2XD9A

Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-4,6,7-trihydroxy-2-((e)-prop-1- enyl)-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
153
Chain Sequence
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Tetrahydrobenzothiophene derivatives: conformationally restricted inhibitors of type II dehydroquinase.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 55
structure length 153
sequence length 153
chains with identical sequence B, C
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2xd9A00
2UYGA 4L8LA 2Y77A 4B6RA 2WKSA 2C4WA 4ZC1A 4CKWA 2BT4A 1H0SA 4V0SA 4B6OA 4CKXA 1H05A 1UQRA 2XB8A 4KIJA 1J2YA 2XB9A 3N76A 4KIWA 3LWZA 3N87A 1D0IA 4RHCA 4CKWB 4CKZA 1GQOA 4KI7A 4B6QA 3N7AA 3N86A 2DHQA 1H0RA 4CIWA 2XDAA 1GTZA 2C4VA 3N8KA 2Y76A 4CIXA 4CIVA 5B6PA 2Y71A 2CJFA 4CIYA 1GU1A 3U80A 4B6SA 2XD9A 4CL0A 2C57A 5WRFA 1V1JA 4RC9A 3KIPA 4CKYA 3N59A 1GU0A 4B6PA 3N8NA 4KIUA
chains in the Genus database with same CATH superfamily
5A5DA 1Z25A 1JU3A 4OQLA 2GUGA 4HX5A 3U0VA 2IHBA 3UEOA 1MV5A 1NTOA 1PEYA 1DT3A 1YQDA 4R71A 3LUFA 3BCHA 4M0KA 4N49A 2ZUEA 4NCBA 2GDJA 4OXKA 1KSFX 2RK6A 1JI0A 1EBUA 3CJRA 4LYYA 3CSUA 4BVFA 1JEAA 1V4BA 1AZTA 1LRKA 4IYRA 4LXGA 3ORSA 4Y67A 1DTWA 3OUTA 2R8OA 4Q6BA 3NANA 4LGMA 4E46A 3H1FA 3M9LA 1P0MA 3KL4A 4RF3A 2QVGA 1B2LA 2AGVA 3OPXA 3CLSD 4RZ2A 4YQYA 3FRHA 2A58A 4CKEA 3KSAC 2Q4TA 4B73A 1F3OA 2PWZA 2FSSA 3KXDA 4JB8A 4HN2A 4OHZA 5BN4A 2A5DA 1E3MA 2ZRAA 1XEWX 1XCGB 4MS1B 1T36A 4CCAA 1IY8A 4FMDF 3VOSA 1QF9A 2VT6A 3T5MA 2DEUA 4U7FA 1QR2A 3BDAA 3EGCA 3RK4A 4AUKA 1PX0A 3WLEA 1CXZA 1YB1A 4L3OA 3UZUA 4HQ0A 3L7DA 2E55A 4FFOA 1NR7A 2P9BA 2ZE6A 4EGJA 4KDRA 2A1UA 4NJEA 4G0WA 2NVBA 1MP0A 2OXCA 3A37A 3T0FA 4BQPA 2KLBA 4Z3DA 1HZZC 3PEUA 1SCKA 2ZYAA 3HGMA 1BQEA 4PAOA 3AUXA 4BMYA 1UEIA 4BTVA 3THYA 3VKUA 3VKGA 