5D1HA

Crystal structure of the 16s rrna (adenine(1408)-n(1))-methyltransferase w203a mutant from catenulisporales acidiphilia
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
204
Chain Sequence
b'TALKVLAGKKLTDLDPDEWAKAQASAERILVDVGTGDARTAYRQAIAHPEWLVVGVDPAWQRMTETAVRAARKPAKGGAPNLVLVSSAIETVPAALHGVADEVMVLMPWGKLLRGVVLGEADVLSGLRAVAKPGAPLEISIGTSIWREPIPLEIRDLPELTPETVVSTGLTDRLAALGWQVADVRLVPTETVLHLRAVAVDPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Transferase
source organism Catenulispora acidiphila
publication title Functional dichotomy in the 16S rRNA (m1A1408) methyltransferase family and control of catalytic activity via a novel tryptophan mediated loop reorganization.
pubmed doi rcsb
total genus 61
structure length 204
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5d1hA00
4E30A 2G71A 3R24A 2O0LA 2PXXA 3NWBA 2OPBA 3G2OA 3KPVA 5K0LA 3DULA 4E2XA 2QY6A 1KPGA 2IP2A 5DX1A 3UA4A 2OB1A 3AXSA 3FUUA 3P9IA 5LQUA 3OFJA 1JTFA 2UZ4A 4YUVA 5HIMA 2NNWB 4RTPA 2GLUA 2HV9A 2ZWVA 1YZ3A 2PBFA 3UZUA 1VQ1A 2ORED 4MIKA 1JG4A 3GU3A 4P7JA 5FA5A 5ICFA 3AJDA 5GINE 1R8XA 4GC5A 3KQSA 5CIYA 3MCZA 5DXJA 2E5WA 3D2LA 2C7QA 2IIPA 4ZTBA 2ADMA 4KRGA 4BP3A 5DSTA 3NDIA 3NVMB 1ZHFA 3B89A 2O06A 2PXCA 1SUIA 4GF5A 2OY0A 2A14A 5EKXA 4G56A 1D2GA 4BLWA 4PGGA 4BP1A 2I6GA 2IPXA 5F2NA 4IV0A 1XVAA 4P7GA 4YV2A 3CJQA 1Q0TA 4GOND 2G70A 2K4MA 1L3CA 5C0OE 5EMMA 2VZ9A 1NW6A 4DF3A 5LQRA 3PFHA 3R9XB 2O05A 4E70A 4FZVA 4RVHA 5CVDA 5EZSA 3P71T 1TPYA 5GIPE 3FUXA 4IV8A 3TR6A 3KQYA 3O31A 3CJRA 1NV9A 4R8RA 4YUZA 2P35A 2EG5A 3GGDA 3GWZA 1NBIA 3G8AA 1QANA 3KPJA 4RTMA 3GO4A 5EGSA 3EGEA 3KQTA 1VL5A 2AN5A 4RX1A 4X41A 1G8AA 5D1HA 3Q87B 4M37A 5EMKA 4RTLA 4O29A 2WA2A 3RW9A 4E31A 3CVOA 3A25A 4KW7A 1QYRA 1VPTA 4PGHA 2YVLA 5DX0A 4ER7A 3HTXA 1L3IA 4CTJA 4HSGA 1P91A 3BKXA 4WXHA 1DCTA 3A4TA 5DM2A 3HM2A 3KQMA 2O07A 3M6WA 5E2AA 4DCGA 4RWZA 4YV1A 10MHA 2GPYA 3A7EA 3OU2A 4FT4A 3LDGA 3Q7EA 4PYJA 3FYCA 2OKCA 5KQRA 5EIFA 4IWNA 1XDUA 3FPEA 5DRYA 5GM2A 2CMGA 7MHTA 2C7PA 3R0QA 2JHAA 3REOA 2ZULA 2NXNA 1RJDA 2UYOA 4FSXA 5E1MA 5E8RA 3UJ6A 5K0JA 2N47A 1HNNA 2BM8A 2QYOA 4L7VA 2P3LA 3LDUA 4Y30A 1I1NA 4EQZA 1N7IA 3G89A 3KQPA 4F85A 2OZVA 1XXLA 4DA4A 3WSTA 2JJQA 4QPNA 2ZCJA 3KR1A 4QPPA 4OX9Y 4R6WA 2PV0A 2GS9A 1MHTA 3LBYA 5K0GA 4KDRA 3VC2A 3M6UA 2HMYB 1EJ6A 5FADA 2P1DA 1VIDA 5EEGA 3FRIA 5T6BA 2V74B 3NDJA 4P7FA 4UOEA 3LDFA 2QRVA 3LHDA 3HCFA 4IKPA 3M4XA 4LWOA 2ZBRA 4PYIA 4LECA 5HFJA 3BWMA 2YXEA 1Q0SA 2P7IA 3GRVA 5K0NA 5EHIA 1O54A 2R6ZA 4XUCA 3GXOA 3I9FA 3LGAA 1P1BA 5CVJA 5GP1A 3U81A 4YMGA 5KVAA 3BZBA 2JHPA 2VP3A 1NW8A 3P9KA 3GJYA 4PWYA 5E1DA 5EVJA 3SM3A 4MQ4A 2YXDA 1AQJA 3G5TA 3HA3A 1F3LA 5ICEA 2UYCA 2NP7A 1JQDA 1JQEA 5IKMA 2AOTB 3GRRA 4K6MA 5EMJA 4R8SA 3PS9A 2G72A 3AY0A 3TLJA 2ZFUA 1M6EX 2XYRA 1L9KA 3PTAA 3FRHA 5DXAA 3F4KA 2GH1A 3ELYA 5E2BA 3FYDA 5EEHA 4EKIA 2PT6A 3FUTA 4OQEA 1YF3A 2AOXA 5EHGA 1VE3A 2I9KA 3EGVA 1WZNA 4YUYA 5BP7A 3B3FA 1QAQA 5FUBA 5T67A 1EAMA 2F8LA 2CL5A 2B2CA 3LBFA 3HNRA 4GOLD 2O57A 4HH4A 3M33A 3TKYA 1XJ5A 4Z2YA 3UFBA 5LQJA 4PYKA 5DLYA 5KYGA 3BKWA 4OBWA 3C0KA 1IXKA 4C08A 2QE6A 4RV9A 4PCAA 3G8BA 3P2KA 5FHQA 3UJBA 3HVKA 2ZVJA 3ERCA 3PFGA 4XUDA 4CWAA 2IGTA 5FWDA 2HWKA 5LQKA 2B78A 3ID6C 4X1OA 5C9ZA 3VC1A 4HG2A 2VDVE 2FRXA 1YB2A 3K6RA 2PLWA 3UA3A 4EMSA 3NMUF 2EJUA 3X0DA 2G1PA 5E9WA 2B25A 1FJXA 3TM4A 4U7TB 3P97A 5EMLA 1BKYA 5E1BA 3KHKA 3TFWA 3TM5A 3BWBA 1KYZA 4RYLA 4GOMD 1L1EA 5P8WA 4AUKA 4PYMA 2YXLA 3MERA 2AVNA 4YV0A 5HILA 5CVVA 2YTZA 3ELWA 2PJDA 3JWHA 4RTNA 4X60A 3FTFA 3I64A 3ELDA 3LKZA 2XYQA 1XCLA 1KPHA 2CKDA 2ONZA 4M38A 4QTTB 5CVUA 4AX8A 1D2HA 5EIWA 1RJFA 5DWQA 3EVEA 2ERCA 1WS6A 3RODA 2OO3A 1INLA 2AN4A 4MWZA 4V0QA 3SX0A 2AS0A 1RI4A 3LL7A 3FTEA 1G8SA 1JG3A 3DH0A 5DM4A 1VP3A 5EQJB 1WXWA 2ZTHA 4R6XA 1WXXA 1DUSA 2LD4A 4MHTA 1FP1D 1TW3A 1X1DA 3V97A 3MB5A 3P8ZA 4QTUB 3SGLA 3EPPA 3HCEA 3LSTA 3P2IA 2PXAA 5DTRA 3MHTA 2WA1A 4CKCA 2GA9A 3UJDA 3P9NA 1T43A 2ZIGA 3AWIA 5HIIA 3BWCA 3LPMA 3HCDA 5FCDA 2H00A 2P41A 2OYRA 4YUXA 5U4XA 1UWVA 3DOUA 3DP7A 3KQVA 4FGZA 3EVZA 5DPMA 2Z6AA 1G60A 3FPJA 1NT2A 2QM3A 2ZZKA 2PSSA 3BGVA 3EVGA 3QOXA 2NXJA 3E23A 2IFTA 4OA8A 5E1OA 3T7RA 1RI5A 1XTPA 5JUWA 1WY7A 1SUSA 3UJ7A 4EVIA 3B5IA 2YQZA 4E2ZA 1V39A 3EVBA 3MTIA 5KQSA 1Y8CA 1O9HA 1NKVA 5GWXA 1XDSA 1EJ0A 3OPNA 4ER0A 2ZZMA 3EVDA 1YFLA 3GDHA 3KR0A 3MQ2A 2PGXA 2IDJA 2FCAA 4GUAA 2GAFA 4QQNA 2EFJA 3GNLA 3PX2A 1ORIA 4H0NA 3CKKA 1WG8A 5CM2Z 1P1CA 2YUIA 4EK9A 4PYQA 2DPMA 2AOUA 3EMDA 5IH3A 3JWJA 1RJGA 1OR8A 5LR6A 3EVAA 3BWYA 3LX6A 2BH2A 4DQ0A 4QVGA 3I5UA 3G88A 3C6KA 4HC4A 2FPOA 2IDKA 3B3JA 1FP2A 4CKBA 3FZGA 1F38A 1IM8A 3I58A 2I7CA 4FP9A 4RVFA 2PX8A 3GCZA 5DSXA 1RJEA 4PNEA 4YUWA 2XYVA 5K03A 1BHJA 5GIOE 1PRYA 5BXYA 3EEOA 4P58A 1MJFA 3R3HA 3LECA 2AR0A 1JSXA 1G38A 4ISCA 3SXJA 3NWEA 1QAMA 1SQFA 5DRTA 4RTSA 1ZGAA 5LSAA 3TQSA 4DCMA 2AOUB 5G02A 3NVKI 3M70A 2WK1A 1G6Q1 3DLIA 3A26A 5EKUA 5LQCA 4FR0A 1H1DA 2VDWA 4LWPA 5DX8A 1X1BA 4DKJA 2Y1XA 3NTVA 2FK8A 3DMGA 3NW9A 2B9EA 3GIWA 3IYLW 4M36A 4RSRA 2OB2A 5HIJA 3P9CA 3HEMA 5FQOA 2NXCA 3UJ9A 3HP7A 1M0EA 3DUWA 5H02A 4HGYA 3O7WA 3M6XA 1BC5A 