5D1HA

Crystal structure of the 16s rrna (adenine(1408)-n(1))-methyltransferase w203a mutant from catenulisporales acidiphilia
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
204
Chain Sequence
b'TALKVLAGKKLTDLDPDEWAKAQASAERILVDVGTGDARTAYRQAIAHPEWLVVGVDPAWQRMTETAVRAARKPAKGGAPNLVLVSSAIETVPAALHGVADEVMVLMPWGKLLRGVVLGEADVLSGLRAVAKPGAPLEISIGTSIWREPIPLEIRDLPELTPETVVSTGLTDRLAALGWQVADVRLVPTETVLHLRAVAVDPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Functional dichotomy in the 16S rRNA (m1A1408) methyltransferase family and control of catalytic activity via a novel tryptophan mediated loop reorganization.
pubmed doi rcsb
source organism Catenulispora acidiphila
molecule tags Transferase
total genus 61
structure length 204
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5d1hA00
4YUVA 2ZIEA 2ONYA 3OU6A 1NW5A 3KHKA 1RI3A 1M6YA 4R8SA 2XBMA 4GOMD 1F3LA 5EQJB 1QAOA 3GRZA 5JR3A 1RI5A 2ZCJA 5LQUA 1G55A 3KQWA 1O9HA 4GBED 2IGTA 4HTFB 1R8YA 3P8ZA 5DX1A 4CTKA 3T7SA 3GRRA 1QZZA 2PY6A 3GRVA 5FHQA 5K8VA 5CCBA 3LL7A 2PT6A 2AN3A 3G2QA 1KYWA 4CTJA 9MHTA 3PVCA 3O31A 1G8SA 5H02A 1IXKA 1G60A 2CMGA 4X61A 2YUIA 1FP2A 2PX2A 4M7RA 4E31A 1AQJA 4M38A 3UJAA 4ISCA 3DR5A 4F84A 1KXZA 2EFJA 2O57A 3LCVB 3ELWA 3FUTA 2PKWA 3UJ6A 4HGZA 5K0BA 5EZQA 3QOXA 1XJ5A 1P1CA 3E7PA 3EGIA 5GWXA 1EJ6A 3KPUA 3TOSA 1TW3A 4DMGA 5KYGA 1I4WA 3MCTA 3Q87B 1WS6A 3A7EA 1FBNA 1WY7A 3DULA 3NW9A 4PIMA 5DXAA 1FP1D 2BR3A 3C6KA 1X1DA 3AXTA 3HEMA 3CC8A 5EMMA 3LECA 1L3CA 2AOXA 5DM1A 4CXMA 2IIPA 3UJ7A 4C07A 2G8NA 3BWBA 2R3SA 1WG8A 3EPPA 5FHRA 5DTRA 4DZRA 5E8JA 4IV0A 2R6ZA 3BT7A 3GJYA 5DM4A 4X63A 3JWIA 4RVFA 2UYQA 4RVGA 4BLUA 4DKJA 1G8AA 1ZGAA 2AOTB 4PNEA 2C7QA 4LWPA 4PIPA 3GU3A 3HCAA 3LGAA 3M6UA 4R05A 5EOVA 5K0GA 1AV6A 2QRVA 4DM3A 3KPJA 1G38A 5KVAA 2HNKA 2OY0A 4LECA 5EMKA 5IKMA 3SXJA 5K01A 2ZZNA 2Z6QA 3AJDA 5E9QA 4BP1A 3H2BA 5DPMA 1U2ZA 5P8WA 3R3HA 3OU2A 1I9GA 5E9WA 4YMGA 1AQIA 3LCCA 2B3TA 1VLMA 3MAGA 4WVLA 5EGSA 2FCAA 4P58A 3FPHA 1JG1A 2EX4A 3B7PA 3GGDA 4C05A 5GINE 3UJCA 3MB5A 1RJDA 3KKZA 5F2OA 2PBFA 4HTFA 3DXZA 2IDJA 2P40A 3V8VA 4RTOA 2P1DA 3VSEA 2AOUA 5EEHA 4YUWA 1V39A 3EVEA 2CL5A 4A6EA 5EG5A 2AS0A 2H00A 5U4XA 3KR9A 4RTMA 4RTLA 5T6BA 3EGVA 3HCDA 4PYLA 3KQTA 4PONA 4L7VA 2OZVA 3EEYA 3DXXA 3HVKA 2PV0A 3NMUF 4WXHA 2ZLBA 3A27A 3CGGA 4C06A 4R8RA 5CIYA 1M6EX 3KR2A 3KQOA 2FK8A 4MTLA 3GO4A 3RW9A 3G2MA 4KIGA 3JWJA 3OU7A 5E2AA 2N47A 2XYRA 4B17A 2HWKA 3TM4A 3I58A 5HIIA 1D2CA 3LKZA 4GC5A 3EVAA 4E2XA 2G70A 5E1MA 4XUEA 5HEKA 1JR4A 4RYLA 4C4AA 4YV2A 5ICGA 1ZKDA 2ZZMA 5GM1A 4OQDA 5DRYA 4ZTBA 4DQ0A 4HGYA 3OPNA 1HNNA 3SSOA 3TFWA 5GM2A 3LBFA 2IH5A 4XUDA 3MCZA 2GB4A 2OB1A 3EVBA 1B42A 1Q0SA 1QAMA 4GOLD 5DTMA 5E1BA 5K0NA 4ER5A 2YQZA 1D2GA 3QOWA 4HH4A 3DUWA 4NECA 2PJDA 4OQEA 1QAQA 2PX8A 2YTZA 3NTVA 4PGGA 3UWPA 10MHA 3HM2A 2WA2A 4Y30A 5ICCA 1HMYA 2AR0A 2VS1A 4E2WA 3KR0A 2P7IA 5ERGB 3BZBA 4ATNA 3M6XA 3KPWA 3NVMB 3PX3A 4H0NA 4G56A 5ICEA 3FTCA 1VIDA 4YUYA 2G71A 3EVCA 3P9CA 1ORHA 4KRGA 3T7RA 3LSTA 3K6RA 5D1HA 4PCAA 3BGIA 4RTPA 3FPEA 4EKGA 2YXLA 5EEGA 2ONZA 4QDJA 3REOA 2O07A 4C08A 2E5WA 2NYUA 3MTEA 5HILA 3FZGA 4FS8A 5ICFA 4ER7A 2QM3A 1VBFA 3B89A 3UJ9A 3HCBA 1JQDA 4QPPA 1XDUA 4E30A 3SX0A 1IM8A 3GIWA 3LPMA 4FR0A 4POOA 3QV2A 2IBSA 5BXYA 5LQJA 1KP9A 2PXCA 5HFJA 2PXXA 3G89A 4M36A 2AOWA 2AOUB 4EQZA 2V7EA 2KW5A 3SM3A 1NBHA 5CD1A 2DPMA 2GH1A 3IEIA 5B1SA 1NW6A 4C03A 5BW4A 4UOEA 3PTAA 4RTSA 4YV0A 4XCXA 3TKYA 4GF5A 2FHPA 3MERA 1QYRA 2PLWA 4OA5A 3O4FA 2YXDA 2B9EA 5D1NA 1EG2A 3TQSA 3X0DA 1BOOA 3I64A 2FK7A 4AZSA 1JSZA 2UYCA 5HIKA 5M5BA 1FJXA 3SGLA 1UFKA 4P7FA 2K4MA 1SQFA 1RJGA 2JHPA 3C3PA 3CVOA 3FYDA 3HNRA 2Z6AA 3P9NA 3CJQA 3C6MA 2ZWVA 5FCDA 1NW7A 4CKBA 3A4TA 3DLCA 3EVFA 4GEKA 4QVGA 4RX1A 2ESRA 3GNLA 1N7IA 3K0BA 3VYWA 1T43A 2QY6A 2EJTA 5DXJA 4RWZA 3AY0A 4XUCA 3JWHA 3UZUA 1JQEA 2PWYA 2GA9A 2EJUA 2P8JA 2O06A 3BGDA 3GWZA 3THSA 2VZ9A 2JH8A 2BH2A 1EQAA 3VC2A 3LDFA 5FQNA 3BXOA 4AX8A 5LR6A 2C7RA 1MHTA 4RVHA 3SSNA 1N2XA 4FSXA 2PWPA 2YR0A 2NNWB 3DMHA 3G88A 2DULA 1XVAA 4OBWA 4M37A 5CVJA 5JUWA 4FT4A 3EVGA 2IH2A 5K05A 2IFTA 3KQSA 3DOUA 2NXJA 3B5IA 2OXTA 3TM5A 1R74A 2PX4A 3OCJA 5FA5A 2PSSA 5CVEA 3A26A 5GOZA 4YUZA 2OB2A 1PRYA 2FPOA 3DH0A 4IKPA 5F2NA 2NP6A 3BWYA 3ID6C 1INLA 3FUVA 2IBTA 3NWEA 5K0CA 2BZGA 2ZBPA 1P39A 4P7KA 3T0IA 2IP2A 1NE2A 5E1OA 2PVCA 4IV8A 3DMGA 2ADMA 5LQKA 1XDZA 5FADA 1DCTA 3GCZA 3L8DA 4GOOD 2H11A 3P71T 5LQNA 3PT9A 3E8SA 3A7DA 4JXJA 4KDCA 1XTPA 4QQNA 4MHTA 3ELUA 3GRUA 1KR5A 2JG3A 3FUUA 4BY9E 3DMFA 3HTXA 1WXWA 3FTDA 4KW7A 1VE3A 1X1CA 2OBFA 5EMJA 3SR4A 3E05A 2GS9A 2NP7A 2AVDA 2PT9A 1OR8A 4DA4A 3HCCA 2PXAA 3G8BA 4F85A 5T64A 3GRYA 3BWMA 4PGHA 2XVMA 1YZ3A 4QPNA 4CWAA 4CKCA 3NVKI 1ZQ9A 3THRA 4AZTA 5KQSA 3B3JA 4R6XA 5LQAA 3AXSA 3LDGA 1DUSA 3E23A 3LDUA 5DLYA 1QANA 1Y8CA 1BC5A 1ORIA 3M4XA 2HR1A 4P7GA 2BR5A 2FYTA 5DX8A 1KYZA 7MHTA 5DX0A 1ZG3A 4EK9A 3D2LA 3HA7A 3KQPA 3S68A 3LCUA 5FUBA 3KU1A 4PYQA 2Y1XA 1YB2A 3U81A 4AZWA 5E8RA 4X60A 1NT2A 2AZTA 4V0RA 4FT2A 1EAMA 4PWYA 3JWGA 4X1OA 4V0QA 5K09A 5EC8A 4ER3A 3I5UA 5FWDA 2I9KA 3HVIA 3G2PA 2QYOA 3KQQA 3FPFA 3IV6A 2AN4A 2JJQA 