5D1HA

Crystal structure of the 16s rrna (adenine(1408)-n(1))-methyltransferase w203a mutant from catenulisporales acidiphilia
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
204
Chain Sequence
TALKVLAGKKLTDLDPDEWAKAQASAERILVDVGTGDARTAYRQAIAHPEWLVVGVDPAWQRMTETAVRAARKPAKGGAPNLVLVSSAIETVPAALHGVADEVMVLMPWGKLLRGVVLGEADVLSGLRAVAKPGAPLEISIGTSIWREPIPLEIRDLPELTPETVVSTGLTDRLAALGWQVADVRLVPTETVLHLRAVAVDPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional dichotomy in the 16S rRNA (m1A1408) methyltransferase family and control of catalytic activity via a novel tryptophan mediated loop reorganization.
pubmed doi rcsb
source organism Catenulispora acidiphila
molecule tags Transferase
molecule keywords Uncharacterized protein
total genus 61
structure length 204
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5d1hA00
4HTFA 5T6BA 5CUQA 3B3GA 3KKZA 3UWPA 4QDKA 4C06A 4PONA 2GB4A 2PGXA 3BZBA 3R24A 4O29A 1RJFA 5E9WA 3JWIA 4GOMD 2QRVA 5CCBA 3A25A 3HA5A 1UWVA 1VL5A 3TOSA 2NNWB 5FTWA 5K01A 3ORHA 3AY0A 4OBWA 3SMQA 2YQZA 4HRAA 3RODA 3KHKA 1G60A 2PXCA 4CTJA 2VDUE 3LX6A 2AN4A 1O54A 1HNNA 3AXSA 2DULA 2WK1A 3IHTA 3PLAE 2AOXA 3NWEA 3MAGA 4MIKA 1NKVA 2XYQA 4QTTB 2PSSA 4MQ4A 3VSEA 4C08A 5CVVA 3FZGA 1RI4A 5EOVA 3HVHA 4KVZA 5EHIA 4OQEA 1NBHA 3M6UA 1EIZA 3KQYA 2AS0A 4P7JA 2BZGA 2O06A 2P3QA 2PWPA 2P7IA 3B3FA 5EPEA 3UA4A 4BLWA 4M7RA 5C9ZA 2JHCA 5EIWA 3KPJA 4PNEA 2VDWA 4V0RA 5FA5A 2UYCA 2B9EA 3FUWA 3EGVA 4Y2HA 4XCXA 3P2IA 2FCAA 1N7JA 3SX0A 3TPZA 4LG1A 4QVKA 5EEHA 4EQZA 4RSRA 4E30A 3BWBA 3DMFA 2ZTHA 1KIAA 5K0LA 3DOUA 4DMGA 5EEGA 1U2ZA 2NP7A 1TW2A 1BC5A 3MTEA 3IYLW 3P9KA 1X1AA 3L8DA 3R0QA 4A6DA 5LQUA 1I1NA 1RJGA 4QPNA 3EVCA 4KRGA 5C0OE 1Q0TA 4XUCA 4CXMA 3GRVA 3KQVA 5DTRA 3EVEA 2YXDA 1RI2A 3JWJA 2DPMA 2O0LA 4RVDA 5E1DA 2AN5A 5DWQA 2H1RA 3G88A 3G5LA 3UFBA 5HIMA 2IH5A 1JSXA 3OCJA 5E1BA 5E9QA 1YZ3A 3LDGA 1SQFA 1XCLA 4DQ0A 3S68A 1INLA 3LPMA 4RTLA 5KS2A 3OFJA 5LQJA 2AVDA 2IGTA 3THSA 2ZSUA 2OBFA 1AV6A 2GA9A 3V8VA 2XBMA 3ELYA 3FUVA 5EHGA 5K0EA 3VYWA 5LQNA 2JH8A 1SQGA 5ICFA 2PT9A 1KPIA 5IH3A 1VE3A 4FSXA 5KVAA 3I5UA 3P2KA 2CWWA 2JH9A 3GGDA 4ER7A 2AOTA 3HNRA 5KYGA 3GRRA 4HSGA 3TRKA 1YFLA 4ER6A 2AOUA 3SXJA 3ER9A 3UBTA 4R05A 2BH2A 1BHJA 2EG5A 2NXJA 4HTFB 4QPPA 1R00A 4AZWA 3PTAA 3P71T 4PYMA 5DRTA 3ME5A 3FUTA 2PX5A 1L3BA 4A6EA 2ZIGA 4RVHA 2BM9A 5B1SA 3E7PA 2VDVE 2AR0A 3P9NA 4QTUB 1B42A 4P7FA 3FUXA 4FGZA 2Z6AA 3CVOA 1QAOA 4RTRA 4V0QA 3LCVB 3EVDA 3B7PA 3I58A 2PT6A 3HA7A 3BWYA 4P7GA 2FRXA 5FA8A 4PGGA 3EEOA 4GBED 3G2QA 1G6Q1 3RIEA 3THRA 2ZZMA 3B3JA 1JG1A 3EGIA 3H2BA 4P58A 1L9KA 3M6WA 2PXAA 1L1EA 2GH1A 3AXTA 2EJUA 1EQAA 3ELDA 5FCDA 1P91A 5CVUA 5DSTA 3V97A 5EC8A 4C05A 1ZGJA 4DM3A 5GIOE 4FR0A 1YF3A 3HTXA 3BWMA 3OZTA 1NW7A 4OA5A 4R8RA 3UJAA 3TLJA 4YV0A 5LR6A 2UYHA 2C7PA 4MHTA 4X60A 2PXXA 3LECA 3MQ2A 5DT2A 2PWYA 4PIMA 1YZHA 4FT4A 4EVIA 4YMGA 3KQTA 3KR1A 1M0EA 3EVAA 3CJRA 1R6AA 3GXOA 5G02A 1KP9A 3TKAA 2IFTA 1XDZA 3PS9A 3LDFA 3P2EA 1YB2A 3TKYA 2Y1WA 3OFKA 4XUEA 3A7DA 2EJTA 2WA1A 3BGDA 3REOA 4M37A 2ORED 3E23A 4ER0A 1EG2A 3R3HA 1JTEA 3NW9A 2CKDA 2ESRA 2ONYA 3GWZA 3LGAA 2VZ9A 5FQOA 3RW9A 4RTMA 2A14A 3CCFA 2P3LA 1PRYA 4FSDA 4RV9A 5DPMA 4RTPA 4CKCA 5EIFA 2VP3A 2GPYA 2HV9A 3EVGA 4GC5A 4E2ZA 1G38A 4E2WA 5GIPE 4GOLD 3GRUA 1DL5A 1FJXA 4FP9A 2G8NA 1NW6A 1BOOA 2HR1A 3HCAA 5EMLA 4DKJA 3C6MA 3QV2A 1I4WA 3OU2A 2IP2A 3LKDA 2BR5A 2O07A 1RI3A 1KXZA 1JG2A 2AOVA 3G2MA 4PWYA 3SR4A 5K0FA 5D1NA 2PV0A 2B3TA 2O05A 3LCUA 4QQKA 5K09A 4RVFA 2XVMA 3GCZA 4FZVA 2ZBPA 5FWDA 3ELUA 4RTOA 4RX1A 4FS8A 5HFJA 2JJQA 2UZ4A 3C6KA 4OQDA 3KQPA 4X41A 5DX0A 5GOZA 3FTDA 3R6TA 4L7VA 1ZQ9A 3PVCA 2AZTA 2K4MA 5EKXA 2IIPA 3NWBA 5MHTA 5CM2Z 5K0GA 2PKWA 1BKYA 3B89A 3KR9A 5ICEA 3K0BA 3HM2A 4RTNA 3PB3A 3HVIA 3DLIA 1XVAA 2P1DA 3DR5A 2OO3A 3DUWA 2ERCA 3OZRA 5DTQA 4GOOD 4RTQA 5BW5A 4IKPA 1QAMA 3TMAA 1ZHFA 2GS9A 3P97A 1R74A 4OBXA 2IDJA 4R6WA 4ER5A 5K03A 5BXYA 1D2HA 2VS1A 2BM8A 5H02A 9MHTA 2LD4A 1JR4A 1SVUA 3GO4A 4AZTA 1WZNA 2PX4A 4EMSA 5ICGA 5DM0A 2OXTA 1RJDA 1X19A 3C3PA 1XXLA 2AOWA 3UJ8A 5JUWA 2WA2A 2QY6A 3FUUA 2HNKA 3CC8A 3G2PA 5DX1A 4IV8A 4C03A 3G8BA 2HWKA 5M5BA 3OZSA 3HCEA 3B5IA 3NMUF 5EZSA 4Z2YA 4BY9E 3R9XB 2CMHA 4KDRA 3U81A 3LKZA 3EVZA 1RJEA 1KYZA 1JG4A 5CVDA 5GM2A 1JTFA 2I9KA 3ER8A 4IWNA 1SKMA 2QRVB 4EKIA 3HVJA 3BKXA 5KQRA 3NDIA 2PLWA 4YUWA 1IXKA 4AUKA 5CVJA 4E2YA 5LQRA 4WXHA 5BW4A 5LSAA 3FYCA 4LWPA 3FTFA 1JQEA 3HA3A 4MTLA 3Q87B 3HCBA 5EGSA 2FK8A 2F8LA 3WSTA 5LQCA 1D2CA 1XTPA 3OE4A 2OB2A 5EKUA 3P9CA 4RTSA 2Z6UA 7MHTA 2R6ZA 1XDUA 1N7IA 1EJ0A 1P39A 5IKMA 4RTJA 1F38A 2XYVA 1YFJA 2NXCA 2C7RA 3CBGA 1QAQA 4PIPA 3HCDA 4F86A 3FYDA 5E1OA 5ICCA 4ATNA 3EMBA 4C4AA 2FHPA 5JR3A 3M6XA 3JWGA 3O31A 3BGVA 3T7SA 1JG3A 3LBYA 1NW5A 3KQQA 2OB1A 3KR2A 3QOXA 4GUAA 3TR6A 4K6MA 4RVGA 3X0DA 1YUBA 1XJ5A 1WG8A 3BKWA 3FPJA 3KPVA 4E31A 2XVAA 3OU6A 1VIDA 1Y8CA 3KPYA 3NVMB 3KQWA 3KU1A 3GNLA 5DSXA 2ZZNA 1PJZA 3MCTA 2C7OA 4C07A 4KW7A 5BP7A 5K8VA 5D1HA 2G70A 2H11A 4FT2A 3A4TA 3IEIA 4OX9Y 5DX8A 3E8SA 2V7EA 2YX1A 4HC4A 3M4XA 2JG3A 3AJDA 3DH0A 1VP3A 2P3OA 4YUZA 4GOND 4F84A 3FTEA 3TM4A 1T43A 1I9GA 4PCAA 