8A 3BWXA 3O0DA 1AZWA 2DQZA 4QE3A 2C5FA 3DD5A 1A8SA 4OYLA 1QO7A 3WYDA 4P92A 4XIIA 3R40A 4MYSA 4J0GA 1MN6A 4KRYA 4UPDA 3LLCA 5JATA 1EHYA 1F6WA 2OGSA 3V1KA 4I4CA 1CUGA 1EXWA 1YAJA 3GELA 4UBJA 3IBTA 1EH5A 2JGMA 2PVSA 3DOHA 4NVRA 2PSHA 4LXIA 2ONCA 3NOXA 2XT0A 3HABA 5AK4A 3G9ZA 2WKWA 1YB7A 2ACEA 3CN7A 1WB4A 4UBOA 1DWOA 3ZLTA 1QZ3A 3D2AA 4E15A 2HM7A 3STXA 3F97A 1A88A 2CMFA 3B5EA 3EIOA 4CCYA 1IVYA 3WWCA 2VJAA 1VA5A 3V9AA 3I1YA 4DSAA 4EY5A 1B6GA 3R3UA 4K2AA 3O4JA 4CI9A 2HA5A 1L7AA 2OQVA 3BJRA 2E3JA 3JW8A 5ALUA 4B80A 1T4MA 4X97A 4X92A 3EQ9A 5AI0A 2QJRA 4YX9A 1AQLA 3I2FA 4HS9A 1GKLA 4MXDA 4XVCA 1TQHA 1FFDA 3DCNA 3E4DA 1IUNA 1ACJA 5K3FB 3FLAA 3DS8A 3VJMA 1CUWA 3IULA 1LBTA 5ALEA 1R50A 5JZSA 3D5EA 3DOIA 4X00A 4EY7A 1H2WA 1YS1X 4ROTA 3FYUA 4MWSA 1XZLA 1YCDA 4UBKA 4N5HX 3BIXA 4RNCA 3STYA 4E11A 2GYVA 4KE6A 5AK6A 1SOMA 2OG1A 2I3ZA 3WZLA 5HF9A 1TKRA 3A2MA 3O4IA 5JIBA 2ZYHA 1NX9A 1CUYA 1TIBA 1ZOIA 3G9UA 3G0CA 3I2JA 1CQWA 4L0CA 4XJVA 3GBSA 5JAOA 3E3AA 1B41A 1DU4A 1RP1A 1YA4A 1P0MA 1UT6A 1TCCA 1CUXA 2EDAA 2PSDA 2AJ8A 3I6ZA 5CXXA 4OPMA 4OU4A 4WFIA 5YASA 2ROQA 1LPPA 3MVEA 4J0DA 5AKIA 5CXUA 4KR0A 1MNQA 3V48A 3IUJA 2PBLA 1EI9A 1R1DA 4G5XA 3L1IA 4QA9A 5A62A 1HPLA 3G7NA 4RE6A 1TCAA 3I2IA 2VJBA 4PW0A 4Y2YA 4FBMA 5CT8A 4N5IX 3O9VA 5AOAA 3W9UA 3CN9A 3D3NA 4KACA 1MT3A 1C4XA 1EDBA 2PSFA 4QDZA 1VE7A 5HKBA 4TGLA 4IHAA 3D2BA 4GBGA 3O4HA 2O7RA 4ZXFA 3SX4A 2Y6UA 2XUKA 2FX5A 3AINA 4QEKA 5A7HA 1RWQA 2PSEA 3VVLA 4I19A 3R3XA 5JYCA 5IVHA 1DTEA 1XZMA 2D0DA 4YPVA 2WFLB 4A23A 5AOBA 5EFZA 1VXRA 4B83A 3HRHA 3FBWA 4J0IA 3K2IA 1K5PA 1F8UA 2K2QB 1G66A 4BAZA 3C8HA 3KDAA 1N1MA 5JASA 5HQ3B 1F0NA 2C4HA 2EEPA 1AX9A 5AK3A 4BP8A 5DNUA 1Y37A 2ZJ7A 1AGYA 4AZ0A 3KWJA 3DJYA 3H04A 4OU5A 3G0BA 3B12A 1Y7HA 4LXGA 4CG3A 5AKLA 3G02A 2R11A 4FLMA 3PUIA 5BWBA 3FCXA 4OB6A 3ZLUA 5AKYA 1LZLA 4H7FA 3ZI7A 4BTVA 5DTIA 1N8SA 5AP9A 1VZ3A 2BJHA 3I6MA 1EINA 2VATA 1MAHA 1UK6A 4CIBA 1ZIXA 2VT7A 3H2KA 4CG2A 4U2FA 2XDWA 3RM3A 4FNMA 1CUHA 4RGYA 3DNMA 5EHZA 2XMGA 5ALGA 1L7QA 4KE7A 3WJ1A 1LBSA 4J7AA 2Y6VA 4B85A 3WKAA 5CT4A 4GLBA 3ZPXA 4F60A 5KREA 4KAFA 4DIUA 4N8EA 4KAJA 5CT6A 1ZD2P 4WFKA 5FUMA 5ALDA 2FJPA 4J0JA 2WQZA 4WDRA 4Q05A 2QS9A 3BDIA 1R4ZA 1K6EA 4H35A 4EY4A 1MPXA 5ALTA 2HIHA 5CT9A 2GBCA 4UUQA 1E66A 3PICA 3RARA 3H1BA 5ALFA 3ESDA 1QOZA 4Y2QA 1GQRA 5KWJA 1U65A 3WKEA 3C43A 2NW6A 2XMZA 1UFOA 3C6BA 2FJ0A 3DL7A 4W1QA 2WFLA 1LLFA 1X2EA 1QIKA 5AI6A 2XUJA 4X85A 4KE9A 4KE8A 3LS2A 3R0VA 4DYHA 1BN7A 1UZAA 5HQ3A 2WUGA 3FVRA 4G9EA 2WFZA 3WK6A 3KD2A 5AIAA 3WWPA 2XMSA 1BEZA 5I7UA 1W52X 3HZOA 2PX6A 1MO2A 3WLAA 4Y2XA 5CH8A 4G8DA 1JU4A 5AKHA 4QDUA 4BC0A 5ALOA 3VVMA 2WG0A 1AUOA 4Y2VA 3WK8A 3DLTA 5AI5A 1CRLA 1X2BA 2B20A 5JANA 3WKDA 1S8OA 3IDAA 4N8SA 2JEYA 5K3BA 3QITA 5A2GA 1RYYA 2IX9A 3JYHA 5CW2A 2BGRA 5C7YA 1XZAA 2OQIA 5H3HA 4GXNA 1AC5A 2BAGA 2HHAA 4H0CA 1UXOA 3QMWA 4Y2RA 5K5EA 4AN1A 1UOPA 2HU5A 1MU0A 1YA8A 2RI6A 1QIGA 5AM2A 2WIJA 4CCYB 1FFEA 3FSGD 2JF0A 1BEEA 4QNNA 2CEKA 3QPAA 2GZRA 5DNWA 1HQDA 1QO9A 4EHBA 1GPLA 3U0VA 3H2JA 5J3JA 3HYSA 4BCDA 2C7BA 1G5FA 1JJBA 5IKXA 4G8BA 2VEOA 1MTZA 3ESCA 4DMCA 1W4LA 4UFNA 4MQMA 5EHXA 5KWIA 1WB5A 3L1JA 2O2HA 5AM3A 4AO6A 4RE5A 4G8CA 4BZWA 5D3ZA 2HFJA 4IH9A 2GBFA 3STUA 4DTCA 3VISA 1XLWA 5DYTA 4DNPA 3NUZA 2Y1KA 4UFPA 2OPHA 3I1IA 4BDTA 4C01A 4BE9A 1LPAB 3H2IA 4ZI5A 3FYUB 2QMQA 4HZGA 4PNZA 4G4IA 3QVMA 1A8QA 4LYDA 2AJBA 5FXMA 1JFRA 2G5TA 4S0XA 5C81A 5SYNA 1Q84A 3F9CA 2XE4A 3ZV7A 3VKFA 2GBGA 1CUVA 5AJHA 1QIFA 3IUNA 4FWBA 3S2ZA 3G0IA 2CUTA 3C5WP 2JGFA 2JGKA 3F8SA 3PI6A 5K3DA 5ALPA 3TRDA 1YB6A 3TEJA 3MGAA 5T4BA 1MNAA 1D07A 1QIMA 4PV7A 5LYYA 1SCQA 1UKAA 1MX1A 1EVQA 5ALMA 5BV7A 4KJXA 4EZIA 2HFKA 3PE6A 1ZI9A 4N8DA 4H7DA 1XRRA 2Z3WA 1CUZA 4W9RA 4PQEA 1XROA 4M0FA 3AZQA 1WHSA 5E4YA 1XZCA 3H2GA 1XQVA 2YASA 2XQIA 2Z5GA 5HF6A 5BOVA 2VQ6A 4G4GA 1FFBA 3I2GA 4UHEA 3IIIA 5CRIA 3HC7A 2OAEA 4DNQA 4AZ3A 2HRQA 5JALA 3FWHA 1KEZA 5LLSA 4B0OA 5D6OA 2C5GA 4WY5A 1H2ZA 1E8DA 1OCEA 1ZD4A 2H7XA 5D3KA 1MX5A 5FOQA 2QR5A 1VJ5A 4JH0A 4U2DA 1E8NA 5DTJA 1ODTC 1WPRA 2QM0A 4FKBA 4LHEA 1IMJA 1JJFA 5EIHA 2ZYSA 2GYWA 2DQYA 1QJ4A 3CXUA 1O6GA 4PF1A 1CR6A 2UZ0A 2OGZA 4D9JA 5IVIA 5K3CA 1BN6A 3V1LA 1ISPA 3NWOA 1R3DA 3QM1A 5FLKA 4X93A 2VAXA 4J3JA 1DX6A 2QKYA 4IO0A 5ESRA 4BVLA 3DL4A 3QYJA 3OOSA 1HBJA 1UOOA 4BATA 5AI4A 2Q0XA 4EBBA 3A2LA 4I3FA 2HU8A 4BE4A 3FVTA 4EUSA 3C6XA 3DKRA 4X3CA 4Y2SA 4OYYA 4W1PA 4BYMA 4M0MA 2PM8A 4K6HA 3FSGA 3WK7A 1THGA 1Z68A 2JIDA 3LCRA 2WIKA 4G9GA 4HRYA 5SYMA 3UMJA 5LKRA 3E1GA 3P2MA 5AKZA 3EBLA 3A2NA 3W9BA 3KWFA 2V9ZA 4C4ZA 1IUPA 1VLQA 3HLKA 3H19A 3C8DA 2HDWA 1OXMA 3RKSA 3KSRA 2WHPA 4BAGA 5LZ2A 2CZQA 4FFVA 4MYDA 2RGUA 1Q83A 3I2KA 4P9NA 4HXGA 1JKMA 2PUJA 5ALRA 1USWA 2X5XA 3DDUA 4B9AA 3H1AA 1QFMA 2JBWA 3ED1A 3STWA 2RHTA 1IZ8A 5AM4A 1XQXA 4Q3OA 5FRDA 1ZD3A 1QIJA 1W76A 3PF9A 2XUFA 4Q3KA 3BL8A 2O2IA 1U2EA 3N2ZB 4H7EA 4IQ4A 4B7ZA 2WTNA 3WK4A 1MAAA 1ODSA 1VOTA 3W06A 1WB6A 3OM8A 4EY8A 4GHWA 5IH7A 