3MQ2A 5DSXA 2CWWA 4PYJA 5K0EA 2UZ4A 5EMLA 3IHTA 4MQ4A 5G02A 3CBGA 5DWQA 3B3GA 4HSGA 2OO3A 1TW2A 3KQVA 5DM2A 5EKUA 1YFJA 1NV8A 1R8XA 3P2EA 1YF3A 2Z6UA 4RVDA 3FRHA 3P2IA 3SMQA 1VP9A 3ORHA 2CMHA 3NDJA 1MJFA 3P97A 1H1DA 4EKIA 4RTKA 4PYNA 4KWCA 1P91A 3Q7EA 1N7JA 2XYQA 3M6WA 3NDIA 3R0QA 1NBIA 4HG2A 5EVJA 3LKDA 3UFBA 4U7TB 2IPXA 3CKKA 3UA3A 3M70A 3FYCA 4LWOA 3KR1A 3FPJA 1JSXA 1VL5A 3PB3A 3BUSA 2H1RA 1SUSA 2QE6A 8MHTA 2GLUA 3G2OA 1O54A 3OZTA 4LG1A 5F2KA 4YMHA 5HZMA 2BM8A 3OZSA 2G1PA 3HA5A 1NV9A 1SQGA 1XXLA 3BKWA 1X1BA 1JG3A 2I7CA 5EHIA 5EHGA 1NW8A 5HIJA 1P1BA 2ZW9A 3NWBA 4RV9A 2OKCA 1UIRA 3G7UA 5DTQA 2ZZKA 3V97A 4K6MA 2YX1A 1VP3A 2ZIFA 1KHHA 2BM9A 4RSRA 1KPIA 3CCFA 4FGZA 5GIOE 1KPHA 4RTJA 5GIPE 1YZHA 3MGGA 3TLJA 2XVAA 5IH3A 5CM2Z 1RJEA 3OFJA 4EVIA 3PX2A 2P7HA 2P35A 2ZTHA 1D2HA 3TRKA 3UBTA 4FP9A 2ZIGA 3DP7A 3O7WA 4PYMA 3KQYA 2I62A 4GUAA 3ANXA 2ZBRA 5CVDA 5EZSA 1KPGA 3NJRA 4OA8A 3HA3A 3P9KA 2BR4A 3R9XB 2ZSUA 2EG5A 2VDVE 4R6WA 2F8LA 5LQRA 1PJZA 4BLWA 1YFLA 1UWVA 5CVUA 4PYIA 1G6Q1 3FTEA 5MHTA 4C04A 4DCGA 4ER0A 3TR6A 5KS2A 3M6VA 4RTRA 1ZHFA 3BKXA 1Z3CA 4QVKA 3DTNA 5EIFA 4QDKA 3EEOA 5DSTA 3CJRA 2WA1A 3A25A 2GPYA 4KDRA 4BP3A 5CUQA 5KQRA 5FULA 3OE4A 4QQKA 4RTQA 4U7PB 5EPEA 3EGEA 3HVHA 1VPTA 2PGXA 3DLIA 4MIKA 3HVJA 3KPVA 3G5TA 2AOVA 3ER8A 2ZWAA 3R24A 2PX5A 3I9FA 1R00A 4A6DA 2B78A 5CCXA 2VDWA 5GP1A 1NW3A 3TPZA 4PINA 3TKAA 2UYOA 4AZVA 2ERCA 5BW5A 4Y2HA 5EKXA 1RI2A 3PFHA 4HC4A 3ER9A 4FZVA 5FQOA 4DF3A 1BHJA 3FRIA 3M33A 3TMAA 4YV1A 2LD4A 1O9GA 2O05A 3HP7A 1SKMA 2XYVA 3ME5A 5LSAA 4Z2YA 3SVZA 1L1EA 1SUIA 3ERCA 1RJFA 4E32A 5BP7A 4KIFA 1DL5A 3OFKA 2P3QA 2JH9A 1XDSA 3IYLW 2O0LA 2YVLA 3I53A 4KVZA 5K0LA 1VQ1A 5FTWA 2Y1WA 3GDHA 4FSDA 3UA4A 3MHTA 3GXOA 2VP3A 3BGVA 3OE5A 1JG2A 5E1DA 2AN5A 2C7PA 3UJ8A 1JQ3A 5K0FA 4RTNA 1R18A 1FPQA 2ZVJA 3EMBA 2OYRA 3SSMA 4E70A 3RODA 1WXXA 3AWIA 5FA8A 4BLVA 4YUXA 5DT2A 5K03A 1YUBA 2P3LA 5EIWA 4P7JA 3HCEA 3FUWA 4AUKA 3PS9A 3F4KA 2ZULA 2I6GA 2ZFUA 2ORED 2GAFA 2IDKA 4GQBA 5HIMA 4MWZA 4DCMA 4CKEA 4GOND 2WK1A 3LHDA 4F86A 1L3IA 5K0JA 4ER6A 4E2YA 3G8AA 1R6AA 3PFGA 5C0OE 1AF7A 1JTFA 3RIEA 1ZGJA 3FUXA 2P3OA 5DRTA 3B3FA 2ZBQA 1XCLA 4PYOA 1IY9A 2VDUE 2NXCA 2HTEA 3ELDA 3PLAE 2CKDA 1TPYA 3HCFA 3P9IA 5LQCA 1M0EA 3C3YA 4E33A 1SVUA 4OBXA 5T67A 5C1IA 1RI1A 2OPBA 3KQMA 2JHAA 1EIZA 3EMDA 1JG4A 5E2BA 4PCLA 2G72A 4IWNA 4O29A 5C9ZA 2B2CA 4HRAA 3BWCA 1L3BA 5DM0A 1JTEA 4QTUB 1I1NA 1KIAA 2P41A 2Q41A 1F38A 3CJTA 4EMSA 2UYHA 3FPGA 3LX6A 3P2KA 3OZRA 3VC1A 2AOTA 3C0KA 2A14A 4OX9Y 2B25A 2AVNA 3UJBA 2HV9A 4PYKA 1L9KA 3LBYA 3FTFA 1XCJA 2NXNA 3DXYA 2QRVB 2YXEA 4X41A 5CVVA 5E9JA 2HMYB 2FRXA 3EVZA 1X19A 2NXEA 3MTIA 3T7TA 5HOQA 1X1AA 2C7OA 5FWAA 3R6TA 1EJ0A 3ELYA 2JHCA 1RI4A 2IH4A 1BKYA 2V74B 4GC9A 4QTTB 4E2ZA 1SG9A 1WZNA 3EVDA 1Q0TA 3WSTA 3KPYA 1NKVA 3G5LA 3UJDA
chains in the Genus database with same CATH superfamily
1YUMA 2PWBA 3QW2A 5ALJA 3F3SA 4ZQIA 3LQFA 4PPYA 4B73A 3A2NA 3CM0A 4CEJA 2AWNA 1DIHA 5IX8A 1LWNA 2C8KA 1AGPA 1L7AA 4GM4A 5LP6A 3F5FA 4DABA 2WUDA 3TLCA 1ZD2P 2V59A 1WAMA 3ZY5A 1QYDA 1R9NA 1FTYA 3OHMA 5FF9A 1EX1A 2HJ9A 4NKRA 2QJOA 3JASB 4URZR 3MGCA 3IKVA 2FCRA 1FMTA 5ESXA 1JFFB 3E3OA 4NZ9A 5LQMA 4XDZA 2VTDA 1F14A 1JKJB 1Z37A 1K9VF 3OJFA 3QWFA 2ZIWB 4XD2A 3EEIA 1TJYA 4BECA 2ZPAA 1BJRE 3TW8A 2PU5A 1UPTA 4OJQA 3DR5A 3T3EA 1BMFD 5L45A 3IJRA 2XGOA 5HF9A 3L7NA 3R3UA 3UK7A 2Q3HA 2VJLA 3QLVA 5IAGA 1BYIA 4KUHA 3ZE1B 3UK1A 4F72A 4EDHA 3GZTB 1EJ6A 1L8AA 2SCUA 3ED5A 3QKIA 3EXIB 3BYZA 3MCTA 4BKUA 3FWYA 3RYCA 821PA 4Q3EA 4A26A 2Q1TA 8ATCA 4LY9A 1WCV1 1ZM4A 3B9RA 2XOKD 4OXIA 4I2VA 4C0SA 5AKJA 5C5DA 5C8YF 5ALTA 2B8TA 3HJUA 3JZAA 1RRCA 2F3RA 4K9DA 5J4VA 1OX5A 3NH6A 1IG0A 1ZIXA 5FT9A 3CUTA 1CWUA 3EPPA 3ZY3A 3NP7A 4FIZA 4DUGD 2UUBB 1DEKA 4J43A 3VZRA 3KIPA 4TYMA 5A9TA 2VJBA 1PFWA 3ECAA 4E13A 4GLJA 5LIRA 1WETA 1R6BX 1OLSA 1Z7EA 3N0XA 3NIBA 3SXPA 4CUZA 3M6UA 4KI7A 4ROTA 1IM5A 3CX6A 1JHDA 2VNKA 1D6NA 3N28A 4OHWA 4RACA 4RFSA 5EZYF 4ZGGA 7REQB 1HDIA 3L4JA 4YJHA 3LH5A 2FEWB 5DPMA 5JNWA 4CMKA 1TAQA 1C2TA 1A7JA 2VPTA 1LI5A 2NVBA 2DR3A 3IUMA 5T4HA 2VH2A 2NZ8A 3AQ4A 1QVZA 1PS0A 1A8HA 3QVKA 1U4NA 5ALWA 2YQ5A 3JQ7B 3MBIA 4R3NA 4AKSA 2EX4A 2JH3A 4YJDA 5AK0A 3SNHA 1FSPA 3M3HA 2IXBA 3EEBA 5KWEA 4YRBA 3U9TA 3U3DA 2FPRA 2IUYA 1JALA 3T38A 4ABYA 3P27A 4JIMA 1BS2A 1N92A 1P0FA 4FDMA 3WB9A 1JA9A 2RHDA 4CLOA 5DIFA 2CVHA 5BMVA 5MN6A 1E2DA 1LLFA 3ETJA 4BVEA 1COZA 1GWNA 1SVWA 1FK8A 2X0FA 4KQCA 1P0MA 1W4RA 3QMMA 1M1YE 3HCDA 1II0A 3NBMA 2DH6A 3SYTA 5EPOA 1O7JA 4H7PA 3LLCA 1QB8A 1I33A 4HXYA 2UVDA 3TQFA 3A27A 4DWWA 4II2A 1V35A 3KQOA 5DGIA 2HHJA 2HJSA 2P5YA 4OFWA 5DDIP 3TNFA 4GXNA 3D4OA 4RK5A 4MGYR 1HDGO 2RBGA 4X1KA 3EWSA 1JEYA 1LQTA 3RRJA 3ZQUA 4IIDA 4BDSA 2VUSA 5M2QA 2CJXA 1RZ3A 2ETVA 5K6RA 1SA0A 4QAQA 5FUXA 3DOHA 4MQUA 4MIYA 1L4KA 2VZ0A 4TVOA 3HPQA 4KQ2A 3WS7A 1A2OA 1YQTA 3FN4A 1VCNA 4K6OA 2QENA 2W6IA 1OWLA 4HX2A 3S7ZA 4S1VA 1RP1A 1A04A 3E9NA 3HY6A 4HSEA 1VPWA 4HH4A 2BMJA 2IY8A 3NTVA 2FPGA 3AV3A 4I19A 1GCOA 2A9QA 4KN6A 1MEOA 4Q7LA 1Z0SA 1PGQA 3VYTB 4EB0A 4W1RA 2P7IA 4ATNA 3C3CA 1PR9A 3M6XA 4B44A 4PZEA 1YQQA 1O03A 2L19A 2JRLA 1NBAA 