2XD9A

Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-4,6,7-trihydroxy-2-((e)-prop-1- enyl)-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
153
Chain Sequence
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Tetrahydrobenzothiophene derivatives: conformationally restricted inhibitors of type II dehydroquinase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 55
structure length 153
sequence length 153
chains with identical sequence B, C
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2xd9A00
4KI7A 2C57A 4CKWB 3N8NA 2WKSA 4B6SA 5WRFA 4CKWA 1GU1A 2BT4A 3N7AA 4CIWA 4CIYA 2XD9A 4CKYA 1J2YA 1GU0A 4RC9A 2Y76A 1H05A 5B6PA 4L8LA 1H0RA 2Y71A 2XDAA 3N87A 4B6PA 4CIVA 2CJFA 1D0IA 4CL0A 3U80A 1GQOA 3KIPA 4KIWA 3LWZA 3N8KA 1GTZA 2UYGA 4V0SA 2C4VA 1V1JA 4B6QA 4KIUA 4ZC1A 4CIXA 3N59A 1UQRA 2C4WA 3N86A 4RHCA 4B6OA 2XB8A 4B6RA 4CKZA 4CKXA 2Y77A 1H0SA 4KIJA 2XB9A 2DHQA 3N76A
chains in the Genus database with same CATH superfamily
5DULA 2ZKIA 1XJCA 1NY6A 3LCRA 3PUXA 1DUIA 3IP7A 3TJMA 4CNBA 5BO5A 1HG0A 1V6SA 2ENUA 3OTHA 3SDSA 3FDJA 2A9JA 3GP5A 5JCJA 3RYIB 2LRHA 4CL3A 3AHHA 3N2ZB 2P3OA 4OA5A 4KU4A 5L3VA 1K7FB 2DR3A 2W2KA 4HYEA 2J3DA 1J90A 1EVKA 4TLCA 2XXJA 1DMRA 3SDZA 3JQGA 4ALKA 5JQGA 4MRRA 3D64A 4ZVOA 3PF9A 2AN9A 1Q7BA 1XR3A 4EVIA 1JG6A 4DT1B 1FE8A 3V1YA 2VUSA 3TDMA 1B7GO 1PUXA 2FEAA 2QN3A 4G4GA 4AECA 4GZMA 2F8TA 3QMMA 4Q16A 2D1YA 4S1VA 1KEUA 4MS4B 1SQGA 4PTYA 3PYXA 4YIHA 2XYPA 4BRZA 4JIMA 4G5FA 2RHOA 3OFVA 5B1SA 1JDSA 1E1YA 5DHFA 3MTQA 1P9NA 3UKDA 4AZVA 1DFGA 4MUFA 4XCVA 1KGDA 3OKAA 4Q1CA 3VKFA 4K88A 3IUMA 3T95A 4AN1A 2G3YA 1JAXA 4YDSA 3WICA 4D82A 2LNDA 3Q7SA 1DBRA 1XTIA 3F8SA 4IS2A 4F2WA 4S05A 4HDQB 4R51A 1RYZA 1WKBA 2WLSA 2ZYAA 3BILA 1R4NB 3NHUA 1E0DA 4L4ZA 3S7ZA 3OWHA 3MLAA 1IHPA 3PQ3A 5IW8A 5LXTA 4B3TB 3PEEA 3E23A 2VFAA 2WIFA 2G67A 4UDNA 1B8PA 1SCIA 1D9XA 3R3VA 2QR3A 1UBMS 4JWKA 1QYVA 1GPH1 1JVSA 4ZD6A 5IYZA 3SQXA 4R2WA 3DV9A 5A2QA 5EHNA 4P4UA 1X0XA 3R0VA 3HZHA 1XRNA 4TSRA 1T9CA 4D6XA 2NMVA 2AHRA 1KI9A 1F6DA 1XAIA 4FZ5A 2DGDA 2V65A 4I5FA 2ZCUA 5DCWA 3SLKA 5FRDA 3KL2A 7GPBA 3Q12A 1KBQA 3IAEA 3IPAA 1P8AA 3O1LA 4MUAA 5ER6A 3O0TA 2CHVA 2O3SA 3F7TA 4QG3A 3IQDB 2JGFA 4WV3A 3S1LA 4D8VA 4AY5A 2O8FB 4KIFA 4PAOA 4FE7A 2D0IA 4EVRA 5FUWA 1N0WA 5F77A 2RIRA 3CNHA 2FEPA 2ATEA 1X70A 2UKDA 3R5FA 4I9HA 4BMDA 1FRQA 1PDOA 3VKGA 5DV9A 3GC6A 3QIAA 2WP0A 2PS1A 1BWSA 3DFZA 2ICAA 2H7CA 4J2TA 5THXA 4BP1A 3D54D 1YAJA 5CXUA 3AEYA 2UXBB 4IXDA 2HF8A 3HKBB 3RYIA 2Y1WA 1H4VB 5D3MB 3OOHA 1Z5OA 4UNPA 4UU0A 5B64A 5KC9A 1SVUA 3ABQB 3G3EA 2J59A 1HETA 1NRIA 1RC1A 4KVZA 5CR9A 3W5IA 1IQRA 2C9BA 2V6GA 4AL4A 4S1NA 1VCMA 1VE6A 4B35A 3QQ5A 3N8DA 2NZXA 3MBKA 4BMOB 3GLIB 2GX6A 1NUAA 2YZGA 3MBIA 4DT1A 3HYCA 2EC5A 1JR4A 3FPFA 4GYWA 5FD8A 5FQOA 3LBFA 1IUNA 5ECWA 4DWVA 2J9FB 4MQLA 5EZ6B 1Z83A 2JAUA 4MS4A 4TV8F 3SBXA 3TUJC 5KZMB 2VWHA 2ZS8A 4DMKA 4R8LA 2JCYA 2X5OA 1Q7EA 2IP1A 3NHYA 2DLNA 5JWRA 1UXJA 2IXEA 2XWQA 1O5OA 3A3KA 3ROPA 2GEBA 4OYLA 4A8JB 4BE9A 8OHMA 3FIUA 1D0SA 3RVLA 5B5SA 5I6DA 3AKZA 4URWR 3FYCA 3NQ41 1LI5A 3GLUA 2UZ0A 4QYTA 4TWBA 3ZTTA 1KHHA 2IX3A 2P4QA 2ID8A 3HP1A 5ADVA 2EW8A 2H17A 3TCXB 4D56A 4R9SA 3LT5A 3PF8A 1K8XB 3PK0A 1PWZA 2KBEA 1IL0A 3L79A 1R4NA 5K2MA 3WLKX 2QYOA 3GN1A 3ZCQA 1RPNA 3KWLA 4YTEA 4G1UC 1POXA 4HPWA 3LX8A 1YZTA 3EUWA 4JVLA 5GADl 3WGMA 3H8JA 3PC2A 3BK7A 2UZIR 2C2GA 3FNQA 3PJGA 4EW3A 1WUIS 4JUDX 1WTCA 4DJ5X 4OSEA 2ZEJA 3OHSX 4AY4A 1U02A 1ENYA 1E9VA 2Y0BA 1H2YA 4OLBA 2NO4A 4P34A 1VOTA 4AMBA 3KLBA 3ROKA 2BSQA 3Q0TA 4ZVPA 2GLXA 3C6XA 2OQIA 4O2LA 2PV7A 4WVLA 1QQTA 1UOOA 4RQBA 1GU7A 2Q6LA 1QUFA 4ISCA 2AC2A 3WS7A 4BZZA 2CSXA 1YVPA 2AYZA 1QH9A 4NP6A 3A1CA 3NJ8A 4BAGA 2VA9A 1PFVA 2Q5FA 3EXHC 4P3XA 1FRFS 1OAAA 2YXEA 3CIFA 2JZOA 2YMQA 3OZFA 4CT4B 1U0HC 1XJ0A 2XZDA 2ZPAA 3UAZA 1CB7A 4OFZA 1YRHA 2TECE 1W5BA 5JC1A 3IO5A 4RD3A 1UDBA 2D1SA 5H68A 3HKBA 4Y2XA 1HOTA 1VJ1A 2XUJA 2XHEA 2ZU0C 4TM8A 3ZGXA 4GUAA 4EG3A 1PNTA 3M6MD 1AG9A 3C8ZA 4GECA 1Q22A 1F60A 1USKA 1XAJA 3KK0A 3SF0A 3S70A 3RROA 4CU5A 2ZWIA 1YS7A 3DOCA 4FD3A 4EGAA 1FEZA 1VC2A 3GLTA 4QEKA 4IOJA 2IEAA 1P4HA 2JAOA 2RG1A 2Q3DA 3QM1A 1WEKA 1XRQA 2O0LA 1BHQ1 2P2LA 1EYZA 2MMCA 2WTXA 4JJIA 4MPJA 1YL5A 1U4OA 1PYDA 2X0NA 3COSA 4FLEA 4QE3A 5JSKA 1BMFD 1GDDA 3RUCA 3Q8KA 1HXHA 2YXNA 1JXQA 2J9FA 2IE8A 2ONZA 3ENVA 3DHEA 2PH1A 4RJIA 5EMMA 1IYZA 5IBQA 1J8DA 3K70B 3REQB 4G1VA 5KTRA 1Z2AA 5DTIA 4G0ZA 1OC4A 2IZ6A 2HQOA 4FLMA 4WCVA 1CZOA 4CT5A 5BV7A 3M89A 4A92A 1C8VB 2EL7A 3SIPA 3HJUA 4KLNA 2HUNA 3FB1A 1P77A 4B79A 2GPAA 3CWCA 3T12A 2RBKA 1PR4A 2QVCA 4Q39A 4C7KA 3HB7A 2QV0A 3HKDB 3LYHA 4WXPA 1D6NA 1UKEA 3UK0A 3VC2A 5DEIA 4Q3KA 3ZJ5A 1E3SA 4IUBS 4I1UA 2CUZA 1NJ8A 4LTNA 1KI4A 2ZRBA 3KSRA 1QE0A 2ZT6A 3L0SA 3LRTA 1S8FA 3P9KA 4J0KA 3QG1A 4GXRA 4P81A 2D5BA 3HV2A 1Y42X 3KXIA 4W9NA 3WGOA 4ZZ0A 4KWEA 1KVRA 3IMGA 1BAPA 2A1IA 1TJYA 3IDQA 5HKKD 1JDNA 3A04A 4KKXB 2WD7B 1ETUA 1OB2A 2W71A 3G8AA 4YGXB 3O8LA 4INOA 3EWAA 1VZ2A 2I65A 3TKLA 4CM4B 3FF1A 4KGDA 2D4HA 1GDHA 4RVFA 1BCSB 4DSOA 1L4MA 1C3LA 5AKIA 3U80A 5HUQA 5AI8A 2O59A 4PZ9A 