5HKAA 3WWOA 5JZBA 4H18A 1VKHA 2WHRA 1GT6A 1QIEA 3BXPA 5CBKA 4QDOA 2LIPA 4X6UA 5I9IA 4OUKX 4WFJA 4JYMA 2EDCA 1J1IA 3AIOA 1HLGA 3KOOA 3RLIA 4U2EA 2QTBA 3C5VA 1XLUA 2HA0A 5FV4A 1XZKA 4GDMA 5K3AA 2DHCA 3IUMA 2Y2UA 4EA6A 1R9NA 1IZ7A 1QTIA 4X94A 2VAVA 3AJAA 2WILA 3LP5A 3EQ8A 1BRTA 2XUOA 1G42A 4FTWA 4GW3A 2GBIA 2XUIA 3O9MA 4K5QA 4ARAA 3DKKA 5HK8A 4ZREA 3I6YA 2XQJA 5EIEA 2Z3ZA 1ACLA 4X6XA 4AN0A 1QGED 2O2GA 3WL7A 2J4FA 5A7GA 5DWDA 3DYIA 1A8UA 3VJKA 1HDEA 1LPOA 1YS2X 1E8MA 2ZSIA 1H2XA 2WUDA 2WJ6A 1LPNA 1ZICA 5FDFA 5ALJA 4Y7DA 4C4XA 5AKXA 1FJ2A 4L3WA 2PKYX 2DSNA 3C87A 2QXUA 3VDXA 1LPSA 2G5PA 5DYWA 5C8XA 3B3QA 4BDSA 2GYUA 3VXKA 2VT6A 3R41A 2DHDA 3BIWA 5FPQA 3BJMA 2WJ3A 3FYUC 3GA7A 1ORVA 2WU3A 2VA9A 4MJ3A 5DYYA 5EIAA 1XKLA 2VF2A 4F0JA 2RONA 4KRXA 1EX9A 3G9XA 1CUUA 1H23A 1EK1A 5HK9A 5LIPA 6YASA 3G8YA 3OPMA 2D5LA 4C6HA 1P0PA 3F98A 1E5TA 3HACA 1EB9A 5CTAA 1K8QA 4X7BA 4Y2JA 2ECFA 4NS4A 4FBLA 3STTA 2HA3A 5AKJA 2PU7A 3GFFA 4UHCA 3AZPA 2HA2A 2H7YA 2XMRA 4CFSA 1VA4A 3WI7A 1YR2A 1XZHA 5AM1A 2VTVA 4EB0A 5E4JA 3T52A 3STVA 1LGYA 4DNOA 1QONA 1AKNA 5A7FA 1PJAA 4HXEB 1DWPA 1EVEA 2OCGA 5T4FA 3IUQA 1CUJA 2H9YA 3WK5A 4TPKA 1U4NA 1WOMA 4CG1A 5A71A 1ZD5A 2JEZA 5CH3A 1JMYA 1DQZA 4C88A 3AIKA 4BCCA 2VSQA 1CUIA 1CUDA 3HXKA 4FFWA 3CCCA 2W22A 4KAAA 4Y2TA 2QOEA 1AURA 4IH4A 5LZ9A 1WHTA 1QIDA 4BVJA 5LP1A 4UHBA 2XUAA 3OG9A 4BTLA 4DGQA 2ZVDA 5IVDA 4ZV9A 1YAHA 1NU6A 1Q0RA 3D2CA 1XZGA 3AFIA 3ANTA 3MUOA 3C70A 5IVKA 3FLBA 2DFPA 3H17A 4W1SA 1EDDA 4BRSA 2H1IA 5HFAA 2ZJFA 4H77A 7YASA 4XWGA 1GPKA 4X6YA 4Y9SA 2FUKA 4LYEA 1XFDA 3H2HA 4HTAA 3S8YA 2J3DA 4Z49A 1EA5A 3UUEA 2AJDA 2QJWA 4AMYA 4G4JA 4W1RA 5JARA 3ILSA 3OTQA 4B6GA 5AM0A 4ZRDA 4X71A 1BE0A 2C0QA 3FCYA 4GI1A 1ZI6A 3WIOA 5JADA 1CEXA 2X8BA 3AILA 3WMRA 4DLNA 1CUEA 2YYSA 1QTRA 1J2EA 2V97A 2PL5A 4MWTA 5EHNA 3QZUA 2WUEA 3QMVA 2HU7A 3WL8A 3QMMA 3ESBA 1ZJ4A 3N0TA 2W6CX 4FLFA 2WU4A 2OXEA 4GECA 2VJDA 2B61A 1XZBA 4NZZA 4UHHA 1YSCA 3W04A 5C8ZA 1SC9A 4X90A 2X76A 5ALVA 5AKKA 3RK4A 4C89A 1Y7IA 4ITVA 1CVLA 2ZSHA 1XRQA 4QDXA 3WKBA 1NU8A 5ALNA 1FFCA 1CQZA 1J06A 4ZV7A 2PU5A 4GEGA 2QUAA 1CFJA 1CLEA 1THTA 1C7IA 4DNFA 3ZWQA 1A7UA 4UBLA 1BROA 1CUBA 1UK7A 5FPPA 4JYPA 4A16A 4AMZA 2YH2A 2HL6A 3IA2A 4QWMA 5CMLA 4UBIA 3OURA 1CV2A 3WWEA 4INZA 2XUGA 3X3HA 5ALSA 2WIFA 3MUNA 3R3YA 3ESAA 4A5SA 2WHPB 2HA6A 3D4LA 2BCEA 3GUUA 2DCMA 1XQWA 2ZJ6A 4KYVA 1BCRA 4OB7A 2JGEA 4UBMA 5HZGA 3WIBA 4UHDA 3DQZA 3SK0A 4ARBA 2G4LA 1CUSA 1JMKC 4M0EA 1TCBA 1WM1A 4RPCA 5DNVA 4Q1VA 2OGTA 4PSDA 4DMKA 4W63A 5AM5A 4B9EA 4PSCA 3F96A 4H7HA 4PO3X 4QLOA 2OCLA 3DEAA 3TJMA 1PV1A 5JAHA 5AKGA 4B82A 5JD5A 2BFNA 2V98A 4B0PA 4BVKA 3Q8WA 5BWCA 4OB8A 2BUCA 4JEIA 4UFOA 2C0PA 4OSEA 4WJLA 1UK8A 1UK9A 4BRZA 3M3DA 4Y2UA 3Q0TA 2XQGA 1HL7A 4Q34A 5AI9A 3LIPA 4X91A 4Y2PA 2WM2A 3M82A 5DLPA 4BBZA 2Z8ZA 1SCKA 5FP0A 4YASA 5F4ZA 4LXHA 4L9AA 2XMDA 4LIPD 3EQ7A 1C7JA 1ORWA 1QE3A 1Q0ZA 5EHQA 4BZZA 1QFSA 2WHQA 5AH0A 3WK9A 1XRNA 4BCBA 5AOCA 2BUBA 4HVTA 3W05A 4XX1A 2I78A 2BKLA 5LKAA 2XUPA 1CPYA 1W6RA 3OC0A 4JUIA 4UBNA 3FOBA 2WJ4A 4HRXA 1FFAA 2QRUA 3VJLA 4B81A 5JAPA 1LNSA 3GZJA 3WL5A 2PUHA 5K3EA 1N5MA 2C58A 5AI8A 4BB0A 1VXOA 3JWEA 2ORYA 2V96A 4MQLA 5HCUA 5LZ5A 2AJCA 2G63A 3K6KA 4QZVA 2QT9A 4L72A 1KU6A 3FNBA 2I03A 3G0DA 5HF5A 5AO9A 5T4HA 4O08A 2OLEA 3NGMA 5ALWA 3QPDA 1LPMA 2WG1A 2XI4A 2XQKA 4MEBA 3HSSA 1MX9A 2O7VA 5JAUA 3SWWA 1GZ7A 5ALKA 1PFQA 3D59A 4CIAA 3WWDA 4U2CA 3W2TA 3WKCA 2GZSA 3WA7A 5ISMA 4ETWA 1DWQA 2P8SA 4WDQA 1XQYA 2RHWA 3LIIA 4DM7A 3H18A 2QVBA 4FDMA 4AXBA 5A6VA 3PFBA 1H22A 5ALHA 4Q3LA 3DYVA 1IUOA 1X70A 1BU8A 2WIGA 2ZYIA 3C45A 3D7RA 2ACKA 1T2NA 4FMPA 3QPCA 5K3FA 2HADA 2WIDA 5AK5A 2I3DA 5FKJA 2RIPA 1GGVA 4X95A 5CURA 5HF8A 4NMWA 5KBYA 3WZMA 3R3WA 4FHZA 2DHEA 1EB8A 1R9MA 3WYNA 3YASA 1J07A 2XLCA 4JNCA 4BAUA 4H7JA 3AZOA 5E4TA 4E14A 4QLAA 4V2IA 1XZIA 5DJ5A 4UHFA 1K4YA 1OILA 5LZ7A 4AX4A 2CBGA 2XLBA 4LKOA 2PSJA 2WFMA 4EY6A 4H7IA 3I28A 5I8PA 3IURA 1WCYA 5ALYA 1MJ5A 3F67A 3O95A 1QLWA 1XZFA 5ALQA 4C4YA 2WG2A 3I2HA 1TRHA 4OD0A 1FSSA 4J03A 1G4HA 2OAGA 3G9TA 3QH4A 1XLVA 2Z8XA 4P08A 4MEAA 4E46A 3WJ2A 4OCZA 3KXPA 3IB3A 3PUHA 3T4UA 4J0KA 4WCVA 4ZWNA 1K63A 2B9VA 2OCKA 5T4EA 1U8EA 3ICWA 3WQHA 5C8VA 3ZLVA 1YASA 1BS9A 3BDVA 3K9BA 5ALIA 1ZI8A 2XUHA 3O4GA 1XZJA 3U1TA 1UWCA 3TGLA 1WPXA 4F21A 1VE6A 3WA6A 5EGNA 1GQSA 4WY8A 1L7RA 2J3QA 3ICVA 3CCBA 1JT2A 4QWWA 2DR0A 4K6KA 1TAHA 3C6ZA 1R88A 5D7BA 1JI3A 1QIHA 5ALZA 1ZGBA 1ZGCA 2IIVA 3ANSA 5AKEA 1P0IA 5AIBA 1JU3A 1QIIA 4C87A 3D0KA 3EF3A 2J4CA 4CCWA 3M81A 1W1IA 1HKHA 1ODCA 2AJLI 4Q82A 3UUFA 1CIJA 1SFRA 4AQDA 4PSUA 3V1MA 4DSZA 2XUDA 2ES4A 1CUFA 4QDTA 4HXFB 2QZPA 1XRMA 3M83A 4H7KA 1VZ2A 1XRPA 2B4KA 2BUAA 1LPBB 3H0CA 3R3ZA 5LZ8A 4FNGA 1ETHA 3FLEA 3IVMA 3WL6A 1DT3A 1H2YA 3BE8A 3L1HA 1GXSA 3FYTA 2IITA 4J0CA 4FLEA 2BGNA 2XUQA 2WTMA 3AUKA 3PF8A 3A6ZA 5EI5A 1KU0A 1DT5A 1UKBA 2JGLA 1JJIA 2RAUA 1ZIYA 4G1FA 1CUAA 1LZKA 3QBJA 2OCIA 2CB9A 2R8BA 4U2GA 1EDEA 1XRLA 2HA4A 5JD4A 4U2BA 2JGIA 1AMNA 1XZDA 5JZ9A 1E3QA 1DQYA 5ALLA 3PFCA 2WLSA 5AICA 4FOLA
