2XD9A

Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-4,6,7-trihydroxy-2-((e)-prop-1- enyl)-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
153
Chain Sequence
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetrahydrobenzothiophene derivatives: conformationally restricted inhibitors of type II dehydroquinase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
total genus 55
structure length 153
sequence length 153
chains with identical sequence B, C
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2xd9A00
4KIWA 4KI7A 4B6QA 4RHCA 4V0SA 4CKXA 1D0IA 2Y77A 4B6RA 4CIXA 1H0SA 2BT4A 3N76A 4CIYA 2XB9A 3N87A 1GU0A 1J2YA 4B6SA 2Y76A 2UYGA 2CJFA 2XD9A 3N8KA 4L8LA 4B6OA 3N7AA 3N86A 4RC9A 4B6PA 4CKWB 1GTZA 2C57A 1GQOA 2Y71A 4CIWA 3U80A 4CKWA 4KIUA 4CKZA 4CKYA 1H05A 2DHQA 1GU1A 2C4VA 2XB8A 1UQRA 2C4WA 3N8NA 4CL0A 5B6PA 4ZC1A 3N59A 5WRFA 4KIJA 1H0RA 3LWZA 1V1JA 4CIVA 2XDAA 2WKSA 3KIPA
chains in the Genus database with same CATH superfamily
1IAVA 3FPFA 3H11B 2AMFA 1RAEA 4L8WB 3I1YA 3HYSA 5DYNA 4M60A 5LBTA 1Q12A 4YNBA 3T3IA 3G2OA 3K05A 1P3JA 1IBRA 3NONA 3R3YA 4XPIA 1KY3A 2LPMA 2JAOA 3GEPA 3NCHA 3WRXC 4D45A 2Q5IA 2WABA 3HK2A 2NU8A 1C3OB 3VVCA 1URPA 3HL4A 3LHDA 3JAMA 1L3BA 4XKJA 5I45A 4P3XA 2FW0A 5EHIA 4KR3A 2ZIXB 3IV6A 1TUGA 2R66A 3SZRA 1E58A 3FPCA 5AKEA 2DOKA 5AKXA 2WLSA 1O4WA 3TR5A 5BV8A 5BVGB 3QOFA 4CFZA 5A04A 3PF8A 1GCUA 4YACA 4BV9A 3THRA 2RCNA 3GRRA 4OUKX 1O95A 4M1QA 4MS1A 1UBKS 4WZBE 1BS1A 4YMWA 5H5JA 4PG5A 1ORIA 3UG7A 2FJ0A 3ZNNA 5TF0A 2XKAA 5DGXA 5FUVA 4IDCA 1GNLA 3KOOA 3R3VA 5E0OA 1NNEA 1YVPA 2JFQA 2G5CA 4CG2A 1HEUA 3A6PC 1XFDA 3X0DA 2BFFA 4PXAA 3W2IA 1W6UA 2XGSA 3HRHA 3VU3A 4Q12A 2WIJA 1M5TA 4RPHA 2WC1A 3GVCA 1WZ2A 1PZNA 1QR6A 3K73O 1QLHA 4AKSA 5LZ2A 2BF7A 4FOPA 4LZAA 1O58A 4C21A 5H70A 1NULA 3I05A 3MERA 3Q6IA 2WM3A 2HHHB 2ZB8A 4IQGA 1QRUA 1I5RA 3CV3A 2NTNA 1C4WA 4PTLA 3PE3A 5ALQA 4J0GA 3GUHA 4HYTA 3QPCA 3EGCA 2V3CC 3H2SA 5BO5A 3TG8A 1I24A 1JG2A 1Z0SA 3G6KA 4U2CA 5KCMA 1F2DA 1XOIA 3MRSA 3ONNA 3QU2A 2C20A 4AN0A 2YJNA 3I5MA 4M1TA 4NBNA 3HA2A 3IT0A 3PYMA 2W2XA 2WWGA 3B6JA 4A2WA 1R12A 1UMDB 3FTQA 3WGQA 3CCFA 6YASA 1FTWA 3I2JA 4L78A 3QYJA 4P0QB 1Z25A 1V26A 3QX3A 2OV3A 5J1TB 1B43A 4UHFA 3UHPA 4X6LA 5MN6A 5JNWA 3KOYA 1H2RS 3KV3O 4C0LA 5JZVA 5BR8B 2GRJA 4FX2A 4QJBA 4MUNA 4L4SA 5EJIA 4B7CA 2XA9A 3ND8A 4EX7A 3HYTA 4Z3OA 3WFIA 3FYHA 3UA3A 2HRZA 2JIDA 2XT6A 4RZIA 4YFVA 2TMGA 5HKLA 4B87A 2V45A 4BE7B 2Y0EA 2IEGA 2L2QA 3NBUA 3QV1A 2V5AA 3FPGA 3QENA 3A4IA 4NULA 2YH2A 4M38A 1VTKA 1KI2A 3VPAA 5JD6A 3CKKA 2FSPA 4G4JA 1U2GC 1DMSA 3WLKX 5HK8A 5CEJA 5TVKA 3AF1A 4KXFB 1H65A 3X2FA 5KNDH 2DQSA 5LQUA 3BWYA 1XU4A 4G0MA 2Z1NA 1IOZA 3SY8A 4V1CB 3PC6A 4DV4B 1CY1A 3MTQA 1RQXA 4O5OA 4JLNA 2YRXA 4MRAA 3BE8A 4TTPA 5ALIA 1FW8A 4ZKDA 3GLIA 1M2FA 4OHRA 3HCWA 1YJCA 2HC9A 5CXXA 4C3VA 2YIDA 4O4IB 2X3UA 4KC0A 3I2YX 3FTCA 1QFMA 3HXLA 3L02A 2XE8A 1QPZA 2PVPA 4G6ZA 3SM3A 1Y5RA 2GNAA 1OGJA 3ETEA 3FXAA 1YHNA 4KH1A 3CG4A 5NLLA 3BZUA 5IJZA 4OFWA 3EQ2A 2FN4A 2DGDA 2WIBA 1E96A 4P1ZA 4YRZA 4HWOA 4Z54A 1UBTS 1RRCA 1E2FA 1JG1A 4JT2A 2OBXA 4DILA 2A1IA 2JIZA 2ZB7A 2AIRA 2ZITA 3ZCRA 4BVEA 2WOJA 4XWGA 2ACKA 4WXEA 4EOGA 4ZARA 3HKDB 4Y2PA 4JJGA 2VQ6A 4D81A 2M6SA 1NYLA 1UFRA 2WINI 2YOFA 2Z6UA 1WDMA 2VCHA 4HAVA 3NDBB 4CR7A 1IBCA 5DXJA 3TINA 3MB5A 5CTJA 1N5KA 4NSNA 3C1UA 1XZNA 1YRWA 2O57A 1KY2A 2XOKD 3KYCA 4FR0A 4BMNA 2PUCA 1NNSA 3FAZA 4BGIA 2GQ0A 3N2KA 1QFXA 4L72A 4A0RA 3BGWA 4XPZA 9MHTA 2JGRA 2PGJA 1RIFA 5CURA 3PQ8A 1T2NA 3VPCA 1X9IA 2UYHA 3C3YA 2X8AA 1GRVA 4X54A 1L5NA 2C2ZA 2G71A 4KLAA 2JGDA 2Q2WA 4DLZA 1RMYA 2VKTA 3K1JA 2VJMB 4OGLA 3NIFB 4R3WA 3F7TA 1U7DA 4LOKA 2ECOA 3UV6A 5D84A 4ZRDA 4DA9A 2AN9A 2BEJA 2R6DA 3GP3A 2DPYA 2JEZA 2R7MA 3HVUA 3KR2A 4L95C 4PLZA 4X95A 4UU1A 2MSCB 1B8PA 4N47A 2F9FA 3TQQA 3TQOA 2WFMA 3DUFB 4BASA 5DT9A 2IF0A 3WHKA 2FPSA 4HWTA 1WG8A 4P4TA 4XCQA 1SEPA 3HWX1 3C48A 1XP5A 2NAPA 5AKYA 3SYNA 4M21A 2QGNA 5EJ6A 5G41A 3SYKA 3COJA 1ULZA 2QX8A 5LZ5A 1USWA 3KJFA 1EWRA 5KCZA 1JFFA 2WUGA 1HZZA 1OHHD 3QEKA 1JWLA 1MQ9A 1Z8FA 2Q5JA 1C1XA 3T35A 3ER9A 1JLMA 2HU8A 4LF7B 1IPFA 2QP4A 1NT2A 2CHFA 2VDJA 2I7XA 3OPXA 4O0MA 3V4OA 4KVGA 3GW8A 3U40A 3UG6A 4DIFA 2B34A 4II2A 1KK1A 3MWEB 2O0JA 4B80A 1V48A 1NM5C 2C5HA 3KHTA 3MS4A 3RBAA 1Z2PX 7REQA 5EPEA 2CL0X 4W1SA 3VPSA 5EKSA 4YB8A 2OCDA 3FVQA 3ZZ0A 3E0QA 1XZBA 4IKPA 4MV0A 2J9ZB 1J8DA 4R68A 3AB8A 3WWDA 3OWOA 3DOFA 1VLMA 1RW4A 5JXIA 4DRYA 1ZM9A 1M76A 3PFKA 5HIKA 1OXXK 1X9HA 2H85A 3KDSE 3VVBA 4NJMA 1MIHA 4Q4CA 1N3LA 4PIMA 2HZBA 4HB2A 1XLTC 4CMKA 5CB0A 3RVPA 2WPDA 2AFHA 3ZI7A 5BORA 3ZWPA 4R8SA 1J39A 1OR8A 1B1CA 2JGNA 2HA5A 3HDTA 5BV2P 3ETLA 4WCVA 3TNDA 2OHXA 4JT9A 1E1QD 1QJCA 1YDWA 3MAJA 1AC5A 4AJOA 3WWOA 5LQRA 3GPLA 1NJSA 1W49A 2ZYSA 3SOPA 1TTTA 4PBRA 5CVJA 2BMWA 4QOGA 2JRLA 5K3SA 3SZLA 3VYWA 1SB9A 1V1RA 3UVEA 5CDUA 2PRZA 2NZJA 2JFVA 4K6FA 1HM5A 1TDJA 1AKYA 4FDAA 4G0PA 4MKFA 3BWXA 1W1IA 3M6LA 3QSYA 5K8VA 3FRJA 5FNZA 3OOWA 3PDIB 5CITA 4UKDA 4B4VA 2AJCA 3N2GA 3QFTA 3BMCA 3UWDA 2IV2X 3GNSA 4PN7A 1LTQA 1HYBA 5DYTA 5CNJA 1SULA 2BL4A 