5D1HA

Crystal structure of the 16s rrna (adenine(1408)-n(1))-methyltransferase w203a mutant from catenulisporales acidiphilia
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
204
Chain Sequence
TALKVLAGKKLTDLDPDEWAKAQASAERILVDVGTGDARTAYRQAIAHPEWLVVGVDPAWQRMTETAVRAARKPAKGGAPNLVLVSSAIETVPAALHGVADEVMVLMPWGKLLRGVVLGEADVLSGLRAVAKPGAPLEISIGTSIWREPIPLEIRDLPELTPETVVSTGLTDRLAALGWQVADVRLVPTETVLHLRAVAVDPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized protein
publication title Functional dichotomy in the 16S rRNA (m1A1408) methyltransferase family and control of catalytic activity via a novel tryptophan mediated loop reorganization.
pubmed doi rcsb
source organism Catenulispora acidiphila
total genus 61
structure length 204
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5d1hA00
1F38A 5DSXA 3IHTA 2G1PA 2ORED 2JJQA 1N7IA 2C7PA 1SUIA 3ANXA 3P2IA 4O29A 5KYGA 2IFTA 1WXWA 2GA9A 4Y30A 4EK9A 1O54A 1ZHFA 5DXAA 1I1NA 4AUKA 1D2HA 2P1DA 1V39A 3FPEA 4LWPA 4BY9E 4UOEA 2Z6UA 1NV8A 2JHPA 3V8VA 2QRVB 1YFJA 1KYZA 5LQCA 4RTRA 4ER0A 3AWIA 3ELUA 3P9KA 2CL5A 3FUTA 3TFWA 2F8LA 4RTOA 3I53A 3G7UA 3X0DA 3UJCA 5K09A 2B3TA 3HA5A 1EG2A 3I5UA 4BLVA 1G38A 4DM3A 2YVLA 2PXXA 4PINA 1RJEA 4Y2HA 4A6DA 2PBFA 1QZZA 1RJDA 2PX2A 4QDJA 3UJ9A 5CVUA 4GF5A 2NXNA 5EEGA 5FWDA 3HVHA 1FPQA 2Y1XA 2GAFA 3A25A 3B5IA 1WS6A 1SKMA 1FJXA 2WK1A 1QAQA 1NW6A 4PIMA 3UJ6A 1ZQ9A 4OBXA 3LSTA 4P7GA 2PJDA 3M70A 3HCCA 3KR9A 2AOWA 4BLUA 2Y1WA 5K0JA 2R3SA 3LX6A 5LQUA 3I9FA 1ZKDA 2VP3A 1XDZA 2ONZA 2ZSUA 3A4TA 4LG1A 3BWBA 3PS9A 2C7QA 7MHTA 3CBGA 3T7SA 2QM3A 3PT9A 3A7DA 2FYTA 3KPVA 3KPJA 4E31A 1DCTA 3L8DA 1RI2A 2EFJA 1VP3A 5MHTA 3DXXA 3EEYA 5HOQA 3PFHA 2G8NA 5FHQA 4HG2A 3FPGA 3G2OA 2PXAA 5CM2Z 1TPYA 3K0BA 4ER6A 5C1IA 2AS0A 3EPPA 3GU3A 3REOA 4GOMD 3SXJA 3GWZA 3P2KA 4GEKA 3K6RA 1SQFA 4CKCA 1SUSA 5FA5A 4C04A 4GUAA 2Z6AA 3OZSA 2PKWA 1VL5A 1NV9A 1VP9A 3OCJA 4X63A 1KPIA 3FUXA 3HA3A 2ZCJA 2YTZA 4MIKA 3BKXA 4AZVA 2NXCA 2XYVA 4PONA 5B1SA 1I9GA 4CKBA 1NBHA 3FUVA 3KR2A 4IWNA 4FS8A 1G55A 5F2OA 2UZ4A 1M0EA 1NW3A 3UA3A 1QAMA 3THRA 2OB2A 1JQEA 3KU1A 3QOXA 4C07A 3KR0A 2GH1A 3NTVA 4BP1A 1RI1A 2P3OA 3MTIA 4XUCA 2OZVA 3M6VA 3HCEA 2B25A 2B2CA 3T0IA 2ZZMA 2ZFUA 3A27A 4QPNA 3OFKA 3AJDA 3MAGA 3P9IA 3FTFA 3AY0A 3G2PA 1G8SA 2P41A 3BWCA 2CMHA 3OU2A 3RODA 5K0LA 2AVNA 2CMGA 3VC1A 3A7EA 4QQNA 3G8AA 4M37A 3UJ7A 4OQEA 1L3IA 3LBYA 3LPMA 2BZGA 4YUXA 2NXEA 4GQBA 3HVKA 1FP1D 1HMYA 1ZGAA 3SR4A 2YUIA 3BUSA 3ELWA 3PX2A 3ELDA 3HP7A 5DLYA 5KQRA 1NT2A 2B78A 5LQAA 3NVKI 4CWAA 4DCMA 4HTFA 3DH0A 2OYRA 1AF7A 4OA8A 4E2XA 1JQDA 4YV1A 2HR1A 3FTEA 3GRZA 3O4FA 1FBNA 5DM0A 4KDRA 4MTLA 2P3LA 2EG5A 2EX4A 2IGTA 3EMBA 3LDFA 2AR0A 3NDJA 5T64A 5E8RA 3LDGA 2Z6QA 3CC8A 4HGYA 5CVEA 3JWHA 2B9EA 2PLWA 1NW8A 2VDVE 2YXDA 3FPHA 4PWYA 2ZZKA 2G72A 2A14A 3CJQA 5EZSA 4HC4A 5DTMA 2N47A 4POOA 4BLWA 1NKVA 3EVBA 3TKAA 3E23A 4R8RA 4K6MA 3PB3A 4NECA 5ICCA 1YZHA 3EEOA 3LGAA 4FR0A 4EVIA 3EVFA 4KWCA 3DMHA 3PX3A 4PNEA 1EQAA 3CGGA 3KPYA 5HIKA 5E2BA 3GJYA 5HIMA 4L7VA 1SQGA 3V97A 4YUYA 5KQSA 5DX8A 2PY6A 3FYCA 3M6UA 4QVGA 1M6YA 5K0FA 1P1BA 1RI4A 5FULA 5P8WA 5DX1A 1XCJA 1JSXA 2ZIGA 5K0CA 4HSGA 1NE2A 1UIRA 1X19A 2AZTA 3C6MA 4AZSA 1G6Q1 1VE3A 5K8VA 3PFGA 2IBSA 3GRUA 2OB1A 2V7EA 3D2LA 3FPJA 4ER5A 1SG9A 4E32A 2AN3A 4GC5A 4E2YA 3IEIA 1XVAA 3GIWA 5EC8A 1TW2A 2R6ZA 2I6GA 3LKDA 4KVZA 5EMJA 2OXTA 3C3PA 3DMFA 3F4KA 2ZVJA 2H00A 4XUEA 2YX1A 3FZGA 3OE5A 4KIFA 4ER7A 5G02A 3EGVA 1L3CA 3UZUA 3MQ2A 3LCVB 1SVUA 5EIFA 1R6AA 4GC9A 3TM4A 2PX5A 3SSOA 3FTDA 2AVDA 4E33A 3KQPA 2QE6A 3BXOA 3MGGA 4FSDA 1MJFA 3OZTA 4R6WA 3SX0A 1AV6A 5LQNA 10MHA 5DT2A 5BXYA 3GRVA 1O9HA 2DULA 5EGSA 1YUBA 3B3JA 1YB2A 5EPEA 2K4MA 1KPHA 4X60A 5ICGA 1JG1A 2CKDA 2OO3A 2FHPA 2XVMA 3ID6C 5H02A 4QDKA 1EAMA 4BP3A 3KQSA 2AOUA 4X1OA 3O31A 2BR4A 2PSSA 5DXJA 3HCDA 1EJ0A 5BP7A 5ICEA 1BKYA 5EEHA 4WXHA 2NYUA 3KQQA 3UA4A 4E2WA 2AOTA 4KW7A 3GXOA 4FGZA 5T67A 4PYQA 4MQ4A 3LKZA 3DXZA 4ZTBA 3BZBA 4GOOD 3HA7A 3RW9A 2ZULA 3AXTA 4V0RA 1QYRA 3FRIA 5LQJA 1XDSA 2PX4A 2H1RA 1WY7A 2GPYA 3TLJA 4E70A 5CCXA 4Z2YA 2NP6A 3HNRA 4P7JA 1XTPA 1Y8CA 5HEKA 5LQRA 1XXLA 3HEMA 3WSTA 3DR5A 3GRRA 4RTNA 4ER3A 3TQSA 3JWJA 3ERCA 2IIPA 2QRVA 1X1BA 2VZ9A 3G5TA 4RVFA 5ERGB 2CWWA 4DMGA 1RJGA 2FCAA 2BR5A 4XCXA 1JTFA 1JTEA 5CIYA 2HWKA 3OU6A 1R8XA 4E2ZA 5EG5A 3C6KA 1P91A 3OFJA 4H0NA 5E1OA 5IKMA 2NP7A 3DMGA 3EVCA 2IDKA 3FPFA 3OPNA 5FADA 3LHDA 5JUWA 3UFBA 3VYWA 2PWPA 3T7RA 1VQ1A 5LSAA 5FCDA 3G2QA 4PCAA 2YQZA 1ZGJA 4YUZA 3JWGA 4EKIA 1O9GA 1WXXA 4RTQA 1AQIA 4YUWA 2ZW9A 5LR6A 5BW4A 3A26A 1D2CA 3BGVA 5KS2A 4PIPA 4PYLA 1VLMA 4C05A 5HILA 3HCAA 3EVGA 1FP2A 5DTQA 5K0EA 3MCTA 4IKPA 2HNKA 2ZWVA 5GIPE 5KVAA 3LCUA 3E7PA 1PRYA 3FTCA 2C7OA 1RI5A 3VC2A 4AX8A 4RTMA 2O07A 2O0LA 3KHKA 3M33A 2QYOA 1M6EX 1R8YA 3P9CA 4QTUB 5E9JA 3SM3A 3R9XB 5CVVA 3PTAA 1QAOA 3DULA 3UJDA 1KR5A 2G70A 3BGDA 3KPUA 4FT4A 3TPZA 1Q0SA 4RVHA 2GS9A 1IXKA 5FTWA 1BC5A 3DUWA 3CCFA 4RTLA 5K0GA 5DM1A 4FT2A 2P40A 4RWZA 2ZIFA 2P3QA 3R3HA 3QV2A 4R05A 4CKEA 3B89A 3BGIA 3G8BA 2KW5A 4M7RA 4P7KA 1P1CA 3SSNA 5K0BA 3HCBA 3DLIA 1T43A 3S68A 5DPMA 2YXLA 3TMAA 1RI3A 2DPMA 