1BKSB 1VL5A 1GUBA 3IKJA 5GADl 2OXTA 4RD0A 3TLZA 2EP7A 4MVYA 5IXSA 2HDHA 1NN1A 5AW3A 3ZCQA 1E6UA 1PQYA 2FW8A 4UVDA 4DTCA 5KQRA 1T3ZA 4JT9A 2BOVA 4W9MC 4JBYA 2CLIB 2I6FA 2WKSA 4V2IA 1XQ1A 4XFDA 4Y0VA 5J2UF 2GCGA 4ZA2A 2H92A 3PRHA 4ZYLA 5J4VA 4AG3A 4NBSA 2WHEA 3JYQA 3HB5X 4FNAA 4UD6A 5EYPA 1SUWA 2ZSKA 4YMIA 5BSRA 4R0NA 2SECE 5CK4A 2WVJA 4J1NA 4KJXA 1WR8A 3QEMB 3AFGA 4M99A 3UHJA 1IYZA 1F14A 5CJPA 3VYRB 1ZD4A 2P1ZA 3N3BC 2OO5A 3N7AA 3QFCA 1YA6A 3HY3A 1HEYA 2QMZA 4NABA 3RFXA 3WKAA 4ESVA 2GEJA 2WE7A 4DF3A 1Z28A 1WMEA 3KSZO 3L6EA 1LGYA 3TWOA 5L95A 3KJNA 2J0QA 3GPBA 1R4NA 1RLIA 3S3TA 3WXMA 5HM6A 1CB7A 1GQYA 1KMIY 3FM9A 3FX2A 3QLEA 1JRLA 3ZGLA 2WUEA 4UPDA 1QIHA 1RZ3A 4A9AA 2XNCA 2GZAA 2HXYA 3B1JA 3SHWA 4QLAA 2XUZA 2P1DA 3GCXA 3KJFA 3CWCA 1BXGA 1YMUA 4HKTA 4G8CA 1WUJS 2HK9A 2V9PA 3G5TA 3STYA 4ZHSA 3TVTA 4XIYA 4FNMA 1QF7A 5LZ8A 3FDFA 2WJGA 2A57A 2Y2UA 1WOYA 3A2MA 4I5GA 3NHRA 3ISJA 3G23A 3MYYA 4NS1A 1YOBA 1CDOA 3INYA 1XDWA 4O4JB 2QT9A 4NFHA 1OB5A 1U8ZA 4GX1A 5FWYB 3RG8A 4NYJR 5GZ3A 5JVDA 1EIWA 4Y6PA 1KH1A 4DLYA 1KDTA 3CPSA 3MCAA 4NV0A 3DP7A 4PO8A 1OPXA 4V0NA 5H7XA 1QM5A 4MKIA 4MUJA 4DUZB 1YZ3A 2WTEA 1PGOA 3N75A 1RRCA 2YBEA 3GXOA 3IAM1 1TUIA 4CMJA 1JDVA 4MHTA 1IIBA 1H9CA 1DC3A 2PD6A 4MXDA 2F8SA 4G85A 4L8WB 4G24A 2YZKA 4WCFB 4P5DA 4ZPXA 5DSTA 3RM3A 1RU3A 1Q17A 2XZOA 2PMBA 1ZCZA 2V0NA 4JC4A 2LIPA 3HNPA 1R8XA 4QX6A 5DWVA 3TLEA 4BV2A 3MFYA 2HMAA 3NNDA 1DAEA 2DGDA 2RHTA 3EEYA 2VZ9A 4JCOA 1A27A 3DDNA 4UAUA 3LP8A 2DKOA 3WRVA 4TS4A 3CZCA 4LN1A 3ENZA 4NSNA 5MGNA 2I78A 2DBZA 3I6ZA 4WEOA 5AHKA 4N7JA 4EDHA 2J0EA 1UJ4A 2ZAIA 1LV7A 3SIWA 3KELA 3JARB 1NMYA 2HB6A 4FWIB 3I1IA 4MWGA 5C2JB 4UKDA 1CW2B 1GR0A 3HYRA 3KXIA 5LOVB 1QOPB 2A9JA 1XQYA 2FHSA 3OIFA 3OAAD 4ND5A 5A0FA 2P9YA 3F1KA 2RJ3A 2C2MA 2GK6A 4MUNA 2GA8A 3WAGA 1NM5C 2CDRA 2W6CX 4BNDB 3I92A 