2Q8PA 3RYCA 1RLIA 1ZEMA 4HNHA 3HBJA 2NV2B 4MUKA 4CETA 4NCAA 5AWFC 4JFAA 1PNOA 4YCCA 4I1OA 1EA7A 3TVTA 3OU2A 1RR6A 3QE0A 2PRSA 1XEFA 3Q3EA 4G8JA 3BEDA 4PQEA 2X7JA 3S99A 5HR5A 5JAIA 1LNQA 1S8AA 4R40A 2O5CA 2RHGB 3K0AB 3S70A 2CFRA 1ABEA 4MUFA 2R5NA 1GPKA 3L49A 3G2HA 4ND3A 1GCIA 1NI5A 1OBVA 2O19A 4AKTA 1P7VA 5H59A 1VHQA 1VGRA 3OPQA 2IHJA 3QXCA 4FDLA 4OHOA 1PBNA 2WQ6A 1KXZA 1R0ZA 2RHCA 4DXAA 1VYVA 1AQ6A 1HWYA 2HPZA 3KXIA 5DEOA 2C07A 4C6TA 5C1PA 4B2YA 2HV8A 1OFGA 4G5OA 3CRZA 2YV3A 1BZYA 5F76A 3WGOA 4YAOA 1FX1A 1U0EA 5J2UF 3I1IA 4W5WA 2PE5A 2ATIA 4U8GA 1XD2A 4B43A 4QULA 1WIWA 3V4FA 2WHEA 2OCLA 2OZKA 5CG1A 4XX0B 1DO8A 2JIRA 5CLQA 1QUEA 2JRCA 3R76A 2NUBA 3FMOB 4L85A 1DPGA 4WAUA 2AI3A 5AVJA 3CLKA 3BGDA 5JARA 3PFFA 2J6IA 3F8WA 1FRVA 2BGLA 3GHYA 3GZ4A 5IJWA 4CXMA 1OYWA 2QUIA 3OX1A 4P93A 4WN3A 1QLWA 4LCBA 2ECPA 1L4NA 2J7KA 2QL5A 1MQ8B 3PQ3A 3WA6A 4ITUA 1UUFA 5HX7A 4WBXC 1KVRA 2F9MA 2O4UX 3TSWA 1ZG3A 4E3WA 2XKJE 4Y2SA 4D0LB 1PR5A 2HNAA 1GZDA 1QFYA 4WXPA 2FVYA 3QE2A 2ZUBA 3VR6A 5CCBA 1JXQA 1KK3A 4W5NA 1HKUA 3KSMA 5DYIA 3SHWA 3I52A 2JARA 3KVVA 1XJ5A 5AI0A 5DBIA 5HFAA 3I4CA 4GYJA 1GUDA 2PO5A 2CVOA 1QXSA 2J59A 2Q62A 3U37A 3HEMA 5IXSA 4Y2QA 3AR7A 1T25A 3K5HA 2ZSDA 1BHJA 5KQGA 1JFTA 3S8MA 3Q40A 1I1HA 1E6LA 2H2GA 2ODTX 2GXQA 3WFZA 4DL9A 1GNQA 1QHGA 3CBGA 4HAIA 1T2DA 1RPNA 2PJRA 3OCZA 1XAGA 3MRTA 1Z2EA 1YS1X 1FMJA 1R7RA 2XDQA 4QO8A 1N78A 2WG1A 3STXA 4BGVA 1Q0QA 721PA 5JXWA 4R1UA 1MN6A 3R0QA 2V1XA 1AJEA 2PRKA 3PFCA 4ZVKA 2ZIGA 4FGZA 1QAOA 1ENOA 4ESVA 3ZPXA 2NO4A 4B84A 3U7HB 4FMCF 4HVAA 2UYCA 1Z3CA 5EHZA 2OFFA 4D0SA 1BMQA 4BS9A 3EFHA 1USVA 4YMIA 1BVUA 2H06A 3BFXA 4O2RA 5BQ3A 3KKOA 5HRAA 1TLFA 1UJ2A 3FY4A 4EY4A 3PU6A 3SC6A 1NW5A 2WM2A 5F1PA 5JCJD 1N2GA 1GXSA 2XLCA 3ZDEA 1J42A 2PUWA 1YIDA 4G23A 3ZQ4A 4F5WA 3O1LA 2OQIA 1GG2A 4OQDA 4QBKA 4NVRA 4RJLA 2IY8A 3H5LA 1MAHA 3CLHA 5EJAA 1FDIA 3QPDA 4Q9HA 2YVUA 1CNMA 4RQAA 1Z36A 2XIJA 5FPKA 3KVNA 1J1IA 2CFSA 5H4HA 4J75A 4AP9A 4QX6A 4C0BA 3A2LA 2Z56A 3N8IA 4Q05A 3ETNA 3QXHA 4WGFA 2CHVA 2HI0A 1IB0A 2P6PA 2Q3MA 1T36B 1IH8A 1NLFA 4MQEB 4PHCA 1XEWX 4AUKA 3K30A 2HJWA 3UMRA 3H3JA 3UJPA 2X3FA 5CH3A 3ABSB 4FZVA 1XVVA 1YR8A 4F7WA 4Q6WA 4D8XA 1CUBA 3BF7A 5AVTA 4D3YA 4D5EA 5HJ5A 2FQYA 5KOJA 2WHQA 5EIXA 1QOQB 4WSOA 2FEMA 2WA1A 3D8BA 2V65A 4G36A 4DV7B 4LXTA 1AM4D 1E9SA 2PDAA 5SY9A 3NC4A 2QNBA 4N0QA 2PKQO 4CM9D 1KQ3A 4BGEA 3GP5A 4YQYA 4KDRA 2CDCA 1P1FA 3DNMA 3F74A 3IAS1 4RK5A 1KO7A 4RLFA 4F85A 1POWA 2PV0A 4RCZA 1UDXA 4ZC1A 4EHLA 2XZOA 2GEUA 1UXHA 2A8YA 2P6UA 4LEIA 3AJAA 2IYEA 1L5RA 3EPPA 3OOJA 2O8EB 1Z08A 2ATXA 2HA0A 2AC2A 1TAGA 4TLMB 3GGCA 1BFUA 4L0CA 4U7JA 1RRFA 3GGGA 1SG9A 1AKUA 4R8VA 1T8TA 1MT0A 3BXHA 3GLQA 4I9HA 2WRZA 3PHHA 1OH8A 2NXWA 1N2EA 1WDWB 2FEKA 4BFCA 4R0MA 3VR4D 2AWOA 3I4FA 3MUNA 4IZ6A 4AM8A 4DLBA 1I10A 4CKCB 3RRYA 5K0BA 4FJ0A 4LMBA 3IO5A 4BVBA 2P6NA 2UVPB 2ES4A 2XA1A 4WUVA 1VYUA 2BM1A 4JP2A 4DLVA 2WD7A 3GP8A 4E6PA 4V0KA 1EM8A 2F90A 3L0ZA 4Z86A 2GZHA 3A3KA 2QTFA 1HE3A 5DLQC 2AX3A 1ECLA 4M55A 2DWOA 1ODTC 2DFPA 1KI7A 4X41A 3BMNA 1BROA 4F5YA 4KUEA 2G28A 3EVCA 1NVUQ 2D74A 2NZVG 1G2IA 2XVAA 2HN9A 1UP4A 3KZVA 4KQGA 3H5WA 5A4DA 1VKOA 2BISA 3K0BA 3S3TA 3PBKA 5LLDA 3NGXA 3NUGA 4FGKA 5CB4F 2ZQYA 1EX9A 1KP9A 4P7GA 2XCLA 2M6KA 3IEIA 5BWLA 3PZBA 4TL6A 1GADO 3D3WB 2ZUUA 2F43B 1ACLA 3KHKA 3KVOA 4LE2A 1B3RA 1W94A 2X8JA 3LPAA 2BMFA 4O2AA 4PC2A 1JJVA 1GTG1 1QYIA 1UBMS 3WWEA 4YRMA 3RUHA 2PLRA 4H15A 3OQJA 2QNIA 1K1EA 3GD7A 4INAA 4EEZA 1GQ2A 3NP9A 4LQDA 1RE1A 1ZIDA 1V5IA 4V0MA 1IJFA 3NTLA 4BZXA 2DG2A 3ELWA 1QG6A 3S55A 3ZI4A 5CVTA 3DMTC 3M3PA 5F3DA 1DFGA 2IXGA 2ZBPA 2RIPA 3QFCA 4DR4B 4BX8A 3A7DA 3H5RA 3O4FA 4DQUA 2QBYB 3KVYA 1ZNQO 5C8YF 1T10A 4CG1A 1Y3FE 2XF2A 4P31A 1NURA 2BI8A 3OWHA 1EFUA 3CPJB 1D6SA 1O95C 3AOEC 3EIUA 1PDOA 4RE6A 4ZRMA 1TVMA 3FI0A 4RAQA 2O8CB 1A9SA 4Q3AA 3F78A 2EFGA 2AJDA 5CX1A 4ZVQA 3UTDA 4K9NA 5BN4A 3THSA 1NVFA 2YXNA 3EZ6A 1KZ4A 1FP7A 3QOXA 1YRHA 1N1MA 1Z5PA 1H8HD 5C18A 3BX1A 3P2YA 1JFSA 4IXDA 4DPKA 1LSSA 1A2QA 4YXWA 5KQMA 1RQPA 4FYPA 5DP1A 3USCS 3TBHA 1G41A 4QNRA 2VYNA 4V0SA 5C37A 3EFOA 1U2GA 1ISRA 1R8YA 2Q6IA 1ZIXA 3EDYA 3IP7A 5CBPB 2HCRA 3LDAA 1KO1A 1RJ9B 1E7SA 4IIJA 1W9HA 3L7IA 1IMJA 2JFXA 3NEAA 4KUHA 3ZE1B 1JSLA 4C7MA 3EK2A 3LKBA 2O9JA 2X6TA 1N0WA 3AFOA 1WQ4A 4BDSA 4DABA 2XZPA 2IYOA 4OQEA 3WAGA 1F9EA 3ZZMA 3PD7A 3NW9A 2FTKE 2DWPA 1JPVA 4Q02A 3E8MA 1TZJA 2IIVA 2QSYA 3PI7A 4TVKA 1YRLA 5HA5A 2ONJA 3ZDAA 4ZYWA 1N6NA 1M7HA 5EGSA 5LA6B 1A2KC 3ROZA 4QGGA 4UOZA 1NQTA 1R27A 4MJ7A 1RPZA 4MV4A 1DBIA 2Y0PA 16PKA 3R0JA 3EX7C 4OH7A 3FOCA 4HYQA 1WQ3A 4I66A 3IAXA 4LWZA 3C3DA 2VF4X 1RWNA 2ZT7A 4Y9TA 3ZH2A 1ACMA 1NAIA 1P73A 4LQ4A 2IHZA 1BFDA 2QY9A 3DOCA 1BWSA 4DAOA 3TOVA 1OH5A 1BDJA 2A0KA 2RI1A 1S9HA 3ELDA 3QXXA 3NHWA 3ZIAD 2GR9A 4HH1A 3ZWCA 1G2OA 4FFOA 1MUUA 4BKQA 4Z6KA 2HK9A 5LVAA 5CT5A 3AFIA 4Y6PA 1ZXXA 1KQOA 4OAOA 3QOYA 1MAUA 3FCCA 2PG3A 1U7TA 1VPLA 5FA6A 2DQZA 2IYRA 1DIGA 3DONA 3FIJA 3AVPA 3PVZA 4A36A 5CH8A 4BKPA 4Q9IA 4CUKA 2ZW9A 1H2FA 4Z4CA 4AQYB 1ZGAA 4D3SA 3PNVA 5AESA 1XMIA 1I2ZA 4ZYLA 3T1HB 1JT2A 4YV0A 1EGHA 4P92A 3UOGA 