3VSEA 2FK7A 1L1EA 1KHHA 4YMGA 4HGZA 1TW3A 5E2AA 1H1DA 2YR0A 3BWMA 1KIAA 3IYLW 2QY6A 3M6WA 2ZBQA 3NVMB 5GOZA 5EMMA 1UWVA 5E1BA 1JG3A 5EQJB 3R6TA 1EJ6A 2I9KA 1R18A 4GOND 4PYJA 4FSXA 4DCGA 3GCZA 5EOVA 2Q41A 2ZBPA 4U7PB 1DUSA 2PV0A 5E1MA 3LECA 4YUVA 4PYOA 4F84A 2XBMA 3PLAE 1JR4A 2PX8A 5FUBA 2ZBRA 2BR3A 4EKGA 2IH5A 2BH2A 2PT6A 2GLUA 3HVIA 4CXMA 3BWYA 2NXJA 2VS1A 4ISCA 3HCFA 3I58A 3QOWA 2ERCA 3TRKA 3M6XA 4A6EA 5EHIA 4M36A 3UBTA 5EIWA 1XCLA 2ZZNA 1HNNA 1WG8A 5CVDA 3EVEA 5EKUA 1NBIA 2UYCA 4DA4A 1UFKA 4AZWA 4KIGA 1XJ5A 5DM2A 5K05A 2O57A 2LD4A 4M38A 2JHAA 1G8AA 3CJRA 3T7TA 3FUWA 1JSZA 1U2ZA 5E1DA 3NJRA 1P39A 2PXCA 2EJUA 4OQDA 3SSMA 3MHTA 5C9ZA 3LCCA 9MHTA 2AN5A 3SGLA 1ZG3A 1BHJA 4CTKA 2ADMA 2ESRA 3E8SA 3IV6A 3KPWA 3P97A 4E30A 3KQWA 4X41A 4V0QA 4KRGA 4AZTA 4YV0A 5K01A 1RJFA 4C03A 3KR1A 5JR3A 4IV8A 3HVJA 5DM4A 5DRYA 3EVDA 5FQOA 3U81A 4X61A 5GM2A 2H11A 2VDUE 3EVAA 3UJAA 4RTSA 3Q7EA 2PWYA 3FUUA 5CCBA 5EZQA 5FQNA 4PYNA 1NW5A 2ZIEA 3EGEA 5CVJA 3TOSA 2BM9A 4C06A 2HMYB 4CTJA 3DTNA 2E5WA 3KKZA 4OBWA 1BOOA 2IH4A 2IBTA 2JG3A 4WVLA 1G60A 1KPGA 3OE4A 5K0NA 2JH9A 8MHTA 1KYWA 5K03A 2ZTHA 3NDIA 4KDCA 4RVGA 3SMQA 4G56A 2FK8A 5EHGA 2C7RA 4QVKA 5U4XA 2I7CA 2FRXA 4RSRA 3NW9A 1JG4A 3GRYA 5GINE 5CD1A 3OZRA 3ER8A 5DRTA 4DF3A 2ZWAA 1PJZA 1R74A 5IH3A 5GIOE 5HZMA 2XYRA 3DLCA 4RVDA 4F85A 3B3GA 3EVZA 3LL7A 3NWBA 3HTXA 3GDHA 1IY9A 3LBFA 1KXZA 3B7PA 5DTRA 3H2BA 4R6XA 1N2XA 5DWQA 3DOUA 2P7IA 3DP7A 3E05A 4OX9Y 3O7WA 1KP9A 2YXEA 3I64A 2EJTA 3PVCA 4HTFB 2HTEA 3GO4A 3KQVA 5E9QA 3UWPA 3MCZA 4RTKA 4DQ0A 2P7HA 2AOVA 1Q0TA 3G2MA 3FRHA 3KQMA 4P58A 3RIEA 2O05A 4YV2A 2PT9A 4ATNA 4RTPA 2XVAA 1OR8A 1XDUA 3AXSA 3C3YA 3G5LA 3P2EA 2IDJA 5EVJA 3CJTA 4DKJA 1X1CA 4RX1A 3P71T 3GNLA 2G71A 1JG2A 4QQKA 1DL5A 2IP2A 2UYHA 3BT7A 1B42A 1N7JA 4PGHA 4F86A 2IPXA 2OBFA 3JWIA 3P9NA 2P8JA 5EMKA 5DSTA 5F2NA 5ICFA 2I62A 3BKWA 2JHCA 3KQTA 3OU7A 3FYDA 4QTTB 5FA8A 5GP1A 1VIDA 2PGXA 2IH2A 3KQOA 4PGGA 2PVCA 3B3FA 5FWAA 4HH4A 2UYOA 4YMHA 1F3LA 3G89A 3TKYA 2V74B 2WA1A 4FZVA 4HRAA 2P35A 5E9WA 4QPPA 3SVZA 4JXJA 1YF3A 3M4XA 3C0KA 5EMLA 3MB5A 5FHRA 5CUQA 2OPBA 1YZ3A 4P7FA 4RYLA 2AOXA 2O06A 4XUDA 2AN4A 5T6BA 3P8ZA 4R8SA 5HIJA 1MHTA 3TR6A 3LDUA 4GOLD 4B17A 4EMSA 3UJBA 1INLA 1L3BA 3HM2A 1X1AA 1VBFA 4C08A 1D2GA 4DZRA 3NWEA 3KQYA 4U7TB 5GM1A 4PYIA 5D1NA 2FPOA 3ME5A 2GB4A 2ZLBA 4RV9A 2NNWB 5E8JA 1VPTA 3MTEA 1L9KA 5F2KA 3NMUF 1ORIA 1WZNA 3R24A 2BM8A 3EMDA 4MHTA 5C0OE 3GGDA 1ORHA 1QANA 2WA2A 5HFJA 3CKKA 5EKXA 1AQJA 4IV0A 2JH8A 4LECA 4MWZA 3UJ8A 5BW5A 5LQKA 2VDWA 1JQ3A 4PYKA 1Z3CA 2XYQA 1YFLA 3EGIA 4OA5A 3ER9A 4PYMA 3DXYA 2AOUB 5D1HA 3THSA 2HV9A 2OKCA 5GWXA 4RTJA 3CVOA 4FP9A 5DX0A 3G88A 4PCLA 1EIZA 4C4AA 5M5BA 1R00A 1IM8A 2AOTB 4GBED 4LWOA 3R0QA 1NW7A 3ELYA 1I4WA 3TM5A 2UYQA 4EQZA 3MERA 3ORHA 2ONYA 3Q87B 2OY0A 5HIIA 1X1DA
chains in the Genus database with same CATH superfamily
1RBZA 1J1ZA 1OA1A 3B36A 2AFIB 1NSYA 2FR1A 3D5TA 3VZPA 3ZBPA 1CRWG 1PZFA 2A58A 3TBFA 1G7SA 1D1SA 2R8XA 3T1YB 3FGOA 1T9KA 3V4FA 4B7CA 5KUTA 4P0PB 4X0EA 1DFHA 4CBVA 3RYIB 5CTJA 2ISSD 5LQCA 3B78A 4UTPA 2YQ4A 1COWA 5EA2A 3ROGA 1D8AA 1JXMA 1T8UA 2RKOA 3NHAA 4M1KA 4QJ4A 2Z2IA 4HYQA 1CJSA 2AB0A 2AFRA 4HUQA 4BLVA 4FFVA 4J2OA 1OLOA 1Q16A 2J59A 4FXOA 3O3NB 4J2HA 1O87A 2OCBA 5REQA 4C76A 2Y66A 4NX2A 2OGTA 3HABA 1G42A 1F9EA 4YRLA 2PH3A 4M98A 3UW1A 1L1RA 3HVHA 5FI5A 1FJXA 2C5LA 3H05A 2WT9A 2GPNA 1IUPA 2HD4A 1FIUA 2WICA 1UC5B 4IOMA 2V5AA 4PZ9A 3V8RA 1U28C 4OBXA 4P7GA 4D25A 3RC9A 3I9KA 1WAMA 2XTMA 4CLHA 4D79A 4KL8S 2QX7A 4I36A 4ZVPA 2BAGA 4EABA 2D3WA 3OD1A 1GTL1 4JOQA 1GQRA 2IE0A 1AKRA 5ARDA 7MHTA 3WIBA 1GRVA 3ETEA 5FX2A 1TC1A 2VRCD 3KPVA 4E31A 5ALJA 1XMOB 3R20A 4RY0A 4MR9A 2ZS8A 4HRXA 1W52X 5FT9A 3GGJA 4Q39A 4IX9A 4GSLA 3FGZA 2IXTA 4N0MA 2D1YA 4QBIA 3FMOB 3L46A 4ER6A 3A36A 3D2AA 4NQRA 1M5RA 3FMIA 4ND5A 4WFKA 5GGYA 2ZUEA 3TJZA 3FB4A 4IS2A 3ZDZB 3NEJA 4MUIA 5EJIA 1BQ4A 1SUSA 2QMOA 3DR3A 4HAZA 4GXNA 4C04A 2PGJA 3U4AA 4JOSA 3DBHA 4X1YB 5KAMA 4CKEB 1KPIA 4CIYA 5I5EA 5JDIC 4HGPA 3QVOA 2R48A 1IN7A 2QNBA 2PO5A 3KR2A 3OZDA 3MYRA 4IWNA 3UWDA 2O23A 4WNIA 4D9EA 2P79A 1V4BA 1M0TA 3FYHA 1TCBA 2VJCA 3QOXA 2V7WA 2FR0A 3JSAA 1Z62A 1U8EA 1G5IA 1TYCA 2GEDA 2WU0A 3A1TA 1SFRA 2CNNA 4HSEA 2XEXA 4DR1B 1ZVJA 4NI5A 2ZZMA 4JCCA 1JU9A 3G2PA 3TRFA 1OFUA 1TKRA 3KM0A 3UQZA 1V16A 2HDOA 4QEDA 2VT6A 5K3BA 2LCFA 1KAEA 2JIOA 1L3IA 2XZLA 1J22A 1O89A 1P6UA 1PBNA 1X15A 2BEKA 4GQBA 2TECE 3W9BA 1PBTA 3BUSA 1T2UA 3ELDA 3PX2A 4PRLA 1OOEA 1Z0ZA 4YJHB 1M6VB 4WCDA 1I2DA 1X13A 1Z4NA 1SRQA 1YRHA 3CRW1 3GAFA 3Q40A 4GR5A 4JHLA 2RK6A 1L0BA 1VZ2A 4CDGA 5HHTA 2XKAA 4C29A 4FONA 2X1HA 5HZHA 3UK7A 1ACLA 4Q93A 1NVAA 1R50A 1IMOA 2EBHX 3A1NA 4R1OA 4QXMA 3AL0C 2PD4A 1ZIYA 1ZNYA 2D4HA 4P34A 2IT1A 3NZEA 4WKNA 4LKOA 3UV6A 3NBMA 4EI2A 5JZSA 1E6UA 1U7HA 3KC2A 5EZSA 1PR9A 4C01A 2P9EA 3M1AA 4B6RA 3BMNA 4POOA 2EP7A 1AX9A 2XMQA 3AERA 4M22A 1E3WB 2ZPAA 2WUWE 5LBIA 4JK3A 4I7EA 3FOBA 3DYVA 3RG2A 5J1TB 1MT3A 3FF4A 5L3ZA 3UHFA 1KJYA 1QBGA 1OGYA 1NUTA 2XNDD 3EYWA 4AQDA 1RWKA 4C4TA 1OYVA 4BNFA 1IWBB 3RHTA 1GIAA 4U2GA 4IP0A 3WHKA 1D0SA 1ZNWA 3EQ8A 4FUQA 3L4EA 1WDKA 4W8OA 