4F86A 1UFKA 2CMHA 1SVUA 5LQNA 9MHTA 1SQGA 4M7RA 4YMHA 1EQAA 4DMGA 2Z6UA 1EIZA 5HZMA 1O9GA 3KPWA 5K0BA 2JH9A 3ORHA 8MHTA 1DL5A 1RI2A 4KIFA 4RVGA 5GOZA 1JSZA 1G55A 4AZVA 3DMHA 1XCJA 5HIKA 1R18A 2PT9A 4Y2HA 4LG1A 1JG1A 1KR5A 2XBMA 1XDZA 4CKEA 3LCUA 3KPUA 5KS2A 3LKDA 3BGDA 2ZLBA 2P3OA 3CGGA 5C1IA 5CCBA 1SKMA 4QQKA 3HVHA 4MTLA 3SSOA 5K01A 4RTOA 1KYWA 5CD1A 3QOWA 3SSMA 4FT2A 2ZSUA 4HGZA 3MTEA 4RTQA 4HRAA 1AF7A 4P7KA 4PIMA 3KR2A 3CCFA 1P39A 2BM9A 5F2OA 3TOSA 4CTKA 1JQ3A 1R8YA 2EX4A 3FUWA 2CWWA 2HR1A 5FULA 4C05A 2GB4A 3IV6A 1ZG3A 3NJRA 3KU1A 3OU6A 5DTMA 1I9GA 1KP9A 1JR4A 5DM0A 2IBSA 1I4WA 4OBXA 2P8JA 5E8JA 1YUBA 2IH4A 2NXEA 3BXOA 3CJTA 1X19A 3BGIA 4ER3A 2XVAA 3G2QA 5EOVA 3OE4A 2AN3A 2PWYA 3GRUA 3UJ8A 2PX4A 4B17A 4E2WA 2HTEA 2PVCA 2PX5A 3HCCA 2PKWA 2VS1A 3OE5A 2OXTA 5ERGB 5BW4A 2UYHA 2EJTA 2QRVB 5DTQA 3FUVA 2PWPA 4HTFB 3TKAA 4KWCA 2P40A 3GRZA 1RI1A 1X1CA 3SR4A 3K0BA 2ZIEA 3L8DA 5T64A 5EC8A 4DM3A 4RTJA 3TRKA 1TW2A 3GRYA 3KQQA 4QDJA 2ZWAA 3OFKA 3DLCA 2BR5A 3LCVB 1AQIA 4QVKA 3SMQA 2JG3A 3G2PA 4KIGA 4PYOA 1ZGJA 1KHHA 3FTCA 2Z6QA 4C07A 1R74A 2B3TA 5E9JA 2AOVA 3KQWA 3BT7A 3UJAA 4RVDA 3C3PA 1KPIA 2C7RA 3E05A 3IEIA 4GC9A 4PONA 3CBGA 4E32A 3ELUA 5K09A 2H11A 2R3SA 1SG9A 3A7DA 2I62A 3DR5A 3KQOA 4V0RA 3VYWA 5ICGA 2ZBQA 3I53A 5DM1A 4BY9E 1IY9A 1ZKDA 4C03A 4OA5A 5K05A 1FBNA 4E33A 5BW5A 3UBTA 3E8SA 4JXJA 3CC8A 3B3GA 5FHRA 2YX1A 3O4FA 4GQBA 5GM1A 2FK7A 3UJCA 3IHTA 5K0EA 4PCLA 1HMYA 1Z3CA 5B1SA 2H1RA 2PY6A 3SSNA 2AOWA 2BZGA 1YFJA 2AVDA 4ER5A 3V8VA 4RTRA 5CVEA 3C3YA 2ZW9A 3B7PA 3PVCA 5DT2A 2P7HA 4OQDA 3BUSA 2AOTA 1PJZA 3HCAA 1NW5A 2HNKA 3KR9A 3THSA 3PX3A 2ONYA 4WVLA 3FPHA 3VSEA 2IBTA 2IH5A 2IH2A 3R6TA 2KW5A 3G7UA 3DXZA 4X61A 2ZZNA 1U2ZA 2ZIFA 4C06A 5FA8A 4GEKA 2BR3A 3TPZA 3G2MA 4FS8A 3T7TA 3THRA 3RIEA 5HEKA 4A6DA 4ATNA 4DZRA 4ER6A 5FTWA 4PINA 1KIAA 5EG5A 1JTEA 4E2YA 1D2CA 3HA7A 3OZSA 1ZQ9A 2DULA 2ESRA 3KKZA 4GBED 3LCCA 2BR4A 4RTKA 4F84A 3S68A 1N2XA 2Q41A 5CUQA 5F2KA 3PT9A 3HVIA 2G8NA 2JHCA 3E7PA 3OCJA 2FHPA 1X1AA 3EMBA 1NV8A 4R05A 5ICCA 2C7OA 1RI3A 4AZTA 2VDUE 1M6YA 3P2EA 3FPGA 3QV2A 2PX2A 2NP6A 2XVMA 1L3BA 1VLMA 3EVFA 4BLVA 4C4AA 5MHTA 4AZWA 3C6MA 3M6VA 5EZQA 3T0IA 1R6AA 2ZBPA 5K0FA 4PYNA 2JH8A 1YZHA 1NE2A 1FPQA 2Y1WA 4HTFA 5K0CA 2OBFA 4PYLA 5HOQA 3ANXA 1UIRA 5E9QA 3UWPA 3ME5A 3ER9A 4POOA 1N7JA 3KPYA 5D1NA 4AZSA 4X63A 4C04A 3OZTA 3EEYA 3A27A 3HA5A 3HCBA 5M5BA 3ER8A 5FWAA 4A6EA 3PLAE 3FPFA 3JWGA 1ORHA 2UYQA 3H2BA 3OU7A 4KVZA 5FQNA 3SVZA 1QZZA 2YR0A 4EKGA 3EGIA 3MCTA 4NECA 4QDKA 3G5LA 4XUEA 4PIPA 5LQAA 1JG2A 3JWIA 1NBHA 1BOOA 5CCXA 4GOOD 3DTNA 3TMAA 3T7SA 3DMFA 3OZRA 4BLUA 3MAGA 4U7PB 1VP9A 1VBFA 2P3QA 3PB3A 5JR3A 1KXZA 2NYUA 4CXMA 2V7EA 5EPEA 2AZTA 3MGGA 1AV6A 1NW3A 2FYTA 5K8VA 3DXXA 3AXTA 3DXYA 1QAOA 1R00A 1EG2A 4FSDA 3FTDA 3HVJA 4KDCA 4XCXA 3EVCA 1NW7A 1B42A
chains in the Genus database with same CATH superfamily
1EDDA 2D1RA 2VSFA 3HYNA 5KNBD 2PXXA 4MRPA 1BFDA 1TJNA 1G21B 2IW3A 4G81A 2I55A 4UCXA 1Z4MA 1OGJA 1Y4UA 5DYNA 3VYTB 2Y66A 5FNVF 4IWXA 4WCDA 4EHIA 1Y9ZA 3KKLA 1J39A 1YFKA 4P81A 2UZ4A 2PZKA 4Z3KA 2NZWA 3FNIA 1OFTA 4TQGA 2DCUA 5T3YA 3UFXA 5KTRA 1QGZA 1HYQA 1O5TA 1Q17A 3PXBA 1D2AA 4JP1A 5ICFA 2VQSA 1QK5A 4P7JA 2V3CC 3PNQA 2YMMA 4F97A 1ESDA 2J9FB 1YZVA 4AFNA 4E0BA 1XSEA 1SIOA 4RDCA 4B83A 1NVVQ 4EWLA 2ZJ7A 1NQVA 3FZYA 4TTJA 2G88A 3MOGA 5JCJD 3DO8A 2YVQA 2ZB8A 1N2ZA 3VAZA 2PUAA 2Z1DA 3KZCA 2O50A 3GQVA 4KO8A 1CUJA 5EIBD 5JQGA 5LJIA 1PJBA 3R9WA 1OIVA 2HX1A 2RHCA 3PZRA 1F4LA 4AN1A 3MYYA 4KXNA 4E08A 3FCYA 3A1WA 3TWOA 3WY9A 1L3CA 4PX9A 4EYEA 1QQTA 4Q00A 5JD6A 3PFHA 1Z28A 3IHKA 3BK2A 4FLMA 4E70A 2IP1A 1NM5A 1YQXA 3VPHA 2ONCA 1G19A 3FUXA 2R2GA 4P6VF 4YC7A 2NW6A 4MZDA 3VR4H 2BGRA 4OXYA 4RH1A 1KMNA 4K03A 2YKGA 1NBIA 2FMTA 4HK4A 4B5LA 1U6JA 3AX6A 3QKRB 2DTDA 2YFKA 5LZ7A 5G0TA 4HPJB 1NG9A 5D1HA 1JIVA 4IL5A 4LRSB 4HNHA 1SCQA 4P4TA 5JWOA 4C2UA 2A0FA 5DX0A 5IN5A 3H1BA 3HTXA 3GMIA 1GZSA 3E61A 4B4UA 4ZVPA 5HKBA 4YCMA 4G01B 5CDFA 4RH0A 1P91A 2J4CA 3NTXA 5JDCC 2IPMA 2X3FA 4EUFA 2Q2OA 5FTJA 3CYFA 4HP8A 4W99A 3OO0A 1JTVA 2DUNA 2JJMA 2FPIB 5J2TB 1YMQA 4UTNA 5B5SA 1UANA 1O0BA 4YLEA 3PPWA 4DVJA 1NVEA 2BEWA 1W5EA 4LGMA 1S8AA 4R9VA 1GFSA 4XWKA 1LV8A 3C1TA 4RGQA 3H3JA 4ACBA 1DBSA 2RGCA 1E7SA 1B1CA 3ZDYB 4EM6A 3HA2A 5C7OO 4TTQA 5B1DA 3OC6A 3D3WB 4C1BA 4L7VA 1GPDG 4RVNA 4ZV7A 4LGCA 3LUDA 1GKUB 1TT5A 2DHDA 2R1TA 3JTMA 3NHBA 5T57A 2BFEB 1XEWY 2B9VA 4R68A 4D41A 4YXFA 3AVVA 2O1XA 3UMRA 1SVKA 3T5GA 3LBYA 1EUDA 1KO7A 2AUNA 4EMBA 5LVAA 5HTOA 1EEXB 1VECA 1SCJA 5T6BA 2C20A 1VSUA 3JQ8B 5CEJA 3T5BA 4FZ3A 5FV7A 1QM5A 1WPXA 1F2DA 3ORQA 1MVLA 3E8MA 1X7ZB 3FCEA 1SG6A 3KOWA 4FWIB 3R7LA 1JEJA 3V34A 4DLRA 1TPZA 4DIEA 3PGA1 1I30A 4W5RA 3FYHA 1OC4A 1G8PA 3GRVA 3SJAA 3F90A 3SS9X 2FPKA 2QMUA 5CVJA 3NWPA 4XPIB 5KYGA 3K0CC 2RK3A 1YRLA 4HNRA 1JUDA 4AJLA 3GMTA 1RAHA 3TLGA 5IPFA 1U28C 2H1CA 1EUQA 3I8XA 1G8FA 3AFIA 5FNZA 4A0GA 1THGA 1UZAA 3MLAA 1L1FA 3RJ9A 1IDOA 4IO1A 3VH4A 3STUA 3H7AA 5H80A 3TLJA 3I0MA 3R7NA 3KLPX 2X9GA 3OG9A 1PL6A 2BJVA 4KV9A 4OOEA 1ZINA 5CH3A 5ELLA 1VE1A 2IHVA 3KFXA 3L8YA 4FDVA 2WJZB 4PNHA 5EHGA 1C30A 5IS2A 4P7BA 4GDMA 4QHSA 