4B3JA 3KFVA 1LRJA 1Q0TA 1E3TA 1Q0HA 3W9YA 5A7HA 2FPKA 1IMOA 3NJ4A 1P62B 2XCUA 1L5YA 4IBOA 3ESXA 1FNDA 3I6IA 4U7GA 2C4WA 5JR3A 3Q9SA 4AYXA 4E2XA 4LTNA 1JJBA 5GWXA 1VKZA 3NFRA 3Q85A 1X7WB 4REQA 4MARA 2EDCA 4A10A 3YASA 1NXTA 2XE4A 2Q7XA 1G5IA 2ZTVA 1SD5A 4W5JA 1UBNA 2OD2A 3FMGA 5C8XA 1O94A 3R2JA 4IIVA 3MT7A 4O2AB 2OO3A 2QRVA 2ZWAA 1NNI1 3WICA 4X66B 1CEYA 4JZYA 5IVIA 2W4MA 3ISTA 3WGIA 4Q3KA 3E9MA 1U98A 2IY9A 3TW6A 2VZ0A 3W3ZB 2E18A 4F38A 1WZIA 3FWZA 4QE3A 1L0BA 1OU4A 4RV5A 4EBFA 2N1MA 2P0AA 4H17A 4V3BA 1IOVA 1I9GA 3CZ4A 3NTRA 5FULA 3L41A 3NH9A 3BSWA 1VZ3A 3D0RA 4HI0E 4M0MA 1GQOA 4EHHA 3H3FA 2WVAA 1VG8A 1B93A 2QBYA 1K7EB 4V24A 3MMPA 1N7GA 5CX4A 2H2WA 4GC5A 1E0DA 3W4JA 5F4BA 5T4HA 3TMAA 2IS1A 1XLUA 5K3EA 5L53A 3BD7A 4FFWA 2IVFA 3ZCXA 3K4HA 3RUIA 4F72A 3AZPA 3ICPA 3L6EA 5A1TA 2EKQA 1MV5A 2RH8A 5EQJB 1L4EA 4DHEA 1SIWA 2VF5X 3B20A 1CB7A 1S6YA 2X76A 1WMFA 3EZ9A 2ZWOA 1AGXA 3K92A 4JWKA 1OU0A 1T3SA 2AOTB 3ADDA 3TRIA 3ZDBA 1KFJB 4TTIA 3QI7A 4H1HA 2P8SA 2WDZA 5L51A 3CJQA 5C51B 5BSGA 1DNPA 2ANCA 4YS6A 4B4UA 1MB4A 1MJ5A 1XR3A 2JCGA 3D6FA 3N87A 121PA 2P69A 3ZTYA 4TL8A 1NG9A 3OZWA 1BKDR 2OHOA 4NAHA 2BTOA 1RXVA 3T12A 4FDVA 1TGVA 1DXYA 1XLVA 4QNMA 2XVYA 3LUDA 2YN0A 2CC2A 2FDRA 1WKVA 2FWBA 2Z57A 1R5BA 1DLIA 4FXPA 3HSYA 4WECA 4H0NA 4JI6B 3RGGA 2WB4A 3GNQA 1M73E 3DO6A 4GWLA 4HDNA 3THYB 4R41A 3E22B 4QVGA 3THXA 2OZPA 1MX5A 3S28A 3IHKA 2GDZA 2H16A 2P2ZA 2J3KA 3NR2A 4G1EB 1SPXA 5JQGA 4MA0A 4ON9A 1A9OA 2GGSA 3BQMB 1WULS 3U2QA 4TT3D 5K0NA 3ILYA 3P27A 5ITVA 5I8WA 3QWFA 3LX8A 4GPAA 1ZGCA 3IPLA 2P1DA 3Q2OA 4EYOA 4KPYA 1J09A 5AIAA 5C32A 3O8QA 2J4DA 4PFQA 5HK9A 2VDWA 2NP7A 4I9FA 4B2PA 3BIXA 1L8QA 2B4AA 3IKTA 2OL4A 5HJ2A 2QIOA 4LRTB 1DMRA 2VTVA 1JZQA 4HAXA 3RIMA 1L5KA 2WZBA 1BQ4A 1XZEA 3I04A 3M49A 2ZPTX 1BXGA 1SA0B 1CY8A 4TYQA 3EOZA 4V0LA 3BTOA 2FFHA 1EAMA 3OCXA 5EPUA 1VJGA 1TCUA 3C0KA 2Q4OA 3GVXA 4LHSA 5U9CA 3QBVA 4GMGA 4D9JA 4H0CA 1YJBA 3AILA 3M4ZA 2C00A 2BEWB 2IYUA 2O7VA 4LWPA 4D4IA 4ZEXA 2Y66A 4CG0A 2HHJA 3JARB 2ACEA 5KNDD 3EVZA 3BRQA 1NYTA 3KUDA 2NXEA 1E2IA 1R0RE 1CYDA 3HBNA 2CJWB 3EDCA 4MWCA 2YJ4A 2Y0CA 5EY5B 3CWZA 5G40A 4YUZA 1XZCA 1ESDA 2HSDA 3M89A 3AI3A 4PG6A 3H3XA 2FWIA 1FNBA 3IBGA 4PZCA 1UBLS 2JK1A 4Q1AA 4G0VA 2MR6A 3C41J 4IIUA 3OZRA 4IIDA 5AM5A 1RLJA 3UAOA 4QGHA 3EPKA 1ODCA 1YQ9A 1ZGBA 2W2LA 3MYYA 4RADA 1A4XA 2NAFA 4WESB 4S24A 2WICA 4L0QA 3TM5A 1EBUA 1QRRA 3F6SA 3TDMA 3KRTA 2RKBA 4S12A 2JVJA 4EYQA 4J1NA 3GPCA 2I8AA 1QV7A 3ZWDA 2O2SA 1P2BA 1UQTA 1TEVA 4HVLA 4IVPA 4Q1BA 5BNFA 3OZBA 4C2BA 2PUEA 4BNXA 4PSAA 5DNVA 3I6MA 2VXYA 2C3OA 5CLGA 4MMYB 2HK8A 2QORA 1T8SA 1CF2O 1U5CA 3H99A 5EE9A 5MGBA 4ZP1A 4UU0A 1EFVA 1VRVA 2REOA 3CF4G 1P2TA 4HT3B 1U99A 1HDIA 1P7YA 2J9RA 4LOJA 1F06A 1DV1A 2EJTA 1SVMA 3ND7A 1IHPA 5HF6A 1PQPA 2BEWA 3DOOA 3KYDA 3LT0A 4CTJA 3FNEA 5DTMA 2NZUG 4ZVTA 3V7FA 1TZMA 3SJZA 2CNKA 2W6ZA 4DWOA 1FJGB 3LYLA 4MR8A 1I7QB 4KPGA 3W6PA 3ZJ5A 4KR9A 1PNQA 1JG4A 2OZLB 3DL4A 3SG0A 3TFWA 1VFNA 1NX6A 3KT3A 3HJHA 4DG5A 2A84A 1SVLA 1BEUB 3HUDA 3WB2A 3BMXA 3WDMA 1W2GA 3FOBA 3KWJA 1US8B 3QBJA 4OBEA 3X1XA 1J20A 1T2CA 3BOSA 3O7MA 3OIFA 4LYJA 5COBA 3OPYB 5GPBA 3AIKA 1IE3A 3EGDA 1A9RA 3IE1A 3E7DA 1YR2A 1E2NA 3GK3A 4X3PA 1DHTA 1JJAA 4B47A 3ST7A 4UW9A 4JQCA 3AETA 4LVNA 2XQGA 1T2FA 4L4RA 3H9BA 2WA2A 3AWIA 3P9SA 3LOUA 4YCDA 1W7AA 2BH2A 1T5HX 2GILA 3ABIA 3C3MA 3M1IA 2ZBEA 2OBFA 1E5VA 2W7TA 4M7WA 4CR6A 3UUWA 1GTMA 4PTYA 4X61A 1TCCA 3KYDB 2SKDA 5IN5A 1UKVY 1XSEA 4DCVA 4X00A 1U65A 4ZHSA 5DX0A 2NSYA 3GB9A 4K9LA 4MYTA 2GZ3A 5D7NA 3O75A 1PYGA 4OSPA 4QEZA 3S6JA 3WL4A 5FHRA 3INYA 3BXOA 2B20A 4EUFA 2C1XA 1PVDA 3IL2A 2PA3A 2ZDHA 1ZMBA 3JQGA 1HTTA 4UCXA 2VHXA 2XYVA 3CNLA 2OGTA 4BRSA 2ERCA 3E2PA 3VTFA 5AKHA 4AWXA 5JC8A 4UFNA 3D5QA 3QELA 4YP5A 1G8MA 1VGQA 2ZCJA 4H7PA 1K7XB 1Y98A 2DFTA 3HXKA 3D6TB 4A5OA 3EVGA 4RY2A 2C7GA 5U1PA 4CIDA 2C4MA 4M1SA 1Q7EA 1T91A 2VJMA 4IG9A 5JNSA 2NO1A 3I45A 4ER6A 4LYFA 4P3YA 5LNK6 3FSJX 1T2UA 3EXIA 4EKIA 3HXOA 1JQAA 2PL3A 5J4HA 1MP0A 4CCSA 4LV5B 1XA4A 1YRAA 2W22A 3EBPA 1IVYA 3H9UA 5CPBA 1E6WA 5DRYA 4N48A 2DJ5A 5M2QA 1AA9A 4K03A 2RGYA 4O4JB 1S96A 5EIWA 3N8DA 1EDOA 2WV9A 4EUKA 1VKJA 2NOAA 3BJIC 3WYNA 2X0JA 1IZ7A 2YY7A 2ZVDA 4ARAA 4RCVA 2O2GA 3RKSA 4MV5A 1LH0A 2CJWA 2H11A 2PZMA 2AZTA 3OIDA 3DC2A 3G2NA 2CD9A 3IR5A 5LKAA 4Z4EA 1L9KA 4JP5A 3LRXA 1E66A 4JXJA 3A4MA 1QIKA 4G3XA 4KOAA 2C5EA 4ZDIA 2G8NA 4U2GA 3V4VB 3Q8MA 2J0UB 2REQA 3MCWA 4JBLA 2EFDB 4JLOA 4LS3A 2LW7A 4H27A 3GJZA 1UC9A 2Q9UA 1FFDA 4NU5A 3EXG2 1NXQA 1U28A 4YVFA 3BTSA 3SDZA 4LJ9A 2AOXA 3H9QA 3ZXUB 3DFIA 2YXBA 4I2VA 3WQQA 4AXXA 3NBFA 1E5LA 1DAPA 1V43A 3M5DA 1GLGA 2Y2UA 4HQ0A 3AKDA 1UAAA 5DTJA 4Z2AA 4ZMBA 2NZYA 5BSHA 3KDAA 2N1BA 5DLEA 4OHWA 1CRZA 2CLCX 5E9JA 1KDTA 2C5LA 4YBRA 1MAVA 1PDVA 4KPFC 1VL6A 5IVDA 1ZSVA 2VT3A 1ATZA 4GM0A 5FI1B 3KZKA 3WNDA 1P9WA 1QNFA 2CUKA 2OGWA 2W2TA 2XXBA 1Y4AE 1V35A 3FCYA 3NAQA 4JENA 4X20A 4CIVA 3GDOA 3W1EA 4BFSA 4UE2A 2X9QA 5BSKA 3AJDA 1L4LA 3C5VA 5TQ2A 3GLGB 1Z6YA 3ID6C 1Y1KE 4QO7A 2E9SA 3SXUB 1GKUB 2E49A 3LLCA 3UJDA 4R8RA 2BFBA 2JLRA 4FILA 5KOHA 3R3SA 3U4CA 3VNQA 1P91A 