3FTCA 4PYIA 4RYLA 4WVLA 1FPQA 2YUIA 3DP7A 4LECA 3GIWA 5FUBA 3DXZA 4R8SA 1R18A 3ID6C 1OR8A 3UJBA 5HZMA 3T7TA 2ZFUA 4P7KA 1DUSA 2NXNA 2FK7A 4C04A 3CGGA 2XYRA 3PX3A 2PBFA 2PX2A 3I53A 3BXOA 5HEKA 5DTMA 2AOUB 2O57A 1FBNA 1NW8A 2ZIEA 2NP6A 3G5TA 3OU7A 1O9HA 4JXJA 3GRZA 3I9FA 1HMYA 5GM1A 4POOA 2IBTA 2PY6A 3UJCA 3HCFA 3LHDA 4PCLA 3UJ6A 4X61A 1WY7A 1G55A 1TW3A 2I7CA 3UZUA 5HIJA 4KIGA 4Y30A 3Q7EA 5HILA 3F4KA 2IDKA 3VC2A 4KWCA 5K05A 2PX8A 1D2GA 1R8YA 1VQ1A 1Q0SA 2ZVJA 3SGLA 5HIKA 1VLMA 1AQJA 1FP2A 1P1BA 2ZCJA 3DMHA 3LSTA 8MHTA 2QM3A 1WXWA 3SSOA 4AX8A 1WS6A 3P9IA 2G71A 1X1DA 3FRHA 5K0JA 5EQJB 2FYTA 3KPWA 2HTEA 4DF3A 5LQAA 5EMJA 3MB5A 1QANA 2CMGA 4CKEA 4R6XA 2C7QA 2OKCA 1H1DA 4AZSA 3SM3A 1ZGAA 5F2OA 1VBFA 4NECA 1RI1A 3C0KA 2ZW9A 3NJRA 3DMGA 5KQSA 1R8XA 5E9JA 4BP3A 5E1MA 4EK9A 3OE5A 1G8SA 3DTNA 4DA4A 1NBIA 3KQOA 4F85A 2P8JA 2OY0A 1JQDA 3QOWA 4ER3A 3O4FA 3EVBA 2CL5A 4YV1A 4KDCA 4G56A 2ZIFA 4LWOA 3K6RA 3M6VA 2P40A 3OPNA 2AVNA 2N47A 3MGGA 2PJDA 1EJ6A 1JQ3A 3ANXA 1N2XA 3FPEA 3KQSA 5DXJA 4IV0A 4E2XA 4YMHA 2IH2A 5F2NA 1QZZA 5DXAA 2I6GA 5DM1A 4ZTBA 2NXEA 3PT9A 2YR0A 5C1IA 1ZKDA 5E8JA 4BP1A 2B78A 3GU3A 4M38A 1WXXA 3DXXA 4PYNA 3P8ZA 3TM5A 2IBSA 3LDUA 2PVCA 4BLVA 4RWZA 5ERGB 1ORIA 5FQNA 4YUYA 1L3IA 3GJYA 1KR5A 3DLCA 3FPGA 5FHQA 5CD1A 5LQKA 3NDJA 3HVKA 5U4XA 2OZVA 4HG2A 3G7UA 5E8RA 2AN3A 2OPBA 2ADMA 4AZVA 4GF5A 3VC1A 4M36A 3LBFA 4HGYA 5DM2A 5CVEA 3PX2A 4GEKA 1M6YA 1QYRA 5CCXA 5FADA 3E05A 5EMKA 1Z3CA 1X1BA 3LCCA 2E5WA 2P35A 4PINA 4U7PB 4EKGA 4PYLA 1KHHA 3PFHA 5FHRA 1SUSA 5K0NA 2YXEA 2ZBQA 1JSZA 5F2KA 4DCMA 4DZRA 4PYJA 3O7WA 4E70A 2Q41A 2EX4A 2I62A 4PGHA 1NT2A 1X1CA 4OA8A 3KPUA 5EMMA 2ONZA 3A7EA 4YUVA 4CWAA 5EZQA 4HGZA 1UFKA 3TQSA 5K0BA 3BWCA 3A27A 2V74B 1L3CA 3EEYA 1O9GA 3DXYA 3FPHA 2B2CA 3FPFA 2AOTB 3EGEA 1M6EX 1MHTA 1ZG3A 4QQNA 1F3LA 2HMYB 2ZBRA 2R3SA 3DULA 2P7HA 3I64A 3MCZA 1G8AA 3CJTA 4XUDA 5FWAA 4BLUA 5T64A 4PYOA 3C3YA 4E33A 1SUIA 2ZWVA 2ZWAA 4YV2A 1DCTA 4B17A 5GINE 1SG9A 2BR3A 2GAFA 4CKBA 3BGIA 2ZZKA 2QE6A 2UYQA 3BUSA 3FRIA 3G89A 5DRYA 3AWIA 3EVFA 3BT7A 1AQIA 1KYWA 3HEMA 3A26A 4YUXA 5EVJA 3G8AA 3MHTA 5GWXA 1XDSA 5E2BA 2NYUA 2P41A 3NVKI 4HH4A 2GLUA 4GC9A 3ELWA 3KQMA 4ISCA 1KPHA 3GDHA 4MWZA 4CTKA 2YTZA 2QYOA 3SSNA 2Z6QA 2YXLA 2ZLBA 5P8WA 1FP1D 3EMDA 3UA3A 2Y1XA 5T67A 4PYQA 2JHPA 4GQBA 1NV9A 1IY9A 2H00A 4RTKA 3MTIA 1UIRA 3NTVA 2ZULA 5CIYA 1RI5A 3T7RA 3EPPA 5E2AA 2EFJA 3M70A 1ORHA 4X1OA 3T0IA 1P1CA 1V39A 2B25A 1VPTA 3UJDA 3JWHA 4KIFA 4DCGA 5DM4A 3CKKA 2BR4A 1AF7A 4H0NA 5EG5A 3ERCA 3G2OA 3HCCA 4QVGA 2G72A 3SSMA 5GP1A 2OYRA 4E32A 2G1PA 1IM8A 1NE2A 2IPXA 3HP7A 3MERA 2JHAA 5DLYA 1NW3A 2FPOA 3D2LA 2KW5A 3UJ9A 4PYKA 4UOEA 5HOQA 1EAMA 4X63A 1NV8A 5FULA 3PFGA 2UYOA 4QDJA 3UJ7A 3GRYA 1KPGA 1MJFA 2YVLA 3KR0A 1VP9A 3TFWA 2IH4A 3LL7A 4U7TB 1XCJA 3CJQA 3SVZA 5K0CA 5HIIA 10MHA 3M33A 3IV6A 1TPYA
chains in the Genus database with same CATH superfamily
1IOVA 5HA5A 1MX3A 2FW8A 1E4VA 4QDKA 5TEVA 3ZBQA 5IDVA 2P4HX 5CJ2A 2QAGB 3WRXC 3IJPA 4M86A 3DLHA 2VYVD 4MB6A 1M0SA 3EJ6A 5FI5A 2F9LA 5EUBA 4AMYA 2J9FB 1MJNA 2HD4A 1H2BA 4P3KA 1SOUA 2GNOA 3ONNA 3RUHA 3TF5A 3L40A 4KFUA 3LUHA 4XJVA 2AOXA 5AW6A 3BIWA 4W82A 2O1SA 1K4YA 4I4TB 4UXJA 3VSEA 5LIPA 4RVNA 5BSEA 3RRMA 2FPMA 3W2GA 2ZPTX 2RK4A 2Y9MB 3IVMA 5C7IO 5K8UA 2AS0A 1GPBA 1LPAB 5EPEA 2P3QA 2SKCA 4GKVA 4DG9A 1ZKMA 1W96A 2H07A 2QY9A 1TA4A 1FS6A 2Q62A 2PLNA 1DKPA 2ZJ5A 3PRHA 2HLDD 2JHCA 4H6VA 1JLLA 5EIWA 1E2DA 4YWHA 3I61A 4ZTUB 3A3YA 3CKYA 1JU3A 1Y1RA 2VDWA 2OBLA 2UYCA 4NONA 3ENNA 1O6CA 3ENWA 3C24A 1EVEA 1ZIPA 2FCAA 4C2AA 5FJIA 3WWOA 6LDHA 1CS4C 1AN0A 3OTOB 2ZUEA 1N6LA 2CXUA 2JGNA 4CE6A 1J8QA 1XKXA 1BXKA 1QWSA 4JLSA 3DBHA 3EN0A 4OYYA 1AKUA 2I3ZA 3MTEA 4Q01A 5F9FA 2XIJA 1BE0A 3MNFA 3CH5A 2CDCA 3OLYA 5KJ6A 4XUCA 2QLBA 1HUQA 3GRVA 4FOLA 4C0SA 3IR6A 2Y1DA 2NMVA 1P44A 1RYEA 1ZCZA 1W25A 2J9RA 4WXYB 1DTWB 3ER6A 3ZIAA 4R2LA 4DLNA 3R76A 2DTDA 3TUJC 4PRZA 5IFLA 1JSXA 4MMXB 5C8XA 1V1JA 5HZKA 2FP4A 5A5FA 2IYFA 1F14A 3C45A 1BMFA 3LPMA 4HDKB 2ZJFA 1T5HX 3JALA 4IQ0A 4Y2SA 1SBCA 1KAEA 2W98A 3ZI7A 1JDPA 1FSGA 2C2ZA 3R5FA 2P5YA 4GU5A 4TMWA 4LDPA 4V24A 4J7AA 2NO9A 4KN9S 1KFCB 4LBZA 5AYVA 2PWZA 3UPTA 2VLBA 3S44A 3V34A 4BX2A 1DCFA 4NYIR 4XRRA 3ZHVA 1EM6A 1Q0QA 4R69A 4FN5A 4YRTA 1ZXBA 1WCIB 4ER6A 2AOUA 1IIBA 3T12A 1TMOA 1UM9A 1M6VB 3JD4A 1ISRA 3DWEX 3E5HA 3DDSA 4EG3A 1R00A 2W6ID 3P71T 4X20B 1Q1AA 4MPDA 3SK0A 2HJWA 3L5KA 4C5AA 4IXDA 2KBFA 4U0JA 5B7NA 2FZWA 3Q9UA 4EEKA 3OPYI 1Z3IX 7AT1A 2I76A 4J0JA 4L5CA 4LQ4A 5E6SA 4GG1A 2V7GA 5I8ZA 1BQ3A 3WAKA 2JLWA 1MFPA 2G88A 2WJVA 1TYBE 4KUGA 1PR2A 4WKGA 2HY7A 2PGOA 5BOSB 1NVGA 2IHUA 2GN6A 5SYAA 3EEOA 2IHNA 3KAQA 3CNLA 5CBPB 3AQIA 2P1ZA 5THKA 4S0ZA 1CQZA 3NHUA 2GEBA 3JRXA 1ZRNA 2BY4A 3EXHB 2RGAA 4N3GA 5JDCC 1JIUA 4JWKA 4N5DA 4M1MA 4FIDA 1YH3A 2VKTA 3JPYA 4TXMA 1HDZA 4XPIB 2Z4TA 5DSTA 1TX4B 1QCDA 1QOPB 4AWXA 1CU1A 4Q7MB 5J58A 4G1EB 3MJTA 2HHHB 3TBKA 4XJSA 5EUQB 4FR0A 5EKTA 4XR4A 4YV0A 1XZKA 2IUEA 3MWDA 5C3MA 3CCBA 2A9PA 3JQRA 3LECA 1R3DA 4YMGA 5DWDA 2ZXUA 3OEYA 1D2EA 3P4YA 3H1EA 1R6AA 4DLWA 3C70A 2QTLA 2UZ1A 5JYEA 4PFSA 5FOVA 2IKQA 1KK0A 4XVQA 4OQZA 5C80A 