2AZ4A 4QJIA 2JFZA 5KJ1A 2A9RA 1JGTA 1JSXA 4NLLA 3A4LA 3KEOA 4NU6A 5K0CA 1M5TA 1DDOA 1S1CA 1SBZA 1TF5A 3RLIA 4NZMA 4LYFA 2XRFA 2AEFA 3ZWKA 4IZHA 3D2LA 4ZFNA 3HDYA 2ECKA 3ZYCA 1JMKC 1OSNA 1IHXA 4B3MB 4B4DA 2F67A 4MAMA 5JY1A 4XB2A 4LY9A 3QU4A 2G6TA 2EARA 2G36A 3OWHA 4UEOA 2UZIR 3QNMA 1CRQA 1Q0QA 2JIPA 2Q9AA 4DRXA 5DWDA 2OXRA 2P6RA 4OBBA 1OIWA 2YV2A 3AZOA 1XKTA 1MN6A 1ZYUA 3ZV6A 1QH0A 5AXBA 4OGWA 4BVKA 5A03A 1YRBA 5DT2A 1TXGA 5K4AA 4Q1CA 5CDYA 3QFHA 5LC1A 3S29A 3BMOB 3CZAA 4J1TC 1UBEA 1JG1A 3GIDA 1LI4A 4ND8B 4R8KA 4FLMA 2RHCA 3ID6C 4L72A 3UT5A 2FWIA 4AF8A 1E1KA 1JLRA 1L5QA 2YVUA 1U8UA 3JAKB 3HCDA 4Z2AA 3N8GA 2FB9A 1EI9A 3L0SA 3GZNA 5ICEA 1O57A 1OT3A 3I4CA 3G0GA 3BXPA 4DLSA 4BNYA 3DDUA 3ZZ0A 2BHRA 1YACA 1B73A 2I6SA 3OM1A 2F90A 2ZULA 4AAYA 4P9NA 1XPOA 4JUDX 1QB8A 1T8WA 4JVLA 2Q45A 5SZJA 2W6MA 1JDBB 2GBLC 2W00A 5JQWA 4IFEA 2YHAA 4YT2A 1H93A 2OQRA 4EG0A 5A3RA 2LIPA 3KQHA 2DT5A 2X8AA 1HYGA 1QX4A 3BN3A 2ZAYA 1BDMA 2A0YA 3CB2A 2QUAA 4QDUA 3ZEIA 3ZHZA 4BNVA 2IQIA 3JVIA 4D6YA 2ZUTA 2P4EA 3V1YA 5BV1A 1KI8A 2CV0A 3WYCA 1R5JA 1IHDA 1YZNA 3LDHA 2YCLA 3M3DA 2VJAA 4B82A 4DMCA 3STXA 3H9QA 2QZJA 3I5YA 2WYVA 1GT6A 3HE3A 4D4KA 4JLUA 2HWKA 3R23A 2QG4A 4N7RA 2WBLC 3E03A 4RDCA 2G0NA 2XMCA 4HAYA 1PVOA 2NP7A 4TYNA 4K3UA 1XRLA 1TTPB 4BEWA 1NBAA 1MD9A 2B8EA 3IO3A 1PUJA 2PWPA 1LXCA 2XNSA 1HDYA 3A6HA 4R9SA 5EUCA 1XDDA 2WAOA 3I34X 1WW3A 1KWGA 1QRAA 4HWOA 4NAUA 2CLFB 1KEPA 2CHEA 4QEZA 3KB6A 4MARA 1NRJB 2H7YA 3N86A 1M0SA 5LR6A 1JFLA 2QIOA 3K4QA 1VDMA 4UDOA 2RAFA 3PDUA 3MJRA 9ATCA 3UKDA 3Q7PA 2ZI5A 2FWAA 2LGJA 2VJLA 1EWRA 5AJZA 4WE3A 2W9XA 3AY6A 1T5TA 3OF3A 4HR7A 4WNAB 2E2WA 4P1ZA 1T4DA 1EX9A 5TMBA 5A1JA 3S2UA 1PW7A 5DP2A 3E7FA 1RHJA 1O97D 4W5JA 2WOJA 4ALIA 1PRYA 3OZXA 2X76A 2C7OA 3ZE9A 1UOQA 3QF4B 4QTUB 3A70A 1K97A 1M33A 2X2EA 1FUIA 4HS4A 3PPVA 1W73A 4LRQA 3RQIA 5EMHA 3U6KA 5BN1A 4C7OA 3BA6A 2PK3A 4OUKX 1HLGA 3BPSA 4ALNA 4W6ZA 3G8CA 2OM2A 4RCVA 3INYA 5FTWA 3DE2X 3O94A 1HF3A 1VBKA 2IVZA 3F1KA 4JITA 3WNQA 5EZYA 1T2AA 4RTLA 4EJFA 1EEXB 2Q4BA 4BMOB 2XGMA 3ANMA 4I6JA 2VH5R 4INJA 3WLNA 1ZN8A 1HH4A 1DC6A 3SKVA 2G08A 2OFXA 1YMUA 1V96A 4W8HA 5C4MA 1GSAA 2PANA 3K70C 4G0UA 3BE4A 1W2WB 1TYEB 3P9SA 3KALA 2DPMA 1TMGE 4MVJM 2PYZA 1V11A 2IV3A 2ZI6A 5JNVA 1G59A 3NVMB 4GHWA 3V7WA 3NALA 3COVA 1UKVY 4R3NA 1AGRA 1CYDA 1EJ6A 3PR2B 2J0UA 2F8MA 4IZOA 3MMPA 1PWYE 4D44A 2D8MA 1KKUA 4C3OB 3L05A 4G01B 1C3VA 3FNEA 4F84A 4AS1A 1RYMA 3OX2A 3DHWC 3KUDA 4HX5A 2RE8A 2I8CA 1JPJA 3P0JA 2C8VA 5FL7A 1ACJA 4OK5A 3ND6A 1NVVQ 2PS1A 2Q1YA 3EUAA 3ZJVA 3L8MA 1C1DB 3OWOA 3IP9A 1QGDA 3MOGA 3UBTA 2P5TB 4HQOA 2PRKA 1HNNA 3VZCA 1ZW6A 5G0TA 3C6YA 3TLBA 4JL8A 4XX0A 5PGMA 2BFBB 4M38A 4BO5A 2WTAA 4QQFA 3T7TA 4HADA 1OZFA 4OL9A 3TNYA 2BHLA 1YU6A 3DUFA 5A6SB 5IDYA 4BO7A 5I6DA 5IASA 4D9CA 5I51A 2FQWA 4CUJA 4MIOA 3LXUX 1N1DA 2E37A 3TECE 2ESRA 2F43A 4LSWA 2I1QA 1AMNA 5G3YA 1ATIA 1OU0A 3E8XA 4L07A 4UHHA 1KH1A 1WCYA 4OMUA 3RFUA 4ZIRB 4CF5A 1D2RA 5I9IA 3MBKA 4WNCA 2QGFA 4C4YA 1Z2NX 3HVJA 1CDOA 2CUTA 4YCSA 1GAEO 5LXTF 2CT8A 4ITVA 4DFDA 2X2OA 1ZNZA 3MB8A 4LPKA 4MB0A 1IVNA 3BZUA 2PMFA 3D6TB 3EZNA 3MMZA 4I46A 3R74A 4BPRA 1A2BA 4IIFA 2ZRIA 2QN8A 3IPAA 4CHGA 5BN5A 1BMDA 3UT6A 1EIWA 2HFJA 2XEDA 2QUKA 4DREA 2IBTA 4OSOA 3B1XA 5E6UA 3SZRA 2VXCA 2P0YA 3DMYA 3LD9A 4HDMA 4CW7A 4RM3A 5EHGA 2X7JA 1EDZA 1UKEA 2ODNA 1VKOA 1DI0A 2XVZA 3FGNA 5TQJA 2J3IA 1UDBA 3WRYC 1CUHA 2Q3EA 1LRJA 4B2IA 5K7SA 2I22A 1IZZA 2IPNA 1D09A 3O4RA 4HRVA 1CW2B 2C9OA 3D02A 1Q7BA 3DLCA 4Y9TA 1KE2A 3OMLA 1RHRA 2NQ8A 1KEEB 4U7WA 5A2QA 4P32A 3AVWA 5HXAA 2NUAA 3GOHA 1KXZA 3LBFA 3CZ5A 3PXBA 3R7AA 3H2BA 3T7KA 5A9SB 2ISCA 2FZCA 3LYHA 3OOHA 3TSYA 1UQRA 3ONWA 3UUEA 3WRWA 3D4NA 1CF4A 4X7PA 2QT1A 2GZDA 4KMOA 4XUGB 1I1OA 2CJWB 2HTEA 2PTGA 1JBEA 4TVSA 4LUCA 3OOEA 3ZHTA 3L1HA 4U9IS 3UQYS 3PR3A 4ZOLF 2HIGA 2QR3A 1Y37A 3KE9A 2P6MA 3ZLJA 3KQMA 2VJOA 3FVRA 3KU4A 2ZIUB 3HSYA 3OEED 3MJTA 4X8MA 4JB3A 5A4AA 4JKIA 3DMDA 2PKXA 4YAUA 4A15A 4I9FA 5IP5A 4M87A 4ESVA 3P71T 4BMXA 3CZ4A 1DBPA 4GVPA 3B2NA 1L4KA 1BU8A 3CPHA 1FYXA 3QOFA 4UVDA 3SSAA 3HR8A 2IP2A 3FFBA 5DCYA 2WWYA 4BBJA 3QVWA 4RHYA 4CU2A 1LW7A 1XPRA 4UU7A 1WABA 2P77A 3N3AC 3N75A 1XMPA 3KVRA 3L6EA 2PVCA 3B3FA 2WWFA 3X44A 4W5NA 2AL7A 1B8OA 2H6EA 2ZP1A 4DIMA 3SVZA 3V7NA 2O7VA 1ZUIA 4JXJA 4QPPA 3VZQA 1AQLA 5DKFA 1ODFA 4L5IA 721PA 3BBPA 5IABA 4GXTA 1J9EA 1YOBA 4L4XA 4FMBB 1U8FO 3OX1A 3EBLA 4MW5A 1BO6A 3MJEA 3GLFA 1C8BA 3DFKA 2QTZA 3KYJB 5ALUA 5HIJA 1U2GC 1W96A 1CY0A 3PDHA 4NYMR 4ZREA 2JIBA 2YV3A 4A8HA 3ZWCA 5KYYA 4S05A 4ARIA 4YPFA 1X1AA 5JXIA 5J4VA 2JBHA 5LZ4A 4DZRA 4L9SA 5E6SA 5GM1A 5LQSA 3VR5H 4OPMA 5BV0A 2Z5LA 1PQWA 2ZLBA 3DB2A 1HORA 4GLLA 2DR3A 3CSUA 2E5FA 3H3XA 1NVGA 3TINA 2E55A 2DGDA 3EMDA 2QS9A 5LLDA 1WWKA 3E9EA 2GM4A 1EGHA 3ZDAA 2WSSA 4P4TA 3H9GA 3BWEA 3NNNA 1I10A 2KM1A 3X43A 3ZN2A 2WPDD 3IALA 3EGIA 4LGYA 3Q5DA 4LY0A 2MTBA 2HBRA 2ZSKA 1L4NA 1TVEA 4D1YA 3TTXA 2OVFA 3CLVA 4C4AA 5AW7A 3BL5A 3UB2A 3HCPA 1G20A 4WFQA 4O1IA 1T5HX 3OZEA 4ZAWA 3H9BA 5KNBA 2V7QD 2AFIE 3C3MA 3EXG2 1XRSB 3DKKA 3FYUC 3HRIA 4C87A 2NT4A 2WYUA 5DSXA 3WNCA 4ZHSA 3G1WA 4Z3DA 3ZOZA 1T3GA 1V5WA 3LKBA 3ANXA 