1P9LA 3HWWA 3T5BA 1LY1A 3HHPA 2JIQA 4NI5A 2OLKA 3VPXA 5BSWA 3O21A 5IVKA 4Z3OA 3GDOA 4TMTA 3GA0A 1K88A 1MIOB 4KE9A 2WAXA 1F2TB 2Z83A 1H9BA 2C7BA 1NLYA 4BB9A 3BBPA 5KU1A 2B94A 2F3RA 1UT5A 1SQ6A 3ITKA 3QHPA 3NATA 4BX0A 5JARA 3Q2KA 5DYYA 4BVAA 3JQ7B 5F98A 1K3UB 3ADOA 5E2BA 1I1NA 3N1UA 3MCVA 3WGUA 2GI4A 3BCRA 3BMXA 3PHHA 3UMBA 3H2IA 3COPA 4CKWA 1EJ6A 2QW1A 2Q5IA 1F9EA 2JJYA 3D54D 3AY0A 4LC1A 4BMOB 4DY6A 1P2SA 3JWHA 5AXBA 3DZKA 5EINA 2HHHB 1NN0A 1X1TA 2YZGA 4HVCA 1QMPA 2W8BB 4XDGA 4R2KA 1UKZA 2HU8A 5BUZA 3PZBA 3GN1A 2GZ2A 4KE7A 3LUGA 1L8QA 1RPJA 3NDPA 2YS6A 1XYYA 3QLJA 2JJ8A 1XZQA 4BVLA 1LCIA 1DCKA 1MC5A 3D2AA 3QOXA 4I7EA 3SBDA 1BMDA 1YZVA 1E2DA 4Q1EA 4C0HA 1JIUA 3VO9A 4IZ6A 2OZEA 4LEIA 3CH6A 1GPBA 4MIOA 1ORRA 4GIBA 3I30X 4QPNA 5DIZA 1PV1A 4BUZA 4H1WA 2FN7A 1LX7A 1CEQA 2ZUVA 3I5XA 3REQB 4RAOA 4BO9A 1CX9B 3IUPA 1SXIA 3CTPA 2JEOA 2WTUA 4L4SA 4OHOA 3CRQA 2WWYA 1VJGA 2PT5A 1TVMA 4NMXB 1JQJC 5I8PA 4KUEA 1C5KA 1W88B 2JGEA 4Z7QB 2OHXA 4TS3A 2D13A 2Y1OA 3K2BA 4IIJA 1V5WA 1S3GA 1R27A 4IINA 4B75A 1BMTA 2GWRA 5IJAA 4X45A 1W2GA 5LP6C 2PMEA 4B31A 5CFMA 5IT4A 2FPUA 1XRNA 1YL6A 2GO1A 5IEJA 3ZI4A 1W94A 5AW7A 3E8SA 1V6CA 4L5JA 3INTA 2QZZA 1JHQA 5IDQA 1TM4E 5KYYB 2WIBA 1WY7A 2EP5A 3D2CA 2XUIA 2IU6A 2JFWA 1XE3A 3DR3A 2JCXA 4DSNA 1KRHA 1DZIA 3QJGA 1R3DA 4HTAA 5C7LO 1V1RB 1YZNA 3KZMA 3EOAI 3KQNA 5CFQA 4FT4A 4XLTA 1QFMA 4H0NA 3FPBA 1T15A 2JJ2D 4WCVA 4KQCA 3JR7A 1Q0RA 2O0HA 1BVHA 3FAKA 1W87A 1XEXA 4IDBA 2O4CA 3MTEA 4WXYB 4Q9HA 1CUGA 3R23A 2OCPA 2FFHA 3EIEA 5AO9A 4KXMA 1AB5A 3KYCB 4GVLA 2WHPB 3U4QB 3OHMA 1ZXLA 3G6KA 1VYHA 1WG8A 2O7QA 3E7DA 1BE8A 3FNGA 4QLOA 1V1MB 5J4YA 1CR2A 1YRHA 2HSZA 4J0KA 5E1MA 2ZI6A 3HRHA 4CM7A 3K53A 1SIOA 3Q10A 1G5PA 1B6SA 2GKGA 4Z99A 2QSZA 4R8SA 2R3SA 4ZHQB 1QFJA 2RGWA 2R1TA 2J41A 4JMLA 4FDTA 1X7WB 4G1VA 5HJEA 1PG0A 4JKIA 