3I05A 3C2QA 5ALIA 4QUKA 3E23A 5AOAA 5G2OA 1PYDA 4QWWA 2AC2A 2UVQA 3W6NA 4EMTA 3TLYA 3KVYA 3AP1A 4V0OA 5FBWB 3RW9A 4GM4A 4EHKA 1H9BA 3LA6A 3LPNA 3TPFA 1WVMA 4LWQA 3TJZA 5C8DA 3NNSA 2QAJA 4JKIA 4DSUA 3R2JA 1GTSA 2BGKA 2I6XA 3T5CA 1RPJA 1H4TA 2FU5C 2VYFA 2ZJAA 3WBBA 4EUKA 3H17A 3QOFA 1SRRA 1WTAA 3STUA 3OVMA 4BNUA 1SEVA 3IQXA 8ATCA 1JWLA 2IP2A 5EWJA 5IK2A 1Z6ZA 2O07A 2XKKA 1K7XB 2P90A 5CX1B 5DWVA 1SXIA 5I9BA 1HFJA 3C6KA 4IFTA 4L3OA 5F1YA 5M34A 4B43A 1KH1A 1TIBA 2PZLA 5K5EA 1QP7A 2NUTA 1TVEA 4KE6A 3AL2A 4J9UE 1FDTA 4LW8A 5ULLA 2PUJA 2NU9A 3UXMA 4G5YA 2C42A 4PZEA 4WMLA 1BROA 3VKGA 1MEJA 2D2VA 1KSHA 1T13A 2YUTA 3EDOA 4BS9A 4UMEA 1I6MA 8LDHA 4YT5A 2FSVA 3UAYA 3ZHUA 3AZPA 3ENQA 2H4YA 2OEPA 4KMSA 3EVNA 1SZDA 4ER5A 4ZYVA 2VDJA 3COPA 5F12A 4AZTA 2H59A 3EBOA 4REQB 1IUOA 2YXBA 3E2IA 5DYGA 3VC7A 3IEMA 4OLBA 1LLUA 1OWPA 1E6LA 4TT8A 5IBRA 4IJ5A 4BNWA 4YRKA 3TW6A 3JQEA 3RJTA 1JHAA 4F2HA 5AW3A 3ZGXA 4C21A 4HUTA 2WTNA 4FZRA 2OQVA 1J8YF 2MYUA 1M34B 1PEDA 5DASA 5IM5A 1KMCA 4K0RA 3RG8A 1ZN7A 4UU0A 3MS2A 1XTRA 3BORA 1WUYA 2JFOA 1T8TA 2GN1A 1KYZA 2XNSA 2G3YA 4W99A 3RF7A 2YHIB 4BX3A 2ATXA 4TZ0A 1SB8A 1ECJA 2BTOA 4MW7A 4GMGA 4TV9F 5KTYA 1HC7A 3QE4A 3DE2X 3I9KA 4EUSA 5JTUA 4PXYA 2AMLA 3THXA 2RH8A 1AD2A 1Z68A 3QVGA 3CLTC 1QDLB 2P9ZA 4LOKA 2O2XA 1AB5A 1KJQA 2B0JA 1TVMA 1PWXA 3GMIA 4JVLA 3V8EA 1GU1A 1D2CA 2QTRA 4G81A 5BN3A 1R6XA 3QBDA 4X92A 3S70A 2Z6UA 3ZNNA 2EAUA 4BV9A 1V16B 2AEMA 2PRJA 3BFPA 4B47A 3G79A 4IMIB 4N12A 3QFRA 2VZ8A 1H2RS 1LH0A 1YCHA 3LLMA 3VI3B 3WS7A 2VG8A 3SYNA 4Q4DA 5E1OA 2GFIA 1BWQA 4MV0A 3LUGA 5D3ZA 1JPUA 3G9UA 3W2TA 4M49A 3SZRA 5DNWA 1CY2A 1G1MA 1JG3A 5ALNA 3A31A 2NACA 3R74A 4MDHA 1XCMA 4BQEA 3WNZA 4AL4A 3KQHA 1NR1A 3EAQA 4FR2A 5JMOA 4OB7A 2JCVA 4AAYA 4Z4FA 2VFAA 5T41A 1SQSA 4OL9A 3PJDA 3V4ZA 5HUJA 1Z6XA 3KU1A 1PJ2A 1QG6A 2VDLB 1IQRA 3FKJA 3HHEA 4FK8A 2P9EA 3B1FA 2C84A 4UVIA 1PCXA 1AGPA 1HK7A 4AO6A 1G20A 5AH0A 5LQMA 4BWVA 4PEVA 2OP0A 3LE8A 3LSYA 1UDXA 3O3OB 1RWKA 1Z0KA 2AXQA 1FEZA 2B35A 1XPUA 1UOOA 2X8LA 3PIRA 3DKIA 1IBRA 4JP3A 4RMNA 3P5BA 2EHJA 4ZVUA 5AW8A 1J0DA 1TB4A 1F06A 1FP6A 1T43A 1V4BA 4CU5A 2PUDA 2PZKA 1BH6A 2ARKA 3CUKA 1DC3A 2PA3A 4GVPA 4ARZA 3ZW8A 4C76A 2V0CA 1O3YA 1CY0A 1PDOA 2I2FA 2ZWOA 2IE0A 3D6NB 5KYUB 3OCYA 3E8MA 5HE8A 4BO2A 2BHRA 4KR7A 3VR6D 4LGMA 4L2IA 4RCZA 5EN4A 4S12A 1OXMA 1HYHA 2H0RA 3LUCA 1GNPA 1YBAA 4ZJYA 3LXMA 4MLDA 3N2GB 4YQFA 3GLSA 2IBTA 5LNK1 4Q1EA 4CM5A 1ACMA 3CH7A 4Q48A 1TW3A 2X4DA 1H1LA 4NJMA 1OSNA 4RKWA 3PFWO 4YV7A 2PZMA 2XKBA 3HI6A 1OZ0A 4IIJA 4LRTB 1TCAA 1T2VA 2JFGA 2OCBA 4NYJR 4ND1A 4EGQA 2JBAB 5CDGA 1SZJG 4K9NA 1MAAA 2W6NA 4JLNA 4UCXA 3DVAB 1MORA 4WUVA 1SVKA 3PNOA 4E5PA 3A4LA 3KPWA 1Z2AA 1QANA 3ZLVA 2WYVA 3CEMA 3W7VA 3KX2A 3GAFA 4AZSA 4LK2A 3ZDCA 3DCYA 4N0PA 5AVQA 1MW9X 3F5MA 3OTHA 2IV3A 5CFPA 1JHMA 3MQ4A 4G5HA 4H35A 4BP3A 5JE8A 2YJ3A 2R8ZA 4D3ZA 1GZVA 4HGNA 3TE6A 4V38A 3LT2A 1MQ8B 2C9DA 3HEAA 4INAA 4KIJA 2XEDA 3WYDA 2TMDA 1EUQA 4GKJB 4L76A 3MS4A 4EL0A 1IIRA 4XQEA 2PMWB 2GN0A 3KDSE 4JXKA 1FNMA 1DTEA 3N6XA 3ZGYA 4DDUA 3WMFA 5GJBA 2N47A 2PJDA 3AEQA 3KOXA 2AI1A 4ZDKA 4EG4A 4MVXA 1TJYA 3PXXA 3TOZA 1PUIA 3PC8A 1TVCA 3JY6A 4TXHA 4P2BA 1VRWA 1VPWA 2QTZA 3C3JA 4Y2JA 3HMQA 5FEMA 2IY8A 1F51E 1PSDA 3JRNA 4WASA 3ZDYB 5JZBA 1BEZA 2PRKA 3LP5A 3P8ZA 1N77A 4RE6A 3LDUA 3DAFA 1L5KA 1M76A 2B5OA 2J9XB 3E3MA 4QPDA 5DTIA 2BBTA 2JIBA 2XYPA 4KDFA 3TZEA 4E22A 3ESCA 4FQ7A 5AJXA 1O94C 3BB1A 4C0KA 1G17A 5U4XA 4GL2A 1M1YA 4HJRA 3VPCA 1NQ5A 4YIKA 4WVFA 1U5BB 1AKWA 1XZQA 3PXUA 4GF5A 3FGNA 2RHRA 4ZODA 3QVOA 3QKSA 3VC1A 4ZYZA 3THYA 4A7PA 1GEEA 1R6BX 3FNHA 2D4HA 5CVEA 4ZDIA 4Y2QA 1CXZA 1PIWA 4O2BB 3LLVA 5T4BA 1O97D 2IYEA 3VO2A 4KWTA 4BJHB 1A72A 1FYFA 3PPIA 4AULA 2ISQA 5L3QA 3W5IA 1EBFA 1GG8A 1SCKA 5AOVA 3K8QA 2Z57A 3NRJA 4BTVA 1AHIA 4MQFB 1A2KC 1PP4A 3AHIA 4AJLA 3IP1A 4TVSA 4NMHA 1KKMA 4KR9A 4C0AC 5LZ4A 1RMTA 2HJSA 5C53B 2PUEA 2Q41A 1Q1EA 4TPKA 4DTCA 3WA7A 4IGIA 4LN1A 1YE8A 5DCYA 1I7DA 1CT9A 1VCNA 3GV0A 5LM3A 4J0DA 5ALQA 1KDPA 4A23A 3GYGA 2BH9A 1O08A 2BEVA 2ZAYA 3CMMA 5BR1A 3GJQA 3RYHB 1E3JA 2QTHA 4EH1A 1RS0A 5HW0A 2CXQA 5LZ2A 1HZZA 1ZZGA 4M87A 2VPIA 1PZNA 1TTPB 1YVEI 3ZHBA 4WLOA 1WV0A 1CQIB 1Q84A 2C2HA 3PHIA 4Y9UA 1ZK3A 4A0RA 2Q4DA 3VH4A 2X0JA 2XI4A 1OXVA 2J3EA 1F6BA 5CDUA 1OBHA 5M2QA 1C7FA 2H63A 3D4BA 3E9QA 1VE7A 1Q22A 4XOIA 4J1NA 2RKOA 3TIGA 2AMFA 5HRAA 2ZZKA 4KLNA 3C7TA 4P3OA 5G0SA 1RCFA 4LTDA 4G5FA 5AI8A 4YYEA 3KEOA 2QR3A 2PT5A 4GI2A 1SQ6A 1IG3A 1L4UA 1M8GA 3WADA 3D6TB 1DIGA 3ZY5A 5KC9A 1MG5A 2HC9A 1O89A 1J2EA 1MAVA 3EDYA 5AW1A 4FWIB 3VAZA 5FPKA 4D96A 4PVDA 3NVKI 3BDVA 3HU2A 1LF0A 4G86A 3CWCA 3DWGA 3O9ZA 5EJEA 2G04A 5BVGB 1R0KA 2ZLBA 1QJCA 3I2FA 4TQAA 4HAWA 3KKKA 1GZHB 1BRTA 1J39A 3U0BA 5K8LA 1UKCA 5KSWB 2ODEA 2GFHA 5KX5F 1NV9A 2C4MA 4U7DA 2RGNC 4YCBA 3A6EA 4M9SA 1RI5A 3EPPA 4K9SA 3V4FA 4IJMA 2PH5A 4UHDA 5IN4A 5BW6B 4HGOA 3RSLA 3DHEA 3FKQA 2DH5A 5HF6A 1ZY2A 3CO5A 2B25A 3BAFA 1NVXQ 4DCGA 1L7DA 2GPSA 3R0ZA 4ZO4A 1PV1A 1UBTS 2GRAA 2ZS9A 3OE1A 2X23A 4MHSA 1LGYA 5EG5A 3UOAB 4BVAA 5ABPA 2VJMB 1KC1A 1FQWA 2CT8A 3H1FA 2GPBA 1IBSA 1UMBA 3HP7A 4UCQA 5B3JC 3BWEA 4QFBA 5J47A 4R9UC 1A4IA 