1BD3A 3LKVA 4Q19A 4RS3A 1CY7A 1BDBA 4ESHA 1D2EA 5TLSA 1O0BA 1F9AA 1BU8A 4GGPA 1BYUA 2OGWA 5HFAA 2PMWB 1VMEA 3KJGA 4GD3Q 3TBKA 3D9QX 4MUEA 2I3BA 4QJ4A 4DRYA 4JCOA 2QMZA 2Q7XA 2WMYA 4UUOA 3D5TA 5LLSA 3L1VA 2Y4NA 3P9IA 2ZJ1A 2G70A 4NBTA 4YAIA 1SR8A 1UDXA 3A1DA 1J2YA 4NXMB 1OI4A 1X92A 2HRCA 5LVAA 1TT7A 4HQNA 4UUPA 2Q8QA 5F1KA 3X1WA 5ITZB 5KYTA 4JQOA 4MV5A 4TYWA 4UC0A 1YO6A 3SQOA 5KU1A 2F4VB 1SU7A 1VLMA 1T6NA 2VYNA 1O03A 3QMVA 1N3BA 1UMDB 4M8IA 5KWIA 4F72A 4LV5B 3W34A 4WLFA 5H3CA 1ZFNA 5CVVA 4XM0A 1JZSA 1OGIA 1TYAE 1G7TA 1ODTC 2OD9A 2WG0A 4KO1S 4PTLA 4Q1FA 4QVGA 4TN1A 5F4BA 2A35A 3LLUA 3GAAA 3KZOA 1FNCA 3RVJA 4U2KA 1U9ZA 1EE9A 2R4TA 4TQAA 4UCQA 2IPMA 1N4DA 4DEYA 1KC3A 1HYBA 1TEXA 1YMVA 3P4UA 1DXYA 4D9NA 3HK2A 5MGBA 4PSUA 5E3JA 2BT4A 2EF1A 3CKKA 2JBWA 3LX6A 4J2OA 4L8WB 5F7OA 1ILEA 4Y6LA 1G8YA 2Z4SA 3AKCA 5AKGA 1SXQA 5GIOE 3OE1A 3O38A 5HZGA 2DOKA 1A9PA 3H5LA 1IHXA 2PO7A 4UNIA 3RJ9A 2BJHA 3UAVA 4N7MA 2YUTA 4M22A 4UE3S 1D9ZA 2QXYA 3GU3A 4G5YA 5KKNB 4UVDA 1UKAA 1NT2A 2YNMA 1CX9B 1CQIB 5F1YA 621PA 3P20A 4IVPA 3RIHA 5AVQA 1LPSA 2IZ0A 3N2IA 2DERA 1OD6A 1US8B 3HKDA 3LSYA 1Z16A 3IRVA 4LJ4A 1VIDA 2XNKA 2C5EA 4MTLA 1GUZA 1U2DC 2KE5A 2ODBA 2RHHA 3TTUA 3ZGYA 2EWMA 2DBQA 3QE3A 4BQQA 4EVQA 1TRKA 3K9CA 2V7WA 1C0KA 3F71A 1UFOA 1YVEI 3ZLUA 5EOVA 1VKRA 1VG0B 2COKA 3PIIA 1N92A 4V0QA 4B6PA 2HX1A 3DE5X 3NHKA 3OC6A 2WD7A 3DVQX 3ODPA 3P2OA 1I2ZA 3SF8A 3ZWOA 4CM4A 5JZOA 1Z0FA 4KL8S 1PGPA 2Z95A 4G97A 4N03A 5IS2A 2BKUA 3E8SA 1IXSB 1DADA 3GWGA 1T9DA 2HKIA 1QVZA 3NT2A 4PCLA 4TOIA 1MGPA 4PQFA 4R8RA 3CRZA 2O5CA 3N8GA 4ZTBA 4BNIA 4KV7A 2AC7A 4DLNA 5K7SA 1T4CA 1B23P 4C08A 2XTNA 5BRAA 4KXWA 5B58T 2FU5C 3UQYS 5JWOA 1JA0A 3WC4A 3MEQA 3NM6B 1ZX1A 4L3OA 2Q7OE 4ZREA 3E58A 2VJMB 1FW8A 2B92A 3PWKA 3GVHA 1X39A 3M70A 3VISA 3U0BA 3GA7A 3GB9A 4FW9A 1FDUA 4OFBA 4X62B 2VTVA 4HJRA 4RMNA 1F51E 2AJLI 5AT1A 1FC0A 4ZEVA 3FNGA 2PXAA 3CJTA 1ECCA 1K4YA 1KSFX 2JGDB 1YRAA 2I2CA 2WFAA 3ETJA 1AUQA 2D2VA 4HQ6A 2GERA 3NBUA 5HKOA 3T3NA 1JIUA 4XQCA 5F12A 2IU0A 2QBYB 2RKBA 3LJKA 3U56A 5CLLA 2VLBA 2VHYA 1E3MA 3ZW8A 4MIYA 3KT8A 1KFBB 1FXWF 4FWIB 4JC5A 4QOEA 1RWXA 2WWIA 3Q11A 4WRRA 4YUXA 5AXBA 4RORA 1GCIA 4B5KA 3RYCB 3C8MA 1BA2A 3ZGZA 1RI4A 2W00A 4NECA 5K8VA 5AW1A 1IOZA 1EUCB 1X7ZB 4J03A 4O02B 4C22A 1J21A 3H3JA 3X1KA 3P8ZA 3MQ4A 2R84A 3JZFA 3EWSA 3I3OA 4DDWA 2ZT5A 4HDSB 1LJLA 2NW6A 2Z04A 4XEHA 3ZV7A 1SVWA 3E2IA 1F3LA 1CQIA 4N8DA 1N1GA 1OU4A 4YRAA 3CF0A 1TYZA 1RJFA 1AHNA 2PBRA 3MB8A 3R3JA 4JVNA 3TJZA 2BDUA 1OXXK 4YDHB 1GQRA 2LWIA 1E4EB 3HUFA 3SHWA 1US8A 3M2TA 2B20A 4IHQA 1MW8X 1GO2A 2E0IA 4TXMA 1J7JA 1XZDA 1P9RA 2WDZA 3BIWA 2C2YA 1MAVA 3GCDA 1U9YA 3R5KA 4P7BA 4PO8A 4C30A 3UHAA 5D5PA 4EPVA 4YCJA 2VPTA 1G3RA 4Z3KA 5JU6A 1KDYA 5T4HA 1QM5A 4HDKB 5K51A 3LY5A 2SICE 3QENA 4BAUA 1V8ZA 5B1EA 1KORA 1YR2A 3WGLA 3AZQA 2C7QA 4H7HA 2WB2A 1V8PA 2DCUA 1AUXA 3H2GA 3OLVA 3GPBA 3O2SB 3GH3A 2IE0A 2WT8A 2I7TA 3AVYA 2Q6VA 3I1JA 4E11A 3NM5A 2A59A 3OFND 4YLYA 3HA5A 4IFTA 2J6HA 3UYKA 2HRRA 2HW8A 2HBYA 1PN3A 4D92A 1GPNA 4DBZA 1H8HD 3IYLW 2ZZNA 1DJQA 4MQEA 2VN8A 2DFDA 1CUUA 1HT0A 2OM6A 1ACMA 3UICA 2YV4A 4OO3A 1MABB 3ZWVA 1C80A 1ZMOA 2FGKA 3GDHA 1BC5A 1HDEA 1LLDA 2D54A 5EJ4A 5LQMA 3EIQA 3AUAA 1H2ZA 1R4AA 4MRMB 3BH7A 4AWXA 1ZY2A 3NGMA 2XNHA 3HCOA 3QA3E 4FFVA 1CDEA 4MGYR 1G9TA 4EI8A 1U3GA 2QJTA 3FCSB 4MW5A 2ZR8A 1ZH6A 2VJMA 4LYYA 2YRXA 4MPPA 5IUNC 4WOJA 3H9EO 3HC7A 3VRHA 4JUFA 2PEZA 2F3RA 1JQKA 2OYSA 2FRDA 3QLVC 1EIZA 3HY3A 3X1ZA 1KP3A 1LPBB 1TM3E 1LNZA 1RQGA 3MAJA 3D6HA 3MJVA 5KHAA 4J7UA 2WRZA 3FJ1A 3QA9A 5BUCA 3OHPA 2X8LA 1RIIA 3E82A 2JGDA 5HIMA 3VSAA 1ZBDA 3T61A 1QK3A 1YMUA 2WHRA 3LGAA 4BPRA 1MOZA 4EVSA 2QBYA 1GQFA 2C97A 1ICEA 1C9DB 1QHEA 3ZIUA 1EVZA 1ZLXA 2PUFA 1E5QA 2ZYRA 4MUJA 4X00A 4EGCB 5AI4A 1G8SA 2YJ5A 5CNJA 1E4YA 3CLSD 3O3MB 4KQ9A 1CUWA 4Q9KA 1MAWA 1IXRC 1TGYA 2PT7A 3ZV4A 1IRIA 2XYQA 3RE1A 1NN5A 5JCPA 3RYCA 2AMJA 2IA5A 3B1YA 5KTNA 2HT1A 4B7ZA 1M8KA 5TPZD 1EUCA 1ECLA 1UJ5A 1V8OA 2O20A 3WLEA 2ONYA 1V71A 2A4MA 4PPYA 2CF5A 2G1AA 2H3HA 3FWYA 2B98A 2XBLA 2XSZA 4KGZA 4HDSA 2OM2A 4JOBA 3UGTA 2P6NA 2LW7A 1IOLA 4CCYB 2OO5A 4OJNA 1E7RA 3L05A 4V38A 5C8DA 2C3MA 2GPSA 2PLFA 4BV3A 5EESA 3R9WA 1FVFA 4FHDA 5D7NA 2PT6A 1I6LA 1E4EA 1P5HA 3KRTA 5CH5A 4ACBA 1HEUA 2XJ9A 2ZB2A 3KPWA 1R8JA 2GZ2A 3MRVA 4XGQA 3GLIE 1WW3A 1VLLA 3TLEA 3R5XA 1JI3A 1MHTA 4LJLA 4GE3A 1JIVA 2GUWA 1PF7E 1R0KA 2RH9B 3CPJB 3K0AB 3Q6NA 5JG7A 3C7KA 3WLFA 9ABPA 1R6AA 121PA 2G1UA 3EJWA 1WDKA 4AMUA 1ECJA 1N57A 2OVFA 4P7GA 1KO8A 2G36A 5ALFA 3OT5A 1IJKA 1XMVA 4Q3LA 4UXJA 3ESRA 4K6FA 1KMHA 3S2UA 2IIVA 2PH5A 4URVR 2WUDA 3D2LA 1XI2A 1G5PA 3EMKA 1UH5A 3QUCA 3FFBA 1WVIA 2YY7A 3ORSA 1WD5A 4TXHA 3ZH9B 4EITA 1COWD 2ZLBA 3RG8A 2A7XA 4KQIA 2F55A 5C8YB 1K5HA 4U7WA 1SUWA 2I62A 1XKXA 2X6QA 1P9WA 1X1CA 4IGKA 3HYLA 4ZCSA 7YASA 1ENOA 2LDXA 5TQ0B 1TF2A 3TGLA 1EXWA 1GYQA 1AKRA 3DL4A 3LIPA 4MRMA 2B4AA 1HQYE 1NTOA 4IIHA 4YECA 3N2LA 1QGED 3QVXA 4DPKA 5LQCA 4XIGS 3K5PA 1DX9A 3BWCA 3J80A 1H1TA 4ZTZB 3EFBA 4TTIA 4IHJB 2ZQYA 3VO8A 2JJ2A 1BOFA 2FN9A 4K6GA 3SXJA 5HE8A 3TR6A 2Z8XA 3A6LA 4DN6A 3CEJA 