1ORHA 1QBGA 2BMEA 4LWQA 2VRCA 1ZPDA 3QK7A 2ZTMA 4IHJF 3H11B 1XQYA 1M1NA 4OREX 4C08A 2Y1KA 1G20E 4Q37A 3PC8C 3FZGA 3OZAA 4O3FA 3MB8A 1DQPA 2QE7D 1RHQA 3E15A 2G9ZA 4KO8A 4PG4A 1O96A 3WGTA 4DJDC 2VTEA 4ARUA 4LSWA 2BGKA 5AK5A 1FYWA 1NZDA 1CDEA 1OA1A 4KR2A 4IIJF 2Q3DA 3QKTA 3UXHA 2DC1A 4WN9A 3C24A 2JFXA 2PXCA 4JBNA 4KO3S 5T6MA 5CH3A 3VISA 2B0JA 2R4QA 1SZPA 3EG9A 4GLLA 5EXEA 4PG5A 4O1IA 5DLEA 3KD3A 5LOVB 1T35A 1KI9A 4CMCA 2F1HA 2D1YA 3SM3A 3V8RA 1ZLXA 1JLRA 4K9LA 1JU9A 1RZVA 4ITVA 5B1SA 3DHWC 4LYDA 4HLQB 4M0UA 3FDFA 3QKSB 4U0KA 1QIKA 2YWDA 1EFUA 4RJJA 2FSVC 2PLWA 3DDOA 2OD7A 4LPKA 2AIRA 5JSQA 3GJRA 3QUQA 1D9XA 1ZO8A 5KHLB 2ZTLA 3SY8A 2IEDA 1HQKA 3T1YB 1VXOA 3AJ8A 1Y4DE 3PDWA 4OGLA 2DBVO 1VZ2A 4G25A 3AM4A 3QYAA 1W9MA 4G1BA 4HCJA 3WLEA 2GDJA 1CBUA 4QVGA 4UHJA 2VQFB 5FUQA 2F1KA 3LO8A 3JD3A 4U7DA 4ZJPA 1T43A 4GPZA 3QU9A 4UE2A 1D04A 1L4LA 1CUUA 1RSZA 3WNCA 4A8JC 4EA9A 3PX7A 1DGQA 5G4KA 1JQEA 1R9MA 4GXTA 1UJBA 1YFKA 3JQPA 2PEYA 2WQ7A 2CZCA 1CZRA 3MRTA 2QIOA 3LWZA 2G17A 2ZUSA 1QOQB 1Y9ZA 3GJ3A 5G0VA 1B2RA 1P2DA 4ZYLA 2WWIA 1BXGB 4RW0A 1MZVA 1JIUA 2IE8A 2XWSA 3N0WA 4OGFA 2G1UA 4QL3A 5BO5A 1CUJA 1VMKA 3E22A 3OEED 4CMIA 2IFTA 4JGGA 3FDZA 3AM1A 5EXPA 4TV8B 1Y33E 2RHCA 1A2KC 2D4AA 2I7TA 2ATXA 2ZAIA 3D3WB 2OB2A 2OR3A 3IUEA 4IKPA 4RK4A 1KA9H 2A1TS 3GCWA 3ID6C 3GZNB 1CFJA 5GZ1A 3VV2A 5L6MB 1YIOA 2BHLA 3P20A 1Z15A 4TN1A 1W4ZA 2HT6A 2CGEA 5JFOA 3PEWA 3GCZA 3G49A 3IDSA 3BORA 4X8LA 4ZJYA 4DL9A 5KX5F 2O8DA 3KALA 2Q4TA 4U7JA 2XNHA 4NLLA 5J40A 4Z4HA 4HXGA 1G3QA 3N05A 4JP3A 2IKSA 1ZW6A 3B70A 3SR4A 4R71A 4C0LA 5AVZA 2CBXA 1WVIA 1SY7A 5FP0A 3VOTA 4Q39A 3VR6A 4YHBA 1HEIA 3HZZA 3KKOA 1RKBA 1CR0A 4MGZR 1NBME 1P9NA 4ZCLA 4QPNA 3J7AC 1N2HA 1XZBA 2I7DA 4LRTB 3THRA 3IAS1 4ZVMA 4MV9A 5EP4A 2A3NA 3WYDA 1KK1A 2ZB8A 4P93A 1NYRA 1XLUA 3G2NA 3KKLA 2ZRLA 2O3TA 4MVWA 2WJYA 4K2HA 2FYTA 4C3VA 4YRSA 1KYZA 2IU4A 4KU4A 2DTXA 2PZMA 4WLVA 3WLMA 1SH7A 5EVCA 4PLCA 2EEPA 4FW8A 1JF8A 2IT1A 3SIXA 3ZDCA 5EGNA 3TX6A 3CUUA 3WGUA 1YK0A 2BMVA 2HSGA 1J5PA 4G1UC 4PZ9A 1VPVA 2ODTX 1E3JA 4J7UA 4KSYA 4V0QA 1CIPA 2P6UA 2X23A 3AKEA 3AHGA 4DZTA 1HFKA 4MW2A 4PYJA 3EPJA 1LDNA 3SDZA 3IHTA 4QXOA 4EUSA 4WNAA 2VLBA 3EMVA 5FB3A 4MS4B 3H8SA 3G9UA 3UWDA 1N0IA 4KZPA 4W5OA 3NHFA 4O8CA 5HMMA 3GJSA 2AQKA 3RK1A 6LDHA 2PH3A 1JI0A 1G8FA 3STUA 1MO3A 4NYMQ 3M70A 4F8YA 3R7WA 1XJ0A 1M7BA 4GX5A 1PJQA 4NBWA 2NV2B 2PGIA 2QRUA 1A8QA 1BJKA 4ZV7A 4LJRA 4MAMA 2VUTA 2DYKA 3B1XA 3ENZA 4YS6A 4RMGA 5HZMA 1ARZA 2FFQA 4OAQA 1II9A 1XAJA 1NL3A 2OZLB 3I4LA 1Q84A 5F78A 1H0SA 3UANA 3B8HA 2QQFA 3HXOA 3BRWD 5FBKA 1J23A 1JE1A 1ACMA 3F96A 4BBJA 1ZJWA 1NQOA 3ZJ5A 3OZIA 3ZWXA 1H4SA 1M34A 4RPGA 1WUHS 3ZE9A 1YK1A 3DNPA 2AEJA 5I7WA 1Q20A 2YW2A 5CFPA 1U65A 5IBCA 5B1YA 4JSTA 2ZRHA 3RHFA 3QFHA 2ZJ4A 3B1WA 3E1GA 3R40A 4RZQA 4W5WA 3VMFA 8ABPA 2XVAA 4N6GA 3OESA 3OQHA 5CM2Z 3R3SA 4DT1B 2IPAB 1ULHA 4MDEA 2ODQA 1EK5A 3I9MA 3JYOA 1CUBA 3DP7A 5LXTA 3KQYA 2I62A 4TV9A 5LUBA 4ARIA 5C3UA 4CDRA 1DIOB 4PO8A 4ZZ2A 4TSFD 3K70D 3W1WA 4JLWA 4EOGA 5MN4A 3OD1A 4L3VA 4KVGA 2JA1A 2V4MA 5MHTA 3ROMA 3CUWA 2VHJA 3OP1A 3UIEA 4C04A 4NMHA 1ZD4A 2WMDA 2X76A 3E2MA 3RBAA 4WI1A 3LFTA 3W3AH 1WVMA 1ZXXA 5AXBA 1NI4B 1WXHA 2O8VA 1KIFA 1N3LA 3BJMA 1ML4A 3OFNA 3R3XA 4W5HA 3DTNA 3PDIA 3VR5H 3GFVA 3WA6A 3EEOA 2P2NA 3MOSA 2UVPA 1K2VN 5HG0A 4B3BA 3KJIA 2VSNA 4FZRA 2RKOA 4QLAA 1H5UA 1YKSA 5FULA 3L04A 3BMQB 4QYWA 3WGHA 5JAZA 4JU8A 1H9AA 4JJFA 1UBTS 3ZNQA 1QOZA 1QK5A 2ZDGA 1DBSA 3D7MA 1KTIA 4MIKA 1KVUA 4K46A 3ESQA 4YRPA 2IYYA 4Q1FA 5DTJA 2ZWOA 1Z33A 4GP9A 4HAZA 5AK6A 1RR6A 2G77B 5C8VA 1S3IA 2Q9UA 4YAOA 2XNJA 4HH0A 5U1PA 1D2MA 2VA9A 1NZJA 3IKLA 3CLRD 1MOSA 1ODIA 4HC4A 2IYQA 4EF4A 5GQSA 1TZBA 1LSUA 3M3PA 5BNWA 3SC4A 2QSUA 2JKYA 3K0SA 5KQGA 1TPZA 1C0LA 5IAJA 2GD2A 2ZXFA 1JEDA 1XSEA 3RH0A 2OGTA 3NTOA 1HOXA 1UC4B 1XRSB 4JT2A 3P9SA 3RU7A 1MKYA 1SVMA 1DG1G 2YYYA 3SZOA 1T1SA 2FHSA 1KEPA 5CLHA 5FH9A 1XA0A 3VSDA 1UBGA 3UG6A 3GAFA 3PFFA 3UJ8A 4H4CA 1I3OA 4ZXPA 2E4WA 5KQPA 4K2AA 4AZ3A 3WSWA 5AKLA 2XRZA 1TFUA 4YV7A 1Z29A 3LKVA 1AK9A 1NIPA 5BUZA 1T3TA 2VBIA 3UFXA 2JZOA 3AP1A 4DFDA 1OZ0A 3JQGA 2CVQA 2A0FA 4HDKB 3L82B 4EDFA 3KAJA 3NKVA 4S12A 4Q3NA 4HDNB 1U1FA 3KT6A 5CYOA 4UXIA 3ZCUA 2DAPA 1VXRA 1RD4A 3FLMA 4XXHA 4FYWA 4XRGA 2ZJAA 2EYUA 3M5DA 3HMKA 1ZR4A 4D56A 1ILWA 1BWSA 4CT5A 4IKOA 3ZDXB 3UHPA 2CT8A 221PA 4EG8A 4UQOA 4FYIA 3AUAA 4GDFA 4NQZA 4IW3B 1IHYA 2GNPA 2PD4A 4O29A 4BGUA 3MEQA 2GHIA 1AUQA 1LSJA 2DUWA 3TE6A 1E3EA 3B20A 3OCYA 2GJ8A 3WLIA 2D3WA 1EWKA 1UJMA 3DDCA 4TWBA 4WLOA 4MR7B 3PXAA 4RD6A 5JS6A 5TDHA 4MH0R 3FPGA 3MT9A 3KXPA 2VDOB 3RJ5A 2NG1A 2AMVA 3QVGA 1RAFA 1Z6XA 2RHGB 3OF3A 2Q6TA 4H6WA 3T4XA 3OCZA 4DDUA 4PYKA 1JWAB 1L9KA 3LBYA 3KT8A 4ZQHA 3QHQA 1KZHA 1YQXA 2EFHB 4B3XA 4BBAA 4B0OA 1J9ZA 2ID7A 4IGEA 4QYMA 4X94A 4LJ6A 3W9UA 3R6TA 2ZBFA 4BZZA 1QH0A 3LFHA 2OCDA 3PIRA 4GMKA 4TRMA 1OTHA 4XIYA 4ZQEA 3FWHA 1XIVA 1KSHA 3GEHA 1E9FA 2Q4BA 4HNAA 2OFFA 4R8SA 3VUEA 1K5GA 2XB8A 3TX2A 3PTLA 4E4RA 2F8TA 2X0NA 4UEJA 1CR6A 5FO0A 5I7HA 4CQMA 2JCXA 1MQAA 4TLDA 1NHWA 4GBED 1TIPA 1U7TA 5DHPA 5BOVA 4AMYA 1KO4A 1BGXT 3H1PA 4DMUB 3DFFA 5H1YA 1ZBDA 2R79A 1RLIA 