4X7PA 2YS6A 2FJ0A 3DNFA 1R0CA 1II0A 1UPAA 4J4HA 5TF0A 4AJPA 3SQXA 1BG6A 3MFYA 3O1IC 4R9NA 2PYZA 3GLGE 2Y92A 4BVBA 3AL3A 5C5DA 3IDOA 3A6LA 3GLFA 2YMMA 3JYPA 3V9AA 1K3UB 5JLAA 2ZVQX 4H27A 3GBPA 3U7FB 1E1KA 4UCFA 2JJ1D 1B8NA 5HIIA 1W19A 1QHYA 2XUOA 2BSXA 4MW4A 4UDXX 5F52A 1BFKA 2HBRA 1G2OA 2OM2A 4YMLA 4TTTS 3UWPA 1QUFA 3IV9A 4G0ZA 2EFCB 4FZ3A 4RZHA 5F2EA 5ELMA 4UNPA 5CCBA 1UK8A 3GZ4A 5C34B 1TA0A 3VYRB 4GI3A 2NNWB 3PPVA 2EDCA 3MJDA 3JQ8A 2CJFA 2WHPB 3C8MA 3MEQA 2IYPA 3E4DA 4IV5A 4AW9A 1OB2A 2PZFA 4G37A 4A82A 4E09A 1LV7A 1UC9A 2OXIA 3KZKA 3OCWA 3KT3A 4PBSA 3T1NA 4CUKA 2PIDA 4D8VA 4UQLA 4A8PA 4MKGA 4MA4A 1IHPA 4BTLA 3DVLA 3NWEA 2WKPA 4G0QA 1Y5RA 3E9ZA 4MR7B 5F64A 1R16A 3GARA 3SYLA 3IPAA 3ZK9A 1XZGA 1EX9A 1SHKA 1YZKA 5EIXA 3O8LA 2XB9A 4OQEA 3M6UA 5TS2A 1J2UA 4AROA 5C3UA 1EB9A 4XRGA 3SKYA 1UC4B 3AUJB 2FWPA 3B3FA 2GXQA 1N5KA 1NBWB 3FUCA 4PC1A 3S1LA 3GLHB 1U7TA 2JFZA 3PI7A 5LA6F 1U0OC 2PNJA 4P3XA 1WXIA 2F48A 4B31A 4BTEA 5BSGA 4GQAA 2H06A 5FA5A 3AFOA 3B6KA 1NUQA 4ZJPA 5C5EA 3II6X 1T8WA 4JKOA 3O7MA 2BFDB 1SCUA 5FPQA 2QRNA 3TXAA 4H18A 3QELA 4W5OA 2R1TA 2ZT6A 2JAWA 1WMEA 4NI5A 5E4YA 5K45A 4HNVA 1FFEA 3LHKA 4JLDA 1TU0A 4B4DA 4E07A 5C0OE 2VP2A 2ZI7A 3EVCA 5JSQA 3A11A 3DV9A 3OQOA 3EVEA 4YP6A 3MWGA 5SV2A 1E3LA 1RI2A 4BB9A 1ZLXA 3DOEA 1I14A 3MINB 5I7WA 1SEPA 2JZCA 3CG4A 3F5FA 4OHFA 2QMUA 3L4BA 3G5LA 3PQ4A 1CQXA 1SXJA 4RPGA 4A10A 1GTL1 1XVIA 3L1IA 2YBEA 3EFHA 3CZRA 5DK4A 3QWBA 1L4KA 3V4LA 1G8HA 5KS2A 5F23A 1UBEA 3NUGA 3IT2A 3JR3A 1A9TA 5HJEA 4EW2A 3SF0A 1T2AA 1JKFA 1U3UA 4KWHA 1HO3A 1UZAA 1G42A 1TM5E 1CRQA 3PNMA 3FF4A 4HNAA 4Q4LA 3KJNA 3GGDA 1W5BA 1PGQA 3ACDA 2ZREA 3DM9B 5D51S 3MHPA 3K15A 4D0SA 1PNTA 1M83A 1N6KA 4M76B 3ADOA 3TRKA 1FFCA 1WCXA 1Q77A 3O38A 3P45A 4G0OA 4D4HA 1OASA 1WDTA 3G0BA 4EA8A 4JSYA 5BQ5A 3OX4A 3PTAA 4HQFA 3OJEA 1ADCA 4R7ZA 3T06B 3N07A 1OI2A 3H7IA 4WESB 4YAOA 3PXDA 2ONKA 2XA1A 3GB9A 3MJSA 2REXB 1DINA 4FFSA 3C16C 4MV3A 5KTPA 2O6HA 3AHDA 4XLLA 2JK0A 4IDQA 1CSEE 1Q0RA 1QAOA 2JCYA 1JJVA 3LCVB 3O1JC 3B7PA 2PMDA 4V0QA 3WE7A 4ODIA 2G07A 3H1AA 4MRRA 3NHZA 3O8CA 1YB5A 4TT3D 3RIEA 4INPA 5IJZA 2QJTA 5CNJA 3TX2A 3TRDA 2HW8A 5AXBA 2PUCA 3AIOA 3D3EA 3UTCA 1AKTA 2QENA 1WR8A 1RRKA 2EJUA 3EPRA 2AN1A 1A82A 5H4GA 1ADJA 1PEAA 1K7CA 4J2TA 5FO0A 4CG3A 3U62A 1KVQA 1GFWA 1I30A 3FPCA 4K6HA 3TINA 5LWHA 2DEUA 1GRRA 1JUDA 4EVIA 2F1RA 5BWNA 4Z4IA 3F3MA 3HRIA 3L0CA 3SAJA 2Z5GA 3PE6A 1PG5A 3HMKA 1T4BA 3TKAA 2IEGA 4BNIA 2X7XA 3P2EA 4EB6A 3CS3A 2NX2A 4KQWA 1OZFA 4M0KA 3AEKA 1YE3A 4GP9A 4NBSA 4DUGD 4N41A 2WA1A 2ORED 3WSVA 1ORWA 2PKYX 5BN3B 1PT5A 6REQA 4BGEA 2QF7A 3PD1A 1XXHB 2QJRA 2X40A 1RFGE 2PH7A 4OJYA 4NZOA 4EWLA 3M3DA 1NOJA 3RJZA 4CKCA 2BZSA 2GPYA 2OG1A 4YBRA 3K70B 2Q1UA 4G23A 4JSRA 3H9UA 3MUFA 4L02A 4QUDA 4EG5A 2F2TA 3BF8A 3DYIA 1BOOA 2WHXA 4QNMA 1O4WA 1FFHA 1HOTA 4IXNA 1QV7A 3HCAA 2UZ0A 1D09A 5U9CA 4DKJA 3C6MA 1ODIA 4Y6GB 3GZNB 4K03A 5BWCA 2RAPA 2VDMB 4CEJB 3ASYA 4K8RB 1K66A 1VHWA 3L5OA 1WJGA 1ADBA 3NTXA 4PLCA 4P38A 4UJ3A 3QV1A 3LCUA 3PDIA 1EWYA 1H05A 5JS2A 4OXKA 1CUGA 4FS8A 4ZP1A 1XN1A 3OIVA 1VJ5A 5GOZA 4XWGA 4ZO7A 3N2LA 4XYBA 3SX4A 3GRCA 5JD6A 1OX5A 3THOA 3F5QA 1X7XA 3DOOA 1IATA 1JKXA 5JZMA 4GYJA 1RLTA 2G08A 4ZVPA 3TZHA 1ZL0A 2P5UA 2XQIA 2PH3A 3U44A 4MAAA 1XWIA 1K5HA 4MOWA 1JQLB 1E1CB 3BEDA 1GAJA 1FQKA 3NWJA 2Z5LA 5REQB 1QGUB 5FA6A 2PMBA 2BRUA 1HETA 1D5CA 2ECPA 1BMTA 3VR1A 9MHTA 4B32A 4U5QA 1FW6A 2Q6VA 2F9FA 2VYNA 1GTVA 3EOAI 3KV3O 1WNFA 3I37X 3QF4B 3FFAA 3QPAA 4LJ8A 3P19A 5FP0A 2D54A 3C3PA 1E8NA 1P4HA 2HEGA 3CF2A 4EPRA 3CLSD 4F3KA 4IOMA 3HBFA 3K32A 3FUUA 2AKEA 2QPLA 1SCAA 1W47A 1KVSA 1EE9A 3EDRA 2HWKA 5JEEA 5LNK6 4D41A 3D6HA 1NVUQ 2NZUG 1WABA 3IPXA 4U2BA 3WK7A 1I33A 3NV9A 2IUUA 5CVDA 2YNMD 3L7LA 4KH1A 4B75A 1UOEA 2ZRBA 4JLKA 2FN9A 3IURA 4UAVA 4DV3B 3I92A 3LNCA 4MWCA 1ZN2A 2OLJA 4EKIA 1PYGA 4MS1A 3UWSA 3F2IA 3BXHA 4O8CA 1P2GA 3E9EA 1Z5WA 3D31A 4B40A 3KZOA 4EUHA 2EU8A 3TRJA 3DGEC 5PNTA 4TX1A 4D9FA 5BSVA 1ZNQO 1OOEA 4L72A 3X1ZA 4CKZA 4GP7A 3PJGA 3PWKA 5EKSA 1ADFA 5IZCA 4DIOA 2BFEA 2O8DA 3OTQA 3VJKA 1KIFA 4F6LA 2RAFA 4Z5XA 5K6TA 3BG5A 2EARA 5TXGA 2W6CX 2BE9A 2R6ZA 1NJSA 4RZUA 2GM5A 4QLOA 4DQDA 5D7NA 4LCJA 2VHVA 1CKEA 1AVTA 1FVHA 1U0EA 4IBOA 5LZ7A 1YZFA 3U7QB 3I4CA 3VPHA 1N5JA 4MB0A 3OY2A 2QL7A 1GU0A 1TZMA 4WIAA 1Q44A 4MXDA 3ZHSA 3TGLA 2FEPA 3QX7A 4UBOA 4XVHA 5LQUA 1F2TB 1QIIA 2Y1OA 2A67A 1SVOA 2AK2A 5CLQA 3D4IA 3K72B 4RY8A 4DJAA 1O5OA 1MT0A 2QTVA 1G63A 5CVCA 1NURA 2F55A 3BKWA 1BGWA 4OJKA 1C9NA 3WB2A 3FPJA 3RHTA 4YQYA 4RLSA 4IMRA 1HLDA 2DFNA 3OURA 3NVMB 1PW5A 3HYLA 3GNLA 1NDHA 2FZEA 1ENZA 4X93A 3S0JA 1CRZA 2B37A 3MCTA 2Y4OA 4GDMA 2PG3A 1U11A 2A1TS 2H11A 4WJKB 2Z08A 4JI3B 5DX8A 5TT1A 3CONA 4QBHA 2HHJA 5I5GA 3SQNA 2ZRPA 3BF7A 3D2BA 5CP8A 3ZYCA 4NOJA 3RAPR 3BHNA 2AD5A 2HGSA 2J0QA 1OWNA 1QYCA 2JARA 2E4WA 2JA2A 4GOND 2HHLA 2JFPA 2P9HA 2FPWA 4MGYR 1Z17A 1FPMA 2WFZA 1S5PA 3GP3A 5L3ZA 3T6KA 1JZQA 1UAYA 3TM4A 3W1VA 1V9LA 5AFSA 5IF9A 4PYIA 1L7VC 3TNFA 1FY2A 1P72A 1XE3A 1XIVA 3ANNA 1XTSA 3CT4A 3MJVA 3MOSA 5HTOA 3ZCSA 2F67A 4CR6A 4BNDA 3B1YA 3H04A 5KQPA 4E6EA 4D8TA 4QG3A 4OB8A 4UEJA 3GUCA 4D26A 1DMRA 2AW5A 