2XD9A

Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-4,6,7-trihydroxy-2-((e)-prop-1- enyl)-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
153
Chain Sequence
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Tetrahydrobenzothiophene derivatives: conformationally restricted inhibitors of type II dehydroquinase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 55
structure length 153
sequence length 153
chains with identical sequence B, C
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2xd9A00
1V1JA 4CIWA 2XB9A 2CJFA 3N76A 3U80A 3N87A 4RHCA 4RC9A 5B6PA 1GQOA 4ZC1A 2BT4A 5WRFA 2XD9A 2Y76A 2WKSA 2XDAA 4CL0A 1H05A 4CIVA 2C4VA 4CKZA 2C4WA 4KIWA 4CKYA 2DHQA 2XB8A 3N8KA 4KIJA 4B6SA 1H0RA 4CKWA 1UQRA 4B6OA 3N59A 4V0SA 4B6RA 4CIXA 2Y71A 4L8LA 1GTZA 4KI7A 4B6PA 4CIYA 3KIPA 3N7AA 1H0SA 1GU1A 3N86A 2UYGA 1J2YA 3LWZA 4B6QA 2Y77A 1D0IA 4CKXA 4KIUA 4CKWB 3N8NA 2C57A 1GU0A
chains in the Genus database with same CATH superfamily
5K2MA 1I0IA 1Z29A 5B53A 3KZVA 2JFGA 1CQIA 4LSMA 4HNAA 5H82A 4RVSA 1JDBB 2VPZA 2P90A 4MWOA 3B7GA 2VJLA 3IJEB 3WFZA 1XTBA 1RAHA 3PYLA 4UNQA 4HGOA 2WM9B 4HDMB 1XRRA 2NVUA 1A27A 2EJUA 2AE2A 3OT4A 3HLTA 1R74A 4KE9A 2ZBVA 3DFMA 2OSVA 4JBNA 4L8FA 5C3UA 3KWMA 3VKFA 3VA7A 2ODQA 3EXG2 4D4GA 3AVTA 5JOQA 4X7RA 1O6CA 2WHXA 1FQOA 3E05A 1WCIB 2FR1A 4KSYA 3U4QA 4RSGA 5G53C 1JB9A 1L7BA 2K87A 2PCJA 1VYTA 1K98A 2RGWA 1B6TA 3BH7A 1HQDA 4KP7A 3D7NA 4MP8A 4O63O 1AX9A 4QG7A 4Z86A 5EZ6B 3WKCA 5G4LA 1ANKA 3U44B 3D0KA 1WBJB 3SEAA 1QCYA 4DNXA 3RVDA 1NW5A 1YH3A 2EJWA 1P2DA 1JQEA 1M1YA 3REQA 1QVRA 3LQKA 3O9MA 4IV5A 3DYVA 4NU6A 2R5FA 3V5NA 1ZNQO 1JU3A 2XMSA 5GADl 4OK5A 2QK4A 4FFLA 2GLTA 2ZRFA 3GRAA 4E3ZA 3IHTA 3VKHA 1FDOA 3ZU5A 3K70C 3A6HA 4ECAA 1HR0B 2HRRA 1FBNA 3H5IA 4REOA 1ONBA 1JXOA 1NMYA 1WLYA 1A8SA 4LOHA 4LOLA 3RYIB 3K35A 3ZHOA 2WF8A 1OF1A 4GXRA 3A36A 3OIDA 1I6LA 1MBZA 1H2YA 5LQCA 1NW3A 1KQNA 2BTQB 1F0KA 4I4CA 3TBHA 5JQWA 4OX9Y 4S1VA 2O8DA 1KPHA 1XXHE 3BGSA 4Z7JA 4A7PA 5JXJA 2AI2A 1E2FA 3M2TA 3KT3A 4RORA 2C8LA 2ZJOA 1PVVA 1JR2A 1X2BA 1JHYA 2GZRA 1UMBB 3G0CA 3KEOA 4IXNA 4MVJM 2X13A 5D6NA 5HJ2A 1ML4A 3RS0A 1J9ZA 1BJRE 3AJ9A 4KLNA 4ZGBA 3B48A 3FB1A 2A0UA 1CERA 4DMHA 2WD8A 2XNSA 4HEQA 2IUTA 2DMRA 3JW8A 3KZ1E 3IX7A 4I1OA 1NU8A 4PBSA 3SK0A 4BOYA 2Z3ZA 4MUXA 1Y3FE 4H4CA 1JKXA 4M3NA 3IAS1 3VTZA 4JK3A 4S04A 2GZHA 1COWD 2IS1A 1U2TA 2W00A 4EY4A 1MB0A 1U3TA 2PTGA 5ALHA 3AUKA 4C78A 1U90A 2C29D 1QK4A 5BN4A 5DYIA 3KLBA 1YQUA 2AJDA 3T41A 3QYPA 5LVAA 1DKNA 3OLVA 4ZDJA 2UUAB 1RFLA 3ZWPA 4N8SA 3QFSA 3OM0A 2Y92A 1QDEA 3FZEA 4AF8A 4C0XA 1U5BB 4EQ6A 4EWLA 3VHLB 5HGXA 4X92A 2FJUA 3CNQS 4TMWA 1NJ6A 1J97A 5KYTA 1VYVA 1XTQA 3D6UA 1X9IA 4Q9NA 3KYIB 4V3BA 1Z12A 3EBOA 3UATA 5KKCA 1KH1A 1ZMXA 3GV0A 1U0BB 4IIEA 1UJ4A 3DE6X 5HMMA 4H7DA 2FZ4A 1S3SA 3ZZNA 1OH7A 3EMDA 3AL3A 4IDGA 4IDEA 4BVAA 5FOWA 5E3JA 4ZPXA 4M8NE 3DOIA 5K0SA 2OZVA 3K2BA 4R98A 1HT3A 5M04A 4H6XA 4P83A 2BEUA 5K3OA 3S81A 3NIWA 3LDUA 2QD3A 5DNVA 4CZ2A 2WMNB 2Z95A 4I6EA 1F7VA 1T3SA 5DEOA 3RSFA 1GAEO 1T15A 2DFTA 1UFVA 1KI6B 2HQRA 2ZSKA 3BWVA 4G84A 5AIAA 1GXSA 1NBOA 1EPUA 3CO0S 3QG1A 1JT9A 1Z8DA 2DFNA 1V5FA 4IVQA 4L22A 4GPAA 4N0EA 4C3OB 5AW3A 4OI0A 3AL0C 4Y18A 3F8TA 1KVQA 1F2TB 4QOJA 5DTMA 4D8XA 1I13A 2B2NA 3RVOA 3LWZA 4IZOA 3FRIA 4FBGA 4MDYA 1NXWA 2P78A 4UTOA 2JK0A 4O4JA 3IPRA 4MKXA 4CFYA 1IPFA 1CTQA 1KO1A 5CVTA 5T67A 3MLBA 5FLKA 1RYBA 2YV1A 1J42A 3ELYA 5BSVA 2IXDA 3EVDA 4BNIA 1BSVA 5CT5A 4LJYA 1FMLA 5K8UA 4PO8A 3NHYA 2VC2B 4H4DA 3GMTA 1DTSA 1W36C 4OK3A 4XOIA 4GOLD 3P9QA 2JAUA 5ESXA 5LLTA 2PZJA 2QE7D 2GJSA 1O96B 2VYVD 2YRXA 4FWBA 2AEFA 4G0MA 1YQWA 2A0KA 2J5XA 1TPZA 4HNSA 4GMHA 3PEFA 4LRXA 4Z0PA 4EJFA 3FYTA 1WW3A 1OAOA 5JBIA 1IJKA 1EFRA 1TT7A 3HB5X 1D6SA 4IRUB 3DWFA 3N1UA 2RGEA 4ZCPA 2AN4A 1G5HA 2WINI 4RGVA 1NSTA 4Q21A 1ZM3A 4BWFB 3TLEA 3A1VA 4RFSA 1QFSA 4HTFA 5K0CA 1R8QA 2PUDA 4E21A 4E1VA 2VS1A 3ORQA 3FUCA 4R7ZA 1M0WA 1N75A 1WB5A 5TV2A 3A28A 3GLRA 3TRIA 3SSMA 3SBOA 1XZLA 2B7LA 3OX2A 2IL1A 4TV9F 4AO6A 3IXMA 2AKAB 4NWIA 3W5DA 4LE2A 1L1FA 3MWFA 1W85B 1OROA 3GDWA 3H9UA 4OJTA 2XQVA 2WI8A 3TFOA 2AJLI 3D7MA 1H85A 3BRQA 4JASB 4P4TA 4UD2A 2RAUA 5LD2C 3ESBA 4Q5IA 4A0GA 1KI1A 1W0CA 1ZKDA 4ILEA 4OI4A 1VJCA 3U7EB 3LT5A 3FFXA 3ROGA 4DA7A 3DL7A 1Q44A 3SEQA 2XUKA 2KBEA 1EVKA 3BXZA 5C8YF 3ABSB 4XSHA 4NFLA 4XGQA 1LBIA 3AR6A 2Y0DA 5GZ1A 4Q7JB 1Q6YA 3F46A 5KYXA 2VUTA 3K31A 1F4PA 1P29A 2IEZA 1ZWLA 3M4NA 4GMFA 4JY7A 3ZCQA 4NYMR 1I32A 3LG2A 4IXDA 2PT6A 5ER6A 1FYFA 5THKA 2D0PB 2OR3A 2XNHA 2G09A 1J2RA 3ELBA 1I14A 1O4VA 3GLTA 4NU0A 4UNPA 4WEOA 4JP1A 1Y37A 4H27A 3GROA 1E79D 2FG6C 3UK0A 1XRSB 2IY8A 2YR0A 3E5RA 1XWFA 5JRZA 1RPZA 2XQKA 4LXXA 4H1VA 4CKXA 1IQ0A 1A77A 4R2KA 3TGWA 2E6UX 1QXSA 2XMCA 2E5FA 3ES9A 4B3SB 4JYAB 2GO7A 1HMYA 3A70A 1VKZA 1J5EB 4BUZA 2ZYRA 4FT2A 4C3ZA 3QRWA 2ZYUX 3IT3A 1DWOA 1CT9A 3CMMA 2H1IA 4H16A 1IN5A 3Q9LA 3HWSA 3LDFA 2MSDB 3LT4A 3ND6A 3OQIA 1SHTX 1PQ4A 3B3GA 4OPMA 4QYXA 4RZXA 3IDSA 3OECA 1BXRA 4I2NA 4ER3A 2GFHA 4QNRA 1MQ9A 2BH9A 3VSCA 2ZXUA 3VAYA 2AOXA 4L5AA 1LK5A 1RWBA 1XL0A 2QMHA 3R3XA 1DCFA 