1IFXA 4Y2JA 4BQOA 3GFQA 2A1UB 3H19A 1JH9A 5KYXA 2GR9A 1U8EA 3E9DA 2DPGA 2OFPA 3FY4A 4MHSA 3AONB 5K9ZA 3KYBA 4JOCA 1KQPA 4I55B 4K40A 5H02A 3ZE7A 5IH7A 2CMGA 2NVUA 1RWMA 2WYIA 3JVVA 1XZIA 2AH5A 2R65A 3JQDA 2OCKA 4UCXA 3TIFA 2WJIA 5ES4B 1DC8A 4RIIA 1FP6A 3SF8A 4B3GA 3FMGA 2RHHA 1GTVA 1N5IA 3K0FA 1T1RA 4O5OA 3FYUC 4UU0A 3DLTA 3RQSA 2Z3VA 2HDNB 3T7KA 4M98A 3K70B 1E0AA 1DAIA 2OXEA 2X8LA 4YRNA 2QMZA 4DY6A 2PFGA 5KYGA 2FPIA 1P6UA 1QQ7A 3UC5A 3MMPA 3K32A 4A0RA 1MX9A 4EW2A 2PUBA 4PIMA 2E1RA 2IHNA 1Z68A 4LOJA 5IDYA 3ZY6A 3C6KA 3PNKA 5INTA 1NJ2A 1DBWA 2CLFB 1OLOA 2EKPA 3VU9A 4EG4A 2WHQA 4QTZA 5LU9A 5LXTF 3FKQA 2IIPA 2VPZA 3ZDBA 4QPZA 9ATCA 1UP7A 3FI9A 3MGKA 4PQFA 4JBIA 1PKXA 1US8A 2I1WA 4B9EA 1XPUA 3BAZA 3HK2A 3IV7A 2VJDA 4LC9A 1SR8A 2ZJ1A 5KVSA 4ETMA 1KEWA 4O4JB 2UUPA 4WH0A 1MW8X 1DEOA 1QFSA 1YR2A 3ADDA 4UDXX 3BIOA 3DDSA 1U8XX 4F1JA 3BXGA 1YOVB 3T99A 1MN6A 2EHDA 5HE9A 3ZHRA 4YBRA 4JBLA 3CX7A 5KSOA 3WA7A 4MA4A 1H6AA 2JAQA 4JA2A 3QWBA 3TIIA 1NJSA 4RD0A 4DQXA 1NF2A 4K1XA 3DHNA 3RSSA 3NATA 3Q85A 4UHHA 5AJHA 2PJZA 5C31A 3VYSB 4BZQA 4YMGA 3RC7A 4UDYX 1G21E 3JYPA 1M0TA 1PLLA 2BFFB 1B8UA 2FCAA 5THQA 5CFRA 3F0TA 3PC2A 4AD8A 3AFIA 5G4LA 3OF5A 3OQBA 2XMDA 2YHSA 1BX3A 4EY3A 3N2EA 3ZHYA 1J00A 4WCVA 3M89A 3G2LA 4LJLA 2VP5A 1AUXA 2XRYA 1WKCA 3AM3A 3D4IA 2JD0A 3G79A 1T36B 3HB1A 4HQLA 5EAIA 4AUEA 4MWBA 1GKLA 4IQ0A 4JBGA 2AR7A 1R1DA 2XXBA 1HG1A 4LZNA 2FP4B 5KWIA 4ZPXA 1YS9A 4G1MB 3K8QA 1FRFS 1ZU5A 5JAMA 4B34A 1B1AA 4F4HA 3IMCA 1WEHA 5K0SA 1GQ2A 3KXIA 2NYVA 3BGOS 2ZDHA 2ZJ8A 2JCGA 4BYMA 2VHWA 3R7DA 5THXA 4YAIA 1Q2UA 1I13A 1XWFA 2J87A 5J23A 2WPDD 4GMHA 1W8IA 1WKVA 1JDUA 1W47A 2XD4A 3SZ3A 1F2DA 1S8FA 2AJDA 2HQSA 2NZWA 3A9WA 4G8JA 4N5IX 2IP1A 1CUHA 3IQIX 1E1CB 3KV3O 3EOBI 2HU2A 2WJZB 4UHDA 3B9QA 3W7BA 3W4IA 3SOZA 1I0ZA 1JH8A 2TMGA 5JMWA 4DQ0A 1XU9A 3UMGA 4YXFA 3K9NA 4YI5A 4DC0A 4BB0A 5ECDA 5CA1F 4JYPA 5ITVA 3ZKWA 2NUBA 2OB1A 4MI9A 4Q7EA 3IXQA 1U3CA 5C4IA 5J2UB 1LJLA 2BD0A 3V3KA 5JAHA 4WAUA 1X13A 1JBEA 3GRFA 4XGIA 2WF6A 5DN6A 5BN4A 1E59A 1M75A 4J0GA 4HXEB 5LLSA 1OLUA 3GJ8A 5E38A 1GTRA 4F3TA 4RL6A 4H0NA 2JCVA 4QOIA 3N39C 1X9HA 4UREA 4ZA2A 3TLAA 3ZZUA 2BYTA 4QBHA 1UMCA 3EIHA 1KAGA 1SBNE 1YBAA 4MI3A 4PSUA 4C76A 4K03A 2FWPA 3ZOKA 2D2EA 3EZNA 4WK4B 1Q0PA 2HRBA 2ONZA 1VL6A 1LNQA 1K6EA 2FLWA 3EXG2 5KWSA 5A4JA 1U7ZA 2PL9A 1GKUB 2ZUVA 2C29D 3E9ZA 3T9CA 4AN4A 1AY0A 2Q3FA 1YE8A 2X7JA 3OQ1A 1T5OA 3OHSX 1Q83A 3S5UA 3DTVB 3UJ9A 3VMMA 3WYAA 2A9JA 1W85B 2GFQA 1IM8A 1YR8A 1ZNZA 2X19A 4R7ZA 5A2QA 1P2VA 2IOHA 4TUYF 2BGRA 4TYQA 5LQJA 4P6VF 4QICA 5ALUA 1ONNA 3U5TA 1IMOA 2XRMA 2GILA 5DK6A 3BSWA 3GBSA 5DTEA 2XVYA 2MSCB 4QNNA 5D5PA 5AESA 3A1VA 1AKEA 1NN3A 4GOKA 3R0XA 2VCYA 4L4SA 3P9XA 4L85A 3Q7TA 2DHRA 1ZN9A 1WZUA 1H0RA 4U8HA 5LNK1 3VR3A 3UGKA 1GNQA 3KYDA 4WW0A 4BO1A 4BO5A 2YXDA 2ZYIA 5B53A 3IMFA 5HS4A 2VVTA 1E18A 4PLYA 5BMOA 4EGQA 1PTJA 1SXJA 2GARA 4IY1A 5EXDA 3ADBA 1UFKA 1P2UA 1FXSA 1RJGA 4H16A 3V4LA 1MNQA 4EL0A 1RNLA 3WQHA 1X7DA 3CPHA 1XHFA 4C5BA 3GRAA 1QF6A 3QWIA 2JIMA 2YASA 3OKPA 2WAYA 4FYMA 5TMDA 4E5MA 3R6WA 2PX0A 5LQDA 1DV2A 2FI1A 1TQHA 2JLRA 2V4ZA 4YASA 3QX3A 4WESA 2HDOA 1WUJS 1BE0A 4IDEA 1XKXA 4OG2A 1DEAA 4QUAA 3THSA 4B4OA 3VYUB 5FUMA 3AVOA 4QNMA 3RTAA 1NASA 4RDIA 4FILA 1SCUB 5LWQA 4ERNA 1N6KA 2E4VA 1MO4A 3EQ8A 1I1QB 3M6MD 4X6XA 3ZHBA 4BFVA 1M8PA 1TEVA 1TUEA 2MYUA 3LHFA 4TTIA 3SAJA 1IWPB 3UWKA 4OK3A 1U0JA 2ZJYA 3AJRA 3S99A 3GELA 4Y0AA 5B2FA 5IJ0A 2CE2X 3F8WA 5EI5A 3H8WA 4YCMA 5CVEA 2CCGA 2ZAOA 4NG4A 8AT1A 1TD9A 2FPOA 4O0LA 4HFJA 3ZWPA 4BWGA 5F23A 4C6RA 3DBIA 3ZHUA 4NESA 2PT7A 3PFWO 2FRDC 3B3QA 4N65A 4HTAA 3T0IA 2A86A 3K2EA 1YZVA 3VKVA 1EXNA 1KI2A 3DMGA 3KJEA 1UPFA 1DT3A 3VDMA 5M7EA 1GNLA 4Y9TA 3O8LA 8OHMA 3KOUA 1E6EA 1B7GO 4INAA 4YCAA 3DUFB 3ROQA 5KAMA 2JJYA 3U6KA 1U90A 2V97A 3VAAA 3CLTC 1CCWA 1K8XB 3HU5A 3FRJA 2WIBA 1G4HA 2EERA 3AFOA 1LSSA 4KBYA 3GLFE 2QRNA 3ORFA 5F5NA 3LPNA 4IZIA 4PS1A 1OWNA 3DBOB 4ENUA 4DR2B 4PGHA 4MUEA 4W5QA 1W46A 3H4TA 2HMVA 1MO6A 4HGQA 1EDEA 4Q6WA 1M2FA 1Y6RA 2V7XA 4GEGA 4P54A 1NAIA 3PL1A 3M6FA 5ECYA 1V1JA 1V7CA 3HZOA 2PZKA 4R6XA 4C1NA 4DCTA 5KTNA 3SBEA 1EK1A 3LDGA 3R20A 1GRRA 1GTG1 2J48A 4QOFA 3ZDQA 1EGMB 2WI8A 2LPMA 2MYTA 3FVQA 3TR0A 2VZ8A 4AULA 4L0MA 1CZNA 2FFBA 4YO7A 4WXPA 4L5IA 5FUBA 4QTXA 1XDGA 3GAAA 4AZWA 2ZJFA 1KI3A 4B46A 4R1MA 3LT2A 4C7VA 3C7CB 4YDRA 1KNQA 4JLJA 2C7VA 5DULA 2IS6A 1I7NA 4BN0A 3S40A 1IN4A 2WUWE 3GLHB 4MQFA 4UNSA 4MLCA 4F5WA 4YRAA 1MOQA 5FWDA 2JANA 3HVIA 4OQ4A 5DSXA 3ZDRA 1TQ2A 4V1CB 2AN4A 3GCGA 4FQ5A 4CV2A 4YCNA 4AMVA 2BTQB 1QUEA 5KYYA 4FNGA 1J2UA 2Q5FA 4G0OA 4K9KA 1NNEA 3O8RA 1YFJA 1XYYA 3SZRA 1YF3A 1U0NA 1RHJA 2XUZA 2IKQA 2OZEA 4FB4A 1LXCA 3DW3X 1M3SA 1Z0DA 3GFOA 3OZVA 3AJEA 5D85A 2IHUA 3WP0A 1A9RA 4AY5A 1LTHR 3F6BX 4ME6A 5JYEA 1PFYA 5EVJA 4FCTA 4KJZA 1M34E 3FLAA 3GLGA 2JFQA 4ACBA 2IPXA 1R0LA 2P2YA 4MCIA 2IODA 5BVHB 1NW9B 4LWOA 1E2MA 4BB5A 2W4MA 4NPCA 3BAFA 3RU9A 3TN7A 2OVBA 3LTNC 1ACLA 3B1KA 1Y82A 3N2YA 1O95A 4KGVA 5EZ5A 4OXYA 5LYJB 1V3UA 3QLUC 3PDHA 3ZD8A 4JYZA 3BN3A 1PV4A 3R74A 3D3QA 5FLEX 2FW0A 5UKDA 4WL0A 3VTFA 3BMOB 3E7FA 4FHDA 2RBEA 3PUKA 2GSWA 1P6XA 1V8ZA 