3EA0A 4YV7A 4EHKA 2P2DA 2PPLA 2J6HA 2EG9A 2HCRA 3C6XA 3HRHA 1ZXBA 3C3XA 4MS3B 4AUKA 1NNUA 4LWPA 4I1IA 2YWXA 3CF4A 2P2GA 2YMPA 3IOBA 4LGCA 2D1TA 1CK4A 1MW9X 4MA0A 1NN1A 4U8HA 5H7XA 1RWBA 3RF7A 2R7NA 5DVZA 4EBBA 1CSEE 6PFKA 3TFWA 2F8LA 1NNSA 3BFKA 4R2WA 4RTOA 2H7XA 4D3FA 4EAAA 4JSYA 2VA9A 5DGHA 3RIXA 5JAUA 1E0SA 1T6XA 2IDZA 2B0CA 3DT9A 2F1IA 2YH2A 4OGKA 1PR0A 1N6IA 4BKQA 3HGQA 2PRSA 3QPVA 1ID1A 1IIBA 1SUAA 1CS0B 2E3JA 2EF1A 3KVYA 4PINA 1GUYA 4TOIA 4GZ3A 3T99A 4B46A 1GV1A 1Y0BA 5AVXA 2E87A 2R1UA 2G0TA 2VQ3A 4LGMA 1J6UA 2QRLA 3AP2A 2QTVA 1P4AA 3ZWBA 5EYPB 1YA4A 1U7DA 1RQLA 2HO4A 4COKA 3PYLA 2AOWA 2GJ8A 3H7IA 4F5ZA 1I4TD 2JVJA 3CX7A 1SIUA 1KF0A 5AP9A 3AF4A 4U2KA 4AMZA 4JYPA 1IFXA 3LDAA 2VDOB 1DO8A 4OQZA 1MO4A 4TLEA 5GOTA 4DRYA 2FYTA 2P9QA 3RADC 5M7EA 2PZEA 2FEAA 3ZLVA 1QSGA 1DCTA 1CC1S 1Z8DA 3C8HA 4OK6A 4UKDA 4JLVA 2VPIA 2DR0A 2D62A 2G8NA 2H2FA 3IIKA 4NCJA 4GXRA 2BUCA 3DE7X 4E08A 1MORA 4HLUC 1B1CA 4LJLA 1VDZA 4ARSA 1NUHA 1YB4A 5KMGA 2B4RO 2BFFB 2NW6A 1O2DA 4GOMD 5TS2A 3SS9X 3UHOA 3T1VA 3NM6B 3QLVA 1D8TA 1V2GA 3PD0A 4ZQBA 4ZDWA 1YI8A 3WB2A 1PL0A 5IF9A 3LBNA 2MU1A 5FA5A 4WTOA 1JT9A 3BIWA 4Z4IA 1XNHA 5AKYA 3OQBA 4TVBA 4V03A 3LHKA 3PC6A 4PZLA 4X63A 2OBMA 4BNGA 4FZRA 1GM5A 3SY8A 1AD2A 1E6EA 5E7QA 1D03A 3FSJX 5LBTA 1Y48E 3HC7A 2XWBF 5A0VA 1QTQA 3ZU4A 1JDTA 3PXXA 4PVDA 4OLJA 4UBOA 1ESNA 1NAHA 5IJ9B 1IUNA 1H9BA 3R6GA 2AMLA 4K7JA 4P4NA 4MP6A 1E7MA 3SQOA 4ZCIA 4ZCRA 3L4SO 3M6VA 2CL6X 4OGLA 1DB3A 3VPHA 3CONA 5C35A 3OTWA 5EXXA 2YIJA 1H0HA 3WGOA 1K27A 1DAKA 1SUBA 4AZ3A 3FTFA 3TLGA 5JNSA 3AY0A 1SZPA 3SBXA 3SVTA 3MLBA 4CM3A 1ZK0A 3L1JA 3L9WA 4E7PA 3Q7IA 4MAFA 1GG9A 5ER6A 5AVVA 3LBYA 1IQPA 2OESA 2NXEA 3N5KA 1H2YA 2PX6A 4Q7JB 2XMBA 3SR4A 3O1IC 1XMVA 1N6OA 3EJWA 3SX4A 1V8ZA 5BWNA 4H35A 5LQAA 3ZIAA 1XTVA 4TMXA 3D4IA 4ZICA 4QBHA 2CYAA 4EJSC 3CX4A 5AT1A 3RTEA 1U9IC 4OP1A 4YV1A 4Z8YA 5F77A 1K4MA 1F2TB 3OKFA 2FWMX 4WD3A 4MTLA 3GLGB 2F1RA 5LMNB 4GP6A 2YMLA 5KCZA 1RM0A 1NPYA 1RYEA 1T1GA 1I1HA 2DTEA 2G88A 2VNKA 3GPDG 4OUDA 4R9NA 4IIJA 5T8KC 3IUEA 5TMDA 1MO2A 1CX9B 1Z45A 1NIPA 1XRPA 1PJ8A 4F86A 3C8ZA 3S2ZA 3STVA 3CJQA 3R3YA 4BZPA 1JI0A 2H1OA 1U1DA 3H17A 4JQYA 3WGLA 2OM6A 4MH0R 1K9SA 4TV8B 2EAUA 4QYSA 4X84A 2PU5A 4K6MA 3LQKA 1P0MA 3M1YA 3N0WA 4S2EA 3WLPA 4X64B 3MK31 1MO6A 2MWMA 4UNNA 5INTA 4C78A 1YAHA 1LB1B 1SCAA 4KYVA 4MUKA 3OIWA 3M4NA 1N32B 1K6XA 4E4YA 4Q1DA 4NOKA 2NT3A 2WIGA 4XI9A 4YUYA 1EJ2A 3IAAA 3FYCA 4NFHA 1H8ED 2B35A 3CVJA 3NJ4A 4IUDS 3GWGA 5FOXA 4D8VA 2Q0XA 3N0RA 3AKDA 5FO1A 3L8FA 2O8EA 4B79A 4GYWA 2AEEA 4DR6B 1T9CA 1NVKA 1PV2A 3VYSB 1XMIA 1ULHA 1UPAA 2VXBA 3NHRA 1K7CA 4UC0A 3W05A 2NTEA 2JGFA 1X7WB 2WD7B 3MPUA 4AJ1A 1EFDN 4GYKA 5IDVA 1BHQ1 1Z25A 5AQ1A 1FVFA 3GD7A 4QXRA 2CVHA 4MQMA 1WUHS 2VYQA 3G2NA 1IBSA 3I9OA 4G0MA 4LVCA 1QIFA 1KJ8A 3DFZA 3L4BA 4IKEA 5AM5A 2X0EA 4EHHA 3WJ7A 2NTNA 1I80A 3GJ3A 3GRAA 4ER7A 2WU8A 3LCVB 4BQNA 2ZT6A 1W0CA 1PKXA 2J5BA 3EIFA 1G41A 4ZOBA 3O90A 3TIGA 5K6TA 3LFUA 1FZQA 3IAEA 4RKRA 1QYIA 2QE6A 3BXOA 4C2AA 1MQAA 4Z0PA 3KYCB 2OYSA 3NXKA 1LPAB 1Q3TA 3NV9A 1U1IA 3PSHA 1TLLA 1ZS9A 2CKMA 2XX3A 2W2OA 3A06A 4RVNA 4YRAA 4IDNA 4UNIA 1P2FA 1LUAA 1YASA 1PNTA 4PC1A 1PS0A 2O3QA 3KQSA 4YP7A 3O31A 4GDMA 4MQFB 1RADA 3HN2A 3PHLA 1U3WA 2O5RA 1VHQA 2F3RA 3DZFA 2KX7A 4XFKA 3SC2B 2NYUA 3PUYA 2QWXA 4CT5A 4KW7A 3GGCA 4YRMA 1E2UA 3A05A 3KZKA 2IS4A 3IE2A 4J49A 4C89A 3B5JA 4RYDA 5DTIA 3OAAD 4LXIA 4FB5A 4BPBA 1TYBE 3OPXA 2CK3A 2B4AA 2HCFA 3CY6A 4L75A 1C30B 1B6TA 3ZDDA 2HN9A 2DFNA 3QVKA 4TKZA 4DCUA 1XTPA 4XVCA 1EG7A 1K0FA 1KDTA 2KPOA 3AEUB 3R5SA 5DJ5A 2WJIA 2BP7B 4UVEA 2D8AA 2X5NA 4D4HA 2KLBA 1BN7A 1BNCA 1OUMA 3BX1A 4HEHA 4KZKA 4PHTA 3WDMA 3ERCA 4K0KB 2QRVA 3FSGA 1A76A 1T91A 3LX8A 1C1HA 1YE8A 2CFSA 1P19A 2FWJA 1E7RA 4J0DA 2XY4A 1NKTA 3O3OB 1E9EA 1SXJC 1J56A 1TTQB 2G9UA 4YCJA 9LDTA 1C3XA 4MAAA 2HHJA 3W4IA 3PEFA 2H1CA 3KELA 3QYAA 1R1DA 3FPFA 3SYLA 1QO7A 3O8DA 3LHDA 4B7XA 2ZUWA 2QDXA 4NPAA 2GM9A 4P54A 3BXXA 4XX1A 3T7RA 5K8IA 2C3MA 3DPSA 5LSAA 1SCUA 2BRUA 4K9DA 2DWUA 2YUTA 3EHDA 4B40A 2WRZA 3LUDA 2FRDA 2JLSA 5B37A 4DR5B 4P80A 1ZNQO 1L4FA 1DQRA 4IIXA 3N7UA 3QLUC 1PZMA 1GG2A 3FLBA 4TWIA 1U0TA 3Q0EA 1DWPA 4Z7OB 4XAQA 4DR2B 1DP4A 4R1NA 5CEEA 2R5WA 2IOQA 3RUDA 1QORA 2G28A 3AONB 2IF0A 3F5MA 2XAAA 3ZIDA 1QVVA 2HK7A 5C7LO 2Q3CA 5HQ3B 2NPIA 1ML3A 4RZXA 1KVRA 5EI5A 3NIDB 3D59A 5I4KA 4E7OA 2YWDA 4JU8A 2G9NA 3FTCA 1N1MA 3B9BA 3BJIC 4IW3B 5H80A 4ZGBA 1G7CA 1Z6XA 1NUSA 1KL7A 2RKWA 3KB8A 5TGDA 3S5UA 5AHWA 3CQ9A 3PKZA 3AMVA 4G1VA 1RQ7A 2B1QA 2RI6A 3VV3A 1BJTA 1WSWA 5BRAA 5FV4A 2O2CA 4R2LA 5KVAA 3IULA 4OSPA 4CUKA 4EYEA 5CA1F 1IEWA 6GPBA 1RYYA 1TF2A 2H16A 2Q4RA 2X1LA 4XB1A 4BQOA 2P3QA 3L84A 1Z08A 2FETA 1KI9A 2ZIXA 3B89A 4KR2A 1Z6YA 2O2DA 4ZAYA 5LNK1 2GF9A 3FRJA 1EJBA 1WXQA 1Y98A 3HDHA 5ESXA 2GEVA 2LRHA 4AICA 1OHHA 5FUXA 4D5EA 3F78A 4RNDB 2J3EA 3JQPA 3KEGA 2F64A 4IIEA 1MVLA 2Q4OA 3GLIA 5EMMA 2GYUA 3I01A 4GLOA 4U2FA 1YHZA 3KWLA 3VJKA 3E5HA 3AR2A 2CHFA 2HV8A 2WF5A 1DINA 5I8ZA 1MT0A 2ORVA 3JY6A 3BC1A 2AZXA 4RVUA 4YUVA 5A4KA 5DT9A 4JGGA 1CRLA 5FYDA 1JR4A 1ZL0A 5REQB 2HLHA 4TXNA 3NP9A 4QTXA 4XLZA 2NXJA 5BSGA 4JJZA 3I58A 