5CW2A 3EFBA 4G4GA 4BVFA 5KI6A 5AW7A 5T67A 3K70C 2O0KA 4H2DA 4OHKA 2G9VA 3V7FA 2O57A 4ARUA 2BMFA 1AKWA 3WGIA 1UKAA 3ZXUB 2HIAA 1GXSB 2JLVA 3B1WA 3C0KA 1Y7PA 3TQOA 3UICA 4PCAA 2ID7A 3DMDA 2EZ8A 3ZY6A 5LQKA 4G4SO 3V4LA 4Z0NA 1SXGA 3KKQA 4X1OA 4H27A 4R0VA 4NONA 4WXRA 5EJIA 2CFIA 3LY7A 3GPBA 3H2KA 3T1OA 3I5YA 4IHQA 3ENWA 3HSKA 5EIBC 1KIMA 4MS1A 4YGXB 1ENZA 1LVGA 1V2HE 1XN1A 2DFKB 2FDXA 2W2OA 2AYZA 1UJCA 3AR2A 3R76A 4DHEA 4EIWA 4AUKA 3LNCA 3Q2IA 4P86A 4CCAA 1B93A 4JBIA 2AVNA 1KZ6A 5HILA 2JPDA 4J0QA 3SG0A 5FPTA 5BUSA 3MVEA 2MU1A 1TO1E 3O8QB 2WPNA 3HPRA 3FWNA 4XWOA 1KVQA 2PD4A 3K5HA 3F9RA 4HDMB 4AX8A 3NTLA 5DWQA 1TD1A 1UZLA 1JA1A 4G1VA 1INLA 4KQ2A 4ZK2A 4GWLA 4UEOA 2PUGA 2XT0A 4EQ6B 3FTEA 3D9QX 3SEQA 3S2FA 1XZDA 3VSBA 1B8VA 2R7NA 1OQAA 1QXSA 4JIGA 5KOJB 4CUJA 1KGDA 2AC7A 4BVJA 1OGYA 2E6KA 3OTOB 4LZNA 4JBYA 4AF7A 4AMZA 3VZBA 2V7VA 1Q11A 4P35A 4QDZA 4B3JA 4YT2A 2EKQA 2Q3MA 2ZIVB 3R8FA 2E4VA 1TVEA 1K6XA 3CUUA 1HNXB 1SOMA 4Y6RA 1YGPA 2N75A 1KIFA 3FCSB 2OFXA 3KXKA 4ZOEA 3G2JA 4FHEA 4GE3A 4QRIA 3NRCA 3SBXA 5F23A 1FTYA 4PHTA 1SZCA 3NHWA 4I55F 3W3AA 4YUXA 4ZJYA 1L5KA 1BWPA 1LDNA 3DP7A 2WT4A 3VJKA 2JH3A 3G0DA 3ZQ6A 4GNRA 3KKEA 5JE8A 4ZN6A 3LWZA 5JYDA 4CRWB 4F3NA 3GJ8A 5ISMA 3ADBA 1L4EA 4OATA 4BO1A 3L1IA 5A5FA 2ZRJA 1E7WA 1XTPA 4J07A 1WY7A 4IV5A 2XXJA 1CRWG 4WKNA 3PWKA 1WO8A 3RU7A 3MINB 1BRTA 2EU8A 2VJKA 1VHQA 1EE1A 2J30A 2F3QA 1KH3A 1P5HA 2KB0A 4DUGD 5AW4A 4UBLA 2GOYA 5A5EA 4ER0A 4KXFB 3GLSA 2VATA 3GDHA 3TIXB 4C1NA 3C8UA 2WYVA 2VF7A 2Y2VA 4A0QA 4KR9A 2OBNA 1DE0A 3AVYA 3G68A 4NY1A 4TVSA 3L0DA 2FZEA 2XZTA 4BC0A 2H16A 4A5OA 4LSGA 3PUZA 1RS0A 4IS2A 4UMVA 3EMDA 4I1IA 4QXPA 1IONA 4DUGA 1GL3A 2R6HA 3PICA 4CEJA 1J7KA 4JEHA 4B3CA 1FX0B 1QRRA 5E7IA 2ZI5A 3U40A 3I5AA 2IDKA 2WKQA 3TE7A 4RVFA 1F38A 2VA8A 4FUTA 2KX7A 1KBQA 2FQYA 4EPTA 1DV2A 4NI5A 2BHLA 4Q34A 4DJDC 3EG9B 3P9ZA 4Y6LA 1DX9A 3ASZA 2A9QA 3LC0A 1WUKS 4QYTA 3IQZA 2OBXA 4RPJA 2A9VA 3GF4A 5E6UA 3VTZA 1G20B 3TIGA 4BQQA 4WY8A 5F9MA 4JI8B 4G0XA 2XMCA 2GJ8A 5C4MA 3W3AD 5AVTA 4N41A 4BKUA 1J0DA 3HY6A 3WMEA 3MRSA 2H7CA 2R8BA 3RRMA 2P6RA 3OX2A 2VPIA 1E7QA 1X8KA 2VDWA 5LYJA 4L4ZA 3EQ2A 3WYNA 1OVGA 5ESRA 4ESEA 4YAUA 2I9PA 5A2QA 2YNMC 1OWNA 2R6CA 1TU0A 3QOYA 1P3JA 1SVNA 3R0IA 4MKXA 4EO4A 1FX1A 5BQOA 2WM9B 4HFJA 3W90A 3VU3A 1EWKA 1K6EA 5JJIA 3WLEA 1VIYA 1ZRSA 4MMXB 3GZTB 5ULLA 1J99A 3KLBA 4FB5A 2C3PA 1UBSB 3CO5A 1YVPA 4TT3A 2MR5A 3PYMA 3M83A 2I22A 4KAXA 4NC9A 1UJMA 1DQZA 2WJJA 1ZIPA 3GJTA 5H7XA 4NARA 2HHCA 1YZGA 1ODLA 5ECGC 2BP7A 1FW6A 4OGWA 3G5UA 3SICE 3BGDA 4QFBA 1XNRB 2H29A 1E5DA 1NMSA 1KJYA 2O2SA 1NVVR 1RBYA 3ESRA 1Z2NX 3JQPA 9LDTA 5LNK1 4RELA 1G1AA 1TK2A 2VYFA 3A3PA 3JAWA 1T4GA 2ZROA 3B1KA 3GD7A 1A9TA 1XZAA 2ZUBA 1OXSC 2JGLA 3AEUB 3G2NA 4TSRA 3DPIA 2BGMA 4R5HA 5EJFA 4EY7A 3U9SA 1Z47A 5ADVA 2JGIA 4QQFA 1QIEA 3OU6A 5HKLA 4OBXA 2P8JA 1LKZA 1X1SA 1YUBA 2LP4Y 2W71A 1YS1X 1PR1A 1KZGB 1TQ6A 1H3FA 1K9VF 1UFRA 1U3WA 3IH5A 3LXUX 4ER3A 3T5PA 3G2QA 4WXYB 4Q9LA 1XMPA 2HPZA 3MM4A 2OXTA 2VJAA 5F1PA 1N5OX 2PKRA 2DFNA 3OETA 4P3KA 2B6HA 5GV8A 4J7UA 3VGJA 1PX2A 4BEBA 5K5EA 3TKAA 1ICIA 4RGBA 4YFVA 3QBJA 1KK3A 2REXB 1W1IA 4DYHA 2XQGA 1E9SA 3QKSB 3KQQA 2I4IA 1E9EA 2ZYRA 2FEAA 3GJQA 3TRKA 3FNBA 3RARA 3UYLA 3OFKA 1R6DA 4UATA 4QVKA 1OX4B 1Y80A 2W4IA 2CJXA 4IBOA 4IEEA 4LA4A 3PVSA 2O2DA 1KHHA 4A8HA 2J3JA 1NXQA 3IURA 3TEMA 4BBJA 1CY0A 1RWVA 4JB2A 1MXFA 4NFSA 1UPCA 1P77A 4PX5A 5PNTA 4BMZA 2PRIA 3TEJA 4JOQA 4KWHA 2X5OA 4UE6A 1UJ6A 4TLBA 5DVZA 5K6TA 3IP7A 4GC9A 1KDTA 3TFQA 4B73A 5K09A 2HJRA 3GLFA 1C0KA 2VYCA 5ALTA 2P8SA 2EBUA 2QJOA 3M5PA 1PL8A 2WKSA 4MW6A 3S1AB 1XNQB 1SIWA 2OK7A 4MINA 1E1YA 4MVJH 4CMIB 3E8SA 2PZMA 3Q3EA 1QUEA 3QLJA 5D3KA 4RNDB 2FW6A 3RBZA 5ITZB 2FRDA 7MDHA 1ZSVA 4C6RA 5GM1A 1EAYA 5KWJA 4D46A 3MPUA 1TTPB 2OAEA 3QPUA 4FU0A 2GEVA 1HURA 1N6PA 4PXAA 3H9QA 1L5LA 2WTNA 3L6EA 1GT6A 4LCBA 4BO7A 1R9MA 1AH2A 2IEYA 4RTRA 1UMCB 2REOA 4BXOA 3EEBA 3CUTA 4IQ8A 1FE8A 3DZGA 3IAEA 1AMNA 3NHMA 4MS3B 1KQ3A 4DM7A 3GUUA 4GPTA 4WKCA 3W8NA 4EYQA 3LQYA 1EDBA 3GPCA 2ONYA 4JX8A 4CKBB 2HSZA 4DABA 5L7WA 2CN1A 3RVBA 1CP2A 2OORC 4R1LA 3UB4A 1KA9H 4B85A 4ZZ1A 5BSKA 1K8RA 1SZPA 4I7EA 2OCBA 5CYGA 3DVLA 3WLSA 2AJTA 4DWWA 5J4VA 5J40A 2HA4A 3T4XA 5IT4A 3RD5A 1HWYA 3FTQA 3H16A 5FTWA 3N07A 3EXEB 3GLHB 1P8JA 3DDZX 4HDOB 4PPFA 4BKRA 3TG2A 4Q7KA 2RGAA 3ROMA 1KWGA 4P34A 4N7BA 3RYFB 3STVA 1WKVA 2NACA 1CDDA 1CZHA 3PFWO 3WJ7A 5A05A 5GJBA 1YS7A 2HM7A 3C45A 3OCJA 2YYAA 2XUIA 4ZAWA 1RMTA 4MR8A 4NE7A 3T3OA 3FFAA 4BO2A 1Z5VA 2RDMA 2RI1A 2VI5A 3X1MA 1O5OA 4JCOA 2ATIA 3ZPXA 5AO9A 2Q5QA 1A27A 1N8NA 4M88A 5C4GB 3M6VA 1YA8A 1H9BA 2EGHA 3K96A 4TKVB 1M2JA 2Q8PA 1ZGBA 2CE7A 2IYQA 4UHCA 3AYZB 3ROTA 4D42A 3OESA 2XT9A 3ANXA 3F5SA 4K9LA 3LT4A 4CIXA 3ME5A 5D7BA 1E79A 4AYXA 3HJRA 5LIPA 4MRSA 2ZSKA 3BG5A 3E7DA 4F5DA 1XQ1A 5BUCA 2WJ3A 1H4TA 3ADPA 3RS7A 3RIYA 2FEPA 4BVHA 4HLDA 4MGKR 4Q4HA 4YJ2A 3VJRA 3EGIA 4ZQBA 1D7OA 1M76A 2GZMA 2D8MA 4RAOA 1RZRD 4MB6A 2QW0X 1PE0A 3G9TA 1NMEA 3TB4A 1RVDA 1IOVA 1VZ2A 3HO8A 1GKYA 1RFLA 4LYFA 3VU1A 1JT2A 2W00A 3PB3A 5TGTA 4AUEA 5JFOA 3Q3VA 2QSUA 2QS9A 2W43A 1GARA 1YU6A 2P4EA 3JQCA 3MGGA 4J2OA 