1FPMA 3FKSA 2JLUA 3PTLA 3AOEA 2B0CA 2HXYA 2HMAA 4RZQA 3JZDA 4EJ0A 3L84A 1KQGA 3LHKA 5FWYB 4ZZ2A 1QU2A 1M67A 3GFFA 4JR0A 4QHSA 3K8OE 2JAHA 3KAQA 5JHHB 2G6TA 4ND5A 4JR2A 4XWWA 4GPTA 1GZSA 1U2QA 4PHTA 1UMDA 4XH9B 5ALUA 2OKGA 1E9FA 1YK1A 2Q6TA 3ZOZA 5JMTA 2FZCA 3ILHA 4U39A 1YS7A 2OK8A 1XJ0A 3TLZA 1YT5A 5J1SB 2IKSA 1JN0A 3AXSA 1K6JA 2J48A 1V6AA 3KKQA 4NIMA 4AYWA 4EVRA 4RE5A 3LTEA 3RU2A 1XF1A 3DFKA 1BDIA 3I3OA 1LLDA 2OLKA 1I36A 1P2VA 1V5FA 4L0DA 4UDOA 1XQVA 1V9CA 4DEYA 2QJOA 2V3WA 2W4IA 1SUAA 4R84A 4TTQA 2A59A 3H2ZA 3NEYA 4OQXA 3KB6A 4R3NA 3PPYA 3NHKA 5C3UA 2N75A 4OQMA 2E37A 2BCJQ 1CUWA 3OO1A 2C88A 4QUAA 1EFCA 3DQQA 2O3RA 2JDIA 2KMLA 3B5EA 2CNDA 4BAZA 3HA3A 1JZTA 3NBAA 4RHYA 3LUAA 1XMXA 3DF9A 1ZOIA 4NEQA 4OIMA 2O5RA 4IG4A 5DU2A 4EPRA 3G02A 3HN6A 2FJUA 2CV1A 4B2IA 1N6KA 3A4VA 1K6MA 1ZFNA 2G5TA 2SCUB 4JT8A 4EELA 1FDOA 3PLRA 4PC3A 1D2NA 4D9CA 4JJAA 1DRJA 2HXSA 4TVOA 4OLHA 3PCRB 2QSJA 1Q77A 4I3FA 1ZVQA 4Q9AA 5GTDA 1TZKA 4L07A 1BJKA 1VI5A 3O3MB 1QO7A 2ILVA 4B1FA 4KTVE 3WLIA 4NCKA 3C7AA 1GL6A 3EVDA 1Y6ZA 3M2PA 4F71A 2CFOA 3AKZA 1ONSA 1H2AS 2ASVA 3RD5A 4DUGA 4ID3A 1HRDA 1OILA 2QA5A 4RK7A 4DTCA 5BW8A 5CX1B 5AJZA 1MRSA 3LOPA 4G1UC 3WX0A 2FPLA 5EAIA 3LQQA 2JBAB 3CO5A 3FYUC 4FSDA 2JAQA 1VJCA 3TK1A 3UHJA 3EDMA 2GBIA 3J81k 1YAJA 1AB6A 4PHHA 1LI4A 5AVZA 3B8HA 1G7SA 1SCJA 3BB3A 4IV5A 5C31A 4BFZA 1K4KA 3U13A 1VSVA 5IM5A 3FW1A 1H9BA 3Q10A 3HJUA 4Z7JA 4LSZA 4QXQA 1X7YB 1NBMA 2C9ZA 3KLPX 3R41A 4E88A 4ND8A 2IH2A 3PQEA 1JZSA 3G82C 2I3ZA 1YL6A 4P54A 5BT9A 4ENSA 2Z9CA 1PG2A 1BVRA 4LJRA 1LRLA 2UYYA 2VEOA 3CE6A 2P2SA 2GPJA 2GCEA 3NX4A 4IUDS 2NZ2A 1QR2A 5I47A 4DRZA 4RPLA 3FZNA 3JTEA 4G9GA 4KNWA 1CF9A 2PZEA 3GGSA 3LXMA 1DC5A 3IESA 3OZCA 1QOPB 1MTZA 1FRNA 4PE5B 5CNIA 3GCGA 3ZD8A 4B3HA 3SN6A 3OJEA 4XASA 4B9EA 2CXQA 3F5DA 3RHFA 1ZR4A 1RLMA 1V1RB 2Q4DA 3X44A 2AFRA 4C7OA 2Z2XA 3GJ4A 1NASA 5LFAA 1Y42X 3AETB 3FSEA 4B6GA 5TF4A 1OAOC 3SZ3A 3RSOA 1SOVA 1TFRA 2FZ5A 2VAPA 3EIXA 1RZRD 2PD3A 1ND6A 1EA5A 4LXHA 4KYUA 1HLDA 1EVYA 3G2KA 3LP6A 1WUTA 3WMRA 1Y3BE 1U1DA 2XQJA 4XGQA 1IQRA 3P9NA 1YJAA 3H16A 2NU6B 5FL7A 2ZIUB 1NF8A 3ZXXA 1KQFA 3SYRA 2PUFA 3H5IA 1EK6A 4CHTA 1IWPB 4BBAA 4HZIA 5HP4A 3QEMB 2ZRQA 4EIWA 4IGIA 1XHEA 3DMHA 5T4BA 1Q0RA 2IWRA 1QZ3A 1ZSYA 4X0EA 2HEGA 5G1PA 1DCFA 4UHKA 1HX7A 4HWSA 2VK8A 4DGQA 4W5RA 3MGAA 4FFSA 3NHUA 1KPHA 2ZFUA 3L8CA 1KMHA 2OWEA 3WLNA 1OBHA 2VYVD 1D3AA 3A9TA 4BUJA 2H2FA 3MA0A 4PAQA 3ZZNA 5C5CA 1H0KA 4C4YA 1WEHA 1ISIA 2D1YA 1USIA 5F3WB 1YS9A 2F55A 3IS3A 3CLTC 5AW2A 1U1GA 3LL7A 4KQ9A 3WDLA 4AW9A 3EUAA 4MB6A 5HCUA 2H59A 1MO5A 2UDPA 4UD6A 3CUKA 1XQ1A 3AERA 4BQNA 3HU5A 1DWUA 1NNLA 2P1ZA 3F6YA 1JWBB 1G20B 1YFKA 2LTAA 3QUAA 4HO1X 1EG2A 1VJTA 5EERA 3V1TC 4G0WA 2D0OB 3AM5A 4ZI2A 3S1AA 4OYYA 3QUQA 3T3MB 1LLQA 5A5FA 2PUVA 5CEFA 2E48A 4KREA 2LXNA 2QKYA 5LDGA 1L5HB 2B21A 2OFPA 4WGGA 1PQWA 1XKTA 4M7OA 5BQXA 2JFPA 1TA0A 5G0SA 3P97A 1YS6A 3FGZA 2F48A 4FS3A 3SQXA 3BL5A 4QHTA 1TM3E 3B85A 2IT1A 2E5WA 2FPPB 3LIPA 4RD6A 1NBMD 2IUTA 2JL1A 2AD5A 2VQEB 3R8CA 2AI2A 2PZJA 1E2BA 3NHLA 1MB0A 2KBEA 3LFTA 3FA2A 3JPYA 3U3MA 1RWVA 3AZOA 4HWGA 4HUTA 2OFOA 1PJAA 2GEDA 4QG7A 3F49S 4IJUA 3WL7A 5LUAA 1OPRA 1H6DA 1KAGA 5JPIA 3WNVA 5JO0A 2W00A 2X42A 3BQ9A 2WUDA 4MVJE 2XMSA 1JG7A 3A6LA 4U7FA 4WTOA 1KDOA 3IJRA 1TO2E 2IXBA 3VPGA 1XDBA 3CT6A 3DEYX 2RHTA 5T3UA 2GK4A 1CZHA 2BBTA 4B45A 1IONA 2ID4A 3GQBB 4MQ5A 1Z18A 4DQVA 2PFGA 1M0TA 4NV3A 2OESA 4ZV4A 4XWYA 4BJ5A 3TX2A 2I54A 4YPOA 3QEAZ 2QR5A 4C0WA 1VIVA 2O2DA 2HO5A 1GT6A 2G88A 2WZDA 3F8SA 3QA9A 3WE7A 1OB5A 3CH5A 2BE9A 4RANA 1PD0A 2FRDC 2CVQA 1UBGA 1ZI8A 2NVBA 3KOMA 4P35A 4RACA 2PWZA 2D5CA 2ZATA 5I7FA 2H0RA 4LRQA 4KQEA 2YC2C 3L6UA 3LYAA 4GX5A 4ZALA 4OU4A 1C0EA 2Y92A 1CJTC 5BURA 3AW9A 5FOVA 5F98A 2ADOA 2QN2A 3O8CA 1U8UA 1S2IA 5M34A 4D3FA 3SDSA 1DAMA 3NUQA 4NMLA 3T99A 3D8NA 4WN9A 3ABRB 2JD0A 4E4YA 3TSAA 5JW6A 4UCFA 4J43A 1SUBA 3GDWA 5I3CA 4AMYA 3G85A 3QQ5A 2EX0A 3ESRA 2XR1A 2BJHA 1KZ7B 2OPBA 3C3XA 4HR7A 1G60A 4QD3A 2GHIA 5T6MA 3TTUA 3WB9A 5FAKA 5CIYA 4Q4HA 3RAFC 3BORA 4XVUA 2BGRA 1T5DX 2VNIA 3E7XA 4O4JF 2ZYAA 3DHVA 1O2DA 3SIPA 1UBEA 3VSBA 1W5EA 3AFHA 1O7JA 3NTVA 3B60A 4F3TA 3CEAA 1YXMA 4Y1FA 2J5XA 3N75A 4P4NA 1UOEA 2EP5A 1Y8QB 4OKIA 5CFMA 2OT3B 2ZE5A 1D9ZA 3LCJA 3HCEA 4NZZA 5AVXA 5J40A 4R2LA 2D7JA 1OJLA 2GJSA 3SZGA 3EZFA 1EP9A 4DKXA 4ZOAA 3FOFC 4QRIA 4F60A 1DAHA 3DWEX 1F9AA 1XMSA 5LB4A 1W34A 1KOJA 1IHXA 4KFTA 3OJOA 5EZ5A 2C5SA 3TLMA 4U00A 4UHBA 1KS9A 1PGNA 2IYNA 3DZHA 3QE4A 3FR7A 4MIEA 1XRMA 3Q9LA 4ZVOA 3SKXA 2O8DB 2ZRBA 4G67A 2P9ZA 3RNLA 3O1JC 1XMOB 3OZVA 4J1TC 1O57A 2W0SA 1HT3A 4ATNA 5G0WA 5JVDB 1KHTA 3EIEA 3RRNA 5LU9A 1NUPA 2XDQB 4B81A 2PN1A 2IUEA 2YMMA 3EWSA 4EB3A 1WZCA 1RRPA 4HDMB 3N0TA 2B83A 3ZHOA 4M1OA 4EG4A 5DW0A 4YDHB 1LTHR 2Q6KA 2HLDA 2VDQB 1L4YA 2Y1GA 4FWBA 4JI5B 1AH2A 4DLTA 1L4UA 4AJ1A 1JECA 1EK2A 2XRYA 3BXZA 4DA4A 3E81A 1GTVA 5FTJA 1ZK3A 1KR2A 3DCYA 4YJDA 3RU7A 2I3BA 2I3GA 4XYMA 4YRJA 3R0VA 5L9AA 1DUIA 3SE0A 3ET5A 4IMRA 3SJAA 3ETGA 3OCVA 1MTOA 1CE8A 2WMDA 2VG8A 3EN0A 3PFNA 1T4GA 5IC6A 5C1BA 2F64A 3RTCA 2BTEA 1CULC 1E5TA 4XGKA 3P45A 