2XD9A

Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-4,6,7-trihydroxy-2-((e)-prop-1- enyl)-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
153
Chain Sequence
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetrahydrobenzothiophene derivatives: conformationally restricted inhibitors of type II dehydroquinase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
total genus 55
structure length 153
sequence length 153
chains with identical sequence B, C
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2xd9A00
1J2YA 4CKXA 4B6SA 2XB8A 4B6OA 4CIYA 2BT4A 4B6QA 2C57A 4CIWA 4KIJA 2XB9A 4RHCA 3KIPA 3N76A 2WKSA 5B6PA 4KIWA 4CKWA 1UQRA 1V1JA 3N59A 4CIVA 1GU1A 1H05A 3N87A 3N8NA 3U80A 4V0SA 1GQOA 4CKYA 2Y76A 4ZC1A 2Y71A 3N8KA 2XDAA 3LWZA 3N7AA 5WRFA 4RC9A 1H0RA 1GU0A 2CJFA 3N86A 2Y77A 2C4VA 2C4WA 2XD9A 4KI7A 4B6RA 4B6PA 1H0SA 2DHQA 1GTZA 4L8LA 4CIXA 4CKWB 4CL0A 4CKZA 1D0IA 4KIUA 2UYGA
chains in the Genus database with same CATH superfamily
1JFSA 1II8B 1MHTA 2NZJA 3Q6NA 2Z9CA 3TDMA 1L8LA 5BMVB 5H9VA 2C2MA 5HVNA 2PUTA 4GR9A 3TG8A 4MW9A 2CYCA 4B40A 1YE8A 4UATA 4W7HA 4MRMB 2WUGA 5TPZA 3RKUA 5FWYB 4Z53A 3WLAA 2JCVA 3GDOA 2PO7A 1ACLA 1WD7A 3BD7A 3UC9A 3WHLA 4RTOA 1O7JA 1RBMA 4A91A 2Z8YM 5AKJA 4UU0A 3TD6A 4E5PA 1YVDA 4CEHA 4TKUB 1HPLA 5AMXA 4EITA 1QQ6A 3M89A 2IY7A 3CJTA 4PBTA 1BE1A 2XECA 4BWGA 3W6PA 3HUFA 1NXXA 1ZMOA 3F3KA 3R0ZA 4B6FA 5MFPA 2CV1A 4HNAB 4O2BF 3KZMA 3R8CA 1JB9A 3QUSA 1NUQA 5K03A 3GAZA 3KSZO 4GPD1 4GM4A 2R3SA 3D0OA 1ZKDA 1WDWB 5FIUA 4IDCA 3F47A 3CW9A 4QQNA 4ITRC 1J9GA 1UQRA 2I1QA 2J6IA 1GZ4A 3OO0A 1A1VA 5B3KA 2IOFA 3IQIX 1OGJA 1XD2A 2NNWB 3TGLA 1R6XA 1L7PA 2WF8A 2FN8A 4E2XA 2CFIA 5KTSA 3QKSB 1BA3A 4F93B 3IPYA 1E1NA 2NIPA 4L28A 4C22A 1OR8A 3O74A 2FH5B 2LBPA 4LHEA 2B0JA 4QOGA 1E2GA 1FE8A 2C8KA 3JATA 1PSWA 1UZAA 2FEKA 3MMZA 1U8FO 1F3OA 3NHUA 4MYCA 4IKOA 5FLYA 1LKZA 3B2NA 3WK5A 3FVWA 1QC5A 1JIIA 2NZUG 3ZVKA 1NFFA 3KTDA 1R12A 4ZTZB 4IDOA 4ECEA 3G0DA 3FJOA 4ZMSA 4XWWA 5DM4A 3B3AA 3WZ2A 4IBOA 2OBYA 3AOEA 5ILOA 1ITZA 1MB3A 1FPMA 3ITDA 3DHYA 3NAZA 5LQJA 1ILEA 2GPJA 1MR3F 3GJTA 4BU1A 5BN5A 5L4SA 3Q8KA 2ZB2A 2E3JA 3T9FA 3SICE 2UZ1B 1UQTA 3KQWA 3NPMA 3JD3A 4CMEA 2V6GA 3L6CA 5HWSA 4UEWA 4IZIA 2X0DA 2H8KA 1E6LA 3L1HA 4KQ9A 5CXSA 5IVKA 4ZARA 3QUAA 1F48A 1COWD 2AR7A 3EZYA 4MW7A 2IOHA 2XRFA 5DN9A 4CMJA 2WD7A 3TWOA 3UUGA 4DLVA 2R8XA 1W4BA 2ICAA 5BNWA 4NK4A 5SICE 3BIWA 2YCBA 3M6MD 1RKXA 3N74A 2X4GA 2BFEB 1BA2A 4NCJA 1GG5A 4GLFA 3AWIA 4H0CA 4C1BA 1MEOA 3HM9A 3HKEA 2R6JA 3PXAA 5G0UA 1GITA 1LJ8A 1YE3A 3AI1A 4LQ4A 1M6YA 2NO7A 1I4WA 2J32A 4EB8A 1C8VB 3WQRA 1OILA 4A92A 1CUGA 1OFUX 1P5RA 2XOKA 3BM5A 4Y7DA 3ZZ0A 2VYFA 4LTNA 4RC9A 3UUFA 5CT5A 3GLRA 2OOKA 5C7YA 1RZRD 1V2HE 2QEQA 4RUKA 4C9BA 1A72A 1JG7A 4HEJA 2FSSA 2GPWA 1BKSB 4I1RA 4N12A 3I53A 4I1PA 1NUUA 2LD4A 1AHIA 5CA1F 3IPAA 3U4QA 3PYLA 2P4HX 4RIGA 1FFSA 3HBAA 4AN0A 1FDVA 2ZU0C 4A8HA 4D9BA 4R6XA 1CLUA 4BZZA 4ZZ3A 3ETGA 1II8A 1LNQA 4KAXA 5JVDB 1JL3A 3UJ8A 1PUJA 2BRUC 3PBKA 1WBJB 4GAEA 5E2AA 2QTZA 3WL7A 3K09C 3IFSA 3JQ7B 4WJLA 1MQ9A 2INGX 4BP1A 2A4KA 5TMBA 3ZDBA 1HFJA 3EYAA 4HZUB 4B4KA 4LOKA 3H5RA 4ARCA 3DCYA 1SULA 3KLMX 4N5IX 1SQSA 1N7JA 1YL6A 1ZGBA 2IVZA 3R6LA 4KQ2A 1VMAA 3ESXA 2WILA 2JLSA 2ZPUA 3NGMA 4XUCA 2ORIA 1VJ0A 4UM5A 1KI1A 1QRRA 4XIJA 1XYGA 4OOFA 5HTKA 4BO2A 3E9DA 3RSLA 2BEVB 2QM7A 1H2XA 2I29A 2OAEA 3FCOA 3ZWPA 1JSXA 1MMFB 1L1QA 2Q2WA 2ZUDA 3EGXA 3JQ7A 3W3AD 3ZWDA 3RRMA 2P40A 1DAKA 1XQ9A 1A5TA 3PQEA 5LZ4A 4WKCA 4DRXA 5DCLA 4EG1A 1ORDA 4L9SA 2YWHA 4R2HA 2OFWA 3EOAI 3OWXA 4F9EA 3BHMA 4H3SA 1WXIA 3WIBA 4WZ6A 2EX0A 2SKDA 5BSWA 3GJ0A 4JA2A 4UVHA 1C0EA 3UT6A 1P2DA 1UPAA 2VXCA 3N8HA 1ODTC 4W1RA 4XPZA 3ZWWA 2ZP1A 4CW7A 4RM3A 4A2CA 4Q1DA 1JE1A 2HUNA 2TSYB 3E05A 3EQ8A 3HBMA 4YAEA 4UHKA 1C1XB 1J21A 1JEJA 3JVDA 3T7TA 5JJCA 1FS4A 4GO1A 4Y2QA 5KSZA 4EGCB 1SRQA 4FBGA 2LIVA 5IN5A 4FT2A 1NIPA 2CN1A 1DINA 4BCDA 1MBZA 3NM5A 1MF7A 1FP1D 2Q3LA 5L6MB 4TS3A 1FDRA 1HEUA 3AR8A 4WD3A 2I9PA 1QRSA 1ECLA 3FLEA 3JPWA 3GEPA 3MCAA 4HVLA 1BDHA 2QE7D 4KI7A 1AKYA 2C5EA 3M1YA 2H92A 2UYOA 4YGXB 1OPRA 4FN4A 4OAQA 1WXEA 1F5SA 2VHCA 1V1RB 2JFGA 2RHGB 3FNFA 3LXRA 4LTDA 1W94A 3UWMA 4LVNA 3L92A 4F72A 1LC3A 2GRAA 4BMNA 5JU6A 2AX3A 1E2DA 4WN9A 5EC8A 2EQBA 5P21A 4DVJA 1Y7HA 2BM8A 1P5ZB 3RVDA 3JXEA 4MHOA 5FR1A 1JDUA 1E1CB 3CF6R 4F4JA 5TJ9A 1EQ2A 4OAPA 3FPFA 4RKRA 5I9SA 3E22A 1FXWF 1KEVA 2HHHB 1U3FA 2EHJA 3SY8A 1R0CA 1R4NB 4KGZA 4KL8S 3K05A 4KVGA 5HIMA 4CN8A 5HQTA 2ZUBA 3TAHA 4DR7B 4FHEA 3T1VA 3TOSA 1A98A 1J56A 1IL0A 5FA8A 3RM3A 3TL6A 1DGQA 2PX0A 3LBFA 3W5VA 1D6NA 1VRWA 2Q5HA 1NN3A 5JZMA 3HXLA 4HX9A 1XPOA 5AD1A 4K0RA 1TKBA 3H75A 2H3EA 3PHBE 2E4AA 3B1YA 3SSNA 3FRHA 1QHYA 1AKWA 3FPKA 3S7TA 4EUNA 4H1UA 1I4EB 1O6BA 4TZ0A 2HF7A 1M9NA 1OX5A 3L1VA 3K73O 5M29A 1C41A 3Q87B 4QFCA 1ECFA 4PV7A 4PNEA 1JLHA 2R5WA 3N2EA 3M49A 1BQ3A 4UZFA 1XNGA 2P91A 2XB6A 4OGFA 4YMSA 2J0EA 3HWX1 1ISJA 4OQEA 1CUSA 2MU1A 2WPDA 3IUMA 3H3FA 5FB3A 2JA1A 2FUCA 1QE0A 3U4QB 4J75A 4KSCA 5IFLA 1Y8ZA 3DEAA 4KMMA 2ONKA 4PLVA 2I66A 3M70A 1YTUA 5LWQA 1BS1A 4OO3A 2HMVA 