3HJTA 4I55B 4L75A 3KKOA 4DLSA 5HEKA 2YIVX 3HJRA 4CHGA 1PBNA 3UAXA 3OETA 1XMPA 1DWUA 1P29A 2XZTA 3PFBA 4CQJA 5DTJA 3JQBC 5K8JB 1RC8A 4BLSA 1NIPA 1Z6AA 1M1ZA 4KV7A 3ZQKA 2DZDA 3FDFA 4X61A 1WY7A 1BGVA 1AZLA 1YS4A 3MTGA 1ZGGA 2YV1A 4MUKA 4YP0A 1EP9A 1QK4A 3VC2A 1BS1A 1WPQA 1QS0A 5B12A 2JEZA 5DNEA 4LNUA 1CE8A 2QMEA 1AXGA 1VLLA 3UOWA 4RGVA 1XGKA 2I0FA 3R0IA 2ZJ0A 3VDNB 3A6DA 2FYTA 1FP4A 1BCRB 2HTEA 4A0QA 3OQMA 2ZJBA 3HDGA 2TMKA 2V65A 4Y3UA 4IDDA 4X1IA 1B6RA 1ISPA 2XGSA 1BDBA 4IEIA 221PA 2UVPA 1PEKE 1O0SA 1CY6A 4C4YA 5CGQB 4DIBA 4HQKA 1TAQA 4NF2A 1PL6A 2YCLA 1HE8B 3BE6A 3IXLA 4FE4A 4OKNA 1AS2A 1GGVA 1J20A 2B98A 3RKRA 1N2CA 1ZSYA 3JQAB 1KYVA 2I3DA 3MJRA 4FUTA 4LI3X 2IEDA 3SZOA 1G4AE 3TGPA 1XK7A 1G19A 3EARA 4EJMA 1XRJA 1GSOA 2VPPA 1W8DA 4JEUA 5KU1A 1XEWY 2O3TA 5D87A 5JCOA 2AVNA 2ZRNA 4YMHA 2CCGA 2NSYA 4P2GA 3WP1B 1F2VA 2BHTA 2Q5HA 2Q2OA 1BFDA 4RABA 4C20A 1R4MB 3TIIA 1KOFA 1A9SA 1PFKA 3Q8MA 4LKRA 2O5RA 5K2OA 2QXUA 1NF9A 1NGSA 2Z1NA 3KZMA 4H9GA 4L8YA 4ENSA 3E70C 2UVDA 3F9CA 2YIMA 4DSAA 2AHOA 1BYIA 1H2AS 2PVCA 2VXOA 3TI7A 1VDMA 4BWFB 2R84A 4BJ1A 4QJ3A 5FQNA 3AU8A 1FMJA 4DDMA 3B8HA 3Q9NA 2FB9A 3KCQA 1SHZA 2OZVA 3GJTA 4CIVA 1G66A 4BYMA 3VH2A 5KYWA 5F51A 5CDHA 2YYYA 4HFMA 1C9JA 1LDNA 2WIAA 1LKZA 3COZA 4HGYA 1G3RA 5DHUA 1IBLB 4HQRA 5FADA 4GXQA 4ZAYA 3QSGA 3SNKA 2AK3A 2KSQA 2WHYA 2XMBA 3AW8A 2E5WA 4NBWA 5IBQA 4LVCA 3REFA 4HYQA 3UT5B 4EKGA 5AVVA 3GP8A 4HFJA 3PP8A 1DTWA 2I3BA 1ECFA 2EW8A 4TYYA 3MT8A 3QVGB 1IJKA 4LHWA 2H8GA 4W9RA 2IUYA 4ERNA 3LUKA 4F4UA 1Z4LA 3LBNA 5JDIC 3V3TA 2PUTA 4TSFA 2WFLA 2YXNA 4XTCS 2HOQA 4NY1A 5K6RA 2PH1A 5H3LA 3C3BA 4HAOA 1E7YA 1S3IA 3MMSA 4MPTA 3ZVNA 2CBGA 3DT9A 3R7BA 2OAGA 4Y2XA 4EUEA 2ECQA 4K7JA 3A9CA 4OO3A 3IB3A 4TLMB 2XD9A 3U61B 4CL2A 4FDAA 4NOLA 3URMA 1VBKA 4BB5A 5FWXB 3DSRA 4BVGA 2BGUA 2HMYB 4W7HA 3BFVA 2PWAA 4C4RA 1E92A 3I64A 4D98A 4IEEA 3L49A 2OWDA 2YWDA 1EVJA 4ZYLA 5K8TA 4TKUA 3GNTA 4OLHA 3WNBA 4QWMA 4BJ6A 5BUCA 4ZOAA 3WNVA 1O5TA 4ECAA 3OO1A 4YV2A 2OHOA 2HO4A 4KYTA 4B17A 4PW0A 1CY8A 1I4OA 3IPLA 1Z06A 2GZHA 2Q2QA 1K5DA 2C4KA 3DMTC 4HUQB 4X71A 5DV9A 4CKBA 1D9XA 1H1TA 2MU1A 2QE6A 2WG2A 3GOQA 3NP9A 5SY9A 1NJ5A 1QIDA 2OV3A 5ALJA 1SU8A 4YRSA 3ZHQA 4F60A 3LQYA 5KQMA 1KERA 5FNVA 2PL1A 3RK1A 3RO7A 1BW9A 1XDSA 1JSRA 1L7XA 2DRIA 2CZQA 3PEYA 2DYKA 2H8KA 1CY7A 2DUMA 4LDQA 4Y2YA 1F8YA 3DKPA 2NV6A 3ZU4A 4M6WA 5JSUA 4PU0A 2GARA 3UA3A 4MW1A 3A14A 3T4XA 1IUKA 2PN1A 4KUHA 4FWBA 4OFBA 1EJBA 2HSEA 2PR2A 3PA8A 3PA6A 4A0HA 2OO7A 1U99A 3UKJA 5BV8A 1SUDA 2IZOA 1XPJA 3IUQA 3H3JA 4XIYA 3EPJA 1DEAA 3AH8A 4TV9B 3B1KA 1QIFA 3ERCA 3LC1O 1F0NA 2QX8A 3UGQA 2G72A 3S81A 4M7PA 1E7SA 1M2WA 1S8FA 4HB0A 2IPXA 3M1AA 2HT6A 1JYEA 4OHXA 1B4DA 1LPPA 1UBGA 3IUYA 3V4OA 3W6PA 4DGQA 4XPIA 1FBTA 3O75A 3K5PA 2PJUA 4KGZA 1UAGA 3JRWA 1KBZA 4U2EA 4JJIA 2PO7A 1WP4A 2J6HA 2VHCA 2EKZA 2CBXA 2UYOA 4Q1VA 2Y0DA 2ZIXA 3KSBC 1UC5B 1M8KA 2V6BA 3GRYA 5EP4A 4DR2B 1AC5A 5KSYA 1OILA 4IIEA 3ZCVA 5FYQA 2XMDA 3A4NA 5CFNA 1CUZA 2O7RA 2JAPA 1G5HA 3IOCA 4CQNA 5TPWB 2PAAA 5JSKA 1X74A 3C7AA 4O4IA 4WN9B 3GA7A 1TPYA 2YX1A 5LLDA 1C1XA 1Q74A 1YRWA 5CUQA 3KKZA 4Y0NA 2CFSA 5FO1A 4MICA 2NU8B 1OAAA 4FYWA 3U4GA 1EUYA 1Z0SA 3BZBA 4LZWA 2ZYAA 2FKAA 3EZ6A 1KRWA 1IAVA 1Y8AA 3HA5A 2ECFA 2PKRA 2Q6IA 4G8CA 5GJCA 4D82A 4R16A 3JU3A 4UHBA 5A7GA 2IOQA 4YMIA 4LFCB 1Z47A 1A95A 4ZEOA 3QWHA 1N6PA 4DABA 1CR0A 3V7FA 2ZUTA 1ODLA 2ATEA 2MT9A 2QW8A 1O54A 1HSZA 1G21A 4H17A 2F1KA 4NBUA 2AFRA 3RE1A 1T4CA 3U9TA 4F3YA 2AGVA 1YFZA 1W46A 3Q3CA 4TL6A 5FDFA 5K0BA 1T15A 1RVV1 2H92A 5CVVA 5AUQA 5ICSA 1ZK4A 3G8YA 2G80A 3LW8A 3P9SA 1OYOA 5COQA 1DJQA 2PWPA 2W22A 4F3CA 3NEAA 4BLWA 5A4IS 1NVVR 3LY5A 2BHLA 1OV4A 1ODTC 3UMJA 2IZ1A 1YIAA 4G5GA 3IEPA 3OKAA 4BQQA 3U5ZB 1O95C 3ICCA 4B8ZA 1G8MA 2HMUA 4TQUS 4CODB 2OM6A 3OIGA 1GR0A 1EK0A 4J0FA 2R65A 5U4QA 3BN3A 3MWEA 5IYZB 2XX3A 1NYLA 2IJGX 2XV1A 4FLEA 4KXXA 4Q16A 1CDDA 2ZTHA 4GMXA 4RD6A 4S1WA 4BVEA 3ZOZA 3LBIA 3CSSA 4LYEA 5FORA 2Y76A 1U0JA 2NSLA 4K9PA 5ALMA 3M6LA 4ZOBA 5K3FA 2XZPA 2GK6A 2QJWA 5CYPA 4FJ1A 5C7LO 2ZJOA 4KRGA 4I3HA 4HAVA 2V03A 1EQUA 4CMKA 2GD0A 4JVMA 3AIKA 3IFSA 4AZ3B 4NJOA 1L5GB 3FHLA 4WNAA 4MVJG 3BCRA 1Q83A 4WINA 3WO0A 5E9QA 1T36B 5A3SA 1I7QB 2LNDA 1J97A 3EAFA 1Z2NX 1E4OA 1K63A 3PUYA 1DAFA 4V3CA 5LA6A 4AK9A 3OJCA 2COKA 4CVNA 3TOXA 4RTLA 3ICOA 4XIFA 2IGTA 3ZDBA 1X8XA 3RVSA 1RXWA 1V25A 1C9EA 3PQ7A 2GA9A 3V8VA 2WMDA 4ZOLF 1B41A 3S1AA 2W9XA 3A9RA 2SCUA 1NY6A 3LY7A 3W06A 3EB9A 2YVQA 1OBVA 3OLCX 5F1OA 4HDOB 2AOTA 5BPFA 1H5QA 1SNYA 3AZQA 3BE5A 4G0NA 3WK6A 2IYTA 3GFRA 4EGCB 1RWOA 2ECKA 2EG5A 3HXPA 3NGMA 1XAIA 2KHZA 1CFJA 1GVHA 1GLNA 1EP1B 2PX5A 5H82A 4NS4A 2BM9A 5DGTA 2UXBB 3CE6A 2MMCA 4RBNA 1CYDA 1OREA 1ODJA 1GFIA 2YHBA 4QTUB 4D9BA 2J85A 3M4JA 5JSHA 2GLTA 1FP7A 4LNUB 2GBPA 1RLIA 4X54A 3I58A 5SY4A 3RSGA 4TSFD 1P5ZB 2BPOA 3HJUA 3N2KB 1D8TA 1SJ9A 1NQOA 3Q3JB 4MJLA 3C5EA 2SNIE 3G2QA 3QIAA 4L15A 3U2QA 4A36A 4QG7A 1BYUA 1YDMA 2VNAA 4G8BA 1UBUS 5NLLA 1K2VN 4DQKA 2OCLA 4FMPA 3CCCA 4S1OA 5A9SB 1H3NA 1I10A 2C59A 2EX0A 3F71A 3GEHA 5GVSA 1M10A 1ZGJA 3PJRA 3ORRA 1ZQ1A 2WM9B 3E2MA 4XGQA 1FNCA 1W0JD 2LXNA 1NW7A 3NTQA 4TYQA 2O3RA 4U7HA 