4NE7A 5AK4A 4YXFA 1AS0A 1L4EA 4C6HA 5FPKA 1R12A 3SS7X 3N8IA 2VDLB 3L0PA 4KX5A 1QORA 4LY3A 2ENUA 1HDEA 4X71A 3T95A 3BGIA 4LDJA 3UJ6A 5JS6A 1OASA 4GXNA 3U17A 5AW4A 2ECOA 1A9PA 4F8JA 3I1IA 3PPIA 1GTRA 1X13A 2QX6A 3NHJA 4HV4A 2ZTHA 2ORED 4XD7A 3MA0A 2CNLA 2WFLA 1DDOA 3MTDA 4GI3A 521PA 1TA9A 3ZIDA 4ZCLA 4PHHA 4Y8VA 3A6DA 2VF4X 4IOMA 3H2IA 3MGBA 2FWIA 3AILA 2IU0A 4IIJA 4CMEC 2PKQP 3WYCA 2F43B 1MP0A 2BLLA 1KORA 1NLZA 4X1KB 2WU4A 5CD1A 3Q6MA 4OYLA 4FOPA 4AJHA 1OZFA 2G9UA 4RKRA 4EG4A 2RI6A 4BO4A 1C4KA 3EXHC 4BCBA 4ZHSA 4B45A 4YCMA 5FPTA 3HZRA 2J9GA 2CV0A 3JWHA 5KO2A 5CVJA 2ATCA 3FOCA 1K88A 4LPSA 1TCCA 4TTVA 4ZIRB 3H99A 2W22A 3G02A 3VTFA 4KQGA 1Q3TA 121PA 4GRAA 4L74A 5CBPB 3MRTA 4DT1A 1T0JB 3D8NA 2G88A 2HY7A 1J21A 3HGQA 3LBAA 1UEIA 2AN5A 4LGMA 4MVJG 4AJLA 4PC7A 5ESRA 3SC2A 2AXEA 1BG6A 1JFRA 4NS4A 1C3OB 2OYCA 4MB6A 3W5HA 3IMCA 3K0CC 4YRMA 2GILA 1RM4A 4TLAA 4ZKEA 2AVDA 4B7XA 5IXYA 2DR2A 3QJGA 3IAFA 5BSRA 1ENOA 1JNXX 3ACCA 1TIPA 2ZR0A 1ZQ1A 3IAAA 4CLOB 5C7OO 1I2BA 1ORIA 3EXEA 3OF5A 4G97A 2WPNA 3SSAA 3HP4A 1F8FA 1JSLA 1P74A 2RH5A 3AHHA 3ETGA 4NOKA 4OTZA 1IQRA 4HAVA 2OHXA 1B8OA 1BE8A 3E27A 4LW8A 2XCIA 2HT6A 3NHLA 4M9SA 3U19A 1J25A 1BEZA 3PBKA 4C7KA 6AT1A 3A9WA 4P6VF 3K9FC 2AG5A 3G1WA 5LXTF 3M2PA 4XVQA 5FQOA 1WU8A 4AG3A 2OORC 3Q7TA 3STHA 4ESHA 2CHVA 1J39A 1I3MA 3DZKA 3P9NA 2GD1O 4GPEA 2R6ZA 1Y6JA 3L4EA 5B12A 1GRNA 3VR0A 4EECA 4JQSA 1TLLA 2PLAA 4ZT3A 4DY4A 3QPVA 1TTTA 1E94E 1C4XA 1HKUA 1XZEA 5EMNA 4ZARA 2OFFA 4O33A 1X1TA 2E7ZA 3BFKA 1ORWA 1PEKE 1NXTA 3ZDXB 1ZG3A 4LZNA 3CB4A 4PHFA 2HF7A 2XTMA 2YZKA 3DF7A 1E2UA 5AM0A 1XRMA 5ECYA 4AM8A 1FSGA 2C2YA 2V6GA 2N1MA 2EWVA 3PVSA 4CMAA 4DZTA 3U16A 3NWOA 1T1RA 2R4QA 4JVNA 4LYYA 4Q24A 4UMEA 1PNOA 3G6WA 1DX4A 1H9AA 1QGDA 2NT3A 2VBFA 3DBRA 3AR7A 3K0FA 3CY6A 5GVSA 2Q1SA 2YJNA 4GYYA 1I36A 3G8AA 1JJIA 1LLDA 4FN4A 4D80A 3DNMA 5A7GA 2J8ZA 3RFCA 4EKGA 5LQUA 3LQ4A 3NJRA 3QITA 2HCTA 2ATXA 2GVDC 2NUAA 4O4IF 4MKRA 5JARA 2JLWA 4ZT5A 2EG5A 1XGKA 1OT3A 1EQ2A 3HDYA 1N6IA 1OYOA 1XELA 1PFGA 1ZZEA 2A5JA 4LYJA 3I9OA 5F1OA 3ZLVA 3TNDA 2EFHB 4TV8B 1VE5A 1QJCA 3WIUA 2R00A 4DLSA 1JA1A 5L3SA 2ZB7A 5LQKA 3EHEA 4HVLA 1W52X 5BV1A 4RYDA 2GXAA 1F2UA 3PFIA 3KV3O 4PQYA 4B4DA 1KAHA 1N2BA 4NJEB 1DIHA 1EUCA 1JNYA 2E9SA 3IV9A 2W90A 2W0SA 4N7RA 1M2OB 3UHOA 1GPDG 1Q83A 1XIVA 2BFDA 3M4YA 3CINA 4YBRA 1RE0A 5IT0A 2MT9A 2PYDA 1OTYA 1VGVA 2BZ0A 1IAQA 4JGIA 3GFTA 4D4KA 1SHJA 2FPUA 2YJ4A 1KU6A 3AHCA 3L5KA 4QREA 1DX9A 3KZKA 2DSNA 1C7FA 1S9HA 1ZGZA 4WK0B 5EHZA 2N46A 1T2FA 1G8SA 1HA3A 1A8UA 1W19A 4DJEC 1KZGB 1QV6A 2MOKA 4NBRA 1WOYA 4NBLA 4F6RA 3DT6A 4YR7A 5I7EA 3GRPA 1DAKA 4KSBA 4PZZA 1F06A 3GLVA 3MOGA 1KYWA 5IM5A 3FPEA 1OX5A 3KCQA 5FFNA 2DUJA 2DECA 1D9ZA 1E20A 4QXPA 1ZICA 4RS3A 1NV8A 1RMYA 2I4MA 2RHDA 1SVOA 1ZU4A 1XMIA 4CDGA 1LF5A 3NHRA 1AK2A 2OYRA 5MN5A 1Z83A 5LKRA 1U0SY 2J3IA 2I03A 2UU9B 1RPTA 1IY8A 1G8MA 1ZEJA 1Y8CA 2ZTLA 3GIWA 1Z6AA 1T4GA 3GOQA 8ATCA 2JHFA 4I4TA 4PG8A 2XGSA 4PQGA 3A3KA 3P2JA 2RGDA 2VZ9A 3V7WA 2NSDA 2VDKB 3ZXSA 3ZVRA 3FUTA 5I6DA 2HH9A 2WVAA 1DXOA 1K66A 1SCUB 2Q5QA 1OBHA 3G0DA 2CLMB 1INLA 3KTAA 3KNZA 4JH0A 2F3SA 5I7AA 4CIAA 3FOEC 1C3XA 3KLNA 1UQUA 4K3UA 3WGTA 3T12A 1O57A 1WDMA 2H7CA 4PW0A 4KSCA 3QVGB 3WHKA 4DM7A 2DFVA 5AK3A 4ZYVA 3IUEA 4W8GA 1E63A 1D2HA 3M4XA 4Q1FA 4G9GA 2EX1A 1TQ8A 2EZTA 2Z04A 3CF0A 3D6JA 2ZBUA 4QO8A 3E48A 3N39C 1VIMA 2XOEA 2XOKA 3C6YA 4J8PA 1VLQA 1K68A 2RAPA 4ZI7F 1EWTA 1BYIA 1PT9A 1E32A 1F60A 2ASEA 3FMGA 2UZ1A 1ULSA 4Y2SA 3FHOA 4WUTA 4MVJE 2O2YA 5BN3B 1FTSA 5HQ3A 1C9MA 4X93A 1SCKA 1T2AA 1ZNZA 4NXNB 1EXDA 5DTJA 1UK8A 2QJTA 5U9CA 1H4SA 3U4GA 3F8SA 1VCIA 1O8CA 4A1FA 1IBLB 1UKBA 1VSBA 5AXCA 4DRYA 4PZPA 1KYIA 3HXKA 3ZDQA 1DAHA 1OWMA 3SI7A 4LYEA 1MJFA 4TT3D 2ZYAA 4ZYUA 1HL3A 2F3QA 1WL8A 2BSQA 3BMQB 1NX6A 4RZUA 2O2GA 5CJJA 2BISA 4CKZA 1GLGA 3ZPXA 1JZQA 4PC3A 1RADA 2YINC 2FEKA 1JPNA 2Y1LA 4HWRA 4CGYA 3P2MA 1QO9A 5FAXA 4WK4B 3A7EA 1XVTA 4Y2JA 1GQ2A 1OGIA 3DH0A 5IXSA 4B3RB 1HZZA 2WR8A 1VIDA 2G9NA 4CUJA 4BKPA 1FFAA 1RS0A 3IBCA 3LGAA 4G5QA 4D4HA 2VQFB 2PQ2A 1RAIA 2C77A 4N18A 1Y7HA 3AINA 3PNPA 3G5TA 2CE2X 3LI2A 4NOMA 4JVSB 3MINB 2NXJA 5CNJA 5EQDA 3BE6A 3MCUA 4M7RA 3D7RA 2XUPA 4AY5A 2UVPB 1ZRSA 4MR9A 3EDOA 2K6GA 3CXRA 2CUNA 3EIUA 1XA3A 5D2CA 1N4AA 1VGQA 4M1QA 1SMKA 4ACAA 1ZAYA 3WK9A 3FMFA 2BC9A 2F1KA 3MMPA 1C29B 2P3QA 3DVAA 2VZ8A 3R5JA 1X7YB 2FN7A 2INGX 2J09A 3CO5A 2CJPA 3F4BA 3DFUA 3NATA 4FD2A 3NCTA 2Z08A 4E14A 4EKIA 3I37X 4MKFA 2H57A 4PN7A 1QFYA 2Y2VA 2ZE6A 4MAMA 5DHAA 3OT5A 4KR9A 1C9NA 1P44A 4F8YA 1YDHA 2WJ3A 4PVCA 2EF0A 3VDMA 2V7WA 5L8VA 2NMVA 1GGFA 2Z6VA 4U9UA 3JYLA 5FO1A 2QMOA 4WT7A 1U94A 3AP3A 2WTEA 1MOPA 3VX4A 3ZWOA 1TF7A 1IXKA 4EYOA 1TUBB 2VSFA 4EB6A 1UP6A 3TQFA 4ESVA 1BVHA 5BWBA 1A5AB 3OBBA 4UHHA 4NRDA 4AJ9A 4BLSA 2ZWMA 1DTWA 3QUCA 5A4IS 2QPOA 1DHTA 3NFYA 1PFQA 4WQMA 5EMMA 1DS6A 2HIAA 1ZISA 5BVGA 4EHDA 2V3CC 3F9IA 4LECA 4XA8A 3UF0A 1HKHA 2AE1A 2IQ5A 3QNMA 4PAGA 3HVUA 2C95A 4U2DA 2QTVA 4M55A 4KXNA 2PSJA 2XQFA 2AI3A 4GF5A 1CHDA 1VE7A 4YVFA 4I08A 1W4RA 1Z6ZA 4URUR 1YBAA 4XIYA 3UB3A 4OXRA 2VDVE 3DPUA 4AZ3B 1LPAB 2XSZA 