1O87A 3BCHA 3RC7A 1XQWA 2NT4A 3RSFA 3TQIA 4MWDA 2PR2A 2W6PA 3FNEA 2UVQA 1WL8A 3I37X 3UT0A 2X1MA 3GEMA 3OCYA 4U2EA 3T7KA 1R8QA 3EX7C 1RKQA 1RXUA 4UZEA 4CIDA 2XADA 1U8CB 1T5TA 3ONDA 4LQCA 2JLZA 3H16A 3I2JA 2X9VA 3C3YA 4U63A 4IZIA 3I8SA 3W5JA 4GMGA 1CLEA 4I9FA 1GTRA 5HS4A 4EHLA 2Q8PA 2Q4DA 2UZ4A 3HEAA 1AV6A 3EVDA 4H0FA 3ETDA 2Y0CA 3FX2A 2HCFA 3PQCA 2JFFA 5KU7A 3WV5A 1VSUA 2CLKB 2Q8NA 2FYTA 2VHXA 4DF3A 3N3AC 1IIBA 3HUTA 3SEQA 3ZKWB 1UEIA 1XF1A 4XYLA 3PU6A 3IVRA 3OP1A 3THRA 2HPHA 2IY9A 1D5CA 2PS9A 2PX2A 5DASA 4B0OA 5JAPA 3L0CA 1JECA 1YAHA 4BPBA 2C3YA 3MLEA 2VCHA 5TXGA 3OY2A 4R0MA 3T41A 1GZHB 5KTTA 2D7JA 2C5AA 5LPNA 4CJXA 2G9QA 3EPKA 2GCIA 1ZG3A 3HNPA 1MEEA 5K0SA 3L4BC 1FU4A 2GEKA 4QIHA 3BDIA 4I99A 2PUEA 2ANCA 4YNBA 2H3EA 1ZC3A 5K0GA 4UTNA 3K0AA 4B8ZA 4YMGA 3DWIA 5PNTA 3V4LA 3AUYA 4IOMA 4YRRA 2UAGA 1M34B 2WZBA 3WKBA 2BKVA 2EP5A 4S1PA 1KFKB 3AOEA 4U02A 1YNOA 2FG7C 4EB0A 4RTNA 2V3WA 1E6KA 4ESOA 3EPHA 3FNHA 5I4CA 3TW4A 4ARVA 3EARA 5TVKA 1YZQA 3C7DB 2NZUG 3TWOA 2QAIA 1ZJYA 3ON5A 2WY2D 2CL7X 2ZYSA 1XL0A 1USUA 4JJKA 4D79A 2DQZA 4PC2A 4IYJA 2AKYA 3EVCA 3LXRA 4G0YA 5SYMA 1C7EA 3PTLA 3CNLA 4OMUA 5C8YA 5BVGB 3Q9NA 3QGMA 3X2FA 4GWLA 2I78A 5TQ0A 3EIEA 1A9XB 1E2UA 3FHOA 3G2QA 3QVSA 5AM5A 2HLDA 4JMLA 3CN9A 5LYYA 3KHSA 1PK7A 3UOGA 1UKCA 4DA6A 2ERXA 4ARCA 3DZHA 2JFOA 3RWOA 1HLGA 3I9V1 4IDPA 2JIBA 1K7XB 4QU5A 2P9EA 5JYBA 1KOLA 2CLOB 2DRIA 4IHJA 4K46A 3TIIA 1Q1NA 3ZCRA 4F8JA 4FOLA 1O94D 3GLKA 4CM9A 1BWRA 2FQYA 4QHTA 4Z86A 1WM1A 1ZGHA 3COPA 4GXTA 4B2YA 3DLHA 3MELA 5CLIA 2KS6A 4B4KA 5KOJA 1PGJA 4PF1A 4B82A 4EA8A 3DYVA 2JGMA 1Y3DE 1E3WB 2RJNA 2WF6A 5FTNA 4JJZA 4KFUA 5U4QA 3LF2A 5ALZA 4TXLA 2HO4A 4L8FA 4Q03A 5BP7A 4Q93A 1NP3A 2GD6A 3T9AA 3IE2A 3ET4A 1I4LD 2FQQA 1JJ7A 3SQNA 1DZ3A 3IJRA 3K6JA 3HB1A 3PD1A 1GWNA 3D1LA 1TI7A 4LJ5A 5HTKA 4XTCS 1QOZA 3RABA 1E3TA 4AQDA 1EHCA 2E2WA 4KSBA 4RV9A 3VKVA 1NLZA 1NF9A 4YXFA 1FIUA 1KR5A 2PL1A 4UW9A 3QHAA 2NTJA 4EHIA 2RGXA 2MYNA 3L6CA 2V5AA 2NPIA 2WU3A 3ZE0B 3ZKWA 3DTVD 4LRWA 3HG7A 4ALJA 5CPBA 2XUGA 3RK1A 4WESB 3U3XA 4D43A 4RVOA 4WLEA 4UHJA 1TM4E 1GZ7A 4DANA 2ZWAA 3AB8A 1V8FA 2HJSA 5ILQA 5DK6A 4M0PA 1R8XA 2O2HA 2DYKA 3E5NA 4DUPA 2BGNA 4CMIB 1LVHA 2VYVD 2CLMB 3Q2KA 2CNKA 1NN1A 3JSAA 2BI4A 3JY6A 3ASVA 3GFOA 3AEQB 5BSTA 4RE6A 1L4BA 5KNBD 2I6GA 1EZ4A 3U3OA 4Q1VA 2H54A 2IHYA 2BN4A 5FBLB 2RGNA 3WTCA 1M34A 3MWEA 4HFRA 4R2MA 2C4VA 3D3JA 4XE5A 4Z51A 5ESWA 3DFUA 3T34A 1G8KA 3HWWA 1Y3IA 4DKJA 1RXIA 1R27A 3MA0A 3OO0A 2UVDA 2NM0A 4YAWA 3U4CA 2R8YA 4ZQIA 4ZVMA 1HDYA 1ZOLA 5JNLA 3TFQA 2YV3A 2ZOSA 1XSEA 3LPNA 5C2JB 2YL2A 5JXGA 4CIBA 2L19A 3O31A 4JOSA 1QZXA 3BE4A 2JAWA 2E5WA 4DMMA 1ZS9A 1SK9A 3DOEA 4UNNA 4WDQA 3WR5A 1KI6B 4GOXA 4BOYA 1SIUA 4DRXB 1I94B 1AK9A 1VMIA 3E0XA 3VYRB 2PX4A 4H77A 5ALSA 4CLRB 2L18A 4L51A 5HRUA 1S2LA 1EDBA 4MLCA 1JG4A 3L7JA 2OVBA 5ALMA 1FQWA 4KQ6A 2ZJ7A 4ZO7A 4LSMA 1O7JA 5FV7A 5T4BA 1GILA 2KWIA 3G5LA 3VI4B 4CQLB 4RTRA 1S4QA 2CNNA 1J07A 3O1HB 1X77A 1M1ZA 4O4IF 5AK4A 4QQRA 2G76A 1AD2A 4LOKA 4Z7QB 5AUNB 5B3JA 2PKRA 1VE7A 3PSAA 4E2YA 3U4MA 4ZI7F 3VPGA 1C0EA 4AO7A 1TF5A 1N0IA 1OTHA 1GU0A 1P17A 1U2PA 2G9UA 3FCOA 2Q0XA 4O1MA 7ABPA 1H0RA 1E3WA 1T9ZA 3DULA 1RWKA 5JRZA 1QHIA 2ADOA 1NQWA 4FT2A 1Y1LA 2RJOA 1U6IA 3LHIA 3LUPA 4PVDA 3X3HA 5HR5A 4WE3A 1SQ0A 2NVUB 3EBLA 4A6DA 1ZH8A 1WUJS 1KBOA 5JO9A 1OMOA 3H1FA 3MT9A 4FGSA 2QM3A 1KO1A 5DBIA 2VPQA 3WAJA 2WUVA 1TA9A 3BS4A 1FOEB 3WK5A 4F85A 4E5KA 1D8AA 4F9TA 2W48A 5LQJA 4C2UA 4IDGA 4K05A 2Q28A 4BNGA 5KTSA 5ALOA 2NV6A 3UJ6A 5K05A 2X7XA 4WESA 3ZWKA 5A4MS 1CRQA 2NYAA 1UC4B 1XEWY 1C7QA 2MWMA 4UEQA 5EHQA 5KB3A 4EZIA 3OE4A 1MVNA 3UMBA 2QTCA 4P6VF 4KWHA 4CMIA 4CGYA 2R00C 1YBHA 3G2KA 4EJ0A 4ZO9A 1H1DA 4YDQA 2XQIA 3OIFA 1T0UA 2BGRA 2FEKA 3AEQA 3HP4A 3QF4A 1WMDA 5F7ZA 4AMGA 2Z5FA 3THXB 1PW7A 5DHPA 3ZU3A 1RVDA 4KUHA 3U4QB 1KXZA 3E7XA 3EUFA 3T1HB 1WCYA 2GHQA 3FPKA 3RC2A 3U2QA 3W6NA 1KOGA 1PJTA 1M2VB 3U7QB 1KYQA 2BEVB 4TTRA 1R0ZA 4YP7A 1XEXB 3TR5A 4J7XA 4BKUA 4CKWB 4YGYA 3KT6A 4GL2A 3AG6A 4LK2A 4A3SA 1GZ5A 2K2QB 3BKWA 3G6KA 1M6WA 3L07A 4WK6A 1KFCB 1G7SA 2W2VA 2PKXA 2WICA 1JHMA 3D4LA 4MV8A 4JBGA 1TM7E 4C7OA 4JCCA 1EM8B 1XWFA 1DQZA 2QZJA 2X5KO 4UE2A 2P9YA 1C0PA 4WJZA 3RVOA 3TVTA 3U19A 1HE1C 2ZRNA 3ETEA 3MZ0A 3WBKA 2I6XA 4DRXA 4J1NA 2OLEA 3CVXA 3WX0A 3IUJA 4M54A 3T15A 1PQPA 3ABSB 3W5CA 4CLRA 1U8FO 1O4VA 3CX7A 3DMFA 4M46A 4OD0A 1ZSNA 4BNKA 3BGSA 2WTMA 1KJNA 2ZE7A 4CQLA 3NIWA 4G26A 3TI9A 4YJ3F 3VJRA 3R0XA 2XKBA 1NJ1A 3PBKA 5ULLA 4KDCA 2CEKA 2CW5A 2PJDA 2WJJA 4RABA 5ALYA 5TMDA 2HEGA 3ABIA 2X0FA 1RYFA 3KB2A 2Q45A 5C34B 3GG2A 4R31A 1P2SA 2J9RA 4XPIB 1I4OA 3GLFB 3LQ2A 1N77A 3ID6C 3R7SA 1N8KA 1RRMA 3C6QA 4M9QA 4K0KB 1ZMXA 4BU1A 4D80A 1TEZA 4YMWA 3EW9A 3UZUA 4EUKA 1K6MA 5BR8B 2I0FA 3CH6A 4JB2A 1EK0A 3WOVA 2P6RA 2XKJE 3IBFA 3BDAA 3F4KA 4ZVSA 3IEMA 4DDHA 3E3NA 4F21A 3T5CA 5BMOA 1DUVG 1XHEA 3IMKA 4BWFB 2D8MA 1ORRA 1DTEA 2I6QA 3O95A 4P3KA 2OHJA 3SOPA 1QCZA 3GLGA 3A6PC 2C4NA 1OI7A 5DT2A 4NEHB 3K20A 5LZ4A 3OEWA 4IQGA 1X3SA 3GUVA 5B1HA 1N2ZA 3QYFA 3I4FA 1ZXXA 4NCAA 1GAQA 2RBEA 4JNKA 4DPMA 3AVQA 3TKYA 3QXSA 5KIAA 