1PJ2A 2R87A 2OYSA 3I9OA 3DCYA 4ZO7A 2QTFA 4L76A 5AVOA 1L6IA 5EE0A 4YJ3A 2CXTA 1R0WA 2HSDA 2IV3A 4RJKA 1M83A 4G41A 3T3GA 1WXGA 4ZAGA 5EE9A 3L49A 4PFKA 1RR6A 3CUWA 3Q8WA 3MELA 4N54A 1TD9A 2ZT7A 4KV9A 1N75A 3BJIC 4Y0NA 5LXTF 5TT1A 3PPIA 4IV0A 1TDJA 4J94A 3ZCRA 1QORA 1AN9A 1YDMA 2QU7A 2P7IA 2R96A 3I64A 4K40A 4BZPA 4YPVA 3DKRA 3GRYA 3BXOA 4HAIA 2PZBA 1ORWA 3HLTA 2EU8A 3ED1A 1TUEA 1WIWA 5ALNA 1FBNA 2Z8XA 4E2WA 1SXJB 2YV4A 4Q4AB 4B33A 3OZCA 2A9PA 1RVDA 4Q01A 2P4HX 4ZYYA 1BU8A 1FTSA 2FPPA 4W7IA 1GZVA 3RS9A 2WT4A 4IF4A 3TW0A 2NYRA 4NJMA 2GBIA 2JL1A 4B9EA 4BL5A 2IYXA 3RASA 5E3IA 3H8JA 2PYIA 4GKAA 4H3KB 3P45A 2MDTA 1UMBA 1J9GA 1MU0A 3QKIA 4RVFA 2P5UA 4UDNA 1N2BA 3CLKA 4M89A 4ZEMA 5JANA 4EUFA 3B1XA 1I9GA 2VK4A 2YUTA 2BGKA 3PC2A 1RYEA 2WMYA 3A2NA 4O0LA 3U6KA 2NVOA 3S5UA 4R8VA 4L73A 4OJMX 4Q3EA 4PYMA 3W8FA 3I62A 5EUMA 1X87A 2H16A 4M3NA 4DCMA 1O1YA 4X54A 1JQAA 2CXRA 3F46A 3QTBA 4YO8A 1LBIA 1CZHA 2XOXA 5CDUA 4F2GA 1RP1A 4Y6SA 1N33B 1U90A 1AC5A 2CDNA 3WDKA 5AVRA 4I1YA 1ZK4A 1JVSA 4XZ3A 4WNAA 4XQGA 1ZOPA 3OIWA 4V0LA 2HQ1A 1RZRA 4HQ6A 1T25A 4B4DA 1TUGA 4V1CB 2AV6A 4HGYA 1MN6A 4K9LA 4KOEC 3F9IA 5BURA 1IZYA 1KS2A 4JXKA 1ST3A 3CMCO 4W4TA 5MN6A 2LCFA 5SV2A 4PE5B 1E7YA 3AW8A 1BIFA 2QZJA 3VUFA 2G25A 4NZPA 2VPYA 2RD2A 3IMFA 1RWVA 2HC9A 2OVFA 1FFHA 1UDCA 5JRDS 5L53A 1Q50A 3EH1A 3RYCB 3CR3C 1KQPA 1TADA 1YONA 2PUCA 1DQZA 4BB0A 5BYKA 5IUKC 4UUAA 3N70A 3UQYS 1XUOA 2ZT5A 4ZVVA 1TJ4A 2GK3A 4LWOA 3G8AA 3JAWB 1ZZEA 3MRSA 3U39A 1NVFA 1UL1X 1JP7A 2MTBA 4I9HA 4K9SA 4R83A 1XG5A 4TV9A 3KLPX 4EEXA 4M53A 4QQ8A 4H31A 3SM9A 1R0YA 5A1JA 3FTCA 3SN6A 2FEKA 3BMCB 3EWSA 2C58A 3X1JA 3IMEA 3EGXA 4CGYA 1X15A 3WIDA 5JQGA 1RE1A 1B8PA 4M9UA 3CPEA 1GU7A 3HXMA 1YKFA 2RGEA 3HZHA 2CZGA 3HVRA 1QKKA 2XDWA 2Z9DA 3KQUA 2X41A 3DNPA 4TRRA 3OVMA 2PXAA 1HDYA 1JZSA 1WDWB 3NOVA 2BM0A 4FFVA 