4CI9A 2HCTA 2OORA 3K0HA 4PSVA 4DPMA 1VHWA 3DFMA 2FI1A 3H9EO 5BN1A 1T9AA 4HLNA 3ZE2B 4TS1A 4EAAA 4UJ5A 1SUFA 1AS2A 1JMKC 4JEMA 2Z4TA 3SEQA 2QRQA 3AEQB 1F51E 3HKEB 4MX8A 3BMOB 2W6ID 4ALMA 2WMDA 2ORVA 5BR7A 1G4UR 3UK2A 1DP4A 2Z1NA 1NGSA 1SVNA 4LBZA 2P0EA 4N0QA 1HE2A 4OHBA 3P27A 2JGRA 2RBKA 5DRTA 3ZCPA 2QY9A 3A6KA 1E77A 1EK1A 2AV6A 1XJCA 1C0KA 1QYXA 2EZUA 2FEOA 3NHRA 4DG5A 5ECYA 2V5VA 3OPXA 1IDOA 5AK3A 1TMYA 2JFWA 2OCXA 5HIAA 4G25A 2B3TA 9ATCA 2TYSB 3H7AA 1ATIA 1JG6A 3NHYA 5K8TA 5A6SB 4MYDA 4FLMA 4KDEA 4R2WA 1KOFA 1ACMA 3TE6A 4GP9A 3L7JA 4RORA 1Z0SA 5J3JA 2O8FA 1HXHA 4MPRA 5DSXA 5DXJA 1DHTA 3SEZA 4GUDA 4JVOA 1GVNB 1MW8X 1EX7A 2F3UA 3I6BA 4M4SA 3RUIA 3I0NA 3U3XA 3V34A 5HS4A 4MVXA 2VHTA 3GUVA 2LNDA 4GNKA 3UK1A 2QTGA 5FWAA 2R6CA 4HNTA 3LCMA 3VVMA 4DLXA 1NOIA 2C2BA 1IZ0A 1LDBA 3D1VA 4CLOB 3D8RA 4TPKA 5HX7A 2RK4A 3EXG1 4JYPA 5EWJA 1XXLA 2I4OA 2WU3A 3HSYA 4UCXA 2A9JA 3HZOA 4HTFA 1E2EA 1N0VC 1UT8A 3IUYA 3H04A 3MJDA 1K6IA 3Q3JB 4LQLA 4LMAA 3EIOA 4ND4A 4KPUB 1LBIA 4JVLA 2I6SA 2CCGA 1O2DA 5T6BA 5C7IO 2UVDA 5AKZA 3KOUA 1N8TA 3OT1B 2HO5A 4G5QA 4YDQA 3OZDA 3ZYZA 1FFEA 2H11A 4EB0A 2Y71A 1GN9A 2CHGA 2G70A 2Q5OA 3OCJA 5JPDA 2MMCA 1OB2A 2IYPA 2AJDA 4PO8A 1GTRA 2CMGA 4B43A 2H1RA 4YMGA 4OU4A 5REQA 1EESA 3DV0B 1XD8A 1U2TA 1B2RA 4WEOA 1Q92A 3IIEA 1J4AA 4AJ9A 2G1PA 3PE3A 1MX3A 4V3CA 2HDHA 2JHCA 3AMVA 2HWYA 1WCV1 4LYGA 3ZIDA 3M6AA 2IX9A 1SMKA 4TMVA 4BO0A 2JBAA 3LO8A 5LQKA 2YYAA 4JOBA 4WLEA 1R15A 2BD0A 5DBFA 3SEFA 2FG5A 4E33A 3L0OA 3WMRA 4WVLA 5DGDA 1NATA 3MWEA 4KG7A 4ZVUA 4YCSA 3DT6A 4N5LA 1C9YA 4EZIA 4FHGA 5G0TA 3UH1A 3KFXA 3KXDA 4NCXA 4N8EA 1KOLA 2RHHA 5TIIA 5HUHA 4UXHA 1M72A 1G4AE 3L07A 1AUQA 2EJTA 5F2NA 3Q85A 3PI7A 2OR3A 4IS3A 1ADGA 1IPHA 1R9MA 1XE3A 3H19A 4FOLA 4GPBA 1H9BA 1CR6A 5B6PA 1LQ2A 1LS1A 4U8GA 3I1JA 1C81A 5CVEA 1KPIA 2OBMA 2QIPA 4KMOA 3H1AA 4WBNA 5GADl 1Y1KE 4QQRA 1XMJA 3NWJA 5M04A 1DIHA 5JS1A 2BMDA 2XQIA 1O03A 2YJTD 3AHFA 2W37A 2GF2A 5ITZB 2XA2A 4D5EA 2HMTA 1DAMA 4ZMRA 5BN4A 3ZJ4A 1TUBA 4WCVA 2R9VA 1HOXA 3L84A 5EMMA 5EMKA 5DM70 3H0CA 3GJ3A 2AJLI 7AT1A 3AJAA 3BHJA 1QFMA 5J5CA 3BS4A 3OE4A 1XRLA 1LZLA 3H9JA 2DUUA 3SE7A 4ZO9A 4EPTA 5IWCA 5JOQA 1VXOA 4MW4A 4W9NA 1JVSA 4G0OA 1AV6A 2R1UA 3ZHQA 4BPBA 4L4XA 4YNBA 5CX4A 3DVLA 1P4JA 4CV3A 1LVGA 3BULA 2BH9A 2GFIA 4UASA 5K09A 3CB2A 4C2UA 3ODPA 1TYCA 3PT5A 1L4BA 4CUJA 5JAQA 2EZTA 1HEIA 2VF8A 1IBLB 4BOYA 3CXUA 1PJTA 4BNVA 2V0GA 1N1GA 2YW9A 2NP6A 1ST2A 1XK6A 3EA5A 1EK0A 3G2KA 3HVHA 3ZHRA 3WLMA 2PUJA 2QYTA 4M7OA 1VJTA 1V5WA 3ICWA 3OE7D 3DE0X 2H4ZA 4D3YA 2FE4A 3ZLJA 2O2SA 1LX6A 2P69A 3EZNA 4H77A 4Q37A 1R8XA 4J0HA 3CB4A 2COKA 4XPIB 3VYVA 5ALZA 3OLCX 1XTTA 5HGJA 2CT8A 3AB3A 1J42A 3E15A 4EW1A 5C37A 2HBRA 3LBAA 2HN9A 5YASA 3G02A 1ENYA 1IY0A 1QIJA 2NSHA 3CLUC 2PT9A 3M1IA 4H7PA 4LSWA 4M83A 4WXHA 3T4EA 2PL1A 3CMCO 3U0VA 2H3HA 5K4AA 3R3XA 3MMSA 1U3CA 4UFPA 1VC2A 1LRJA 2AXEA 2JI9A 1MQSA 3ZD9A 2DSTA 1OIXA 1R00A 3WDSA 1KJ9A 1WA5A 1D2NA 1JIKA 4K6FA 3E2MA 4OHYA 4V0OA 1WKVA 4BMYA 3LGAA 2F67A 2VRNA 1K5GA 4M86A 3TO5A 4KITB 3TNFA 1QIGA 2I7VA 2EW1A 3JQAD 2AFHB 3WXBA 4BC0A 4TV9B 4E2YA 1A7KA 3PL1A 1Z7YA 3L40A 4M0CA 5HKBA 1WBBA 5EESA 4R3UC 4RULA 3PKJA 2XT9A 3V9PA 2VSXA 2QRMA 5B37A 4DRXB 5C1DA 4JR0A 1AXRA 1T9KA 4YONB 3C6MA 3GFFA 2ATXA 3W05A 4ZOEA 4QE3A 2C1XA 4DJEC 3DH0A 5HSGA 5BXQC 3CMMA 4KO2S 4JI8B 1JHZA 4ND8A 3BERA 2M1ZA 5CBPA 4GIBA 2QK4A 5DASA 5CAEB 4A8JB 1AS0A 3FZYA 1SH7A 1TUBB 3CR7A 4ZYUA 3HDJA 1RHMA 1JSRA 4JLMA 4FYPA 5CP8A 1ESCA 3FOEC 2G0NA 2RONA 1ONPA 3MCZA 4F4CA 2WAMA 3O3CA 3V8VA 5E1BA 1CIJA 2Q4EA 3QE2A 4GHWA 1URPA 4Z86A 3ZU4A 2GCOA 2WT8A 2FUNB 4PYLA 2VK1A 4WASA 1P62B 3ESRA 4Y98A 5HOQA 2CYBA 4HVAA 3Q3IA 4JFRA 4OKIA 3BA1A 5L40A 4RVDA 3WAGA 2Z3WA 1DC6A 4P9NA 2CNLA 4BBZA 1CUDA 1LTHR 2BJHA 3WK6A 1YA6A 5HFJA 4PAGA 3GLHA 4F91B 5IVHA 2V9PA 2GPBA 2WKQA 1UBJS 1L5HA 2D8AA 3KL4A 2FWMX 1Z0UA 2Q07A 2Q62A 1XELA 4NJEA 1PSDA 5HF8A 3R74A 4DA7A 4WEQA 4NNPA 2B69A 4WL0A 1JFFA 5DXAA 2YMQA 3K2IA 3OBIA 3SU8A 1VI5A 4B6GA 3RJZA 3HFJA 3B3JA 1B4DA 4XKJA 3W5JA 2XF2A 1SCDA 4HAOA 1SZJG 3MCTA 2JRLA 1X7YA 3DVSX 4B32A 5LWHA 3VNQA 3NIWA 2V58A 4QVIA 2J08A 3D2AA 1VECA 5LP6B 1QONA 3ET5A 3QF4A 1I7SB 2D7JA 3JQFC 4P4LA 5BQ5A 3B9QA 1T43A 4QBTA 4RVGA 1FRZA 1UBMS 3DT9A 3RSCA 1N1DA 3RS9A 4AAYA 1U0RA 2B36A 2GRJA 2DBYA 3F46A 3KAPA 4WY5A 4COOA 1QG0A 1MAWA 2ZJ3A 3VU1A 3FM9A 4NMLA 4XXHA 1C9JA 2ZJ8A 5SZIA 5L4LA 4LF5B 4Q7LA 4MKHA 4RV5A 4D79A 1ULSA 4HYTA 1U2ZA 4YMUA 2I8LA 4FFOA 3H0KA 2QMQA 1PYGA 1V26A 5K0EA 1NNLA 2P6OA 5J4LA 4HAXA 1YCHA 3VR3D 3LOUA 4G41A 1ZSYA 1KZ9A 4ZK2A 2Y1CA 4F3RA 5DWDA 4RJIA 5IUKC 4TSRA 2JG3A 4OI0A 1EGQA 3MWFA 3O5AA 2IH5A 1JAHA 2JCSA 4ZVNA 3IT0A 3OP4A 4JLAA 2DTXA 4N7MA 1HFEL 1B8OA 2CXUA 2FLKA 1G8KA 4JI7B 1J06A 3NTRA 3QEMB 4AUNA 5EMJA 3QVGB 4R9VA 1AMOA 1W88B 4LC1A 4PLCA 4TKLA 2FN7A 2IITA 3NW9A 1BXKA 2V7QD 4PAWA 5E4YA 3V2UA 4DE5A 3MTIA 4ZOLA 2X1HA 3FZQA 1V7QA 2IEAA 3MRTA 2W2KA 2ZI4A 1SB9A 2QI9C 5ICSA 4WZAA 4H3VA 5LQUA 4Y2SA 1EVLA 2XIQA 1Z4LA 2D2VA 4MGZR 2GXUA 2C7GA 3IMKA 2D2IA 3NEPX 3IUPA 1ZBDA 3KT8A 3ABZA 1V8PA 3LKZA 4OSEA 5C7OO 1X15A 3B48A 4Z9BA 1BHQ1 