chains in the Genus database with same CATH superfamily
1F9EA 3MS7A 3W6ZA 2BMWA 2Z1MA 4UKDA 4IH1A 1JPVA 1I4OA 3NNSA 4OHBA 5KYNA 4AXXA 3DE6X 4ID3A 2HT6A 1UOQA 2QUBA 1GA6A 4RVFA 2X5NA 4X1YA 4D6YA 3G23A 1WMSA 1R16A 4FS8A 4RACA 4BKOA 3CBGA 2UZAA 4TS3A 4TVKA 1MEOA 1OHHA 2C2WA 2CJPA 2DQ4A 2PBFA 3M6LA 3QFRA 3TCXB 3HJFA 2D1TA 1H93A 1HNXB 5DLDA 4M9QA 4Q4HA 4D56A 3R74A 4ZN6A 4CM1A 1G2IA 1RFGE 4F1JA 4AO7A 1M2OA 4PVDA 3QHPA 5SY6A 3U5TA 1T4GA 2DECA 2QRGA 4B7AA 1T2FA 2Z30A 3PL1A 5BW4A 2WHXA 4BJ1A 3QXSA 1T2DA 3HDYA 4LX8A 2BBOA 2XY4A 1OVGA 3ANNA 2V3VA 4QGAA 4D82A 3WLPA 4ZVRA 3W5CA 4LPSA 2J3IA 3K2BA 1W36B 3OVMA 4D9BA 4D4HA 4L75A 3AVTA 2C2BA 5BY2A 1GZ4A 1FMFA 3RJ9A 3EGOA 4N0MA 3LKVA 2NTNA 4L8GA 4TT3D 4N5NA 5A4JA 1AF4A 1BGXT 1U3GA 4JJGA 1N5RA 2AFHA 3HJBA 1G2OA 2PRKA 4GEKA 1DEHA 4U7DA 3PC6A 1PWXA 2PUFA 2YQZA 4GWLA 1EK0A 1JP7A 1LBIA 1S4QA 3GNTA 4K6GA 1XTBA 2ZB4A 1TAGA 4ZI2A 4XVRA 2JK1A 3W90A 2AQ8A 3E6AA 5JD6A 4J0HA 1A8IA 4OHPA 5P8WA 1V39A 2QP9X 3KG2A 5FWNA 3ROMA 4DR2B 2XRMA 2HRRA 1YT5A 3GYGA 3AR5A 4K28A 2H07A 5IYZA 4ARIA 4GMKA 3AIMA 4E4RA 2FG6C 1NW8A 3JTMA 5GGXA 3CMCO 2VJCA 4ZVOA 2YHBA 3HI4A 1NVFA 4KIJA 2C5AA 4UZSA 5E7IA 5C5DA 3NVKI 3B5IA 3DQQA 4WE3A 4X1OA 2O9JA 4CR6A 4GDFA 4NL4H 4TKUA 4ZXPA 4QPJC 2CSUA 1VYHA 1Q6ZA 2QG9A 4M1YA 4HO1X 5LIRA 2IYAA 3FZNA 4PPNA 1NX6A 1XWWA 1K3FA 4LFAB 1V7PC 1NYLA 1Q5PA 3I6BA 3WMWA 4MZDA 1OV6A 4TKZA 4HPWA 3IJRA 1I9CA 2SNIE 2XMQA 1Y5NA 3A26A 4EKGA 3IEMA 2PPLA 2Y1EA 1XZEA 4TTQA 1GPNA 1ESCA 8AT1A 4M87A 4A4DA 4AG6A 3ANMA 3K9NA 1JSCA 2WHYA 3OLVA 4P34A 1UH5A 1O89A 1J00A 2VZEA 4YRSA 1JEJA 2NP7A 1X1EA 5MN4A 4CUZA 5JQWA 1GPUA 1KJJA 5D87A 1WCIA 3CF2A 4PSAA 2DQZA 1DBWA 4J3FA 4QE3A 3K4HA 5LM3A 3I5UA 2C5FA 1WAMA 4ZQIA 5ITSA 1A8SA 2VHEA 4KYTA 1MRSA 1N1DA 4P92A 4LZJA 1CQPA 2RHCA 2WT4A 4OSOA 3U7FB 3Q9NA 4HB2A 1Y33E 4UPDA 4YV7A 1G8AA 4NBNA 3VZRA 3E9YA 1SC3A 3QTLA 2TMGA 3FSEA 2F1OA 3V1KA 4BFUA 1IBKB 1V6AA 1ZX1A 3D43A 4EENA 1CUGA 4HRVA 2GT1A 4P36A 3V8PA 3PT9A 2ZQZA 3PQ6A 1XCBA 4AKHA 1EXWA 2VXOA 4I08A 1O94A 4DYDA 3IVRA 1YAJA 2GZ2A 3B6ZA 5AJTA 3V9PA 4TS4A 1X1QA 1U3TA 3C7TA 1HG0A 1XEFA 5DGIA 2A30A 3NOXA 1M72A 1J8QA 3NHMA 4G65A 4N39A 3IERA 2R5NA 4HV4A 1P3Y1 5A3JA 4BZPA 1KDOA 3OZXA 3CN7A 5J47A 5IK2A 1GTSA 4QBHA 5EERA 3SC3A 1YRLA 1N9GA 2G17A 1G60A 2VDQB 3DEYX 3JPYA 5T8KA 3GFRA 2FSGA 3ZLTA 1ZUNA 4LGYA 1V1JA 5GZ1A 3D2AA 3C5EA 4JOCA 4HDOB 2X3YA 4J2TA 4R8LA 3ZLBA 4E15A 3LPLA 1HI9A 2FFAA 3ORHA 2VTKA 1SBNE 4ZANA 3OLQA 2NYVA 3BSYA 2X9NA 1KMNA 4O1IA 1MOPA 1M34B 5KX5A 3ZGYA 4MHTA 2WD8A 1Z2PX 3MAAC 3WWCA 1E4YA 2HREA 2LGJA 3EGDA 4R9VA 5DW3A 2DPHA 1Y6QA 3HDTA 3IIJA 2GN2A 2PKWA 3C5HA 4FT2A 4PXAA 4LZLA 3U44A 1LB1B 1TIKA 1ZMXA 2D1RA 1XXHE 4L74A 2ZUEA 1DJMA 5K8LA 4WRRA 3UAVA 2WSMA 1U0BB 1VJGA 3KR9A 3LQRA 1JUDA 2A3RA 4C7JA 4DV7B 4LVOA 3L8DA 1Q0LA 3O4JA 1L5HA 1JF8A 1G8GA 4CI9A 4ESOA 3CIFA 4XPIA 1L7VC 1PNTA 2I6QA 2HMAA 1DJNA 2AEMA 5KKAA 3DMTA 4MPRA 3TVTA 4JI8B 3QEKA 2OQVA 4KHPB 2R7MA 2ZYTX 4MA4A 3T7TA 3WLLA 1MC5A 2POCA 2HWUA 4IKEA 4F9FA 5ALUA 4B80A 2UUPA 1NW3A 3F9RA 3IT3A 1G5HA 4J07A 1IK6A 2ZROA 1T4MA 4A92A 4DLLA 5AI0A 1U4OA 1XHEA 2QJRA 3GGOA 4YX9A 1VBNA 1AQLA 3WP1B 3OMXA 2QX7A 3D1JA 3FA2A 3C85A 5ELXA 3B6MA 3FW1A 2ZIZA 3V8MA 2XWSA 3AHHA 4XVCA 4CMIA 4XM1A 1YOVA 1DC5A 1TQHA 1W96A 1FFDA 2IP4A 1Q1BA 3K8QA 3IO5A 1R6AA 3KLBA 1RWPA 5E4FA 5IASA 4UMFA 5DMHA 1Y1SA 3QI2A 4YQFA 2FR0A 4IVQA 3NC4A 2YV5A 1JLLA 3HXTA 4YGYA 3W0LB 3LGSA 3VJMA 3ZVRA 1KORA 3QF4B 2GX6A 2XDQA 1QHNA 1LDEA 1RAEA 2MYNA 1AK1A 2O06A 2P6PA 2DBVO 2B1IA 2HEGA 4ITRC 1GGNA 3VR5A 2GJ9A 4X00A 4MQBA 3QY9A 4CNQA 3G2OA 3HG7A 3LFUA 5EP2A 5LQSA 5KYYA 2XVXA 4D9HA 4DT1A 1YS1X 2JLAA 1SIBE 2BFMA 5ENVA 4HQ6A 3W7VA 3OZEA 4ROTA 1EP3B 3FYUA 4QU8A 4KPFC 4F9GA 3FF4A 1PJBA 2QU8A 3AW8A 1KSGA 1Z9BA 3AJ8A 3BK2A 3BWCA 5F1OA 3ZKWA 4RCYA 4OP3A 2J3JA 4HMPA 4KL8S 2AE1A 3LPAA 4JJZA 4UBKA 2Z2ZA 5IWCA 2Q1WA 4L4YA 2XKAA 2PKRA 2WTBA 4KIGA 4KUHA 1M2KA 5EQTA 4P54A 1ZRMA 4FFBA 3G6WA 3STYA 4H1VA 4QHSA 1JQDA 1U5BA 3NORA 1YQ9A 1NMSA 3OZDA 1Q22A 1M1YB 1SZPA 3JAWB 3L6CA 3N8DA 3PX2A 5AK6A 2OG1A 2QD4A 2C77A 2I3ZA 3HNRA 3KPUA 3PCRB 3MOSA 2NLOA 3ZWOA 3KHKA 1P1KA 1L7OA 3O4IA 1G9TA 4UCFA 3SR4A 5JIBA 1DKPA 2FEXA 3HXOA 1RKVA 1C30A 1UBMS 5DM70 3U19A 3A1EA 4F46A 3B6KA 4J8PA 4UTZA 4K9PA 1LRKA 4W82A 3IV7A 4QPZA 1CUYA 3CLRC 2Z04A 1UZUA 2JCVA 4OO3A 1OD6A 2ZJ0A 3PC8C 3G9UA 1GN8A 1M83A 3G0CA 4FHDA 4L0CA 4XJVA 1T3GA 3AEXA 2QB5A 1U5CA 3QUCA 4HDSA 4PWZA 3VO1A 1ZXBA 2C7VA 1RWWA 1RXSA 1S1MA 2QNRA 1U2QA 3GRKA 1GP2A 4C07A 1QS0A 3D02A 1XTKA 4QPPA 4MJ7A 2AJ8A 3THWA 3W5DA 1XMQB 1M2FA 3IR5A 2KS6A 2C84A 3WO1A 3EAFA 2FUNB 4HSGA 3I6ZA 4LK3A 4KO8A 1TYAE 1XI2A 4NJEB 4PTLA 2ZRAA 1ZCBA 4HB3A 4P3XA 3G85A 1UFRA 3KL2A 2GN6A 4ZAVA 3QE9Y 1OYWA 2Q0SA 2PL3A 1QH9A 2JAXA 5AKIA 2WSBA 5F1PA 4KR0A 5F1KA 1A5AB 3WGLA 1Z16A 2PBLA 4CE6A 1EI9A 3ADKA 1GAQA 1P62B 1Z62A 1R1DA 3IO3A 2H0QA 4I4TA 1LSSA 