4L16A 4RNCA 4QT4A 3AU8A 4KW7A 1CF4A 2AFVA 1AA6A 2HJ9A 1FNMA 1Q1GA 2ZI5A 4IIGA 1FNBA 2A78A 3IPXA 3VJMA 2PGOA 3AQ4A 4O2BF 1V7CA 4R1OA 3AB3A 1Q1ZA 3THXA 3EXG2 4TLBA 1NXVA 3U4QA 4LPSA 4MI3A 4Z4GA 2W2PA 4I5GA 3WLJA 1NDQA 2JC3A 2DHQA 2QF7A 3N8HA 1WPQA 5K3SA 3T9FA 3U7QA 2O8BB 4G3XA 2BEVA 3IKTA 2W83A 4EJSC 3KHKA 1XEXA 2GJKA 1PG5A 1RCFA 3W2TA 3LTEA 4ZI3A 4HB0A 4CKWA 2Y99A 3VSCA 2JHFA 2XODA 5D1HA 1XAHA 2ZIFA 1VJGA 3PC3A 2QNIA 3SFVA 3T1NA 3HVRA 3DWGA 3WWDA 3B3GA 2CHGA 2W6JD 4UHCA 3RYHB 4F8EA 4Z4HA 2Z56A 3EDQA 2YTZA 3DEYX 1Z17A 4QBIA 5FA8A 3ILYA 2PUVA 4X85A 5IC5A 4JI6B 3AGQA 3EGVA 3T5TA 3E05A 1LW6E 4QDUA 5M7EA 4LYHA 2FFAA 4H17A 4J49A 2YJ3A 4TWAA 1MC8A 3ODGA 4EHNA 1DO0A 1Z8FA 3DZKA 4V0MA 1T36B 2QMUA 4RVGA 4UUAA 5FR2A 4X1YB 3T5MA 1EBFA 4C43A 1U8ZA 2GWHA 2R60A 4DNFA 3KQTA 3K4QA 1Z75A 3OTIA 5LCXA 1IHDA 2PL9A 3BOSA 4XPIA 5JVDF 3S8YA 1JGTA 3ADPA 1SUPA 2XOEA 1EG2A 1G63A 4FMDF 4F12A 3B6EA 5D87A 1M1XB 1UZMA 4HZIA 4XD2A 5T4EA 2DR2A 5F76A 1T9HA 1WSAA 3AVOA 4YRTA 3WMEA 1K0FA 3H6KA 4G0NA 4L75A 3RJTA 4BEBA 3LC7O 3RVPA 3MIIA 1PR2A 4O4IB 1J2EA 3I5YA 5CDHA 2XHZA 1FLDA 3B2NA 2OYCA 3K9HA 1W0KA 2XBUA 2I1VB 2YWEA 4ITVA 4ZVUA 4ETNA 4QWWA 1GPAA 1A8PA 2QU8A 4LXXA 4MI9A 2IYXA 4RETA 4CGZA 1CS4C 1G18A 2PX3A 2PRKA 2EKLA 3IBTA 3GFBA 1J5EB 4R1PA 2LKDA 1W44A 2QW1A 4HUJA 5E1OA 2WU0A 4OUKX 1EGMB 1Y33E 2I3DA 4IIDA 3NNSA 1T2CA 2IYOA 2VXYA 3SLRA 2C1ZA 2BMAA 2AG6A 2J6CA 8AT1A 2F62A 4IKEA 1JIJA 1MG0A 2MDTA 1D6JA 2WU1A 1EBUA 1HZZA 3VTAA 3MXTA 1OT5A 2WVGA 2XMZA 1X1RA 3O7MA 3PXUA 3RIMA 3VYTB 3HVKA 5T8KA 3UGJA 3M6FA 4DLVA 4ASUA 3SS9X 3I6YA 1BRMA 1J06A 1Z3CA 2KYRA 5FJIA 4BQEA 5BV0A 3X0DA 1VMKA 3GJYA 1VGRA 4UATA 4C4OA 4DCVA 5BSFA 1A8IA 2YIDA 2HYIC 4A73A 4PZYA 2VS1A 4NEGA 5IBRA 3QE0A 5ELXA 3W9BA 4CODB 4F8YA 1GPWB 3D4PA 4EECA 1BN6A 3O21A 5EFOA 1ONPA 2H5JA 4G1MB 4OHPA 3MJSA 1WZCA 1F2UB 2ZR9A 3FWPA 2GCEA 2REBA 4IIFA 4N5HX 3O1JC 4RTQA 1JPNA 4Y0NA 3RYHA 4C0KA 2LD4A 1UZAA 4YRIA 2VUTA 1ZD4A 5JECA 5CFNA 5CIYA 2XTZA 4GLFA 4CM6A 3AVUA 4YJGB 2DPYA 5B57C 1FMLA 3DAGA 4A03A 1V35A 2HPZA 1IHYA 1M33A 1K5DA 2YY5A 1M34E 4L4XA 2OV4A 1J5PA 1NR7A 3S5JA 4ZV4A 6YASA 5H70A 1XNQB 1R88A 1I3CA 2PX8A 3KX2A 1WDMA 3DXXA 1BXRB 1PQYA 3QFHA 1NW5A 1VP3A 1T36A 3C4VA 4CIWA 2COUA 4X1YA 1IE3A 2QROA 5BR4A 2QG4A 4BIIA 4X6XA 3RIYA 3C1UA 9MHTA 1I1NA 1U04A 3C7TA 4Z7JA 1ZMTA 5LN1A 3ZGNA 2W6NA 2WSLA 3EMBA 3KSDO 1JU9A 3HBMA 2IS1A 3K9BA 4RZQA 4DIKA 2R48A 4ZQGA 2PZMA 4D3YA 4TMYA 4W1QA 5K8JB 4KLAA 4A6XA 3KG2A 1WPRA 1OJLA 2NUBA 1NLMA 3L6DA 2G1KA 1LDNA 2JA2A 4LJRA 1X1AA 2RBGA 4RMHA 4O4IA 4YAJA 3COVA 1LY1A 1W5SA 3OQMA 5HA5A 4LWPA 3KR0A 2GR9A 2VCYA 1LQUA 2A30A 4L0MA 3PX3A 2QDXA 4AIIA 1NZJA 1M2FA 2V6BA 3D0RA 4KITB 3KOXA 1XVVA 4HLNA 3HGQA 4J29A 2Q07A 4I1VA 2D2XA 4MCAA 1CYEA 2ZR7A 3CF6R 1PAUA 3P71T 2R8RA 2Y92A 1XZLA 3BXFA 4IGIA 1W25A 2BCEA 2HAEA 3KZMA 5TPWA 1S4MA 1RJ9B 2AZXA 2H7YA 2ZWOA 1JMYA 3OF2A 2CXQA 1IPFA 4EUEA 5A1JA 4P0PB 3TZQA 3RUAA 4BC0A 2WUWE 2XWSA 2DPHA 2AJCA 4XPZA 3B38A 2P90A 4BO6A 4N7BA 2O5RA 5B1YA 2IPXA 3ME5A 4UHFA 2OFFA 3KSAC 2YFQA 3LPMA 2VJKA 3N86A 4QXAA 4FOSA 2GS9A 1XNRB 2ID4A 2R1TA 1OCEA 1YZYA 2HD4A 1XXHB 4P3OA 2IY8A 3WIVA 4OGLA 3GJRA 5I7EA 3T38A 5FWDA 4BJHB 4MVJF 3U9TA 1HUQA 1OWPA 5AI5A 2GOYA 4NPAA 4CPDA 1ZRHA 3LPAA 3C15C 1AKMA 4WXEA 1YIAA 4DG8A 4PZUA 1DJNA 1M0SA 4DC9A 3WYNA 5CEEA 2BFNA 1O96B 4L85A 1AO0A 3JQPA 4TM7A 2G5TA 2JGAA 1OH7A 1F2UA 1E1QD 1GQOA 3MFQA 2D1QA 3VJLA 3HU1A 3G8CA 2UUAB 3G8DA 1ZKMA 3B1ZA 4RMIA 1DCTA 1ISRA 3A32A 2XVAA 4B46A 1JH8A 3QLEA 2F9LA 2G8NA 1YH3A 2YBDA 5F52A 1WZ2A 4YJGA 3KT3A 5E1DA 5EIFA 1P0CA 1QYIA 3OQJA 5HEKA 4FN4A 5FNVB 1G8GA 1V5FA 1YRLA 3WNDA 721PA 1EJ2A 5D5QA 4N8EA 3EH1A 1N2XA 3ZTWA 3SZOA 1RXWA 4D8UA 3RRNA 3KV1A 3SBDA 4RJ2A 4YJ2B 1BXRA 2GGSA 2DJIA 3L8MA 1T10A 1DAGA 3NZEA 4PHCA 4Q3EA 5JD5A 2CV0A 3OQ6A 3HH8A 2ZTHA 4GGMX 4LHVA 1RYHA 2Z5LA 2FPPB 3DAYA 2P41A 2MJLA 5AXDA 3KZVA 2QRJA 3H3XA 4MP8A 4C3UA 3K9LA 4J0CA 5ALRA 4DYVA 4YLEA 1BEEA 1HORA 4Z9XA 1GZ6A 5JAIA 3GROA 3R7DA 4EP1A 1I7PA 1CUYA 2FN7A 1KZ9A 3S3TA 1DCMA 1PJQA 3ZCSA 2G5GX 3WK9A 1NUHA 3OTQA 4DBLE 1J1UA 2BGGA 3E61A 4D3XA 3LQ1A 5I3ZA 3GT0A 1S8AA 4JL6A 2UYCA 4ZODA 5H83A 2J08A 3E3OA 2DQKA 4F6RB 1A27A 2QXUA 4XVQA 4YBZA 4NV0A 3FZYA 3CLUC 5FAKA 2O52A 5JVDB 1E6EA 4EIWA 5HHTA 1T1EA 3HDGA 4CV0A 3CC8A 1XBTA 4LFAB 5JSZB 2YWCA 3C5CA 4GKBA 3RIEA 1IUPA 3IAFA 4F06A 1JW9B 4MW7A 5JADA 3PA8A 5EMLA 2HBQA 3L02A 4DNXA 2AXQA 3KD2A 1NXSA 4DDVA 4V24A 2V7BA 1G8MA 4P3NA 1MJGM 5TJHA 3FNIA 1YR6A 3BHNA 3MPOA 1NV8A 2VATA 1CHDA 4M36A 3FMVA 4UOQA 2VYFA 4HGOA 3OZDA 1EDOA 4AY3A 2O2YA 3ONWA 4ENQA 5C1DA 2ZI4A 1LTHR 1RQ7A 1XZEA 3C2QA 1JLHA 1GLGA 1RE1A 4ANFA 1RP7A 4XX1A 3HJFA 4OQMA 4PGAA 1NQVA 3GLGE 1XXHA 4MYSA 1QK5A 2WV7A 3IV6A 4KZKA 3S27A 4RCYA 4RC9A 3TTVA 1N6RA 2Q5EA 1YL6A 3JYPA 1GOTA 1GFIA 1JZTA 2I2AA 5I9TA 3VHRA 5HYVA 1QV6A 3TNDA 1KZ1A 2W4IA 1O96A 1XNJA 8ATCA 1TW3A 3NIBA 1MB3A 2JCBA 2I4OA 4G0PA 5TEVA 3HYSA 4OSPA 2R85A 3SC6A 3ADBA 1YRQA 2VP3A 3FLMA 1QBGA 5GV8A 4LHWA 4ZJZA 1K5GA 2VDMB 4LYDA 1LLUA 4WXMA 5K1ZA 1S89A 3E9MA 5FNVA 4QJ5A 5DBGA 4R1LA 2GCNA 3N5CA 1XRPA 1NVVR 1VGVA 2Z1MA 