4OATA 2IOHA 5K3BA 2P75A 4KV7A 5F9FA 2HTEA 5CFOA 3SP1A 3KQOA 5DT9A 2MSEB 3WXBA 3O84A 2GF9A 1EFVB 3E84A 1GGVA 5DM1A 5I3ZA 3COJA 3PUJA 1TFUA 2QOEA 3LUAA 1AK2A 1WUKS 4KFSA 5ELMA 3M4YA 3GLHE 1EM6A 1WV0A 4RTRA 1MB9A 2VQFB 4Q0MA 1I7DA 4UHEA 1ESNA 1QFSA 1RKBA 2VPTA 2ZG6A 3THWA 5JCOC 2TECE 5ERXA 3ZHBA 3RSLA 4M9SA 4BMZA 1QJ4A 2F17A 3JZAA 2AKAB 5A02A 3DCNA 1GP2A 3TTTA 2FUG1 1TUBB 2D2IA 3KU1A 1U0EA 1A82A 2F2TA 4RTNA 4BO1A 1KJ8A 3GLKA 3RVQA 4RVGA 3KCQA 1R6BX 4AY6A 3V7WA 1GZ6A 4HC4A 4GH5A 3RRNA 1P31A 1U3WA 2WKWA 4JI1B 5KWJA 4U3JB 1K2VN 2J30A 4ZCLA 4EOGA 4HGRA 3O94A 1M2JA 1T2FA 1BMFD 2WJZB 4OYRA 2J3HA 4QC2A 2GPSA 3M1AA 1EB9A 2C04A 3HCEA 3MJSA 2VT7A 1J0XO 2XE7A 3SVLA 3GT7A 3G2HA 3HZZA 4Y8VA 4RTQA 2ZW9A 1YXMA 1T8PA 4KLAA 1A96A 1MAHA 2J09A 5IH3A 1HETA 4EKGA 4PO9A 1I94B 2CY0A 4TLLB 2WNSA 4DMCA 4E4TA 2XUGA 4XASA 3IAS1 4LJ8A 4KH1A 1AKTA 2BN4A 4RVOA 3I2HA 2OWDA 1ZG3A 4ZAXA 3HBNA 1FXUA 1DJLA 4KKVA 4FBLA 4RYDA 4LCEA 4CF5A 1RQXA 4Q7JB 2RIRA 1LW6E 2HT1A 1UMCA 2FZGA 1KZHA 4E3WA 4TZTA 1PJ4A 1X19A 2BI4A 2I6XA 4LQ4A 1SJ9A 3HKBA 1WDLA 4NU5A 5J4KA 2VNSA 3DFZA 1YJBA 2G1JA 3CH7A 1CR0A 1B41A 4N7MA 3WRXA 3NBAA 4V1CI 1E0KA 4HL6A 2PMWB 3C6KA 2PHZA 3JPWA 2IH5A 3HEBA 1P73A 3DL4A 4GR9A 2JI6A 1SD1A 4TYWA 4KNYA 1UZAA 2FSFA 1XELA 3F96A 4F4HA 3QOWA 4MUXA 2XV1A 4BVBA 1OAAA 2ZB3A 5JSYA 1NATA 3E9MA 4R8RA 3M9WA 5CD9A 4F1JA 3FFWA 1T3HA 4MMZB 4NXMB 3DEJA 4AS3A 4F2PA 4PYLA 3PX2A 2Y05A 2AA3A 4IPTA 4IX1A 3OPQA 4TLEA 3UJNA 4DPLA 2CMGA 3NV9A 1ZWLA 5LC1A 5TJHA 3U7RA 1KAOA 4DG5A 2HNAA 3ISVA 1SVIA 4OM8A 5FIUA 1G8GA 4IOLA 5IKEA 1QHFA 3MJDA 5B7QA 1T1EA 2IV7A 1J56A 2QPTA 5SZHB 4XVHA 4L6AA 3A1DA 2SBTA 3AF3A 4MR7A 2IHNA 1B6RA 3WNZA 2WQ6A 1RWXA 2H3EA 2ONKA 2GZSA 4TT8A 5ECDA 3UJBA 1UEJA 3DFIA 4XRRA 2L42A 1SG9A 2BM9A 2V7WA 2VNKA 1GSAA 3ILSA 3AR5A 4KJZA 4QVKA 3CFYA 5LMZA 1E3WA 1BVRA 