4YAJA 3TSZA 4ZDJA 4QD3A 3V8QA 4CV0A 3SFVA 4Z4QA 2WFLA 4B47A 3OC0A 2LIVA 1A5SB 2ZZNA 3UJHA 4EJMA 1PVVA 2WZBA 1Z0JA 2PIDA 4WECA 4FINA 4RJJA 3O8NA 2VQEB 2O57A 5DNVA 4BWYA 4YREA 1ZICA 2DQYA 2J9RA 2J07A 2O1SA 1QWSA 2Q5LA 2Z3WA 4JJAA 4JXKA 2BF4A 2P8SA 3QBJA 3WIEA 1K89A 2VP4A 4OLFA 4URZR 1K8YB 4OJTA 5CDUA 9MHTA 5HE9A 2C58A 3E8SA 4YPOA 3DBOB 5EJ5A 3IVCA 2QI9C 3UMMA 2EL9A 2OCKA 2QN7A 1SCKA 2UZ0A 1E89A 4V0QA 4O1MA 2GCGA 4OBEA 5DNAA 4Y9SA 4KGVA 4E12A 3RRFA 5I5GA 3MWJA 2RHRA 2D5BA 3QKTA 2RHWA 1HRDA 4CU5A 3K0CC 3ZW7A 4B44A 3COYA 1I2CA 3U49A 2VDUE 3NHYA 2BBTA 4GNKA 1U02A 3CTMA 1AK9A 5F2EA 1P18A 4HB3A 3VTKA 1A8SA 2FKAA 2YFYA 3B1YA 3W5SA 3ZK7A 2YWRA 3DTNA 2E5WA 5DK4A 4WI1A 3WRXA 5KTMA 4BVGA 1VFNA 4B3HA 4FLFA 4AXXA 3AR7A 3WWYA 5ALFA 2BI8A 3TLAA 4KDCA 1MNAA 3SMQA 1K8XB 1N9ZA 5I9MA 3H5OA 3RRNA 1H1TA 5IKEA 3B6JA 3NW9A 1XDWA 3VR5D 4QSHA 3AL3A 5AW9A 5JPCA 1ZIOA 1O4WA 1YQEA 2ZWAA 5I7AA 1GGFA 3KSBC 3O91A 1RRVA 1MF7A 1W36C 2RAPA 1BS2A 3KZOA 1QV9A 1QHHA 1DG9A 2XYRA 5L6LB 5DULA 3MQ4A 3O8LA 3U4DA 1PW5A 2HHLA 3AV3A 3B3GA 3D4PA 5CH3A 3GFFA 3M34A 3SKYA 4BQEA 3CE9A 5A6VA 1SQSA 3CF2A 4M7PA 3BQMB 4OAOA 1OWOA 2O52A 3M2TA 4YDQA 1VIMA 2VQDA 1UR5A 3D9QX 4IXNA 2HC9A 3UG7A 3AIKA 3LI2A 2JLVA 4DEXA 3JRNA 1FJHA 5FWXA 4MO9A 4TKLA 4D9FA 2IYEA 2H0AA 5EHNA 3VTZA 4YJ3A 3R3ZA 3WKEA 4TTSA 1DG3A 3UEOA 2AK2A 5MDHA 1COWD 1RC0A 3V6LA 2ZE8A 1CNFA 3CWCA 1VKHA 2GZ1A 2ZBVA 3CX8A 3KTAA 4RMIA 4ETNA 1EWVA 1HETA 2HLDA 3R9KA 1CIJA 3LP6A 1DQSA 3AF6A 3CUWA 3AERB 1H2FA 3KOZA 1ZX1A 3ORRA 1WU7A 4L8GA 4OQMA 1E18A 3RO7A 3SR0A 1VXRA 3EW9A 4RVCA 3F9CA 2NU7A 2WAXA 5CYOA 1Y9ZA 2VP6A 3OPYI 4NCNA 2NTYC 3M9XA 1WMEA 2HU8A 3NBQA 1M8FA 4Y6GB 1F3LA 4B6JA 5E9WA 1VLHA 2QQGA 1UAYA 1N5OX 3KSZO 2XADA 1T24A 1GJRA 3U7GA 1OH6A 4EUSA 2GJ4A 2AOXA 5EINA 3FWNA 1EFHA 2AN4A 4XM2A 4EM6A 5K99A 1KJZA 1MEEA 1X86B 4A23A 1KJIA 5LUAA 4LQLA 2XMGA 1EGMB 1ZC3A 2QV7A 4BAUA 4L57A 5HKKA 2F1KA 3IDSA 3PVZA 3PCXA 2H4FA 3ZQ4A 2Q5OA 4TT3D 1SZJG 4PRZA 4FDUA 1DZIA 2OVBA 2R85A 4MICA 2HU5A 4DRXB 4WIAA 4NBRA 2ZB7A 4MW0A 4QYMA 5T3YA 2GK4A 2Q5FA 1ODSA 3PITA 1KYQA 2XQVA 4FHDA 4MQEA 2Q2VA 4DIDA 1SOVA 2QTTA 3LHSA 5KNBH 1YQWA 2WA2A 5C7OO 3BTUA 4MWZA 2D1RA 4IEEA 3KL2A 4EPWA 2Y6VA 4LRUA 4NBSA 4NZZA 3UT5B 1SB9A 5D1HA 1PDWA 1PHRA 2HV9A 1QGYA 1S4MA 1YJBA 2E1PA 4UHKA 3GZNB 3HVUA 4QJ3A 2I80A 2ET6A 5DX0A 2E9SA 1MIHA 3OQVA 4H7EA 4RE6A 5FKJA 1AU9A 4UFOA 4GLBA 2QE7A 4FMDB 1NW7A 2HR1A 1MAWA 1JUDA 1FMLA 1G64A 1WNFA 2GM5A 2GSWA 3DF7A 3HRKA 1PNOA 2EZ4A 2ZATA 2ZWIA 4BNZA 1S02A 2QY9A 1QK5A 2FLVA 4J94A 2HBYA 1V48A 2ZPUA 4GOJA 1NUUA 1IEQA 4N9WA 3P2IA 4OJYA 3AYZB 4MI3A 4ZAGA 4Q4AA 2DRIA 1X74A 4MP8A 1LPBB 3Q9LA 4MJXA 2RCYA 1OKKD 2EGUA 5IYZA 2Z6UA 4NCKA 1X9IA 2DBYA 4ZODA 3ROTA 3SYMA 1XMJA 4B3JA 3PGA1 2Z56A 2C4UA 4IYRA 2CL5A 4R2XA 3VKWA 1Y33E 2HKIA 1U7TA 4RQBA 2CMKA 2EKLA 2YYZA 3RYHB 1RYFA 1RZRA 1J2TA 1GN8A 3E5MA 1XQWA 4TTPA 2V96A 3MMXA 1HQDA 3KDAA 5IJZA 1TZMA 1X3LA 2AX4A 1IJFA 1WVMA 4G0ZA 4R54A 4ZEMA 1M6HA 2C77A 2P90A 2PXXA 3GVXA 5KYXA 2N75A 2YV4A 2GYYA 3JS5A 2NXNA 4FYKA 1PG2A 2GAFA 2GWHA 3OP4A 1TU0A 4FNAA 1KGDA 4E46A 2EL7A 3MBOA 2YFHA 4C4OA 1BROA 1FFDA 3LUPA 1ECGA 4KLZA 3TK1A 5K0JA 5LQUA 2WZDA 3C14C 1VE5A 1OWNA 3LVFO 1A8IA 3LUBA 1P5FA 3G13A 1XDZA 4PANA 3A4TA 4LG1A 2WF9A 3PRHA 1VB3A 3L93A 4JBYA 2F4VB 3HG7A 2QM3A 3BRWA 3I37X 1WXGA 4HMOA 1PO7A 2EJCA 3E22A 1GPWB 1RQPA 1HLFA 2QVZX 3L8DA 4Q6BA 3BEOA 2IPLA 2C2OA 1JHVA 5DE3A 3ICOA 3K8YA 1NHGA 3FTPA 3LY7A 1CF9A 2AXEA 1NVDA 1AHIA 1T4MA 1KI1A 2HA7A 3MM4A 4DM4A 4C7OB 1H2BA 2EW2A 4KQKA 5CM2Z 4HFRA 3X1XA 1DKQA 4RGBA 3ANSA 2ACKA 3GBSA 5AXDA 2IK8A 4G1CA 1JA1A 4LZOA 1DE0A 5EZYB 3UG6A 3B12A 4KYIB 4BB0A 1EFCA 3G59A 1KFJB 1ZY2A 4BS9A 2O9JA 3UAXA 4Z4CA 5LD2C 3MSXA 1O94A 2W4QA 3DMTA 3FY4A 1I5RA 2FHSA 4URYR 2IC5A 1R5BA 3WIDA 3S2EA 4EG3A 5BRNA 3N74A 3GZJA 4ZVNA 3UA3A 4ESEA 3ZW9A 3C48A 4KPUA 1XWFA 1JQEA 2C54A 1XYGA 1V11B 3O8RA 1RKQA 4MOWA 4RF4A 4LDNA 3HY3A 4NWIA 4EFMA 2QN2A 1NKSA 1IZ7A 1U28A 1JWAB 1USKA 2Q3MA 2K2QB 2J0UB 2KHZA 1ZUD1 3H11A 4L4UA 4OK3A 2HI0A 2NVBA 3W8RA 3A27A 4D4LA 1W5FA 1E79D 4X7RA 4AF6A 1J8VA 1J1UA 1GHTA 2PZGA 3NASA 3CRZA 4TQGA 2AXQA 4BKUA 1T4GA 1T35A 2CMGA 3K9GA 5JXGA 4NNOA 1XTBA 2CHQA 2C5GA 1BSVA 1MH1A 5AJWA 3TFQA 2H17A 1AUPA 5IS2A 3DVAA 4JB0A 1QQTA 5K51A 1DKUA 1KY2A 3EY4A 4Z8XA 2D1SA 3R5HA 4TV8F 4G4JA 3E53A 2P9GA 4E2XA 4ZDKA 5MFPA 4NE7A 1GPAA 4G5GA 2DWCA 3WTBA 4DWOA 4XX0B 4KVFA 1R4ZA 3EPRA 4ML3A 4QQRA 2RGRA 2WDZA 2FJUA 3QJYA 1E1YA 1X1TA 5J5VA 4YCLA 1M9NA 5LOVA 4Q9HA 1QHIA 2VRWA 4I1PA 4LVUA 1EDEA 1PKEA 3DUFB 4RESA 1NW8A 3PRYA 1HMPA 4H7JA 9ABPA 5JDIA 2OZPA 3OFND 2I4OA 1PSDA 2F43B 4YJFB 1Z2CA 3E8MA 3GVCA 3VI3B 4D82A 4NECA 1TADA 3GFVA 3ZQKA 3DDWA 1FU8A 4BMZA 5LKAA 4FR0A 1J2EA 2NZUG 2CJFA 3J7AC 4X94A 5IKOA 1PQUA 3V8BA 3EEBA 2W6OA 3TVDA 5E2BA 5EUQB 2IE8A 5P21A 3IQDB 2C1ZA 2DFLA 3D2BA 5BNZA 2Z6VA 3W6NA 4WDQA 2FPKA 1IC6A 1ZDMA 1DCMA 1VRVA 2A7QA 5BN5B 2B21A 3LQ1A 5LUBA 5TEWA 3DOIA 5FOUA 1XWWA 4UNQA 5IBPA 3F4LA 4DDHA 5FF9A 2L18A 5KOHA 5C3MA 3NYIA 5E6UB 4HDMB 3SM9A 1X38A 2GCPA 1DS6A 5K8VA 1BEZA 2YZGA 2WM8A 2WYWA 2WVHA 4TUYB 2PS9A 3LM8A 4H31A 4E32A 5J5AA 3ZQJA 5BY2A 