3V4PB 2Q4EA 4QPDA 3RM3A 4H0FA 4WGGA 3M0EA 4QHSA 1KOLA 1N7HA 5E4JA 1A2QA 2BM9A 2PS3A 1KPIA 3R0IA 4IJKA 3LT0A 4RTJA 3HXMA 2Z8XA 2ZRBA 4I3HA 4OD0A 1ECFA 3FNBA 3LK7A 1CQZA 3ILSA 2OK7A 1NWCA 3SHWA 4YIKA 3DAYA 1E62A 1PHPA 2DM6A 2C5LA 3DZGA 4OMCA 3UGTA 3DLHA 2YFQA 3AZQA 4EECA 1I14A 3JU3A 2H7YA 1L8LA 1U2TA 3OIWA 4TQUS 5G1PA 4DIOA 2ECQA 2XTNA 4QULA 4CV0A 5CEJA 3QVWA 2B21A 2P6OA 3G8DA 3HSYA 4JQOA 2O5VA 3JQAB 5E7MA 2ZYSA 2XGSA 2GYVA 4IILA 4ENVA 3CX3A 2CHUA 2XA2A 5EQFA 5ANRB 2EG9A 1LTKA 3HCPA 1C7EA 3VC3A 1I7DA 4X6LA 3RC2A 3RWMB 4YP1A 1TJ3A 2EL7A 4EZEA 3IL2A 2PKYX 1S9HA 1W2GA 3DC2A 5BSTA 1Y1RA 4Z9YA 4EG6A 1Z3CA 1XMSA 4QVKA 1ZOOA 1XP5A 2W6ID 3IIMA 2WD7A 5HOEA 1FUEA 2C5HA 1A5TA 1F8YA 3W8NA 5HM8A 3QVMA 2Q6LA 2QD4A 3ZWVA 3U09A 1U2DA 5JH7A 1DV1A 4BIMA 1E1LA 1QF7A 2CJWA 3DT8A 4GI5A 4WFIA 3VR1A 2CMDA 3PJRA 4CEHB 1MA3A 4CEIA 1R3UA 3VH2A 4J7XA 4JJAA 2G1KA 3BS4A 2ATCA 4RGQA 1WDLA 3CN7A 4NYIR 1HI9A 1W0KA 3B12A 4XYBA 5EJIA 1QHNA 3STHA 5K0TA 1KYQA 1RPJA 4NOJA 1M73E 3UCXA 3KTAB 3A1CA 2VRCD 1ST3A 2QLBA 1R00A 2FRVA 3AERA 3H6KA 4HX5A 4EJSB 3PTZA 1DE0A 1WZEA 4MGKR 1B4DA 4TTQA 4X7MA 2C0PA 4FN4A 2VDQB 1ZLYA 4GO1A 3FA2A 3I4FA 4JJGA 3ICVA 4RDCA 4A82A 2QBYA 3RSOA 1R6TA 4CU2A 3KVNA 2E1PA 2X4LA 4H4DA 4ZVVA 4B3IA 4LF4B 2HX1A 2OUKA 1W2WB 4LXQA 5LSAA 4Z2YA 3QZUA 2WDZA 4LZAA 5HSGA 1VSUA 3TSCA 3AUFA 4Y2TA 4JZYA 1YCGA 5I7OA 2YVKA 2C4NA 3PQEA 2ZTUA 4CMHA 5AVWA 4KI0A 3SR3A 3HJFA 3D6VA 3D8SA 4JYMA 2VP3A 5E1DA 3NWPA 3ZU3A 1LBIA 3VJRA 1JA1A 2DBQA 4B2PA 4IINA 1BROA 3ZDZB 1AD2A 4DRYA 3RS5A 2RE8A 1I6LA 2XXJA 5DLPA 2BTEA 2E2WA 5JSKA 4BNJA 2A0XA 4DR3B 1T2CA 5DCLA 2K7ZA 4UEWA 5LNK6 2ZYHA 1BO6A 5ADHA 3GH3A 3FOCA 1Q5PA 2BGIA 2EDCA 4QHTA 4LF6B 1P2BA 4Q4HA 2F48A 1S6YA 2CBGA 4MWZA 5HCNA 5H3HA 1DG3A 1VHDA 4JLPA 3OETA 4C89A 4MB6A 5KTOA 3OMXA 4RL4A 3KOOA 3KU4A 1ZOPA 5A2GA 1II8B 3RYFA 3S2IA 4EABA 1I2CA 1OFIA 1XZKA 1CS0A 3R7BA 4TVSA 2PPLA 2NXCA 2YDYA 1L4HA 4HVCA 3C3YA 4J0DA 1IZZA 3MWDB 2WJ3A 4FOPA 2YWJA 3QNUA 1NBWB 4GXRA 1XRNA 4S04A 1CRPA 3NU1A 4HMOA 5KJCA 1T0BA 1ORRA 1U98A 2A5LA 2HNBA 2YIDA 4HDRB 3X2SA 4BMCA 1ENPA 5HGJA 4QTUB 4BL5A 2PEZA 2J4DA 2Q41A 3ASUA 5I4CA 1MJGA 2CL6X 4QXMA 5J43A 3B60A 3A4MA 5FAXA 1CQIA 1MB3A 3A05A 4OX9Y 2RK4A 1UM9A 3W9YA 1XQVA 5AFSA 5JIBA 2WD9A 3UTDA 1UR5A 4BYGA 3GEDA 3A1TA 3ZCQA 4OOEA 4CUKA 3U4QA 1XKQA 5H3CA 1VYTA 4U7WA 3Q9NA 4GVPA 5BWNA 2B9VA 3BRQA 1LDMA 3L5OA 5LC1A 4QTTB 4JGBA 3JQFA 1WZNA 3EVDA 3K1JA 5B7QA 1W0CA 3NBZC 5KYKA 4NDAA 3MRSA 1J0EA 1Z0AA 3H17A 2ZIEA 4K9RA 4MI6A 4QDOA 3KHKA 4JI0B 1VIYA 2Q1YA 4Q01A 2XBMA 4OHVA 2HXGA 2IHZA 3KWLA 3SCZA 2G09A 1O9HA 2CDRA 2XH8A 3LXXA 1KHTA 4CLHA 5BNIA 4D02A 3U60B 3AY3A 3FNIA 3P7MA 2F43B 3L6CA 3PK0A 2ZJ7A 2YWFA 3RIMA 3VR6D 5IBRA 4LW8A 1LRJA 2AN3A 2PT6A 2FF5A 4ZVOA 2AXNA 4LZJA 3WLJA 3ZS8A 2R68A 4Q47A 4KL8S 3TGWA 1OYYA 1WSDA 1V5IA 3OO1A 3CHYA 2FPPA 1JVBA 4Q93A 1SKQA 2QSJA 4D42A 5C1PA 4OMFG 3H5WA 4M38A 2EX1A 2I34A 4YQEA 4BU0A 3LXUX 3DVQX 1TJ5A 1ZOSA 2X0RA 4A16A 3FYTA 4S0XA 1W581 3RTDA 1ZW1A 5GWXA 3H13A 4MMZB 3X3HA 3ZZTA 2XDAA 3TUJC 3VTAA 4WXMA 4MLPA 1WY7A 3DOOA 2PA3A 4NXMB 1QYXA 3OC6A 2AEFA 1T8WA 1W4BA 1QX4A 4TX1A 2CCJA 5AOCA 4DW8A 1RS0A 4CTOA 1BU8A 3WFJA 4BNWA 2YMPA 2NPOA 3NHAA 1KEZA 4LFCB 5IDQA 1PL7A 4PM4A 1WEKA 4JJKA 3WC4A 1B74A 3HB9A 1CSEE 4PE5B 4G2TA 1M6NA 1O77A 2WHYA 4WLUA 4CF4A 2ZDQA 3OQJA 3T5PA 2AZMA 2QVCA 1U1CA 3OC0A 3UVEA 3AETA 1Z38A 4OYRA 3WOHA 4EB6A 5A6SA 5KVAA 2A1TR 2BCEA 2EZUA 4FEYA 2BZ0A 2Z3WA 3P2OA 3W77A 5K01A 4D9FA 2V9CA 3LK6A 2UU9B 2QRZA 4TKUB 4R8VA 4KYTA 1CP3A 2PYZA 5JH7F 4JI2B 3E3AA 4YQFA 3L9WA 3LCCA 1DTWA 4C7XA 1RPNA 1T2EA 3O1IC 2FJUA 2O0MA 2OORA 5F3DA 4EGFA 2PRIA 2VUIB 4UTXA 1USIA 2IZOA 4H6PA 1N5OX 1T8YA 4D8TA 2XQKA 3RT7A 5HS6A 2GM4A 1X0XA 3K7EA 3DFIA 4DV2B 3VO9A 1Z56C 3MJVA 1CUXA 3M49A 3H9GA 3I8OA 2GBFA 2QTRA 3QM1A 4N12A 5EG5A 1SHJA 2PU7A 4PN3A 3V1YA 2GMWA 3E82A 4IP0A 2ZSFA 4OQXA 3GZJA 5A4AA 1F7VA 3O2SB 1GZ6A 1CZHA 3TAUA 4ZEMA 3AYXB 3LU1A 1NMSA 3N58A 3R4VA 5KYNA 3QSYA 2DB3A 1VSVA 5CIYA 4RXMA 2HRCA 3U3RA 4WA7A 4ZOLB 2DEUA 1UK9A 3OU7A 4ZOCA 1J09A 3CRZA 3W8EA 1KMNA 1F6DA 1FTQA 1QGOA 1RYNA 3JQBC 5J63A 1QGAA 2D1TA 4JHXA 2JS7A 1B15A 4KB5A 4IIHA 4I81A 2QM8A 4LDQA 1RBMA 4GC5A 1PJRA 1H4VB 1NF3A 5DF1A 1DMRA 2CFCA 1JIVA 2YV1A 3D02A 3QF4A 4KRYA 5E1MA 1JR4A 2HJRA 5HEKA 4C4AA 4E4YA 2CFTA 1U1GA 4FXOA 4AJ4A 1EESA 2YIVX 1YZFA 4P4TA 5JQGB 4IMPA 1FQJA 3SSOA 1DFGA 1UBFA 4ZAZA 4BTEA 2GRAA 1ZY2A 3K9FC 2G76A 3OFND 5BT8A 5DBIA 1ZAYA 3KT3A 3HO8A 4DLKA 3WLLA 3K70C 2WUFA 3UJHA 3RVPA 3WGZA 1ZEJA 3F90A 3RSQA 3MT7A 4KFCA 1XF1A 4MRSA 4KXXA 3CZ9A 4LNHA 4RH0A 1DOHA 2ZSBA 2N42A 2H3HA 2ZVQX 4ZK2A 1LVHA 1ZINA 3GMSA 1ENOA 2ZYDA 1IIRA 2RH4A 1U63A 2P9ZA 3N7UA 1RRGA 2DQYA 1WU7A 3REOA 4F8EA 2ETXA 3EBLA 1V7PC 3FLBA 3MTEA 4MUAA 2XIJA 5FJJA 3DR3A 4OY3A 3U7QB 1RYEA 4R1QA 1IXYA 5AWFC 4NJEA 1LW6E 3HCBA 5T3YA 3WL8A 4DNFA 4QPPA 3NBXX 3L49A 2PMCA 3GIWA 2IXDA 1SXJE 4E12A 4YCLA 2E85A 4JBYA 2QGZA 2YV2A 4FR0A 4POOA 5A0TA 2IBSA 1VE6A 4X9XA 3HB5X 4AL4A 2V7EA 2BFEB 2Q7OE 3TD6A 1K88A 2GF0A 3CLRC 4UNPA 1IHUA 1X8LA 3K6SA 1FRNA 4LJKA 3MFQA 3WK5A 4CG1A 5JMOA 5CD1A 1IPHA 1S2LA 2TECE 3ZE6A 1RLMA 1TL7C 5J2TA 