4V3BA 4OFZA 4JKIA 1SUWA 4QA9A 3RT1A 2FZCA 1CS4C 4RE6A 5EE5B 1SIOA 1TQDA 1MABA 2FZVA 3D3EA 1C4WA 3I2IA 1B76A 4EB6B 3I0MA 2HLDA 2OV2A 4JB3A 4HNTA 4TLEA 2EJBA 2ZIVB 2Z6QA 3COYA 4WLNA 5B3LA 1XN4A 3AI3A 3R44A 2Y9MB 5AOAA 3U3JA 4L85A 2B3DA 3OIGA 4HAUA 1AOXA 5ERYA 4DLKA 4O1MA 3VA7A 1FPMA 3I8XA 3PXDA 4OHMA 2BM1A 2ECQA 3CE6A 4FD3A 4I1RA 1B15A 3SBOA 5G3ZA 1C4XA 3EPHA 1GTJ1 3RVNA 4CKBB 4GLLA 4FI3C 1ZL0A 3LZ6A 2H52A 4RPJA 4U4AA 3AU9A 4MLZA 4EKEA 5KOJA 2P40A 1QANA 1EUDA 4O0LA 3I09A 4DDMA 1ECGA 3JPWA 1ISFA 1N7JA 4K6OA 3I3SR 4N3AA 1COZA 4QEKA 3VKVA 1TCUA 1XA0A 3EEYA 3AONB 3ETNA 3IQGX 4V0NA 1QPGA 3O82A 4I9NA 3R3XA 4TT3A 4U7GA 4ZVPA 1DTEA 2D0DA 1UJMA 4RLQA 4TN5A 2HRZA 2W11A 3KL4A 4EYOA 5EKXA 1E1CA 1YJ8A 1YKFA 4TWZA 5FIUA 4A23A 1C7RA 5AOBA 1Z0ZA 1WMFA 3NP9A 2CVQA 4EG3A 1CY2A 2A78A 4ZZ0A 1Z38A 3UBMA 5LD2B 1E5QA 1L4LA 3MWLA 4WBNB 3OIDA 2R5WA 2HPVA 4R8KA 1U8YA 3HPRA 4QTTB 2EFEB 5LR6A 3LUGA 5I9BA 2EW1A 4OGLA 1EWVA 1E6CA 1Z5WA 3Q3GE 2I3BA 1Q19A 1ZVKA 1G4AE 1CP2A 3OEEA 1OV4A 3IT1A 3D7SA 3JQ9C 4FE7A 4ZAWA 4BAZA 1FRFS 4JI1B 4Z2AA 2VZ0A 3PNMA 4DEVA 2H2FA 2ZI5A 2P0YA 1D1PA 3DFUA 3EAQA 3CPEA 2ZJ4A 3ASUA 1IEQA 2NZ8A 5JASA 1UKEA 4RMNA 3FNFA 2VK8A 4NZOA 5KNCH 2BE9A 1W46A 1OGJA 2O0JA 4PNHA 4F2WA 1P5FA 3PHCA 4KLCA 3W8NA 3BB4A 4ERXA 2H1LA 5IPFA 3D2LA 5DNUA 2XCLA 1FVHA 1AGYA 4K6MA 3S2UA 4AZ0A 1KGSA 3N2GA 4F9TA 2GO1A 1A4UA 4QXQA 2E85A 1SUEA 3DJYA 2QUIA 1PKEA 2SCUA 3T94A 4J4HA 5C0OE 4MQFB 1NBAA 2AYZA 1KYYA 4YCMA 4OU5A 4RKRA 3GHYA 2QTTA 4I4LA 4ER0A 1E18A 2XVZA 3VBCA 1HNNA 1M5UA 2BP7B 2M98A 1G21B 3DF7A 1PT5A 1Y7HA 2KBEA 2HQ1A 2R47A 3NIFB 4CG3A 5AKLA 1N6OA 1NMYA 1AUQA 1ECBA 4QNRA 4YCDA 4GQBA 3PUIA 1UIRA 4OB6A 1XJ5A 4DR1B 4J1SA 1PIWA 2JGNA 1DMSA 4M0PA 4F3NA 5COBA 4Y6PA 2H17A 3LQ1A 4DAOA 3V80A 1Z7YA 5D00A 5LBTA 3PDIA 3CRNA 1ZP6A 4C30A 2I2DA 4RDIA 5ED4A 3KDPA 1VZ3A 3I6MA 1G1MA 4QSMA 4ZD6A 4TLDA 2CF5A 4FEGA 4FCVA 2G36A 1OMOA 4MS4B 2H1VA 2ZB2A 5GGYA 4D9NA 3L4JA 5U9CA 1OX6A 3KYDA 1J8FA 4AZSA 4ZDIA 4TMZA 2YC2C 4U2FA 4P8RA 1U7PA 4EBFA 1DKQA 3BHNA 2MSNA 4WZBA 1V35A 3LQ4A 3RUAA 2DERA 4V0LA 3NM6B 2JA1A 4FNMA 3HGQA 4LE0A 1QGZA 4OAQA 5IZCC 4CEIA 1HKUA 4B6JA 2VT3A 4IFTA 3B2EA 1UDAA 3Q2IA 2XMGA 2H2AA 3KYCB 3SQXA 2QQGA 2CE7A 4F97A 1GCUA 4U7PB 4XD7D 3DLPX 4JLSA 4KQMA 4CCSA 4Z7OB 1TUEA 3BD6A 1DX9A 2IE0A 4J7AA 3ZCSA 4IINA 4PFSA 2VR1A 1LFAA 3TIXB 4RJTA 1E9AA 2RJNA 1ML3A 2DWPA 4PZUA 1WW2A 3UN1A 1C4KA 2GNPA 3A3KA 4NY1A 3G2HA 5K6RA 4DQXA 2REOA 1J2RA 4CDMA 5L3VA 2O3UA 2WPDD 4GSKA 3VNAA 3ZPXA 3HYNA 4EG6A 1RQXA 3RO7A 3ENWA 1SVNA 1MUUA 1U0JA 1UL1X 2QR2A 3EC2A 3HR8A 3WGOA 3P9ZA 1OC4A 3RSLA 4NJMB 1BDHA 5LDHA 2VJYA 2V8OA 4HUQB 1DZ3A 1LF0A 4WNYA 1Y8CA 2Z8YM 4L5IA 5CT6A 1J9ZA 4RPHA 4WFKA 1UXKA 3AERA 4YRBA 2J9FB 4KR3A 1UFVA 1OX5A 4CMEA 1U02A 4JQOA 4ONEA 5LBUA 1XTSA 1TM4E 5IBPA 4BU1A 4LY3A 4RDHA 5D8DA 1ATZA 3BULA 3BDIA 3PUWA 1KZ4A 3KVNA 1R4ZA 1K6EA 4RVUA 3TEMA 4EY4A 4R6WA 1YFLA 1PQUA 5ALTA 4ZJUA 5L3QA 3A3NA 3AHCA 1QP7A 2QG6A 3WSVA 1HLFA 1OLXB 3KTDA 3ZY6A 3DSRA 1P2UA 4IQ8A 3VOTA 1U3VA 5HRCA 2Q9AA 3O8OA 3ZHXA 4L27A 4Y2QA 2IP1A 1GQRA 5JPIA 4NCBA 1ATIA 1GPH1 3L82B 4H1WA 4JY7A 2XYVA 2IYQA 2D4AA 4AP9A 3D6JA 3WLRA 2LBPA 4E5NA 1WD5A 4NZNA 5LLTA 3KQKA 4R16A 4DR4B 3GEEA 3BC1A 4YQZA 2FJ0A 1KZ9A 4W1QA 2WFLA 1CQIB 3ONFA 2ZJ1A 1BVYF 2F2TA 4RW0A 4XZ3A 4P7KA 5F76A 1YOBA 1EXDA 3ZHRA 4EL5A 1GCOA 2JFXA 2Q45A 2B36A 1ONSA 1NBIA 2BGUA 2XUJA 2Q6OA 4JR1A 4X85A 4C7OB 3LBYA 4KE9A 3L5KA 2PJDA 2GF9A 1LJLA 3QWAA 3I6QA 3D4PA 4YO8A 2WJJA 4KE8A 5KMGB 3CX8A 3IP1A 1KK1A 3L41A 2MSLA 1EAYA 1H1DA 1U7OA 3LS2A 1KWGA 2QE7D 2NZUG 1AT1A 3LX8A 2J5QA 4JMLA 1F48A 3IMCA 4EEZA 3UJDA 4CLOB 2DAPA 3GB9A 3FVRA 3SU8A 5AQ1A 4MCAA 1VCMA 1WVGA 3OIVA 5FULA 3RUDA 2C78A 2CSXA 1SELA 3WK6A 4HGNA 5JJ5A 3IKLA 3VHXA 1REQB 2IS2A 2WK1A 3KD2A 5G4KB 1QAMA 2FMIA 1P5ZB 1J0CA 3VU9A 5I7UA 2PGAA 3BXOA 4YIHA 3V33A 4HFMA 2LXNA 3R8XA 3KSZO 2PV7A 1GQOA 3GIDA 4KW7A 4Y2XA 5A5VA 4QPNA 4F2HA 1BHSA 2F9MA 2HK8A 1JA9A 4QDUA 4BC0A 5ALOA 3VSEA 4O4JB 2W2PA 4YJHA 2H48A 2OO5A 3WMXA 1I3KA 5GZ3A 2H4XA 5CNMA 3AXSA 2ECKA 4F4HA 1G7SA 2QAGC 2R6HA 2TYSB 3DLTA 5AI5A 3ZS9A 4BNVA 4QASA 3V3TA 3P9YA 1NVXQ 1TYBE 2WF5A 4MGHA 5CHYA 1GKIA 1I7LA 1S8OA 2FW9A 4IGEA 4F8YA 4OXRA 5JRZA 2JFBA 5KNCA 5LC1A 4GUAA 4RZUA 4TS9A 1FOEB 1LJUA 2FQQA 3U9LA 3PYMA 3G7SA 3QITA 1AHPA 1ZONA 3QSYA 1G7CA 1OZHA 1VJTA 3VU3A 5TPWB 2FEMA 3UTCA 1V11A 5B57C 2JD1A 3KJZA 3OI7A 2UUCB 3LLMA 4B3BA 2AMJA 1W88B 1GOTA 4DMRA 5C1DA 1XNJA 1FSFA 5C7YA 1NC1A 3KVRA 3RAPR 1QFYA 4KQ1A 4RKYA 4YA6A 1XZAA 3B13B 3ME5A 1U8TA 1HK7A 2PXXA 3PHJA 3W79A 3WGJA 3L7IA 3QELA 3HBMA 3CV3A 1H9BA 1U0SY 3PWKA 5HRUA 4HJRA 2DPYA 1SPBS 4JYAB 2ORWA 3PNVA 2IBSA 3IMGA 1ZVMA 1AC5A 4EPVA 2PQMA 3MWEA 4Y6RA 4Y2RA 4AN1A 3PVCA 2PSSA 1NQWA 2HU5A 2ZUWA 1MU0A 4V3CA 5ECDA 5T64A 1U90A 2RI6A 3VU8A 4C1BA 5CIQA 4ARZA 4JUBA 4MGZR 4CCYB 1U2ZA 3WB2A 3L7YA 1TADA 2JF0A 3DTNA 3GEHA 1W5FA 3NZEA 4AROA 2OXCA 3E0QA 4UCWA 2VSYA 1U7UA 3N0XA 3AVPA 4TMKA 3W2GA 1HMPA 1NF2A 