1FW8A 4QG7A 5FR2A 2WYIA 4C6SA 3JY6A 2DR0A 5D51S 1O89A 1KHTA 1TCCA 3HNRA 4FFDA 4QUIA 2WWXA 4UHHA 1J9EA 2MMCA 3NYIA 3LY8A 1K6XA 4RZUA 2O7VA 4ALIA 4AFNA 4YWHA 3FFBA 3PQ7A 3NHLA 2OXRA 2WSSA 5IANA 5CR9A 2BGWA 3G2IA 4ZTZB 3AHHA 4MWSA 1I6WA 4NY1A 1AOXA 4E2YA 1H4QA 3GCGA 4EAAA 1WBDA 4RH1A 2GBCA 4L5YA 2G5GX 1SXQA 2BFMA 3FZEA 4B46A 2ZUFA 1FRFS 2CNWA 5BWOA 4ND8A 1CK4A 1VHDA 4QPZA 4IDAA 3MPUA 5GY7A 2BEJA 5EXPA 3HCNA 3JQEA 1UK6A 4M38A 1NY6A 1CSEE 1DG1G 4PHTA 1NQUA 3A28A 5H4GA 1KYVA 4PLFA 4AX4A 1TYDE 1K8XB 2A5YB 2GAJA 4PR0A 1CRQA 2XLCA 3FCAA 2PLRA 3IESA 2AN5A 1SC3A 4ZXFA 4FKZA 4GNRA 4NIMA 5KI6A 3KPWA 3JVEA 4K03A 4PXYA 4CLEA 1TGYA 5KHOC 4JDUA 2OK7A 2VZ0A 2MWMA 3EGOA 2DJ5A 4P33A 1MX3A 5T3UA 3ZCUA 4EBFA 5JLJA 4J16A 3VVLA 1GZSA 1E1DA 3I04A 3ZDDA 5TDHA 1ECPA 2FEMA 2NOAA 4P31A 1V95A 3GMTA 3QLUC 1UBHS 2ZRJA 1MX9A 3I3SR 2GKOA 2H85A 3DONA 1CE8A 4GGOA 4CW7A 2CJPA 3HJUA 4QGGA 1Q0TA 1MKYA 1QAQA 2QTNA 3UCXA 3W9UA 1QPBA 1Y8AA 3N28A 5AKXA 1I7PA 4L27A 5EKTA 2FOLA 5C8YB 1YB7A 1G66A 1Q74A 1R0CA 1XXLA 1Z45A 4B4VA 5EP3A 4LNHA 3NO4A 2IUTA 3GROA 4B3MB 4Q37A 1T4BA 2DPYA 4XUGB 2CJFA 1NDQA 5KMGA 4B6SA 4XJXA 3Q12A 4DYDA 3UK0A 1EUDA 2JFPA 5MDHA 4YIKA 2F9MA 3ELDA 1LPBB 1WQ4A 2G1UA 5L3QA 4UBOA 4B3SB 1JDSA 1I2CA 1F0NA 3QVLA 5DO9A 1Z22A 5JFGA 4DT1B 4U7DA 5J2TF 3OSZA 1IWPB 3SFZA 3WGLA 2CFSA 2ECKA 1Q92A 3ROGA 4BQFA 1EVEA 3FSEA 1VPVA 1D8AA 1I4DD 1JNYA 4LJRA 4EPXA 2KBFA 2OV6A 4M0PA 4CLOB 1PQWA 2C1ZA 4D9BA 4MS1A 3HQ4O 4KP7A 3ERCA 1UOPA 2PS3A 1YC5A 1UM9B 2LTAA 1C30B 3P0FA 1KWKA 4WKCA 4KI0A 2RBEA 4Y9SA 2AKYA 1OE0A 1PF7E 1SHUX 4Q12A 3RIMA 1BD4A 3K15A 4ETWA 1LSOA 4X62B 3SQNA 3VR1A 4K28A 4HDMB 4M0MA 3I1JA 3L06A 2FOXA 2WUFA 4IDEA 4KBFA 3U61B 2FMXA 5H70A 2RGUA 4O4IB 1HK7A 1NYLA 3E2PA 4L50A 1USGA 3KE9A 3EODA 5EIEA 2G8NA 3C8UA 4FD2A 4I9NA 5CEJA 4OA8A 4M8KA 3SVZA 1E1NA 1ZICA 