4BNKA 4C0LA 1XYVA 1YC2A 1G4UR 1AKQA 4O8CA 1RZVA 1E8DA 4UDNA 4UD6A 5HDBB 4P98A 3STUA 4EATA 2DAPA 2C3PA 3N2IA 3THWB 5G02A 1TPZA 3A4NA 3AFOA 1JJ7A 3WB9A 1GTSA 2NUAB 4NENA 3S44A 1WR8A 3TQRA 5C37A 4CV2A 3SSOA 4D9NA 1ST3A 3KOUA 1W46A 3L6RA 1FU4A 4RHUA 1RCFA 1MBZA 4GKAA 1XZAA 5IAGA 1NJ8A 3EISA 4ARUA 1YUBA 2MJLA 2NQTA 1SUCA 3TL6A 2AC7A 2ONJA 1KPHA 1FFBA 1UMKA 4MS1A 3SIXA 4NCBA 3HP1A 1XALA 2QD1A 1N33B 5DO9A 3ODPA 2R1VA 1MAHA 4FFLA 4B2YA 1ZXXA 1LSSA 3EMKA 3P9QA 3U6BA 4BN4A 4XA8A 1LPSA 3W78A 2HQSA 4O2AB 3EZLA 4Y6RA 3ZZNA 2Y0EA 4HEJA 2BDTA 3SK0A 2Q8PA 1C8LA 1CR6A 1ZUNB 3BZBA 3KUCA 1GNQA 4AKHA 1WDTA 1Y6ZA 5KAPA 3VI4B 5E0KB 2QM7A 2XMDA 1Z4QA 2ZDQA 1VJ0A 1ONNA 2XUFA 3TLJA 2OP0A 3GL9A 2VBGA 4Z2YA 3T7IA 4EARA 2BH9A 1QE0A 2QT0A 4Z4FA 5F5LA 3BXZA 1RKBA 3DE5X 2X9LA 2AG1A 1I94B 3N28A 5KPDA 3U3MA 3G0IA 3IQHX 1A04A 2RIPA 2BGUA 1NFRA 2BKXA 3CH7A 4MJLA 2FP3A 2LXNA 3WY9A 1Q1AA 1X14A 5ERGB 1OXMA 3V2GA 1RJGA 1CWUA 4XYLA 1YMVA 1CUXA 1JVSA 4KYUA 1JXQA 3AM3A 4YVFA 5JPIA 2R7KA 3OQ1A 3GLFB 1DXHA 3DBRA 3QKRA 4I4LA 4YHBA 3OT4A 5EG5A 1YOVA 2YHBA 3JAWB 2LNDA 5KYYB 2IDKA 3MJHA 4IVQA 2A9JA 2ID9A 4BUJA 1P9RA 1JDJA 4EGSA 1SCIA 4J1TA 5B1HA 2FMIA 1OYYA 3EXIA 2QLFA 1RHKA 4D8WA 2HPAA 3H2GA 5E6SB 3JWGA 1N0HA 2O2ZA 3L8GA 1Z0UA 1T9GR 2GFHA 1AQIA 3OY7A 3QOYA 1X1EA 4PLFA 4Q9AA 4IWXA 4X3OA 2I4TA 4OU5A 5D6NA 5T41A 3MW8A 4TQAA 3RIHA 5KS2A 4XKJA 4YB8A 2A3RA 4ARZA 3EVNA 1YQGA 2P1RA 2W48A 4BEBA 1QZUA 1GG8A 3ONVA 2QD3A 1FYWA 5C7YA 4Y1EA 3GQBB 4UBNA 2G17A 3K53A 4YEDA 1Y63A 2ZRDA 2GBLA 4NMHA 4IUCS 5JXWA 1TEVA 3P9CA 3EGWA 1NWHA 5K2OA 2ZUVA 3VSAA 3PTAA 5KINB 1AUOA 2ZAIA 3H1PA 5G53C 4AURA 1G20B 3BXHA 5HUHA 1S8OA 4XSVA 4XTCS 5KQGA 3ET5A 1CUAA 2F9LA 2FMFA 3NBZC 2AG0A 2ZSDA 2XCRB 2WIFA 1FP4A 4UPDA 1Y3FE 1TNDA 4ZT7A 3LRPA 1SQ6A 2F1OA 4J8PA 1M6WA 4ZHQB 4OOEA 3WLFA 3T5MA 1P1CA 1VCIA 5EZ6B 2JDID 2C5BA 2CE7A 3FXAA 5FOTA 4E5NA 5JASA 1UKZA 3C3WA 4RW0A 1L1EA 5BSUA 4NYJR 1H1DA 5CNJA 1Y42X 3BWMA 1CR0A 3KYDA 1JILA 1Z22A 5TQVA 1OH8A 2PUBA 3ILVA 4PZYA 4YH1A 3PXCX 1X9GA 1WJGA 3U4QA 1XZEA 3B1JA 4IZIA 3H9CA 1DIRA 2JA1A 4OL0A 3SFTA 4AY2A 1POWA 1CJKC 1T8TA 5JWRA 5BVGA 3R5KA 4CIWA 3H5IA 3DXFA 4UDYX 5SY9A 3RDPA 3WAJA 5FPSA 4CXMA 1Z6PA 2HX1A 3CH4B 3H2YA 4ISCA 2K6GA 2V97A 3M6XA 1RVDA 2QTVB 3EVTA 3M6AA 3PE6A 1ZI6A 3QWAA 3TH5A 3SHVA 3FI9A 1XCLA 3WDSA 3QJ5A 3WK8A 4O4LA 5CVDA 3OZAA 3QVJA 4BVBA 5JO0A 5CURA 4DVJA 4W7SA 4H7FA 4RF3A 5DM2A 1E66A 4F45A 5JWHA 2QD5A 2LD4A 3ADCA 3T5CA 4JLMA 4OJNA 1NG1A 1P39A 3QE9Y 4H1TA 4HQRA 1H2RS 3ECCA 1DT3A 4KLCA 2X0IA 4K9NA 3V4VB 4ARVA 1XI2A 3IE0A 4EVRA 4JR1A 2AN5A 2QK4A 1NLMA 4UREA 2PVSA 2QW0X 2Z04A 3FA2A 3F6EX 1F12A 1SOUA 1ZMXA 2BCEA 1DFGA 2R66A 3DDHA 3DMNA 3KQWA 2E4VA 3ND8A 4KRGA 4CVNA 5TC4A 5KMGB 2HQBA 3WZMA 1GAXA 2G76A 3TLZA 5CJ2A 1Z5UA 5AW5A 4LN1A 4Y3UA 3AU9A 3OEYA 3SQXA 4Z9FA 4J0KA 4P5DA 4PNZA 4BTLA 2EZ8A 1E9RA 4F4HA 4RTSA 4CIVA 3CG4A 5EZQA 1PGJA 4RULA 2X13A 2DUJA 1NJ2A 2IH4A 2XZTA 3KKZA 2Y1DA 2BTQB 1FSFA 4FQ8A 3NTUA 2B5WA 2UAGA 4TLLB 4V0NA 1HTBA 1LLDA 2PD3A 4KXWA 1YQQA 2HMUA 4Q37A 1EVYA 1U5CA 5G1PA 1ISFA 2Q07A 2REBA 5GINE 2EVWX 2WAAA 4WY2A 3W8FA 2QHXA 4AZ3B 2ZRQA 5H3HA 1T29A 3TLGB 2TS1A 4BLPA 5EWLA 4YC7A 5KNBD 3Q9UA 5I8PA 1QHEA 2JAOA 2JFHA 5DGDA 5M34A 2DWOA 2OCGA 4UVGA 2JJ8A 4R6XA 2OKGA 4NSNA 3WGVA 2GEKA 1EVIA 1UKAA 4DL9A 3E05A 2OLJA 3P0RA 4KQFA 3PUKA 1XZQA 5AI4A 4RKWA 3CLRC 1JL3A 2H59A 4ALLA 5CFPA 3NOOA 1T5OA 2J7PA 4H1HA 1H42A 3QM1A 1B8NA 4G24A 1ZESA 4W1QA 1RLTA 4C0SA 1HPLA 1Z38A 3ORFA 4OUDB 4ZU3A 1G8MA 1VCHA 3E1GA 3UB4A 1FDTA 4IIJB 4RE5A 4A8JC 3FJ1A 5ITSA 1ISRA 3NYWA 4MZXA 3LQFA 4BFSA 2WTBA 4CMAA 2G71A 4UASA 4YP5A 3K1YA 1R7RA 2ACEA 4KK4A 1AXRA 2VHVA 5F5NA 2REXB 3PLNA 3MOSA 2AT1A 2XRYA 5ICFA 4ZI2A 3DO5A 3WRYA 1Y8ZA 2FZWA 1Q0ZA 2O3UA 5KB3A 4HH4A 1K5DA 4YAIA 4S0XA 3D3NA 2FLKA 4UTOA 4PBRA 3UJPA 1UJ5A 2FR8A 3AVOA 3CTPA 3EXEA 4LXYA 5MGBA 2JLCA 2O8EB 1TJYA 4X91A 4EY3A 5SZHB 3N2GA 3EOZA 1G3MA 1ZJWA 2OPBA 4BNNA 3UJNA 1HNXB 3TXAA 2O06A 3GVIA 2BTOA 1ZJZA 3LAWA 4H27A 2BMFA 4IQGA 3FCYA 4H0CA 1FJGB 1YWGO 1GPUA 4ZRNA 4F11A 1KEUA 1DG1G 1GZSA 1KZ1A 2FEKA 1C7EA 1P1FA 2BPOA 3PQFA 4UQPA 3EZXA 3KSRA 3TR6A 3VSDA 4B17A 4EEKA 2DUUA 5ALHA 1J0XO 1WB4A 2QNIA 1QG2A 2WF6A 1GZUA 4X20A 1J00A 1DFIA 2EFGA 1QTRA 2MSNA 3OICA 3TL3A 3ZCSA 1D2GA 1U5BA 4LTNA 2PJZA 1NN5A 2GEBA 2OFPA 1L4YA 1T9BA 2QZSA 3CRNA 5E9AA 3SBDA 1V4NA 5HK9A 1YZUA 4S1WA 3AGPA 3BK1A 3RU2A 1ARZA 3C1OA 4LOHA 2WKPA 2WWRA 3WLOA 1VPTA 1VG0B 3IP5A 1ORIA 4I1OA 4TKMA 3FOFC 4DQUA 4CDNA 1CTQA 2D06A 3GCWA 2WMYA 3CF0A 3JWEA 1SC3A 4RGQA 4XJSA 4YRCA 1C0LA 4AJ9A 3A37A 1D2EA 2FG6C 1QMPA 3IIEA 1JJAA 4JR0A 4Q00A 4E94A 4ND6A 5EWJA 4CKXA 1YHYA 2BEUA 2IPOA 3W2GA 4C2UA 3D3QA 5L7YA 3GXBA 5FPHA 3UAWA 3CWZA 3NNSA 3PENA 4GQAA 5MF6A 3ENKA 4GBED 5NULA 3BHIA 1PAUA 3K0KA 1XKXA 4KGXA 5EJGA 2MMCA 1PVDA 3GAAA 4X85A 3TZCA 4IDFA 4UQLA 1IPFA 1QHXA 2C2XA 3FHJA 5BUCA 3DAOA 4MYUA 4CI0B 2HF7A 3IAUA 1NF8A 5EE9A 4Q1EA 5KVSA 1XCBA 2O1WA 2M6KA 1BW9A 1YFKA 1RE1A 2JAXA 1FX0A 2ZJ8A 3G5UA 4A36A 3HK2A 4Y2RA 1SVIA 1UFVA 2UYGA 5HSGA 2WUEA 4BVFA 4BY9E 2HSJA 4DJEC 2DUMA 3IPRA 3PNQA 1HE1C 4IRMA 2QRVB 2VP2A 3HKBB 2DCUA 3IP7A 4HF7A 4N6GA 