4HDSA 4LOHA 1N6HA 4K46A 4L4SA 5JO0A 1KI4A 1N6RA 4FT4A 4ZYWA 4YX9A 3CJRA 3M34A 1H5UA 2HSGA 2M98A 2CE7A 4EY7A 3VPBA 3T3IA 3CLUC 1CQJA 4BKMA 5J2UF 1RLJA 1X15A 2IPAB 3L4SO 4CIWA 3TR0A 1DXYA 1TIPA 2CJXA 3BERA 3KKPA 3BDIA 5DMXA 3ZG6A 5TS3A 1V8OA 3HXTA 2ESRA 4TS4A 2JEOA 4WL0A 3AUKA 3ZKAA 4FJ2A 1YIDA 4D9MA 1OXKB 3USES 3W4JA 1OD6A 2D7JA 2VP3A 5C18A 1NE7A 1E0JA 2QKYA 3NALA 1UCFA 4HX5A 3WMGA 1G38A 2V0GA 3T54A 1N2EA 1OH6A 3JQQA 3ETNA 3LT0A 1I5OA 4OKIA 1R15A 1YJAA 3PVZA 5ALEA 5G53C 3DO8A 3EIWA 4CTOA 3TVYA 2Q2VA 2IXBA 1NZJA 4PC7A 1FFSA 4FYIA 4NDNE 1LY1A 2EZ9A 4JK3A 5I4CA 2ZJ2A 3D5EA 3I0NA 2AUTA 2AOVA 3IMFA 4ZYTA 5D1NA 2V6GA 1GWNA 2PCJA 1J0BA 3DV0B 3FXAA 4YLEA 1HDIA 3QE3A 5H68A 3MW8A 4KE9A 4R2HA 1J2YA 1H1LB 4R4JA 3ESXA 3VOAA 1BE1A 4DR5B 3KFVA 4PZLA 5IDWA 1W48A 4B7ZA 2BFCB 3FKSA 4NE2A 2PANA 1GA4A 5CDTA 3LCMA 5JNLA 4BLOA 1QIJA 5FFFA 3H3FA 4KITB 5K0GA 3VZCA 3K3PA 4IF4A 3AY7A 4Y7DA 4BNHA 5B1EA 3KR9A 5SYMA 4KL8S 2SICE 3OF5A 4MA0A 3ROZA 3LJKA 2JVKA 1RPTA 1CWUA 2GS9A 1CG6A 2ACWA 3HJGA 1Y3DE 2RHMA 1S6YA 2CWDA 2M1XA 1U7HA 2EL9A 3L0BA 4ARBA 4DBZA 3U4QA 5B36A 4UMFA 1LZLA 3IP5A 3LYHA 4LJAA 2I87A 1R0XA 3RNLA 3KTFA 1XXLA 3CB4A 821PA 5KOJA 2HK7A 3GPLA 5CEEA 1VCOA 2QY6A 4UULA 3OSUA 3B6ZA 1KO1A 1AHPA 2C9MA 3KP1A 4M54A 2X0NA 3RPEA 3CVUA 5G0TA 1L8XA 1T6NA 3NXKA 4GMHA 3EXIA 2Z58A 3KLBA 2XUAA 5AR1A 2GN9A 3KYCB 4Q4AA 1T10A 2HADA 2WJHA 1E9SA 1WZCA 1YQXA 3F4LA 4IDHA 4LRWA 3U81A 3W8DA 2EFHB 1X77A 5JTTA 5B7GA 3FAZA 3O4VA 2JLQA 1MDBA 2VHJA 4KR2A 4KXVA 2HBZA 4LF7B 1KI3A 1IWBB 2A0KA 3BQNB 3GRKA 5HGJA 3NP7A 5FEUA 4ABTA 4KR6A 1J5XA 3OTWA 3UEOA 4P5DA 2VKQA 3EF3A 2GX6A 2G28A 3CLKA 2C8KA 1LW7A 4TLAA 4EYOA 4DUZB 1JAXA 3WJ7A 1KEEB 1MRZA 2FK8A 2Q5LA 2YZGA 3R5TA 3SN6A 1C5KA 4Y9SA 4AFNA 1O0BA 1VMKA 4J0EA 2WJYA 3DZDA 3G5UA 4M0MA 3EZYA 1O1YA 1WX1A 2IPLA 3GEBA 3K9NA 3LK7A 2VZEA 1ZUHA 2QP9X 1NQVA 4LY3A 4DC9A 1UPXA 4PLZA 1QM5A 3FPAA 4MW5A 1N2CB 3FB1A 1XDBA 3LQRA 1D8AA 1XRNA 3BL5A 3IBSA 3N86A 3PC4A 1X2BA 4GX5A 1EVYA 3N0TA 2IEZA 3LTEA 2O8NA 3T7SA 2BLLA 2WLSA 3UENA 2Z1DA 3VPGA 3AEUB 3KEFA 1Y89A 4KKVA 2ATIA 2O2ZA 1Z0JA 1KR2A 3RFCA 3ZYZA 3N0RA 4D9KA 5C1PA 1N34B 1UANA 1Z4QA 3RASA 2XVAA 3UKOA 1KU6A 3LX8A 2W2XA 1VHTA 4MWSA 2O7VA 1OLUA 3KAPA 2WB4A 1G5IA 2ZZNA 2H52A 2YV2A 1FDVA 4N54A 2G70A 5DB4A 3A4TA 1C30A 1FXSA 3JZFA 2VK1A 3B3QA 2PNFA 5F3RA 3KOYA 1MB3A 1MO6A 1PZEA 2Y6VA 3PQ8A 3W3AD 4AMUA 2DFKB 3ZZNA 2AFIB 4JLMA 4UE2A 5F1KA 1MVLA 1U4SA 2R97A 1VKJA 4WK2B 2QV7A 4EFMA 2XE7A 5ADVA 5CYOA 4QTYA 4QXPA 2I2XB 2W2TA 2HK9A 4KOEC 2WZQA 3MBIA 4IG4A 4GPEA 4R8SA 3OZ7A 3ID6C 2W2OA 4KE8A 3HRKA 4G1BA 1RPZA 1Z88A 4BN4A 1YASA 1QG2A 1F3OA 3O8NA 2D2IA 2ZXFA 4KQIA 1FMCA 4NOMA 2R2AA 1OW3B 2CVOA 1QNFA 1N4AA 4B4OA 4EPTA 1W29A 1FBNA 4YAGA 2R6FA 4CNBA 3OU7A 1Z5PA 4NBRA 4ZAZA 2VYND 4YP9A 5DE3A 4Y2UA 2KM1A 1G3MA 1ZM2A 1XHEA 1YBVA 3F7OA 2I7CA 1Y63A 3M89A 1N0HA 3OE7D 4KJXA 2VTBB 1GAEO 1A77A 2IYRA 5COBA 1R0BA 2AZMA 4LXIA 4BDTA 1VQ1A 3NGXA 5EPOA 1JT9A 1RYMA 1VL8A 1P73A 3ZH9B 3LSTA 3CVXA 2OO5A 2QM3A 2J3IA 2VDWB 2QN7A 1E9DA 3CX8A 4O63O 4QEZA 3ZCPA 4V2UA 4D4LA 2G71A 2Q6OA 1M67A 2XF2A 2R0QC 3E5MA 3B3AA 3EFOA 4R6XA 1DEOA 1Y6QA 1BJRE 3HFJA 2Q1TA 2QXYA 4YXWA 3WFIA 2FAXA 3TD2A 2LKDA 3C0KA 5KUTA 2YOFA 4OHMA 1HKHA 1RBMA 1UADA 4YP5A 2M2IA 5KSPA 5E1MA 4D6YA 4EVRA 5IJ0B 3UHFA 1L4BA 3IR7A 5I9NA 4G0UA 3KQOA 3U7QA 3X43A 4ZT2A 3S28A 1ZWKA 5THQA 4ER3A 1EMDA 3DFMA 4QC2A 4MRPA 1ZHOA 2ZIFA 2O3JA 1VKZA 3K6RA 1E3TA 5G41A 1D1TA 3GCXA 3OPNA 5K3SA 3ZU2A 3U19A 2F3TA 4A6PA 4X1KA 1EJ6A 3KQSA 4NE7A 3UWMA 4B6SA 5B55A 1OU4A 4EG6A 3N70A 5ALYA 5DXAA 2NU9B 3V2IA 1P9WA 3I6IA 5GZ6A 2W90A 2ZVDA 3DTYA 5AK3A 1GGKA 1ZKDA 2COEA 2DQSA 1TQDA 2VAMA 4AMBA 2B78A 5KNBH 1E9CA 1E2GA 1DBVO 1VB5A 1UBJS 2AE2A 2WU4A 5DBOA 4YEDA 4B2LA 2WNSA 1KQGA 2NUAB 2XOXA 3N2EA 3ZNOA 1XZJA 4CM4A 2O8EA 4FW8A 1EP3B 4FCVA 3U4QB 4DUGA 2QD5A 2YJ6A 3OWHA 3E0QA 2OHGA 4DA6A 4F6RB 2XZLA 1DJNA 2JC3A 1A8IA 3CEPB 3LT4A 4LMAA 5FHQA 5LU9A 3VVLA 3ON5A 3W7AA 5KVSA 1X7GA 1XQ9A 3H2KA 4TV9A 3G7UA 2Q4BA 3I23A 1ZSVA 4E1BA 4GWGA 4OYHA 4HY3A 1RFLA 3C5WP 4LXUA 2J5KA 2W2KB 3CF6R 4QO7A 1LVGA 4UC0A 4Y6SA 5IEBA 5TJHA 3RLFA 3VHXA 1W5FA 2WI8A 3E05A 1Z2DA 3I1YA 5CFQA 1R5OA 1VGRA 2YQ5A 3LUDA 3NBKA 5DBGA 3VV2A 3QKWA 1RYHA 2XCRB 3UWOA 3GIDA 5CBPA 1EXVA 1Y3FE 1UXIA 1M2HA 4UEKA 4N8EA 3QFTA 4TLDA 3HDQA 4KLZA 4XOUA 3SKXA 2YV3A 4ESHA 1LC0A 4NOKA 2P6UA 1N2IA 2ZBQA 4ETNA 4YMTA 2PS1A 3O03A 4MYHA 5AW5A 1OGJA 2IK8A 1V5FA 4Q3DA 2YVUA 1IM5A 3WLSA 2FMFA 2ZIAA 4JUFA 3DZJA 4NQZA 5C37A 4EGFA 1M2OA 3ETGA 1QRDA 1RIIA 2IU4A 1UQRA 3MJHA 4PS1A 4WNIA 4B83A 2EBFX 5JAMA 2OWEA 4LVNA 4CV3A 4B09A 3ESBA 2QDKA 1TM1E 4ITUA 3V00A 1ZCBA 1NM5A 3MCVA 5CLGA 1M7HA 1PAUA 4OSPA 2B2CA 2V5UA 3IAS1 1KK1A 3MOGA 4M0FA 4XUDA 2CLEB 3MCZA 4N03A 3K09A 3BCHA 1PVOA 5TB5A 5TLSA 3X2EA 3PNSA 2Y2UA 1IMOA 1KVRA 2RDMA 1RQNA 2K87A 3A1SA 3TB6A 2J0VA 2HIHA 2OR3A 1NXXA 1NA5A 4Q0MA 4B79A 2W6OA 1C3OB 1IYZA 5EIBD 1KGSA 3BL8A 3BGIA 5E95A 4QNNA 1JB1A 4JX9A 1AQIA 1TCBA 1T9ZA 1E2EA 4XD2A 3HYRA 4XX1A 4BZWA 3W5UA 3L7YA 1SXJD 3B70A 3VVCA 2CVQA 1A9QA 3DPUA 3W04A 2Y1EA 2BMWA 5LYJF 2P69A 4UU1A 1TO6A 1IAQA 3FWNA 3ZXYA 1W59A 2Z6QA 5AI5A 3RYIA 