2FYTA 1DEHA 1PEAA 3GGSA 5KSZA 5FB3A 3PHHA 4UTZA 2A9OA 1LS1A 1VKNA 3HVJA 2OUKA 3I9KA 3ZLTA 1BDMA 4KDCA 2H2GA 1G8JA 2W11A 4YRIA 1GM5A 5C3MA 4QZVA 3X1JA 1O57A 1KARA 1TA4A 2IYYA 2ZAYA 2ZS9A 2ZPAA 3K5PA 2AE2A 2Q7DA 4C7XA 3ZVKA 4E2XA 2RHMA 2O0JA 1ID8A 1V9LA 3R5KA 4IXNA 3HGQA 3FOWA 3GJ3A 4ICIA 3PRHA 5LU9A 1G7SA 3P9IA 4A2PA 3EWIA 3LAWA 4NABA 4TM8A 3CVYA 2A9KA 1BXRB 3H5VA 2QL7A 3E22B 1QHNA 2ZITA 4QOHA 3ZV6A 4BRSA 4RTPA 1FFSA 1A2BA 1DHRA 2AC2A 4F5ZA 1EWYA 2PBFA 2Q2WA 2PL9A 3M3HA 1URPA 2F9MA 3EXFA 1HQYE 2A1TS 1SURA 1IG3A 3KQSA 5H59A 2ODAA 4EHAA 4DYDA 3IA7A 1GV0A 2XPCA 3RAFC 4NMMA 3DO6A 1YB5A 3AY6A 1F8XA 2Z5VA 4LKOA 4BP3A 3ZGLA 1OFIA 3KEMA 1YE3A 3O94A 2IY7A 2WU8A 1VJRA 2NTNA 4F9TA 4PGAA 5BYKA 1D2GA 3JQ7A 2I2FA 2W22A 4YR9A 5LMNB 4L8YA 4HEA6 1YDFA 4OHUA 1XF1A 3KZKA 1MX3A 4P80A 4V1CA 4W5WA 2R62A 3SC6A 4IFBA 5ALDA 5DCWA 3SC4A 3BRQA 5EWMB 3WWOA 2GYVA 2QIOA 2W2KB 2YJ5A 1M1ZA 1R4NA 2V97A 3D8SA 3QLVA 4H18A 4I36A 1ZRNA 4YRCA 5EMMA 2NGRA 1CUVA 1ODTC 3KTDA 4JYMA 2H17A 1CUFA 3RC9A 3S2ZA 4F7WA 1KI1A 2QK4A 2QBYB 1L4BA 2NO6A 3ER6A 3VPAA 1MJHA 2W8ZA 2LBPA 4XJSA 5HZGA 4NYIR 1XA4A 5F5NA 2H8GA 5BVHA 3GNSA 3QVXA 2W2QA 2EP5A 3D5QA 5CFMA 1CVRA 2R68A 1XXHB 1EINA 3MQFA 4P5DA 5CP8A 1B41A 2YZMA 4OH1A 2P91A 1WVIA 2Z1MA 4V2IA 1A77A 2QYHA 5JRDS 4B3FX 3OA0A 1N2CB 1R15A 1DBIA 1GNSA 8LDHA 5B4UA 1BGXT 4DS3A 3EPRA 4DB4A 1O4VA 1FTGA 1NX6A 1ODSA 1QRAA 2XOKD 1P7PA 5GMOA 5KJ6A 4RPCA 4IHJB 3RHSA 1Y89A 1H8EA 3C4VA 4KAAA 3WDLA 1E2EA 1S3SA 2AK3A 2Z3ZA 3KB8A 4MQ6A 4XWAA 4AROA 4B44A 4UPDA 3A4TA 2FN4A 2GNPA 1B2RA 2X7XA 3VM6A 3M6WA 2AG6A 3GMSA 4LK3A 4RPHA 2IHKA 5HQ3A 5TNXA 4EY8A 1E6WA 3HKCB 1UBTS 1ZMBA 3OU2A 4MH0R 4E7PA 4CQMD 4EHHA 4YRGA 4YTEA 1JB1A 4I08A 3CPEA 2XTZA 3DOIA 2C7PA 2AHOA 2JHAA 1XJQA 2OZLA 2ZJ0A 1BAPA 2RCNA 4J0DA 2O8EA 4PHCA 3M81A 3WAGA 5TEWA 1XPRA 3CEPB 1VTKA 4F5YA 3T6KA 2FA9A 2VH5R 2YWGA 2L42A 1YRYE 3G89A 3ZOKA 4F04A 1SXQA 2DPYA 1SWWA 1E2BA 2YWRA 3PC8A 3PDHA 4R6WA 5DBOA 1XNJA 2KI5A 4LVUA 1ZEMA 1Z38A 3T99A 5JAMA 1JNXX 3MMPA 2M6KA 4I4LA 4XM2A 2VUTA 1N8KA 3PFIA 1FYXA 5FPPA 5DHSA 1A9ZA 3IUMA 1YONA 3N0TA 1Q0SA 1RLIA 1IN6A 1M6VA 5K0NA 1D09A 1OI4A 3RLIA 1M72A 2RH4A 1C4OA 1XTJA 4YMGA 3JQBC 4P3NA 5AHOA 2O3TA 3ZWXA 2O2CA 3TTYA 3JQQA 1DQYA 4FFVA 4OV6B 2BGNA 2UYCA 4CU5A 4H3KB 3FOCA 3ANYB 2NM0A 1LX6A 3N0XA 4MWSA 1TLFA 3TB6A 1N8SA 1TVKB 3TQHA 3C8ZA 2F17A 3WX0A 4UOZA 4LE1A 3THXA 3HMQA 1ZUNA 5H81A 1DLJA 4AVYA 4DLXA 4HNAA 4BVEA 4WGGA 5JIBA 2I4MA 2WZQA 4PVCA 4AC9A 1JHPA 2OAGA 2PAFA 4GAEA 4LTNA 4UD2A 2I6FA 1KZYC 3JWEA 3BD6A 2WU4A 3JZMA 4M83A 1QAQA 1VJGA 2OEPA 4OQZA 1L5OA 1G20A 2DSTA 2LNDA 2J67A 4BQIA 1XJ5A 3DUFB 4Q05A 3V7WA 1MTZA 4A8JA 5LQJA 1TC2A 3A2LA 4MHSA 1NUAA 2JKYA 2YVUA 3TNLA 3CN7A 3AW8A 1RADA 3Q8WA 2I03A 3R5FA 1L7EA 2QMYA 2UXBB 1YJXA 4RADA 2JEYA 2FVXA 3ZGYA 2QSZA 4RU1A 4K40A 3W0LB 4B1FA 1XMOB 1HOTA 2NVOA 3DB1A 3MT9A 3NMUF 1EWQA 1XXHA 4PHHA 3DDSA 4D7AA 3WGOA 3WK5A 1W93A 4GT1A 1JVBA 4M8LA 2Z4RA 1FRZA 3FZEA 1B1AA 5JC8A 3PGJA 2ZE5A 2OBMA 4HVCA 2YZ2A 3A11A 5EKDA 5JCPA 4J76A 2A2ZA 4F60A 1WMFA 1A7KA 1KSHA 1LI7A 1I9CA 2PN1A 3DS8A 2JIDA 3ELWA 4FZJA 1E9CA 4JJ4A 3WLOA 3ZE2B 1QO0D 4TTVA 1VJDA 1KPHA 3LUGA 4YO7A 4M38A 1K08A 4EY6A 4CI9A 2OSVA 1RJFA 3PJDA 1DIAA 2OO3A 1T10A 4ACAA 1RQRA 4PTLA 1TTQB 1Y34E 4KN8A 4M0LA 4I1RA 4AS1A 1I0ZA 1GUYA 1SC1A 1UBCA 3QY9A 4A26A 4LYDA 1HDZA 1DUSA 1R0YA 3OFND 4EB3A 4X54A 2Q4RA 3RC7A 3ZUPA 3MMZA 4TVBA 3V97A 5FUYA 1RKBA 5BWBA 3EDOA 3Q0IA 3K0AA 5T3UA 4YIHA 3FDZB 3KLMX 3P2IA 2X4GA 4CQNA 2O8FB 5KNCA 1K88A 2Q9CA 4NBWA 3P9NA 4NU6A 4NHOA 1N36B 1HTBA 3EXFB 1UPAA 3WNZA 3TUIC 3OE7D 1UPBA 1CY1A 3B7WA 3QELA 2NVUB 4QLBA 3DOUA 4BKPA 3C6ZA 1KI6B 2ZRQA 3AP1A 3EVZA 4WXEA 2VQ3A 4Y7DA 2BY4A 1BMQA 1QHGA 1QCDA 4DLSA 3FPJA 4WBNA 3IJPA 3QU5A 2PSSA 2UVPA 3HKDA 3O9ZA 2WSSD 1PU2A 3T1TA 2IJGX 3D43A 1EP1B 4LDNA 3V8EA 3N8KA 2DQSA 4U8GA 4GX0A 5K6AA 3BMOA 4K0RA 2HA3A 4CEHA 3FJOA 3MBOA 3OA2A 4J7XA 4L3OA 1EPUA 5TVGA 5ITVA 3EF1A 1SHZA 5DGXA 3RT1A 5FTMA 1IBCA 5F12A 3CR3C 2YHIB 3VYSB 3U60B 5JYBA 1I4TD 2HREA 2JB9A 3NX4A 2R6AA 4OHRA 2RHWA 2H4HA 4PZDA 3GZNB 2ZYSA 1OBCA 1WUIS 3EDRA 3KETA 1L5ZA 1WOMA 1JLSA 2EYQA 3K0EA 2CFCA 3FHLA 2VK8A 3HCRA 5FAXA 5CFZA 2IC5A 4TMYA 4QU9A 1EXWA 3RIGA 1DQSA 3EMKA 2W5UA 4BQFA 4Y2VA 4MIOA 2YHBA 4UEKA 2BM1A 1XP5A 3LX6A 1OYOA 3AONB 2WW8A 3L9XA 1HT2E 2K5UA 1Z83A 2CFRA 2ODNA 3V8RA 4AWBA 5JQWA 3GJXC 1H4QA 2A7XA 2Z6VA 3SQXA 1R7RA 1RRCA 1IBRA 4NPAA 3SD7A 2C9DA 5JAHA 4NCAA 2ZYWX 2CZCA 3AEUA 4DV7B 3LP5A 1XEWX 4B43A 1SQSA 3G1WA 3PFBA 2PQMA 3OIWA 5K3DA 5KNDD 2VP5A 2P9GA 4LSMA 3AHJA 3BFVA 4DCMA 1J0EA 3LVQE 1IZ8A 2PBLA 4JP5A 5DTJA 2VHTA 3TIFA 3C8MA 4L74A 4L28A 2GK3A 2JIBA 5JNRA 5H70A 3CNBA 1L8QA 2FK8A 4F6LA 4ZYYA 2IYZA 3CX4A 4UU8A 1LF5A 4NSNA 5CITA 4YDQA 1DELA 1BG6A 2ZYTX 3R5HA 3S2SA 2IZZA 1Z7YA 3UCEA 1FFCA 2WHRA 1I3KA 3PXDA 1Q7BA 3NYRA 2HXYA 4K8RB 4N0QA 1E1CB 1OYWA 1V11A 1IY1A 2CFTA 3ZLBA 3F97A 1JZQA 3KPWA 2YFYA 3TNDA 1VJTA 1J9GA 4HMPA 4ENRA 4ARZA 1EUDB 2NSLA 4WK6A 1X7ZA 4A27A 3MWEA 3Q7QA 3RTGA 4LOJA 1LLQA 1VL6A 2VDRB 3RVSA 1AY0A 3DDCA 3IDZA 3SZOA 3VZQA 4XFKA 2WM8A 4RY9A 1KEZA 5AKIA 4MW0A 1BWQA 1C5KA 3DT9A 3I6BA 4NTZA 4X20A 