5BQXA 4PZZA 1NQOA 1E6CA 3F5DA 5K0SA 1P0MA 5GPBA 2CVPA 4E4TA 3OZEA 1XWWA 2ZJ6A 4ZVPA 4F4HA 4FC7A 4DARA 2FWIA 1AK1A 2C1ZA 3PNYA 1YRAA 4M87A 1AX9A 4IQ0A 4PIMA 4WZBE 4IOKA 4ZI7F 3T0FA 4AJEA 3H83A 2E87A 4A16A 4DXAA 3HGTA 3HO1A 3FKQA 4KVZA 3ZHZA 1T0BA 3EK2A 4QARA 1HDGO 1BDMA 4ER3A 2HA6A 4BN5A 4D3SA 4BKPA 1M7HA 3FGZA 1UK9A 1NZFA 3DTNA 1ZNXA 4GMKA 5E6SB 3T3MB 3LDFA 4OBWA 4CKEA 4JJEA 2WI8A 4C4XA 5BSRA 2ZZKA 4HBGA 1OWMA 4MGKR 2QAJA 4RHTA 2JFOA 3E5NA 4IDDA 2XITA 3L4JA 2GHQA 4CQJA 1XDGA 2KYRA 2Y9MB 3OPYI 3Q9LA 1W5EA 4GKAA 4RGQA 3NDJA 1NVVR 3DBHB 4YMLA 3K9FC 2WNSA 1KQ3A 1EUDB 1I7LA 1UEXC 2R6R1 4G1FA 1PT9A 1P1HA 3SVTA 3DBRA 1G8PA 1U02A 3P9IA 5KWJA 5HTOA 1V37A 1YQUA 3QFCA 1O57A 4P3OA 2Z5LA 1VLJA 4DUGD 5JY6A 2O3RA 1UOEA 3KKPA 1CZRA 5D3MA 2MCFA 2RAVA 4B9EA 4DYVA 4HT3B 4YYZA 4WLOA 5IM4A 1N3BA 3FAKA 1JQBA 3LD9A 5GGYA 1DKQA 2GH1A 1JSLA 4TRNA 4YC7A 1A9SA 5TPZD 3R8XA 3IQZA 2QU8A 3T7KA 4YH1A 5K3OA 5G3ZA 4E03A 4L7VA 4QREA 2QBYB 2GETA 4TTSA 4N03A 4DQ0A 3O2QB 1WUTA 4J1TC 5K2OA 2X2FA 3CBQA 3W5HA 2AFIE 2JD0A 3MD9A 2WKPA 2XNCA 3NM4A 1DMSA 4FONA 4FFVA 4J2HA 3WHPA 1S7CA 4QJ5A 5I7OA 2AIRA 1O95D 2WU8A 4E94A 5JANA 5L9AA 2Q8PA 2VDNB 2RHDA 1OKKD 2IW3A 3HEMA 4JLNA 3JASB 3TOCA 2WUEA 4D42A 1XL0A 1EFLA 4A1FA 4JYCA 2O1WA 4XDGA 3RH0A 5AVVA 4MEAA 4MWTA 6LDHA 5LMCA 5LP6F 1TC2A 3CN9A 5JH7A 3L4BC 1VE7A 3V2GA 1QFJA 4FM9A 4ALNA 4LHVA 2WRZA 5DGXA 2VHQA 1R0RE 2K6GA 4D44A 3H3XA 4HH1A 4DANA 1GQRA 3G5MA 3A4NA 3OTHA 4KR3A 1VRCA 1PNVA 3PRYA 4DJTA 1Z8HA 3REQB 4HMOA 1JIUA 1UC5B 3VVBA 3C3YA 4XR4A 3SKVA 5EE1A 4NCNA 2J3JA 4RX1A 5K8CA 3C3CA 4DNPA 3UG7A 4OHRA 2FN9A 3TIGA 5F5XA 2IWRA 1FYWA 3OQJA 1KAOA 3ABSB 3Q1KA 1T0UA 4IINA 4IXMA 4ZK6A 3M4YA 3MT8A 2W4MA 2QLJA 4XDZA 2ZSBA 4QNRA 2VRCA 5HQ3B 4G0NA 5KQSA 4N3NA 3LKBA 1HBJA 3DBLB 2I9KA 3OOJA 1K7XB 2I8CA 3PRJA 2DBVO 3HCEA 4Q18A 2XNDA 3DKPA 4NENA 1LPSA 1C7EA 5AW5A 3D2LA 1IC6A 5FA5A 3FYTA 4I9FA 2E4XA 1RS0A 3S5JA 1KF0A 2AG0A 2GN8A 4BQQA 1RZ3A 2H08A 4CT0A 2NSYA 2YHBA 3T9EA 3NT5A 1WB6A 2V4MA 2ZRPA 1GHTA 3ILHA 2WWIA 5CFOA 5IAKA 3D0RA 3F7OA 2IK8A 4EHAA 5T4EA 2IC5A 4XJTA 1W0JA 3V32A 1U7WA 2C31A 3HUDA 3TX6A 4G5YA 4G24A 1IU9A 1SELA 2HF8A 2PVCA 4X85A 4UQLA 1E8NA 3AVTA 1L5KA 5JFGA 1WSDA 5BN5B 2ZIGA 4O25A 5K0BA 2BVNA 3RVOA 2LP4Y 5I4KA 1CUXA 2IPAB 1L7BA 2Z04A 3IEVA 2XOXA 4J07A 3S2ZA 5I9NA 5JCJD 1Y8RB 4YJ2F 1LQUA 3K16A 3R0JA 1M76A 3BF7A 1ID1A 3INNA 4TLMB 1FP4B 4HRXA 4OG2A 1GGFA 2V1XA 2QAGA 4KXLA 4DLBA 2C4VA 3G3EA 5B36A 3VNVA 1A96A 1ESZA 3MFYA 1GU7A 4TROA 2IOQA 4BX3A 2ONYA 3H2SA 3NBAA 3D5EA 2BFEA 3NUGA 5JHGB 1GTL1 4GP6A 1FEZA 2HMSA 1J09A 4CF3A 5JJ5A 3QU5A 3JZMA 1R64A 1H3FA 3RIMA 5JALA 3WS7A 4CGYA 2CK3A 1C9EA 2PYZA 4QNMA 1P6XA 2IU0A 3IELA 1NXQA 1L4KA 1B0PA 1GR1A 2OT3B 1VHTA 2FR0A 3QUBA 3MMNA 3U37A 2C92A 2E4ZA 3ESQA 3IUNA 5DZSA 4YBRA 1PV2A 3RNOA 1N77A 3ZWQA 1CF9A 3IQXA 4J7UA 3S81A 1ZZGA 3PB3A 5CW2A 5SYNA 4FKZA 1ZXLA 4NZMA 1E2QA 2L0XA 4FINA 1Q57A 1E4YA 4RHXA 3WC4A 3GK3A 4GC9A 4AG6A 5A5GA 5JDIC 3E5RA 3QF4B 1N6LA 2WTBA 3FGOA 5CXUA 1U0EA 2ANBA 4Y6GB 3O7WA 3R0IA 4JJ7A 2E21A 3FDZA 4C14A 1Z4OA 3ID6C 3D6TB 4AJLA 3L5OA 4EI9A 3CCCA 3VZBA 3LNTA 4H4CA 1NLFA 5EJMA 1Z2PX 1H8ED 1HG1A 1KK2A 1VG9B 5CEFA 3WYBA 4OJTA 1PCXA 1H65A 2EJCA 2QN3A 5E8RA 4RY2A 4S2EA 1OXTA 3ZU2A 2DC1A 3UGTA 2AFIA 1L7EA 3ZOZA 2W22A 3BUSA 1DCMA 2XQJA 2Q0XA 3AVPA 3B9BA 5ALKA 4Z99A 3PRHA 2FPUA 1CF4A 4MRMA 1Z18A 4IJ6A 4W5JA 1S8OA 2MYUA 1L5HB 3FSGD 5ICFA 1EJBA 3PUJA 1D2HA 1K6JA 1YBMA 3VYRB 3WNVA 4D97A 3R5JA 4URWR 2D2FA 5LYJF 1RBQA 1LB1B 1S9DA 1VJ5A 3G2LA 4JI0B 2KLBA 2HGSA 2YJ4A 1DI0A 1WNTA 3RSFA 4QM7A 4S2UA 3OMXA 3CVVA 1V6AA 3OTGA 3I62A 4MUFA 1A88A 5TX7A 5G0WA 1CS0B 2LUOA 2Z2JA 2QJRA 2VATA 2D1QA 3ZKWA 1DKPA 3JQGB 3FNBA 3SC4A 1PR2A 4JS0A 3THXA 4KKXB 2XDWA 5FLKA 3M4XA 3PR1A 3TNLA 3PNLA 3QU7A 4M0FA 2VDQB 3U2QA 4JWKA 1PD1A 3F6CA 3FPLA 3O2SB 2OD7A 2OTCA 3FTCA 1HX7A 5M34A 2PRZA 2RHWA 2E6KA 2GD2A 3QOXA 3EXIA 4NIMA 2M2IA 3NH9A 1IBCA 3UBMA 1SQ6A 4CIBA 2GZRA 5ALGA 1H2EA 1XEXB 2ZYWX 1J9EA 4JGBA 4ND8B 1V8FA 5CDYA 2PLWA 1ZJ6A 4W5WA 3H5OA 1R5JA 3QX8A 3L04A 1J0EA 4NCIA 4B7CA 3O03A 4KYUA 3CF4A 4LXHA 1CBUA 4YLGA 5DLPA 1GAJA 1C4WA 3D2BA 5ADVA 3D3JA 3EG9B 4RVSA 3DLBA 2FWAA 3EODA 1U8AA 3A26A 3UCEA 4AF6A 3K0BA 5JXIA 4YDSA 1PR4A 3W34A 4I6GA 3FOCA 4HSEA 2XMGA 4MR7A 2XTZA 3CGGA 4UDOA 4KRFA 2VH1A 3B2QA 4N5DA 2H57A 2P9ZA 3N2IA 3PGKA 1RXWA 3FBGA 3HCOA 4B2IA 1HTBA 4IRMA 5IJWA 5AUNB 2FDXA 4XI9A 1E0AA 3AIMA 3GPCA 5H7XA 3T5TA 3TUJC 3H5NA 2G67A 3KQMA 1EZ4A 4OV6B 4DSZA 3QQPA 1XRJA 4EZBA 4Z4IA 5IC5A 1L8OA 2BF7A 1YCGA 1YQWA 2PQ6A 3DJFA 3ENZA 4DY4A 3U7GA 4OHPA 4D8UA 1CQIA 4YV2A 4PPFA 4GOMD 4OQPA 4JBYA 4IIJA 2A0YA 4F3TA 2E9SA 1P1CA 3LC2O 4ZYXA 2ID7A 3JVEA 1DUIA 3E8XA 4N3BA 5C8YB 2BFAA 3R6TA 3HKDA 2H18A 2PLRA 3U1TA 2IXDA 4RZHA 1OH7A 1O6GA 5CT8A 2AYXA 4DCJA 3UWPA 3REGA 1RXSA 3VJKA 4PYJA 3L02A 4LVOA 4A6DA 3MILA 5BR4A 2AH5A 1CJVC 3GLIA 2FGJA 1AHPA 1VMKA 3CIOA 3A6DA 1SUBA 4AM8A 2EBWA 4U2FA 5A71A 2RHLA 3BMCA 3LUJA 1RQ2A 2FJ0A 5JNTA 2ZQ5A 4TKZA 1RACA 1V4NA 1Z2EA 2IE0A 1DKMA 1PQUA 1KSJA 1TO6A 1U0OC 1WSAA 4Q6WA 4U7FA 3BTUA 1S3FA 1XVLA 3DE2X 4WCDA 3T9CA 