4DR7B 1JDVA 1VI5A 1P1CA 5K0TA 1NN5A 2R8ZA 1OX4A 1T36B 2W6ID 4LHZA 3SQOA 3I2GA 3VYTB 5KS2A 3ESYA 1U9ZA 3LRPA 4WI1A 3W9YA 3NXKA 3CNNA 4JA2A 3EXIB 1J6UA 1ZJ5A 1DO2A 1ESNA 3ON5A 5J2TA 1J24A 1XXHB 4HWPA 4YDSA 4E5PA 1D4AA 2VUUA 2JA1A 3FVVA 5COQA 4BX8A 3GP5A 3EFOA 3N2GA 1NZFA 1OD6A 5AT1A 4LWZA 2RGXA 1DC4A 3HI4A 1DCTA 2ZRCA 1PGJA 2J9RA 3NDRA 2HNAA 3IAXA 5EQFA 4OEHA 2QG6A 1NT4A 2V7BA 2WKQA 3PZRA 1OA0A 4FI3C 1JR3A 1TPYA 2XMRA 4LK3A 4B6QA 3GAZA 4YMSA 2PZEA 4Q4AB 5HF9A 5L51A 5J23A 3KEQA 5DI3A 1U98A 1I4WA 2R66A 3A1WA 3A37A 3LH5A 3QPUA 2HK9A 4NJOA 2BKXA 2OXCA 3QFRA 2CVFA 1WMFA 4DC9A 5L3RA 3UWOA 5ISMA 1ZVJA 4QFCA 5FBWB 1AV7A 1T13A 2ZYGA 4OQYA 3WK5A 1MAVA 1G63A 3F0TA 3FFWA 2QTMA 2W93A 3SDSA 5KU1A 4UHEA 2A7XA 5EINA 5K0BA 3ZWNA 1LW6E 1G5RA 3X2SA 1A9TA 3GMDA 3U3JA 3BIOA 1L7QA 2X2FA 4DAEA 3GFOA 5IHPA 1JS1X 4CCAA 1Q1BA 1HQKA 5TIIA 1SUPA 1B0UA 2OCYC 4O2AB 4TRNA 5J5AA 1T2VA 2QM8A 1VC2A 2H7XA 2HRBA 3A25A 2ZJ6A 1ZYUA 5J3JA 1E18A 1JLLA 1J2EA 2VTDA 2CWDA 2QZJA 2YL2A 2VLBA 3UXEA 4RF4A 3EZ2A 4FGKA 2PQ6A 2XNDA 3R6GA 3SJBA 1T5LA 1OFVA 2XVXA 4RVGA 1AQIA 2PMWB 4R1UA 1SQFA 4YXWD 1FLVA 5C8DA 4QHTA 1E59A 4MKZA 3TSAA 4A8JB 4WEQA 2NW6A 3QG5A 4M36A 2NV0A 4ETIA 2AW5A 3MZ0A 4MUEA 1IM5A 4PIVA 1UZNA 1F48A 4KMMA 1YTUA 2IHUA 3KUDA 5J4YA 2BELA 4E07A 2HADA 5IUNC 4GLOA 3BRWA 2Z2ZA 4Y9TA 1H2AS 1GIAA 2GCNA 4YRAA 1DGQA 4DUYB 1GT6A 2CD9A 2IYRA 1E1CB 2PCLA 4Q1DA 3QYAA 4J2TA 1A98A 1VSUA 2JFBA 4HLDA 4D8UA 5KWIA 2QRGA 1SU4A 1Z2OX 2GJ4A 3KOMA 2OENG 3NAZA 4IJMA 3SY8A 4AG6A 4PO9A 3VPAA 4Q9LA 1V6SA 2C2KA 1F38A 3G2KA 4MW5A 2HJRA 2VT2A 3O8DA 4IDAA 4LUCA 4GWKA 2Q5CA 4FMCF 3LY9A 1D2GA 4KGVA 2G4CA 2C3MA 1E3JA 1NRWA 3E3AA 4NQZA 4QDUA 3H83A 1NFQA 4DJAA 4Q34A 2GYYA 3T8YA 4B8WA 1NI3A 1JG1A 1JXAA 3S0JA 1K4KA 2B78A 2OCAA 2ODNA 3BE4A 3ONNA 3D43A 2CHUA 2XUFA 4RD6A 2YWGA 1XHEA 1PAUA 2ZEJA 1FFEA 1ISFA 3EIWA 1T3HA 4E5VA 1P33A 3L6UA 1FS4A 4L95C 5IKXA 5IKOA 1VZ2A 1GAXA 5I9IA 5A71A 3M1LA 4S2UA 2JFQA 2GZ2A 3KBBA 1LVUA 1PVDA 3TIVA 3SQWA 3UB2A 3MUEA 5NLLA 1OWPA 5U1PA 1IN1A 4PY2A 4UKDA 1XZPA 1JHAA 1YKFA 3G9TA 1U81A 2JFZA 3VOAA 4QD3A 1K2WA 3WLIA 3CF2A 2EKQA 3E7FA 4QBKA 2FV8A 1NA5A 2GBGA 4LV8B 5CLIA 1Z2AA 2A9KA 2EW1A 1N0HA 2YXDA 2QMEA 1TT5B 3AFGA 3UUFA 5CJPA 4U7DA 1Z0UA 1P2BA 1SQGA 4M7WA 1QYWA 1N0IA 4GU5A 3UAYA 1BA2A 4P4LA 1KMNA 3B6JA 1LD3A 3IQEA 1L4BA 3ZW9A 3DMFA 3RU2A 2FU5C 4ECEA 3I0ZA 3AFMA 3RJZA 1KL7A 1TAQA 1X6VA 4DCJA 4BS9A 3ZCUA 3M9LA 3QU5A 2Q2WA 2V4MA 3X1KA 2V96A 3E70C 4BO0A 4BTLA 3O73A 3Q2KA 4BX9A 3EIHA 3IILA 4GW3A 4BNTA 4R0MA 3OC6A 1NIPA 4F46A 3N53A 1Y1KE 4DRZA 1N7GA 3ENVA 2APJA 3C3DA 2AQHA 2ZRQA 3HCOA 4KIWA 1DJPA 4HAYA 4TMZA 3WQBA 2W71A 2N0SA 4RW0A 4ENQA 4YCSA 2C04A 3ZZTA 4TWAA 3BEOA 2M1XA 1IH8A 3BG5A 3QVJA 2ANBA 2NXWA 4OJKA 4FMPA 4MR8A 4FLEA 3OP4A 2IWRA 1CP3A 2QAGC 5F21A 2XV1A 4BV8A 5KSWB 2NXCA 4FCWA 1NBIA 2JJYA 4RANA 3ZCSA 5SICE 3BL6A 2QLMA 1RP1A 1C3JA 2GT1A 2ODTX 4ALLA 2VF8A 1A71A 2RJOA 3DP9A 1CYEA 1S2GA 4I2VA 5IAGA 4F4FA 2FN9A 4HUQB 4NCIA 5LP6F 4M6WA 5KWJA 1H6CA 4FE7A 1IZ0A 3W1EA 1V96A 3TNFA 1E7YA 1ZIPA 1GV1A 1YRLA 3B1YA 3BL5A 2RI1A 1X9GA 3DDHA 3AYXB 1P7VA 4H0FA 5IAAA 3CZ9A 3DBOB 2X0NA 4HB4A 4B6SA 3ZWWA 1A04A 2Q4RA 3C1OA 4UFOA 4ZANA 4C08A 5BMVB 4W5RA 5D5HA 3OBIA 1C0EA 4JL6A 3L82B 3UJ9A 1VPTA 1M3SA 2JGJA 3FKSA 3CMCO 1XVAA 1Z5ZA 2HEGA 2XTAA 4P53A 1II8A 1QSGA 1VOTA 5DOZA 1U1FA 2C7PA 4IJ5A 3S6JA 4JB8A 1QR2A 2ZVQX 4URHA 5FXMA 1CNMA 3EXFA 4HNGA 2VDRB 4N9WA 4H15A 1T3TA 3D8RA 4AX8A 4GPIB 5B2FA 2CFRA 1G8FA 2C8JA 3PT5A 4RLQA 3TZEA 2FSHA 4JLMA 1JFLA 1BOOA 4K6OA 1X1CA 4L15A 4NZMA 4URFA 4X1IB 2HBQA 1TDJA 4IJWA 1TJPB 3LY8A 3CVXA 1NBME 4XZ3A 2DF8A 4CMEA 2IS4A 4FKBA 1V45E 4DA8A 2I66A 3EUAA 5BSMA 3CGWA 3EARA 4TRRA 1F9AA 3LF1A 3OQMA 4CQJA 2I2WA 1SUWA 5KVSA 3BT7A 2GD0A 2BEVA 5A05A 1HO3A 2PIAA 3LDAA 3O94A 3EG9B 3TLMA 4FSXA 4DQKA 4URWR 2NAPA 3EXHA 4FYXA 3V8BA 4X5OA 4EA8A 3HA2A 1X8KA 2JI9A 4WLVA 4F92B 4B3GA 3EQZA 3HP1A 1WUJS 5KNCA 4IIXA 2X14A 1A5BB 1P61B 1ODSA 4N47A 2G4LA 3ZWYA 4F5ZA 2AUTA 5FWDA 2VQ3A 1GEEA 3ONVA 2EU8A 1PJ4A 2OCKA 4ARSA 2IDMA 2DLNA 3I39X 3Q7QA 5D86A 4EG6A 3SP1A 4BQRA 4ND2A 2Q07A 2VOJA 1EFRD 4HQ6A 2ZKLA 1E6LA 1XROA 3LUJA 2C2XA 3I73A 3NP7A 1Z3CA 1YZYA 3O75A 1TCBA 5KWEA 1RFGE 1TEXA 1YIOA 4M9CA 4WA7A 5IEJA 3W6NA 3BJRA 1W5FA 4UM8B 3D6MA 1M6EX 3U2QA 1QF9A 4G63A 4BCCA 3TW8A 5JW6A 2QTCA 1RKBA 3RHZA 3TJMA 5I4CA 1OLUA 3D3NA 1EVQA 2J9ZB 1N6HA 3AIOA 3KB1A 3DFZA 4J2HA 2PBRA 4JT2A 3IA7A 1XPJA 4QUEA 2I55A 3GLIA 5KTSA 4TTTS 1VJDA 4UE6A 5EE9A 3HKCA 3FD8A 1YB5A 4OYRA 4WKNA 3ZHYA 3Q0TA 4ZMSA 3SMVA 2NACA 4IBOA 1L7RA 1V5GA 2FUEA 2V1UA 1EP1B 1N5MA 2OBFA 2YXLA 1XBTA 3M5PA 2FOXA 1C14A 4BNDA 1XPRA 1E2IA 3EOAI 3GCXA 4BL5A 1IWPB 1DC7A 1WUIS 4C7MA 2BHSA 2GBFA 3BIXA 4Y6PA 4RPIA 1KXZA 3G89A 1LCIA 5AW9A 5LQMA 1KI8A 4LZZA 3R24A 1YJ5A 3SZLA 1DC5A 1T5HX 3G3EA 4OHPA 1RXVA 1R7RA 4P9NA 2WAOA 4XPIB 1P4GA 3OSZA 4ZO6A 4XUEA 3H9BA 1QANA 2HK8A 1YOVA 3AI2A 3QWAA 1U0LA 4RE5A 1E2MA 1T5TA 5KMGB 4WN3A 1B8VA 3P71T 3NI2A 2Q62A 2GBLC 3NNDA 3OUTA 5ALNA 1QK5A 3ZCTA 3DG9A 2VXCA 3GEIA 3P26A 3NBAA 4GKAA 3PC2A 4K9SA 4NPAA 1K9SA 1QOQB 1NNUA 2I6FA 4B84A 