2QD2A 3EZLA 3PWZA 4HZUA 5C4MA 1HQDA 1QAOA 2V5AA 1QO9A 2X6RA 3MCUA 4PG4A 1L5GB 3RW9A 4EHBA 2Z6VA 5LQJA 1XL1A 3H2JA 2JCSA 1TO6A 4GZ3A 4KQ6A 5E3HA 3I9V1 2V8BA 3HYSA 4EFKA 2XVMA 3JWHA 3AIIA 3Q6MA 5AXCA 1IATA 1QNLA 1V5GA 4O29A 2OD9A 3NHWA 3HO8A 2WWWA 1DTWA 5L3SB 3W77A 4G8BA 4HNRA 3AJRA 1FFYA 2VEOA 3BX1A 3SJCA 1V43A 3ESCA 3FOAA 4DMCA 2X6QA 3ZVNA 3D8NA 1W4LA 4JNKA 5CLQA 2WVHA 4N5LA 3GNQA 3TTXA 4UFNA 3NJ4A 5B2EA 5EHXA 3U3OA 2JVKA 1C80A 1DQNA 3HA2A 3VR2D 3ZCTA 4ARUA 2FCRA 3WNBA 5KWIA 1WB5A 3PL5A 4RU1A 3TWOA 4BNFA 4GZ6A 2HJ9A 3JALA 3K9HA 4DPLA 4ENUA 5KPDA 1D8AA 2WJZB 1BWPA 2I65A 4Z9FA 2O19A 2ZRQA 5BV1A 3H6HA 4TSKA 5BWMA 3AFOA 1JLRA 1Z36A 4HNVA 2QTCA 4A2WA 2NIPA 3C6QA 4BZWA 5K0CA 4HDNB 4IH9A 3OWHA 4KO3S 3P27A 1LFDB 1TLLA 3K0CC 5IFLA 4DTCA 3RC1A 3LU1A 1XU4A 2GN8A 3BXHA 4EX7A 3M4ZA 2EKLA 2NVBA 5JU6A 1DAOA 3ROGA 1HTBA 3GEGA 2RG7A 2WF8A 2WZDA 4DNPA 1JEYA 1ZMBA 1X1TA 2X5KO 3U3MA 4Z1OA 3GD5A 2A7QA 3FOCA 1SM4A 1X1SA 1LPAB 3AFMA 3BHIA 4F3YA 4UTNA 1NNUA 3MTIA 3R5JA 4MDHA 4ND4A 5HJEA 3HSKA 4HZGA 1RRKA 3DLBA 3L9WA 2GKSA 3QEOA 4DABA 5A03A 5IAEA 2QQ5A 1GUZA 4FFDA 3QVMA 3C41J 4EF5A 1OWOA 1A8QA 4OX9Y 1E3DA 2PKQP 3CG4A 2JFHA 3HVUA 1R4MA 2QTHA 2AJBA 4OQXA 3SJUA 4KITB 5FXMA 1ESZA 2P6OA 2DWOA 3BWYA 4DJFC 4I5EA 1ELOA 2ZQ5A 3H4IA 4S0XA 2YWHA 4PPGA 4C6SA 4F9EA 5C81A 4B4DA 3ZDBA 4NSNA 1UDWA 3S2YA 2RK6A 3ZBUA 3WHIA 1T6YA 1OI3A 2PEYA 3F9CA 3H9BA 4OHZA 3UZUA 4MV7A 3KAQA 1TOAA 2C2ZA 1G5PA 3GJZA 3OE1A 1G98A 2ZT5A 4PONA 4CM4B 1OU0A 2O23A 1IE3A 1KS9A 1E2DA 3IBGA 5KQMA 5K0SA 2CJWB 4JOQA 5E2BA 2YN2A 3R8CA 3EDYA 4YT5A 2IK8A 2RMKA 3HWWA 5AJHA 3RK0A 1U2DA 4EWLA 3EGWA 2FNAA 3VUFA 4YPOA 2PRYA 1Q1QA 3FR8A 4MVYA 1ZA2A 1E2FA 3CHYA 3WNZA 2UUAB 5K9ZA 2NP6A 2AQKA 5H5JA 4RFSB 2CUTA 4R1LA 3R3JA 4G0NA 2WZBA 4DCNA 3KQNA 3ZD9A 3N6VA 4Q3AA 4XD7A 2VDWA 1PS9A 3V4LA 1E59A 4FGZA 3LRXA 3VR6H 3F8SA 3PI6A 3LQQA 1W4AA 3C6MA 4IDAA 1TCVA 1WO8A 4DAEA 2N0SA 2VDPB 1OGIA 3O2NA 5ALPA 5ERXA 2QHXA 1N3IA 4C05A 4EVIA 3UJNA 2PYIA 3E9QA 3U7QA 3ZGNA 2IZ5A 5C53B 1PEKE 2J5BA 2WPDA 3RTAA 3LLUA 5KYXA 5L7WA 4O1HA 4L50A 2H63A 3TLMA 2NU6A 1GHTA 1LDGA 4EGJA 1XXLA 4Q7QA 4JI0B 3R9XA 4MRRA 4MWEA 1QIMA 3I73A 4PV7A 3TMKA 2XITA 4CM5A 4RJIA 1CZHA 4HKTA 5IRCD 5C1IA 1GNLA 3DG9A 2J3KA 2Q29A 2H2IA 3Q88A 4FX2A 1G20E 1TEVA 2JLSA 1ZD1A 3FPCA 1E4EB 4OLBA 1WJGA 3PE6A 4GU5A 1GCAA 1YVRA 5BVHA 4N8DA 2FMKA 2VO1A 2RJ3A 4IUYA 3UK2A 2IIQA 1PL8A 3KM0A 2ZIFA 4OLHA 3EULA 3FKQA 3AZQA 4XQEA 2HK9A 3D54D 3I5XA 4UAUA 3QYAA 2BBSA 3IEKA 2H4ZA 3LSYA 3TR5A 1BX3A 1XQVA 1DRJA 2YASA 4XRRA 4CEHB 4ZOLA 1M2VB 1PNQA 3GRCA 3PQ3A 5HGJA 4ZI3A 5K45A 2IHZA 2HYDA 2PD3A 2C4MA 4ZCSA 3VNUA 1P7CA 2CMKA 2RKWA 1PYGA 4TV9B 2C9YA 1XVUA 2QZJA 2ILTA 3OAAD 3HI6A 1GPDG 2UVDA 1CIPA 1N8TA 3UJPA 3RB8A 3HP7A 3IQXA 1FW8A 4Q9IA 2OHHA 2ZFUA 3C3AA 3IIIA 3BRQA 1NG9A 2JAOA 2P9HA 3P2OA 2HXGA 1BWSA 4YAJA 4WA7A 3C1AA 4AZ3A 3WAGA 3MT8A 3E8XA 5EWJB 2Z4SA 4N6GA 4MQEB 1JIKA 3EGIA 3ND6A 3VO2A 2A5GA 2BEVB 3LUFA 4U00A 2V7WA 5JISA 5K0EA 1P2TA 1V7ZA 1ZN8A 3LXXA 1LJ8A 4KQ9A 4Q9NA 3EZ7A 4IV5A 1EXMA 2QSYA 3GEIA 5LLSA 3GV0A 3WV4A 1PK9A 2LCFA 2V65A 3JQEA 1VP9A 4WY5A 5FTNA 4F3CA 3K0AA 2WM8A 1V5EA 4C7VA 2CJFA 4PAQA 1M6NA 1SURA 2QE7A 1GSAA 3OLXA 1T24A 1OCEA 1V8OA 2VHQA 3GJSA 3H9JA 5I9MA 2EKDA 1IJFA 5FOQA 4AN4A 2YMMA 3THXB 1QVRA 1B8VA 2B1RA 4I66A 2X7XA 3BWBA 3E5RA 3KQYA 5HXAA 1VJ5A 1D03A 4HDKA 4KFTA 4U2DA 1A0OA 5EIWA 1Z28A 5AW8A 2GCGA 3PRJA 5TQ0A 3ZCQA 2Q4BA 3ADBA 1LC0A 2O5VA 2VA8A 3GZTB 1IMJA 4BP3A 3ZBQA 5FHQA 1Z45A 3RIGA 4Z4HA 1H0SA 2YVKA 3SEAA 2ZYSA 4X3PA 5JCXA 1O54A 2A9JA 3IYLW 2E1PA 2YXDA 4MKGA 1NF3A 2D8AA 3V8EA 5FA8A 3SYRA 9ABPA 2GYWA 4YRZA 3DGFC 1YULA 1AKTA 1QJ4A 1O6GA 1JHUA 3G6KA 4F12A 1CR6A 4MLDA 2CFCA 4MWDA 2WWXA 5HA5A 3CX3A 2D13A 4D0RA 2OORC 2C1XA 1Q3TA 1DJOA 1WDWB 2GZ3A 1PWYE 2AFRA 4HH4A 5IVIA 2PUDA 2P0AA 4HNGA 1T6NA 2YFHA 1XQ6A 4OQDA 4HN2A 4E2ZA 3OM1A 2NU8B 1UBCA 2ZRKA 3HCBA 1DKNA 4LXYA 4P2BA 5F2OA 2RHLA 3VRHA 4LQLA 3SSOA 1Q3KA 5GONB 1EFDN 1GR1A 3TS1A 5ITVA 2FPIB 2IKQA 4P0QB 2OWEA 4P5EA 3UT5B 3QHQA 1JBQA 4JWKA 2HZBA 4P6VF 5JH7F 2A5JA 4E5MA 1KI6B 2JCYA 4ZVMA 4G0MA 3RUFA 4J3JA 3NV7A 4X24A 2PEZA 1UXGA 3AX6A 1A8PA 2BEKA 2AFIA 1QGUA 3EEIA 2JRCA 2P75A 3JTEA 4NAVA 4X8HA 5TV2A 3WFIA 4RHTA 4II7A 1YS4A 4XYGA 3SD7A 2V3WA 1FTYA 5KU7A 3QGMA 1P72A 2C8KA 2PUTA 3QYJA 3K71B 5K01A 1LU9A 2OG2A 5KNDH 2DT8A 2Q8QA 4POAA 5DX8A 4V0ME 1LSOA 3EFBA 4P5PA 4ZQHA 4BATA 2ZWPA 4NDNE 2X5JO 1UC4B 3E3OA 3H8JA 3KVOA 4AULA 3E7PA 1APBA 3BFPA 4RWEA 2ZAMA 4LTDA 1ZXXA 1F4PA 4NBTA 2AYYA 4BEBA 4PFKA 1HL3A 5CITA 2G0AA 1PGPA 2Z43A 4X3CA 3Q8LA 1G59A 1X14A 2A2ZA 1QM5A 2R8YA 5TQ2A 4BVBA 4RTSA 1FUEA 3QVUA 3TMAA 3R3HA 4JGBA 1J4AA 4ZU1X 5FUYA 5L40A 3M6IA 2ACVA 3ZXIA 2O3QA 2QWXA 4IHQA 3UMMA 3WHLA 2HSJA 3EFOA 1H05A 1R5BA 2IYLD 1U0TA 3HDJA 4M0MA 1MFPA 5FT9A 3RHSA 3X1YA 1C3OB 3DM9B 2O5CA 1G2PA 2BSQA 2PWYA 5B4TA 2VCHA 1Z68A 3CVXA 2MDTA 1CF2O 2WYHA 2WIKA 3MMSA 1RRGA 2FK8A 1F2DA 4JC5A 4HRYA 4M86A 4P0PB 2GLXA 4JJKA 3D6HA 