1MG5A 3WLOA 2J85A 1AGRA 4F4FA 4F4UA 2YN2A 4MDFA 2PG3A 2A7XA 4LXXA 4RYDA 5DCUA 2GEBA 5ALDA 1L7RA 1RR6A 5C35A 3RJ5A 2IOYA 1OE0A 1T2CA 1PZHA 1KSGA 2HDWA 2R25B 5ICCA 5CTAA 3VHXA 4LTMA 3K0AA 1CVRA 4E2FA 3WLTA 2FW1A 3PK0A 4IIHA 5M5BA 5JNVA 2PH3A 5FHQA 2UYQA 4KXMA 5EUBA 5IDWA 3EVGA 5JNSA 1UZUA 5AXCA 4UBOA 1OU4A 3FWZA 4W6ZA 3C87A 5EZSA 5IXJA 4TQ9A 2HJVA 3EAGA 3M0EA 4GVXA 2YIVX 1HR0B 5IKMA 2Y2UA 4FGWA 3Q6IA 1AO3A 1LFDB 2P5SA 1LSOA 4G2TA 4J0EA 2O14A 4OB6A 3W2GA 3ZY3A 1IJEA 4BXOB 2R2AA 4HGRA 1GUFA 1QE5A 3K0AB 4UHHA 2O5RA 1SAYA 3UAYA 1ORTA 1Q0QA 1QG6A 1DRWA 4KX5A 2E0IA 1U4OA 3C7DB 3T41A 3AVUA 4RA9A 2DHQA 4CEJB 4LWZA 3SLGA 2IHYA 4QRHA 1BDJA 2UV8A 4YJFB 5EIEA 3NHKA 1JKJB 1G3QA 1RXEA 1FLAA 5ALXA 3PC7A 4D4LA 4NECA 3FCUB 3T3OA 1PJQA 4ZZ0A 2GJKA 1Z68A 2E49A 3QWBA 2C9ZA 3E2PA 2R6GA 1XRMA 3WL4A 4AMVA 3T1NA 3UMVA 2O0LA 2O2JA 4OCZA 4DT1A 1PZGA 3UFXA 3VOAA 1KEZA 2YV3A 1CUJA 4OXIA 2ADMA 4WY2A 1P4HA 2REOA 1RQ7A 3T9DA 4ETWA 1WBDA 4BO4A 2VPYA 5JRDS 1QQ5A 4PX2A 5ARDA 3E0XA 2CXOA 2VPXA 2ZVPX 5EHGA 2W6QA 3NVMB 4HATA 1QFYA 1ZVJA 3LJKA 1XTUA 3CZ9A 3OD1A 1L7OA 2ZUCA 3NVAA 3GJXC 4H9GA 4KLZA 1IFXA 5FTJA 2XQKA 3MJVA 1C1DA 3OF5A 3T3EA 4A82A 5DYWA 1BHSA 2QPAA 4WH0A 1C3XA 3D2CA 2P6NA 1A69A 2AOUB 3FYDA 4HQKA 2MDTA 2P78A 3FCAA 2C4TA 5KAPA 4M8KA 1LLQA 4X8MA 4KBFA 2OM6A 2B1JA 4Y2RA 4OIFA 3TZCA 5KHOC 2O3UA 1RC8A 5B7QA 4JP8A 3PXGA 1NJ5A 2VDOB 4PYKA 3QZUA 4BAUA 1G38A 2OV1A 3CCBA 1LI4A 4KQCA 1O4WA 1NVBA 2GUGA 3B1FA 1VE6A 1VKNA 2E4VA 2I99A 3IB6A 4MA4A 5F64A 1D5CA 2B1RA 3ZWMA 2X8BA 1JF8A 4UOEA 1QLHA 4W1SA 1GY8A 3IA2A 4MUXA 1ICIA 4W4TA 4LGYA 4F06A 3X44A 1T8YA 2PPLA 2VH2A 4IXTA 5KTPA 2ZJYA 3GVPA 1V6CA 2H2IA 1G8GA 4KQKA 4QGFA 1Z4MA 1RRCA 4UFNA 1UXGA 3E9QA 4A2PA 2CYAA 1M8GA 1Q1GA 3E7FA 3RBAA 4TXMA 4WMLA 1FIUA 4NU6A 4JL6A 2YRXA 4X60A 1U11A 5IJXA 3A1EA 2DFVA 2GEUA 3UJCA 3SJBA 3RUEA 4HS4A 2OQ2A 4UUMA 5FI5A 4BVHA 1KJYA 4RVUA 4LHSA 4WFJA 3SQDA 5AQ1A 2X7HA 1R5OA 3CKYA 5SZHB 1CPYA 3ZCXA 4QGAA 3OQ1A 1Z08A 1L4MA 2AQKA 5DU2A 3WK8A 2PBLA 3KLNA 3ZQ4A 4EYGA 5G4KA 1R0KA 2O23A 7ABPA 2OCPA 3ESDA 3NOOA 3A1TA 3HDGA 3HVJA 4XOIA 1YDHA 3NP7A 4PNZA 3T0IA 2GAOA 1F14A 3K6SA 4ISCA 4R98A 2Z98A 4L0MA 5AW7A 1LBQA 1KY5A 4QLBA 3IR7A 3SGLA 1U9CA 4G5GA 2C78A 5IDXA 1JKMA 3CH5A 4RY0A 3DE3X 4FR2A 5FBZA 2WFAA 2PRIA 4BNHA 2JGDA 3U5ZB 4FDUA 4IYJA 3T7RA 4I2VA 4JXZA 1TAUA 4EEZA 3CUWA 3ZXUB 3QJGA 3UAOA 4DOMA 2W0SA 4RE6A 2Q1WA 4XH9B 4XIGS 4ZGWA 4DCGA 2FZVA 4GFDA 3O31A 3Q7TA 3C8MA 3CX7A 2UZAA 1UAAA 3GA5A 5FPTA 3ZHSA 2LKDA 5K99A 1C1DB 1NVKA 2VHVA 3MXOA 3BT7A 5KNCA 1YC2A 3RIEA 1HYGA 2JHPA 4UVDA 4BNUA 1ZLXA 3L06A 3C8DA 3RC9A 4H6VA 2GHRA 5EJAA 1JWBB 1T2EA 4W5RA 1EFVA 5GIPE 1KYTA 3F9CA 4PHCA 2O8FB 5GGXA 3ZY6A 4LV8B 2R5FA 1MA3A 3F6YA 3LUGA 3QRWA 4QJ3A 4O4JA 5CG1A 4OIMA 4Z1MD 2J9ZB 4HYYA 4AW9A 3UFXB 1UK8A 5EWMA 2F17A 3TZHA 2ZR9A 2FUKA 1FX1A 1P19A 2G6TA 3UK7A 1MABA 1WPQA 2R65A 1J1IA 3K30A 3NV9A 3LT4A 3PG5A 4KLAA 1B43A 1EP1B 1TU4A 2GPSA 5LQDA 3CZRA 4Z7JA 5I5EA 1PFUA 1JDBC 3GWGA 3H5VA 5J2TF 3EFOB 2ZR8A 5TQ2B 5CB4B 2H5EA 1UR5A 4U0KA 1M1XB 5H82A 1OUMA 3HVRA 1RQPA 1RAAA 2WTAA 2WU1A 4CM5A 2QTRA 5EE3A 4KQ1A 1POWA 4BN4A 4N47A 5A03A 1PQ4A 4X20A 2PT6A 5KIAA 2KWIA 4MDYA 4KNVA 5HQJA 4C0LA 4EW2A 2QXUA 3ADCA 4P0TA 2V0CA 2Z08A 4BE7B 3K6RA 2BZGA 1IUOA 4PLGA 4MVJF 3MT0A 2YWGA 3BIFA 2ASVA 4IV0A 1AB6A 2M1XA 1E3MA 1T8SA 3GOQA 4FYIA 3IV6A 4D9MA 3KUKA 1NI4B 1SBIA 1ISHA 2C2XA 3PPVA 3V00A 3ELWA 3QVOA 2IZ7A 3LMKA 4F1KA 1GA1A 1I7DA 4ACAA 3V4ZA 1FJXA 1L4NA 4XUEA 1NBHA 1Q22A 3C8UA 2GO1A 5DX1A 3GVCA 3HZRA 3A2NA 3C85A 4LJ9A 1MTZA 2G25A 3K1JA 4YASA 3UNXA 4YRGA 6CHYA 1EVIA 1ZS9A 2ADOA 2ZYRA 4YCCA 3AV3A 2F3SA 3MRSA 4JLKA 1T1IA 2FKNA 3B70A 3W2HA 5J4HA 1I2AA 3I72A 4JUDX 4A8JC 2PUAA 3KR9A 1Q0TA 3K72B 3RU7A 5DTQA 4MVJE 3IKLA 3ZNPA 3IDAA 1M1NA 3MS7A 3HB0A 4LCJA 4GBJA 4QX6A 3KCQA 2QMZA 5DBIA 3PIDA 4F8EA 3STXA 4AJ2A 4D9KA 3ZIUA 2B35A 4UE2A 3LBYA 1PGJA 3LUCA 3IBCA 3TG2A 2B30A 1DKOA 4OX9Y 4HX5A 3VZQA 1Z88A 3VKUA 1ZC4A 2C94A 4M7WA 4H16A 4QJIA 3MNFA 4AN4A 1RAEA 4MMXB 1RJGA 4IDNA 2BCJQ 3ZUGA 2ERCA 1CT9A 2FZCA 1Y3DE 4LRXA 4BQSA 2JAPA 1S8FA 4KGXA 4X6LA 3RJTA 5AI6A 1MRZA 1N5KA 2P9JA 3RVPA 3D59A 5JRJA 3KQKA 4EEXA 5B58C 1YWGO 2AOWA 2VZLA 2PFKA 2OB1A 3MWEB 1CZNA 1BNCA 1SIBE 1T0JB 2XNJA 4J76A 4BB9A 4HWPA 3WL3A 1O96A 3F8SA 1VBMA 3EVEA 4L51A 3TTXA 1P3DA 3N2ZB 4NBKA 4ESOA 3RVBA 3D8BA 1KIMA 3BGIA 4EIWA 3ABQB 3O92A 1NMEA 3H2IA 1J49A 2AMJA 3EGCA 3MS4A 3PEUA 2WKSA 2BDUA 3JZFA 2WZCA 4UBKA 4DEVA 5J4KA 1FW6A 3KAKA 2X9LA 3EZXA 3KJQA 1M8JA 4TTAA 3I64A 1UODA 4Z4EA 2Q50A 3D43A 3V8QA 1JI0A 1EFTA 2YFKA 4IIGA 5BP7A 4NG5A 4HUTA 4C07A 4RKWA 4C4YA 2EL7A 2DCMA 4TXJA 1BH6A 1DE0A 3LECA 3DDOA 3VV3A 1UJ6A 5JI3E 1EIZA 3TLAA 2MSNA 4JP5A 1ISRA 2IA5A 2V4ZA 3D3WA 3GU3A 3EH2A 4G1UC 1DX6A 4H7DA 4E5NA 1NC3A 2AMYA 5DK6A 4UPVA 3ZQJA 4EW6A 1KFKB 3T99A 3UB4A 2D5CA 2HM7A 1E20A 4BKUA 4QQKA 1QMPA 1BU5A 4UTZA 5DJ5A 2VRWA 4JI2B 2AOTA 2ZPAA 2I6FA 2IIPA 3DBHA 3KZKA 3VQTA 3ZWYA 1OKKA 1X1CA 4AKTA 5KVSA 1JA9A 1O94D 1PAUA 3V42A 3WYCA 2QZJA 4OI2A 3GDFA 3P5SA 1EIWA 1O95A 1EFDN 3KWFA 1X2BA 4NYIQ 4OGGA 4RPCA 4TWJA 4X61A 5CCDA 4C5AA 