3G5AA 5K0JA 4RM3A 4JEIA 2GMWA 2ZJAA 1VSVA 4ZEOA 5KC9A 4QBIA 2BKUA 2H0RA 2XI4A 3V8MA 1UXKA 4FFPA 4UE2A 2QLNA 1NI4A 3VJLA 2ZYWX 3E0QA 3LLUA 3PI7A 4JXZA 2F9MA 1YR1A 3OLYA 4CKCA 2EKBA 2DJIA 2JLXA 1F3OA 3D4BA 5EZYF 1L8LA 2AZ4A 2VSOA 2OUKA 3QWHA 4NR0A 2OM6A 4F4UA 5LNK6 4N3CA 5K0ZA 3IE1A 2ZCUA 3EH2A 1X87A 3CW8X 3MILA 1NASA 4JJGA 3IQIX 3QHPA 4I46A 2IFTA 4PC1A 5DHSA 2D4AA 4ALMA 2SBTA 2JGNA 1R0LA 3RC2A 3WWCA 2Q8QA 3A06A 3ANTA 2YJ6A 4AD8A 4L6IA 5JYCA 5EP2A 2VA8A 3ZN2A 1AMUA 2XWBF 1R5NA 2PVCA 4M54A 3HS3A 5CMLA 2X40A 4XD7D 1ETUA 4PLYA 2Z4RA 3OE7A 5ALYA 4P0PB 3GDHA 3TMYA 4K9DA 1FTYA 5E6UA 4ZOQI 5BR4A 1P0CA 2VZEA 3K2IA 3MB8A 5F9HA 2WHQA 1RWKA 1IUPA 2QD5A 3PP8A 3W7BA 4CLHA 2A4MA 4R81A 1GRCA 4FYKA 4MS3B 2ZYTX 1NVVQ 4FMDB 1RHMA 3UNXA 3QVTA 1N2CA 2X9LA 3LNTA 2HUPA 1N8KA 4MR7B 4EY7A 2JAHA 2VUSA 4YCNA 1FMCA 2H16A 2O1XA 5BRNA 4UHCA 3ESCA 3GIDA 2DPYA 2PXXA 1I30A 2QU8A 1C1XA 1NSYA 3DBLA 3H97A 4HH4A 4ND5A 4O2BF 2FQWA 1L5GB 1FU8A 4BNFA 4TKZA 4IW3B 1U4SA 3HYSA 4WZBA 4JXJA 3I9NA 5C8XA 1SUIA 2SNIE 1QIEA 3E61A 4LZOA 4P5DA 1FLNA 4IHJB 4MHTA 2YHUA 3NW9A 3OTWA 3EGOA 3GJSA 3V8RA 3ZWBA 5T41A 1YDWA 2R1TB 1ABBA 3OWHA 1K8RA 3EJ6A 3JYPA 1DBIA 3BILA 1F51E 1Y3DE 4NCNA 1YCHA 4AJIA 4AXXA 1V6AA 3E4CA 2FPIA 2HMWA 5JZBA 5E6RB 1H3FA 1ZD2P 3QE2A 4JU9A 4AY4A 3C6MA 3I9FA 4L8VA 4V38A 1AHPA 5IT4A 4JMLA 4B2PA 3RC9A 5JC8A 2EP7A 3BE5A 4YLGA 3LUHA 3QENA 3HFGA 1WXXA 1YIAA 3GT3A 5KOIA 2KJQA 1UJ5A 1YKGA 3BERA 3CURA 2RHMA 3MD0A 4NMHA 5DYYA 3MOSA 1X7XB 2WM2A 2X3FA 3FOAA 4LY0A 2DE0X 5EG5A 2VK2A 3OY2A 2Q1XA 1RMQA 4EUFA 1GILA 2Z58A 3MCVA 5DTQA 2XITA 4WWHA 2QUIA 4B0PA 4D0GA 1FL9A 2YQ5A 3CNLA 3NAQA 4KWCA 1C2TA 5LU9A 4TWJA 1FUYB 2QSJA 4Z7QB 5IC4A 3K1JA 4D97A 3BICA 3HLYA 1FUIA 3L6RA 1R0RE 4KXYA 4Q48A 1KJJA 4E1BA 4YUZA 5A06A 2HMTA 2OE2A 3B6MA 1FTNA 2FSFA 2ZWPA 3KQUA 4BNKA 5B36A 5EKXA 3PQ5A 1HM5A 4E46A 3MPUA 4Z4CA 3AKYA 3ETNA 3BB3A 1G5IA 3Q2OA 3GB9A 3RBZA 2C0CA 6CHYA 2XE4A 4Z0TA 3ZD6A 4MUYA 1YL7A 1N2GA 3QJ5A 5CCDA 3VNUA 3R3ZA 2QYTA 3GF4A 3HCEA 1PUXA 4O0MA 2GXSA 3RDPA 1E4EB 3KVOA 4B3HA 1G3UA 2FB9A 4BY9E 1NR1A 1XUOA 4DSNA 1TVCA 3ZY6A 3AR2A 1T1GA 1GTVA 1L5RA 1RAFA 1N5JA 3STXA 1V26A 4JR0A 3OH8A 2B1GA 2QV0A 2B1IA 4OP3A 4FZRA 1P7WA 3L7BA 1G1MA 5DVZA 2YWCA 5BV0A 4S0ZA 2XWSA 2VDNB 2X1MA 3A1TA 4ML3A 1BCRB 3AI7A 1MAUA 1JJ7A 1ISSA 1RQPA 4R5HA 3UBMA 1QVWA 3PXGA 3S2SA 1UBHS 4BO5A 4DA6A 5IPFA 1GL3A 1YZNA 3Q0EA 4Q9IA 3KKLA 2OPHA 1WY5A 1BU5A 2E49A 4YRLA 2JFXA 2BEWA 3FWKA 1LDGA 4ZO4A 3ISTA 3R7FA 3RNOA 1Q7GA 2PPVA 3C0KA 1E6EA 1TEZA 1CE8A 2OZLB 5LYJB 3VO9A 2D6FA 4JKOA 3IT2A 4FC7A 1TA0A 4NEQA 4ALNA 3W2FA 5KKNB 2GCPA 4UM9B 3KZOA 1QH1B 2VJMA 1CQPA 3LOQA 2PEYA 3PUVA 4S1WA 2FPOA 1UBNA 4BC1A 2CFCA 3FB4A 3IE0A 1UOOA 1C0IA 5TT0A 1L8QA 3GEPA 4MIYA 4CETA 3U9TA 3RFVA 3ONFA 1CY6A 4GZ6A 5EXTA 4YJHA 2G0NA 3M6XA 2PMFA 5CIWA 2CLDX 1LBTA 2OHGA 3M6MD 1ZQ9A 5EXPA 4BPRA 1YJXA 2C82A 3BQ9A 2IKSA 3IBGA 3IUJA 3ONEA 4O4JF 5EL0A 2MINA 4C4YA 4D98A 5AVKA 5A4AA 3THXA 4Y67A 3FBWA 3PGKA 4KNVA 1HFKA 1Y3CE 3LUDA 1HNNA 3VI4B 1GGMA 1SKYB 3QEMA 1NOKA 1V4BA 3W06A 3KUCA 4DEYA 2PRSA 3PE3A 3W5SA 2A3NA 2C5FA 2XDYA 4HLQB 4M0UA 2YIDA 4HXGA 4V0MA 4HDNA 3ZWDA 1AKQA 1FYWA 4LI3X 2W6PA 3TLXA 4OJMX 4FOLA 2P6OA 4QOSA 5CHEA 2ZDGA 3X1DA 1ESDA 3E7DA 2QJOA 2H1LA 4ZQFA 4B4OA 4ZV7A 2BMWA 5L53A 2AX3A 2HAEA 1KFBB 2ACKA 1KKUA 1TJ3A 3E22A 3QPWA 1XCBA 4A0RA 5EJAA 3T7KA 4AWAA 1S6YA 1XYYA 1ZM7A 2XOKD 2YJ5A 3TVDA 1E0KA 4OLFA 1J2TA 1E3WB 4MRAA 1SPXA 1DWPA 2D1YA 3WLRA 1KJNA 3FFTA 2HF8A 2ZRJA 2FFQA 3HJTA 2FSVC 5JAZA 2EZ9A 2C2GA 4Q4JA 1B43A 1JB1A 1EFTA 4UUQA 3BCSA 1GN9A 1I5RA 2VYFA 2XUHA 3PX3A 1WIWA 5KNBA 4NSNA 1P81A 3IJ5A 4PYQA 4YO8A 1EFVA 1CETA 4KQ2A 1PJSA 1X1EA 2QXYA 4KCGA 4OHRA 3LYLA 4YALA 4CEJA 5DGXA 1HFJA 3RROA 1COZA 2Q9CA 1WV0A 2I8AA 1RBMA 3I76A 1O1YA 3OTHA 2JW5A 2EAUA 4PX3A 1YZVA 4HQ0A 2QN6A 2Y76A 1HGXA 2POQX 4EKNB 4PU0A 4B6GA 4YJGB 4B1FA 4KBFA 1TYCA 2BJWA 5E6SB 1SOUA 3O93A 4TQUS 4BBJA 1LSJA 4CM7A 5JMPA 3OQBA 1K08A 4M2LA 4UW9A 3K0KA 3K09C 4UDXX 3LSYA 2V7EA 5I8WA 1ZDMA 4FFBB 1XEWX 4G4SO 4INPA 3ACBA 5EIOA 4DQ0A 3R6DA 2ZXFA 3AIIA 3ZY5A 4CR7A 1W29A 4HLUA 4Z1OA 4N0QA 1T24A 5EJ5A 3P0JA 1RBQA 4LXIA 3U37A 4DZZA 4CEIB 4EY5A 3IFSA 5I7SA 2C3PA 3NT5A 3EFEA 3BB4A 1Z5WA 3IIMA 4KV9A 4W5HA 5FBZA 4C0BA 1VFNA 4CL2A 3UJPA 5BNWA 3EZYA 5IN4A 4P54A 3VYUB 2Q3DA 2VNHA 2H1RA 4M9UA 2NU8B 3CF4A 3UJ8A 3LCCA 3LVQE 3G2OA 4RQTA 3D3WA 4BLWA 1K6MA 3ZE0B 3HJNA 1KU0A 3AJEA 3DVQX 3HUFA 3V34A 2B83A 4BLPA 1DU4A 1E1QA 1T4MA 4DBLE 1N8NA 2QTRA 5BW5A 1U5AA 3KWLA 4ZHQB 1X1RA 5CB4F 1RRCA 2A3RA 1XDUA 2PUJA 1Q0ZA 1ONSA 1KK0A 2UXBB 2NTJA 2HLPA 5ALJA 3ETJA 3GG2A 4XIJA 1QH9A 2WYOA 2ZE7A 4MZDA 2GWRA 3A1FA 5AICA 1K5HA 1WCWA 3K2QA 3O8OA 3KSDO 2CVPA 4OU4A 1NLUA 4U7WA 3ABZA 1JHUA 1NXSA 4FS3A 4B74A 4CV0A 4N3NA 1TMOA 4LYFA 4DLRA 2IZ6A 4X44A 2XYVA 4NCXA 3TQCA 1QRTA 3IS3A 4MGEA 5DNYB 4HX9A 3TEFA 5JHHB 5A0TA 4MRRA 1MABB 3ZLTA 2AFHE 3OZSA 2GM9A 2X1LA 2CK3A 3ZUPA 3IPLA 3NHFA 4CV3A 1GARA 2X4DA 2NZ8A 4Y9RA 3SFZA 2CMHA 4Q66C 2GPAA 2XSZD 3OFJA 2VTBB 3PR3A 2Y77A 4Y1GA 3RIEA 3TSCA 1BHQ1 1V8BA 1MO3A 2VXYA 1ODIA 1CU1A 1XCOA 3H42B 2QPTA 3DV2A 