3EBLA 5HVNA 2YW2A 1HDRA 4JBNA 2V9ZA 2BI4A 1H9AA 3H6GA 4HGZA 4QFBA 2YZ2A 4W7HA 3CVYA 3QXHA 4G0WA 3K73O 4KRFA 4OBBA 3WIUA 4XQ9A 3MJVA 1E1NA 3HY3A 1CDOA 1OVMA 3C8DA 3NCHA 1YZYA 2OCYC 4BKMA 2I80A 1OXMA 1OZ0A 4TWBA 3A9RA 3RKSA 5HM6A 3OP1A 5CAEB 3RFFA 4YLYA 2AI2A 3RRYA 4ZHQF 1TUIA 2BFCB 3CLVA 2LKCA 2EGGA 2WHPA 3L6OO 4N3GA 4BV8A 3L18A 4QLBA 1QSGA 2CCGA 4BEVA 1OWLA 5FFMA 3IAS1 2CZQA 1NONA 1NQAO 4KXUA 3VR2A 3WRVA 3S6JA 2SKEA 4JBGA 2RGUA 2NVUB 5ES4B 2TMKA 4B32A 5JY6A 4P9NA 3FFTA 2PUJA 4HXGA 1WUHS 1JG1A 1UJCA 2EV9A 3I42A 2ODWA 2AI3A 3GJ3A 3KR0A 1XJQA 5J2UF 1PR0A 3BA1A 1V1MA 2UYGA 4IJWA 4HQLA 1SCUA 2FZLA 3GA0A 4OQLA 3PHHA 4D9MA 4D45A 3E4CA 3EYAA 1HO3A 1QFMA 4MKRA 5JFTA 2Z57A 5AJWA 4JI4B 1O3YA 2QMZA 1Z4NA 2KJQA 4XKJA 3L7JA 3BICA 3CRZA 2X8WA 3H1FA 3IOYA 4OFWA 4D4LA 5HJ5A 1WBDA 3RT7A 1OLSA 5FRDA 1Z0IA 1ZD3A 4A0QA 3KZXA 4LDRA 13PKA 3PF9A 5IT5A 2JKZA 2UYCA 2GKOA 4NEGA 3ADDA 2F9LA 3GFQA 4EO9A 3TK1A 3LBNA 4C0JA 1YK1A 4Q02A 5T3YA 3J81k 4MUBA 1OWNA 1Q0QA 2P9BA 3L79A 2PO7A 1S7CA 4ZYVA 3MSCA 4L4SA 4IW3B 4C76A 3W5AA 4PLVA 4EEXA 1JXMA 3DP9A 3F6RA 2MINB 3T1OA 3VPDA 4ASUA 4C0XA 1NOJA 1WB6A 1VPVA 4NE7A 3TQHA 3A11A 4GHWA 4Q21A 5HKAA 4H18A 3VAYA 2JLRA 1GT6A 2WHRA 3HN6A 4K03A 4AJHA 5JRJA 1GZ6A 1QZTA 4FGUA 2JFGA 1IZYA 3C1OA 3CUUA 3KSAC 1JYSA 1JI0A 1XF1A 2QYHA 5TNXA 3I83A 4MUIA 3EPLA 3MW8A 4X7MA 1RLOA 1O94C 3H8VA 4BLOA 5HZMA 2R1ZA 2AUNA 3HEMA 5JYEA 1QH0A 1N6PA 4EUEA 2NZ2A 5D84A 3THYB 1OF1A 2DQKA 2R00A 3JYLA 4PHGA 4YAKA 1KAQA 4WCFA 2G9UA 5TARA 9ATCA 1T4CA 4P4UA 2AQHA 1TKCA 3Q3IA 4Y67A 3GVPA 2GVDC 5JHHB 4FOTA 1U1IA 2HUNA 2OFOA 3N8IA 5JQGF 5FV4A 1O77A 1QYIA 4FOPA 4JIGA 5T8KC 1PJCA 2ETVA 3NKLA 3B6JA 4L76A 2Y2UA 2HQRA 1BS1A 3E81A 1O96B 1PZGA 3OKCA 2ZR8A 1PQPA 5BURA 2ZJAA 2YZMA 2VAVA 4GKBA 4MR9B 5D51S 5CIWA 2WILA 2D1QA 4D3ZA 2HGSA 1UBEA 2NUTA 4GW3A 1CFZA 3NEAA 4FTWA 3DZFA 1NXOA 2YVUA 4TWAA 3O9MA 4ARAA 1UPUA 4OQZA 2IGTA 2BD0A 3DKKA 4OOEA 5HK8A 3P9RA 3Q72A 1T0PA 3I6YA 4MO2A 3HCDA 2GASA 5BR1A 5JCZA 5LOVB 4C08A 1RXVA 3FUUA 1TU3A 1Z08A 1U99A 6AT1A 1T2CA 3C14C 3IC5A 5F7ZA 3OM9A 2BMAA 4ZAFA 4DV1B 1IAVA 4AN0A 4MMXB 3PC7A 2FWRA 3GEPA 1P33A 1QF6A 3A4NA 5J1TB 4FWTA 4XUGB 4HHEA 3AVYA 2Q2OA 2P67A 3EK2A 1YR8A 3K0FB 2J4FA 1S1CA 4J29A 4P0TA 5A7GA 2XCTB 3GLIE 3OJEA 2V9CA 3E2MA 4PLTA 3DMTC 1DUSA 1ZSYA 3L7MA 2LTAA 2YZGA 4D80A 4EFDA 2VHXA 2ZRNA 1E1QD 4UNPA 1B0AA 2FZWA 4KXFB 3VJKA 1JR2A 3L1VA 4NOJA 4PZCA 3HK2A 1OX4B 3UHPA 4AUEA 4EHIA 1NAIA 3GFGA 2Z4RA 4HWPA 3KUCA 4ODIA 5LQMA 2ZQYA 5ALJA 3NM5A 1NURA 3IELA 1QYXA 2PWAA 5A2QA 4FBGA 1KRXA 3WFZA 3B1KA 3JQ8B 1FJ2A 3S29A 2DUMA 4O0MA 3Q0IA 1X77A 3HVKA 4HPXB 3I1JA 2KSQA 4DCUA 2RH9B 3EN0A 1WIWA 2B0JA 3OAAA 4EMSA 2GN0A 1XCJA 4YRKA 5ARBA 5I9TA 2EARA 1MIHA 3K8YA 1H2BA 5ITWA 1FF9A 4EG7A 1ILEA 2QXUA 3KDSE 4MCIA 4P32A 1PV4A 4KH0A 2VDRB 2DM6A 3DW1X 1GSIA 3Q87B 1ZMTA 2GCOB 1G0OA 2G5PA 1QHYA 3OZVA 1JSLA 4E5VA 2R7NA 1R6DA 2EZTA 3MGBA 4F5YA 3TG2A 1WCWA 4DV3B 2GYUA 3VXKA 4K26A 2IYZA 1NLUA 2OZEA 3SYMA 4D8XA 2ZW9A 3VAAA 1UKYA 3NEPX 1NHGA 1RXCA 1E3WA 2VBGA 1O6CA 1OBOA 1P0FA 1Z29A 1ZBQA 3FYUC 5FLYA 5FO0A 4O4HF 4YJFA 4ZFNA 3K0EA 3H9EO 1ORVA 1AB6A 2VCYA 4U3JA 4ADSG 5L3ZA 1EBUA 5DYYA 2PX4A 5EIAA 5EXEA 4EMBA 4XGNA 2AV6A 2J85A 1BX0A 3MERA 3PZRA 1PL0A 3JVVA 4JUDX 1YJAA 2FVXA 3D8RA 5LQNA 1BJKA 1AKWA 1E2KA 3LOPA 1I24A 4UNQA 2HU2A 5LJIA 1G4UR 1V71A 4Q00A 1ZJYA 1MB9A 2O1WA 4JC8A 2EG9A 1KQGA 2LNDA 3TSZA 4IEFB 3INTA 5JPDA 1D4FA 1X1DA 5AFSA 4FVTA 1VL2A 4F6RA 3OPMA 4AW9A 3CSUA 1IK4A 3PWSA 4K46A 5IANA 5DBFA 4MINA 2G04A 4HNAB 1KAEA 1T0BA 4LBVA 1ZGZA 3B1WA 5FOUA 1WSDA 4Y2JA 4AECA 4BJ3A 3AT1A 2QEQA 3HKEB 1M1XB 1GPWB 3L01A 3TLCA 4WK2B 3QX8A 2BLNA 4ZOCA 1P7VA 1Q0SA 1SK8A 1BMDA 2REXB 1GA4A 3M4YA 3B9PA 4CFSA 3GLUA 1QAQA 4CKCB 5KNBH 1ORRA 4P4GA 3WI7A 1XZHA 3EEQA 2ATCA 3ZLJA 3JD4A 1W36D 3MT7A 2X8JA 2PMBA 1J21A 1PGOA 1R66A 4TL8A 4NHOA 5I45A 2V4ZA 2XNDD 1XWIA 3KPVA 3M6UA 2ADFA 3LCVB 1LGYA 3WMEA 5J4YA 4DNOA 1QONA 2I8CA 2TRSB 5M7EA 1XD2A 5IS2A 1Y6FA 2H11A 4IZ6A 4IBOA 5A7FA 3DMDA 4URZR 1H5NA 2E5LB 1SVUA 1G5RA 4RJJA 5TSDA 2FE4A 2ZAGA 4EF6A 4PG7A 4R2JA 4R2LA 1TGYA 2DBYA 3BJEA 2JFVA 4KXNA 9GPBA 2F59A 4OH7A 1QUFA 4N7RA 1KSFX 4ER5A 2P6RA 1JHYA 3QW4B 1ESNA 3GUHA 4PC6A 2FWJA 2R1TB 4M2LA 5CVCA 4NLLA 1DQZA 1GUYA 3LPCA 3WOVA 4LJSA 4YRIA 5JW6A 2PRJA 5ICEA 3AOGA 2DGDA 2Z09A 4W9MC 1CUIA 2X8LA 4HBGA 5LXTB 1ZRNA 4QTYA 3HUTA 3KKOA 4JUCA 3EWIA 3UAWA 1PI3A 4D6PA 1OYVA 5IXSA 4M1WA 5JTTA 1D7OA 2XRZA 5EE1A 3R8FA 1PW5A 2PANA 3T4XA 3PS9A 4KAAA 1DFGA 2R6FA 4KZKA 1BFKA 1RWXA 1QIDA 4MLPA 2FP4B 4U5QA 2XYPA 4G09A 4BVJA 5FL3A 4CGYA 1Z13A 2O8EA 3R9IA 5FUQA 4FX5A 1A98A 1JJAA 1IHPA 1UMCB 2J3EA 2JH8A 3N2YA 5LP1A 1XDBA 4KQFA 1QYDA 2QZSA 3RIEA 3WWZA 2VWGA 1TT5A 2JIOA 3ZWYA 2R65A 5F4BA 2PMEA 3K0BA 3HWRA 3BMOA 3PHBE 1M5TA 2LUOA 5LYJA 1VHWA 4LMBA 1JDPA 3HKDB 5JVDF 3ZJTA 4WBXC 1IXRC 4NU6A 3ZDQA 4NBSA 2AKYA 2IJGX 3HTXA 3EXG2 5CEJA 4KR6A 3PYXA 1R0KA 2XA2A 4HVAA 1YV9A 2XDYA 1OH6A 2OENG 1WVIA 3IB6A 