2AN9A 1R16A 1PYOA 2G0AA 1MTZA 4ZGBA 2LXNA 1KYIA 1IHDA 1LJ8A 3RVJA 1D9XA 1QYDA 2PA0A 5IARA 2DT5A 1T8SA 3Q4GA 4GM1A 1Y8RB 4X90A 2QR3A 4WL0A 5B1IA 5CG1A 4YC7A 2AJ8A 5CIYA 2HZ7A 1ZQ9A 1VSVA 5K20A 1ADFA 4DMUB 1EG2A 3WWDA 2JJMA 5CHEA 3RCBA 2X15A 2Y6VA 1F17A 4FFWA 5L40A 1IHPA 4C2TA 1MTOA 3N8NA 1G8HA 2OUIA 2X22A 3AYXB 3OQNA 2WPNA 2YWJA 2YX1A 1RD4A 3UOAB 4RJJA 4MJLA 3DEIA 3QEMA 3K6SA 2VCEA 3FVRA 4UUBA 3RYIB 3UJDA 2JAQA 3CG0A 1JA9A 3CRRA 2O8VA 1N6HA 2QRLA 3OF5A 3MJVA 2VT2A 5E2IA 5ALSA 3RVRA 3O1HB 4DB4A 5BP7A 1P4RA 3JXEA 2FWAA 4BFUA 3D0KA 2FMTA 1X8LA 1Y0BA 3W5BA 4IHJF 3A1EA 1YZYA 1N6RA 1A2QA 2C2WA 2I7XA 2Q6KA 1WMSA 3WB1A 3WHIA 1K92A 4Y2SA 3GLIE 3A6PC 4C0QC 4P2BA 1JEQB 4AZVA 1QLJA 1ZM9A 2JLAA 1SEVA 1RXVA 2J6BA 1NW4A 2IE8A 4MRMB 2WBLC 1E62A 4XH9B 3QKSA 4A3SA 4BVHA 4MP3A 2NO7A 2C54A 4B7XA 3AEYA 4DIMA 1RM3A 5DXAA 1GAEO 3I28A 1JKJA 3P2IA 4K9OA 1E2KA 1M0TA 3RG2A 5JT1A 5LQMA 2EARA 1OBOA 2H2FA 1V9SA 4NG5A 3TLCA 3AGPA 4POOA 5FWYA 1OI2A 2CF5A 2ERYA 4JX9A 2PX6A 3DG9A 3TDMA 1XA4A 3P9SA 4ZCTA 2NO1A 3BDVA 3KBOA 4L1KA 1GDHA 3SJAA 3MLBA 5BR7A 4CEIB 1FE8A 2QL6A 3D6UA 1DCFA 3ONFA 3GNQA 4TM7A 4EL5A 5BOVA 3EQ7A 4L5AA 3S2UA 3SICE 3Q5EA 4BVGA 1SCUA 4R2HA 1WPGA 1SBQA 1UC9A 4U6NA 1MH9A 4URYR 2Z2JA 1PR3A 2G17A 2X8WA 5EJMA 5HJ2A 3U5ZB 2B3DA 4EB6B 1JR2A 3O38A 1P74A 3PR2B 2BFFB 4HCJA 4QHSA 4K26A 3COVA 3NGXA 1J20A 1WZNA 2YY6A 3ODGA 5CT4A 3JARA 3U44B 3D6TB 1NNEA 4PWZA 3QVSA 1R37A 2FG5A 4R6WA 1VHJA 1RRFA 4MWZA 4R9UC 4UXHA 3GEIA 3ZYZA 4Z51A 1DEOA 5BR4A 4NESA 1G41A 2AJLI 5LOVA 7ADHA 4H6VA 4K1LA 4ADSG 4RV9A 2XWBF 2IIVA 4GX5A 5HK8A 4DJDC 4TWJA 5IXJA 1PCXA 4BNDA 3C3XA 5JAMA 4MLCA 1KH3A 2P6UA 3O90A 1RAGA 1CV2A 1J7KA 2H8GA 2COKA 3EIFA 3HV0A 3DF7A 3M89A 4IIYA 2VDLB 4TV8B 4XPIB 5EXTA 4BNWA 4BFCA 1P60A 2BMWA 2QENA 3FCSB 4TM8A 2FG7C 2CUNA 4YREA 1CKEA 3NDRA 5CP8A 1S2LA 