5SYMA 3U4DA 3REOA 3KOWA 2GCEA 4EGJA 1YDGA 2PRZA 1X8LA 1YL5A 2ZYVX 4H08A 4BTEA 2ZZKA 3PNQA 5IJ9B 2B61A 6REQA 5HE8A 5KJ6A 1SK8A 3PA8A 2WWGA 4DYHA 3KSAC 4Q16A 4H9GA 3SQLA 4FNOA 2GEJA 1N3YA 3D7LA 4V03A 4DSAA 1YXMA 4JBYA 1TU3A 4MLCA 1DIAA 4G25A 5CK4A 4GP7A 5E7IA 5AUPB 1AS2A 5JU6A 3N6RA 3L05A 1ODKA 2VL7A 1JR3D 5PGMA 1YBHA 3PUJA 5KEIA 2FN4A 1W6UA 4RYLA 4XJVA 3LHKA 1IOWA 4I50F 1WBBA 2LXNA 2QAGA 1DC3A 3H6GA 4BU1A 4B6FA 1DEAA 2AMVA 4U3JB 4FFWA 3ZWAA 3D3EA 3LLSA 1NRXA 4P84A 2O0KA 5FCDA 2X9NA 3PV0A 2QRJA 5EC8A 1G20A 1BMFA 4RJJA 5KSPA 1ZH8A 3E5NA 4DV5B 2ZTVA 2AF4C 1RCTE 1TVEA 3CKYA 1XDWA 2ZU6A 1UPXA 4PXAA 4A2QA 3ET5A 4OK6A 1CBUA 2H1VA 2QTZA 1S1MA 1JAHA 3OM9A 3EDRA 4MW0A 3DT8A 1T8PA 1PSDA 2B4AA 4WN9B 3T3MB 5KWSA 1NAIA 3RYCB 1N2OA 4JYPA 1BRTA 4IQFA 1OVGA 1VRCA 3IR6A 1GKIA 1RMTA 3O7MA 3HKEA 1ZJ6A 1CIJA 1F9EA 4IM7A 4MEJA 2XNDD 1G21E 4PLVA 5A3RA 5EIWA 2XE6A 1WHTA 3EWSA 3M4JA 1R15A 1U2SA 3OPYB 5FV7A 4DA4A 4RDXA 1GR1A 2ZSDA 5CK5A 3L0ZA 1W6RA 3ZX5A 5DGTA 3D1VA 4ZMRA 1IN8A 3M3DA 4FE3A 4FLFA 5BNIA 1OQAA 1TZCA 5ICGA 1EWQA 1YT5A 4ER7A 1OPXA 5JAQA 2RGYA 3L6DA 2R84A 4IGAA 3VSDA 1JWBB 4DLPA 3DDNA 2GEKA 2H17A 4XQEA 2D3TA 3ROQA 4MMYB 1W1UA 4J0DA 5L7YA 3JZDA 3COJA 5GJBA 1QQ5A 1ZC3A 5KSOA 3E9MA 1VDMA 3VKGA 5DLPA 1YZTA 5L3QB 3DMPA 3F47A 2ZRLA 2Q41A 4HXEB 5KOHB 2BGJA 1T26A 3NBZC 4PLCA 2IV2X 3TRJA 3S2YA 4X61A 2BKVA 3DDOA 3L40A 3FCSB 4MA5A 1ZR4A 5TS2A 4IJUA 3AFIA 3MWEB 1AVTA 3TDMA 3B53X 3T9BA 1L5HA 2PEZA 1EDBA 2BGUA 2KM1A 4KEAA 1SVNA 1VE3A 4M87A 5DEIA 5LDHA 3TO5A 3GL9A 1NAHA 4A6EA 4OQZA 4EUSA 5B1YA 1QPBA 3VXKA 4D9JA 1PJLA 2JFYA 3FDZB 1Y6QA 2CUZA 2ZJBA 1Z0DA 2BSXA 2ZW9A 3DE4X 4KPUB 1IDOA 1BDJA 3R5SA 3MJSA 4P3NA 4DV4B 1NR7A 5FKJA 1N0UA 2GPYA 3C3EA 1NMEA 3KBOA 4TTJA 1S3GA 2QT1A 1ADBA 5HTOA 4TXMA 3NRJA 5DN6A 2HMAA 2CBZA 5FL7A 5C8VA 3GGDA 5ILGA 1Z4PX 2JCBA 3IKTA 4P7JA 5IW8A 3CA8A 1PZFA 1JIKA 3HEBA 3IGFA 2AXPA 2X7HA 3LP5A 4I4IA 3SHOA 1X1AA 4X54A 3WAJA 1H93A 3CUVA 4NYJQ 2XUJA 3S44A 4TYNA 5KYKA 4RY0A 3VAZA 5P21A 1ODJA 1YRWA 2YOFA 5T8KC 1T8RA 4RPCA 1N32B 4RVNA 2E4UA 4XGRA 1G66A 4D8WA 4FVTA 5IASA 1E5QA 5AJXA 4GOJA 2YKGA 4MDEA 1RCUA 1UMDA 1Y3BE 4LKOA 4QUJA 2ZBPA 1Z63A 3AB7A 4GBED 3MG9A 1WPXA 2AFIE 2JBAA 3G79A 1W5SA 1ORRA 4CLRB 5KPJA 1FDUA 1PR6A 4LRUA 3K6KA 1Q12A 1O7JA 5DBOA 4UJ3A 1LH0A 2GHRA 3S8EA 2BM9A 4BFYA 16PKA 5IUJC 1D3AA 1OI7A 4GE0A 5IH7A 3I9JA 1L5FA 2GVNA 4PSDA 5EXEA 2XT9A 3WAKA 3PXEA 2GJKA 4HPXB 4YNBA 1WY7A 3KQPA 1W4BA 4DM3A 2ICAA 4OG2A 5HIMA 4UTZA 2IYUA 3BM5A 4J1QA 3GY0A 5ALKA 1EGQA 2F8LA 4E5NA 4MQFB 4H1TA 4HN2A 1MC1A 3LVBA 1DDGA 4I5IA 1DKRA 4DXHA 4BLQA 3E9EA 2O8BA 5JV5A 3VJMA 1BC5A 1DQZA 1FLAA 1OWLA 1NLMA 1AKWA 2Z2YA 1T1IA 3PFBA 4CTNA 2LZ0A 3SXJA 4OHZA 4NH0A 3TLZA 2LIVA 3Q8LA 3HUDA 3G2IA 1IK4A 3BXXA 3MHPA 1XLWA 2ZJ0A 2VFAA 3IVXA 4LSZA 3WGZA 4GOOD 2X15A 4KQHA 3ROZA 3K7EA 1CS0B 2IELA 2IYZA 3UT5B 1D5WA 2XCOA 3RAGA 1JH8A 5AKZA 3VVCA 1OGYA 1KEVA 3T4XA 1ESCA 1WDWB 3TUJC 4BYMA 1C5KA 3E2PA 4H3SA 3W5BA 4ZN6A 2KYRA 3A6LA 4OAOA 3V8QA 1UCFA 4A2CA 1H3EA 2C5LA 3FKSD 1R4NA 2CFSA 3GVHA 5I7UA 4OFZA 1CYDA 2HJHA 2XQJA 1KEWA 1KYVA 2Q1UA 4BVFA 2FQXA 3WJ1A 5JSHA 2XQGA 4YA6A 1EK6A 1MOZA 1Z9BA 3MWJA 5K6AC 1R10A 5FBKA 2PMBA 1SUDA 1HDGO 4P7FA 2QT9A 4B8ZA 1NZJA 5D5PA 1GPKA 2V0NA 3GPBA 4MJXA 1U4NA 1KS9A 3HCNA 2Y1CA 5AKLA 4KLAA 4AMVA 1B6RA 4L4ZA 4P7GA 5SZIA 5CB8A 2W2LA 1HFWA 3I04A 3GGSA 1ICIA 3CLKA 3USZA 3P2EA 4WZAA 4BFLA 4W9NA 2ODBA 1CQIB 2ZT6A 3AKEA 4HNAB 3L18A 4H31A 4Q3BA 2P75A 3JQRA 2XVMA 1FQKA 2C2MA 3KAQA 4GI1A 3IURA 1RWQA 4EYKA 5KQRA 4FHCA 2XZOA 1MGOA 1P72A 2WC1A 4H35A 3UUWA 2NPOA 3JQ8B 4KLRA 4MW6A 5IBQA 3ZE6A 3TB4A 3BIWA 2BFCB 2A35A 2B4QA 5KNCD 1NFRA 1T5OA 3N7UA 4FJ1A 5JXHA 1PTJC 2FJPA 4QJIA 2BR3A 1V3VA 2PRKA 1IOZA 3VC2A 3JZAA 4NYIQ 1JWLA 3PLAE 1XKTA 2REXB 1WXGA 2AFRA 1Y3IA 1FYVA 1HE3A 2R6CA 3R7NA 1MX1A 4N8EA 4IJQA 2VDMB 1VCMA 4GX2A 2CLFB 1I2CA 3UT6A 5TQ0B 1E62A 1ELOA 3TLYA 1M10A 3T52A 4DQDA 3REQB 1FSPA 4YAUA 3U5TA 1MJHA 4UM5A 3OOYA 2GS9A 2OLEA 4RZ2A 1ZWKA 2CZCA 4UTRA 1WQ3A 1L7NA 4O0LA 2RG7A 3DTVD 1XP5A 2JIMA 2I6TA 1EE1A 4KB5A 1HG1A 1YJBA 4WNCA 5AM4A 5DT2A 3MWDA 3UV7A 3MMSA 2OVBA 2ASVA 2ACVA 2JLYA 1CF9A 3P0FA 4U5XA 1UXIA 1H1TA 4YIKA 4B6JA 3Q6NA 3LW7A 1CUHA 1FQJA 1NFFA 2B92A 3KKEA 1W7AA 2PZKA 1E0AA 1PFUA 2WABA 4D9CA 3R7DA 2IH2A 4EMTA 2O8DB 1TNDA 2Z5VA 2FUG6 4JC0A 2QRPA 3A9CA 3FR8A 2WB4A 4G0NA 4L0MA 4N49A 4WXRA 3V2GA 3CNEA 1BKSB 3BORA 2JEZA 3SDZA 2CKDA 3BXPA 3ZE2B 3PUHA 1C7JA 4Q9HA 2Q4BA 3AERB 3HB9A 3UG6A 4J03A 2OV2A 3F98A 1M5TA 5J2TF 2BBOA 4BE7B 1HTWA 1ECCA 2C9CA 4JIMA 1WUHS 3HYLA 4KODA 1YS7A 1ONPA 4NENB 1XTZA 1EH5A 1XE3A 1M54A 1Z38A 2D74A 1H6BA 3CX4A 3TSZA 1XTUA 1VM6A 2B99A 2X8WA 1MFZA 3BQNB 3MMXA 4CCSA 3B5EA 5K20A 3U61B 1Z26A 4FDVA 4HQKA 4EW2A 2WVGA 4XGNA 3EF1A 1XRQA 3Q98A 5G40A 4QYIB 1KWGA 4V3CA 5BN4B 2ZZNA 1VJTA 4YDHB 4CV2A 4QXRA 3FGOA 4RVHA 4EEXA 3B70A 1IRIA 3DEZA 2UUOA 3HUTA 3L6BA 4LRSB 1RLMA 2CLOB 2A88A 3UJAA 1UKCA 2OGUA 2P4SA 4HD8A 3S3TA 3TS1A 4N03A 4BZPA 3D1JA 2ECQA 3ZLBA 3QTTA 1DCMA 1UJBA 3IB6A 4A0HA 3HHEA 2GETA 3H9JA 3I6MA 1GQQA 1I5OA 4GVXA 5AJYA 3U3XA 3DBHB 1CFZA 1FX1A 