1IQ0A 1Y34E 4IUBS 1YE8A 4R68A 4XVQA 1XA4A 4W1SA 3TVYA 3OP4A 2CNDA 4XIYA 1XYVA 4EPYA 1VKZA 5EJ9A 2WUVA 4Q9HA 5JH7A 4QUEA 2FLVA 1Z8NA 4ZEOA 5TGTA 3PFHA 1T5IA 3HN2A 2ZPAA 1GPKA 4MW2A 4Y9SA 2ZT7A 1YQWA 2JH3A 1N36B 1Z17A 4OIFA 3H2HA 4FUQA 4RXMA 4HTAA 3LVRE 2IYWA 4HY3A 1T8UA 1SXJA 2BGLA 3U4MA 4BNNA 1EWTA 2J3DA 4MTLA 5KDDA 3A6GA 3MAGA 4CEJA 1EA5A 1VHQA 4DBLE 3IKJA 1KKMA 3HGTA 4I14A 1DHTA 5DN6A 4IP0A 4DW8A 1E9EA 1Q7BA 1THZA 3SIXA 1FK8A 3U16A 4B6GA 3EOZA 3Q2OA 1NATA 3DE7X 4ZRDA 3FR7A 5JNUA 1PHRA 3SICE 5HS4A 1VDZA 3ZDDA 1CQJB 5B4UA 1TAQA 2XR1A 3SF8B 4R40A 3WIOA 2F1JA 1P8JA 1X86B 1PL7A 2CNKA 2X8BA 1ZOPA 2B30A 1G7TA 3D7NA 5TT1A 2YYSA 1QTRA 1J2EA 1G1AA 4YECA 2B5VA 3ZZTA 1OTHA 1QORA 3QZUA 4HX5A 4DIMA 3ZVKA 1L8XA 2AXNA 2Q3HA 5J63A 2ZRDA 3WL8A 2BGWA 2P9TA 4CDNA 3R7WA 1T0IA 1QOQB 1EU1A 1YMUA 4Y1EA 1KQ3A 2CL7X 2GNAA 3EB9A 2NV2B 1JEDA 5KTTA 2NTEA 4FLFA 3OZRA 2XXAB 3H3JA 2LE0A 3BS4A 4TTVA 2QTVB 3CURA 2FWIA 5BSVA 1A27A 2Q4RA 2GH1A 3MINA 1XZBA 4KGXA 2X6TA 2YN4A 3PDHA 4AYXA 5IT4A 4N3BA 1UWVA 3W5HA 3OY7A 1ZNZA 4FCTA 1HM5A 2WT8A 2Q1YA 2GARA 3N3BC 3OJOA 4G2TA 1Z6PA 4RVHA 4ZHQA 3VO8A 5TRTA 4X90A 3OA0A 4K1LA 3W2EA 1E7YA 4UNNA 5G3YA 2OA0A 1BO6A 3NCTA 1XYGA 2C5HA 4TTRA 2M6KA 3OT1A 3E7FA 2AIRA 1I2BA 4KDCA 3UA4A 4D9CA 4PYIA 3WO0A 1J2UA 3MTEA 1DTSA 2ZYAA 1GA1A 4C5CA 2JIZD 4PIVA 1X7ZA 5J2UA 1Y7IA 3P0RA 4WLEA 4KXWA 4N0EA 1PFWA 4JDUA 1IU9A 1IHDA 2B7LA 4QDXA 5DYGA 1NVDA 3U7RA 2HHCA 3QVGA 1A9YA 3RVOA 1I0LA 3JRXA 4LRUA 3EXG1 5IC5A 1E92A 4E70A 2I7TA 2PK3A 4CMEC 2JFWA 4ZV7A 4ENRA 1NE2A 1JZSA 1XTPA 1Z0AA 4LC1A 2PGLA 3ZCRA 1Z7GA 1L9XA 4Q1FA 1RM3A 2I2AA 4F4DA 3FOEC 1MDFA 2EKQA 1F2VA 1SQGA 3DHNA 3B7PA 4P80A 5KNBA 1ULZA 2J4DA 3DYBA 4V0OA 2PX0A 3H0EA 1WG8A 4GP7A 2Q07A 1C7IA 1IFXA 4TXLA 3REOA 1Q2XA 4DCVA 3D8UA 4BX2A 4DNFA 4OHXA 5IEJA 2FB9A 1A7UA 1ZU5A 3OPYB 1II8B 5SYAA 2B2XA 1T9KA 2Y0DA 4JJEA 2D0PB 4DUGA 2IDMA 4FR2A 3BRWD 5FPPA 4URHA 2IDKA 5LPNA 3CT4A 2VUSA 4LC9A 2OCXA 4EUNA 1ZIPA 3CE9A 1MIOA 4RV4A 3NTOA 5F1YA 5MDHA 2G9QA 2OTCA 4QWMA 4R0VA 2P9YA 5F52A 1CJTC 4LS3A 4M7OA 3KZCA 2PH1A 2OCBA 1P7PA 1T2EA 1S2MA 2J8ZA 3IAM6 4MQ6A 1Z83A 3ZCVA 3OHMA 5BSFA 2CUNA 5IKMA 5JS6A 3PLAE 1B23P 1U1CA 2AG1A 2N3ZA 1RHMA 4L7QA 4P82A 2WIFA 2HRBA 4GX0A 3R3YA 5CYOA 2Z1DA 4LYGA 1NUAA 4A5SA 2BDTA 3F5SA 2C9ZA 4F45A 1TW3A 3QSGA 4NR0A 4WBNF 2OV1A 2FY8A 1HQCA 2JZNA 2UVPA 3ABIA 3QU9A 4WGGA 3RUEA 1PK8A 2X4DA 1YDFA 2BCEA 5IMSA 4M98A 1I30A 1WUKS 1A2OA 1W2WB 3BZBA 1XN1A 2EQAA 2QAGB 2RGDA 3Q3HA 1MC4A 4Q1DA 1CJCA 4ZAYA 5JQGA 3FPGA 1M2JA 4OB7A 4D0LB 2EXXA 3AUUA 4UBMA 1JFTA 1VJDA 3WIBA 3B53X 3H9UA 4B4UA 4UHDA 4O4IB 2CFSA 2QL6A 4ARBA 5IT9A 1PZFA 4WASA 3H5WA 5IDXA 4MQUA 1JMKC 2VLBA 5GVSA 2ZP1A 2HJVA 2PCLA 4H6PA 1TCBA 4RPCA 4YJ2B 1DC6A 3RSGA 3TW6A 3WGKA 5CDUA 1WUYA 1C0EA 3OMLA 3GNLA 1H6CA 3SXJA 4QJ4A 1ZEMA 3PIRA 1TTHA 5DBIA 3ZBTA 2HK6A 3SBDA 4PO3X 4NEQA 1US8B 2BGKA 4MPPA 5BQOA 2IV2X 1P1CA 4RH1A 4UOEA 4HEA1 5IKPA 3IODA 1FS6A 3TJMA 4DMUB 1ULBA 2JHPA 3G49A 3KSDO 3PC2A 2OO5C 1LV7A 4YUWA 2FPXA 4IFEA 3ZNQA 5AKGA 4O02B 3CLUC 4B82A 4ENTA 1IWPB 1DXQA 2EZ4A 2VJMA 4LHSA 6ABPA 5MHTA 1BU5A 1WZNA 2M6LA 5AVXA 1Q0TA 2JFNA 1N5KA 1ZIDA 2NSHA 2V6GA 4WXEA 4DIFA 5GWXA 1WU7A 2C99A 3GG2A 4IGFA 1GIAA 1M75A 2V98A 3EMBA 4IMJB 3X43A 4OL9A 4ZYLA 3ROFA 1V47A 1X7YB 5KSYA 1NW5A 2BUCA 2DTXA 2KBFA 3RRZA 3T41A 4UFOA 1IHYA 2NQ2C 1VB3A 2C0PA 2XT6A 1IM8A 3OF3A 4WJLA 3NANA 3EXEA 1NQOA 1UK9A 1V3UA 3ANXA 3EBOA 3O9ZA 4BRZA 3AY0A 3DHVA 3M3PA 1OLUB 2PS3A 2XNDA 3Q12A 3Q0TA 4K9OA 5EA2A 4Z0PA 2HMVA 2RGEA 3IP9A 1ECPA 3WRXA 1F2UB 1CEQA 4Q34A 3P97A 5M5BA 5FAXA 3ZWNA 4F6LA 3LK6A 4HX2A 1JR3E 1RCUA 1HDXA 3D0OA 2WM2A 2AZ4A 3L6BA 1M76A 1T9AA 3N59A 5HMMA 2B8JA 1UPCA 1G3IA 2WSYB 3Q6NA 4M46A 4UHKA 5LVAA 2GXAA 1A9QA 2MYPA 4YY3B 2J7KA 3UWKA 4GS5A 1N5IA 2X2PA 4YASA 4E4YA 4GOXA 3E9ZA 5F4ZA 2NNWB 5CEFA 3PTLA 5FTJA 4BQSA 3QTTA 3ILVA 4AYTA 1DAFA 4XQCA 2C7GA 3UGTA 1A96A 1B14A 1P1HA 2PXAA 1Q12A 4O8ZA 2ZE5A 4G8JA 4O4HA 1NXPA 1ZCFA 3C3EA 5EHQA 3RYIA 3TIIA 1F9AA 1XR3A 3N28A 2XDAA 3PEEA 2JIPA 5IN4A 3EMDA 3I0ZA 2WHQA 3JU3A 2NSJA 1KP2A 1XVLA 2ZYDA 1U9JA 3IDFA 1U8CB 4QOFA 3KT6A 1QPBA 4UU8A 4W8OA 1TQ4A 3K20A 2LD4A 4OV6B 3U2QA 1R0WA 3TTSA 5AOCA 2X0JA 2ZVQX 4N03A 3FWYA 1RW4A 5CM2Z 5AUNB 1VRWA 1VDMA 3RSZA 4ZQGA 4RGVA 3TSYA 3IVAA 3IHLA 4ZI7F 5I01A 3ITNA 2I78A 2ZUDA 2P2ZA 3N9IA 2W8ZA 4J9VA 5LKAA 2XUPA 1YS6A 2BI7A 4TTIA 2QTAA 3L7OA 3IE1A 3DR3A 2YXLA 4JVNA 5JSFA 3IBSA 1E79A 1LNQA 4DLPA 2VBCA 4IRMA 3RIHA 2Q8PA 1Y42X 3IBYA 1JIQA 2QUHA 4UBNA 1KYIA 3FOBA 1C1XB 5MGBA 1EZ4A 2XTAA 3OZFA 3DH0A 5JAPA 4B81A 4MUXA 3HVIA 4PLPA 4JJAA 8ABPA 3GRPA 4GRIA 5K3EA 3ER9A 2HO4A 4RZHA 2C58A 5AI8A 1A7JA 2BMEA 3U4DA 4R81A 1G8KA 4RVGA 1Z56C 1DCFA 2VDJA 3BORA 1H6AA 3NB0A 3A9TA 1EFHA 3JWEA 3V4PB 1QQAA 3L04A 4MKXA 2V96A 1OSNA 2BEUA 2DCUA 4FFSA 3VPAA 1W9MA 1G5TA 1JSZA 5K0FA 5L4SA 2PQ0A 2YFQA 3CPJB 4ZEMA 3K6KA 3A3OA 1J2YA 4U7JA 5EXTA 4AZVA 5BYJA 2HNKA 3KKEA 1VIMA 4L72A 1NKTA 4LG1A 4YREA 1TEXA 3RANA 