3R23A 1A0OA 3IQIX 3GZJA 2ZUFA 1V2GA 2AUMA 3OX4A 3WGTA 1ZPDA 1FRQA 2DB3A 1G8FA 1U1CA 2KQUA 4MA4A 3AHEA 3EPHA 4FHDA 4K87A 4AZWA 1ABBA 4EK9A 2RGEA 4EY6A 3GVHA 1KP3A 2GFHA 3CZPA 1A69A 1UFVA 3JQAD 2WWIA 3GLVA 4FVTA 4DQXA 3EXHC 3ZW8A 1PBTA 3E03A 2HRQA 3OM9A 1DJMA 1JIXA 2I7TA 2LVBA 2V96A 3OZIA 5AM4A 5ALXA 3HCAA 4TVBA 1SG6A 4B6FA 2IY7A 2IYLD 2ZJFA 1NQWA 2YY5A 4KRXA 2R00C 4V1CA 3R6TA 1JH9A 1NONA 3WG9A 4YXWD 4GT1A 1PVOA 3CUUA 1SOMA 2IFTA 4ZFNA 3HO6A 1RYBA 2ZBRA 4FP9A 1TQ6A 4KPUA 4NBKA 2BUAA 5FI3A 2NUAB 5A3RA 5KOIA 4TTJA 3D0KA 3FVVA 1VMEA 2I87A 4ZT6A 2YDYA 5KMGA 3I9JA 1MJGM 3C3JA 1ZNYA 1NUTA 1OHHA 1FUUA 3B7GA 3B3QA 3QVOA 3I9V6 3HDJA 4B8YA 1F5NA 1V2HE 1R9NA 2OM2A 3ILXA 3IQHX 2Q21A 4JUCA 4UUPA 4WUTA 2AZMA 3MHPA 5DX8A 4ZIRA 1DHRA 5HF5A 1RCUA 4WNIA 4BKMA 3G9UA 3H87A 1QVVA 3P4UA 4PPQA 1EZ4A 4A8TA 5K0SA 4FTWA 2YIMA 4JLSA 2C59A 2XCSB 1DCMA 3A10A 4H6XA 3V33A 4MDEA 2DUMA 4HXFB 4X7MA 1EFRD 4NZYA 4FDUA 1WSBA 5BNIA 2QM7A 3CHYA 1YQTA 4NU0A 1JQDA 1V16B 3D7RA 2Q5HA 4W1RA 1F38A 2XB6A 4GP9A 5CBPA 4BNNA 7YASA 1OVMA 1CK4A 1MIOA 2EGGA 3AG5A 3MEQA 4QQRA 1VBMA 2BTQA 3OTOB 2IEAA 2ODWA 3RCBA 2KLHA 3C6MA 3UGQA 2SBTA 4ZZ3A 2QLJA 1KO5A 3GT0A 3OPMA 5B6IA 4NENA 3A3OA 1ECFA 4FGUA 4G07A 3Q7PA 4PYKA 1NUUA 1DC6A 5IWAB 1LX7A 4IINA 2XX3A 5EZYA 3LV8A 4B6JA 1MAAA 5D86A 1P1RA 4NV0A 1XXLA 2Z95A 3STUA 4D57A 2B9EA 4IWNA 3FOAA 1RAFA 4QECA 1GAWA 1PFWA 2GYYA 3KPYA 2FQ1A 3GJ0A 1ZNWA 4QELA 4YAJA 1QCZA 3D8SA 4MMZB 4C6HA 2DFKB 5KYWA 1DXQA 1KSJA 1V95A 1C1HA 3HCRA 1DP4A 4ZOLA 4CQJA 3U16A 3QEOA 2DKOA 1YQWA 1BAPA 4QU8A 4NCBA 1HL7A 2C7OA 3LHSA 3HRIA 4AECA 1H2BA 4NH4A 1KZHA 4C4TA 5A05A 5I7OA 5FIUA 1JDZA 4C2TA 3EVBA 1A50B 3ZWKA 1Z63A 2C2KA 5KOYA 4Y2VA 3SHFA 2QJWA 4YI3A 4W5QA 3M81A 5ALLA 5DASA 3Q5EA 5E1DA 1ZJ5A 3V3KA 3KZNA 1PEAA 3A70A 4A73A 5CHYA 5I9NA 1U3UA 3S1SA 1OLOA 2POQX 3LLVA 5ALEA 4C7XA 4QG3A 3VYRB 4Q4AA 3BN3A 1VSUA 1KEEB 1U0RA 1ZKMA 2XTMA 1RMTA 1NBWB 1RZVA 2ZSIA 2Q9AA 1OFVA 3GELA 3I23A 2PQMA 3ZTTA 4NK5A 2RHRA 4L51A 3LRTA 5KB3A 4AF7A 1MIOB 1B7GO 1GVHA 1QRDA 1OGIA 1X14A 2OFXA 3IAEA 4YJ2B 2C2BA 3VZDA 1PEYA 3MWKA 3P2EA 2PWBA 1UDRA 1BGWA 4LYEA 5FQOA 3IAM1 1UPUA 4D9KA 1TJ3A 3QW4B 3OSZA 3WL6A 2FK8A 2WTNA 3KQUA 2ASEA 4FFDA 1Z4MA 1NXOA 5GMOA 4WNAA 5BNZA 4X3OA 2Z2KA 1Q7RA 2HQOA 1UKCA 2VK2A 1S2NA 1RJEA 3TTSA 2X2FA 2DLNA 2FMUA 1TQDA 4ZQCB 2VJDA 1B42A 4JFRA 3BIWA 7ABPA 2VK1A 2X0IA 1EP2B 3S2ZA 3BB1A 2CCGA 2VF2A 3BL8A 3RVNA 1QRAA 2C2MA 4E33A 2FZGA 4KXLA 3ZY2A 1Z4KA 3U1TA 4JB3A 1R1DA 1OFHA 4N3CA 5KTSA 3HADA 3GLIE 4TZ6A 4EGSA 3BWCA 1YAHA 2CF5A 2ORIA 2XKBA 4GZLA 5D3QA 1SU6A 2JLYA 1KI1A 4F4DA 5B4UA 4TRJA 2SHKA 4P2GA 1JRLA 4YDQA 4DEVA 1QHHB 2E6KA 1X1TA 1Y63A 2QLNA 3CA8A 2WYOA 1TJNA 4MCHA 5B58C 5J5CA 2P68A 4LXUA 5HNKA 2V9CA 2H3HA 1CJVC 4C4RA 4BO1A 2VTBB 3N6XA 4CM9A 2EIXA 4C7BA 4FE4A 2C5GA 5DIZA 4QEDA 2KJQA 2EJBA 1SCUA 3OMXA 1IBLB 4X65B 1OTXA 5KKCA 4PSUA 4LZWA 1GILA 1Y80A 3TZBA 4LY3A 3IURA 1DEXA 2Q5OA 5KAPA 1U8EA 2ZYRA 3MAGA 1U6KA 1UMCB 3JALA 4U2EA 4MQ6A 4WXRA 1QGAA 3ED1A 3FMPB 3TVYA 4YGYA 2FW7A 5EJFA 3TJMA 3W8FA 2BDEA 4FEAA 1T0BA 4RK4A 3ZV5A 3L4KA 1UK8A 1AMNA 2C7VA 3QBEA 4XVHA 2CKDA 1DX6A 1Q57A 2MYPA 3B2QA 3DYVA 1A8UA 1YR6A 3HDGA 3ORYA 3K6SA 4OD0A 1NI3A 5C8ZA 2VPIA 4BVFA 4OA5A 4URYR 1JU9A 4YMSA 2VVTA 3D6MA 1EHYA 2FUG1 1JU4A 1SC4A 4H35A 3O6VA 2CLSA 2PT9A 1P8AA 3FHLA 2WHXA 2H4FA 3D3JA 3ISJA 3AUSA 3PYLA 4PSKA 1SIUA 4XUEA 5FWXB 1IHUA 1YNOA 1VJ0A 5AD1A 2CXNA 1RXIA 4IHKA 2WTAA 1TNDA 4TWRA 2LCFA 1QZZA 1ZZEA 3PDHA 4HNRA 4MO2A 5B53A 1Y1TA 4K8OA 1YRBA 5DM70 1XDSA 3N1UA 4YCBA 4L15A 3WDSA 3WV4A 2R85A 3VX3A 2QDKA 2FUG6 1C8BA 4A0FA 2ON6A 3M9WA 4LYAA 3PRYA 2B4RO 3BHIA 3K70C 4N7RA 2H4HA 1J23A 2YZ2A 1AB5A 1H05A 1U63A 2PMDA 3IQWA 5LQJA 1U2EA 2JLAA 3SHVA 4KRGA 3K9CA 1CUIA 3R0IA 4OL0A 4QM6A 1SKAA 4D6YA 5FP0A 1PFQA 2QUHA 1ZD8A 3C4VA 2WU8A 1JIJA 2QS9A 3NT4A 5TQ2B 2O8BB 3LI2A 2HSJA 2PL5A 3IPCA 2EF0A 1J0EA 2WJIA 1CIVA 1L5VA 3PFHA 3VRHA 4YRBA 3H8VA 2BYTA 4EO9A 4PN3A 3KWFA 1E2QA 1ULBA 3AI2A 3GPIA 4MDYA 3GAAA 1OIXA 5IBPA 3PC3A 1M72A 1Z9BA 3T3EA 2G5PA 1Y7HA 1K08A 1T3LA 1C7IA 1TO1E 1TX4B 1WOYA 2O2JA 2VDNB 3E35A 3BZBA 3QFSA 4RV9A 3V1LA 1N8TA 3H11A 2F8TA 2B1RA 2Z8XA 4HGNA 1DTWA 3NJ8A 2KHZA 4N1AA 4MGZR 3AJ9A 4G1BA 4OXQA 1QB7A 1U28C 3N70A 1G2PA 1U2TA 2QG9A 4RKWA 4RVNA 5DN6D 2FEOA 4GM4A 3Q5DA 4D26A 1X7HA 1FP2A 5FUBA 1Z5ZA 2JIPA 3JZIA 3DNPA 2GZ1A 3NVMB 1R6DA 1GPLA 1KJ9A 4BBJA 3LUPA 4KODA 1H8HA 3ZXSA 1CUSA 1Z8NA 4FBLA 3H6GA 1L5GB 4L3WA 4PX9A 3TI7A 5JNTA 5LQMA 2C8VA 2B5VA 4PO1A 3MILA 3OLQA 1LSOA 3S7TA 1Z4NA 2YVQA 3SLGA 3AVOA 1R4AA 2Q0XA 3R44A 1K97A 5EMLA 1V8DA 2GN4A 1C7RA 1CPYA 5EMNA 3VR3D 3T5AA 1Q1AA 4TLAA 4V2UA 1DB3A 4LAFA 5C7OO 1PR2A 1LI5A 3U56A 1W75A 1IFXA 4O02B 4RY8A 5FTWA 3BKWA 3R3WA 1NMZA 2FW9A 2QW0X 4YUVA 4JH0A 4ZZ1A 1EZZA 4IX1A 4DV6B 5FFFA 1WM1A 2IQIA 3D1JA 4LE0A 5ANRB 1KEVA 2EFJA 1HNZB 1G4HA 5FTNA 1JSZA 3Q3IA 1FU8A 1OI4A 2H4ZA 3N58A 1AURA 1B2RA 1U7ZA 4NBRA 4OK6A 2XYPA 4J16C 4YRLA 5TB5A 2NYVA 5B7QA 2OHJA 2OZLA 1C29B 5MFZA 2DEUA 4UBNA 1LRKA 5KVAA 3OQPA 3VZPA 1JDBB 3KZOA 3RS7A 1TKCA 1X8JA 1WMEA 1T15A 4JEHA 5CDFA 5L45A 3UXEA 3A3YA 