2VAMA 1A97A 3SSOA 4IAOA 3WGVA 1N7HA 3R76A 4Z4EA 4XDGA 2YW2A 3KXDA 1XJWA 2ZE5A 4ER6A 1VSTA 2VH1A 3I4LA 4PYRA 2PRYA 3MJ4A 5AVJA 4FXOA 4LGYA 2C4HA 1XEFA 4PPYA 3AVUA 1Q91A 5K51A 2WFMA 2JIPA 5L6MB 1JU4A 4RMGA 2BR5A 4B33A 3FOBA 1T6XA 2Q1WA 3F5QA 3UY4A 1FNBA 2JI7A 4AXBA 1EEHA 4RA9A 3LZCA 1M0SA 5HCUA 2PO7A 2HMVA 2BEUB 2EG9A 3G9QA 4F8EA 3EIFA 5EJ6A 2QTBA 1EGAA 4TTQA 3DEYX 3L46A 4GFDA 4W5WA 1U3UA 3W2TA 4DLYA 5DBHX 4CM8A 1QP4A 1G9SA 3DZGA 1DADA 3KKQA 5JWOA 5JSUA 3B1ZA 1MR3F 2FPMA 4K86A 5AIBA 3OE7D 4Q3CA 5FL3A 3WLOA 3T1TA 5KNBH 1GUFA 1NIJA 2CYCA 2Z6AA 2GHQA 2C1ZA 5KYVA 3T6KA 3MUNA 4H7EA 4EJSC 4C4OA 4MULA 1RPAA 1LWNA 4MKHA 1SOMA 1W0JA 1VBKA 1NBEA 4PLPA 1ZNWA 4FOTA 4YAFA 4H18A 3LPCA 4OXIA 5EWLA 5BQPA 5HA5A 5G0UA 4I7EA 3FOFC 3DZFA 2WKSA 3QUBA 4D82A 2X8JB 3GMIA 1XJ0A 1QH8B 3DAGA 1ZD9A 1NM5C 4YYEA 5JPIA 1GDDA 1DUVG 1T0PA 4E30A 3JYHA 3ANNA 2JG3A 4Q6BA 3SD7A 3HKBA 4CYMA 4C0HA 5EHIA 3WS7A 3PUIA 3RPEA 1PW5A 2R65A 4A4DA 4MS1A 1NP3A 2F55A 1QU3A 1UDCA 2H11A 3VPDA 4ILKA 2LE0A 3AHEA 2DG2A 1W1IA 2O23A 3DR5A 3AVOA 4IVPA 3RTCA 5LKAA 3A32A 3T1YB 3GA7A 3W3ZB 4YRRA 5CW2A 4MGYR 2XB2A 2Q3LA 4RFSB 5IM4A 1XP8A 3GLGA 1W8IA 5EP1A 2PRIA 4LQLA 1NUAA 4BDTA 4G1EB 2H51A 2GNPA 2PHZA 2F3TA 4I8DA 4TSFA 4LF6B 3PIIA 3C3WA 4ENPA 3KT0A 1MIOB 4QGSA 5IK2D 4HSEA 3S4YA 2PSDA 1EX9A 3NWJA 2IGBA 1V2HE 4PHGA 4F86A 1LC0A 3I09A 2FFBA 3ICVA 4CLEA 1WB4A 3ASZA 5AI4A 1BEEA 1JJVA 2QBYA 3ZD9A 5J58A 2Q28A 3ZQKA 3FE2A 5KHAA 1RQ7A 2ZB4A 3UMVA 3GJ6A 2AL7A 1Z0JA 3WRWA 1VPWA 1WZNA 2ZETA 4GBMA 3ZWCA 1RQGA 1Z6PA 1ACJA 1VJ1A 4GDMA 1I2ZA 3TK1A 5I7VA 1UADA 3AZOA 3PIDA 4K2HA 2VYCA 4B8YA 4L76A 1G38A 4BASA 1ZXLA 2XJ9A 3FLBA 3MBKA 5H3LA 2CF5A 5JASA 3SHQA 3I12A 4WCDA 2JGAA 2QNBA 1A95A 3VPHA 1FFBA 3OLQA 3OETA 4JKYA 4XB6B 5ALTA 2NOAA 3V7YA 3ZBPA 4URYR 4J0HA 3A9VA 3DB2A 3HJHA 4MICA 3IJRA 3K09A 1PL8A 4MIOA 4LF5B 2NSHA 1Y4ZA 4A0FA 4URVR 3F4KA 2GBIA 2BMEA 5D84A 3G88A 3WZLA 3AM5A 3MT8A 4A36A 4L9RA 5KYUA 1MAAA 4NU5A 3AUSA 4GOND 1X19A 3C74A 2ZWVA 5KSZA 4KAJA 5CFLA 3WKEA 2I80A 1N2HA 2B8JA 1JYEA 1OTXA 2GCOB 2WHPA 1JSRA 4H77A 5DBFA 1KZHA 3T15A 1ZK3A 4YASA 3ZIAA 2FDXA 4GM1A 2D1SA 5HK8A 3WDSA 4HMQA 3T7SA 4JR1A 3V3TA 1K92A 1KJ8A 3ISVA 1II0A 3EGIA 4BZXA 5B3JA 4CIYA 4AY6A 1Y8QB 2Q3FA 3H2BA 3UPUA 2C5EA 3N74A 2PKXA 2Q45A 3E35A 3CRMA 1KFKB 1PI3A 4WE3A 1E8DA 4DV0B 1XTSA 1TAHA 3DYIA 5C53B 5AP9A 1TUEA 3GGGA 4KO4S 1WNFA 4DJTA 3ZE7A 3L9WA 4AZ0B 5CH5A 3ZLJA 1VIVA 2BFBA 3BAFA 4P2GA 5CGZA 3UC9A 4NV1A 3VHXA 2C5HA 3JD0A 3T7JA 5KYGA 2AMJA 4HDAA 5LL6P 4OHCA 4FOSA 2IP2A 4YROA 1VCOA 2QENA 4HN9A 3VO1A 2X6RA 4DA0A 2QYHA 1NXXA 1ISHA 1L3CA 2OB1A 3C14C 4DIUA 1UZLA 3EIOA 1IMJA 2AFVA 5AOVA 4MRMA 3E7PA 2GYVA 3PSHA 1SB8A 4DLAA 4AO8A 1VTKA 3KJZA 1UJCA 2AFHB 5EKTA 2O0JA 5CLHA 3DC2A 3N2LA 5ICMA 3NOVA 2X1HA 4OAPA 3ZU4A 4J0IA 1SVKA 3NBQA 5HRUA 1I3NA 3I9KA 3SZUA 1TD9A 1EX7A 2W6CX 4R2XA 3BREA 3H5AA 3AUTA 3QI7A 3EQ8A 1PK7A 4OJYA 1FP4A 5E1BA 5KINB 3SVLA 3TGPA 4K0KB 2XQIA 3IV6A 4TN1A 3J81A 2DHEA 4AMUA 2IXEA 5JH7F 1DIBA 1IB0A 1NZDA 1ZFNA 3B8EA 5DTEA 2IUYA 5JFOA 1HT1E 1XTKA 4GQBA 3IAM1 1NMSA 1T0HB 4KW7A 4UUOA 1RYHA 3C45A 5EMJA 5HDQA 3RKSA 5JZSA 1QF6A 1RHUA 3HWWA 3LT1A 3T3NA 4XLLA 4B3MB 4UC0A 1L4UA 1UMCB 2GEDA 1UDAA 1FDTA 4ZI3A 4RZ3A 4Q7QA 1NXOA 3U09A 4MYRA 4H7PA 4YP7A 1XAGA 1KIMA 1KZ7B 2WF9A 1TYBE 3CB2A 3CLSC 4ETMA 3NIGB 1JWAB 4MWTA 4M9QA 5DPMA 3CKKA 5B1IA 4MW9A 4MMXB 1O58A 4HDMA 3RLIA 4URXR 3AJDA 5I7RA 1JDNA 3PDHA 4OREX 3VU1A 3X2FA 5WRFA 3WK6A 1O0SA 2A5LA 2F9LA 2QZ9A 3HABA 3DONA 4RJIA 4GPTA 3E5MA 4I4NA 1WCIA 3U9LA 1TYAE 2G4VA 2YHIB 3OHSX 4RETA 4F3CA 3JAKB 5BPHA 4ENUA 2ZJ2A 1Z4MA 1YHZA 4OHMA 4QU0A 5DBIA 1YCDA 1L7AA 2QN1A 2ZTUA 3MW8A 2GN6A 4MRVA 5KNBD 3AESA 4Z8YA 3UYKA 3ENKA 4A73A 1VMEA 1LRKA 2EDAA 2F9FA 4WK2B 3C3JA 4WVFA 3DWGA 3DF9A 5FHRA 5IBPA 2AJCA 2F48A 3ZZMA 1CEQA 2D2FA 4C43A 3GH3A 5AXBA 2ZUBA 5F9FA 1G21B 4YWJA 3TOSA 4BZWA 1CQZA 2EV9A 3K16A 2ETXA 2VRCD 2BY4A 4ASUA 1OU0A 4DPLA 2I3AA 1UFRA 3EOBI 1E8NA 2VF2A 2YS7A 3TKYA 3R0QA 3RYIA 4HYQA 2QGZA 4N76A 4LBZA 4PFKA 4BEBA 4GUAA 4ETWA 4RV4A 3OX1A 2IOYA 3R41A 1Z7GA 1MVNA 4D3DA 2O1EA 4FYMA 2BTQA 1VI6A 1CDOA 2VSNA 3W5JA 3WHPA 2V58A 3CRRA 4DSTA 2QKYA 4CF5A 2G3YA 3HXTA 1Q0PA 2O2JA 4KKXB 2WWYA 4J7AA 5K0EA 2DP4E 1G16A 3OTIA 3TJZA 3P7MA 4C2UA 1LK0A 1XLTC 3AQIA 5EIXA 2HLHA 2V59A 2FSGA 1JXQA 4TRMA 3WIOA 5BW8A 2CFTA 2V5AA 3M5DA 1YQEA 2G83A 4DY6A 3ABOB 1F2UB 2HQBA 3JQBC 2BSAA 3K30A 1NUQA 2J32A 3IQDB 3NYWA 1E1QD 2BFDB 4PPNA 2Q29A 3SIWA 5CAEB 5LA6A 2VHUA 1AHIA 1ZOLA 2JIOA 2R97A 4YAIA 2X5OA 1TO2E 1AZTA 4NATA 4RF5A 1V11A 5ERGB 3RGGA 5HRCA 4BUJA 4YJ2A 4MGZR 1KEPA 2XMBA 1HH4A 1M8GA 3F6CA 3MSCA 1X80B 2FK7A 3KJNA 1V25A 2E4ZA 3GAAA 1DDIA 1UBLS 4OKNA 4CWAA 5HKAA 4MV7A 1ZL0A 3SQDA 1K7FB 3TNLA 4CJXA 1N9KA 3EVCA 3MIIA 4Q4CA 4WXEA 3R0VA 1MAWA 2WF6A 4X20B 5C5EA 2X77A 2XMGA 1F1JA 4JOSA 3T1HB 1JEDA 3KZMA 5TX7A 3HY3A 3FM9A 2HBRA 3WWEA 2R9VA 4ZK2A 4ZZ3A 1GL7A 2CK3D 3RIMA 3FWHA 3O31A 4MVJP 5GPBA 3BGWA 3OIWA 3F6PA 3SCZA 3HV0A 1Q7RA 1O95C 2X2OA 5CVEA 1YVDA 4L4UA 2WWHA 3EWAA 4DR3B 2RGBA 3FF1A 3HBJA 4NTZA 3WL8A 3GJYA 5CB6A 3ETEA 4V24A 1CZLA 3ADPA 