1NXVA 1UMDB 5CD1A 3M5DA 2FSHA 4QG3A 4UEWA 1NPDA 3TOSA 5F7XA 4FFWA 1QZXA 4LHWA 3N87A 2BVNA 4K9KA 5FULA 3DR3A 3JAKB 4ZEWA 2FMUA 2B6NA 1U02A 2WE7A 3GNTA 3NBXX 3KU1A 3DD5A 4PLFA 2QR2A 1JR4A 4NZOA 2IBSA 1ZD4A 3LBAA 4OX9B 1NIPA 4WA8A 1WL8A 2PFKA 2RI0A 4PQGA 4V1CI 1MUUA 3QY0A 2I4NA 3RJZA 3WIOA 1KORA 5FBVB 3F71A 3JARB 5B1YA 4OHPA 5DGDA 2IEBA 3QRWA 3BXFA 5CW1A 2PX5A 3A1DA 3CPSA 3OE5A 5ECYA 3V1LA 5EWJB 2GETA 3E0QA 2ZRBA 3H4MA 5EIOA 5M29A 2XYPA 4UBKA 3N0VA 3T1VA 4YJGB 2I87A 2AEEA 3IHLA 3IQIX 2IYSA 4K1XA 5EC8A 5EHNA 5H4HA 4ARZB 3EH1A 4Z53A 4Q1FA 1AZSC 4MW1A 5C81A 2WSMA 3R3WA 1KY4A 3HZOA 4Q3DA 1EGQA 4L5BA 1JKXA 1P4GA 2RKWA 3LL4A 1M34A 1R10A 5JSFA 4HVAA 4XVQA 2O5CA 4F8EA 3OZCA 1PFKA 5FWNA 1HG0A 3AZQA 5EMHA 1F5SA 2YCLA 3OKPA 5BT9A 3GDOA 3A2MA 3T9EA 5BMOA 4RMIA 3V42A 1AB5A 1IHXA 3F96A 4I50B 4Q1AA 4A6XA 4DRYA 5TQ2A 1O5IA 3CMCO 3DR5A 1LTKA 1P1KA 1SBZA 1YD7A 2W6JA 1P5FA 3BJIC 3IAUA 2YQ4A 3MJTA 4JOCA 1XTVA 1MQ8B 2W6IA 4ZZ2A 1ZM2A 4CKXA 4DXHA 4WZAB 2B8EA 4OA5A 2IXEA 1XQVA 1ADBA 1R1DA 3WGYA 3I0NA 5I9MA 4DW8A 5I45A 1DFIA 3D4IA 1FCJA 1V8ZA 3CLRD 5ECDA 5A06A 2ID9A 3MAJA 6LDHA 4V3CA 3HXKA 1R66A 1VB5A 4LF7B 1VXOA 3B38A 4WN9B 2JZCA 4HWOA 4BOYA 2QL6A 4MMYB 5JYCA 2FGKA 2GEDA 2FLKA 1IHYA 4FJ0A 3WV5A 4WDQA 1N5LA 3L06A 1Y5MA 2IF2A 2M98A 2P67A 3C3YA 1IY2A 3K20A 4BGVA 1H0HA 4RANA 4D9JA 5BWOA 3W5AA 3VMFA 3I2HA 4KSCA 1R0BA 1XZMA 2BE9A 1P17A 3GN2A 3RHTA 3CX3A 4YMUA 3A4YA 3VSEA 1K89A 2WYHA 2C3UA 2D8AA 1QMPA 3RVRA 2A5DA 4D4GA 1R88A 1M33A 1QVRA 3C7KA 3PF9A 4LBVA 3U31A 2ZZNA 1FZTA 3EX7C 4UNSA 4GHWA 4C06A 2DLNA 2J1LA 5FA8A 1CE8A 1NW4A 4H7EA 3T7TA 3TG8A 3NHJA 2BFMA 1JLMA 4KN6A 1U3UA 1C1XA 3UFXB 4C0SA 3BS4A 2VJMB 3AHEA 4PQFA 1JEQA 1GGKA 2J9RA 3KLOA 3LRPA 4C76A 1BDIA 3MPOA 5B4VA 2OZEA 1BD3A 2G5CA 2W6OA 1Y1QA 2DULA 5DHFA 1T5OA 4NCXA 4OI0A 1TKRA 1GRQA 3FOBA 1ZBDA 3S68A 2VDJA 1TYAE 3TRJA 3VOAA 4RKWA 3LPCA 2CBGA 2CKMA 1MLDA 2QL9A 4DJEC 5JBQA 1RQGA 3LGSA 3IUNA 3MTQA 2XHZA 4OUDB 4ZCMA 1TC1A 3DZCA 3IB6A 4G67A 4BBPA 4E1AA 1PR2A 4NOKA 5JS8A 2M1XA 2YY7A 4HGOA 3F5DA 2C82A 3WGJA 3WL3A 2H2HA 3OIFA 1KKMA 1W30A 1W9MA 1TJ5A 3QXJA 4HTFA 5CFNA 3Q8MA 3TZ6A 1V4NA 4PYLA 1G291 1DEAA 4DE5A 1EHCA 1Q7GA 4H3HB 2CUTA 4POOA 1OFVA 1AA9A 3H5OA 3DE0X 1II8B 3ER8A 4A2CA 3WAKA 4QYSA 1WDLA 2ERYA 2YIMA 3OE1A 4KXLA 5IC6A 2F3TA 4LMRA 2ZUCA 5CT4A 3S1AA 1G98A 3K6KA 2BI7A 3UHAA 2AX4A 1R9GA 2QM7A 2WF5A 2GBLA 3CCBA 3IV7A 3L82B 3LLVA 3OD1A 5CM8B 3TMAA 5KQPA 3OZDA 2WJPA 3GOHA 4GMKA 3HU5A 1NATA 3FDXA 5H1YA 3ILHA 4AYTA 4GQIA 5DLEA 1FDSA 4LV6A 4EG4A 4TKVA 3ZYZA 1LXCA 2QZZA 1QP8A 1RHUA 4JQZA 2EG9A 3KEOA 2BRUA 4KP7A 2AW3A 2GZ2A 1R00A 2JA1A 5CLIA 1MRSA 1C7QA 2V6JA 2ZWPA 3WYFA 5FDFA 5KO2A 1OH5A 3MQ4A 4HNGA 4C3UA 4E30A 4KQEA 3KAQA 4KO1S 1GG2A 4BNLA 1C9KA 2ZR8A 4QJ5A 4DSZA 1HYBA 2UZAA 4DARA 2HGSA 4HVLA 3AKZA 2ORYA 3FKJA 2K6GA 3LX5A 1UP6A 2ZKLA 5EI5A 5D8DA 4BTVA 3DQPA 3OFJA 5IN4A 1J8FA 3R2JA 3Q15C 4YP5A 3L2OB 1M7BA 3JQ9C 4G2NA 1I3NA 1C7RA 2C9YA 2X42A 3ZVRA 3JVDA 4CT4B 3U1BA 5CGZA 3U26A 1AO3A 5GINE 1ZMXA 3FW1A 4LNHA 3C4JA 3BIFA 2B92A 4GKVA 2B0JA 4DIDA 3DBRB 2QTVA 1Y82A 3F4BA 4C4PA 1KFEB 2REBA 5F1KA 3DQQA 3FYUA 9ATCA 1WUTA 4EJ2A 5DGTA 4H7JA 4QA9A 1W29A 2XQVA 2WWYA 5ES4B 2WIGA 2AV6A 4K9SA 3NDIA 3PGLA 3OBBA 1QHXA 2A92A 1SUDA 2ZU6A 4ZXPA 3GYGA 3W6OA 5L45A 4XD2A 4KR6A 1AS3A 3HI6A 4IMIB 3ITEA 5G3YA 2CXNA 2HT6A 4BIIA 3NR2A 2G1KA 3WRVA 1E9RA 3WDMA 3VR5A 1M5TA 1ZVQA 2ZRCA 3ETGA 4RSHA 3TXXA 5JYEA 1QQ7A 5AESA 5AVZA 1HSZA 1OTHA 4DF3A 1A69A 4OI2A 3PHIA 1N78A 2O05A 3NU1A 5FI3A 5HW0A 2ZXEA 4QQ8A 4WUVA 4BGDA 1P2TA 1ZUIA 2QSYA 1QYCA 4GYKA 2PNJA 3R7SA 4MUMA 2FWAA 3OFNA 1RWOA 3KQYA 3L7MA 4JB0A 3TR6A 3OQNA 1SXJA 2JD1A 2XVXA 1J21A 5TR9A 5JSQA 4GPEA 4ZMRA 3FSEA 2QOEA 4IZHA 1DEKA 2FR8A 2IDMA 3NNSA 5C8DA 2AN5A 1CUEA 4OJKA 1VLQA 3IIIA 1TKCA 1PGQA 2ZJBA 1FNMA 2AWOA 3I1YA 4WFIA 3RWMB 4CCYA 3FLMA 4M0EA 3V55A 3UJNA 1GSIA 1CV2A 2BM0A 1LSJA 2UZ1A 3RVNA 3ICQB 3I4FA 3O4GA 4D3YA 2RH5A 3DMNA 2WABA 3ZDRA 3PJEA 3ZZUA 1ZITA 3SEFA 4WCFA 4HSGA 4BNIA 1AKMA 3MUFA 2V7BA 1KK1A 3UXYA 1ZMOA 2PL5A 3HDHA 5FP0A 3FBTA 3K9BA 1XMVA 5LDDC 3WTCA 2G67A 3L04A 3DW3X 4Y2QA 3TGPA 5B12A 2FETA 4JH0A 3IP8A 1A8UA 2ODBA 3T9FA 3D6HA 2L0XA 5BOSA 1UBEA 2PT7A 2OKCA 1FNNA 2PR7A 4JJ7A 4EO9A 3ZK7A 4W1SA 4YY3B 1A2OA 3MD0A 4JYCA 3CLKA 1RTTA 3ELBA 4MRMB 1Q22A 1P0CA 1DCKA 3GJ4A 4V0LA 4D8YA 3EYAA 3H2IA 2PBZA 2Y0PA 2QMHA 2LXNA 2XLCA 3A36A 4W1RA 4DIOA 4K88A 3WWCA 2BM8A 4KGZA 1Z2CA 3O8BA 1KJNA 1I1NA 4FFNA 4KFSA 6REQB 2IVFA 4BECA 3KZOA 1KDPA 1C9JA 2YW2A 1S2LA 2C59A 4FBGA 4GI5A 4MVJF 4P4SB 3RC1A 3KLNA 4O59O 2XF2A 3GRCA 3ZWYA 1EJ6A 1AE1A 2ACVA 3PNVA 3JVEA 3CG0A 5L3QB 1K7YA 3ICEA 1C80A 2O8CB 3K2BA 2HB6A 4C0WA 1HV8A 3CWQA 3HQ4O 1NBMA 5K8IA 1F0PA 3BMNB 1AUOA 1F14A 1UBHS 2PX3A 4J90A 3BWMA 1ECJA 2YXEA 3TLBA 4OYRA 5BR4A 2HA5A 5AR1A 4OQLA 2WYOA 5A4KA 4B2LA 1Z6PA 2W70A 1NW8A 4DV6B 3GJYA 1UC9A 4O2AA 3DAFA 2ADFA 2WILA 3VU0A 4WECA 1ATIA 1YZUA 2AOTB 5HJ2A 1I7PA 3OCUA 4O4LF 5KSOA 4B3SB 2AXQA 2BL4A 2B1QA 3T41A 1Z12A 1G17A 3EXIA 1E1DA 2VUHB 2GNAA 3W7AA 3AUUA 3W5BA 2A0YA 5E2BA 3RRNA 1PCXA 1ISHA 1HDEA 1Z0UA 1IHOA 1YQWA 4OQEA 2UZ0A 1Y6QA 2ZTVA 2FR1A 4ODIA 