1YCGA 2ZI4A 4WLFA 2BT4A 3G1WA 4JLBA 1SHKA 3GEGA 5IP5A 2NUPB 1Q44A 2FW1A 1O6BA 2PEZA 2WWXA 2OB2A 3KQQA 1AS3A 1HYHA 1DAOA 2I7VA 4DMGA 4NENB 4U7WA 3SBXA 2IS2A 3OF3A 3AJEA 4M6WB 3F96A 4C6RA 5KSZA 3UFXB 4PZLA 2ORVA 2ESRA 4Q66C 1QH1A 5HGJA 3RYCB 5AJUA 5EXXA 1AUVA 3NBKA 4UMFA 1S2MA 3ZVKA 2OORA 4JCOA 2YYZA 4K7JA 3BGSA 3KS9A 3SZOA 2EYUA 2DM6A 1T5BA 4DZRA 1P33A 3FPKA 5JWOA 3CVVA 2X5NA 1R8SA 3RDPA 2ZUEA 3CM0A 4IH4A 5K3FA 3ZWQA 4P80A 2QWXA 3K72B 4K26A 1UQUA 3IBYA 4BE9A 1PI3A 2XH8A 5C3MA 2A9PA 1Q7TA 1YGYA 2C4KA 2PGAA 3EFEA 4TS1A 2PUHA 2PA0A 3FLAA 4V0OA 1XN4A 2ZI5A 5DT2A 1L5HA 3ASVA 4CF4A 4DLSA 1VLVA 5ARCA 2ZYGA 3OO0A 3PXUA 4MR7B 1A4IA 4QKQA 3G5UA 3N8NA 1XV5A 1VDZA 3CNQS 5EZSA 4UQLA 4HMOA 1W2HA 1NV8A 3HU3A 4G5RA 1LLCA 2O6LA 2OV6A 5FWXA 3RUAA 2AQ8A 1WD7A 1I5EA 2B1JA 3BJMA 2B4KA 2Z09A 5I4KA 3V1NA 4ZVMA 4AJ9A 2WF9A 4R1LA 3DM9B 4F3YA 4ALNA 4Q15A 4JJIA 2FJPA 3A28A 3BL6A 4NOLA 5D1NA 3FG9A 4EZBA 4JGIA 5BYKA 2MYUA 2VPPA 3WFJA 4G0ZA 5J47A 4DCPA 1XAJA 2Q5LA 3AONB 5EXEA 3ZGLA 2OCKA 2PFSA 2H5JA 2H0QA 3EVEA 3ZWWA 1NMQA 3R5TA 3CSSA 4P83A 2NVUA 2ZIXA 5HHTA 4DIOA 1F48A 1VLJA 2Q4EA 2WKQA 1E2MA 1F6BA 1V3QE 2GJ9A 1GPNA 2DT8A 2YW9A 1R0KA 2CDBA 4RJ2A 4YJ2F 2QJFA 3CRW1 3U0BA 3DSRA 2PJUA 2XT9A 3T9AA 4DA7A 4WBSA 3RARA 3I9LA 3D3KA 4OI4A 3RSZA 3U44B 1JE1A 2WTEA 5LP1A 1Y34E 2Z3ZA 4TXNA 5LR6A 1KJZA 4MITA 2DCUA 3TG2A 3EAGA 1DTWB 1QLJA 4AC9A 1KMCA 4HUQB 2Q7OE 3VR2D 3SHOA 2IHNA 1HG0A 1O95D 5HM8A 1KFEB 1EWQA 1FFXB 1F5SA 1IOWA 1RACA 4QYSA 3TXYA 2NNLD 3L6BA 1S3IA 4PC7A 3K8YA 4N7MA 4RQTA 1XRNA 2HSGA 4GQAA 3ZV6A 4D99A 1CVLA 1K98A 2OFWA 3WB1A 1SK9A 3HPRA 4NAUA 3SF0A 1INLA 3OAAD 3H6KA 3V4ZA 3PWKA 2R47A 3A58B 4TMKA 4ACBA 4HQOA 5JRDS 4WK4B 1JKJB 5IAAA 1B0ZA 1KE1A 2CVFA 1F1JA 1XEXB 1SOWA 3MG9A 4QLOA 5SY6A 3CLTD 1ENZA 4WLVA 3SEQA 1ONBA 2ZYVX 4HDKA 5F7XA 2CKMA 1AO3A 2WF6A 3B2NA 3DQZA 4I1IA 3SVTA 2CMHA 2LCQA 3BEOA 5EJMA 1H0SA 1XWWA 4E5NA 5K45A 1E3DA 4C43A 2P3QA 2PJZA 3KKLA 1J90A 4U0KA 3TF5A 1CY2A 3C97A 5KO2A 1H94A 1KRWA 4QBHA 2Z8YM 3AVVA 4V1CI 1M10A 3GFSA 3NBMA 1IB6A 1VP3A 4EWLA 1EFHA 3ZWNA 1T9KA 1M7BA 1E6EA 3FHTA 3WLOA 3MCTA 3PK0A 2YQ4A 3RS3A 5KU1A 3OQHA 3FKSD 4Y9RA 4GLBA 1EVKA 5J9FA 3AYZB 2QZSA 3KE8A 2WSBA 3OHPA 2FUNB 3ZUGA 1Q20A 4AO6A 2HU5A 5AVKA 4KQMA 3H2HA 1ZU4A 3GQVA 4J6FA 2NADA 3INTA 1JW9B 5JZMA 1HY3A 1L5ZA 4TRNA 2JF0A 4XEUA 3T5BA 3N5KA 3RRJA 4QA9A 5TEVA 4GU5A 3CZCA 4ROTA 4RNCA 3ZU4A 4DV3B 4MUXA 2IUYA 2V7BA 4UFOA 3D8RA 5CA1A 2BY4A 1YRQA 3SNKA 4X1YA 1R4MA 3CVUA 1JLRA 2OAQ1 1KIMA 2BRUC 2B61A 4HWKA 3DMGA 5EMJA 3GIWA 1U3CA 4BLSA 5KWVA 1R8XA 4UVDA 4RDHA 3HUUA 1CZOA 2C0QA 2PWPA 4IZOA 4KN6A 5TPWB 3AVUA 3HVJA 2JS7A 4ZDWA 5JJKA 3IJEB 3ROMA 2HO4A 3G9QA 2UZ4A 3TIFA 1JEQB 1NF3A 2PZ8A 5TMPA 4EQ6B 4M7RA 1BH6A 2E2WA 2EFEB 1N4AA 1ZIYA 4JGGA 3ULKA 4M0DA 1QNLA 1Z0UA 3RQIA 4PTZA 4PHGA 1E79D 3I76A 4N9WA 4MJXA 1WU7A 5F7ZA 1IATA 5CXQA 2HMYB 2RHLA 4KGDA 2O2XA 4EEKA 1D5CA 1TF7A 2I6GA 1KOFA 4HDSA 2RKWA 4DLWA 3QX8A 4IMJB 5DI3A 2Q8NA 4O4IF 3WLJA 1V71A 1R16A 2AEJA 3EVAA 3DLCA 5GZ6A 3CLUC 1E89A 4EYEA 3PCXA 3DAHA 2VZ9A 2CMDA 3DQPA 3RUFA 2D4HA 4LRSB 3DZJA 4EI7A 4GKKB 1T13A 3KCNA 3IPYA 1BXKA 4GWGA 5A3VA 3RJ5A 4O3MA 3H5TA 5B7PA 4B5KA 2ZJ5A 2X23A 3U17A 1W46A 1FIUA 4IV0A 4GRAA 4X60A 2G36A 4GIBA 4XJTA 4KXUA 4DLKA 5AVYA 5JRJA 4TWJA 5L95A 3KYIB 1KVSA 1KQPA 4BGUA 4D4GA 4G97A 3VVMA 1W30A 3PKZA 1PCXA 1UF9A 1VP9A 5GJVC 4L76A 4DCNA 2OQRA 4JJEA 2ZB3A 1BE0A 4MDHA 1W76A 4YRPA 5JS6A 4MAAA 4I5EA 2Z6AA 1JMVA 2IHYA 5TMDA 4OP1A 3FNFA 1RC0A 3QMMA 4JA0A 1F2TA 3HJRA 2OKCA 5JECA 2BFAA 1IZ8A 3FDZB 2FXVA 1I1QB 5B2EA 3LBAA 3NM4A 2C92A 3WMEA 4TWAA 2W2MA 2X2OA 5GADl 1ZW1A 2JHCA 2QENA 1CVIA 2CLOB 1HMPA 1Z37A 2ZIFA 3KBBA 3OPYI 3PRHA 2YV2A 1MNQA 4EW2A 3KETA 2ZTLA 3HLYA 4P34A 1NMSA 4REOA 5B2ZA 1HC7A 2L69A 3DBOB 3ICVA 1NZJA 1YDMA 2WUEA 5C4MA 3M3DA 3GH1A 4DJJA 1IXRC 1W5TA 2E85A 1WDKA 5BQOA 2C8JA 4Z4FA 4MLZA 4O1IA 5JH7A 4TX1A 5TS2A 4FT4A 5HVNA 4RLHA 4CKWA 2CL7X 5BMOA 3C98A 4ONEA 2CVPA 3BDAA 3IUQA 4OYRA 1TU3A 3RRBA 4GDFA 4YRDA 2J45A 3DPIA 4B75A 4NYMQ 4UOEA 1N5IA 4EFDA 2ETVA 3J7TA 4Y0VA 3UMGA 4OIFA 1W36B 1ZL0A 4LYDA 3ZS8A 1CETA 1J2JA 3QWHA 3ECCA 4MAMA 3W2FA 3H97A 1NVVQ 1NRIA 2PX6A 3O4HA 4XEHA 4DBZA 5E7QA 3UWKA 2CL6X 5EMMA 2IELA 4GXTA 3EWIA 3Q0EA 5GJWC 2IF2A 3X1YA 2ZXFA 5JQGB 1ZMTA 1G9TA 2QMYA 3AHFA 4N9QA 4BB6A 5CG2A 1IZ9A 4M0CA 1JALA 2PXHA 1ZITA 4PM4A 4Y6RA 2QRLA 1QRSA 3AR8A 2X15A 3QLUA 4EA8A 1QQTA 4O4JA 4KE8A 3QU4A 4OQFA 5D3MB 4CM7A 3G9XA 4TRMA 1QH8B 1CY6A 3PNQA 3W7BA 5IJAA 2R1VA 4MEBA 2CCKA 3F97A 3LQRA 3D1LA 3N9IA 2LWIA 2O0HA 4IDFA 4DQLA 2HGZA 5B1YA 5BSWA 1MC8A 4WKCA 4EJ2A 4F91B 4C0SA 3FUXA 4URWR 2VQFB 1RE0A 3IAS6 2QAJA 4O2LA 4RH0A 1D0IA 1QV6A 4CE6A 4FINA 2GKOA 3H2YA 1GFIA 4FWTA 2QW1A 2M1ZA 3DLBA 3PUIA 1I4OA 3K94A 5FOUA 1AZLA 2A58A 5LZ7A 1WUKS 2CK3D 1BRMA 3UTCA 1CQZA 1ZHFA 1WLYA 4J76A 1GCAA 4MI9A 3NVAA 4CQLB 1B4DA 5JY1A 3WTBA 4DLRA 5I7EA 2G6BA 3WZLA 3EW9A 3EVFA 4RETA 2NPIA 3FAKA 2VJNA 1MOSA 2I7DA 3G79A 3GEBA 1YDGA 4N5NA 4FBMA 1FQWA 1SFRA 2B78A 4ACAA 1IIBA 5LKRA 3ZNPA 4B0OA 3EARA 4BX9A 1U3FA 3M2TA 4JVOA 5LWHA 3O4JA 4MGKR 4A92A 2WI8A 3LSTA 3FMFA 