4RAOA 4MI9A 5LWHA 4Q7QA 4JLBA 4QICA 3FFXA 1N2JA 3C45A 6NULA 3TEFA 1RIIA 3U48A 5AQEA 1WBBA 2YJGA 5UKDA 4PRKA 2BTEA 3G7UA 5K09A 4YT5A 5IFLA 3RIMA 1VPWA 1I36A 3IXLA 3NGXA 1CHNA 1WDLA 2Y77A 3WWPA 2L17A 3B20A 4BP1A 2VIIA 3U3JA 4H1VA 4KLNA 2J6CA 1RBQA 2L69A 3CNEA 2YJZA 1SCUB 4LBZA 5AHXA 4RLFA 1UFRA 1K08A 4JC0A 1Z5WA 3A10A 4G85A 1YZKA 1BWQA 1ZD2P 3GLHE 4B3TB 3BWXA 4G37A 3ZWAA 2N1BA 1H2ZA 1E3MA 1U99A 2ZVPX 2VPXA 5B6IA 2C2WA 3RBAA 3O2SB 3PPYA 1T4BA 2PJDA 3KB1A 2EEZA 2FWBA 3LX6A 3AQIA 1YRQA 1U3VA 4WXPA 4XCVA 3VJMA 5IUNC 4A73A 4EFNA 4ZEVA 4CEJB 1BJKA 1Y6RA 4AMUA 3VNBA 4ZAVA 3IEVA 2AE2A 2XB4A 3T7SA 3N8NA 4PSKA 2PFGA 4E5DA 1REQA 1X70A 1NX6A 2ZCVA 4O4JA 4TPKA 5FPYA 1U5AA 5T4BA 1DTSA 3SQNA 2VAXA 5L53A 3AR8A 1AV7A 3C1AA 3DD1A 2FNAA 4AMBA 5MHTA 3DXXA 1FUKA 1PIWA 2Z3VA 4PG7A 3CLUD 1ZAKA 1V3VA 3NONA 1CR1A 1LRLA 3QSGA 3RC2A 5KNCA 3Q3VA 4ZQHA 5L3QA 1NXVA 1CZOA 1F8YA 2FMKA 4EO9A 1CJBA 4BLQA 3VXKA 4PICA 4QT4A 1J4AA 2RFLA 4H4DA 4C21A 3B38A 3QNUA 4TLAA 3DKPA 2UKDA 4NYIQ 4BB5A 5FUVA 3ZI7A 3H99A 1JDZA 1G3IA 3LP5A 3ETDA 2ZIXB 2AG6A 5CLIA 1EA7A 3KTFA 2D1FA 2NXCA 1KIMA 3TXXA 1I9GA 1JQAA 5HQJA 4W82A 3OEWA 3AF2A 4FS8A 5KC9A 3DONA 3S2GA 4WOPA 1NW3A 3L1IA 3B51X 4F6CA 5E3JA 3UTCA 4EG4A 2ZUBA 1QOQB 3ZKAA 4FZJA 4Q4CA 1Z7WA 2C07A 2C3YA 2VYFA 2XDQA 2QUIA 3OT1A 3OZIA 5CMLA 1KE1A 5JH7F 2CNKA 3RVKA 1H66A 1HWYA 1PJAA 2VL7A 3CLKA 4Z5XA 1M1ZA 1R0YA 1PEKE 4IDGA 5B6JA 5F1OA 1MC8A 4YRZA 3RFXA 2ZGVA 5DTEA 2Z2YA 1UADA 3LZCA 5AJYA 1SBNE 1N75A 1Z5ZA 3MGCA 1ECCA 2CK3D 3EWSA 3JQ8A 1NQXA 4JSRA 4QJ5A 5DLYA 5TJ9A 3NVKI 4A10A 2QB5A 4DAOA 4I1VA 4KN8A 4KGDA 4HLUA 3HHPA 5ITZA 4WGGA 4I5DA 1A9SA 1YDHA 1GN9A 2G4VA 3R09A 7GPBA 2NV0A 3KJEA 2IGTA 2JANA 1W4RA 1O03A 2AR0A 3FSGD 4YAFA 2OBLA 3PC8A 4I1SA 2XDYA 4MVJP 4QGAA 4F71A 4HZUA 3CC8A 4ZYXA 5C18A 1NBOA 1NT4A 1PQYA 2HJSA 2WVGA 2PLWA 3BCSA 3CB4A 3HZOA 4P53A 4DA4A 3CNLA 1X7XA 4H3HB 1QUEA 1ZA1A 4R16A 1LV7A 4LY6A 4LOKA 1QM5A 2GARA 4QVIA 1TZJA 4RL4A 2AQIA 2H48A 4BFLA 3LGAA 3L77A 4HWTA 3A4MA 3UC9A 1K92A 1RBMA 3GJ7A 3ZGXA 2HIAA 2R8RA 4TUYF 1EUCA 5C2JB 3V9AA 4YRDA 4M0LA 1JU4A 1RAAA 1NG9A 1HLDA 2XJ9A 3EZFA 2WKWA 5DM70 2H0RA 2DQZA 1WEHA 5DX8A 3PI6A 4Q9LA 4PLYA 3N53A 1SK9A 4B9AA 1M6YA 3JYHA 4EJ0A 1EBUA 3JVVA 1ZBQA 2DY1A 3X1YA 1ESDA 4G63A 4BFWA 2ZWMA 4KQWA 1B93A 3C3KA 2GFQA 2ZYGA 1JJVA 3H5AA 3I2HA 4K6HA 4TTAA 1ZISA 2IBSA 1IVYA 3FDIA 1J25A 4AT1A 4XASA 1KJWA 2IEDA 4TXJA 1IWOA 1FQJA 3P4YA 1SGWA 2DFVA 1UM8A 1C8KA 3VPAA 2QW1A 1KI7A 4FBGA 4AF7A 4EJSA 1SUWA 1U9IA 1IM5A 1XLUA 2AYYA 3F4KA 4RD0A 4PSDA 1WO8A 1QHHB 1SHTX 1ZOSA 5DIFA 2I6TA 4X93A 1EP3B 1JR2A 5CT9A 1EK1A 1G98A 1UEIA 2DZDA 5T8KA 2DLNA 3RAPR 4BVHA 3X1ZA 4O2AF 3EC2A 1GNRA 3H9EO 2CUZA 3NBKA 4LPSA 4ICIA 4D43A 3E4CA 3LK6A 4CIDA 3OURA 2O6HA 1RKVA 2X8BA 4M53A 3ZXUB 1GLGA 4R7TA 4ILKA 4CM8A 1I7NA 3CH5A 3CXRA 2X41A 1YB2A 2G5PA 2GHIA 4TRRA 5A5FA 3QA3E 2R6CA 1JZSA 1RQGA 4V0KA 1FFWA 1F1JA 3RU7A 3VFDA 5BSWA 5K8LA 5JJKA 2V58A 1NI5A 1C0KA 3AP1A 4Q05A 4XWTA 3V33A 1OHHD 3EH2A 4Z51A 1O6CA 3F6PA 2VJMA 1BKYA 3MRTA 4QXQA 3RT1A 1D4OA 3QVXA 4BLSA 3I9NA 2I6XA 1IY0A 1MTZA 3KTAB 621PA 2CWDA 1I2BA 1CP2A 4I9NA 5DLQC 1UXHA 1CE8A 1XQ9A 1PJBA 2PX4A 2LDBA 2QAGC 3Q3EA 1KMQA 1WY7A 2NU7B 2ZB8A 3WZLA 3E2IA 4JBNA 3O9ZA 1VCMA 3AR5A 3S1AA 3ICVA 4H4EA 5H3CA 4CMIA 5LQRA 2SICE 4FNOA 1Y9AA 3HBFA 3QXHA 1ZZEA 2PZFA 1G5HA 4R71A 3T41A 1FUUA 1KNXA 1U9CA 2WM2A 3G23A 4HVTA 4KXFB 1XAIA 4QUKA 3GLFE 1DPGA 2X9NA 2LKDA 2VJNA 2OXEA 3DKIA 4MQ5A 4RD3A 3HPQA 1K8ZB 4Y9DA 4AMGA 1TFUA 2GLXA 2YZKA 3GD5A 3H8SA 3RROA 2E0IA 3SXPA 1TQ4A 3EAQA 4LJ9A 3V8MA 4X24A 5A3SA 2FX3A 3DTVD 5FADA 2FW1A 1V1MA 4LJ6A 4B87A 2JFFA 3CPEA 2Q3HA 2X5KO 4FHZA 1JLSA 3VYWA 1BYUA 1GRQA 1Q6ZA 4K81B 3T38A 3PFFA 4PCAA 4UMDA 2WVAA 1O9GA 1U3UA 3TDNA 2QUZA 3I2GA 3F3SA 4LDAA 3U61B 2FVXA 1RM5A 2JZOA 2VA8A 2WG1A 3ITDA 5GAJA 3ZW8A 5FPKA 5H68A 4MQEB 3LLUA 2RAVA 3EGDA 3KJIA 1ACMA 3C15C 3ENVA 3NBFA 1FDUA 2FDXA 4MW9A 4PAQA 3JVUA 1Q3HA 2GJ9A 4IX1A 5CH5A 1C9EA 4X45A 2AUNA 1SC4A 5I7RA 3JYLA 3K0AA 1TO6A 4US2R 3PGLA 5CXXA 3GVHA 1K4KA 4OMFG 1PNVA 4IG9A 1Q2UA 1RE0A 3PDIA 2XOXA 2ZRMA 2YMQA 1DOAA 2WUDA 3DWFA 3Q8KA 1QAOA 4A0FA 4DC9A 1C0PA 1OI4A 2A5LA 1KJQA 3L8EA 1MO5A 1RP7A 2YJ4A 1IXKA 3RTBA 5CFZA 3FBGA 2P9ZA 3LPNA 3WGGA 1LS6A 3CCFA 4Q3AA 5DM1A 1N25A 1CS4C 1T8RA 2J3HA 2P40A 3C6ZA 4OHFA 3TUIC 1R6DA 4P5PA 1OH7A 4Q4AB 1E0DA 4HLQB 3DDZX 3V4ZA 4WOBA 5AOBA 3DLIA 3I3OA 5IYZB 1YS7A 2AW5A 4BO8A 2YXLA 4NNJA 4XVRA 1LFDB 3LLVA 3PIDA 1N8SA 1P44A 3LRTA 4LZWA 4LZPA 1LDNA 5KVCA 3QLUA 3AQ4A 3K3PA 3A28A 3VVMA 1HYQA 1MO3A 5EIBC 2CLCX 4DLTA 4J3NA 4CCWA 1YFZA 1U0EA 2ORWA 3L8YA 4GFDA 4U7PB 1I4EB 1UWKA 1R6TA 4LOJA 2GD2A 5CLLA 1RLIA 3Q41A 1J8MF 1T0UA 3CW9A 3DLPX 4M9SA 1MH9A 4EKGA 5KYXB 4YBRA 4BN0A 4EHLA 4JGIA 4CG2A 3A9SA 3S55A 1DBSA 4FDLA 1JHYA 3TRKA 3DZIA 1XZ8A 2OCIA 5G41A 4QEKA 4EF5A 4UFNA 3ROEA 3FETA 2IYSA 4MGIR 3SYKA 1FFGA 4DABA 2NXWA 1CT9A 2RG7A 3VPFA 3VR6A 5CITA 4A0HA 4H0FA 5LZ9A 1DQYA 1ISHA 5CA0A 1G8AA 2O3JA 1S9HA 3CISA 2JFXA 2WWWA 2JLUA 1X1QA 2PRJA 1QIJA 3ZX5A 1NQWA 3EDOA 4GXQA 4YRKA 3MHTA 2ZBDA 3PSAA 5AI5A 3WGNA 5F7ZA 4CTKA 1JVBA 3ESDA 4YP0A 1SPXA 5A4IS 4ZJUA 2IZ0A 4AX4A 