3LT0A 3MHPA 4J1SA 2Q3EA 2VJCA 5ABPA 5E8RA 4ZI5A 4L9WA 1WXEA 5ES4B 4KC0A 1Q3TA 2DLDA 3IMEA 4YJ2A 2FN4A 4K87A 3IDZA 1P1CA 2NZVG 3EEIA 2XTAA 2FUCA 3DBOB 1QO0D 5AJUA 1W4RA 2FPPA 1R37A 2IOQA 2F59A 1UBOS 1ODJA 3P9PA 4GZLA 5DM4A 1XYVA 1EP1B 2OBFA 2YQ5A 3RR2A 5IULC 1AN0A 2QE7D 3M9XA 2Q1WA 3JQAB 1QTNA 5IAEA 2YHBA 4EJ6A 2C9MA 5CB0A 2JS7A 5LUBA 4A8JC 1SNYA 1EPUA 2GCOB 3MUFA 6Q21A 1YB5A 5C8VA 2DHRA 2QN8A 1ABEA 3ANMA 2YJZA 2FRVA 2QVZX 3QK7A 3JAWB 1IK4A 3R74A 4F6RA 4BXOA 2PA0A 3NVAA 4C2BA 4V0ME 4FMPA 4U5QA 2XYRA 1J49A 3KB1A 1XEAA 4NYIR 2BGKA 5JVDA 1UP4A 4REMA 4OEHA 3Q3HA 1LS6A 2IYWA 2QLMA 3PUHA 5CA1F 5JSZA 3I9MA 2IL1A 1QFZA 1YASA 2F1KA 5ALTA 1WHTA 2RIPA 4HGZA 1I7LA 5EMNA 5G0TA 4YVFA 4K86A 1LBTA 3HN2A 1UBGA 2E49A 2OFOA 2CNLA 2H1WA 4GLJA 4RF3A 1Z5NA 1DQYA 4REQB 4BO7A 2V03A 1X6VA 1ETHA 2JF0A 1WPXA 4B3CA 4JI8B 3E8XA 3H5NA 1PNQA 4GEKA 1W5TA 4MV0A 1NPYA 3KYBA 1C5KA 3LUGA 1FRNA 4F3TA 4MMZB 2PZAA 3HO6A 4MMYB 2YFYA 5AR1A 2Y66A 4D46A 1S9DA 4ZANA 4YRPA 2H06A 3KLOA 5F1OA 5HF5A 4AJPA 5FUXA 4HXEB 3ZOZA 2CZQA 2XOKA 4G0WA 1SZPA 4Q3DA 5FT9A 2GWRA 4EY4A 4JUCA 5JANA 2G1PA 4FYWA 3OWOA 1RLTA 5TEWA 4GHWA 3VNRA 1ODSA 2H65A 2VP9A 3FCAA 4GI2A 4UU8A 3GN2A 2JPDA 2Y3IA 3DQPA 2IVFA 3OZWA 4G5HA 4XLZA 3ZCTA 2MYTA 1ZSYA 4HYQA 4Q37A 1WETA 1CDZA 1H2WA 5EFZA 1YKFA 2QD1A 1GA4A 1A50B 3H04A 4B3BA 1CUXA 2ZIAA 3IUSA 2FUG1 1WNTA 1TE2A 3COZA 2PD6A 4OXNA 4WNAB 4P93A 2E4VA 5DGHA 4G5GA 3NPAA 3VNVA 1Z36A 1GR0A 4TRMA 2WJAA 4HRYA 3HV0A 1BDMA 1DBIA 4AMZA 5JNUA 1ZI6A 3GD7A 1EXDA 3DEIA 1WOMA 3PZRA 3UGKA 4X44A 3PTAA 4HB4A 4DC1A 1LW7A 2QSJA 2AE1A 3H1EA 1S7GA 1Z39A 1XPJA 1CQZA 3MMXA 2BMWA 4M0UA 4NWIA 3VR5A 1WAMA 1ZU4A 4BTVA 2R0QC 3DZBA 4DA7A 4XGNA 4KR6A 2IOYA 2BLNA 4LMRA 3RB8A 1TAGA 2JIZA 4PLVA 3K70C 2Q5IA 3EVNA 4YCLA 3FETA 4MCIA 3SZMA 3JQAA 1G6Q1 5SY9A 2VHCA 1BW9B 3UANA 1TZBA 2D8AA 5JDCC 3TOZA 4PWYA 4C7XA 2GCOA 1X15A 2Y2VA 2O4UX 2Z3WA 5C5CA 1WV1A 1T1GA 2C9DA 3GCZA 4MW6A 3WHIA 2C0QA 3P2YA 3PQEA 4RDXA 1E89A 3QKUA 3JAWA 3PEFA 4FDAA 4OK5A 4NPHA 4NNOA 4IJKA 3WP1B 3DLBA 2B34A 4OBWA 5IVDA 4KPUB 4BFSA 3O93A 1ACLA 1OXVA 1WF6A 1YCGA 3MCVA 4G8BA 3STXA 3T6KA 4RLHA 4I4CA 3LW8A 4F4HA 3QI7A 4P54A 2QVXX 4Q4HB 3NAMA 3HHPA 4YV2A 1YB7A 2ZJAA 3IV7A 3HJBA 3CURA 4DXAA 1J1ZA 1XN4A 1TFRA 1W5EA 5F7XA 3CRVA 2PUCA 4KXVA 4EA9A 5LZ9A 2XD4A 3CISA 1PBTA 1FMCA 1R4ZA 3BHIA 1Z0SA 3RT1A 1ONOA 1X74A 1PL8A 3OIVA 3EC7A 2NO1A 2REQB 3BGVA 4FJ2A 5C18A 3RS3A 1TZJA 4KXMA 1A5BB 2CKDA 3H86A 3VPBA 1LB1B 2B5OA 4G0XA 2FE4A 1OLXB 1SHKA 3GZ4A 4H9GA 3VU1A 3ZZTA 2Q2QA 4IZOA 2ZJ2A 2BGUA 1TA0A 4IH4A 1FYWA 1UAYA 2R87A 2FEWB 3F1KA 3JQQA 2BTQB 4KMSA 2R5NA 1CEYA 3HEBA 1M6HA 1QAOA 2C9ZA 2GPTA 2ZYWX 5AI0A 1CHNA 2FW0A 2FQ1A 3E15A 3K0HA 5HDBB 2PMEA 2Q4TA 2VK1A 4JQZA 3NASA 4TLEA 4XSGA 4CF5A 4QARA 4EFNA 4X1IB 4KO3S 2C57A 1T4BA 4MVJA 1AKVA 4XB1A 5CCDA 3S8MA 4WNAA 2C94A 2JZCA 3F67A 1Q57A 4PYJA 2IH4A 2FFJA 2ABWA 1U8YA 2GPJA 4RY9A 4I50B 5DI3B 3BTVA 1YE8A 3BWYA 2GJ8A 3IAHA 1N34B 4R3UC 5DN6D 2VDNB 4KNYA 3BCSA 3LWZA 4JD5A 4MV4A 1W35A 4HUQA 3PVSA 1OH5A 1E1MA 2BJVA 2QSUA 3KWJA 3LC0A 2Q9UA 1YA6A 5BR7A 1CC1S 3LBNA 4P5EA 2O0JA 2O2JA 1CUVA 1Y9DA 4ZEXA 2C83A 3ZU6A 3VNBA 2CLIB 1KQGA 1C1HA 2R6AA 2F3QA 4I4NA 4I4IA 4A0GA 1BW9A 2JI4A 3JSXA 1Y81A 2X3FA 3VPDA 3PXEA 1KO4A 4MJLA 4MI6A 2A0KA 1WCXA 1JJVA 4LQLA 1Y5MA 3W9UA 3EEOA 3FDFA 5EVJA 3A3OA 2B8JA 3E9ZA 1X7YB 4OLJA 1J5XA 4U0JA 5DGXA 4UXIA 5JHHB 2I66A 3SBEA 1UDAA 1NPTO 2ZP1A 3AVXA 1LVGA 2VT3A 4KPUA 1M67A 1G4UR 1V25A 3NFRA 3O75A 4MKIA 4OHMA 1FP1D 2F7SA 2WM8A 5E2AA 3EUEA 3HXLA 3CEMA 2I2XB 1UT6A 1L4KA 3TX2A 4AZ3B 5I8PA 4GR5A 5AQEA 5LQAA 4Z3DA 5I48A 5AVOA 3NH6A 1EWYA 1TCBA 3PYLA 2ZQZA 3P7MA 3TQCA 5AO9A 1SKMA 3GFVA 4Z9YA 5CW2A 4J3NA 5DFAA 5FL7D 2AA3A 5TE9A 4UCXA 3IHKA 1E7WA 1DQNA 4BLWA 2AL7A 2JD2A 2QMEA 1RMYA 4BLPA 1MNQA 1Z4JA 4DYDA 4GP7A 5KJ1A 3GFTA 3FHCB 3ZWDA 3D43A 1XMSA 5KQPA 1XA0A 2PQ2A 1JEJA 3DEZA 3PL5A 4AI6A 3H99A 3KR2A 1GADO 3VR2A 1OLXA 4LOAA 4LE1A 3VTKA 4UREA 1E9EA 1L3BA 3TTWA 4YRZA 4HF7A 2CD9A 3O4HA 4FHGA 3U4DA 5KQRA 1NI5A 2IZOA 1B74A 2BDEA 4PLPA 4K9RA 3FGNA 4PE5B 5CLGA 2Q27A 2YFKA 4FSDA 1S8NA 1PO7A 4FW8A 2AZMA 2QRLA 1L5FA 1ESDA 1U2ZA 2EYQA 1J0AA 2C9YA 4FX5A 1DAMA 5GONF 1ATIA 1DIHA 1YJXA 4IIBA 4X1IA 5T4FA 9ATCA 2JIDA 3PX7A 2XVZA 3DMTA 3GDGA 4TYPA 4R0NA 1Y1PA 1GPLA 4XYGA 5CH3A 1XXHE 4F5EA 3SSAA 1YHNA 4FI3F 1BS1A 4TS1A 1N1MA 2DE0X 3JD2A 2FG5A 1CQJA 3GRKA 2J1LA 1E5LA 2WJPA 5DI3A 2D59A 5JYCA 2QN6A 2XH8A 3KIPA 4WLVA 4NV3A 3ZJYA 5HZHA 1E7YA 3WYDA 2PO5A 2IY7A 1Z88A 4MIOA 3X1JA 1FLNA 4RTPA 4MUKA 3IVXA 4JLSA 3P45A 3L4SO 1UT5A 1QZ3A 5IHPA 3FDIA 2O8NA 3VAYA 4YAUA 2OV1A 4FOOA 3G9XA 3SKVA 4LA4A 3QPUA 5DHQA 3DXZA 2LBPA 2DEUA 3OQIB 1TTHA 1HGXA 2QD2A 3PC7A 4POAA 3DBLB 1V6AA 1EU1A 2ZYTX 3WGUA 2REXB 2WSYB 3VHXB 2YVLA 2ZSKA 4AN0A 1YD7A 1V26A 3QWIA 3UJ7A 3GFFA 4ZJPA 5K4AA 3TRFA 4AMVA 5JCJD 4J0GA 4LWZA 4F93B 4XIYA 4FI3C 3M3DA 2A3RA 3DMDA 1ADFA 1OIXA 1X7YA 2QN1A 3OQBA 5AK0A 1O58A 3MPUA 1PIWA 2IEDA 4PXSA 3SK0A 1UPBA 3A3NA 3MMZA 3YASA 2AW3A 4BZWA 3HR8A 1YVUA 3L7AA 3IUYA 3PFFA 4F2GA 5D2CA 1JYSA 5DWDA 2G5CA 2YYSA 1Z15A 3GUUA 3VDNB 2D5AA 2C5GA 