1YJQA 2N46A 3L1HA 2ERXA 4MUEA 3RAEC 1V2GA 3WYDA 3A4NA 1NJ1A 5CNMA 5KOJA 2QR5A 2VLBA 2FLVA 5IDXA 5G0UA 3M33A 1I8TA 4V0NA 4NPCA 3PXEA 1GOTA 4RY0A 4HD8A 3RYHB 3WRYC 2J9YB 4BE7B 1RPNA 4WOKA 5IP5A 1IXKA 2AFVA 2QE6A 5LZ2A 1R64A 2XNDA 1OLXB 5KAPA 1B43A 1V6SA 1VKZA 1Z17A 1GAEO 3WIUA 4OL9A 3MMNA 3AUAA 3CNNA 5D3MB 3K6RA 1WETA 4BMDA 4RF5A 5F78A 3I1IA 2GXAA 2R66A 4NK5A 3EHDA 4LJ5A 4FEGA 4RACA 3DM5A 4JU8A 3AM5A 1JQBA 2YY6A 3B6MA 4UHKA 1S2GA 5TF0A 1U2QA 2O5RA 2F2TA 1U7UA 1XQWA 4FWBA 4GPIB 5G1OA 4H15A 4XD7A 1UXOA 1X1RA 1XVIA 3HUTA 5AKEA 1QLJA 1V45E 2A7QA 3RIHA 2XYQA 3FF1A 3PTLA 4QTTB 5AKGA 4CLRA 4Z2AA 2APJA 3D7SA 2BFNA 1S2DA 3F3SA 4V0QA 1QH8B 3HB5X 4A7PA 4E12A 1Y6GA 3PA8A 1V5GA 5ALXA 1XCOA 2OMKA 1XNGA 2YL2A 4N8DA 2FOXA 1RYMA 2Y05A 3BB3A 3NC1C 2NU8A 4HDRB 3V2HA 4OK6A 1I1HA 2KQUA 1XK7A 3H84A 2DFVA 3ZXIA 1EZ1A 5J43A 3OJCA 3K31A 4BMPB 2B4RO 4DJ5X 3H5LA 3P8ZA 3LY8A 4ZANA 1CRZA 1U3DA 3LZ6A 5H68A 4AD8A 1T2UA 4JLWA 4QTYA 1TUBA 4PC3A 4ID9A 4MPTA 1SUWA 8AT1A 2E0IA 2OHFA 4A82A 3K8OE 4FSHA 1UCFA 1FRVA 3MT8A 2Z6AA 5DW0A 4NZZA 3ICCA 1EE9A 1D2NA 2FMIA 2YFQA 3P2YA 4JSYA 1JWLA 2GN6A 5SZHB 3KJZA 1RQLA 5IVDA 2YMPA 4NNPA 5L3QA 1RJ9A 2WF9A 2AW5A 4FINA 4GPD1 4IGKA 4LNAA 5CLJA 1XQ6A 2WUDA 4EDHA 4QX6A 4B34A 1QFMA 2LDXA 4DDMA 1WB6A 5I51A 1RXEA 4MK4A 4BBZA 1I4OA 1V39A 2RAPA 6AT1A 2FEXA 4KFTA 2VWGA 1XDSA 1L7DA 1CLUA 4K87A 2GCEA 3DMYA 5EUMA 4ZDKA 3R7AA 3TLXA 4TWAA 1GA1A 2GESA 3BK7A 3DVRX 5CB8A 2QTLA 3J81A 2JD2A 3IJ5A 4PEVA 3UOWA 3H5WA 3SZMA 1NVTA 2HDOA 2PFGA 2QRLA 5AT1A 3MTDA 2ZYUX 1EXDA 2JANA 1NOJA 2M6RA 3RYIB 2WYIA 1HDRA 3QE2A 4WBNB 1RHRA 4GZ5A 4I50F 2QSJA 4PYQA 2NTEA 1O03A 3RYTC 4GZLA 3RUCA 1SUCA 5KYXB 2CHUA 4IDFA 4NCHA 4PLTA 3HCOA 4QUIA 3QBDA 5LR6A 2II6A 2BELA 2OGWA 3GDWA 3H4TA 3PXCX 2HWWA 4B46A 2EZ9A 5GY7A 3WYGA 1T5TA 3HM9A 3OJFA 3OFSA 1VCMA 2AWNA 2I2CA 3KJEA 1RJEA 4KYTA 3NBUA 4TMZA 4M86A 1JDJA 2R60A 4MV7A 4GWGA 3GZ4A 4RFSA 4C0LA 3BVPA 1BX3A 1IZYA 1QF7A 2ZSFA 4X71A 4MUXA 3EVTA 3WLPA 3QF7A 1JXQA 3P0RA 4ZYXA 4KNVA 5ADUS 5A0TA 3PV0A 3N5KA 1MIOA 1UL1X 1Q1GA 3H6KA 1ZGAA 2HEIA 1BQ4A 2VDNB 4KSBA 1GITA 3TK1A 1ZXBA 1J2RA 5K4HA 2ISSD 4U7JA 4GRIA 2AKEA 3M2PA 3IIKA 1XTBA 1WVMA 3HEMA 3PHLA 3P4UA 1KGSA 2EL9A 3AKDA 3ESYA 3M6XA 4UCQA 2FQQA 3O90A 3NP9A 3EFEA 3P4XA 3IKJA 2WAOA 2ORVA 4XIJA 4ECAA 5IZ4A 1E3MA 1N6KA 1FVFA 3BMQA 3P0FA 1JAXA 3C7CB 1D2RA 4MYUA 5E3IA 2DLDA 2PZGA 3WQRA 1G7RA 2VXBA 1XDBA 5A04A 3PEFA 5HCNA 2AIRA 8MHTA 4FZ5A 5HKKD 2RK6A 4LDAA 3QM1A 4AZVA 2QAGB 2DQKA 4TRRA 3WXMA 1T34A 1KR5A 2HYDA 5EWMA 3VZCA 5BORA 1WHSA 2IUYA 3LKDA 1L8OA 1Q7RA 2OQ2A 2EEPA 4UVHA 5JPIA 3RASA 2ZWMA 2X0FA 4BQSA 2JLYA 5IVHA 4RTOA 1NVGA 1RAEA 3L05A 3NONA 5NLLA 3LQFA 2WB4A 3I9OA 3TLKA 3MCUA 4EF5A 1M74A 1JQ3A 2QD3A 1J9EA 4NICA 2YJTD 4QXMA 1ISFA 1ZG3A 4EKEA 1ZUNB 1OXUA 4MV4A 1I4WA 4XWYA 1GFZA 1USKA 1V16A 2P5TB 3OEHA 3VO8A 5ALSA 3KT0A 3HDYA 1YK0A 1YJ5A 3CJTA 3EGCA 2CV1A 3GFGA 2AN3A 2CD7A 4C7BA 3FXAA 4X5OA 2VS1A 5BN4B 3SF0A 1KVTA 4G1MB 4JQCA 1E92A 3AOEA 5KU1A 2Q1XA 2HMVA 3H18A 5HF9A 5J2TA 4DR6B 2ECOA 4M6WB 4RF3A 2NSYA 1JFSA 2B30A 1HLGA 4RF2A 3RJ5A 4ZHQF 1USUA 3BGOS 2QAGA 3LWBA 4BVKA 2C97A 3K1ZA 1WA5A 3GCDA 4LJ6A 3C4QA 4WNAB 1XFDA 1YB4A 3OMWA 4X6LA 1T3HA 4KUGA 3IV9A 1VSQA 1I2AA 1N0HA 5EVCA 3JQ6A 2SCUB 2VWHA 1VE5A 3B51X 2QJTA 4RZ2A 3LW8A 3BT7A 5FTLA 4OAPA 3C3PA 1OAKA 1USWA 4YT5A 4Q24A 4U2CA 4UU1A 1JYEA 3CBGA 3V2UA 2RFLA 2AEFA 3RRZA 1C1XB 3E2MA 4KPGA 1JHOA 3I53A 4CR6A 5ICGA 4OJNA 4PQRA 4HN9A 4A0FA 3O8CA 2Y0EA 1P9RA 1APBA 4G0NA 1L4HA 1Q92A 1Z22A 3EXHB 2C5BA 4JYBA 5L3ZA 1L7MA 3UV6A 1GZ6A 3IHTA 2YMLA 4FIDA 4PCLA 2GNOA 4UDYX 1OWLA 4F9GA 4LYYA 4UUMA 4WVFA 5IK2A 3DMRA 4U9HS 3OJXA 4CKYA 1I2BA 1L4GA 3OSZA 1FU4A 4FGLA 3ZGOA 1PVOA 3SCZA 5CT5A 4JEUA 1UFOA 3TCKA 5CIQA 4PAQA 1NPTO 1RC8A 3ZI7A 2J6BA 1GCUA 4DWOA 4MV8A 1PTKA 3KR9A 5JD3A 2I66A 1NJ5A 2G5GX 1P33A 2WTBA 3MD9A 5TPZD 1SBNE 1WE2A 5DB4A 3WSWA 2ZI3A 1GU1A 2CJYA 2WQ6A 5GTDA 4QLAA 3E9ZA 1CK4A 1GTMA 1E5QA 1RYFA 3M9WA 4QSMA 2E4AA 4B4WA 2PQ6A 2ZSJA 3QMWA 4FS8A 2I76A 4NCJA 4P3OA 4PNZA 5EINA 3BD7A 3ZEIA 3KZNA 5IJ0B 5AHKA 3VRHA 3UV7A 5L40A 2H92A 2RJ3A 3AQIA 1OROA 1UMBA 3I6ZA 3W79A 1OBVA 3D5TA 3Q7SA 2V55B 1FMTA 4ZP1A 5SZJA 1T5DX 3PNOA 4AMGA 4B2IA 4F84A 5KYWA 3EYWA 5LIRA 3L4KA 1N2XA 1U7PA 3WK6A 5E3JA 3EWSA 2DKFA 1CPYA 5AHRA 1WV1A 4I6GA 3RSZA 1A9XB 4HLUC 3ZYCA 5MDHA 3UPUA 2DWUA 2GBCA 2VDLB 2PS0A 3LK7A 1T1SA 4NK4A 2Q1UA 4WADA 3OIVA 1M2HA 3SJCA 2XB2A 2R6FA 3WKEA 4RJJA 3C6MA 2QRHA 1VLZA 3KDSE 4BFLA 2E3JA 4N8SA 2H2FA 2ZBPA 4QICA 5C53B 4ARBA 3DD1A 1L4LA 1SR8A 3ZXYA 4A73A 4L72A 4N03A 5COAA 3UWPA 5EAIA 3ER9A 3L8MA 1N7GA 4ZEXA 1H6CA 4OHYA 3LQQA 3LQ4A 5BUZA 1GFWA 4OD0A 4AICA 1I36A 3A27A 3ANNA 3NIDB 4I50A 3PCRB 4PSCA 5AVOA 1JJVA 1E9BA 4CODB 1P7VA 1MC5A 4H17A 1ORHA 4RHEA 1V16B 3WG9A 2A57A 4EKGA 1GCOA 1VKHA 3G1UA 3HUDA 4LWZA 4RE5A 2R8EA 4PG5A 3F78A 2AMVA 3OZ7A 4D9IA 3M34A 1UEXC 2XMDA 3QWFA 3UW1A 4YXWD 2C00A 3F6PA 1WPQA 1Z5OA 3C6BA 3FNFA 4AQDA 1A9SA 2EGGA 3NTRA 4CT0A 1NX9A 2BP7B 2EHDA 4G0QA 1G6OA 3TMYA 2D2VA 3AW9A 3FLEA 3BN3A 3W5HA 3I2YX 3Q9LA 4I3FA 2CHGA 5CK4A 5L4NA 1RXYA 1QTRA 3TTSA 2ZRNA 5K8VA 4UDOA 5KJFA 1CP3A 2RK4A 3K70B 