3MQ4A 1X7ZA 4MVJD 1Y3AA 4KEAA 5KYXB 3LKZA 3RBVA 1YR1A 4D3DA 4QOHA 1PRYA 2JIQA 3M7IA 8ADHA 5IN4A 1ID8A 3GAZA 1VIYA 3ZK7A 5K0TA 1MDBA 5KNBD 3QY9A 4DUPA 3LZDA 1HLFA 5D87A 4F1WA 3K5WA 4O2BF 2CXSA 2DUUA 1E8DA 3ETCA 4RA9A 5JC1A 3OLYA 5IHXA 1OZHA 4FZJA 2JHFA 5GVSA 1I3MA 2AFVA 3LCCA 4MVJM 2FVXA 2I8CA 3NWEA 3L0BA 3HWSA 2FPWA 2VP3A 1E77A 1Z4PX 3DBVO 3FTNA 4TTSA 3SCZA 1A2OA 2CUTA 2QUKA 1JSCA 1M0SA 2PIDA 2W6JD 2WAMA 3WA7A 3L8DA 3NPMA 1RIIA 2AZDA 4DDUA 1FPQA 1KE2A 3DDZX 1PU2A 2J85A 2N3ZA 4XGIA 3UCFA 5KVCA 3O8RA 5LYJA 4M76B 5FR1A 2HRCA 5CLJA 1XZFA 1JDJA 3MM4A 1YCDA 3LJKA 2IPMA 1G3RA 1EX6A 4PRYA 1OVGA 3BCHA 4HFJA 1EQAA 3QV2A 3S27A 2PAAA 5KS2A 2D2FA 2GI4A 2W37A 4IDPA 4N0EA 3ZCTA 2DWQA 2Z5FA 1ZCAA 4KO2S 2IL1A 2QX7A 3ANNA 3OJFA 3GUCA 1E32A 1T8UA 1GSOA 1XTSA 2Q8QA 3PXEA 1Y3DE 3LBHA 2QTZA 2ZRJA 4MQBA 5CJ2A 3TS1A 4A26A 4DY4A 4F2PA 4R7TA 5A5GA 4PR0A 1QDEA 4AJLA 3UJBA 1DBPA 3VH1A 4LF9B 3NANA 1AGYA 1Y8RB 2A9JA 2QTNA 4UHCA 3RYIB 4RLQA 3NWJA 3ANSA 2PX4A 3ZWAA 4CMEC 5AW7A 1U4SA 4QT4A 1O0BA 1JIUA 1MFZA 2WAAA 4QFMA 4X92A 1AG9A 2WD7B 5JBIA 4YREA 4TMYA 4ISBA 1KNQA 2XUJA 1V25A 4N39A 3SAJA 1DIBA 1PFKA 4OCZA 1DKMA 1KI6B 3K35A 1VHLA 1H3EA 2H5IA 2ZK7A 5TE9A 2JKZA 4IDNA 1G42A 2DUNA 3ZIUA 4KMSA 2FI1A 2QT1A 2OPHA 5T5QA 2P9JA 2DUWA 1G66A 2B98A 1VG9B 2VHZA 2YX1A 3F8TA 3FFBA 4IM7A 2JZCA 4KXNA 4PAMA 4QFCA 4UDNA 4A91A 3EH2A 2MOKA 4ZHQF 2XGJA 2WBLC 5PNTA 4EA7A 2ZXEA 4ASUA 2HJGA 2Y1KA 3B9QA 1L5OA 4INOA 3QVWA 3FX2A 1I2BA 4K6GA 1SU7A 5TLSA 3CVYA 5HZMA 1YIOA 1N6RA 1Q7CA 3DHYA 3HCPA 5A7FA 4DZTA 1K7FB 2IOFA 4H4EA 4IF4A 4TVSA 1CUZA 4LY6A 1NPDA 4UNSA 1N2ZA 4YRGA 4NV1A 1CRWG 2B2NA 3IPAA 5IM4F 1A8HA 3RREA 2CJXA 1K89A 3A1EA 3C74A 4ZXPA 1DEAA 2P6RA 5IYZA 2H7VA 3EEBA 4L73A 1XEAA 3PWSA 3AQ4A 4ZAYA 3RS2A 3Q4GA 3QIAA 4QNNA 4W7IA 2OORC 3ZY6A 4ALMA 1JL3A 3ONVA 1BXGB 2GPTA 4G4IA 2WHRA 1UIMA 1Q21A 4Y9DA 4CEJB 2RDMA 4C0QC 2H8KA 4ZTZB 4HK4A 3MT8A 4MKHA 2O05A 4XIIA 1N36B 5K0FA 3L9XA 2HF9A 1W96A 3BCSA 4I55A 4R1OA 1L3IA 1G8YA 2EP8A 2EGUA 1AXRA 3KQOA 1OFUX 2HWUA 1Y1LA 4OP3A 4RQUA 4BAGA 3KB8A 4L4XA 3WOVA 4UUMA 4F4UA 3IEKA 4KBGA 1EESA 3DVSX 5CT8A 1T26A 2DHDA 4UEWA 3A6JA 4A16A 1RTTA 1IN4A 1QIHA 2HY7A 2XUHA 3HEBA 2JCYA 1TKRA 4TSRA 10MHA 4RTPA 1UDCA 1E1KA 4F9TA 3STYA 1ONOA 2ZAGA 3UPDA 4KXWA 2WSMA 4ETMA 3AJRA 2EBFX 3A2NA 3OKPA 4U6QA 2I4OA 5EXTA 3TIGA 1AIPA 3OT1A 3CMCO 1OROA 1OXUA 2ZJYA 3EGVA 2Q49A 4LA4A 5DBEX 3WO1A 3EZ2A 3VNSA 4MDFA 3QMPA 3WNCA 1U0HC 3O2QB 4GECA 5FOWA 4Q7QA 2GEFA 4O2AF 5JV5A 3TX6A 2QLTA 3NO4A 2AG5A 3DDOA 1ANKA 5EI5A 2WTXA 3C6BA 4DLUA 1UXGA 1MXFA 4PRLA 5KREA 1D03A 4GRDA 3S40A 2D1FA 1NP7A 1YZUA 2JGKA 3GDFA 1XZPA 1NN5A 5GM2A 4MMXB 1U9ZA 3VOTA 2Z98A 5IJ0A 3W8EA 4NPCA 5JFTA 1SH7A 4TLLB 1XJCA 2PLWA 1O1YA 2H5EA 3CEMA 3HFRA 3OM0A 2I22A 4CEIB 3Q72A 3A1WA 1JQLB 3BMQA 4CRWB 1NIJA 4RL6A 3E48A 2XBMA 5FFNA 3I04M 4MHTA 1Z0ZA 2H9AA 3INNA 4CVNA 1HOXA 4PZUA 2KW5A 1PFUA 1I4LD 1FYEA 3G49A 2IXFA 2ONYA 4FI3C 4Q03A 5TVGA 4DMMA 1EUZA 5I9SA 4ZYYA 3DE7X 1VZ2A 1W6RA 3BXGA 2QXTA 1PG5A 4LRXA 5TC4A 4GVPA 3RIEA 4I1RA 1W59A 4CGYA 1YTLA 3VYUB 1P4SA 3ZJVA 1FFCA 1T6ZA 4TRRA 2VDWB 2F9LA 4UPEA 2WSIA 5TXGA 2WPDD 2JB9A 1X2BA 3NT2A 4QWWA 1K9SA 5IHPA 1N5MA 3OHMA 4JD5A 4KIUA 4P84A 5IJ9B 1O6CA 4BFUA 3B13B 1PQ4A 5CUQA 1E3IA 3RJTA 3I61A 1TYBE 2GXAA 1ZM4A 3V8BA 2Y1FA 1YFLA 1FUKA 2Q5FA 5BOSA 5FLXA 3LC2O 3E2MA 3DVQX 5AK6A 3RUPA 3AGQA 3TEFA 3T15A 3DB2A 4GYYA 4F4JA 1PHRA 4JYPA 3WTCA 1IM2A 1I3NA 4U8HA 1KWKA 4UAUA 3VHXB 3QVGB 3HLKA 4YP9A 4JJFA 2C7RA 4FGJA 1L7NA 4C7OB 1RT9A 1JQ5A 3T7AA 4XUDA 5I6DA 3MGCA 2XYGA 1N3IA 3GVPA 5E6SA 2OWDA 3NRBA 3FZQA 4BQRA 4DWWA 3NV7A 4W8GA 5G02A 3URKA 5AW0A 1HK7A 2Q3HA 3NDIA 3KX2A 3UO8B 4HZUA 5IAKA 4DRXA 2GNOA 4QU0A 2C9CA 1QO0D 2HJVA 1QIGA 1TM5E 3DYBA 4FCWA 4FSXA 1ZOSA 4X20B 5BOVA 3W5VA 3WWZA 2FV8A 1DARA 1P7PA 4LOIA 3JD3A 2AR7A 3A4NA 4MW9A 4OBWA 4RMHA 5B7NA 1REQA 4CMBA 5ABPA 4BMOB 4GXNA 1IULA 3NOQA 4Q9LA 4AZSA 3MOIA 4DA8A 4Z2YA 4EB8A 1UDBA 1K3FA 2PVCA 2ZRCA 5C52B 3N7UA 2DBZA 4GOKA 1P18A 2XRMA 4RXUA 2XUPA 4MKZA 4OMFG 5FBZA 1KSGA 3RS9A 3PX7A 3SR0A 3TOXA 3S5JA 5AI5A 3QVKA 2XVMA 5DCWA 3KFLA 3SC2B 4MYHA 3CTMA 4MRSA 4F0JA 2X2PA 5IDYA 3VR5D 1NF9A 2UVQA 2I2CA 5DTEA 2BZSA 3W5HA 1BS2A 3PI6A 3TL6A 1M6WA 5B30A 2VFAA 2RG7A 1CRQA 3PVCA 4NONA 1JB9A 4P9NA 1AUXA 2ST1A 3GT4A 4I8XA 3ZV3A 4EFMA 1IVSA 2GX6A 2PWYA 1F0PA 2P41A 2FLKA 4P36A 3RVBA 1I0IA 1KY5A 2J46A 4ZO9A 1B0UA 2PU5A 1I4EB 1RP1A 2PKXA 3A9VA 4M0UA 2C78A 2ZJ4A 3O31A 1U0GA 4CIBA 3TL2A 4F92B 1A8IA 4CKZA 2DHQA 2J6BA 4YJHB 3BREA 2VJQA 1X6VA 2RH4A 3BSFA 2FQXA 3VU1A 5M29A 3HVIA 5JYEA 4CFYA 4J0JA 2ZOSA 2Y9PB 1NFRA 4PZ0A 3P9KA 4NMWA 2NX2A 3AHJA 1IY8A 2A35A 2QM3A 5HFJA 4B7UA 4YO7A 3LY8A 2EG9A 2VXBA 3KJZA 2M6RA 4GBMA 4JL5A 4YX9A 3EDOA 2B69A 5KOJB 2BVNA 3PDUA 1DZIA 2OAGA 4RCYA 3KG2A 5H3LA 3HR7A 3O84A 1EFKA 1P45A 1QK4A 1XZKA 3E82A 2K2QB 2K7ZA 4X97A 4Q1DA 5EJGA 3W04A 2GBPA 4ZCRA 5BP7A 1S0UA 2BTQB 1EGAA 2OLJA 5SV2A 1NAHA 1QIFA 1UWLA 3NLLA 3DHNA 3SVZA 3W4IA 1X1QA 4I1PA 2XXAA 1GGKA 4NFHA 1MQAA 4GS5A 1R0YA 2SKEA 2JI7A 4AMZA 4GPD1 1E18A 4F9FA 2P2LA 4IRUB 3S2EA 4DAEA 3R6GA 3L6CA 1A1SA 