2B4RO 2E48A 4AZ3A 2QLLA 3N59A 1TQHA 2WWRA 1P19A 3DE1X 1VJ0A 1ZD1A 3O47A 3PE6A 2DFKB 2P3SA 5AVJA 5A4IS 5CU7A 5IXYA 4B45A 2JA1A 2CVHA 5BRNA 2JJMA 4L2IB 1RRPA 2PE5A 2ROQA 2FPOA 3VBEA 1T15A 3SYRA 2R6ZA 4BMXA 4D0LB 2CCJA 3BSWA 5CA1A 1D2MA 1W85B 5EG5A 1M2OA 3AI2A 3LOPA 2ECFA 1XTQA 4XQ0A 5B4TA 1YE5A 2XVYA 1TO2E 2Z9CA 3INTA 3QQPA 1FTGA 1IFXA 1RWQA 1ZN9A 3PQ5A 2AWOA 1GNSA 3WKCA 3L6RA 3UAWA 1AHIA 1PGNA 4HSEA 4JC4A 1KERA 2J7KA 1IVSA 1X1TA 3I83A 4QQNA 3OZRA 2P6MA 3NXKA 3KPUA 4GZ6A 3HFRA 5LR6A 1XC7A 3FOZA 3EWNA 4ZQCB 5K0EA 1JJIA 2ECOA 5FBRB 2C2HA 1MFZA 2VJYA 4J9UE 3BXHA 5HQJA 1GRVA 2PLNA 5FPQA 4Q9NA 3UA4A 4F60A 4HLDA 1KY5A 1KAHA 1YMQA 1RBMA 5K3AA 1RYMA 3ZZMA 4DLSA 4DHWA 5KS2A 2OY0A 1YI1A 2I6SA 3KD3A 2B4YA 3ETGA 5AK6A 1PCXA 3C6BA 2CV2A 3QUTA 3FSGD 4GQAA 3OCVA 4JZKA 2ZYVX 3UWSA 1EP2B 3VU3A 2P62A 4MWEA 4Q9HA 2X22A 1SULA 1AVTA 1VYTA 3BWMA 1U2EA 4L9RA 2JIPA 3AL2A 2PVCA 3BXGA 1H2BA 4RZSA 1O97D 4WKPA 3F46A 2P8SA 3WJ2A 4MICA 3VA7A 1NKTA 2ZSIA 2X9QA 5JD4A 3TEMA 2WFZA 3U3KA 2R86A 2ZR0A 2I76A 4KOAA 1XNHA 4B6QA 5JW6A 2PLRA 1WXGA 2OCDA 2VWGA 9LDTA 1T2VA 2BMVA 3HXKA 3OQIA 1IOWA 1MOPA 2N46A 4OV6B 4RNDB 1OUMA 5IUJC 4TWZA 5KYUB 3DBLA 2E5LB 3IDFA 2ASVA 3VHXA 3HM9A 2CEAA 4GI3A 5EJIA 2OORC 4QPDA 4EDFA 2HA3A 3EC2A 1F14A 4HVAA 2ANBA 5DBFA 1GKIA 2WIAA 1MDFA 3USES 5KBYA 1Z56C 2IEIA 4PFSA 3RSHA 3ENNA 2OFXA 2XUIA 4BY9E 5KYYA 1U90A 2H1HA 3HE3A 3QFRA 1A7AA 2AEJA 2IUYA 4I36A 1IXYA 1T0HB 3L7IA 5IDWA 4L0QA 1G2OA 4J9VA 1RT9A 1RYYA 3CZ9A 2VHVA 3CMCO 3FBGA 3LC2O 4M86A 2BVNA 2K87A 3UT5A 1EXVA 1FP2A 3OMXA 3Q5GA 1A72A 3O8OB 4O1HA 4J07A 5LMNB 3C3CA 5LBTA 3EZYA 4JYMA 2QVBA 3N8IA 4MR9B 3ZHXA 1N6OA 4TTPA 4YUYA 1GYPA 1ULSA 1A98A 1EFCA 2YJNA 2ZRCA 3AVTA 3ECSA 3JD1A 2RHTA 4L2IA 4H7IA 4AKTA 4NJMB 4IXWA 2VDJA 3Q1LA 1RJWA 2EX4A 2QMOA 2YIMA 3D6TB 2AEMA 2I6UA 1W85A 1NQAO 2NGRA 2Q2WA 4C5AA 1BDHA 2PUDA 4HD8A 1SXJC 3GGPA 3PGKA 4EARA 2X5JO 3TYXA 5H9WA 2XT6A 3CEHA 5K2OA 2DT8A 3EA4A 3V32A 1Z33A 3U4IA 3C3PA 3AH8A 3HJGA 4E14A 3GDFA 2WWGA 2CFOA 3JR7A 2IDKA 3V2UA 4IQ0A 2Y67A 3FPGA 1QRRA 4OI2A 5G0WA 1BZYA 4GP6A 5CDFA 2QZPA 2B4TO 1WZIA 2BFWA 4D99A 4Z6KA 5JEEA 3NCTA 4P35A 4BFCA 4D8XA 1TAQA 4Q3BA 1YR9A 1IQPA 3OX4A 4V0KA 2P3LA 3KR1A 1LSJA 4MUHA 4H08A 4YMVA 1TO1E 1IY1A 1O6FA 3A70A 2HQ1A 5CYFA 4EHKA 4QAQA 5I9MA 4RHYA 2WKQA 4L7VA 2WE7A 3E2PA 2J4FA 3D7LA 4WBSA 3ZE7A 1NVTA 2PN1A 3G02A 5KTPA 1ZU5A 1VBFA 2AMFA 4P82A 4URHA 3SXUB 2J41A 4MRNA 4TTJA 4P98A 1NVAA 1S3FA 4RXTA 3RO7A 5D1NA 5K0JA 5K6AA 1V47A 2NZJA 3WL6A 3IPYA 2DUNA 3SIWA 4DIFA 2HV9A 2FW9A 1Q0UA 4X45A 4OQDA 4ZAVA 3RPEA 3NAQA 1ZOPA 1KH1A 2WT4A 3AHGA 4D4JA 3CIOA 1JQEA 1AKUA 3FPSA 2DTEA 4MVJE 4LXQA 4TZTA 3UO8B 5KYUA 2UYOA 1O1YA 4U7PB 3BGWA 2DXIA 1O0SA 2H1OA 2XXBA 2E6UX 3H2HA 1P9LA 3T0GA 1TDJA 3FOEC 5FBVB 1XN1A 2YHAA 2BD0A 3L77A 3N8KA 4X60A 5DMHA 3WNBA 5EMHA 2JH8A 4CM8A 2FMXA 2P2SA 1MX9A 1EFDN 4PIMA 1C3VA 5E7QA 3GZNB 4X61A 3T7RA 3WO1A 4B6EA 4HXGA 3RVSA 4G63A 3VU0A 2HHJA 1SBIA 1M7GA 4QDJA 3ZWAA 4MLDA 2XB8A 4OCZA 1Y5NA 4E3WA 1E0KA 1RHRA 2GFQA 1TMGE 1ZISA 2VH2A 4N5DA 4ZHQB 1WMEA 2GNPA 3VV2A 1P3DA 4FZRA 1UC9A 1F2TB 1M6VB 3AUJB 3BMNB 1BKYA 1W1IA 3I58A 4IDNA 4LS3A 3TKAA 3U4HA 1VDZA 1G291 1NR1A 1P0FA 1GVHA 2P0YA 5LQRA 2ZSJA 3BWDD 1W8IA 2GVZC 4N6NA 4P58A 1T8WA 2OCGA 2GF2A 5GVSA 1F38A 3LXUX 2OC4A 4AB1A 5ALLA 1B3RA 2XNCA 5LWHA 2NWQA 1Z3IX 4MGHA 1E9RA 1DIGA 2C5LA 4WADA 3W4KA 1VPDA 3FBWA 2MCFA 3N6VA 3GRAA 1XTKA 2QUJA 3BTOA 3OOSA 3WYGA 1XFDA 2ZJ0A 2V9ZA 2ZI7A 5HMLA 5HJ5A 4NZPA 1AQJA 4NZZA 4EEZA 3KLPX 1Z28A 2XCTB 2ETXA 3G8YA 3SYKA 1PZMA 4OVKA 4XCQA 4Y2QA 3S99A 4EH1A 3T3OA 1VIYA 4ZDWA 4AF8A 2FSIA 3GRZA 3KYIB 1OLSB 1Q3HA 2R8EA 3JQFC 4RZHA 1QQAA 3D8TA 3DNMA 1R0BA 3IAM1 3ZD8A 2RGEA 3IEUA 4IGFA 4AJKA 1VKJA 4G5OA 3GXOA 3W05A 3TW0A 5I4IA 1OFUX 1W93A 1RWBA 3U13A 5CYPA 4FGJA 5CLJA 2UU9B 3PIRA 1H5UA 4D3FA 2OSBA 3R20A 1HV8A 4V0SA 1C2YA 3GFGA 4ZZIA 5ICMA 3SXUA 1MXFA 1QYXA 5FUQA 4PY2A 5C1OA 3DHVA 1FTNA 3PICA 5GONA 1U6KA 1JAZA 2MIIA 2W90A 2ZJBA 3FYTA 3QJGA 1ZZEA 1Q83A 4YUAA 2BJWA 3FROA 2JBHA 1K8YB 2F3SA 2OCLA 1AMNA 4EB6B 2W5UA 1REQB 2VJLA 3ESBA 3KO8A 2QGZA 1SQ6A 2GK7A 4KGXA 2RSLA 1EINA 3RHSA 2XRFA 3EFOB 4M0DA 4QXMA 5I9LA 2JKZA 2GD1O 2XR1A 1B6SA 1JHQA 2OHVA 2AR0A 2ODAA 3DP9A 5FH9A 5JI2E 3RTEA 2C7BA 1NBAA 4B81A 1MJNA 2V0CA 3CWZA 3F4BA 3KAQA 1XD8A 1N2JA 2VEOA 4DCTA 4FN5A 3DQQA 4LBYA 4ARUA 3Q7RA 3TZ6A 2NO6A 2QVGA 3KM0A 3I5XA 3B6IA 4WA7A 1FFHA 3OM1A 5H59A 2F8LA 4ZU6X 1F2TA 3C41J 2V6FA 2IHNA 3BMNA 3CE9A 3QXGA 4G5XA 3BWEA 4EY3A 1J00A 1NSFA 2PK3A 3WLSA 5COAA 5PGMA 5B6IA 1H8EA 4S3MA 5AVUA 1Q84A 2FCAA 2G8LA 2QUHA 2ZT7A 2Q4EA 5HIJA 2C8KA 4CMKA 4AJJA 2RC5A 3DR5A 3HLKA 1SU6A 3W06A 1WTAA 1X9GA 2YNMD 2XJ4A 3GT4A 3HM2A 3LVQE 4Q6WA 4A0HA 1IWBB 1ESCA 1GNTA 2OP1A 5JYDA 3QOWA 2JANA 4P1ZA 3GZTB 4OXQA 3GI1A 4CTJA 1AKQA 4MUYA 2X2OA 3HKEA 4NQRA 4E2XA 3FYHA 1DE0A 3WA6A 4M37A 3DLCA 4DV2B 3AF3A 3NWEA 1T3SA 4OH7A 2Z1NA 4QUKA 3ZCXA 2C00A 2GDJA 1ZIDA 2IF2A 1GPDG 2X0JA 3I52A 4KDEA 4OXKA 3T3GA 4NYJR 1Q7CA 4IDOA 5IXJA 2AXPA 2IZZA 3BSFA 3LUDA 5BN3B 4PHFA 2R2AA 2H1IA 2X0DA 4GWKA 1MAHA 5B4VA 3TOCA 4E5SA 3EE6A 5K3DA 