4OPMA 4TQUS 2BKXA 3WWPA 2ODQA 3OX4A 4WX2B 4AY4A 4KQFA 5HP4A 4G84A 3VR1A 4I55B 5ES3A 1BMTA 4RESA 4J03A 1WX1A 3WC4A 4G65A 5EFZA 2A86A 1HUQA 1W5SA 3CONA 3V46A 3GJSA 4B7CA 2HLDA 1T9DA 1MZVA 2JIRA 5MFPA 4G9GA 2WJAA 1R5NA 2XCIA 3BM5A 4FGKA 2OXEA 3MTAA 2HZBA 3F2IA 4L50A 2W4MA 3WIBA 3H8JA 1ADGA 2BFFA 4IHAA 4BQRA 2NYAA 3I30X 1Y3HA 1CQIB 4H1TA 1EK6A 4M7PA 3UZUA 2WZCA 4NDNE 1JG4A 4F9FA 2C99A 1K0FA 5FR1A 4G5RA 5IULC 3S3TA 4BHTA 3ZWBA 4BASA 4OLJA 5AVKA 5DXJA 4QRHA 5EY5B 1Z08A 4ETWA 4HYTA 3TSZA 4LK2A 4OYHA 4P3PA 2FZGA 3DZBA 4BWVA 3VR6H 4BTEA 1H85A 1E3TA 1NW9B 5GGYA 1H2YA 2QTMA 1RXSA 3JQGB 4IRMA 4O4HF 5KYYB 4KIWA 3WHLA 4A8JC 2DQYA 1WR8A 4LS3A 2Z9DA 4R2MA 5AXDA 1XVAA 1PUXA 5DU2A 3ICWA 2WKWA 3BILA 3CZQA 5JLJA 4BKOA 1DKNA 4F2DA 4RHCA 1NW6A 1SBHA 2PZLA 2IIBA 5B7QA 3BA1A 2VQDA 5JY1A 3N86A 4UM9B 2OCXA 3HPQA 1R9NA 2UAGA 1PDOA 1IAVA 2CUKA 2XTAA 1TK3A 1GSHA 4IV8A 4WCVA 1RCFA 3ON5A 5E7JA 3LCJA 1J09A 5K4AA 5IT0A 3JQAA 3GWZA 4MOWA 4GBJA 3VHXB 4QUBA 5BN3B 1X94A 3G8AA 4QXOA 5FKJA 2QVYX 1D6JA 1U7OA 2PPVA 3KOUA 5FOUA 2AEMA 3KQTA 3VDNB 4NPHA 1HKHA 2SHKA 1NP7A 1C7ZA 1IM5A 2C4MA 3H1EA 4C4XA 4C4RA 4D26A 2W2KA 1AC5A 3RW9A 1NY5A 4TWIA 1IEQA 2G08A 1ULSA 4R01A 3W7BA 1VPTA 3CINA 3JZAA 4C4SA 1TEXA 1I6WA 3HB9A 3N5CA 4WFKA 4CM9A 5I47A 3I23A 3QNUA 4EG6A 4X1KB 4AXXA 4FFSA 4WMLA 3RV3A 4L5JA 1I2CA 3FPSA 2B69A 5DM2A 1QO7A 5FI1B 4HI0E 4MKFA 4PSDA 4O4LB 5EUBA 3VX4A 1MU0A 4WLFA 4XM1A 2ZIUB 3HZRA 5BYAA 4WW0A 1MV8A 1CB0A 1U3VA 5TS2A 1MB9A 3ZCUA 2WWRA 2F6RA 3BCHA 3OJ0A 2I6XA 4QGHA 2HRDA 4FDUA 4DXDA 4FQ8A 4KR0A 2FB9A 3W05A 5AM2A 7MHTA 2ZULA 2J3HA 1Z4OA 4EI8A 5LP6F 1X7XB 4FSXA 4D02A 2B36A 4TYWA 3ASYA 3HR7A 1HNNA 1U8YA 1DJOA 3H1PA 4PXSA 4LJAA 5AHXA 3H9GA 2Z04A 4Y30A 5HS4A 1M0TA 4Q9JA 1HA3A 3Q5GA 3KEGA 3PEUA 1YHNA 3ACCA 1JHDA 1XXLA 4WK0B 1DFHA 1PG0A 2XWPA 4QAQA 1SBYA 4KLCA 7YASA 1E2PA 5F7ZA 5AKKA 3PUVA 1NUUA 1U7ZA 2Z83A 4IKOA 1GYPA 1V6AA 1KJ9A 5JADA 1ZR2A 2DECA 1D04A 1QQAA 2L17A 2QE7D 2X1MA 1Z73A 4IKPA 2J31A 4JKYA 3M4NA 4LJ4A 3VR2A 1GKKA 2GRAA 3FVRA 5BWCA 1ZVJA 2HXGA 2WWHA 1TO2E 2GZAA 2QRPA 3AFGA 1BYUA 2R6ZA 1XV5A 3GFRA 1DTWB 2RH9B 4JOSA 3S1LA 3ZE9A 4ALKA 2CFOA 4IF4A 1E32A 4N5NA 4ZT7A 1PJCA 5ICEA 2H2IA 1GLNA 2BC9A 4K9OA 1JAYA 2E89A 4ND7A 2FWMX 2KPOA 1T4BA 1Z45A 1E3DA 2HLPA 2ZFUA 3OQPA 5DYYA 3ZH9B 1MQ9A 1Z75A 1XG5A 3X2FA 4YUAA 1L9KA 3PTAA 5DXAA 3KHTA 3FYDA 3L93A 1CUBA 2PT6A 4GFDA 1YF3A 3LPLA 2OBBA 1B7GO 4IIHA 4BNDA 5C7YA 5IANA 2WUEA 1JE0A 3FMGA 1JRLA 2PD6A 4EHJA 3U4HA 3AF0A 3WXBA 2QLLA 5BP7A 3N8GA 4S1NA 1UPUA 3JCZA 3L6CA 4HH0A 5DV9A 1O77A 2CL5A 4ZMBA 3SFVA 5F33A 1U2DC 2XYGA 5KYKA 1ZX1A 1YR3A 2ZANA 3BWEA 1P72A 3ONEA 3IE0A 3UFBA 4ASUD 2VQFB 1EFDN 1S7CA 2ZWOA 1DRUA 3QYAA 4IXMA 2VUIB 1ORTA 2ZYIA 3OQ6A 1Y8RB 4XJXA 1PR6A 1ZNQO 4CWAA 3THXB 1DO0A 3RI3A 4FK8A 4CF7A 1EFCA 1ZJ6A 2C2YA 2HDHA 4LJYA 1ZN9A 5REQA 2FRXA 3VNRA 4INJA 1PZEA 4HRYA 4EMSA 3GH1A 1O94A 5KTTA 5HHTA 1M2GA 1MABA 4MAFA 4ZVUA 3FIJA 3DE1X 2Q7XA 3LRTA 4AMVA 1UF9A 4BO4A 3ZI4A 5IJ9B 1ZFNA 3ITDA 3TM5A 3HEBA 3QI2A 3PD0A 1EFRD 3SF8A 3KWMA 1WNTA 2BMVA 4I6JA 2D1YA 4R83A 3RBXA 4DQLA 1D4OA 1I6MA 3MERA 4A8JB 1XHFA 2Q1WA 4Q3EA 5FBKA 1I94B 5ESDA 1I7NA 2YTZA 3VC7A 2PS3A 4TMXA 4X60A 4RSGA 4CL3A 1NXWA 1WXQA 4UBJA 5ALPA 4N6NA 2IZ1A 1KKUA 2A59A 4G5QA 4OM8A 4TVKA 1FVHA 1P80A 2QROA 2F9FA 3KVOA 5KVVA 2AS0A 2F1KA 4WESA 1XJ0A 4AIRA 4OMUA 1QHHB 3KIPA 4FYXA 1LNZA 1ZLYA 1PHPA 2LVBA 4EGSA 2OHXA 4YR7A 4EUSA 2VT7A 2LD4A 3AF1A 3HRKA 3UVEA 1RP7A 4JLKA 4YS6A 2C2WA 3ZNNA 5HUQA 2D74A 1OC2A 1P4SA 1PTJA 2FY8A 3U49A 3JASA 4DL9A 4F2GA 3L0PA 2F67A 4BE4A 2ZM5A 5CB0A 1G5FA 4MWEA 4GX5A 3UJDA 1X70A 4K28A 3DTYA 5HE9A 3GEHA 3MTGA 1YDEA 2XAAA 1XKQA 2AN9A 2I1QA 2ST1A 3COSA 3R40A 1B3RA 2F1IA 4UZEA 5AICA 4GM0A 6NULA 3MJDA 2E1RA 4YK7A 5LZ8A 1UWVA 1JHRA 1NP3A 4FGZA 5J5VA 2HMAA 5A0VA 5KNDA 3QVVA 2EATA 2YVAA 1S9DA 2C88A 5T4BA 4UHHA 5CDTA 1VJ5A 1KOGA 1XHEA 2CFSA 3ANLA 1SUPA 1XVUA 1A76A 1T6BY 2PL3A 1V4VA 1HE1C 4II2A 4R81A 1TEVA 4TKZA 2HD4A 4CU2A 6Q21A 2HO5A 2JAXA 2VHCA 3G9QA 4NEHB 1CR1A 3VHQA 2C98A 3B5IA 3TR5A 4D0LB 1EVJA 2HQRA 4P22A 1V7CA 4MV6A 2WUVA 1UDCA 1C9YA 1ENYA 4W7HA 4YA6A 3IX7A 4E2ZA 4F2WA 5IF3A 3NHLA 1E0JA 2XLBA 4LJLA 2O23A 5FWYB 4MLDA 5EPOA 4I5DA 4NAVA 1P0FA 1CNMA 4MKRA 3TDMA 1YFLA 3JZIA 1F12A 1XF9A 4LXHA 3G0HA 3IPRA 3V2GA 5HA5A 1UR5A 2AJ8A 4LYJA 5JXIA 3PX7A 1R0KA 1LBSA 3FKSA 1V7ZA 1M2WA 1U9IC 2JAPA 3NPAA 4FOLA 2IEIA 2YOHA 3DE2X 4P8RA 4R51A 3WZMA 1PQWA 4HRXA 3IT0A 4KQ9A 4ZVOA 5CM2Z 3SQLA 4LFBB 1LDYA 2GN8A 3V4OA 4B2YA 1V3TA 7ADHA 2XJ9A 4NNOA 1MCZA 4J49A 2QTFA 4CMEA 3DUFA 4EARA 4DQ0A 4QVGA 1DQPA 3G88A 2QRUA 1JX6A 3KYCA 3NUZA 4HC4A 4HGNA 1G41A 1Y1LA 4P38A 4CKBA 3C85A 4FP9A 3A6HA 1GT91 1KSFX 5JJKA 2JGEA 1JIIA 2R96A 3PLNA 1SHLA 1X74A 4XYBA 4E4RA 1BDHA 1JNYA 2ZRLA 3QX3A 4IJMA 2VPPA 1USIA 1JDNA 4MPRA 1W4LA 3WMXA 1JSXA 4YRRA 4CR7A 5DRTA 3LI2A 2R7LA 3I45A 2EHJA 4KL8S 1PYOA 1QGOA 3QTTA 5CNJA 3TQSA 5LJLA 2VPXA 1Q95A 4H16A 4XDHA 4MGHA 1GTJ1 3PUWA 2R2AA 3A26A 3M0EA 4JJ6A 4M99A 1QZ3A 1W6RA 1AZTA 2GCGA 3DF7A 3RGWS 3EIOA 3RWOA 4C3VA 5KVSA 2DF8A 3FZQA 1TYEB 1NNEA 5DLDA 5CDYA 4W9NC 1UT8A 9GPBA 4JUBA 4DCOA 2HY7A 2JGDB 3B9QA 3RAJA 