3WYGA 2HMSA 1XZGA 2PBLA 1Z6XA 3CUTA 3GBVA 3KQYA 3QZUA 4G9BA 4XB1A 2OO5A 4MA5A 5G3YA 3SF8A 4DBLC 3IELA 1TYZA 2R8EA 3CWCA 1JEOA 3TZLA 1KSHA 4IUCS 5DBOA 3RFTA 1NU8A 2JFHA 3ORHA 3QVXA 3GMTA 1ZD1A 1JJIA 2H9YA 4GH5A 4RKFA 5HBGA 2HQ1A 3H13A 4R8MA 1C7QA 2VH1A 4TN1A 3QEJA 3VR6D 3HKBA 3G5MA 1J5XA 2FUEA 1JE0A 3PR3A 1VE9A 5T8KC 4KGVA 4RLSA 2WZQA 2XECA 1PJZA 4HUQA 4BTEA 1XP8A 4BECA 2VHVA 3BXXA 3DMTA 3DDHA 4P7FA 3ONFA 4UQOA 5BOSB 1KOGA 2V6GA 5B57C 3CW8X 3RVMA 1HTBA 1H8ED 4WBNA 2C1ZA 3Q41A 5T4EA 4TKVA 5C8VA 1E4YA 1JR3A 2QN3A 3OFVA 1YB2A 3OQIB 4JLDA 2AL7A 4OO3A 1XXHB 3Q6NA 5SZHB 1M2NA 1ARZA 2PLAA 4GX1A 4I4TA 1EUQA 2ZQZA 1GHTA 2V7WA 3B1KA 5L7WA 1DPFA 1NL3A 4CI0B 1JNXX 2ZRPA 5J4LA 3ITEA 1AGPA 3SQDA 2B6NA 2FW8A 2F8MA 1PS9A 5JSHA 2V7XA 2II6A 5KQLA 2NTJA 1P6UA 1CLUA 1OF1A 2C84A 2GESA 5HILA 4C4SA 4F8YA 1Q15A 3L46A 4CV1A 4URHA 3ZDCA 4Q21A 3BFPA 5CP8A 5ILGA 6Q21A 1IXYA 3ONDA 1P74A 2VAWA 4YJFB 3AFMA 2ZM6B 3LHFA 4K5QA 1IN1A 2CN1A 1PWEA 4GDMA 1Q16A 1ZBQA 1UDAA 3HXPA 3HO8A 1CQIA 4W9NA 3PC8C 1HQKA 3DCIA 4AICA 2G9ZA 2X9VA 1HDYA 4AROA 4EKEA 2GAOA 4J3FA 5HIIA 2A9FA 4GBJA 4KN5A 4G86A 3G0IA 3UUEA 1ZESA 3W7VA 3U09A 3GYGA 2FN7A 5LSAA 4JL8A 2WYHA 1X8LA 2G77B 2HM7A 1THMA 3Q8WA 4KGZA 3ZY3A 2IYFA 4AY4A 2HMTA 2PTHA 1N5OX 5B5SA 5JS2A 5JCOC 4YLYA 3R8FA 2R9VA 4GKBA 3IXQA 3AKCA 3VR2A 3I6YA 4JLVA 2W2VA 3TNFA 2Q50A 4KFUA 4MKIA 4D3ZA 1T5IA 1GIAA 2ZS7A 4MI3A 4LJLA 1GR1A 5IMBA 3S1AB 1BHQ1 1JEAA 3WK7A 3GJ5A 1G19A 3W4KA 1T2EA 2NTYC 3F7MA 4HP8A 2J30A 5HMMA 3RAEC 3LT5A 4EUNA 1HSZA 4NHOA 2CV0A 5KTPA 2L82A 2DH6A 5F7OA 2BR3A 2J08A 5LMNB 1PTKA 3SEZA 1MA0A 1H2EA 2P11A 1GL7A 1VE7A 3S0JA 3ANLA 3SJCA 3CZRA 5ER9A 3QLUC 4TT8A 5H7XA 1GGJA 3P52A 3PUZA 2D13A 1X0VA 4KO3S 5CVEA 1E1YA 5FPQA 1XKQA 2BMVA 2KSQA 4PG4A 3RVJA 5EIOA 1Z3IX 3UV7A 1QH9A 2CLIB 2TECE 1YVDA 4KXXA 1KC3A 1Q84A 4HH0A 4N18A 2NGRA 3S2IA 4ZCTA 821PA 4C5BA 3FFAA 1IIRA 1EGQA 5K3CA 4OOFA 1Q3HA 5C7IO 2UUPA 3E9DA 4IDAA 2DECA 3CF4A 4LNAA 5DMXA 1EFPB 3AP2A 1NRJB 1HMYA 4EJFA 4G8DA 3WGYA 3V34A 5TEWA 4F46A 2ZR7A 4PGFA 3AF6A 1V1MB 4BO2A 5KNCD 1XRSB 1EK1A 1JWAB 1Z6GA 1EDBA 1TRKA 2YFHA 3DMRA 4KIGA 4M87A 4IO1A 4ISCA 4YT2A 1J4AA 1A9PA 1SVSA 1KEWA 2PMBA 2HSWA 1JF8A 3VO9A 3ZCVA 4P3NA 1XMJA 4RFSB 5LB2A 3NBZC 1GQSA 1Z5WA 1J2RA 1I4TD 2A0XA 4IVQA 3KEGA 3DVRX 3VM6A 3WKDA 3QXGA 4PZAA 4MUMA 4G5YA 1FJHA 1L4KA 2DYKA 3ODPA 4EKNB 2X9LA 5BUQA 1G0NA 1SXJA 4Y8VA 4GI1A 4D46A 4MWTA 5JJ5A 3ZU5A 2IU4A 5C8DA 1SN7A 2FOLA 2N9UA 4FS8A 3ZIDA 4KGXA 1QUFA 3OZAA 1NPYA 2ECFA 4EVSA 5INTA 1DX9A 1FY2A 3U62A 4C76A 1CQJA 1FP1D 1VI2A 5CVCA 4CL0A 4WBNF 1UAYA 1A7UA 1DT3A 3OIWA 2JD1A 3OEHD 4AS3A 1ETUA 4IYJA 1YOVA 5LDDC 2DY1A 1ST3A 1SQSA 2FKAA 4HEJA 1RPAA 1TK3A 3BMCB 1OWMA 1HNWB 3O7WA 3NIGB 1FOEB 4MI6A 3RYHA 4MP8A 2D2EA 4HLCA 4ND6A 3ORQA 4B2LA 3ZHTA 4JDPA 1QTQA 4FYVA 3HYCA 1NV9A 1OTYA 3TRHA 5GINE 2DBYA 5C7YA 2A9VA 1YZVA 3HJBA 5G1OA 2DC1A 3WGVA 1E9CA 5CEEA 2BGKA 2WNHA 3IJPA 3GCDA 3K1AA 2YVAA 4WT7A 5A5DA 1NP3A 1WU8A 3LS2A 1B2LA 1BHSA 1GGNA 3D4BA 3P0IA 5H3HA 5DVZA 4DHWA 5H9WA 2FG6C 4RK1A 1F3OA 4XM0A 1CKEA 3K0CA 1L6RA 1D2RA 4G85A 3R9IA 3K9FC 3MBOA 3WYCA 5DBFA 1VJDA 3WLFA 5HRCA 2EKPA 2BFDA 5J2UB 1YZ3A 2WWHA 3OF2A 2QVBA 521PA 3K9HA 3WIDA 3PD0A 2AT1A 1FVFA 1EP3B 2AW5A 5F77A 3O93A 5K4GA 1J70A 3U7EB 5L8VA 1H93A 1YB1A 2UXBB 2JLQA 4YAEA 3V00A 1JEYB 2NYAA 4PGAA 4KCGA 4UM5A 3RUEA 2XMRA 1D2CA 1NLMA 5DSXA 3ZU6A 2IQ5A 1M1YB 1I8TA 1AKRA 1MORA 1VA5A 2P1RA 5E9WA 4BN5A 3TMKA 4N4AA 4EMUA 1AS2A 3L7BA 5KHLB 2CLFB 5JS1A 3LWZA 2G72A 3CW2A 1ILWA 4HB3A 2ATVA 3MWYW 4U2DA 4HNAB 3TO5A 1OOEA 2JFNA 2UAGA 3SDBA 1VPTA 5KYUB 3WI7A 3S81A 1F14A 3QF4A 5LMZA 5IARA 2FZWA 4OSEA 4TXMA 2VYFA 2YJGA 1OE0A 2A5FA 2E82A 2AD1A 1OD6A 1FX0A 1ULAA 4DNOA 2J9GA 3TW4A 3WBJA 3E9EA 3LDFA 1C3LA 2PKQP 2QEQA 2RB5A 3OC0A 4M4SA 5DO9A 4NJMB 4RA9B 3ZIAA 4D56A 4JUBA 3OFKA 2WTBA 1AF4A 3H1PA 3LQ4A 1B0AA 2YBEA 4G37A 4MR7A 1ECJA 1VMIA 1Z5OA 1ZISA 4L6AA 1G64A 5TQ0B 3MWDB 4BMZA 4BWYA 3LZCA 2OOSA 3N0XA 1MVLA 1XQYA 3R1IA 4HEHA 1SPBS 1VDMA 4FNGA 1D8TA 1TZBA 3PZRA 1DAFA 2HREA 2WSYB 3MMXA 3MINA 4K1XA 4I8IA 2HADA 2O2IA 4MIOA 2BHLA 4CQNA 4L2IA 3K2EA 4MCJA 2MSWA 5I8PA 2ZZNA 1LFAA 1SHZA 3GNLA 3MD9A 4BP1A 4N40A 1I32A 3R40A 2K5UA 1MNAA 4XSHA 3N2KB 4MV8A 3NTUA 1D1PA 3OCJA 1BE6A 4URUR 3GEDA 3GLGA 3JQFA 4X71A 4OI1A 3BKXA 2BUBA 1LW6E 3E3LA 2KX7A 3O8OB 5I7RA 4OHMA 1S7GA 3DBRA 4EZIA 4EMBA 4ZK6A 3I9OA 4A4DA 3U44A 1A3CA 4MVJG 3AC0A 1SIOA 3E5MA 3CUVA 3JD2A 3KAPA 2QP9X 3C5CA 1R0BA 3HKEA 1XTPA 4IFEA 1Z2DA 2JLSA 3RVKA 3TZQA 5FWYA 1CR4A 2YC4C 6AT1A 1NQXA 5HSGA 4LVCA 3FM9A 1ZH8A 3MWDA 4RH1A 4O4HA 5CH5A 1WXFA 5BV7A 1IBKB 4KX5A 2YYSA 1BA3A 4A2PA 5FBKA 1W4AA 2XZLA 5KWSA 5ICSA 1N5JA 4B09A 2V6JA 2CBZA 2E5FA 4RPCA 1Z73A 3JWPA 1II8A 3ASYA 1E8NA 2O3JA 1JU3A 4YASA 3R5XA 4Y6OA 3TQCA 4DLPA 2QR2A 3WY9A 4TV8B 1RKVA 3ZWYA 1KAMA 4Z8YA 2GBLC 5LWQA 2HHLA 4N6GA 1CP2A 1W88B 2DH5A 2FPOA 4Y2GA 5LZ9A 1WD5A 2VUTA 1GZVA 4KACA 2HHCA 3ROEA 3UJNA 3U4GA 4F5EA 2EC5A 4YV2A 4UFPA 5BNWA 1VG0B 3C3PA 2L19A 3PF9A 1P0PA 2WHPA 2YL2A 1FTNA 2VP9A 4HNSA 5GOZA 1RHRA 3FDZA 1QE3A 4DVGA 4DE5A 5ILOA 3C45A 5ALFA 5K51A 3CNBA