3TKYA 3NT5A 4OP2A 1Z08A 5KKCA 2AFIA 2C78A 2UYHA 2IYEA 3AC0A 1NXXA 3LQ4A 4FZ5A 5AH0A 4YJ2A 1BGWA 2B9EA 2AQ8A 4U7HA 3BEOA 1LC0A 1NVMB 1SC3A 3I5YA 4Z5XA 2A33A 1W94A 2GD1O 4B8ZA 1QX3A 3FYDA 4CKCB 2FZKA 3CVOA 4KE8A 5AO9A 5AUQA 5FL7A 3OUUA 5IXSA 3V8NA 5JFGA 2O59A 2N1BA 1M2OB 1N9ZA 1NW7A 5A4FS 3A4TA 1T3GA 2BBTA 5LBTA 1PX2A 2OG1A 3HJCA 2Y05A 1H1LB 4J1QA 3VI3B 5KPDA 2OGUA 2V7UA 1DX6A 1R16A 3MWEA 3NNNA 4IOLA 4AMUA 1MTZA 3I0ZA 4D82A 1C9KA 3R8CA 4FFBB 3HKBA 1UXOA 1EB8A 1YNSA 2IY7A 3KO8A 5KJFA 2FFJA 2PZBA 5LUAA 2PWYA 1DTSA 4DJTA 1IEVA 4IVRA 1JDJA 2AF4C 4JFRA 1CY6A 4JBHA 4ZVUA 3L6DA 1ZONA 4IOKA 1DEHA 1U7XA 1MJNA 3D6MA 1UOPA 1J49A 1TK3A 2A1IA 2ZR0A 4J0FA 1RQXA 1TMGE 4IPTA 4C21A 2O0KA 1ZJZA 4F2DA 7AT1A 2IXTA 621PA 4CQNA 4LDZA 4W82A 4PO1A 3N0RA 4ZAVA 1N2XA 1OIWA 2OXCA 1CD5A 2HH9A 5CVJA 3QIAA 3EVGA 1N2CE 3IEPA 3LY7A 4FIDA 1RJ9A 3WGKA 1QTQA 4PX3A 4BS9A 2OLEA 2C9YA 2DWUA 3IJ5A 4C6SA 5CB4B 4MCJA 3W3AA 4UNQA 1C0PA 1PRYA 2FLKA 1Z4QA 1DCFA 4H31A 5T4FA 3FUVA 3IDQA 3PA6A 4QBTA 3DBLB 3VR5A 1MOPA 2XTJA 4KXMA 3TCXB 1E8DA 2XZOA 2BLNA 1HSOA 1V3TA 1OKKA 4GZLA 3ZWQA 2A4MA 5DYWA 4JVSB 4WZBA 5KQMA 1BHO1 1AKNA 1PS8A 3PFBA 1UAYA 5MDHA 2ZPUA 1RXEA 2F90A 3DAFA 4IFTA 4S1WA 1JNXX 3H0EA 4UXHA 4PC3A 1Y8QB 1OW3B 5AM1A 4UTNA 4GMFA 1HUQA 3BIJA 1A82A 5BR8B 1AS3A 5K6AA 4CQMD 4CN9A 1N77A 1Q7CA 1HZZC 2XB6A 1A77A 1GPNA 2ID8A 2P27A 4LN1A 4DCPA 5AW2A 5IEJA 1X87A 2P6NA 1RM0A 3FHOA 1D2EA 1TI7A 1VMEA 5ILOA 1UM8A 1Y9AA 3AG6A 3G8BA 4JEIA 5DYNA 3BWMA 3C39A 1V26A 3PIDA 5ALFA 5WRFA 3HN2A 3UKDA 4FE3A 1C7FA 3FPLA 3U44A 1OI4A 1A0OA 1DC5A 1WMSA 5DVZA 3ZWMA 3T3OA 1HE5A 3TQIA 1X38A 3C3JA 1C5KA 2BR5A 3IHWA 3QH4A 1LK0A 2RGRA 3B6ZA 3UUEA 3GJ0A 1FDWA 4RANA 3UMFA 3Q40A 2BM1A 4KAJA 4DLXA 4UZEA 4WKNA 1V5FA 4JOSA 3ABSB 4L9AA 5B6JA 4MQ5A 3DD1A 4KV7A 4XOIA 3JWGA 3LP8A 2V58A 4FHZA 5FBHA 4YLEA 2I9KA 1W9HA 1NJFA 4X8HA 2ERYA 2CWWA 3BGSA 4RZXA 2LVBA 2BZ1A 4XYEA 3UMJA 1Q7BA 2RCYA 4IVQA 4TKLA 3QI7A 4BQQA 2OSBA 5EKUA 1JXMA 5CMLA 3OY2A 4UUQA 3KVVA 4ZTUB 2GCGA 1SVLA 4NCIA 4G86A 1P8JA 1W29A 3PG5A 4P7FA 4RK1A 3ZWCA 4C3UA 4QFDA 3V33A 2AI3A 2HMWA 2Y67A 1FYEA 3D2CA 3OUTA 3VZQA 4A4DA 3R0QA 3OLVA 4HG2A 4KGZA 2Q2VA 5CA0A 4XAQA 3ZBTA 5CDYA 4EY7A 2GXAA 1N1MA 1ZUIA 3CKKA 4E5SA 2F62A 5CFLA 2FN3A 5IAAA 5HCIA 4ZHQF 3E9QA 4PC7A 3N1UA 4PAQA 1U8FO 1W36B 2V5VA 5K3OA 3FGPA 3I6QA 1ZJ5A 4N03A 4TMYA 3TRFA 1K9SA 3P9PA 1CHDA 3QFSA 4GPIB 4U6NA 1UFQA 1JDVA 3BKWA 2HPHA 4N47A 2MWMA 3PRHA 1T91A 3K05A 4BAZA 1AQLA 3MCAA 2RKWA 3B1FA 2YC2C 3NWBA 4IQGA 4XD7A 1J25A 2VKTA 1HDXA 1DC6A 1UF9A 1VP3A 3DBRB 1PWYE 2YZKA 3OPVA 4I4IA 4U3JB 4WK6A 4K0KB 3QXGA 1PP4A 2ZU0C 1T5HX 1UBUS 1P2SA 1U0LA 4NBKA 1U3DA 2Y93A 4Q4LA 2GCIA 3SQLA 5J4LA 4B0PA 3V4FA 1E7WA 2QAGB 2EATA 3KZXA 3I2FA 2AZXA 1DWQA 4FYJA 2F1OA 4X71A 2WC1A 3NNSA 4P83A 3FNRA 3VJKA 5JC1A 5JC8A 2G83A 4TGLA 4M1KA 3OJWA 2Z30A 3KLPX 4N5DA 4DQKA 1V1MB 3MXOA 3W5AA 4B6GA 5IANA 4RUKA 5LZ8A 4YJ2F 3UOGA 4IIUA 4J16A 2O2JA 4YCBA 2AXEA 5KS2A 2Z5VA 1WOYA 2IYOA 4B7AA 3EZ6A 5I5GA 1RHMA 5CTJA 1AUPA 1AM4D 2PAFA 3CTPA 4LJAA 2WA1A 3ZPXA 1E60A 2WJ6A 1LDGA 3JAWB 4GVLA 3NVDA 3DNMA 1EWTA 1E0DA 3A2LA 4M49A 4W5JA 4CMEA 1GPJA 1ZM2A 3HHPA 1EINA 1YS2X 1ELOA 4LJ4A 5AQ1A 5DN6D 1SU8A 4YWHA 3DLIA 3KFLA 1A9ZA 3TSOA 4KRFA 2A84A 4DLZA 1O0SA 1XMJA 4GYKA 2FWAA 4M0MA 3THXB 2XYPA 1B3BA 3I1YA 2XJ4A 4ZYTA 1OAKA 1CNMA 1LZKA 3Q3EA 3Q12A 4LPSA 3H8VA 3O95A 4PINA 5LDGA 1UZAA 3TQRA 2UYGA 2HSWA 4AJHA 3NANA 1PD0A 2O3RA 3EGWA 2RAPA 4UQLA 2C58A 4CFYA 3RS0A 2FQYA 5EYPB 5C1BA 1EHIA 1A7UA 1UZUA 1GYPA 3AEQB 3GAZA 4HLNA 1T9DA 1VJCA 2C4WA 2X8JA 4PHGA 1AZTA 2O05A 3C43A 4MPDA 3WK6A 2CLIB 1QMPA 1K4MA 4IDHA 1OC2A 3GUVA 1DHTA 1GQQA 3HL0A 5BP7A 4ZFNA 1G66A 1NP7A 2D0OB 3JALB 5HM6A 5KOHA 3TL2A 4L4ZA 3WE7A 3O91A 2W83A 1LLDA 1O87A 2Y0PA 1IU9A 1KU6A 5DHAA 1MZPA 5FEUA 5DM70 1JG2A 1TAGA 3H9EO 5EIBD 3UXEA 5ADVA 5IMSA 2IELA 1FTSA 4MQEB 521PA 1O5OA 2LDXA 3I2IA 3VR3D 2REQA 4E07A 4RH1A 3PJDA 1JDBC 1YOBA 1OV4A 2HDWA 4IGIA 5EN4A 3S2SA 1YUBA 2INGX 4BFTA 4ML3A 3TEFA 5EIWA 1ABFA 4DBVO 3HUEA 1Z8FA 3A9VA 1A7KA 2I6UA 3PUYA 5DWDA 1XCPA 2YMMA 3BOSA 5L3RA 1W1UA 4MX8A 1Z18A 2R87A 3EAQA 4M8LA 5GONB 4XWKA 2PYIA 3AEYA 1WX1A 3PGKA 2BH9A 5JROA 3HCOA 4LHVA 5HF6A 3QPCA 3KSAC 4Q3AA 3LW8A 4RZHA 4FDLA 3HZRA 4O2AA 5JE8A 1SURA 2Q27A 2ODPA 3PQ8A 4MPJA 1V96A 4RSHA 4E33A 1PYGA 2OBMA 4BP9A 3KOZA 4M83A 3FSRA 1PGJA 4BUCA 4MRMB 1OSNA 5TEVA 1ZMRA 2VH1A 4MW1A 2YJGA 4J4HA 4N0MA 5DBOA 1IQPA 3H6GA 4JI7B 2B37A 1J2YA 4DG8A 1BXRB 1ESDA 3O8CA 4EMSA 1E5TA 3KKMA 1C4KA 3K09A 1A9YA 4URUR 2GCOB 1EB9A 2BMFA 2MCFA 4RJTA 3M3DA 1MB9A 4BAGA 1EX6A 3U5ZB 1ZD3A 2B25A 3NYQA 3DV9A 3EXHB 3O6VA 2ZRGA 1QDUA 5FAKA 2E48A 5E9JA 1QCDA 4IS3A 1KFCB 4INOA 1ZH0A 2HMYB 3KC2A 4N8EA 1YDEA 2X1HA 3SQNA 3KB8A 2LXNA 1G19A 1AKWA 2W6NA 2E6UX 4EO9A 4QUGA 1KVRA 2ZPTX 3IALA 3IVAA 1NFRA 1SG9A 2DJ5A 4DCNA 1JQ5A 5TVKA 1FIUA 2NACA 4MWGA 4NC9A 1SC9A 1EHCA 1A8PA 3G1UA 1VL2A 1C1XA 4DLNA 3GT7A 3I0MA 2JJ2A 5JSZB 4J0IA 2BFDA 4O4HA 4NCAA 1IVNA 1ZZEA 2ZT6A 3RTGA 1YTUA 3IRUA 4YPVA 4B6QA 2ZCJA 3FVTA 2BM0A 2DKFA 1GAEO 3CMMA 1NUSA 4HTFB 3V7FA 5KREA 4Z4IA 1TYEB 5DX1A 1GY8A 3KSZO 2B3DA 3D2BA 1UADA 4GM0A 