2O19A 2VF4X 3ND7A 1D1QA 5HKKD 5EJEA 4QZVA 4K9KA 3L7KA 3NEYA 4RY8A 4DY4A 4MV9A 2ID8A 4Q0MA 3L5OA 2B1GA 4TSRA 5JISA 1YZGA 5LZ8A 2X0KA 5FAKA 5ICSA 1OTXA 1P73A 2ZSBA 4OQQA 4EZEA 1B3BA 1DX9A 2FW8A 1VE9A 2APJA 1VFPA 1AQ6A 3CX6A 3PUXA 2C7BA 4FI3F 1UMCA 2YRXA 2VWQA 4HVAA 3INRA 4LDJA 5AOVA 2FSSA 4PTZA 4D0GA 5CB4A 3HA2A 5HKOA 2SKCA 4XB6B 1DT5A 2JATA 3I28A 4KPUB 3ZHYA 4WINA 5IU6A 1F17A 1NATA 3SU8A 1YS1X 3IA2A 1IIRA 3JQ9C 1ECBA 3M4YA 1PJRA 4C4ZA 3H11B 1FLVA 3A6PC 1YJXA 4LZJA 2C7VA 2E82A 2QXYA 2XBLA 2OD2A 2W2LA 3E1SA 3U17A 4C5BA 2AD1A 2IU4A 1YZYA 2VHZA 1UAGA 2ZUUA 1NNI1 4FFDA 4HTAA 3GLUA 2H5IA 4NNPA 4QU5A 4V0SA 4ZO6A 5BSRA 3KLBA 3WR5A 4EB0A 5J2TA 4JEHA 4M8KA 1IY9A 4IIJF 3JD2A 4H1WA 3SIPA 2Q3DA 2WJGA 2BBWA 1YNOA 3KVVA 3FMGA 4WQMA 3DVAB 1VHJA 1MENA 4M9ZA 1S2MA 1HM5A 3C4VA 2IIVA 1KP9A 4D45A 4JWTA 3UAVA 4BNIA 2VK2A 1S8FA 2HU7A 2R62A 1HY3A 1U2TA 2OLKA 5GZ6A 3K0CA 2Q0SA 1Z34A 2FCRA 3KCNA 5LOVB 2V03A 2YDXA 3HGMA 5JLJA 3NIFB 1SCBA 4TROA 4EGCB 3SJ7A 1O4VA 1LK5A 5TPZA 3AIIA 3GGOA 4RX1A 1G0NA 2JK1A 3T12A 4Z7NB 2DC1A 2QSUA 1RZRD 3EWIA 1MMFB 2V7GA 2W6JA 1YR8A 1M7HA 1AF4A 1L7RA 2VNHA 3FIJA 2C98A 5IK2A 4BGVA 1GNTA 3P9NA 5SYMA 2GDJA 1OI3A 4RPKA 1ONBA 5IW8A 2A1TR 2X7HA 2OR3A 2IZ1A 2GM3A 3JD1A 2XB6A 2DHCA 5LN1A 2REQA 4PHFA 5CT8A 4ECEA 3PGKA 1VCNA 2TMDA 4NMXB 4REQA 2WA1A 2FF7A 2Z09A 3B70A 1YV9A 5BSVA 5FBWB 1YF3A 3C0KA 5KOHB 1P29A 3JVEA 3S2YA 4RHEA 3K9QO 5K4HA 4ZRMA 5EKSA 3RE1A 4NJOA 4WUVA 3SZ3A 3OQIA 3N5CA 4XUDA 5LYYA 3OOJA 5EWMB 2YXNA 2IS1A 3KOWA 1FTSA 3BRWD 4Y8VA 3WAKA 3VUEA 5I4CA 3GJSA 4JFAA 1H05A 1W88A 4RANA 4Q3DA 4PO3X 3UJBA 2PUVA 2RG1A 2ZTMA 2A57A 1LVHA 2X3YA 3ZBUA 5JV5A 4BGEA 4KDFA 4KBGA 2UXDB 3NWEA 2DQKA 2POQX 2OUIA 3PQ7A 2JCVA 1MB4A 3QFSA 3C2QA 3QWBA 4WH0A 4DQDA 4RV9A 5CX4A 4LVNA 5I7UA 3KS9A 1E2NA 2D3TA 2XQKA 1CUJA 1L9KA 2JGDB 3AHGA 1J23A 1V9LA 3NHBA 2M9MA 2Q27A 4NL4H 4ZI7A 1JB9A 1MOQA 1ORHA 2VT3A 4PGFA 2EP8A 2JH8A 4MS1B 1I3CA 3FKQA 4OA5A 4DJAA 4RL6A 4PYMA 1RQXA 2IHKA 4KNYA 2R8BA 2R1VB 2H2GA 2P2NA 1I7DA 2W58A 1IDOA 5GWXA 1IZ9A 2ZDHA 3SHFA 3R9XA 1RAHA 3TLYA 1UPTA 3IURA 3MJFA 2RH9B 3Q6MA 4KP7A 4ZKEA 1NU6A 1A9RA 1KKLA 3E3OA 4ZQCB 5CVTA 4PC6A 4QHTA 5AUOB 1XB2A 5K0ZA 2WHYA 3K5HA 1MC4A 5C4IA 2VDMB 5HIIA 3AEKA 3WFIA 3EYAA 2G1KA 3Q87B 2YZ7A 4IJUA 4MRNA 3OM9A 2ORED 1R3UA 4N3BA 3DLBA 1HDCA 4W5RA 2R6FA 2MSWA 1I13A 4JBWA 3IEMA 2GXSA 3B52X 2DHQA 2J46A 1EB8A 5DXAA 3WLTA 4Y2JA 3BF7A 4KITB 1F2UA 1D4FA 1FW6A 3FPEA 3RKUA 3NUQA 4Z3KA 3W6PA 2QVBA 3VNVA 2RHGB 1L5ZA 5JBNA 3RPEA 1XZIA 2E1RA 3LCRA 2IITA 1KYZA 4R9RA 1P33A 2PBLA 2D2IA 1HR0B 4AI6A 4KHZA 2NO4A 3RQSA 3KETA 2HMWA 2QQ0A 4OO3A 3KO8A 1FVHA 3VZBA 5L40A 3TS1A 1J9GA 1FE8A 1V6CA 3UJCA 4FWTA 2JPDA 2QMHA 4CMBA 3DBRB 4JI2B 3QKRB 3JZDA 1NNLA 3NHFA 5HS6A 1YOVB 1PFWA 1TMYA 2H8GA 2PFSA 4CLOA 5AVUA 5H4GA 4ZV7A 1P62B 3G79A 4FOLA 4XWGA 3I09A 1XVTA 4FOPA 3EXIB 4A6DA 1JLKA 3UJ9A 3DEJA 5FBLB 2H1LA 3OCVA 4GF5A 1HKUA 3WLLA 3A25A 2HRZA 3EPJA 4HD8A 3PJFA 4WW0A 3PQ5A 5DFAA 2ZRAA 4IEIA 4NAVA 1U2SA 4GR9A 3DZJA 4KV7A 4ARZB 2ZRBA 4PR0A 4P35A 1RKXA 1RJWA 2XCTB 1TMOA 3GFTA 3OE7D 3LNTA 1I7PA 4QUIA 4AUMA 2C7QA 5KSOA 3KEQA 5KTNA 4RZ2A 5EESA 4X66B 2ODEA 3BEDA 2FN8A 3CRQA 3LYAA 1T9AA 3DW3X 1CZKA 3I5AA 3VKFA 2VRBA 3X2FA 2DBVO 1VLLA 1TKBA 2O5VA 3TNDA 2P9CA 2VTVA 2Q4DA 3LQYA 3QPWA 4KR0A 3TVYA 4RHXA 2HNAA 2C00A 2OILA 1C9YA 3A6FA 2JFOA 4MWDA 1Z5VA 3OVMA 4FYJA 4ZEXA 3INGA 4I55A 1Z4IA 2J41A 4JJFA 4D26A 3FWYA 1FP4B 1UOPA 3NCHA 1K8QA 3SIWA 4UJ5A 4MNTA 1O6BA 4UUNA 4C43A 1Q14A 3CUSA 1E2HA 4JAVC 4UQOA 2VQFB 1AOXA 3ETJA 4L8VA 1NRIA 2ZWOA 2H57A 1VHDA 4E11A 1AHHA 1CY4A 5IWAB 1C2YA 3P26A 4W5HA 4V3CA 3FUVA 4XZ3A 1SKBA 1U6KA 1G55A 4UNSA 3GLIE 1UJ4A 5DCLA 2R6R1 4NE2A 3S28A 2V0NA 4HJXA 3THRA 2FZ5A 4RK4A 2CXPA 4LFBB 2YYAA 1L8QA 2IA5A 1Q1EA 2HSDA 4LCEA 1KAMA 4UM5A 3MTIA 1KDOA 3DFMA 3LWDA 4MO2A 1E7SA 2COUA 4QDXA 5TF4A 1FQKA 4LYYA 1DARA 1W19A 3U4QB 4OB6A 3IO5A 4YP1A 1MQ8B 3SFZA 3QEBZ 3EG9A 2QP4A 5BQ5A 2AW3A 4RIHA 5FJIA 1U6IA 4X7BA 5B3AA 4DIUA 4QPDA 4ZVLA 3TGWA 3T94A 1Y3CE 2EFCB 2P69A 2QTCA 1LLFA 5LQMA 2N0SA 1FP1D 3BE6A 1A9QA 2QU8A 5KQRA 1H3NA 2FFRA 5ULLA 1W9MA 3HWRA 1XTSA 2Y71A 4TL8A 5I7HA 5FNVA 1UK7A 2H1FA 3L92A 3FCUB 3U16A 4O4LB 3BCUA 3D64A 1JQDA 3FWHA 1Z06A 4KE8A 3WC4A 1SVMA 2ZU0C 3FMVA 1E2DA 3ZWNA 4MGZR 3PD7A 4XTRA 4F6LA 3V4PB 4YIKA 4YAEA 3VNAA 1U94A 3D1VA 1JNXX 4JLOA 2YW9A 1DV2A 1USWA 3VBCA 3ZWOA 3MJCA 2NU9A 2A14A 3S7TA 5A3VA 2JF0A 1EINA 1N0UA 2QN3A 2NPOA 3H4MA 5DNCA 4ZVSA 4MITA 4Q3KA 3EEOA 3BHJA 3RWMB 2F3TA 1QVZA 1QR6A 3AU8A 1O9BA 4R1QA 1XQ6A 1SK8A 1TF7A 2L0XA 2XT9A 1U9ZA 1RACA 3D7LA 3V1LA 5J5CA 4RTNA 1UK6A 3IVAA 4FCWA 3RWOA 1ZM3A 2UU9B 3CVWA 4TQUS 4ZQEA 5FULA 5EQFA 2VWHA 1BQEA 2XA9A 4QARA 4HDCA 5EKDA 3U44A 1A5ZA 1JR3D 4DNFA 5DGIA 3QTLA 2AZTA 4K03A 2CE2X 1ONSA 3OD5A 1VE3A 4U4AA 3MWGA 1XZJA 4GWGA 3RASA 1FP6A 1W93A 4JBLA 1SG9A 1KY4A 5KO2A 2AN3A 4LF9B 4D74A 1JLLA 1AKTA 3STTA 2FPIA 3R7FA 4KVZA 1WMSA 4ENPA 3DOOA 3OQMA 3NUZA 2R6JA 3GDFA 2I7VA 4UTZA 2H00A 3KJGA 5AICA 4ZC1A 3FZGA 1YKFA 2VTDA 4KIFA 1XD2A 4FJ0A 5LP1A 2HA4A 4PG8A 3M6FA 1SCDA 1GQYA 1VM6A 4M7WA 1G0OA 2QJOA 4N12A 5CPBA 3IMEA 1QIIA 4R6WA 3Q1KA 2G63A