4DDVA 2HMWA 1ZG3A 3U56A 1UM9B 2C2ZA 3GQVA 3TOVA 1U0TA 1UJCA 4NEHB 1HE4A 4GBMA 4Y67A 4F3NA 3NJ4A 1NU6A 5AK0A 3ZK7A 1XA0A 3EC1A 2WY2D 4ISBA 2WU0A 4L4ZA 3TIVA 4A9AA 1YFZA 2G77B 4PGAA 4D8TA 2XJ4A 1OYOA 1IBMB 1S6YA 5AK5A 4JI5B 3H5AA 3UB2A 1N4DA 1HC7A 1GKYA 4MUHA 3HB7A 5BYBA 1QZZA 1P1KA 4KBGA 2GN0A 4L4UA 1JJVA 1SVMA 1Z0AA 1OB5A 3QUCA 2PUFA 3ZKAA 3DS8A 1KAGA 1UKYA 4KUHA 3QWAA 2JD2A 1M2EA 3KEGA 1PS8A 3E70C 3H97A 3KOOA 2W90A 4N18A 1N6HA 1P31A 1YDWA 3CF2A 3I52A 1XPRA 2L18A 4L95C 1TRHA 2WMNB 3M4NA 4Q1AA 2RGBA 3BD9A 3HB5X 1R0BA 1MEEA 4LCEA 1H6AA 1NLYA 1PLJA 1QO0D 2F43B 4QPJC 2D6FA 3VYWA 3RT9A 2VUTA 2WICA 4PR0A 2ECOA 3CN7A 2FF7A 1U2PA 3EDQA 3L1KA 3W1VA 1QJCA 5ESDA 2IXBA 5IBQA 3N6RA 3I9KA 2E2WA 4L4YA 3HS3A 4P53A 3CRQA 3ONVA 4NU5A 3GCXA 3UY4A 5ADWA 4G5XA 2WQZA 3CLRC 2F43A 3JATB 3IRUA 4KPYA 2Q0QA 2ID4A 3GLVA 1K5DA 3ZWOA 4HXYA 1CNEA 1ZHFA 1K86A 1YDFA 3N87A 4NAHA 3X2FA 5KYUB 3DF7A 3NHBA 2O8NA 5FPHA 2ODNA 1Z5OA 3WRXC 3HJGA 3DM9B 5IFKA 4RSMA 4BMPB 4MWCA 5WRFA 2DE0X 3JWPA 4P4NA 5AO9A 1AF4A 4JVSB 4DR1B 5FLEX 3DZFA 3FMFA 2DP4E 4A26A 3O4IA 4FZVA 1JIQA 4CM6A 1DRKA 4C7BA 2WIGA 2ESRA 3HN7A 3W6ZA 1QTRA 3QVWA 5FWXA 1UMBB 3QKIA 4CV2A 4MVJI 3W8DA 1M8FA 5J63A 2PUDA 4BMXA 3U1BA 2HJGA 3PYXA 4N40A 1JIVA 2WZDA 3DO6A 3L6UA 4OD0A 4WW0A 2GPNA 3KTFA 1RLIA 4P4SB 1YGPA 2XUJA 3SFVA 4MVCA 4JJAA 1QO9A 2HU7A 3GJRA 5KTYA 3HR4A 4GPAA 3DEJA 1GGJA 2ECFA 1IY2A 1UBSB 3AX6A 1N8SA 4IDQA 4RKYA 1T4CA 3WLFA 1CEEA 1E6KA 4DA8A 2DJ5A 4NPCA 2B34A 2JFPA 2NU7A 4YQEA 3VOBA 4DR6B 2BY4A 1M2OA 1ID8A 4LKRA 3I9V1 2D0DA 2JZNA 1XCJA 2X6TA 2PTGA 4HDNA 2DU8A 3PDUA 3G2NA 2IGTA 4HFMA 1DBWA 1FFDA 1PKXA 3UH0A 3VR5D 3NQ41 2OZLB 1KJNA 2NO9A 2PBFA 3CO5A 3ACBA 3FRJA 9ABPA 4DRYA 2ZYTX 1EFRA 1GPLA 2ILTA 2WNIA 1KU6A 1NLZA 4NMXB 2X9QA 5DT9A 3TCKA 3LH5A 2MSEB 2QX6A 3FYUB 3ICCA 4DZTA 4MUKA 1HT0A 1VJGA 1ZAKA 4MULA 1QPGA 2ZAMA 5AOBA 4AJNA 3FIUA 4C76A 2CL6X 2H1FA 2PS3A 3B1JA 4DMCA 2FMUA 1DCKA 4IMRA 3ZXYA 3THWB 3KSBC 2VXYA 3DAHA 2Z5FA 2GBIA 3AESB 3IHWA 3R6GA 2YBDA 1FSZA 1Q0ZA 1SUAA 2I3BA 1GM5A 5JAIA 1M0SA 1S2IA 2P1RA 1MLDA 3STHA 3BHNA 5LQNA 4EHIA 3T15A 1S5PA 2CL0X 2QRNA 3CUTA 3G0OA 2H9IA 3GNTA 2C3UA 1EFPB 1CC1S 1G8AA 3MQ4A 4FCVA 2VJCA 4P8RA 4YRRA 4XE5A 5JCXA 2O2XA 3UGJA 1D0SA 2V03A 2WWVD 2DWCA 1IQRA 1BDBA 1VBKA 1X38A 3QBVA 3I9FA 2X1LA 4FFRA 1Q1QA 4DRZA 3WFJA 1X14A 1E1KA 2A92A 1H8HD 1PWHA 3UMRA 3MJCA 1ZBQA 1OI2A 3EGEA 2XT0A 2BONA 4RQTA 3PNPA 3CZ4A 2LDXA 3KLPX 3OPYA 4IDFA 1EFPA 1SEPA 5B3LA 4AECA 4G85A 2W93A 1F06A 3DZKA 3KDAA 2KSQA 3LQRA 4L76A 2BFPA 3A31A 1PZMA 1X42A 2C9CA 3DG9A 1C2TA 4PYNA 1V16B 4B76A 4J90A 4XYBA 1N9KA 4F84A 4L85A 4MCIA 1XTVA 4MXDA 4NABA 4DREA 3PCXA 1N0UA 3PLRA 3CQ9A 5B3JA 3ANYB 4QWWA 2PY6A 1DNPA 1TF2A 2YC2C 2RGCA 2Y0EA 4YYEA 2R0QC 3ZV3A 1XXHB 2WJ3A 4B5KA 3A3PA 1D4FA 2C0PA 2Z2YA 1NHWA 2FPRA 4G1EB 2HCBA 4CHGA 2X9GA 2Q27A 3ZCTA 4C0AC 4CDRA 4EHNA 5A4MS 5JPIA 3QYFA 5THKA 1A71A 1IEQA 2GM5A 1NN5A 2MINA 4GEGA 3OURA 3KHTA 3MINA 4LW8A 2XMCA 1QZ3A 2P79A 3JQAA 4MGEA 1NDUA 5LXTA 3O8OA 4MV3A 4ZO7A 3URMA 3HDYA 4IPTA 4DDTA 5K3CA 4JK3A 2D54A 4EF4A 4XTCS 4CIWA 4L5IA 1YBAA 4RMGA 4DQDA 2IYXA 3SHTA 2BKLA 2GGSA 1TX4B 1M2NA 1FNCA 3UEOA 2C5AA 2O0MA 2Z9BA 2KX7A 1E63A 3L0CA 4HNGA 5K0TA 4ZQFA 1KQFA 4AZ0A 1CEYA 2NX2A 4XGRA 5U9CA 1B41A 1PHRA 3N75A 5DV9A 2BTQA 4HDMA 3ONEA 1B8VA 3OCUA 1STOA 2HU8A 3NTQA 3A37A 3UQZA 4JROA 4NY1A 1CSEE 3QLUA 1YNSA 3GUHA 3OQIA 2ZQZA 2HMYB 4XQ9A 1GG2A 1Z8DA 2IHNA 5EZ6B 1GYQA 1CWUA 1HYQA 1RE0A 3BD8A 3I6QA 5E3JA 3H1EA 2FPIB 2OGWA 3TTWA 4O1MA 3DMPA 4J4BA 3W2TA 4RF4A 4F9FA 3SZ3A 2FY8A 3B6JA 4AJPA 4YAIA 3PITA 4WIAA 3IJPA 2Z57A 4RETA 2QUIA 3T4XA 3WQSB 1D2GA 1KJQA 2RAFA 4CLRA 4GMGA 4WXEA 5LP1A 4MVJH 4JBXA 3Q11A 1TIKA 3DR3A 3VH1A 2YASA 4FE3A 2Q3CA 1RRGA 1DXOA 5JMTA 1WQ4A 4JJGA 4FQ7A 1O3YA 4EHDA 5HKKD 2DKNA 3KDPA 4N7RA 4UM7A 3QBEA 3HG7A 3ZV4A 2WJZB 2YIMA 1E7RA 1G98A 2D13A 4ZFNA 4RTRA 2ZIUB 2RD2A 3GLGE 1XOIA 2UKDA 1SBQA 2WB4A 3O47A 1HFWA 2A8YA 3ICPA 1I5EA 4POAA 2ZSJA 3U9LA 1XNJA 1XN1A 3J81k 4Z3DA 1AQJA 2WD7B 3BDAA 2A9KA 3G8AA 3QHQA 2UZ4A 4R8VA 3K20A 1DBIA 4D9HA 2DF8A 3OHSX 3NWBA 1L5QA 5CNIA 5LZ8A 5L95A 2AJCA 3I30X 1V39A 4N5NA 4DHWA 5HZHA 4U7PB 7REQB 1JR6A 1AKTA 2OHVA 2VWGA 4FXOA 4R1UA 3LW8A 1VRVA 1I0LA 3K9QO 2HKIA 3U4IA 5BOSA 3NG1A 5T4HA 2J9GA 2QP9X 3LRTA 1VIDA 3AF1A 1ZINA 4HQRA 4US0R 2J4CA 3CJRA 3EEBA 4GXRA 4XD7D 3R75A 4DS3A 2P65A 3F96A 4R7TA 4HDAA 4URHA 1UDRA 5C46F 1M2WA 1NUTA 2OL4A 3ORYA 4F6RA 1P9WA 3V4PB 2CSXA 4Q7QA 4QASA 3MERA 4DCMA 3HLYA 2VKQA 3KE9A 1X3SA 4FFMA 5CVUA 4Z4QA 1W4AA 2VWHA 1A7AA 2PYDA 4L73A 1XT6A 3UAVA 4AL4A 2VP5A 3RG2A 4PS0A 3CNLA 3JARA 3Q5DA 1NZJA 2FCAA 2NZ2A 5B55A 3AR5A 4ND1A 4MS4A 2A14A 3TDNA 3K09A 4ZHQA 3UJHA 4IZOA 1E1QA 1G5FA 3NDRA 4F11A 4PLPA 4F45A 3UMCA 3DMTC 3MK31 3AUKA 3LW7A 4AUMA 3DP9A 2WHXA 2C04A 1Z6XA 4HV4A 4MINA 4Y2PA 2C96A 1CUIA 1E3TA 1BMFA 1GPAA 1BHJA 4AZVA 4CQMB 3VAYA 2QX4A 3U1VA 2ZEJA 1N5IA 3E9MA 3TLMA 3CX3A 2BBWA 1WF6A 4QL3A 5AOVA 3OZRA 3GRFA 4F2GA 1FFYA 1J7KA 1SUEA 3IQHX 4W8HA 2XCSB 2H4XA 3A4YA 3N07A 3AB8A 4GVPA 3WK4A 4C0QC 1GKLA 2PX6A 3C6ZA 1P72A 3LUFA 3H5WA 5LLTA 2O9JA 