2OMKA 2Z43A 4JB3A 1DBWA 4IUDS 1JEOA 3FGOA 2JAUA 4NPAA 3PHGA 5FUYA 5F1PA 2OCIA 1N8NA 4A16A 1GUAA 3NCTA 1FDOA 1MA0A 1L4HA 3T7RA 2RBKA 3LO8A 3PR1A 3RUAA 2KX7A 1AK9A 4J7UA 5F4ZA 3SBXA 4QA9A 3RRBA 3OUUA 3UJDA 4AZ3A 4P92A 1K9SA 1NVMB 3ZD8A 1UKZA 2QW1A 1GA6A 1H0RA 1AQLA 1TPZA 1KEVA 3ILYA 3N5CA 5JFOA 2ORIA 3PHJA 5TQ0B 1JNXX 2IHKA 2QTVB 4WHMA 1G8FA 3GJ5A 2ZYTX 4TMFA 3ROPA 3MERA 4JJKA 5A0TA 2AR9A 2EW2A 2X8JA 2ZYGA 4OGLA 2RCNA 2PSDA 4WH0A 2O3QA 4ZU6X 4R1TA 4CU2A 2X13A 5EWLA 1MOSA 2R86A 1RHRA 3D4PA 3H16A 1KQOA 1H0KA 3EXEB 3NTUA 3NAMA 4HMOA 4HMQA 3N9IA 1MJFA 721PA 2Z4RA 1OHHA 1QFMA 1JHRA 3ESAA 4I5GA 4QKQA 1M34A 4EF6A 2WWWA 4LJKA 4CEJA 2Z9DA 5T4HA 3QG1A 4RSRA 3AM4A 4HTFA 4N5IX 5U1PA 5B6PA 2QLTA 4GSYA 4Z9AA 2ZS8A 5C4IA 1ZESA 2DFVA 1I4TD 1Y1TA 3CEHA 3WC4A 3M9XA 2QEQA 3VPFA 4TTPA 2FSHA 1D1SA 4NBNA 3X1YA 4AP5A 3F47A 4QOEA 2B6HA 4UBLA 5FTWA 1RM4A 1KDVA 4EA7A 5K01A 5EUCA 1PS9A 3KHKA 4CKWA 4CMEA 3HZRA 1IRXA 1DAOA 4XFDA 1Y9AA 2A30A 2NXWA 2AN4A 2Q6LA 4LZLA 3EIQA 3AHEA 4QGFA 3TLBA 4CIDA 4MIKA 1C4OA 3MA0A 1AKMA 1ZIYA 5NULA 1I8TA 1U8TA 2VF7A 4MWTA 5JHGB 2HYIC 4O1MA 2F3PA 3WYEA 1GAWA 2O06A 3RCBA 2PUGA 1XJ0A 3LMKA 5FNVB 2LPMA 2OV4A 4F1WA 2V7QD 3NC4A 3I76A 4WUTA 1J1UA 1U6JA 3JYHA 2H2GA 4FHEA 4FMDF 1A5TA 1LK7A 2H4XA 1NXOA 3Q5DA 4XCXA 5BMOA 1RM5A 1AZSC 5KWSA 5CB4A 3FNQA 2Z6VA 1KIAA 4JNKA 4N8SA 3T4UA 4HZIA 1ZO8A 3L06A 2FDXA 2V4ZA 3DAYA 8ADHA 5L95A 3IAAA 4JODA 4TLCA 5FBHA 5KNBD 1K2WA 3L8DA 4FFVA 3J80A 1KY5A 4JXZA 2W00A 5T8KC 3RSCA 1P0MA 4AJKA 4MV5A 5BXQC 1OF1A 1JFFB 1P7YA 2I65A 2P6OA 1UXOA 2DPMA 1CQPA 1E20A 3B38A 4PNPA 1GQOA 3P0JA 1RZUA 3QITA 4AO8A 4ALLA 3ACCA 3HQ4O 1W85A 4FPXA 5KWIA 4JDPA 2ZUCA 2YOHA 4RNCA 3HN7A 1N3YA 4IIVA 1AV6A 4L8GA 3L6RA 4KVAA 2ZUBA 3ELYA 3WKAA 4TMZA 5CXXA 3QX3A 3S2FA 5LMNB 2Q2WA 3IULA 2JH8A 4Q3CA 5HMMA 1KPIA 4MQEA 2V98A 4OHRA 3ROMA 3EZXA 3ZY3A 2H1SA 1QCCA 2QTNA 4Q9IA 1QGED 3NQ41 4Y2PA 1VL6A 3QXCA 1YB1A 3R0VA 4H3KB 5A62A 3NDBB 1TAUA 3HO8A 1F2TA 1G5RA 4FOOA 1HDCA 5J5CA 2HRQA 4M9ZA 1GUYA 2IIBA 3RANA 3FWZA 4B85A 2V58A 1V71A 3A6HA 3BK7A 4R83A 4RVHA 3W2EA 1X70A 3E3OA 4D8YA 5C8YF 3QNWA 1O0CA 5UKDA 1UWKA 3FUXA 3WDLA 1BVRA 4B81A 5LP6B 1LQ2A 2E4YA 1UJCA 1RMQA 4JITA 4ZT5A 4B4UA 1XTKA 1LDEA 1Y1SA 3ML1A 1UXJA 4QODA 3EGIA 4P22A 2PZ8A 3F3KA 4V0LA 3CWZA 1DFIA 1ECPA 1CD5A 1JVBA 1LLCA 1JHOA 2YFYA 1PR3A 3JD0A 3JVIA 1U9CA 1EQAA 3M2PA 1TIKA 1LBEA 1ZOIA 2JIZA 3ZCRA 5TQJA 5KPDA 2Z2ZA 1D7OA 4DDWA 5GIOE 2D0PB 5CLHA 1YF3A 3K2BA 3HTXA 1YIOA 1ST3A 4QPZA 4R8RA 3DCJA 1S89A 4RF3A 4PAQA 1LK0A 4IZIA 2QR5A 5ETJA 2FFHA 1CR2A 4J1TC 3KTAA 4EATA 1PJ3A 3JQ9C 3WWYA 4YRNA 1YJQA 3AMVA 3W5VA 4BGUA 3K30A 4J3FA 1MQAA 1P6QA 4J0QA 5AM1A 3ZD9A 1MJHA 1RP7A 5CK5A 5IULC 5TJ9A 5G4KA 4JJ4A 2Q7DA 4QSMA 1KEWA 3QPCA 2P2GA 3RUIA 3GA0A 2FWMX 4PF1A 4DWVA 1YR9A 2Y27A 4B6FA 3F5DA 3NEJA 2XGMA 1J5PA 2DH6A 1CEXA 1HQDA 1GO2A 3JASA 4ZVLA 1PRYA 4BV2A 1I4LD 4RJKA 5D3MA 4CF6A 1QF9A 1S3GA 3H11B 3PHCA 4GC5A 4Q4HB 4UJ5A 1VKHA 1ILWA 4K6CA 2FGKA 3NETA 2DHEA 4TV8F 1HNWB 1EUZA 4FC7A 3SC6A 4PSAA 4RV4A 1PFUA 3KLPX 3SYMA 2IUFA 3M3HA 3FCAA 1X2EA 3AESB 3P0EA 4MCHA 1EPUA 2H31A 3RS8A 1VYHA 2HJ9A 3E2PA 5CITA 1DG9A 2BR5A 5A4MS 3WYCA 1NVFA 4MVWA 4CCAA 1D04A 4RS3A 1C50A 4MP6A 1JG2A 1TJ3A 1U0LA 3HBLA 2BM0A 2FPKA 4DXHA 1Z62A 2I2WA 1VM6A 3D0KA 1X80A 2B3TA 2SCUB 3AEXA 3DHWC 4QQKA 4WKBA 5F73A 3VDXA 2ZBPA 1XVTA 3MWLA 1PV4A 4FGWA 2HA7A 4D43A 1CETA 4RJ2A 3LZCA 3FTDA 2Z9CA 2VI5A 3NONA 1WHSA 1WETA 3LRTA 1DU4A 1YS6A 3AHJA 1DEXA 2RFLA 4G4IA 4HK4A 2X3YA 3RF6A 5BPHA 4X20A 3IVXA 1LBQA 5FOXA 1W36B 2PX6A 2YCBA 1JTVA 1H0SA 2W6MA 4I4NA 3NHFA 5B7PA 2ENUA 1ZRHA 4B3HA 1I2AA 2UVPB 1WUTA 2IDJA 3A4IA 3HGMA 4U63A 5DNUA 5AKGA 1A4XA 2W43A 3D3NA 1HT0A 3Q9LA 1JR4A 1SVUA 2YY7A 3OZXA 4J76A 5D85A 2HHAA 4C6RA 4KFSA 1NATA 4AMVA 4OXIA 2R8YA 3WLJA 2AOWA 2VDOB 4W5HA 2OOKA 3CEAA 4EDFA 1RHJA 1Z5UA 4K9DA 1L9XA 2XUHA 1M54A 3MILA 5KYXA 3D4NA 3F6BX 4LE0A 4C03A 5JW6A 3SDSA 3P0IA 5B4VA 1Y1PA 1JU9A 1JEQB 1VHJA 2QLJA 1RNLA 3Q2KA 5AUPB 4EHBA 3OA2A 3RS5A 4EFNA 4BUJA 2CFIA 2OORC 4BFZA 2OFPA 2DF8A 3NWOA 4KNWA 2FWBA 2HIAA 1YQ9A 3UC9A 3IQZA 5KYTA 4WLFA 4M7WA 2PPVA 4PX9A 3QPDA 5HQJA 5KQRA 4B7AA 2B8JA 3G0OA 2HPHA 3VDQA 2JF0A 5IAAA 5BW4A 4V0NA 1IEWA 4FYXA 1Y6GA 1O57A 5JC8A 3L1HA 1D1PA 2ZSHA 4JHXA 4LXGA 3WO1A 4I1SA 4EZIA 2IF2A 3DO5A 1TGYA 1ULSA 2WSSD 5LP1A 4D79A 3PR2B 4Y6QA 1GL6A 1U6IA 3D1VA 2A1UB 3NJ4A 4JI5B 1B14A 4ESEA 2R00A 4TRMA 3RTDA 5CT9A 4NU5A 5AMXA 3ZHXA 1Q15A 2V6IA 2WF9A 3COWA 2RJOA 1SD1A 2XVYA 4ETWA 4Z4GA 2PGDA 4UXHA 4QBGB 2Q5QA 4GPIB 4IS2A 4M1ZA 4PAMA 4E4RA 3FYDA 3UT5A 5BV1A 1Q19A 3GUZA 1ONOA 4IGAA 3B6IA 5A6SA 4DB2A 5KINB 1UL1X 3ZI4A 1OX4B 2RGYA 1V7CA 3HY6A 1D4OA 3KQQA 3QOXA 5DXFA 4RVGA 2I4OA 5L7YA 2BEUB 4KVGA 5CDSA 3ZWDA 2CVPA 1H42A 2P9TA 5TMEA 5JCXA 3H0KA 2FEMA 2ZSBA 4W7IA 3OT5A 3KAJA 1U3WA 2WUGA 2IBMA 1QH8B 3RVOA 4S2EA 5BNFA 2Q8NA 4W6QA 3IP3A 3F8WA 4HWKA 5JG7A 1N0WA 5GPBA 3B9PA 3FX2A 5CA0A 5ED4A 4KW7A 4ONEA 3DTTA 4DZZA 1FFXA 2NO4A 3IUNA 3RFVA 4FE3A 3I3OA 2BGJA 1MNQA 4XSVA 3TZQA 1TUGA 1RE1A 4TRJA 1QYVA 3WB0A 3I8SA 4M9XA 1PJSA 1U7UA 2AYYA 4UW9A 4YDHB 4KREA 1N2OA 5DK6A 1M2NA 2HQOA 1PGNA 1JDNA 2FW6A 4NFLA 