2NOAA 3RSSA 4ABTA 1BFDA 4YP9A 2X8AA 4RGYA 4PAWA 2HR1A 3U62A 1C3XA 3FCYA 1KR2A 3B20A 5EKDA 3NC0C 1ZGAA 1W9HA 3UK1A 2OUIA 3CEAA 5LYJB 1G7RA 3L0IB 3NU1A 2H2IA 4Y6GB 4R4JA 2WSBA 4BDSA 4HAVA 4YV7A 4RE5A 4JVMA 3VAZA 2R11A 2HF9A 5KOHB 2ZRMA 3WO0A 3HCBA 3IC5A 2I8LA 2ZJZA 2OL4A 4C6RA 2V7TA 4QDTA 4QM7A 2I4RA 1S2OA 2R65A 4HS9A 2GO7A 4FXOA 3B1VA 1MUUA 1HF3A 4QXQA 4AMYA 1VB3A 2YS7A 1O95C 1YZFA 4EB6A 2V5UA 3C3XA 4WY5A 1REQA 2GKSA 5J23A 2EOAA 3CLRD 3RVBA 4D6YA 3AZOA 4UNRA 3ZDAA 3HVUA 2I7CA 5DRYA 5FB3A 3NAZA 5LWQA 4ZVVA 1XDGA 4PX2A 4PXAA 3NEYA 1HRDA 5EAIA 3EFOA 4XR9A 1YQTA 1BO6A 4N82A 4GLBA 1D2CA 2I6TA 2WTNA 5T6MA 1UEXC 1VRCA 3EWIA 3ZW7A 1M2WA 4NCNA 5F23A 1QG4A 4CCSA 2RARA 3E18A 3QITA 4TYQA 1GPMA 3BB4A 4IXNA 1DO8A 1Z0DA 1CRPA 1V4BA 1ZVKA 3PB3A 4E7OA 1ZDMA 3EB9A 1ZD3A 4CUKA 1N7JA 4LN1A 5A0FA 3L01A 1TM5E 1E69A 2G25A 1B41A 1Y34E 4ENSA 4GEGA 1Z12A 3AF1A 4FKMA 3PXAA 3S2FA 5LQKA 1OBCA 4K8OA 2LR0A 3KPJA 1LTKA 2C78A 3PNQA 3BHJA 1KEEB 5IVKA 3ZEIA 4Q3NA 1CJVC 2YOGA 3P9QA 2IXTA 4BUJA 1UPCA 4UTZA 4DFDA 4DY6A 3GGSA 3I2FA 1YACA 4ARIA 2ZAOA 1TD9A 4UUMA 1VYUA 2YWJA 2XB9A 1ZJ4A 2VDLB 2WNHA 4MWCA 3FF4A 4DV7B 1OKKA 1VL6A 3N7TA 1L7PA 4FB4A 2P9HA 4BZQA 4I3GA 4RY0A 1G3MA 1DKRA 1X7HA 3ZZ0A 1VYHA 4GDFA 2PNJA 5DNWA 2QTFA 4E5VA 1T35A 3L84A 5BN3A 2ZREA 3FPAA 3MTEA 3JWPA 4C0XA 1DJPA 1EDEA 1XZCA 1D03A 2AOUB 5SY6A 2QT0A 4IWYA 3PA6A 821PA 4Q00A 5LFAA 1G0NA 3C4QA 4D3SA 2WR8A 5CBPB 2X13A 1QK4A 4OQEA 1RXEA 1V41E 2Q41A 3NONA 5FOSA 2Z3VA 1CJUC 1KE2A 3PXDA 4L0DA 2GRJA 1E3DA 5LYJA 3R0IA 3VGPA 1QCDA 4ZAWA 3P9ZA 2ODNA 4MRAA 1KDVA 1JSZA 1HY3A 3AETA 3KSUA 3VR6A 421PA 4D3ZA 2E4ZA 2HWKA 3IILA 4I19A 4XWOA 5FPYA 5CDFE 5KYKA 2OZEA 3CZPA 3PE4A 1TK2A 2QUZA 5HPYB 2K7ZA 2QA5A 4V2UA 4S04A 4KLZA 1QFJA 3BL5A 4BN5A 1GLNA 2AK3A 3UK7A 3WGHA 4BVBA 3ITDA 3BRSA 4YJHB 1Z74A 1YB6A 2UZ1B 1Z82A 1T8RA 3OBBA 1GUBA 5EZYF 3BCRA 1YZHA 1DIRA 2IUFA 4B4WA 2H51A 1DAKA 5B3LA 1KBZA 4OQXA 4RD2A 4ALIA 1MRSA 4N8SA 2GHIA 5EWJA 3RIGA 1QRDA 2X4GA 1W6RA 2XCSB 4RPCA 5IKOA 4EATA 4EFDA 3IL2A 2YVUA 3IIMA 3WLTA 1LU9A 1SG0A 4Q48A 5ED0A 4GT1A 5TS3A 4GXNA 3WDMA 3HP7A 1KYVA 4A1FA 5KHOC 2JW5A 5F2EA 3P2KA 5A9RA 3UK2A 3FFXA 3ZLBA 4WCDA 3FTEA 5ECYA 4E1VA 5IN5A 3UPDA 4LYJA 1KQNA 1RRFA 3GMTA 3ORRA 2GK3A 1HG1A 1E79D 1TKRA 2A0FA 1MW9X 3B7GA 4G65A 4LVOA 5C7IO 1CY0A 4NBUA 3EQ8A 1UMBB 3OECA 2IYPA 3KKQA 3DV2A 1VIVA 2F1RA 3KVOA 5CM9C 5LZ5A 3ICQB 2XSZD 4UQPA 2Z2ZA 3TQFA 5K4HA 3O94A 1P60A 1KEEA 2V7VA 1J39A 1QHFA 4D0SA 3F9IA 3U7GA 3MJFA 2OV6A 2OBMA 2V0GA 4B48A 4UVHA 3T35A 1EEHA 3B78A 1KYIA 1JIIA 1RC0A 1YS9A 2QQ0A 3H2SA 1PWHA 2AS0A 3QF7A 4I6JA 4BGIA 2H2WA 1XO1A 1EVJA 1N9GB 2JZNA 3A9CA 2VIIA 1M76A 1L5HB 1NXPA 4NOJA 5IP5A 1GM5A 3DCJA 3ZE8A 3W2HA 2GZMA 2HHCA 2RI0A 2OV8A 1QGOA 2AE2A 3BZWA 3HA7A 3JWJA 4RSRA 1SIBE 2P75A 5JRDS 5EJ5A 1K6IA 3CBGA 4JGIA 2F8SA 3IIIA 1QR2A 2AOUA 3HEMA 3TLGB 4GF5A 4TRJA 3C8DA 5AM3A 4MV9A 2V7UA 5DP1A 1PUJA 1SVIA 3MWGA 1J0CA 1Q74A 3GYGA 2G0AA 5BR1A 5M29A 1TAUA 1NHWA 2WSSD 2C7RA 2Y0EA 4OHVA 4PYLA 1QX3A 3H11A 3ISTA 5A7FA 5G0VA 3R3SA 1XLTC 4EWLA 2W2MA 3EBPA 2PY6A 3EODA 5AK3A 4QZVA 3MTIA 5DHTA 2IU3A 2NUAB 1W34A 1AC5A 2IOFA 5LNK1 2V1UA 1SIOA 1SELA 2Y71A 2Z98A 1Q6ZA 2AMLA 1KJ8A 2R7AA 3V6MA 4I1OA 2OHGA 1I6WA 4YJHA 3H9GA 2UZ1A 3A6JA 4AM8A 1S3SA 2BLLA 2EJUA 3K0CC 5F5XA 1JR6A 3L7BA 1EK5A 1UF9A 3KHUA 4IG9A 4MKHA 1YCFA 3RTAA 2D7DA 4TWJA 4OP2A 2DT5A 3H2ZA 2BFOA 4G23A 4DSZA 4R2JA 5DGDA 5TPWB 4Y3UA 4HQ0A 2RD2A 1DTWA 5A5GA 3KC2A 1JEQB 1SWVA 2NLOA 2NX2A 2W6ZA 4IUDS 4WHMA 3R3XA 3TLMA 4A2QA 5CFZA 4ZGWA 2QQEA 5DU2A 5KNBH 3MQ2A 2HPVA 3OJ0A 4Z8YA 1OU0A 3F49S 5IT9A 2W22A 1P8JA 2FSUA 3H3FA 2IHKA 3UWPA 3ZYCA 4B3HA 5BN1A 3D81A 2BL4A 4L8LA 4CNQA 1HDCA 10MHA 4EY6A 2HB6A 5K0BA 4MQ4A 3PC4A 4CFYA 2QYHA 5FHQA 2WD8A 1Q0QA 2Q49A 2MSNA 1QX4A 4BVGA 1UMBA 3FTCA 3A9RA 4UNSA 4BNNA 5L51A 3R3ZA 3B3JA 2WU8A 3W77A 1Y8CA 4O0MA 4RPKA 2QLTA 4N0EA 1TU4A 4NFHA 4RKRA 1M5RA 2VP5A 3E9CA 1QU3A 1LBIA 2WBLC 4UJ3A 1QV9A 4FFLA 4XCXA 1HKUA 3BMOB 4FWBA 3JQRA 3M9LA 3TL6A 5AQ1A 3MBOA 2F1JA 3V5NA 4ND8A 4K3VA 4RCVA 1IDOA 4UM8B 3S0JA 4Z4QA 3KQSA 4Y18A 2O6HA 4KAXA 5CX4A 5IDXA 1N9GA 2H1RA 1K88A 1LV8A 3OE5A 1JBEA 5F9HA 1CUGA 2BH9A 1SZJG 2H1FA 1D1SA 3K0KA 3K73O 1W581 2VF5X 5I9BA 2I2DA 3A7DA 5FBWB 1WU7A 4L4SA 4PSAA 4UVEA 1R6UA 1XCBA 4HGPA 4PLHA 5E1MA 1OYOA 1NP6A 4M0LA 4C0BA 4PN3A 3BE5A 2ZB4A 2HHAA 1T5IA 2IYEA 2Q3JA 3TLGA 2F8MA 2ZIVB 1DQPA 1XEFA 1U9IC 3O1IC 2CXUA 4L4YA 4GSYA 1UIMA 2X40A 1PTJA 4Y2JA 3EZNA 4JLNA 2Y1KA 1NNEA 1MO4A 1FDRA 4D9FA 3RG2A 3ZE6A 4BP8A 1K8RA 2DM6A 3M5CA 4BIMA 2Z09A 5TJ9A 1H05A 2NUAA 3MERA 4Q24A 3IRUA 4I3FA 1OQAA 3MWJA 1FDVA 1V3QE 2CZGA 3PPXA 3VR3A 4X65B 2HU8A 3BC1A 1OJ7A 3DL7A 2HLDD 3ZHBA 4J1TA 2Z4TA 2OFPA 2RGBA 3JYHA 3RTBA 3VVLA 4CR7A 4BVJA 4IO0A 2JHGA 5ANRB 1SD5A 2D62A 3UJDA 2X4DA 3CKYA 2DUJA 4IVRA 2P11A 3ESDA 1HC7A 1K9SA 1H8HA 1U31A 2GEUA 5TC4A 1ZPDA 4C04A 1Z6PA 1C30B 4UAUA 3ELUA 3LPDA 3UWMA 1LWOA 3ETLA 3IQFA 4QBHA 3IAS6 4M8SA 5F64A 3TX6A 2XBMA 2FWRA 2P69A 1IM2A 4LGYA 5EZYB 2GAJA 1ZK1A 4EFLA 5HXAA 4K2HA 1TFUA 1GY8A 5K0NA 3U31A 5LL6P 3ROMA 2PCJA 4DB4A 1XD2A 1PK9A 3T1OA 2BCGY 