5C4GB 5G40A 3WGQA 2FF5A 4FR0A 2ZTLA 4KLRA 4AK9A 4DIDA 5B6IA 3IP7A 1ZGHA 3FWHA 3H86A 4EL5A 3SHOA 4FQ8A 4OLFA 1LW6E 2H2DA 2IEGA 3AQIA 4I4LA 1MV8A 1KVUA 1LLFA 2FE1A 4S24A 2WFLB 2QG4A 1PR3A 2ZIWB 1JPNA 2IP1A 2FOIA 4ZT4A 1ZY2A 1PV1A 2I1WA 2ILVA 3GLHB 1HG0A 3FHOA 4JBGA 1S8NA 3GBSA 4LSGA 1TZKA 3EWNA 1N8NA 3TH5A 5DYTA 3FI9A 3Q41A 3IIIA 2R7AA 3SBEA 4CG3A 3EGWA 4UTVA 1H8HA 1QM5A 2APJA 4LYFA 3WL5A 1E98A 4OL9A 1RXUA 3MWKA 1USIA 4E09A 1W4CA 1MQ8B 5F35A 3GEBA 5IZCC 1U1IA 3KZCA 1SBHA 4R2XA 3FPSA 3TQOA 1F1JA 1SKUA 3VGJA 1GQFA 2YY7A 1FMCA 4P7BA 4W6QA 1D1SA 3K0FA 2J9XB 3HJTA 4TTJA 5L8VA 1R16A 1KZ4A 4FKBA 1Z63A 5T67A 3TI9A 4U3JA 2O3SA 2O3QA 2I2DA 4YGYA 2CB0A 5JCOA 1WW3A 4HADA 4HD8A 2WKRA 1JLRA 5FTKA 2PGXA 5K3SA 4RWEA 5JSZA 1ZOOA 1I6LA 3OQIB 2DPMA 3CEPB 4HX2A 4YUWA 4ZJUA 2A0UA 1G9XA 2XTMA 2X40A 5ERYA 5ERGB 1I24A 4TKVA 3U60B 5JJKA 5DEIA 4TYMA 2PFGA 3I2JA 3U3KA 2VP3A 1ZM3A 2BFFA 3WWDA 4BO8A 2QAGC 3FG9A 1FW8A 1NXVA 4TL7A 1SVLA 4TMWA 1WHTA 2FLVA 2YS6A 4OYLA 4CKXA 1YQDA 1EFRD 1G19A 1KARA 4HH3C 1PT6A 5EAIA 5LA6A 1U90A 2J59A 3BL6A 3ROFA 3UMFA 4CLRB 1W52X 2LIPA 2QN8A 2X1VA 4Q4DA 4PN7A 3TUZC 4FGSA 4AKSA 4P0QB 2CNWA 2QLTA 4Q4HA 1CJMA 3HK2A 1DWOA 3JYNA 3COSA 3BXPA 4RD0A 4U7WA 3MFQA 3K2BA 4WNCA 4BQNA 4YLYA 3QBTA 2KHZA 2XMBA 4X93A 5FQNA 1YGYA 2C3MA 2FQXA 2QMOA 4ZXFA 3AF5A 2GN2A 2ISSD 1XCBA 2OBFA 3BSYA 3CKKA 2BFDA 1CB0A 1S1CA 2NO4A 3Q5EA 4RA9B 3RI3A 2AQ8A 4U5XA 2GFQA 1YR1A 4KPEC 4ALKA 3Q10A 3EHEA 5DHRA 3LIPA 1K7SN 2C5HA 2DBZA 1GZ7A 1SQ5A 4XLZA 3KJGA 1E2FA 5FJIA 5KTRA 1D4ZA 3O93A 4O4IB 2PXHA 5I9TA 3V7WA 1ZD9A 1D4OA 4I46A 2I03A 1SA0B 3DLPX 4P3YA 5FX2A 1L8XA 2F3QA 5A5EA 4CTKA 5EJ9A 1ORIA 1SQGA 3ZHUA 3VVCA 5EXPA 4WDQA 3BL5A 3CH4B 4W9RA 1LLUA 2VVTA 3TRIA 4J29A 2GEFA 1GQQA 5C18A 4BTVA 1COZA 2ATVA 2VYNA 2PZJA 1BE0A 3EN0A 3BE4A 4ARBA 2VYND 4UC0A 4I3GA 5A7GA 4U7TB 1TQ8A 2V7BA 3OPQA 3LHFA 5F7OA 3PZBA 2O0JA 1XZKA 3HV2A 4D4KA 2XKAA 2IKQA 4NL4H 5IBRA 3RC7A 5JH7F 1SKYB 1JLMA 2F64A 5AKXA 1R6TA 1BMTA 2CFSA 2JGJA 3UN1A 4ZOQI 1EJ6A 1XXHA 5ISMA 2E89A 4HXFB 3BRCA 4R51A 5KOJB 1K2VN 2AI3A 2QUKA 2ZJ7A 3F74A 4HN2A 4AJOA 3VNRA 3I5YA 4HGQA 2YHIA 2DTDA 1W4LA 2XA9A 4HL6A 6ADHA 3EX7C 5K05A 1TK2A 3I42A 2WU4A 1SVKA 2G76A 1QYCA 1LLCA 1Z5ZA 1N78A 1WHSA 3HYTA 3S70A 2JAXA 2DSNA 3ANTA 4TLDA 2DT8A 1ZUD1 2WNHA 1OOEA 1YBFA 3TZLA 5MN5A 2NZWA 4ALJA 2P9FA 3OPVA 3MCVA 1W48A 3LX8A 3RRJA 3WMEA 2CJWA 4BNTA 4E5KA 2CNWD 2OCKA 2PRSA 1E9VA 3L79A 4AJJA 3QKWA 3FZEA 4B0PA 3AY7A 5AW9A 3L3BA 3CNNA 4L72A 1ZRNA 2D1SA 4UUOA 2AOVA 4RZXA 1T6BY 4NHOA 2P6RA 3U49A 4MAAA 6ABPA 1GPJA 3KQNA 3EPJA 2V7UA 2VHWA 5CURA 4G63A 1DARA 2QAIA 1DFGA 1QHIA 3NX4A 3RF6A 4K5QA 1NVFA 4KIJA 3R3ZA 2R8PA 2C5GA 4GZMA 5F21A 2H1SA 4EYEA 5GV8A 1IZYA 3HZHA 3UA3A 4BLWA 3VR0A 5K20A 1XZHA 4JQYA 4G23A 3N39C 2YZ7A 5IW8A 1DAEA 5BV0A 1F4PA 4Q0MA 2F59A 3W1EA 5BWCA 3LCVB 2HIMA 2P67A 1M34B 3ET4A 9MHTA 5KJFA 1X9GA 3LFHA 4WPGA 1X7ZB 4QXOA 2I3ZA 2GBFA 1ZH6A 3BXGA 2E18A 5H9WA 1X7WB 2QL7A 3THWA 2HF9A 1JLSA 1BWQA 4U7GA 1UPTA 4DG8A 2OB2A 3PDWA 4RL6A 4RKQA 2VJMA 3SI7A 2N9UA 1HLPA 4X71A 4O4HA 3RG8A 4OGLA 1UINA 1QIEA 3AF4A 2FXIA 3R5KA 2PZBA 1MG0A 4HY3A 2RIRA 3RVRA 5DI3B 5IDQA 2AXQA 5FUBA 4X1KA 2H1CA 1X1RA 3LL4A 3AP1A 3EIWA 3QLUC 4UAJA 3OM8A 3SIPA 2GCGA 2ZRQA 5EQJB 4RXMA 1Y48E 4DLPA 3W7VA 1APBA 2KPOA 1U2RA 4ABTA 1XVTA 2YWDA 1W73A 1GTG1 1YNOA 2O57A 5D3KA 4ZD6A 1PJCA 1FQJA 3CR3C 1GAWA 1XC7A 2PZGA 3KALA 4XB2A 2YDYA 5I3CA 4UHJA 4WRRA 2NSJA 3L7NA 4MVWA 4PZ0A 1K5HA 3WB0A 4PO1A 4OLJA 2P2SA 2XOKD 4G0YA 1L5RA 4HDSA 1WUJS 4BMDA 3RYCA 4ATNA 1SCIA 3C6KA 4IR7A 4OP1A 3AONB 3AGQA 3BK2A 1N2HA 3AQ4A 1HE1C 1RPTA 2OHFA 4J0IA 3G0BA 3ZCRA 2OBLA 1BIFA 1ODLA 4JSRA 3U4HA 5FBQB 3WL8A 3AB7A 1N7HA 2ZCUA 3IR6A 1IY1A 4HAUA 4NDZA 1C9MA 5EKXA 3TQQA 3MGAA 2BEJA 4ZOBA 4MROA 1AKUA 3HL4A 2OK8A 3P2OA 1BMFD 1K8XB 4UBMA 4FMCB 2I1VB 2E6UX 3OZSA 1RIFA 2WSBA 4AI6A 1NYTA 3EXG2 4JQSA 5AW3A 3DDHA 2ABWA 4NONA 4DVGA 4J0DA 2WJJA 1F17A 4I0WB 3JQ9A 4UZEA 1UPBA 1E1QD 5GOZA 1C3EA 1JKJA 2HLPA 1C4OA 3AC0A 3D3WB 3LYUA 2OCDA 3PE4A 2GEJA 1HZZA 2OOSA 2VCHA 1T4MA 1OVMA 2H1VA 3JS5A 5ENZA 3RFUA 4GG1A 4C0HA 1E9FA 2P5UA 1X7DA 3LUKA 3DTTA 1Z34A 1K63A 4TGLA 3WV4A 5CHYA 5SY4A 3ZU3A 2POCA 5JYDA 1NVGA 1QCDA 5EHZA 4YECA 5IMSA 3AERB 1KA9H 1U28A 3IAM1 1ULZA 2H2AA 3LVRE 1X8LA 1UBGA 3BJMA 3JZDA 1TMGE 4AD8A 4IP0A 1FP2A 1U2EA 1ZN8A 4WVFA 5IBPA 3A2MA 4K9KA 1KZ7B 3OJWA 3QVUA 4G56A 5F77A 4J0QA 1OYWA 1ZM4A 2JVIA 4EMSA 5BNZA 2ZIZA 1FQWA 3MPOA 4YMWA 3M3DA 5DHAA 1CULC 3IAS6 3HCWA 2FCRA 4RVCA 3CUYA 4LXIA 4UHBA 3WLKX 2CNOA 5EUMA 1SXJA 2JLCA 4K9RA 3UANA 3HJHA 1MDBA 3EXHA 2VR1A 2P3SA 3I0ZA 4LJYA 3EDYA 3ZDCA 3CSSA 2ONZA 2IZ5A 2YMLA 3EISA 3SLKA 1KEKA 1L4YA 1E79D 2WWFA 4NRDA 1ZU4A 4HQFA 4RANA 4IRXA 5LFAA 1E5TA 1M74A 1RTTA 4MS1B 4NZYA 2SKCA 2AFVA 3O26A 2OV6A 4Q4JB 5A05A 1E1RA 2Z43A 3D4BA 3MYYA 3R3YA 4BGEA 2Q0HA 3QI2A 4PSDA 4A6PA 3NKVA 1KHHA 3ORFA 2IDZA 2GWHA 3TAUA 2VF4X 3WADA 4WHMA 3WFZA 4FGKA 4CM8B 4YUZA 5CXXA 3R20A 1HKUA 2CXPA 3HGMA 1RXVA 3NHLA 2P4EA 1LVHA 3AH8A 2J9FB 3NHSA 3BA6A 1GFSA 2B1IA 3GMTA 4N01A 1OY1A 3BH7A 4GZ6A 5K6RA 5ALHA 5IJ0B 3LY9A 2VSQA 4HVTA 