2AJDA 4GXRA 4PSAA 3SJ7A 2Z0MA 5LP6A 2RMKA 1ST2A 3REGA 4AURA 1K7EB 2PLFA 1W5AA 4RJIA 1O9GA 2MHCA 2ZAOA 5A4JA 4KB5A 5K6RA 4KXXA 4G85A 3LF2A 3NM6B 4RVGA 2NU7B 3M9LA 2HRBA 1SXIA 5J1TB 2PT9A 4UPEA 2BDUA 3L6UA 1B6RA 4FDAA 4CN9A 5LFAA 4PANA 1QKJA 4MUBA 1R0WA 1AK9A 4UTXA 4H9GA 1BDJA 3Q6NA 4ZOLF 1K1EA 2VZ8A 4UM8B 3SE0A 1SKMA 1GYRA 4ZPXA 4RKRA 2M6SA 4Z7OB 1B6GA 1TM1E 3DCJA 1QYDA 2Y1FA 3O4VA 4GP7A 1CQWA 1YUMA 1AKEA 1T2DA 3KR2A 4LRUA 2X0RA 4X7MA 3ZNPA 4QGGA 3H8WA 1BS2A 2C3YA 3TJRA 4DCNA 4URXR 1DJMA 5KX5F 3WGQA 1IE3A 2NYRA 4BJHB 4CGZA 3PEVA 2P62A 3A9WA 3WFJA 4UMEA 3I9NA 5KNCH 1L1RA 1QIIA 2NXEA 4Z9FA 2XCLA 3USES 1MH1A 1UPXA 5EOVA 2ASVA 2FTKE 1PR0A 4JXZA 1NASA 3PVZA 3TCNA 4ZTZB 4ARIA 4LVOA 3F6BX 5TY0A 3H1AA 2QRVB 3VZPA 5C5CA 1W1UA 1QONA 4OB8A 1JSLA 3RTBA 2C2MA 2XW6A 4JSTA 4PFSA 1F8GA 1T3LA 1BXGB 3GYBA 5LQSA 4ZZ3A 4JYZA 2WM2A 4DTIA 1L6IA 2R4UA 4GGMX 1P31A 1AGXA 2ZWAA 1JFFA 2DTEA 5BSUA 1DDGA 4J75A 3TW8B 5JSKA 3BH6A 2AXNA 5FJJA 3M5WA 2AZ4A 2XR1A 3HUUA 4IXTA 4DNPA 3VPXA 3AVTA 1C9DB 2C4TA 4C0HA 2H5IA 2X9QA 2XCOA 1IN4A 3DEFA 4PC1A 4C07A 1RRMA 1XTQA 3P0JA 3CCCA 5K3FB 4Q1BA 5D6NA 4LYEA 3ZWDA 1U9IA 1FFXA 2R5WA 1H3EA 4Q1CA 4E32A 1SIUA 4J91A 5A2GA 1WU8A 4V0RA 3CO0S 1O6CA 4HVTA 2FUEA 2E37A 4IDOA 1TXGA 3N75A 4DBVO 1M54A 3AIKA 3PNSA 2O3JA 1ZKDA 1A04A 1O96B 1TRHA 4BEJA 3B1VA 5TT1A 4DSOA 2BHRA 2CK3A 3CC8A 4OQPA 5EP1A 4BV2A 2X8LA 3KQLA 1KFCB 1VMAA 1Y3DE 4GQBA 4C29A 2FKNA 3ZIUA 4GW3A 2BV3A 3A05A 1CXZA 2WYWA 1TDJA 4MQEB 1XB2A 1BXZA 5DEIA 5B1SA 2VNSA 3H2HA 5A5DA 1OFGA 1ZD2P 2BCJQ 5FWXA 4G8BA 3ZZNA 4LOIA 1OH8A 2ZAIA 1KI9A 3QX8A 1XKLA 2XOEA 2X2OA 2NLOA 3MJCA 5GJWC 5ALVA 2D7JA 3NCHA 2QX4A 4KLAA 1X80A 1Y7HA 2P7HA 2QG4A 5DT2A 4X66B 3GLIE 2AOTA 3EUFA 5BT8A 1NW5A 1FL9A 2ON6A 3C3BA 4KBFA 2P9QA 2EW8A 3CUSA 2XKBA 1NKSA 3NM5A 4MS1B 2HK9A 1RYEA 3N2KB 2VXOA 1VI2A 4ND2A 3T94A 4XVCA 2JI6A 2G06A 4G1EB 2HQBA 2JA2A 3GIDA 4UE2A 1MJ5A 4N47A 1CVIA 4IHKA 2PH5A 3GLVA 2E9SA 3UJPA 4HZGA 4EFKA 1TE2A 3N2KA 1B0PA 2R6JA 4F8JA 1HE4A 4PINA 4I2VA 4BUJA 2P65A 2ZCUA 4R41A 9ABPA 4WKPA 2ZXUA 3VVLA 1NN5A 3QKUA 2XMZA 2OHIA 3UKJA 4B45A 3ZQKA 1VKRA 1FJ2A 4JBLA 4RCZA 1MEJA 2EIXA 1FFBA 5KC8A 3LBNA 4YPOA 1NV8A 4R05A 4L9SA 2GHRA 1CF2O 3JQBA 4R7TA 3CLHA 4C87A 4DQKA 4EY4A 4EUHA 1OZGA 4N0PA 3UMSA 4HEHA 1UP7A 4F92B 3EDCA 1YTUA 4MVYA 1OXVA 3OX1A 1OZAA 3H1GA 1QE5A 1E2JA 3GVIA 3KYDA 3U09A 1YZHA 3LFHA 1F6DA 3V1NA 3R0JA 3DGEC 3IESA 4UARA 4XASA 1P74A 2DHEA 1UIRA 3OMXA 3ZKAA 5EP3A 5CVTA 1HORA 2J5XA 3KUUA 4YP1A 4C04A 1MX5A 2QUAA 1GPLA 3DTVD 4DHWA 4JHXA 1ISJA 1FLVA 2GCOB 4RL6A 5JDIA 2O0MA 1N0WA 2UYQA 2QZJA 3HCNA 3VU9B 4E07A 4QDKA 1X92A 2NUTB 2GF2A 4PQEA 4P53A 4N0EA 4RNCA 4BNWA 2OCAA 5IFLA 1KMCA 1R0ZA 4INZA 4AL4A 1DAFA 3KG2A 5JR3A 1FMJA 4CG0A 1O87A 1G8GA 5C5DA 5F3DA 4X20B 3WI7A 2FPRA 2R44A 1U0JA 3DXYA 3OC0A 4M1EA 3S40A 4CNQA 1Y5RA 4TWBA 2PJRA 1R9JA 4GLFA 3R3UA 2E4XA 1C29B 2AR9A 2CL7X 1NW7A 3C5VA 4ZT2A 1U0EA 1RVV1 3BE8A 4TPKA 3VZSA 4FB4A 3K16A 3RS5A 4US1R 3QVOA 1AOXA 2IXDA 3AUFA 3I2IA 4DJJA 3HKDB 2V7XA 4M76B 3U9LA 3DHVA 1KZ4A 2CXTA 3IODA 4Q4AA 4D4HA 1TMGE 4H1WA 3H97A 2Q3DA 3HS3A 1EEHA 4OKSA 4JELA 3V4SA 3E3NA 2ILVA 1DKRA 2C9OA 4ZYZA 1PWXA 3IGFA 3AJ9A 1DBVO 1YZ3A 4MS3A 4X1YA 4JFAA 3AINA 1KJJA 3UJ3X 3H5IA 3T9BA 1L5WA 1USVA 2GVZC 2RCYA 3K4PA 5AI9A 4FFLA 3O3MB 5FWXB 2I4LA 1A5SB 4G5HA 1F2TB 4MDEA 3TCXB 5DSTA 4BN4A 1W35A 1EK1A 3NKLA 4DMMA 1WULS 2OILA 3AUKA 1TZCA 2IPOA 2W8BB 1NI4B 4BLWA 5CXUA 4UMDA 3V00A 1KY2A 1GAQA 1AB6A 1WW8A 4JLUA 3V4ZA 2I6GA 1CIVA 2GN0A 3F49S 3OFVA 3OZXA 4FUQA 1E1QA 5AIAA 3CJQA 5DHTA 1S3IA 1Z7BA 1QYVA 3FRJA 3T3MB 1V0JA 4BJ6A 2VJOA 1L5YA 4OXIA 1E77A 2WP0A 4GXNA 3TPFA 2K2WA 2JEZA 2WU1A 4HHEA 4M0UA 2EWVA 1NSFA 1KYIA 1TYZA 3JAMA 2H1WA 2JFFA 4BB9A 2JIQA 3IR6A 2QPOA 3I37X 4U7DA 5EZ5A 3T3GA 1J1ZA 3I05A 3GGDA 2I3AA 2HTFA 1WZ2A 2IK8A 1G7CA 2JFBA 2P9YA 3B52X 5ITSA 3V8QA 1QK3A 3MRXA 1VZ3A 1U3CA 4W7SA 1QUFA 5AW2A 3NNDA 4ZOAA 1L7NA 1S5PA 2OGTA 1N6OA 3NB0A 3WSVA 421PA 3ZDBA 2MCFA 3BICA 1PS8A 3KEFA 4G0ZA 4FKBA 1BROA 3NC4A 1S6YA 5DWVA 4YP6A 4W5HA 3A3KA 3VKVA 3F9CA 4YCNA 1UT5A 4PAWA 4KI7A 2C4VA 4HGPA 4NX2A 1HETA 2YFHA 5E7QA 1EVZA 3UOAB 4GL2A 1QVZA 1F0YA 1HZZC 2V7QA 2JBAB 2PH3A 3H2SA 1XZGA 1XDUA 1QC5A 2FX3A 1DDOA 4JB8A 3HCWA 3R0QA 1DHTA 4LJ9A 1NUQA 4CKWA 1Y5IA 1Q3KA 1C3VA 4NYJR 5E8RA 1PV4A 4R2LA 1VFPA 1D03A 1ZISA 2G9RA 4R69A 4JASB 4ZI7B 1EWVA 1GA4A 1YGYA 1IQPA 2NO5A 4K6FA 4D74A 1NRWA 3I83A 1PUJA 4HMOA 5A9TA 1W9HA 2OZVA 2EKPA 1HDOA 1O6ZA 2BI4A 1PDVA 2FP3A 2H9YA 3O8NA 4L73A 4CLRB 1DVRA 1Z3IX 4YP0A 5EKTA 3JS5A 3TQCA 3CUYA 4YNBA 2FPPA 2WTAA 1NBWB 2GF0A 1SEPA 4YCBA 4AP9A 2BGWA 3DLAA 1M7GA 1FYFA 2DT8A 1RP1A 4HWKA 3ZG6A 3ZY2A 4ETMA 2CVFA 4M21A 1WLSA 2ZBEA 5C1DA 2RGBA 1MABB 3LT2A 3X1XA 4Z3OA 1XTSA 2ZT7A 2Z9CA 1T36A 5REQB 3WADA 2EOAA 1KI8A 3O5AA 4H3SA 5TRTA 5MFZA 2NQ2C 4BPBA 1JDSA 5KVQA 5CT8A 2NP7A 2CT8A 2HK6A 4QXAA 1Z6ZA 1X8JA 4V1CB 3KOOA 4MRVA 4D80A 4DBLE 4MEAA 1VMEA 2HFKA 3F3YA 5KINB 5KTYA 2OHJA 1ZOSA 5CT9A 3ELYA 2Y6VA 5IW8A 2HJ9A 4RZSA 4YI5A 5BV7A 5KKCA 3VKGA 3QXCA 3FMOB 1JIUA 2AD1A 4HNSA 4UXIA 2DPLA 4RIEA 4MXDA 4R8KA 3G2IA 4X1IA 4HDRA 3IUBA 3QZUA 4QD3A 2GCNA 4J2TA