2VK4A 5HBGA 2Z8XA 1DOAA 4IGEA 5T8KA 4DR4B 3KB2A 2GK6A 3WWDA 1WMAA 2JAWA 1NXQA 3EVTA 3VR3A 2P7IA 4CHTA 1Z4KA 5IJZA 1LNZA 1G4UR 3GFBA 5DYGA 3QE3A 1KI6A 1B14A 2IU4A 3TAUA 2P6UA 3KL2A 4HGZA 4U2EA 4ZXFA 2AFIB 1I4DD 4J6FA 2WJIA 4RFLA 3W0LB 3ZVLA 1MENA 3KTAB 1ISIA 1DC8A 2F90A 3R23A 4KGXA 3I5MA 4JOCA 4PC6A 3U1TA 4DQXA 2WSYB 5AKYA 3FRHA 1F2TA 1BRMA 3I52A 1E4YA 3OX3A 3Q7EA 4GLJA 4P58A 3VSAA 2E3JA 3M5CA 1XKXA 4Y98A 3RM3A 3O47A 1E2KA 4AJ1A 3SS9X 4NFSA 1CPYA 1XRPA 3IXQA 1FTWA 2J4FA 2OFPA 2FW6A 1CUYA 1I2AA 1QKKA 1VPLA 1LBEA 5E8JA 2C7GA 3QTLA 5DM4A 1ZBDA 1U2GC 3PQ2A 4G0OA 2JLZA 1CRPA 1PEAA 2VAWA 3F3KA 1A2BA 3ZGZA 1L4FA 3ZY3A 1DMSA 5T4BA 4XSGA 3SZRA 1DVRA 1QVVA 2UZ1B 3GEMA 3LHSA 1CCWA 1EGVB 4YLEA 1JXMA 5A03A 5JYBA 1BMFD 1RRGA 2WWIA 3A7DA 2QIOA 2C9YA 2O8NA 4N5MA 5HQ3B 4WOKA 1AS3A 2NQ2C 2BEJA 1EK0A 3R8CA 3CLUC 4KE7A 4JBGA 4RLSA 3FIJA 2ZTSA 4JSRA 1WSWA 5EPOA 3R3UA 1I33A 1PWEA 2E85A 1EBBA 4HNVA 3PXDA 2YOGA 2X0FA 1UBOS 3AUFA 3UO8B 1KA9H 1YE5A 2HJVA 3H1TA 2BMFA 1ESEA 2I7DA 2J3HA 1MJNA 1C80A 3OU7A 4G0PA 4NZZA 2HBZA 4JS0A 1HDIA 4QECA 1WQ4A 2FAXA 2HRQA 1ULZA 2X7XA 4QU9A 1AMOA 4MINA 1QV9A 4L57A 1MW9X 4EHKA 3ABQB 1J4AA 5FPYA 1Z8FA 2QVZX 5KJCA 3C43A 4YB8A 1VGRA 2MSWA 2ZT7A 3DMDA 2DYKA 3BCHA 3T0GA 1GT91 3DFFA 3KXKA 2FW7A 1E61A 5CU7A 3OFSA 1W85A 5K6AA 1YQGA 1WD7A 4K1LA 2BTEA 2R0QC 3C4VA 1D5CA 1NF9A 3L4SO 3TTXA 2QM0A 2B30A 1WPGA 2Q0HA 2QL6A 4R9NA 3OD1A 3SXPA 1U8TA 1ZOOA 4BGDA 4P5PA 2VP0A 4UMVA 1B0AA 1L5SA 4MR9B 2PX6A 4P32A 4BJ5A 2GNAA 3ZXYA 4TMTA 5IVKA 4NCAA 2F4VB 1C30A 3L1HA 3GUVA 1X3SA 5BURA 4AUEA 4BQIA 3E3OA 2WDPA 4D81A 3SWWA 3V7FA 4N48A 2HIHA 2EKPA 1QG6A 2ZU0C 1PU2A 3K1AB 1MHPA 3QLUC 5CURA 1AXGA 1BN6A 2Q3HA 2E48A 4KHPB 2CCKA 2DHRA 1DKMA 2HRCA 3G8BA 1KZYC 1V7PC 3WMEA 4BV3A 3K0SA 3A6PC 5DN9A 3O9ZA 1PTJA 3HXPA 1YRHA 2FE4A 5EIBC 2YS6A 4OJNA 3A1NA 4EB6B 2CEKA 1KK2A 1CF2O 1GPYA 4F2HA 4MNTA 3WYEA 5JJLA 3CX7A 1PBNA 1D7AA 5C4MA 2YWJA 2P9JA 2HXSA 1DTWB 4OA5A 2V0GA 4IDQA 3LPDA 5HG0A 2WJJA 1MPXA 3QPBA 1L7OA 1LQUA 3A4YA 3CSUA 3EAGA 3O1LA 4NBNA 5DN6D 3WDKA 5F12A 3CH6A 4IDDA 5HKKA 1G55A 3C1AA 1GD1O 4BNMA 2BWJA 4WJLA 1DFHA 1EDOA 2JFFA 3MNFA 1M2KA 3JQPA 4HYEA 5E3HA 4N0MA 2PV7A 5GONF 3K70B 5CLGA 1RP7A 3DE1X 3P0IA 1GA6A 4Z9BA 2YX1A 3ENZA 2DBVO 1JHOA 2F1JA 4J0QA 2EFJA 5EE5B 1RWOA 2Q5LA 4M8KA 4N0DA 1P1IA 4UUBA 4WNIA 3Q9SA 3ZH9B 5I4BA 4DXDA 4V39A 1GO2A 5AJUA 4FOOA 4GKBA 4GICA 4QPJC 5A4MS 3H5RA 7AT1A 3ZDCA 1Z5OA 5CDSA 3FSRA 1MN6A 4F85A 2H1OA 5HBRA 3TGLA 2ST1A 4Z51A 3IUMA 3MXOA 3NO4A 3UQYS 3WLSA 1RRPA 3EFOB 4OY3A 2HSDA 3T5PA 2QUHA 3HH8A 3P20A 4P93A 3GGOA 4M1EA 1C50A 2TS1A 4HRVA 5ALRA 2F43A 1UXOA 2FXIA 2YV4A 3EZLA 4X1KA 1XZGA 5SY9A 3X1XA 3ZQJA 4XEHA 3ZNNA 5JQGF 5KOYA 3MYRA 4RTMA 3A3PA 3BF7A 1NJFA 1J8DA 2H08A 1TVKA 2CXRA 2YWRA 2Z9BA 3D6TB 3QLTA 5SY6A 2HHAA 5EZQA 2WJGA 2PLFA 2ZE8A 4TQGA 5EGNA 3C48A 3ZGVA 4LWQA 1V3TA 2VNJA 5HKLA 1E99A 1USVA 2PLNA 2QD2A 3HN7A 3OJCA 3FOWA 1UPBA 2I2BA 3CN7A 4G4GA 4NOJA 5F73A 2YYAA 3RRBA 3GHHA 2IYFA 2ZQZA 3R3HA 1OLSA 4L1KA 4YAJA 5CNIA 4ZIRA 5CBPA 5JJBA 1SXJC 5EJFA 2C99A 2C92A 3OTOB 4XIGS 1EUYA 1UK6A 4B2IA 2EEPA 3NXSA 1MU0A 5FOTA 4BN0A 1FK8A 2O2EA 3DV0B 1MO2A 2C57A 2QXUA 3X43A 1C3OA 2I8CA 1SVWA 3GELA 4NDAA 3MT0A 2X2EA 3K8QA 1T9HA 4QOIA 5CPBA 3RV4A 1SCNE 2Y0EA 4QL3A 1REQB 1Z07A 4XLZA 4KDEA 3IKJA 4I4LA 4CLOA 4L72A 4CNQA 2VPQA 1T5DX 2HXYA 2J5RA 1ORTA 3M82A 4KK3A 1GDHA 5HUHA 1Q0SA 1VMKA 3DLIA 4N5HX 2ZR8A 4OB7A 4UHKA 5CGQB 4CQMB 4YMLA 1QX4A 2PL3A 4MCJA 4LZAA 3DO6A 3PXAA 4UNIA 2Q5OA 4X41A 4B7CA 4C0JA 1Y82A 4XUCA 2O07A 3ZD8A 2NZVG 3UAOA 1Q77A 5HF5A 4B35A 3O4IA 3REGA 4I8IA 4DKXA 4JYBA 1E1RD 3PCRB 1T9KA 4P86A 1CB7A 1GSIA 1VSQA 1SD1A 1G7TA 2AHRA 2WA2A 3G7NA 5KVQA 3UH1A 5J47A 2OM2A 2W2LD 1C0LA 1VG8A 1TTHA 2D62A 4RELA 2R7AA 4DWVA 2QNRA 1YZ3A 1D2CA 3IV7A 5BSUA 3TOZA 2ZLBA 5KNDD 2REOA 5L4SA 4X90A 2CWWA 2FWRA 4CCYA 2NU6A 4JCCA 2R6DA 3BN3A 5K1ZA 3DOCA 4D92A 1JEQB 5F2NA 3P2IA 3A6KA 4TYQA 3UWPA 4EF5A 4IRMA 2QAIA 2G1AA 2W2TA 2OBXA 3RABA 4FNAA 2WYIA 2ZUUA 5K01A 1JUDA 3EVBA 3G0BA 3QHAA 1JKMA 1KOFA 2Y71A 3RFXA 4IWYA 3B6ZA 3HU2A 1GPUA 5TMDA 3EGEA 5TSDA 1C4WA 1W36B 1KJYA 2AB0A 2IBMA 2JLSA 2LW7A 1ODLA 2HPHA 2WG2A 3C6KA 3FSJX 2QI9C 1ORHA 1SAYA 4IGKA 4IY1A 2PGOA 3G13A 4JVLA 1GP2A 5LUAA 1SQ5A 1ONOA 2HHJA 1UPFA 1Z4OA 2KBFA 2BRUC 1J7KA 1PDWA 1AF7A 4D6XA 3IEKA 2P9EA 4JKIA 3HK2A 2PBLA 3EOZA 3BOSA 4W5TA 1YHYA 1CJSA 2DHQA 3OM1A 2QLTA 3ZCVA 2Z6QA 4ND8B 5E95A 2P35A 1MX5A 4EP1A 4ZYXA 2BHNA 2R48A 3B2EA 2IHBA 3RT7A 2VSYA 4DMCA 1W76A 3O90A 5IDWA 3WYNA 2GYWA 2IW1A 2ORYA 4JELA 4N7BA 1SZCA 2WWTA 1LPOA 3K5HA 4BAGA 2WU0A 3BWDD 4Z4HA 2HO5A 4WOPA 1QBGA 1U6JA 3GQVA 2D5BA 5TC4A 2QLBA 3ZGYA 1Z88A 3T5TA 3INRA 3RUDA 1HT0A 2XRYA 1YZLA 1KO8A 4B9AA 4I9GA 3HY4A 3R6TA 5LD2B 3IEIA 1RHKA 1P9WA 5ARCA 3GFPA 1ZN9A 1R4MA 5B64A 3TR6A 4I66A 5IDXA 3PQDA 1JR4A 1T3LA 5J1TB 1DRJA 2JF0A 2Y1EA 3FTDA 3KYCB 2I2DA 5B2ZA 3SJAA 3VSBA 1MV5A 3PKZA 3QMVA 4B81A 3PQ6A 1NT2A 2WP0A 4MPPA 1JRLA 3TZHA 4A6XA 2D0OB 1SEVA 4FM9A 2E0IA 4C6SA 3TINA 3RANA 1IVYA 1FP6A 1W44A 9LDBA 4HAOA 4PRYA 1VKNA 3EPLA 4J1NA 3LOPA 1S5PA 2GEBA 2OGWA 2PZ8A 4IZ6A 