1J1ZA 2GLTA 3PP8A 4J0JA 1X77A 2GVZC 2YZGA 2O19A 1U9IC 2QDKA 2ZB8A 3WYDA 3AHIA 1E1CA 1WXFA 3SPXA 4LVCA 4YAOA 1EZ1A 1V1JA 2VP9A 3AOEC 1BFDA 2SCUA 3RAEC 2AVDA 3X1YA 1SU4A 2XZPA 1YKFA 4ZZ2A 3QPCA 2GZ1A 4I36A 4LOJA 5DHFA 4PZ9A 2AVNA 2CZCA 2E7ZA 2D1YA 1GZ5A 2MHCA 3G9QA 3V1NA 3QX9A 1A9PA 2HLHA 5BV1A 3AI2A 4DR2B 1RW4A 4IWXA 3T9BA 5ED0A 1RWBA 2R87A 4ZU1X 3T5BA 1J00A 1SHUX 1QJ4A 1C3VA 2O6HA 1DOAA 4MWDA 4GM0A 1GNTA 1PZFA 2O5VA 1QKKA 5H3LA 3RVQA 4MRAA 4B7UA 1V71A 2HV8A 1UPCA 5DP2A 4ZEVA 2G07A 3A1WA 3AINA 1O1YA 4MIOA 5EXTA 3BILA 2OEPA 4BLTA 2CNBA 4G4GA 5GONF 4KAAA 4OHZA 4LJ4A 3SSOA 3IE0A 3AILA 3N53A 3B20A 5KNCD 1ICEA 1M1UA 4IKEA 1B8NA 1TNDA 3L8HA 5F9MA 4D3XA 3Q3EA 2OHXA 3JWJA 1ZM9A 4IGKA 1M1YB 1MHPA 5KC8A 2F9LA 1F8UA 1WL8A 1SOWA 4LWPA 4GF5A 4AQDA 5KZMB 3DVRX 3PVCA 1NBAA 1U9ZA 2MSCB 4EY3A 4KLNA 3NS7A 4Z5XA 3KSRA 3EFOA 1J8FA 4LYAA 1UFKA 4MLCA 3DBRB 3HNOA 3BWVA 4AZ3A 2IIQA 1KETA 3OFKA 1KEUA 4KTTE 4PBRA 1UPXA 5FLXA 1USVA 2EKQA 2B7BA 2RAUA 2V6MA 3GP5A 1GGMA 4MR9B 1EGMB 4P92A 4B9AA 4E70A 4DDWA 3U16A 1GRQA 1ND5A 2RGAA 5E4TA 5I4BA 1P5HA 3LA8A 5CFLA 4J94A 3B1WA 1E5XA 3GRAA 1NBEA 2PGIA 4KZPA 2D4HA 2QNBA 5HK9A 2ZPTX 3DONA 3HRHA 3M5CA 1X1QA 4IMIB 3PCTA 4M1TA 3G89A 2O2DA 4ZAXA 2CDRA 4QXAA 2BR3A 1I2MA 3D31A 2ZTSA 1I9GA 3AERA 4TYWA 3NAQA 5CCXA 2E85A 1NX6A 3VYSB 1ZNQO 3R77A 1JXAA 2AI2A 4MRPA 5EIWA 1YE5A 3JQGA 1MO6A 1NBMA 2GBGA 2TS1A 1UP6A 3RV3A 2IYOA 4BFLA 2FA9A 1J22A 3F73A 2PT7A 1PG5A 3HJBA 1UDAA 4ZICA 1YQEA 2BGRA 3T1OA 3A1UA 1OSNA 1Y6JA 1ZGJA 4NEGA 2YY6A 1YHNA 1CR2A 3T0GA 2YOFA 4P0PB 1FP7A 2DULA 1F6WA 3LQ1A 3F9RA 3OMWA 3K5WA 4JENA 3EXHB 5HHTA 5JATA 4CMBA 1A95A 5J23A 4QAJA 2Y99A 1EVQA 4KMSA 3F90A 1WU7A 1KYWA 4EZEA 3V3TA 4D43A 1PYOA 3TN7A 2C7OA 3KC2A 1VFPA 1Y1SA 1Z47A 4P35A 1LCIA 1OFVA 3NBQA 2XBMA 3MJSA 1OTXA 2GTIA 2R11A 4DKJA 2I67A 1O97D 1ZMRA 3KV1A 5BWBA 1FA9A 4WX2B 3I39X 1KNQA 1QC5B 1FTGA 2NSLA 3CZCA 3GQBA 2XH8A 1XEWX 3ESZA 3FFBA 3LPNA 1L4EA 4ML3A 3CLSD 4Q9LA 3T9AA 4EJ6A 3KXKA 3H13A 1TU0A 5TGZA 3R7BA 1Q0UA 1QGUB 2WSMA 2Y92A 1P1IA 4CKCA 4WJKB 1K0UA 3WIDA 1KC3A 5F23A 4JYZA 3TM5A 3MG9A 3U3MA 2BMJA 2R7LA 2ZVJA 5EGNA 1P1RA 1QHNA 4BVEA 1USKA 4O2AB 4UNQA 1KZGB 1FMFA 3HXPA 4K7JA 4R54A 3G7UA 5KTMA 4R1TA 1BFUA 3D1JA 1PLLA 3WIUA 4D45A 3K2EA 2B4KA 2FQ1A 3ILVA 3JAWB 2BMFA 4IX9A 4KWCA 3ZNOA 5KREA 3TVDA 2BDEA 2W11A 1UXHA 5CEJA 3QWHA 1TA0A 5ECGC 4HSGA 2GPAA 2W2KB 3PUZA 3TRDA 4RS4A 5AM4A 4DYHA 3GG2A 4GXQA 3PYMA 5CUQA 4MEJA 1AK2A 1PZEA 3U3JA 2AHRA 4G4JA 1Q14A 1RYDA 4B7AA 1H1TA 2O2HA 3GLSA 3L8EA 4E5UA 3UWSA 1CHDA 3U9TA 2H85A 1CNMA 3KVOA 2HEIA 5I6DA 3VTZA 5A4AA 5ICEA 8ADHA 4JP3A 1QKJA 3ISTA 1AQNA 4HK4A 4QIHA 3GLTA 3RHSA 1R4ZA 4A8JA 5CAEA 3GGGA 2F55A 4RIHA 3LQFA 1QYWA 2JLZA 3VOSA 2QORA 1FK8A 1U2GA 2AOTB 2DQSA 2WWXA 4V0RA 2IYNA 1Z5NA 2VDKB 3FOAA 3WLRA 4UM9B 2N3ZA 2HA0A 3NKLA 3UV3A 5JS8A 2IEIA 3I1FA 3O95A 4TTPA 2ZWPA 1UZLA 1RJ9B 3LXXA 2NYRA 3VSEA 1KI6B 3TECE 1JG4A 4MUBA 1MP0A 4GYJA 1TTHA 3I2YX 1AXEA 3ZE9A 3HNPA 3O6VA 4PQYA 5DI3A 2JL1A 1FBNA 3NATA 4WV3A 5KSOA 1S8AA 4CM9A 1R6DA 2X76A 4EVIA 1EP2B 1AZLA 1J23A 3GF4A 1L4FA 1OQAA 1DTSA 1II9A 1OU0A 3FKJA 4QLAA 1ZC3A 2I7XA 2FQWA 2LKCA 4JYBA 1WB4A 5SYMA 3ZS9A 1FFXA 4G37A 5E9WA 1KZ6A 5CCBA 1O0BA 1XZEA 2YNMD 4PGMA 3WMGA 3W8FA 3WWZA 5JEEA 1UKCA 2O8CB 1K4KA 2OV3A 2YWJA 3QYJA 4RPLA 1THMA 4PG7A 2GNAA 5TMDA 5DSTA 3GA7A 1YZYA 8LDHA 2BL4A 4I1VA 5ELXA 2AYZA 3BIXA 2HSWA 4FD3A 2QGNA 3UOWA 1KHTA 1I36A 2OC4A 5DGTA 2BFNA 2ZDQA 4U9UA 3NTXA 3QNMA 4PQEA 4XPIA 4I9NA 3SSAA 4X3CA 2YYYA 1LJLA 3ENKA 3RYIA 4G5HA 5LLSA 2C5BA 5KHAA 2OG2A 3K9CA 5G2OA 3OWHA 3K8ZA 3WNDA 4EKEA 4R2LA 2OQVA 2GPYA 3H87A 4WNYA 1ZMBA 3GLGA 1OAOC 4I3FA 2CJFA 3IQGX 3PLAE 3Q12A 3K1AA 4A27A 1OF1A 4B7ZA 4D3ZA 1EVZA 3JASA 4L1KA 5KYKA 4QELA 2OLJA 2NACA 1B42A 1BRTA 4MKIA 4D2IA 2DLDA 2C4MA 5B4UA 3D6FA 4FR5A 2BMVA 3MUNA 1TCBA 4NV0A 4LHWA 3AG6A 5DGHA 4BEVA 4C6SA 5JBQA 3ZE7A 1U0JA 4R2IA 2HT1A 1AN0A 1MQAA 3PPWA 5E2BA 3P2KA 2QB5A 3I3SR 3SHQA 1X13A 1T2AA 2Y66A 3KD2A 4FLFA 5JSUA 3SDBA 5CRIA 2V9ZA 3GGJA 1BWPA 1SBYA 1JHOA 4N9QA 3WB9A 4G9GA 4PRZA 3HP4A 4XWKA 1IPFA 2Y1WA 5BNTA 1IMJA 3C98A 2AB0A 4IHKA 3AL0C 3STUA 1G18A 1LK5A 1VPTA 4OH1A 4WCFC 1VLMA 1PFQA 3IOCA 3PXBA 1LPMA 1Q74A 1VI2A 4NAVA 3RT7A 1VPWA 2H31A 3PFGA 4IJVA 4WXPA 4B4WA 2C9BA 1JU4A 2OZEA 1GGEA 4RA6A 1H4TA 4DV1B 1YDGA 1E9DA 2BGKA 3DOOA 3GFVA 4M38A 1Z6QA 4Y1GA 3BAZA 1X9IA 1ZX1A 2OHJA 2VUHB 2FSVC 3STVA 3D8SA 4BQFA 1GUBA 4CFZA 3FSEA 5PNTA 3K0KA 3LQYA 4OATA 3C3KA 4OJNA 4QPDA 3DNFA 1T9GR 1Y80A 1VFNA 4WK4B 3F0TA 3HNRA 1I0ZA 2RB5A 4O4IA 1VIYA 1Q11A 5E0OA 1T4DA 4OU5A 4FNOA 2EYQA 2DH5A 2H0RA 2QMHA 4J7CA 4ZMBA 3THRA 4FYKA 3AVYA 1VYHA 4BB6A 1TW3A 5CLHA 3QHPA 5C53B 1TQ4A 2VG8A 3K70B 1AG9A 2Y1XA 3O8CA 2WZQA 2P30A 1QV7A 5HUJA 4OY3A 2O4UX 3HU5A 4RTMA 3TRKA 4FXPA 4ZKEA 2WUFA 1QIFA 1CZUA 2XE8A 4X8OA 4OP3A 5JSFA 1S1MA 3KTOA 1WXHA 2IBTA 3AEXA 2QL6A 4W82A 4X1YB 5ITWA 2N42A 1J2UA 2PGAA 3L6RA 4XX0A 2NU9B 3IILA 2BR5A 1ODIA 3C3WA 1RI3A 3WBKA 5HW0A 1WEKA 3ASUA 3LVFO 1RI4A 3SZUA 2Y1DA 1KEWA 1CQZA 3IVCA 1OWLA 3GFRA 1V3UA 4M8NE 1XLWA 1T6XA 3HY3A 4QPCA 1GYRA 1R6AA 5DK4A 