4RYLA 4WVLA 3KSAC 4PV7A 3H11A 4FI3F 1C0LA 2XCUA 1I6LA 4RHTA 5FUBA 1WXHA 3FSRA 4HH3C 3Q1LA 2DBVO 1B73A 3C3WA 3UF0A 3ZQJA 1DUSA 4FQ5A 2Q9AA 3PPYA 1K06A 2ATVA 1JHDA 2PBFA 2W8ZA 4POAA 5IANA 2OYSA 4JXJA 1X0VA 5ALUA 1OROA 4ON9A 4YO8A 3GT7A 3RBXA 2M32A 3QBVA 4L8FA 3WDKA 4KPUA 1S2MA 2AC4A 3IVAA 1G55A 1Q20A 4HRYA 5A03A 1XR3A 1G7RA 5FPPA 5HJ2A 3UHJA 4XTRA 2UUOA 3VNVA 4QOSA 1E2QA 2WDPA 1XXHE 2AC7A 2EYUA 1VLMA 5EJ8A 1YOVA 1IZ8A 2VHZA 3DMHA 1D2RA 1Z0UA 1WXWA 3PYLA 3CN7A 2ZS7A 1LS6A 4ALIA 2PGIA 4RGQA 2RGDA 5EQJB 1ZJ4A 2O5CA 2UYYA 2J3JA 2IITA 4XJXA 4ZT7A 4YXWD 1LNQA 2Z0MA 1KYTA 1VBFA 4P3PA 1JIQA 3W8EA 4RF4A 3K1YA 3CIFA 1JE0A 1TEHA 5I4KA 3PFNA 4H3SA 1F0PA 3OE5A 5FOTA 3RH0A 2G6TA 1RSZA 3D4OA 4L4RA 1S3SA 2FQ1A 4RFVA 3NTRA 1QUEA 4F2DA 2YS7A 2JVIA 4WBXC 3H2SA 4HX9A 4DJ5X 4LWOA 4DNPA 5G4LA 4TS9A 3ZX4A 1O96A 4HLNA 3FZNA 4R54A 1RKVA 3DEJA 2FUEA 1KAGA 1ZWLA 3EIUA 1AGRA 3L9XA 5JSYA 5DNYB 4C7XA 1G5FA 2F1JA 2B8NA 1RWWA 2CNLA 1QC5B 2BL4A 1LC3A 5C1IA 1OE0A 4P82A 4N3CA 5FAKA 3HWSA 2DTEA 2OSVA 3KO8A 1V1MA 4O4IB 4PTZA 5CM8B 3O2NA 4IIYA 2G09A 4JQOA 1FOEB 3HXOA 1RBYA 3O4IA 2HJVA 4PX5A 2ZAGA 1MPTA 1V0JA 2CXOA 2ZWMA 5ALOA 3TZ6A 1M2VB 4JOSA 5LN1A 2OG2A 2IPMA 2H1HA 1NLZA 4QHYA 2B1RA 1TO2E 1U94A 2B1IA 3AW9A 4EB8A 1F1JA 3DPIA 4ENWA 5LB2A 4ZVMA 3RC9A 1VFPA 1EM8B 1ZAYA 4RUKA 2XTZA 1A7UA 4C5BA 3I28A 5FTNA 1ISMA 5KNLA 3K1TA 2VP5A 4O5OA 1XMIA 1YQEA 2MMGA 1U3FA 4DILA 3RK4A 2FEXA 2X8JB 4CKXA 1X6VA 4JB8A 1IPFA 1E9AA 2Z8XA 2C3PA 1N9GB 2WKSA 3EDCA 4A8JA 2NUTB 3OFNA 2GA8A 1IXRC 1QX3A 1QQAA 5EAIA 1H5NA 4DIKA 2L0XA 1P74A 1ZISA 2H4WA 1MMFB 4OAQA 4ZI5A 5ILOA 2WB2A 4Q6WA 2O8DB 4NJMB 3OCZA 4RLFA 3Q85A 2PJRA 4AS3A 3DPSA 1SCNE 2HSDA 2W7TA 4LC1A 4NHEA 5IG2A 3AIIA 2R8PA 4ID9A 5DLEA 3U16A 1SB9A 3WIUA 1AUXA 3DQQA 4CCWA 2DVMA 2ID4A 2FPGB 5BSKA 4TWRA 4RACA 4QFCA 4RJIA 5D7BA 5JZOA 2XR1A 4B2IA 1WKVA 2YIJA 1NMYA 4BKPA 4DA9A 5BSFA 1F3LA 2ZBRA 3SEAA 4JQSA 1LQTA 2Q45A 2WHQA 5JDCA 5FWAA 4EQ6A 4TKZA 3JQCA 4BX8A 4MRMB 3WRYC 1AB6A 5H5JA 3RFXA 5TNXA 4KNVA 1Q3TA 1GRVA 4NX2A 3TNJA 1UWCA 1A5SB 3QQPA 1CNEA 4LBVA 1X39A 4Q5IA 5DOVA 4OY3A 2A86A 1A2BA 5IASA 1HYEA 3TTYA 1KEZA 3FG9A 3G6WA 3EIHA 5FNVF 4LJ4A 3SZGA 1AXEA 5GTDA 5KU7A 4ZA2A 3MHTA 1RJ9A 2WRZA 1HGXA 4L1KA 2WLTA 2V7VA 3O3MB 2GLUA 4HXFB 4R3UC 3S7ZA 4EARA 2VPYA 4ISCA 1T2EA 4RZ2A 4URFA 1PZXA 4IP0A 4B8YA 5IMSA 1QB7A 2HPAA 5CB6A 4M8LA 3EUEA 3IIEA 3IUBA 5P8WA 1WPGA 1XZAA 1GSIA 4IZOA 1Y8ZA 3R09A 2Y1XA 3NR2A 2HO5A 5KNBA 4FB4A 4DLPA 3GLIB 2Y67A 3E82A 1UP6A 2GT1A 2J41A 4EPWA 5E2AA 2GF2A 1JFTA 3QUSA 2ZTMA 3H05A 5BW8A 4ZGGA 4IO1A 4LGYA 3OLZA 4XJTA 3N2KA 3GHHA 3WKBA 1S8NA 1AF7A 1P33A 4YRFA 4D9HA 5JAIA 3IQHX 2V7QA 5DP2A 3HNOA 2HLDA 4GEGA 4Y6PA 5CT4A 4F4CA 1CZNA 1WAMA 4QAQA 3AKZA 1EFHA 2QG6A 1IWOA 5ALTA 3GHYA 1QG0A 5JNTA 2I8AA 3OX2A 4MV4A 4OUKX 5IX8A 3RAFC 1QTRA 1DKUA 3NHRA 3FKSD 4JASB 5KTRA 1AUQA 4FX5A 3N7UA 2IS4A 1E9FA 5M04A 3WWPA 1N9KA 1WRBA 4NIMA 2WWXA 4DIEA 4I9NA 3BIXA 4UPVA 2J5QA 2XVZA 5EWMA 1T3GA 1VP9A 3TFWA 2PGNA 1NF2A 3HBMA 3DAGA 1CUIA 4A92A 2EFGA 4LEIA 4NHOA 4TXJA 4ZCMA 1QRRA 1H66A 3M33A 5ALLA 2BGMA 3VU1A 2WTBA 4CLDA 1H6CA 4RY2A 3FFTA 3RVDA 1K6MA 1D3AA 2RGUA 4JB2A 4RKYA 2IXAA 1QKKA 1UZNA 4M0DA 1UODA 1VG8A 2GCIA 4O29A 1F6WA 4OIMA 1YRHA 4PFJA 3A25A 4AJIA 3NBUA 2G63A 2BJHA 4X5OA 5DHPA 1C7ZA 1HDEA 3B48A 3MJCA 5LD2B 5EXEA 3IL2A 5LP6F 1VKNA 2E82A 5IXSA 2YOGA 1UMCB 1W49A 4R1SA 1Q92A 5K51A 1Q6ZA 4B73A 1QFZA 1FCJA 2VH5R 3Q8WA 5HFNA 4P5PA 3IHTA 1NQTA 1PQPA 2AYZA 3O26A 3UK0A 1UPFA 4IDCA 1TCCA 1P60A 3PGJA 4KQ2A 3EH2A 4JBNA 5FH9A 4ARIA 3OQNA 4NBKA 2GVDC 4PPQA 1NBHA 2UZIR 3HLTA 3VKFA 2WYOA 3IE1A 2X4GA 2C2MA 1NBME 3B78A 2IV2X 2H85A 5B6IA 1RDFA 2H4HA 3CSUA 1REQB 3DBIA 3RVNA 5ADUS 4L16A 5C9ZA 4QM7A 1U7ZA 3ONVA 1K88A 4N01A 1HR0B 1GZ4A 4V0RA 2JIRA 3JS5A 5A6SB 1J8FA 4QUJA 3V46A 5DM60 4WD3A 5JJ5A 3SR3A 2R6AA 4MUFA 4JIGA 1EBUA 3ZHRA 5AVZA 4B87A 2O8BB 2BCEA 1V35A 1JXQA 1XA4A 3G02A 3NIGB 3N87A 1GAQA 2FX5A 5BVHA 4LF8B 2NP7A 2JIPA 1EDEA 4WDQA 3ZLUA 4DQVA 1TADA 1R0ZA 1WOYA 3F6CA 3H84A 3MBKA 3P2MA 1WB5A 3ZE6A 4JV5B 5JXIA 5KC8A 4YRAA 2Y0BA 5I7EA 3H4VA 2O0LA 4GPZA 3TIXB 2XKJE 1ATZA 3OWXA 4UZSA 2H1RA 2J6IA 5L6MB 1XAGA 2A7QA 2QRLA 4HB2A 5ECGC 5IKXA 3A28A 3BD8A 3K4QA 3VV3A 3WNDA 4IQGA 5KREA 2AVDA 1C29B 1DPFA 3OOYA 2HMAA 3ENZA 4F0JA 2ZUVA 2VWPA 4X84A 4YAUA 4O25A 1UKVY 1XJCA 1K97A 4I08A 4PE5B 1RMYA 4C0WA 4E3ZA 1GM5A 2O8EB 2Y0CA 1D6SA 4ND7A 3KVRA 1DWPA 3KV1A 4JQZA 3CLTD 5LLSA 4JLOA 4ZAXA 1TD9A 2UDPA 1YI0A 2WEKA 1AGNA 2FZ4A 1T6XA 1U1FA 2WDZA 3AR8A 4OLFA 1IRIA 2H2HA 1N2SA 2QVZX 1BWSA 3V4SA 1W4LA 2R7MA 3GJ4A 5D5QA 4HTFB 5JDIA 1UZLA 5F7XA 1QVZA 2VXYA 4B35A 1L5NA 3A1UA 1P1RA 4L50A 2CN1A 2XDYA 4WOCA 4E08A 2RMKA 3D81A 2VF4X 4L4UA 1Z8FA 2RH4A 3VH3A 2EVWX 1SIUA 3B53X 3R6WA 3JZMA 4CM8B 4EL5A 2AKYA 5LZ5A 1B42A 4V03A 3T3OA 4Y1GA 1EB8A 1P61B 3WZMA 2VP9A 4YXFA 4HTAA 3VYTB 3A36A 4RXUA 1NN1A 1IDN1 3EZLA 1AO3A 5CEJA 4BXOA 1SKAA 1PLLA 4FNOA 5DHFA 1M0TA 2D5AA 4RDCA 2NTYC 5AKHA 4UCWA 1W94A 3O47A 4L5IA 5JC1A 3AXTA 4LY0A 1UFQA 2DUJA 4DLAA 5KPJA 1ISJA 3E15A 4KGDA 4BMYA 5CAEA 2QVBA 5ADHA 4CCYB 1N2HA 3T15A 3JQFA 1W4RA 3JAKB 1OJ7A 2YQ4A 1VA5A 3HJBA 1DBIA 5HM6