3KPVA 1F2VA 5K3OA 1L1EA 1RVV1 2PLAA 3NM4A 3OOWA 4K3UA 4D41A 2Y1FA 2B2CA 4GDMA 4AWAA 4PBRA 1GUDA 4I55B 3WZLA 1HMYA 1SBTA 2AXNA 2IIBA 3CVOA 3TO5A 3UUGA 4HVLA 3LRPA 3AIIA 1H23A 1MDBA 3GDOA 3P96A 3QBTA 1HQKA 4NS1A 3I09A 3V7YA 3LY7A 4IFIA 2O0MA 4FXPA 5A5EA 5EIEA 4N65A 2IS4A 2HO5A 2IUTA 3RFFA 4ZYVA 3KB8A 4JSTA 3CCCA 4TKLA 1HBJA 1XRMA 3L8CA 2C2KA 3AR8A 3Q5DA 1M0TA 3CBQA 4G89A 4E12A 4RTJA 2B36A 3BJZA 2FSVC 4HMQA 1E2NA 1FJHA 1PV1A 3IPRA 1T0JB 3QX7A 4J3FA 3TM5A 5TPZA 4RLQA 1NATA 2EP8A 5AUPB 1P7YA 3F78A 3SIXA 1TUIA 4IF4A 2D1FA 3AHFA 4W6ZA 3RK4A 4ZCMA 1HYEA 5KAPA 1G16A 2ZRPA 3PS9A 5I4BA 1WVGA 4OXXA 4EPTA 5JUWA 1TRHA 2H52A 4HVTA 1QLWA 2PQ6A 4HKTA 4FIZA 3T3DA 4BWVA 2GD0A 1EGVB 3BD7A 3QWBA 3ECAA 4O4HB 4JOQA 3BQMB 3GT7A 4X94A 4ITUA 1DPGA 3OPVA 5G1PA 4ZQHA 4M87A 1RXSA 3QP9A 2DF8A 4X95A 3SE0A 2GHRA 4XJSA 3NDIA 5DXAA 3CINA 1AM4D 1K1EA 3VH2A 2JIOA 5MF6A 3BIXA 1SHLA 2CNOA 4BFTA 5A62A 4H7DA 5EZQA 5LD2B 3B12A 3WGGA 3WRYC 2CXSA 1R4MB 4MK4A 4RVNA 5IAKA 4D9MA 4W5WA 3IIKA 4PNEA 1L4UA 3DOJA 2F3PA 5TGZA 5KNDH 1HDRA 1XLVA 1AS2A 3LSTA 3BXZA 3ZXXA 4EUHA 4MNTA 1DPFA 2E21A 2ZJ6A 3C1AA 3OURA 1BVYF 3CF4G 4ZCIA 3SSMA 1DKMA 4PHTA 2GAIA 5L6LB 4IIJF 1GR1A 1X7DA 4C4RA 2FZ5A 2HU5A 3WNQA 3LUKA 4JFAA 4YFVA 4KZPA 2R44A 5FLYA 5ARBA 4PQRA 2YW9A 4Q3OA 4QPZA 1CB0A 4IYRA 3KBOA 2NP6A 1COWA 2Y1XA 1VFNA 3FH0A 2GETA 2JD0A 1C30A 2J6IA 4GNRA 2C7PA 3F8WA 1JLKA 1O6BA 4A1OA 4PIVA 2VAXA 1CR4A 2HCJB 1MC5A 5EZYA 5J4YA 5HX7A 3FNBA 1DIOB 1W96A 2ZROA 1QIDA 5GPBA 4E46A 3L0DA 2JKVA 4B3MB 4RHEA 1GFWA 2HADA 2ZE6A 4LK3A 1NIPA 3WVNA 4RJLA 3QSYA 4BFZA 2WV9A 4X3PA 1O0CA 2AZ4A 2IPNA 2G0TA 4I55A 4Z0TA 1P4AA 4ICIA 1DEHA 2R7MA 3Q2IA 3T5BA 3K8ZA 4CI0B 1X8JA 1N3IA 1V45E 2F6RA 1UC5B 4FCWA 3SE7A 2A5YB 3I8OA 3ZHTA 1SOUA 4EYEA 2F1IA 1PWEA 2C0CA 3H05A 5CW1A 1E5DA 5DGIA 3D2CA 5THKA 2O3RA 5JFOA 2YASA 3VO9A 1XVLA 1SC1A 3B51X 2PKWA 3BJRA 1LQTA 3NUGA 1G20B 2XYHA 3KJFA 5KTOA 4UE6A 5CB8A 1ZHOA 5CDUA 1PVOA 3IP3A 4FMCF 4DAOA 4FUTA 1GTZA 2AG0A 5HIIA 3CMMA 3ENWA 3K2IA 1V96A 2YWBA 4RBNA 4EHJA 1ZCBA 4JJFA 2I5PO 2QKYA 1N2SA 1W46A 1Y8AA 2UYQA 3O26A 3VPHA 4M89A 5IXSA 4ND2A 3OZBA 4DIUA 3RAEC 3DDCA 3TUIC 4C7JA 3DR3A 3DTVB 1E2MA 3F0TA 4PZPA 3PR2B 1YS1X 3EVEA 3H2KA 5ITVA 3CLTC 4ETIA 4YPVA 2HRQA 3QYJA 1B15A 4JSRA 4M4SA 4FBMA 1FPMA 4XB2A 1NF8A 4N54A 5JMTA 1GCAA 4HFNA 5LBUA 1L7NA 1Z6GA 4FYJA 1J2RA 2OO3A 2WOOA 3WL7A 3OZTA 1IUOA 2F9FA 4WINA 4CL2A 4CEJB 2YUIA 4A27A 4GMKA 1R4MA 2HQRA 4QAJA 5ICFA 2XB4A 2OMKA 3GOHA 4FFSA 3RU9A 2R6R1 2Q50A 4DLRA 4OATA 5THQA 2Z8YM 1KWGA 1A2BA 2UUOA 4XJVA 1EFRD 2Q5HA 4G6ZA 1PFYA 2XTMA 4QVIA 1D1QA 4YJKA 4TSFD 2FX5A 3V7NA 2R3SA 2PUTA 3KOUA 4HMOA 1L5WA 4PRKA 1WP9A 3L8GA 2AOVA 3QVVA 4FFMA 3EGCA 3DMHA 4RCZA 4XVRA 1P0PA 3DDZX 4LY9A 3WTBA 4E30A 1UZNA 1WLSA 1MJGA 4BB6A 5A5VA 3ZK9A 4AX8A 4RKEA 4WSOA 4JFRA 5HTOA 2VH5R 3OCWA 3V8PA 4XIIA 4NE7A 1JAYA 1D2AA 3R7BA 3X2SA 3AP3A 2I33A 5AVTA 4RZXA 3ZHOA 3PC8C 3L7YA 1CBUA 1D5WA 2QB5A 3FVRA 2VPWA 4MQMA 5JAUA 5A06A 2JAQA 1BE8A 3C70A 5EE9A 3PUKA 4GP9A 3GUCA 3OPYB 5EJ2A 5JMWA 3M2PA 3A9SA 5DI9A 4EY8A 3T7DA 3R44A 5IZCC 1BDIA 3UK6A 4U1RA 3G5TA 4EY5A 1WWKA 5JOQA 1JIKA 3BA6A 4GOJA 4S24A 4XUGB 2H5LA 1RXCA 1DC6A 2RGRA 1HI9A 1MQAA 2VJNA 4OG2A 1E4VA 2GBPA 4RVHA 1VHJA 1ISFA 3ZU5A 1J0BA 6REQA 4C1BA 1NKVA 3UMSA 4PSVA 1ESZA 1G20A 4JXJA 4O4JF 5CVUA 3UVEA 3TQQA 3DOHA 2ZB3A 4CKCB 1TEVA 5ECGC 2ZWVA 3D3EA 2J9XB 4JXZA 1A8UA 1LSUA 1SU4A 1CZHA 4FLFA 2IIPA 2ORVA 1DG9A 3TRKA 1M8FA 4ZDIA 2DR0A 3MOIA 3AXSA 4CKZA 1VCHA 2CMHA 5CIQA 3AF6A 2II6A 3E4CA 4NOMA 3DTVA 3TL2A 4V1CI 2GLUA 4IBOA 1P80A 2VNSA 1YBVA 2JFGA 1HMPA 3QHQA 5EQFA 1L8LA 3FA2A 3KAPA 3KQVA 4MO9A 4B4DA 2O6LA 1RI2A 3G1WA 4CG0A 4PZ0A 1XA4A 3IOBA 3FAKA 1DUSA 3M6LA 4GH5A 1THGA 2JI7A 1RZVA 4G8CA 1DFHA 2YCLA 3EAFA 3QPDA 3ANXA 2H63A 4LRXA 1OBVA 1W4AA 2VHWA 4OMCA 4V0RA 3JU3A 4CEJA 1AQIA 3GJ6A 1NOKA 4QFCA 5IT0A 1XQVA 1CR1A 1AMUA 1SVLA 3QELB 3C45A 4H4DA 2WUFA 5MN6A 4KPEC 2JFYA 2EF0A 3OFKA 4OFXA 3QE2A 2FFRA 1VRWA 5I7HA 4PWZA 1Y1QA 3L8EA 1PSDA 3DTYA 4DNPA 4LECA 3EZLA 1U2GC 2FWPA 2ADFA 4QOSA 2W2NA 1KS2A 2Y6UA 4PINA 4PAGA 1IZZA 2IYZA 3ASZA 4K9QA 4F3KA 3WXBA 4IRXA 3OQ1A 3H9BA 3BIJA 1X7XB 3TD2A 4H7JA 3V7WA 2IYSA 1XZ8A 2IYRA 2X4LA 4HQFA 3RRMA 4RPLA 3ZQKA 4XUDA 1MVLA 1T5OA 3H0EA 2E4UA 3A1NA 2PCLA 1AZLA 4M1MA 3QBVA 1VQ1A 4QLOA 4EABA 3QNWA 3CA8A 1CU1A 3NDRA 4G01B 3QKTA 5TVGA 1EB8A 1E92A 3U6BA 3WB2A 3QIVA 1SC4A 3E03A 3I2GA 5C51B 4AQYB 3OPYA 1FJXA 3GVXA 3NDPA 4JYCA 3WNZA 2HMVA 4RUKA 1PP4A 2BCJQ 2VTDA 3U5ZB 1XZBA 1POWA 1DAPA 1A7KA 1YUBA 3GEEA 3M4NA 3K5HA 3OT1B 2ZBEA 5LSAA 3E7WA 5HS6A 1JKIA 4FMBB 3U6KA 5D01A 3DMTC 1G4HA 1NSYA 1BMTA 1DRWA 1NSTA 2CXTA 1XWWA 2XMSA 4JODA 1LFDB 4QNRA 5DX0A 5C1IA 3CTPA 2ZK7A 4R84A 4WDRA 2WJIA 2E1RA 4GOOD 1YHYA 4ASUD 4CKCA 4Q15A 1QGUB 3EOBI 3HY4A 4L57A 4MUXA 1OF1A 1DBVO 3W2FA 1KJWA 1E1RD 2HXYA 1WR8A 2N3ZA 2EFCB 4RULA 1P1JA 4B84A 3A7EA 5DW0A 1VM6A 2GARA 3PP8A 4ES6A 5ALUA 2B4QA 4F5YA 2PL3A 3V80A 1YJCA 5CDSA 1Z0JA 1BJTA 1UWKA 2OBNA 2J5BA 1XCPA 3AR7A 3WMGA 3ZI0A 3L1UA 2HJRA 4MHOA 2DULA 3SNKA 5A02A 4JL5A 4JYAB 4BX3A 1NW8A 2C5BA 1GIAA 4FMCB 4IMJB