4Q4LA 1DEXA 1HT2E 1RLMA 2YV5A 3OJEA 1FTQA 3TRFA 1RIIA 4OM7A 1U5CA 1JEEA 5IAGA 2IHVA 3WLEA 3QPUA 4BKMA 1IN1A 5AM2A 5BRNA 1UXJA 2Q1YA 3MIZA 4DIEA 3M6UA 3U9SA 2J6HA 2Y68A 5BUQA 2GAAA 1U3WA 3OFVA 1TMKA 3C39A 4J9UE 2O8BB 1ZUNB 4IIJB 2V0NA 1SU8A 2O3JA 1H1DA 1Z8FA 4RHEA 2ZETA 3C1OA 4G0XA 3QTTA 4R5HA 4CCAA 5AW0A 2DX7A 1V8BA 5HCUA 4PGHA 2NTNA 4HRYA 4DJFC 5AW1A 2ZXUA 3ZK9A 5DDIP 4F60A 1SC1A 4J7XA 3CRVA 3ESBA 1TO1E 2BUAA 5PGMA 1V5GA 5BSVA 5JNLA 1CD5A 2FR8A 4KACA 4YY3B 1OXVA 5E6UB 3RUAA 1NR7A 4YAUA 1HK7A 4PWYA 3RS4A 2H63A 4L5AA 1WP4A 3RK0A 2OV4A 3MTEA 4R7GA 4OK5A 3S2GA 1YS7A 5EMHA 5GP1A 2V9CA 3DXYA 1KO1A 2CW5A 4CE6A 4EJMA 2F6RA 2IE8A 3K1YA 4G36A 2DG2A 3AHHA 3V48A 3KPJA 3ETEA 3NTVA 4DM3A 4Z0NA 1WUIS 1JH8A 5HM8A 4ARIA 1KIFA 4UM9D 1RCUA 4PNPA 3GG9A 3ADPA 3KXIA 1RHQA 2P5YA 4IJ5A 4J0FA 3WGKA 2O1XA 3DMHA 4DV5B 3GPIA 4LDJA 4MVJM 4RZQA 3K0CC 3P9KA 4GGMX 4Y30A 2REXB 5EIOA 3RFXA 3ZTTA 2F4NA 4Z7OB 4LX8A 3OUTA 1UJ5A 2R8RA 3EQ6A 5ECDA 3VDNB 4TYYA 3TF5A 1DDIA 3EWIA 1P1BA 4B47A 3CC8A 5JCJA 4L22A 2OBBA 3DL2A 2G9UA 3GUYA 4C5BA 1WM1A 1KRHA 1TW2A 2IHKA 2ZR7A 3AR2A 3T5MA 4CZ2A 4EY4A 4KQ6A 5K3FB 2HU5A 1AGYA 3G49A 1SXQA 3H8JA 1MX9A 1SPXA 1USWA 1SR8A 3EY9A 3VSDA 1NQUA 1GZSA 4WACA 1I7PA 1I1QB 1JG2A 4N76A 4DA4A 1P73A 3IAS1 6Q21A 1T5OA 3IIKA 1GV1A 1WD5A 1AIPA 1FMLA 1YUMA 1Z74A 3MTQA 4BMCA 3JR7A 2RSLA 5JE8A 4IVPA 2J41A 3SQMA 1V9CA 2NU8B 4ENWA 1DQSA 1WLSA 3BMNA 4M99A 3ZH9B 3X1JA 1SCJA 1U7HA 1FQKA 2ZB7A 3ZWKA 4I4TB 2FDRA 2VCEA 2PKQO 2X8JB 3C4VA 4QPZA 4C2TA 2DLCX 2WD8A 3DLTA 4Q19A 4DR4B 2FZEA 1I6WA 4AB1A 4QSMA 4I4IA 3AUUA 5G41A 1DC8A 2R47A 3IH5A 4WKOA 4ZXPA 4AJKA 1DAHA 2ZI3A 2QRLA 5AI8A 2PWAA 3QVVA 4Q02A 2PKQP 5FFMA 3QKRA 1AMNA 2BGGA 1JMVA 1Y1QA 1YVUA 2NTEA 3L4EA 2IUUA 3FPGA 3VKWA 2C9MA 2DXIA 1T8RA 3W79A 1UBLS 4RW0A 3GLIE 1B26A 5I7AA 1EK6A 1OV4A 4CLHA 2JIBA 1MXFA 4M7RA 2VK8A 4E4YA 3DLHA 4CCYB 3NT2A 4KX3A 4B8YA 2DPHA 1HL7A 1ZNZA 5EKSA 1W30A 3O1HB 4OBXA 1BRMA 3AUXA 1JTFA 1A0OA 1BQ4A 4PG8A 3HH8A 1SEVA 2CHEA 2R6ZA 4JLBA 1SNYA 3KSDO 4KI0A 1EX6A 1B7GO 3E1KA 5HILA 3FYHA 4DQKA 3B38A 1T0PA 5TMEA 2HEGA 4AZ3B 1GPKA 2BGNA 4NR0A 1U7XA 2X77A 2EVWX 2HRDA 3KZVA 1P6UA 4MR8B 4CT4B 1A2OA 1VKHA 2OV8A 2AW5A 2JW5A 1VSQA 3NP9A 4GR4A 3SYNA 5BVGA 3ZBPA 1SCBA 3PGMA 3TOXA 1BGXT 2GA9A 1XU9A 1JHAA 1W47A 3FDFA 4KWHA 3FDZB 1DJLA 1PFWA 3I92A 3P8ZA 4OYRA 2A78A 1Q3HA 3QBDA 4H7FA 2QRJA 2YVLA 5KVCA 4UDXX 4MS3A 3LLVA 2QTBA 3O8DA 2PEYA 3T5DA 1L7XA 5CM8B 1NSFA 4TQUS 1M6HA 4AZSA 5JT1A 2VDJA 3P9SA 4YRAA 3D7RA 5BV7A 2QVLA 3HCRA 3N2GA 2W2LD 2JJYA 2ERXA 4YJ3F 1KP9A 5HKOA 1UBOS 3V8NA 5IDYA 4RH1A 5B1DA 4RXUA 2ZVDA 4E14A 1WOMA 2C2YA 1Q83A 3RRBA 1L9KA 2W8BA 3KETA 1OHHA 2HWWA 3BTVA 1NE2A 2JFHA 1BKYA 3E7PA 3CSDA 4BKOA 4AF8A 5K5EA 3KSAC 3ODGA 1Y4ZA 1N1EA 1LDGA 2ZWMA 2CMHA 5FWNA 4LNUB 2HK7A 2I55A 1H0RA 1ODFA 2JH3A 2FEXA 2O2CA 4CQNA 2JAQA 2VTBA 2ZZMA 2Z30A 5I9IA 4ALIA 3BE6A 2CUKA 1NE7A 1T9DA 1XR3A 5E4FA 3AEUA 4BV9A 4HLUA 2GHTA 2JKZA 4E11A 2ZUTA 1U94A 3TDKA 2QX9A 1FBTA 3P0EA 1AH2A 3BRWD 1LDMA 5M7EA 1UJ4A 4QGSA 2Y1OA 4GQBA 3NR2A 3O1IC 2R48A 2OHOA 1TKCA 3AJRA 2JAUA 3KEMA 4FSDA 4BMZA 4CM9D 3LZCA 5CA0F 1AO0A 1E2LA 1IJFA 1UBTS 2Q5QA 2PYIA 4KQGA 2C9DA 3JQAB 2QRVB 3CM0A 4WXYB 2ODPA 1XJQA 2RH5A 4BUCA 4YJDA 1Z56C 1DRJA 1UMDB 3MWDB 4LE0A 3S2YA 3S1SA 3KQTA 4GVLA 4PHHA 3VI4B 1H6CA 2BGTA 3F78A 1MH9A 3OLQA 4ME6A 3H6KA 3K6KA 3MLBA 1HLDA 2A1UA 3I2IA 1NV8A 1O5TA 3BFXA 2VYQA 3ABOB 3MIIA 5DCWA 1ARZA 1DAPA 1KZ1A 1VA5A 3PJDA 1VIMA 2QW8A 4J9VA 1KFEB 1C80A 4C3VA 1QH1B 3UC5A 4TMXA 1YVPA 3LG2A 3DHWC 1RTKA 5IZ4A 1QOQB 1K4YA 5I8ZA 3QIVA 1TVEA 3UPTA 4UOZA 1EFUA 4MUMA 5I4IA 3A7DA 1QUEA 1Y5LA 4AO7A 4XWGA 4JI6B 3DW3X 5BWOA 4HGNA 1OD6A 1ODJA 2O8DB 3P2JA 3GROA 5C3UA 4EELA 2ZLBA 2PSHA 3K0SA 2QR3A 3SX0A 2GF0A 4HGZA 2RG1A 3EMDA 3SMVA 2ERYA 3W7BA 1XRRA 3IBGA 1QYRA 1RM5A 4K9OA 1WCWA 2N46A 1MOSA 3AP2A 4PQGA 4X6YA 3ROMA 5DISB 3DV9A 3CPSA 2BFMA 1RMQA 1RC0A 2HNAA 3I1IA 2BUCA 4G86A 1SBCA 2FLWA 3JYQA 1GG8A 1KDRA 3ZI0A 4BHTA 4Y6LA 5JH7B 5KINB 4E5MA 4CMEC 3AIKA 3EGDA 5DYGA 2AEEA 3OZXA 3U19A 2Q9BA 1NDQA 1YZFA 3QE4A 4DILA 2I2FA 3HR7A 4DNOA 1BYIA 4BFVA 1MC8A 3MJ4A 3IVRA 4BX9A 5CLIA 1AHHA 2NU7B 5A1JA 1FJ2A 3H05A 5GVSA 2J87A 5ALOA 1U0BB 1WO8A 4UNPA 5ICGA 3WG9A 3DDNA 3GVHA 2VSOA 4M7PA 2RC5A 3TLGA 4LGVA 4LXUA 1G7CA 1Z4PX 2IBMA 4KUEA 2QJWA 2VT6A 2ZB4A 1VLLA 3HSKA 3U81A 5CEEA 1CETA 1L4LA 4UEOA 1H2HA 1L5ZA 1ZL0A 3S2IA 4O4IF 2I4IA 2J30A 4RJJA 1SG6A 1AZSC 1V11B 4ETMA 2PUEA 2QD4A 1S3GA 4IOLA 3SQOA 5GM2A 5BUSA 4QLOA 5CLJA 5JADA 3GLKA 2QTAA 2X15A 1XMPA 3GRRA 2C83A 1KGSA 3ZX5A 3A05A 4HS9A 5TQJA 1XKTA 2IYRA 4H31A 2ZRNA 3IQEA 4Q3BA 3NDPA 4FYWA 5CPFA 3F3SA 5CB4F 3SJUA 4DMLA 2ZBUA 5H4GA 2EZ8A 1BWSA 4N1AA 4ZI7A 3FGPA 3EFBA 4O3MA 4PFKA 3OQ6A 1NW4A 2XVYA 5T6MA 2IDJA 4M0EA 4DSUA 4L3OA 4YDRA 5K3DA 4D9CA 1O58A 2YXLA 3EGVA 4KHPB 3L1UA 3CY6A 4NH0A 5BYJA 1PFGA 2QLNA 3TINA 4ZPJA 2XKKA 1IZZA 1SCUB 3AL3A 5AUOB 1VB3A 2QZ9A 1PJLA 3KM0A 5CDGA 8AT1A 3TFOA 4IIXA 2GN9A 5CD9A 4GU5A 2BC9A 2FAXA 2ZSIA 3VTKA 2AI1A 5FUMA 1P2TA 4UMVA 4LOLA 1DG9A 3HR8A 5DNWA 5U4QA 4BCBA 5DNYB 3HP7A 2HQRA 4TT3A 3MT9A 1SCKA 2Q3JA