3T7SA 3AKZA 1ND6A 2ZB7A 3GP3A 5JI2E 1OIVA 3SR0A 4EPWA 1Y4ZA 2XUFA 3TNYA 2JIBA 5G0SA 2FX2A 5DKFA 2PCLA 9MHTA 2KM1A 2N46A 3WDLA 3PVCA 3R76A 2B94A 4ZI7B 3KOYA 2PN1A 4RA9A 4N6OA 2ZYGA 4X61A 4DLAA 4URXR 2QDKA 4PO3X 1A5ZA 2BFCA 2GPWA 3G13A 3U16A 3OVMA 3IVXA 5LP6C 4CJXA 1A9TA 1VSQA 2DCUA 2PKWA 3QW4B 4JELA 1DTEA 2QT0A 3UMRA 1YL6A 3DZBA 4HQOA 3WSVA 1Q1AA 4EJ6A 3IP3A 5DK4A 4Z99A 4B3FX 2HB6A 3VX4A 4HAIA 1Z26A 2YCLA 3DULA 3NW9A 4O0MA 4OJKA 4RD2A 5IYZA 1O94A 2GPTA 1OV6A 3IPYA 3KLMX 4WT7A 5EMMA 1SZJG 4W7HA 1L4BA 2WTNA 2G8NA 1F7UA 3D0QA 2ZJ3A 2BGLA 1MORA 4MZDA 3N8HA 4COOA 1YNOA 2P67A 5DNVA 3NM5A 5FUWA 4F5EA 2P2LA 3MT0A 3QLVC 3F46A 5HKAA 2BUCA 4RVFA 4OUDA 3C3XA 5EQTA 5LP1A 2I03A 3NYRA 2AOTB 4I1OA 5IDWA 2QTTA 4MQLA 3OG9A 2B8WA 3RBVA 3T34A 3TOCA 3QTLA 1AO0A 1M2EA 1C7RA 3QNMA 3UK6A 2GPNA 1QIFA 1ZNXA 2HCBA 3VH3A 4KFSA 3CCCA 5B2EA 5CAEA 4Z4EA 2OT3B 2QM7A 1GUFA 5E6RA 2YC4C 4Y1RB 4XB1A 2QLNA 4Y2VA 1GG8A 1YD7A 2OHJA 2QNRA 1L4UA 3EXG1 4KE7A 5JPIA 1MH9A 4ND7A 1O95D 4S1TA 1GOTA 1WCIB 4XGKA 1XRRA 3I3SR 4RKWA 3TLYA 1JG1A 4CGZA 1XMXA 5EPUA 3EEFA 3AFGA 1GO2A 5E6UB 1RAHA 2B6NA 1E7QA 2C9MA 4D9MA 1ZA2A 2RARA 5HK8A 3WNBA 1ZN8A 1LVGA 3N86A 3E7DA 3M9LA 3PWSA 4KKVA 3Q7RA 1J99A 1NJ8A 1U2PA 1J1UA 1Z73A 2CL5A 2RC5A 2H00A 3TWOA 1J1ZA 1EPUA 3EGVA 3G7SA 5I7VA 1PQPA 1JPUA 1VSTA 2QL9A 3WGQA 3B53X 4KWHA 421PA 4UNRA 1EVIA 2UUCB 3HVKA 2KJQA 4X1IA 2Z2ZA 1E0KA 1FB5A 1KSFX 1DBQA 3FIUA 4R8RA 1EE2A 2HWUA 2WAMA 3W5IA 3ER6A 5ESWA 5JD5A 4KIGA 4XJVA 2EW2A 1SELA 2PO7A 3DE1X 1FMFA 2JF0A 3ND5A 2OBNA 2P4HX 1XD9A 3BILA 4KEAA 4OU5A 1G1AA 2CLEB 3FMFA 4GE3A 4ZRDA 1XEWY 1XXHE 4HN2A 1V5EA 4PTLA 1QH9A 1F6WA 3K9HA 1TA0A 1KMIY 4QSMA 5K45A 1S8NA 4Q4JB 1PZFA 2QXTA 4R8LA 2VN8A 4HGYA 5JVDB 1JX6A 1V11A 2DUMA 2XE8A 2ZBDA 3LBFA 3PCTA 3O2JA 4OHZA 4K9PA 3UHJA 4TYWA 2I29A 2AFVA 1RC8A 3ONWA 4UEOA 5K6TA 1QHSA 4B3HA 3EZ7A 1XQ9A 3PBKA 5IK2A 4DLRA 3HM2A 4Y30A 3BXFA 4ENSA 3IERA 4DQDA 1NP3A 1JLHA 1L5HB 3HWRA 4MGEA 3S27A 4MYTA 1NC1A 3ZDEA 4E2WA 2NYRA 3NVMB 3CWZA 5HUJA 3FYSA 4UKDA 1W0KD 1VCOA 1CQXA 3HJTA 4GM1A 2H5JA 3X2FA 1U11A 2R6GA 1G0OA 1F5NA 4P80A 4RMNA 3DFMA 3IPXA 3FWNA 3RPEA 5HZGA 2WYHA 3O73A 2F67A 3GVXA 1R0YA 4FNMA 4WWHA 5KJ1A 3WAGA 2XNDA 5KBYA 1P2GA 2LP4Y 1SULA 4ER7A 1YGPA 1U0GA 2QM3A 5TQ2B 3WRXC 4EHDA 4IOMA 1ZEMA 3AH8A 2BONA 2I0FA 2X9QA 3N53A 4DM7A 3NIGB 5FBLB 5JSUA 4A0GA 3SC3A 4LYYA 5C8DA 4G0YA 3G89A 1A7AA 2AOUB 1BVUA 1PV2A 1WV1A 4IXTA 3HKDB 1WHTB 3VPCA 4QBGB 1YZGA 5B7NA 2DPMA 2EIXA 1UKBA 1SBZA 2QV7A 1QHIA 2EF1A 1ZXLA 4G41A 4HNTA 4OI1A 4E22A 5ABPA 5C53B 3SBDA 4YXWA 3W1EA 1P72A 1GILA 3NYWA 3H1EA 1E1RA 3E1SA 2ZG6A 3RVJA 3PQCA 3BWXA 2F9FA 5HIKA 1FJXA 2OQRA 3IBSA 5CT5A 5FPYA 3SGLA 5IT0A 4WXYB 4D8WA 2HPVA 2R8XA 1Z82A 4MS1A 4N76A 1YIAA 4JJEA 5BRJA 4ALIA 3ACCA 2NLOA 2ZATA 2V6IA 3DLCA 5BORA 3DGFC 1DI0A 5FTLA 4ZAWA 3THYA 3RFUA 1PGNA 1A97A 1WHSB 2EEZA 3DPSA 4LRQA 1WB5A 3GA0A 4TKVB 1QGDA 3MMZA 5DXJA 4UD6A 1XALA 1LDYA 3DM9B 4NE9A 4ZI5A 2V7VA 3T35A 4QC2A 3HG7A 1UKCA 2W6PA 4ZTZB 3HFJA 3RSHA 4XEUA 3PR2B 3DQQA 1CE8B 4LQ4A 3KM0A 5AI9A 3LDFA 2IHTA 2XT0A 3LUBA 3N2NA 2Y76A 5EMHA 4BNXA 4D3ZA 5KDOA 1U0RA 1VYUA 3R1IA 1S89A 3CR8A 3D7NA 1GZUA 4OBWA 1U4SA 1XVAA 3CG0A 3PI6A 4PLZA 5D3KA 3EDRA 4J49A 4ALLA 4DC9A 2BFOA 2IPMA 3PE4A 1IZ8A 5IYZF 1QDLB 3DOUA 2OXTA 3TM5A 1C1DA 1EM8B 2PX4A 1N25A 2KS6A 3OCJA 4M7OA 4AYTA 3IAEA 5AW0A 4FWTA 5F3WB 2JFOA 2W6JA 3FFTA 3WGOA 3TTTA 5H3LA 1TZKA 1GQSA 2WRZA 2WUGA 2B5OA 1KE2A 4DCCA 1PEYA 5DW0A 3NDBB 3PHGA 4H15A 2QOEA 3VKWA 4GR9A 2C2ZA 4J6EA 3L43A 1Z9BA 5SV2A 5A03A 2W6OA 4U2CA 3WB2A 1LVUA 1VOTA 2PUFA 4I4NA 3TZHA 3LUAA 4O59O 2F59A 1KYYA 2VKQA 3GR6A 2WFAA 1XDZA 2R85A 3Q8MA 3RVQA 2V8OA 3BL6A 3WP1B 3RYTC 1EZ4A 1IH8A 2ZIVB 4HLDA 2WE7A 1KFBB 3PT9A 1WLSA 4W1QA 3JQ8B 4BLPA 4GL2A 5EJ9A 1PLKA 2D0PB 1ISIA 3DONA 1RWXA 5COQA 2BGJA 3QX9A 3WL4A 3K9QO 5C4MA 3P2MA 1TEXA 3VVLA 1K3UB 1UH5A 2ODBA 3BD7A 4MITA 2NP7A 1WXGA 3NHJA 4IXNA 4Y8VA 2E3JA 4G0MA 3REQB 4Z1OA 3PQDA 5KYTA 5BV2P 4G5QA 4DA4A 1LPNA 2PXAA 1DKUA 1YDGA 1G16A 4R1UA 3TXXA 1QHEA 2CSXA 2G08A 2R1TA 1CRQA 5AKEA 3UAWA 3WK4A 4CWAA 4TTJA 1KDZA 4YLGA 1ZQ9A 2IX9A 3GJ5A 4PSCA 3IPRA 5JI3E 1X7YB 1SB9A 2XUOA 5LQAA 2HBYA 3IAM6 1G59A 2OGSA 3ZGVA 2Q21A 3GEEA 4H35A 1B6GA 2RBKA 1ZGBA 4ID9A 3BA6A 3D2LA 2F9LA 2FE4A 2ACVA 2OD2A 2VF7A 3DEIA 3KQPA 3QV1A 4OX9B 3OWXA 3IIIA 5HZHA 4EEKA 3DDHA 3F6PA 1R2QA 2NXWA 4UU1A 1IY1A 3F5QA 4DHEA 1S7GA 1T2NA 3MQFA 4W6ZA 1QVRA 1G4AE 2OMEA 4UCFA 1R15A 3I5AA 3K16A 4FMDF 2O1EA 4OHPA 4TVBA 3GY0A 4B3RB 3EUEA 3GV0A 1F2TB 5DNDA 2CXXA 4MQ4A 2H17A 1AHPA 2G80A 4F93B 5FYQA 4L8WB 4PZ0A 1GEGA 3QBJA 1CVRA 3N87A 4S05A 4JENA 2Q5LA 3D6NB 3C7DB 2JLWA 1QMGA 3A6PC 4MMXB 3PGJA 3TZQA 1H1DA 2XCQA 1I1HA 3LBNA 3OZEA 4IIXA 1P0CA 3ET4A 4BV9A 3RUIA 5E0KB 1Q3TA 5EE1A 4JN6B 4LS3A 3WR5A 1UBCA 1FDUA 4NIMA 1NOJA 3PQ6A 1VA4A 2UDPA 4ZKDA 5BPHA 2Y1FA 5FD8A 3EDQA 3AUXA 5A62A 1DPGA 1Z34A 2FWNA 1KARA 1E0SA 1Z7YA 2DWPA 3PKZA 2AC7A 5FFMA 3OZSA 4WZBB 2OBBA 3CRMA 5AT1A 5JDIA 5KCZA 3SZGA 3AY6A 1NV9A 1XXLA 2OBXA 4G09A 3TSYA 1SUPA 4JY7A 4Q19A 3C14C 1C41A 3PNPA 5HPYB 1RM3A 2Z2XA 1P1BA 2ZUTA 4D46A 2A67A 3MM4A 4RV9A 1GGKA 1CJKC 1Y7PA 3V1UA 