1T4BA 4MSUA 5EMLA 1JQBA 1CY1A 4GOND 1RABA 3DDHA 4YMHA 1ZHFA 4OXQA 2OLEA 4R7GA 3SNKA 2VHTA 3A04A 3ZIAA 1FP1D 4JYZA 4KNYA 4WHMA 4C0QC 2PZMA 1Z2OX 1JKJB 5JZSA 2A5YB 1MD9A 1CBUA 3VKUA 4BRWA 2GM5A 3KLOA 1TK2A 1CG6A 2ZSDA 4DN6A 4JT8A 1NAHA 4L73A 2KQUA 2DLDA 4RPKA 1M0EA 1BE6A 4FGJA 3OOYA 5DT9A 1M34A 4EVQA 3UAGA 4DCTA 4ZT2A 1AH2A 2H1RA 3WWDA 1FFHA 2VRWA 2H0AA 3NDIA 4PLYA 3WKCA 1KEKA 1PNVA 3TECE 2J9RA 3ZY2A 4GOLD 4CTNA 4YT2A 2ZBRA 4KVGA 3R6LA 4MROA 5AD1A 4RLFA 1WWKA 4A6PA 3WA7A 5ISMA 2F7SA 1FJGB 3CLSD 2RG1A 2AD1A 5SZIA 4HWSA 4ETWA 1EJ2A 1HZJA 1GFWA 1U2DC 4B35A 1AMOA 1NNEA 4NESA 2QBYB 3SIRA 5DZSA 3RR2A 3FZGA 1ONOA 2JZOA 2RHWA 2DUNA 1L7NA 5BSEA 1KOGA 1VIAA 5B55A 3H9GA 2I87A 2ZI6A 4E5PA 4MKZA 1Z4IA 5JVDA 1CJSA 4GD3Q 3HCCA 4EW1A 1UZNA 2HNAA 1YZHA 2QM3A 1I2CA 4AXBA 3EDQA 5JMOA 2HWKA 3RYHB 2CL5A 4A7PA 1AKUA 4F86A 5CBPB 4X64B 3Q6IA 3IPRA 1X70A 3FSRA 2F1KA 3FMGA 3LCMA 4L9WA 3MM4A 1P6QA 5FPSA 2C4WA 3GJQA 2H0RA 2JIZA 5FI3A 3L46A 1SZCA 1SG0A 1VL8A 1RKBA 4XFDA 1LWNA 1H65A 4DB2A 5BMVB 3UG6A 2Y1OA 2ZTUA 2R1VB 3VKWA 4JSRA 2WF9A 5KWEA 2I3DA 3MOIA 4KR9A 3PFFA 3C1TA 4FGLA 3FHOA 1W0KD 3SIWA 4BX9A 5AVQA 1T1IA 2IYOA 2H18A 1TF5A 4EI8A 1GGVA 2D5CA 2E82A 2Y67A 2YV4A 5PNTA 1B42A 4D9IA 5JROA 2NYAA 4X95A 3DDCA 2BF4A 4KV7A 4PZEA 3WZMA 1A1SA 3R3WA 1FMJA 3QVOA 1ZKMA 1EB8A 4FD2A 3SBEA 3LY8A 3DFZA 1W6UA 3D31A 1E1DA 3IHTA 5CGZA 5KDOA 4DR3B 4F3RA 5ICSA 5PGMA 4ZO7A 3SYNA 3FZQA 2RAFA 1J07A 2ZKIA 2XLCA 3AY6A 3YASA 2ID8A 2MSWA 2UZ1B 3JAWA 2XRFA 4V0KA 1F06A 2AN4A 2HXYA 5DXJA 3VC7A 3MTDA 2XGGA 1N77A 1FYVA 1TM2A 5E4TA 2IUFA 1JBKA 1TLTA 2CXRA 4FEEA 4ZO8A 4E14A 1T0UA 3OUTA 1AXRA 4FYVA 4ZT3A 3HB0A 1PG5A 4M1TA 3OJCA 6ADHA 5E8JA 3QNUA 1BQEA 1VLVA 2PMDA 4Y6LA 4LF6B 2PVCA 1XZIA 2HW8A 5FH9A 3DF9A 1LBEA 3L6RA 3KEOA 3ED5A 4JP1A 2OFFA 3CVJA 4BMXA 3WJAA 3QWIA 3WGHA 2QPTA 2I1VB 1MV8A 3T3PB 1JRLA 2JARA 6LDHA 5SY4A 4P58A 3MB8A 4LXTA 2I29A 1P9LA 3UXEA 3FLMA 2V7QD 3I28A 3OJFA 2ATEA 4E6PA 1DS6A 1TL7C 3ENKA 5CW1A 5HIIA 3F67A 2NOAA 3O95A 4LDZA 5ALQA 4DCOA 5LWQA 4RTRA 3VH3A 4TLMB 4CMCA 1FMTA 1TRHA 3HB5X 4XARA 1AZTA 4YP9A 1FSSA 2DR2A 1EHCA 1I3NA 4J03A 3KE9A 1VLZA 3OOJA 5JD3A 1LH0A 3CIOA 1FYEA 3AXTA 3G9TA 5DHUA 4RK7A 1XLVA 2Z8XA 4P08A 3MJTA 4N5MA 5T7BA 2BTQA 3WVNA 4E46A 4OJKA 2XE6A 1UBJS 2I7DA 3I04A 5G53C 1OBHA 3RU7A 1S2IA 5EIFA 3T4UA 4KWEA 2PL1A 4WCVA 2EKPA 3AVQA 4XSVA 3K70B 5HYVA 4AZTA 2GD6A 4Z9YA 5T4EA 4DYVA 3CNOA 4D3DA 3D5QA 1DSSG 5C8VA 1N4AA 2VP6A 4Q4HB 1UM8A 1BS9A 3BXZA 3A6JA 5AW9A 1MRZA 2IHKA 1M2OB 3BDVA 5IDYA 2Q0QA 2Q6KA 4G4SP 2IHVA 2VXBA 5A6SB 3L1UA 5J4HA 2DQSA 1BJRE 3B89A 3O4GA 1XZJA 1PTJA 2EJWA 4NIMA 2C42A 3MTAA 4PYRA 4CR7A 3PPVA 3WIEA 1IQPA 3D9QX 3ZGXA 1Z3IX 1WUTA 1XALA 1CULC 1KAMA 4F21A 1UCFA 1A9PA 2VQSA 2W42A 3MRSA 4TSFD 1MJNA 3UEOA 3JZAA 1GQSA 3K1AB 1T43A 5E0OA 2YZKA 1ISRA 4EATA 1C3LA 3W78A 4LTMA 2YUTA 4L9SA 1USGA 2Y1WA 2DR0A 5DOVA 1L4MA 2G80A 5AYVA 1X92A 1JI3A 3U3RA 1ZGBA 2GZMA 3GP5A 3N0RA 1OA1A 2Q6LA 4WKNA 3S8MA 1QKJA 3GLGA 3EGCA 1XMXA 1YJXA 2NXWA 3NDPA 3ROXA 2VNKA 3LQKA 4WBNA 5JNLA 4CODB 3DGEC 3PR1A 5HTOA 2XKBA 5AIBA 2YW9A 3JQRA 1QIIA 1C14A 4RVCA 3A3YA 2BW0A 2WJPA 1TYCA 2XODA 4G2NA 4MGKR 4RQAA 1UBSB 2P5TB 4G1CA 5C7LO 5HKOA 3LT2A 4L0DA 2Y9PB 2J4CA 3FVQA 4L2IA 4CCWA 3WV5A 4BEJA 2Q5IA 2Q9UA 3CONA 2AJLI 3K3PA 4R3UC 2IRWA 3MOGA 1AN9A 4FEYA 3ZWCA 5EVJA 3TQOA 2OUIA 4RY9A 1FDIA 1O9HA 1TPYA 1HE3A 2F8MA 3W5UA 2OKCA 1RHUA 1SNYA 4D3SA 4YMLA 1QDEA 5KKNB 1FSZA 3RGGA 5H83A 4FNAA 1RBQA 3EOBI 4E33A 3KP1A 2JJYA 1DUIA 3ORSA 2C54A 5FYDA 3KZVA 1SHLA 3FPJA 1RRVA 3IKMB 4TRJA 2XUDA 3AKEA 2GUGA 2HNBA 4KV9A 4WOKA 3WQQA 5JFOA 3EDRA 2WICA 4LZZA 4M8IA 4DJ5X 1GN9A 1TZKA 2ZE6A 5BRAA 4UEWA 4QDTA 3W5BA 3U4IA 2IH5A 2CXUA 1LK5A 1MFZA 2PZAA 3M83A 1ONPA 1WCIB 2BUAA 3RKUA 4JIMA 1F6DA 4LHXA 3F4LA 1W1UA 4MW1A 1UEXC 3ABZA 4WKPA 5TMEA 1WXIA 5HJ7A 5DM1A 3MYYA 3OJXA 1NBOA 5AMXA 3JZIA 2I71A 1I5EA 4GKVA 3LCJA 3B82A 1GTVA 5G0TA 3U1BA 2R0QC 1VI6A 4FGWA 3WIDA 2AZMA 2N9UA 4G63A 1KDTA 5B1EA 1K3TA 2P5YA 1NW7A 2AS0A 3N8NA 4FSXA 5KWVA 4OQFA 1VMEA 1LBHA 4GX2A 3AUKA 1E61A 2WTMA 3QOFA 3A6ZA 3HB4X 3ONWA 4QT0A 2H31A 4RD1A 3GLHE 3SJAA 1KU0A 3T7EA 1UKBA 4OMDA 4MS4A 1HE8B 2GHRA 1M8KA 1ZWLA 3ZHSA 4NYJQ 1TEZA 2GXQA 1RKXA 4JENA 2J6CA 3H8WA 3JASA 1XJCA 1SOAA 4IRXA 4WIAA 2Y93A 1SQ6A 2G1UA 4Z7NB 3ELUA 2NTVA 5AUOB 5FR1A 3IAFA 1IZ9A 4Z53A 3L4SO 1QG6A 1A9RA 1YC2A 1I1HA 5L9AA 4D81A 1P2FA 2IZ7A 4S1PA 1IY2A 4KLNA 4XQGA 3KYCA 1RJWA 2VQ3A 3HADA 1XRLA 1PGQA 1MB4A 2VP9A 4AIRA 1N9GB 2V6BA 1L9KA 4P83A 1GSOA 3OM0A 2VSFA 5JD4A 5EUQB 5BR8B 1STOA 2D7DA 1ZUNB 4P4SA 4M0UA 2CMDA 4I7EA 5JZ9A 2WB2A 5EUBA 5THKA 5E1DA 1VHDA 3W8EA 4ZYTA 1XDSA 2R60A 4P4TA 1N1EA 1MB0A 3WXMA 3PIIA 1JHVA 2XMBA 1XAIA 3E0XA 4J0EA 4NBUA 5AW2A 1RZ3A 4OI1A 1TB4A 3RBZA 1IWOA 3EGDB 3R5HA 2YR0A 3NXKA 1ZBDA 3CNEA 5F35A 1O6FA 1QZUA 3CZRA 4B3GA 4IMRA 3U44B 4CLHA 3RBAA 1MXHA 4GGPA 2OK7A 3OOWA 4LDNA 1W75A 1ENZA 1EE1A 1ZIOA 3K9CA 2J9FA 1YI8A 3ZNOA 2C4NA 5E2IA 1I2ZA 2J30A 4Y9DA