4E4TA 4MWSA 5HJ5A 1P5RA 2B94A 2OG2A 4MR8B 4QNNA 2D2XA 3E18A 4RABA 4UAVA 1XQYA 1UOEA 2G9VA 5J5VA 1OXBB 1JQAA 1P1JA 2JGIA 2CLCX 4I9UA 4F7DA 3TVYA 3KS9A 3RAFC 4JIGA 4LFBB 5ALZA 4Y7DA 1A2QA 5B57C 1PL7A 5KVVA 1EJBA 2WKWA 4BMVA 2FMUA 1YMVA 4FEYA 4WKGA 4QPPA 3UK1A 2VPWA 4DILA 5HE9A 1ZCAA 2YC4C 3KQVA 3FDIA 4UUPA 3C87A 1R6XA 1TZJA 1JLHA 1PVOA 3V97A 5IARA 3GCDA 1WETA 4XVRA 2O3RA 2VP5A 4Y2YA 4BLUA 2W6ZA 1IVNA 1KMQA 1JLMA 1BE6A 1ZU5A 3CRW1 5ERYA 1J56A 1X94A 1YAHA 2BI7A 3A58B 3V48A 2I22A 5BQFA 3ROTA 5K8LA 1KRWA 2GAAA 1ZPDA 2QQFA 1YZUA 5FEUA 4ZZ2A 2HJSA 1CFJA 5EIFA 5IXJA 3HACA 2JGMA 3R7WA 2PR7A 5LFAA 4FB4A 1AUOA 3AFHA 5AKJA 2VBIA 3QLJA 2Q2NA 2A9JA 4ZALA 3I92A 4BFTA 1WXQA 2RHCA 3L7DA 5JFGA 1G64A 1Y1SA 2UUPA 2DWPA 4R9SA 5EUBA 3VC7A 4HO1X 1YMUA 3LGXA 5DYNA 3QKUA 2V6MA 1S2MA 1V47A 3NAMA 3LFTA 4G0QA 4KH0A 4QFMA 1JEAA 4MAAA 5AJWA 2IHJA 3Q88A 1JZTA 2CHFA 1CUJA 1GTSA 1P1BA 2VRWA 1X14A 3NIBA 4KXWA 1SXHA 2Y0CA 3BMQA 3HCCA 1AKTA 1W0JD 1WSDA 1PZMA 4BNJA 3VNRA 2NN3C 3UVEA 3NHPA 2BEVB 3PQ7A 3IERA 5AQ1A 1KY2A 3UK7A 3EXHB 2FN3A 2JIQA 3O4VA 4GWGA 1SFRA 2HA2A 1L8XA 3LP6A 4IIYA 3EWIA 3ZU6A 3EZNA 4XFKA 4WERA 1IEVA 2CCJA 4YQYA 4E09A 1LLUA 4PG6A 3CSDA 2J85A 4I8XA 3R5XA 4MV6A 1IFXA 1W35A 3PEUA 4ENWA 4CMIB 4D02A 2B1JA 3P32A 4Z4QA 2MCFA 4B6PA 1LJLA 1QS0B 4NBUA 1HV8A 2A14A 2PL9A 2JS7A 2UVPA 3TAHA 3DJFA 5EWMB 1MXFA 5LQSA 3ZDDA 2GN9A 3OD5A 4U8GA 4DV6B 3FNIA 2DTEA 4RTLA 3ADKA 5IVDA 3GP3A 3ZQ6A 3RVQA 2IXFA 2Q3CA 4EG0A 1B74A 3FN4A 3J7TA 3JQEA 1USUA 4GYJA 4HWKA 3D3KA 1R6TA 3BULA 3REFA 4TSFD 3CLRC 5TNXA 1Q1QA 3G2PA 4HNTA 1T5IA 3IC5A 4BRUA 4J75A 3AJRA 2Q7DA 3E0XA 2XZTA 3GLIB 4TWRA 3CKLA 2H2GA 3B1KA 3MS4A 5HFJA 1IONA 3VYWA 2ODWA 1E3SA 2XUGA 4YJ3F 5AO9A 1YK1A 4LRTB 4PRZA 4C22A 1VHDA 1UXGA 2OD9A 2UYGA 3FOZA 4BNDB 4MGIR 1C9KA 2OMEA 1L1QA 2B20A 1BNCA 1K3FA 3QWFA 2IYQA 4J94A 4TMYA 2R79A 2OP0A 1C1HA 1GKYA 2YBDA 5T5QA 3CVVA 4HDKA 1UKVY 3NUQA 5A1TA 3KKKA 4UVDA 4B7AA 2OEPA 4ND7A 2PV0A 2ID7A 5GY7A 5I01A 1NDQA 1EQAA 3DP7A 3MMZA 4RAQA 5EP3A 2JLRA 1GUYA 4JODA 3ZXIA 2XEXA 3ZJYA 1SXPA 3D9QX 2BZSA 2YZ2A 4REQA 4DSOA 2FHPA 1I9GA 1P7PA 4HZUA 3SMQA 2XY4A 3VPFA 1T36A 3DCIA 4JLBA 4Y30A 4JL5A 3ENWA 3JQCA 1Q84A 1PR4A 2A9OA 2EL7A 3LBYA 5ABPA 2D0IA 2O20A 1M2HA 4F4IA 1WOMA 3EXIA 2P0AA 2P3OA 3ZCXA 2GXUA 1XXHA 5IANA 3CUKA 3IAS6 1W88A 1N2IA 2MDTA 1X1DA 2RC6A 1I7QB 1MZPA 3L4JA 5IF9A 1D7OA 2FP4A 1XLTA 2YZNA 4P38A 3FTEA 3ZIAD 4Q3DA 4IICA 2ZRAA 4LBVA 1N2JA 3H8VA 3A4VA 1OKKA 4DQLA 1CQWA 4IIBA 2AQ8A 4MQMA 5BYBA 1LDYA 5TMPA 3CRQA 1JFSA 4KRFA 5JVDF 3WGGA 4INOA 1M33A 2QVXX 1NW4A 2OC9A 3F6RA 3HL4A 3STUA 2QG9A 3UXYA 3VH4A 4O25A 4YAGA 5ADHA 3OZ7A 3PLNA 4HG2A 3FPAA 2EARA 5F7XA 4GKKB 4XYLA 1KVTA 4QPCA 1UPCA 2FVXA 1A9SA 1SNYA 1UM8A 2I6UA 3D2AA 3F1KA 4HL6A 4ND4A 4M7PA 1K0FA 2COKA 4M0MA 1J33A 4RM2A 4ZOAA 1JTFA 4L7QA 5P8WA 2ODEA 1BO6A 3LKVA 4UEOA 4XPZA 2UVQA 3VHQA 4O2AA 3FY4A 1PR5A 1UJMA 2I54A 3L0OA 3PRHA 4EG8A 4XTRA 5J2UF 3ILSA 3HB0A 4CUKA 2OGSA 5E6UB 5C34B 4DSZA 2QRVA 3CEMA 1CUIA 1SK9A 1Z7EA 5IDQA 1J70A 2C9BA 5AM5A 1VL0A 2OZKA 1B8UA 3UHFA 4FHGA 5BSWA 2FN8A 3FPKA 3DE3X 2J0UB 1O95A 4JYMA 3CE6A 3I1YA 4P31A 1R64A 3MRXA 5ALWA 4XRRA 2OO7A 2O2SA 4ZT4A 2EL9A 2OFOA 3UJ3X 5JCPA 3KAJA 1N2CB 4ENSA 5JXWA 4QJ4A 2XKKA 1XXLA 4GZ5A 1CDEA 1GNVA 2IXGA 4Y2GA 2VWQA 3GEDA 1FU4A 4E3WA 4KUEA 2P6PA 1C1XB 3ZH2A 2VDOB 1R0ZA 1XN1A 3A1SA 3F3SA 1D2MA 4UAJA 1U3FA 1E1CA 2AMFA 1V48A 2LP4Y 3LRXA 4P3PA 4V0OA 1UAGA 4JNKA 5IFKA 1KMHB 1LBSA 3AI3A 3PFGA 1FXWA 1ABFA 2G5PA 3IDFA 4ZREA 3TRHA 1Z4JA 4OLHA 1KO4A 1SCDA 5LSAA 3FCCA 1W49A 2Z5FA 3M33A 3CJTA 1YIDA 4WCFC 5CHYA 3SEZA 5C7YA 4IRXA 4B2LA 4LDRA 1YASA 1D9XA 1R9NA 4FIDA 3WYFA 2VAXA 4C6RA 2YWXA 4JP2A 2CXHA 2OP1A 1ZGAA 3B89A 3B2NA 2R7NA 2ATEA 3PEVA 3N3BC 3FAZA 5E2BA 2Z98A 1FOEB 3VU9B 1EM6A 5ARBA 1Y80A 4EJ2A 2WLSA 1O54A 4JBXA 1XB2A 3BZUA 1P2VA 3TTWA 4BVGA 4FINA 2I71A 4R7TA 2OHVA 1XRJA 1XQWA 1ZM4A 4ZAXA 5LMZA 4HB0A 5IC5A 5CT9A 4TSKA 5T6MA 4YYZA 3TPCA 1XZIA 1TJNA 2V6BA 5C31A 5JI2E 3NHZA 5E3IA 1KI7A 3BWXA 1XMOB 1MH9A 2Z8YM 4H59A 3DE0X 4QBFA 3WK7A 4EAQA 4E70A 1TU0A 3KRTA 1U1EA 3N75A 1BWQA 3NHKA 4NYJR 4RF2A 3RVBA 3VKVA 2R4TA 1QZTA 2FWMX 3FNGA 3I42A 4IMJB 5EKUA 5CH3A 1QU2A 3NASA 3LYUA 3FRJA 1PX2A 3OCXA 4ARZB 2CMFA 5KX5F 1TT5A 1MPTA 1OR8A 3LPMA 4ASUD 2RGCA 5A9RA 4P22A 2X9QA 3A3YA 5J2TB 3CJQA 4A3SA 5FUQA 3LX5A 4MV8A 3CSSA 3A3OA 3NVDA 2CHGA 3AF5A 4HADA 5AW8A 4O4LF 2Q46A 2IOHA 1UIRA 1UWKA 1UWVA 2PWAA 2L82A 1E6WA 1E92A 3YASA 1S8FA 2QTAA 4O6VA 1CNFA 3EZ7A 4IR7A 2PLRA 3EX7C 3RJTA 1TFUA 4ABYA 2AD5A 4BP8A 1F14A 3NBUA 4O3MA 1SKMA 1HOTA 5CCXA 1YRBA 2O57A 2J6BA 4RKFA 1VHJA 3Q4GA 1UANA 2JLQA 3H1FA 4MI9A 4OD0A 2AG1A 4ND1A 3QE0A 1K75A 2ZJFA 5M7EA 1EK1A 3HZHA 1LA2A 2RGUA 4O3FA 3F6EX 4PAWA 1Z2DA 1S2NA 1V1JA 3W3AH 4KR7A 4QT0A 1YB6A 3K1YA 2Y67A 3THYA 5FJJA 3QLUA 2H5LA 4X94A 1SH7A 1TQ2A 1YS1X 4TXHA 5B1SA 5IFLA 4I1VA 5FTWA 2VT6A 2VP3A 4ZPJA 3BFXA 3EEOA 1PWXA 3DBVO 3AGQA 1B4DA 3GZJA 4JT9A 4X1YB 1EHIA 1RAEA 3RRYA 1SO8A 3AKDA 4YT4A 2VHQA 4NAHA 2LDBA 5JDIC 4N6GA 2ENWA 4Q1BA 3PNVA 4L3VA 2R62A 5D3KA 1RWNA 4HUQA 3P8ZA 1CIPA 3FVQA 3OO1A 3RRJA