1U99A 5ARDA 1A9QA 1K0FA 1WXIA 1IEXA 1K66A 1BW9B 1OI7A 2EFGA 2HXSA 2ZIFA 1JKMA 4OYYA 5IJZA 5JEDA 4AKEA 1E9DA 4P84A 4DXHA 1SQ0A 3C8ZA 2OZKA 1YE5A 1DLIA 4YJFA 5JPDA 2KSQA 2ZJ5A 1R5NA 1IUOA 1GPWB 2GO1A 2O6HA 4FBLA 2CUZA 3I5MA 4HMQA 2H2FA 2AFHB 1NATA 2MDTA 4A5SA 1U6JA 1KMHB 1O3YA 5TT0A 5JNLA 3U19A 4OA8A 3QPVA 2B6HA 2O5CA 1RBQA 4OVKA 3PU6A 3U1BA 1Q7TA 5EJ5A 1G3RA 3LDAA 3LRXA 4DCGA 3ZVMA 4YAFA 3L05A 5DGDA 1SIUA 3DZHA 3KJZA 4YRCA 2CYBA 2YOHA 2W2MA 1XTJA 2IZZA 3L41A 5I5EA 1B76A 4AO8A 1UMKA 1DKLA 4R1PA 4YAGA 1AKMA 2IIBA 4CQLB 4QDKA 3G7NA 3TNDA 3GP8A 4ZODA 4WOJA 4DSZA 4KSCA 3WQSB 5LZ2A 1HY3A 2KBEA 4P0QB 1PDOA 2OCIA 2EJWA 1FDVA 1GEEA 1MTOA 1YJ5A 2JHFA 1PKEA 1T6XA 4K5QA 3V7YA 3ZGYA 3K96A 3PNYA 4B6PA 1MT0A 1H4TA 2PG3A 3IMGA 4KLZA 5TRTA 1YBFA 4LUCA 2HWXA 5GJWC 1W1WA 1WUYA 4FFVA 1IUPA 1E2KA 2AOVA 2JZNA 3E58A 3UMCA 5ER9A 1U28A 4RMIA 1KRHA 1OWOA 1NQAO 4Y9UA 4FR2A 4IUBS 4PBSA 1LY1A 2BDUA 2AV6A 3K31A 3UT5A 3JCZA 2QWXA 2X6TA 2EZTA 4HH3C 3T1VA 1G7TA 4AG3A 4JSYA 3U37A 1U0HC 3WRVA 3FRIA 4HKTA 1GYRA 1LDBA 3HP7A 5JTUA 2IYFA 2XYVA 1I36A 2GZDA 1KDRA 1I2DA 1MJGM 3GNTA 4KIFA 2FE1A 4G5OA 1P1JA 5ELLA 4FHEA 2B99A 3LZ6A 2OKGA 3FPAA 2OLJA 4KVZA 3MYYA 1Y5LA 2D59A 2H4FA 2Y1WA 1EP9A 1XFAA 4FONA 4J7CA 3MHTA 4JGIA 2I3ZA 1QG4A 1X0VA 3I01A 4JP2A 4JC8A 3W2FA 121PA 1JS1X 2VZEA 1HKUA 2Q62A 3M81A 2CLMB 4TTPA 2NU8B 1L0BA 4KZKA 3K1AB 4XM0A 1H69A 1PFUA 4XI9A 5I7FA 1NVWQ 3AZOA 5ILGA 2AR9A 1NPDA 4AUKA 4Y6SA 1HEUA 1NOIA 2I6GA 2QD3A 5ALVA 5FL7D 4IMIB 4IWYA 1DKOA 4H7KA 5CIWA 2NVOA 1AH2A 3AG5A 1U8UA 1FYDA 4NCKA 2CLKB 5DHUA 3KETA 2EDAA 2I2AA 1CUVA 4RIEA 4TLBA 1QR6A 1AF7A 1RMQA 3FB4A 2IS1A 2CK3A 3S2ZA 3FOAA 1ZGJA 1Z36A 2HPAA 1JG7A 2XSZD 5BVGB 4KBFA 4TYPA 5U4QA 3UUFA 1C1HA 3R77A 2R6HA 4I9GA 4C0AC 2W11A 2HTEA 4EY8A 1NLZA 3OZDA 5C5IA 5JCJA 4D26A 4NAVA 2B5WA 5I9SA 4AROA 1NOKA 2VAPA 2BE7A 2D74A 3I32A 1XR3A 5C1IA 3DDZX 1GL9B 1MU0A 3EMDA 1ZL0A 4L4UA 1R6DA 2Z56A 3G0IA 4H7HA 3N3BC 4B3JA 1NUAA 3DT6A 5TEWA 2X42A 1NMYA 1IB6A 3CJTA 3LQQA 5FOUA 2ZWPA 4E5DA 5L3SB 3PNVA 1FFGA 4G1VA 4P81A 1NNI1 3C0KA 4RD4A 3N5KA 4LV5B 2O54A 5DYIA 1CNFA 5DXFA 2FUG6 1X7ZB 2RGEA 1XCJA 4Q3DA 2Q99A 4V2IA 3W3AD 3HJGA 1PQ4A 3EVZA 1KH1A 3BDAA 4JUFA 2IUUA 3GZ4A 3SHQA 1RU3A 1JDNA 4M8IA 3VR5D 2Y8EA 2BTOA 2WWFA 2IH4A 2DBYA 3MYRA 1R0BA 1OKKD 3G1WA 5GZ6A 2ZI4A 3WSTA 3VKGA 3A4NA 2ICAA 1T2FA 1SD1A 3K0CA 4GOMD 4KAFA 5EQJB 3H5VA 4Z3KA 1ZVJA 3CSSA 4KK3A 1FDIA 1D4ZA 1Q7GA 4QQ8A 1DAHA 1N0HA 1QZZA 3GOQA 4X20B 2J07A 4YT4A 1VI2A 3MFYA 5FI0B 2WVAA 4D41A 1IAQA 1LU9A 3A4LA 2H5EA 4Y2SA 5CXUA 1UJNA 1DJMA 1OBOA 1E9AA 2NWQA 3O31A 4FC6A 3I9V1 1CEQA 1R4ZA 3BPSA 3WKCA 1C50A 1WW3A 4DJ5X 3H04A 2PX2A 5JY6A 3O84A 3X1ZA 1HWYA 1DBRA 1WSWA 1WP4A 5K3SA 5AVXA 4A8JA 1GT6A 2O57A 3UJ6A 2JFGA 2JA2A 1G3MA 1RMTA 3I12A 2A2ZA 1P1CA 3QOXA 1C3JA 2FLVA 5E7JA 3M5CA 4U2FA 1MJ5A 2ZKIA 1D6MA 3FKSA 4FWIB 4IDPA 4DV7B 1SMKA 4N7MA 2YMLA 2I2WA 2VWQA 4OXQA 4R9NA 5GVRA 3JQ6A 1AQNA 1UXJA 3IS3A 3FWKA 1W4LA 2P79A 3CVJA 4INPA 4UQPA 3UJ7A 5CXXA 2R3SA 1K97A 1WG8A 2H2HA 3E7WA 2W0SA 4BLSA 4AN1A 5IVDA 1L1FA 3WADA 3KQLA 4X63A 4ECEA 4C0XA 3B6IA 3JWIA 2IYVA 1HLFA 1GGEA 4INJA 3JR7A 4IRMA 1SXGA 2WU3A 2KLBA 5NLLA 5IWCA 1J5EB 4JC4A 3FVRA 1XZFA 2CBZA 1Z83A 3E7XA 2FUCA 1GG5A 3BBLA 3GN1A 3IVMA 4PW0A 5E6SA 3NLLA 4RKQA 1L5QA 1DO8A 2A4KA 1IZ0A 2FEXA 2OY0A 1VCHA 4DQVA 5EMKA 5IKMA 3MMSA 2W2NA 2ZYVX 2HDHA 1N36B 2C03A 2FR1A 5KWJA 2NADA 1U2ZA 1J1IA 3S0JA 1EM6A 4P9NA 4LDRA 1R9GA 2R8YA 3MWLA 4GWKA 4QUDA 4RVSA 4WADA 1CKEA 5CURA 4M1TA 4PXSA 5DYGA 3WFZA 2HK8A 3HYTA 1F2UA 2OENG 4OHUA 1X1SA 2IITA 2JBWA 3IEXA 4C2BA 4IQ8A 4P58A 4O1MA 4P32A 2R6CA 2W4IA 4RHEA 3CR7A 2FPSA 4G0PA 1RJDA 3UJCA 3GGGA 4BQPA 1U2RA 1GA6A 4YP5A 5JPCA 1G8YA 3V4OA 3DXZA 4E2FA 1EUDB 1H3FA 1AKTA 2C0CA 4OKSA 3BWDD 3U26A 1QS0B 4DOMA 3W5VA 4B7XA 3BZWA 3L1IA 1PT9A 1XLVA 1BDJA 5I7SA 4AY6A 2PKCA 5SY4A 2P4QA 2B7BA 4OEHA 4XD7D 4AKIA 4IH9A 3JASA 3SXUB 4H1WA 2XWJI 4CCYB 1WOMA 1JFFA 3IHLA 3CA8A 1JKJA 1D7OA 3NT4A 4LYHA 2MJLA 1KBZA 1IULA 1PHRA 2V54A 4KQKA 2NT4A 3ESRA 4BU1A 2ZLBA 3NCHA 4FZJA 4C2TA 2NUTB 3GO4A 1JYSA 3G2MA 2H4ZA 3R5SA 3UXYA 5KNLA 3M7IA 2X8BA 2ASEA 3N6RA 1TM4E 3T3PB 2ZSEA 4P35A 3LX4A 2PUGA 1E7RA 1O97D 2NZXA 3EXIA 4YRFA 5HDBB 4C01A 4OYHA 2FEPA 3AESB 5MFZA 3S8YA 1HQDA 3N8IA 3RNOA 3VPBA 2HQOA 4XUEA 3F8TA 3RS9A 5ICGA 2E49A 2QU7A 2X22A 3CEJA 4FFOA 4YCJA 3T54A 3AO0B 3SQXA 4CM8B 3BB3A 2R44A 1XD8A 3NHPA 4I46A 3WQBA 3ENVA 5I4BA 3OQMA 1QIJA 4ZCTA 4MEAA 2QMUA 2J9FA 2JL1A 3I1IA 3MCZA 3MJCA 1KNXA 3NAQA 4RXUA 1ACJA 3I23A 2FV8A 3PEYA 2VPQA 1V16B 5BV7A 1NI3A 3ZK7A 1BWRA 3DB1A 1PJ2A 3PR3A 5JRZA 4EI9A 2PL5A 4QPJC 1PE0A 4WBNF 1KEEB 4YALA 5JDCA 1OA0A 3PX3A 5IXYA 1T0IA 2QUAA 1ZC3A 2OCAA 4RO0A 1M10A 4CIWA 4G1FA 4UBOA 1D3AA 4YVFA 4PAMA 1RFLA 4DPMA 4Q3CA 6ABPA 4I6GA 4CVNA 1O57A 3ZVLA 5KC9A 3O4IA 3DV0B 1A3CA 3A1WA 2AK2A 1GR1A 2Y0BA 3JVIA 3JQ7A 3F9IA 4B8WA 4MINA 1QO0A 1ZKMA 2GN9A 4MVCA 3T5GA 5MGNA 1XPOA 3C1UA 4IQ4A 3TLZA 3OMWA 1U31A 3IEKA 1H2HA 4P86A 2ZJZA 2H54A 5HFJA 1RQRA 4D25A 1EYZA 2AOWA 1UFOA 4YRDA 3T5DA 4FFLA 3T9AA 2WOOA 4JR2A 4D5EA 5IUNC 3INYA 4H7EA 1LCIA 1UJ5A 4XJTA 4CETA 3A0RB 4TN5A 3YASA 1OB5A 2G5GX