4RGVA 4DV4B 1XHEA 2ZJ3A 4NECA 4ZOCA 5IT0A 1PI3A 4D2IA 3NVDA 1XTJA 3IQEA 1XTRA 3D6AA 4J49A 4X7BA 1L8XA 3JQ7A 2FLVA 4B81A 2GPWA 4GPTA 1HO3A 1YQXA 2H2HA 3M5WA 2PAAA 2FETA 2X77A 4MSUA 5G1NA 3WLHA 1JVNA 2ZKIA 1E18A 3QE3A 1BKYA 1FRQA 4MARA 1KO5A 4D3FA 5EIAA 4KREA 4K2HA 1P91A 2ENUA 3QVJA 4MIKA 3UJ7A 1I3CA 4D4IA 5F9MA 1QMGA 3AW9A 1HFEL 5K3OA 4OYYA 4AZ0A 5B7NA 1MHTA 1VBKA 2W8BA 3RO7A 1N2IA 4U2DA 3MF4A 1JWLA 1WF3A 2WM2A 5MFPA 4QYXA 3LAWA 1XWIA 1E1KA 1BXRB 4HV4A 5LKAA 1M8PA 4Q3LA 4PV7A 4XX1A 4P7KA 5HFAA 1LLDA 2HMTA 5ULLA 4B82A 1QHYA 4BWYA 1M2WA 4I5DA 4IZHA 4ER7A 1EFAA 1RCTE 2Z2KA 2FP4A 3Q3IA 4PXAA 4LOHA 5LZ4A 2NSLA 1WP9A 3PPYA 1O9BA 3MM4A 2BEKA 5AM1A 4TN5A 4QO7A 3BTUA 1EFPA 2N47A 1A4XA 1RYZA 5DW3A 3SLKA 2O7NA 3T3OA 5FWAA 2FOIA 4DLSA 3Q9UA 2PLNA 1NP3A 4C4SA 3X2SA 3I01M 3QVGB 1VGVA 4IIDA 1KYXA 2A1IA 2XH8A 4FEEA 4HF7A 4D0SA 1O2DA 3ZWQA 1O95D 5CDFE 1GL3A 2VYND 3ZHYA 5BOSB 5MN4A 4BBZA 4C7XA 2YVLA 3OJLA 1MABB 1ZC4A 4ZMRA 4MR9B 1WUTA 3KOMA 4H16A 4MVJA 4JV5B 5EXXA 5JVDF 2BEWB 5JAPA 3IEXA 5AI5A 5EIWA 3KZCA 3IO5A 3PPXA 1Z4OA 3D6MA 5C46F 4KR9A 3IUYA 1KYTA 1YC2A 1EK0A 2BV3A 2QGZA 4RXTA 3SEQA 1HH4A 1SCDA 3THXB 1QIDA 1HDRA 1FXWA 3KOZA 3GV0A 2P27A 2EIHA 2QMOA 3N8KA 5F51A 1NOIA 1YI0A 3Q0TA 3ZV7A 3EXIB 4EFDA 2XVYA 1SZDA 2C4MA 3NVAA 3LZDA 1V1JA 4MQMA 3K0HA 5JSZB 4I66A 1V1RA 3C6BA 5M3BA 5GIOE 2J87A 3V3TA 1NVAA 3RV3A 2BMDA 1KPGA 4TYNA 1Z2AA 3BWBA 3JVVA 3CGGA 1EKXA 5IEBA 4ZTBA 1Y7PA 2BKLA 4N8DA 3X43A 2TMYA 3F98A 3WQBA 4DANA 2V6FA 4WGGA 4FOLA 1XHFA 4DCCA 5K8UA 3L7NA 2G08A 5FYDA 1HYQA 3KYCA 2WHPA 1M73E 5AJUA 1LLFA 3U4QA 3GRCA 2B6NA 5D2CA 4CF6A 1H0RA 1V1MA 4CFZA 1CZUA 4N01A 1B1CA 2Q45A 1SU7A 3OZFA 4F3NA 1Z34A 2R5NA 4LVUA 3RHTA 2PX4A 1VP9A 3TYXA 1Y4SA 1SKYE 2VF4X 4YMTA 1NRIA 5SYNA 1U2RA 2R85A 1KZYC 1S1CA 3L8HA 5EPEA 3WV5A 1RCFA 3VTAA 2QTMA 3TBFA 4YMLA 1HOTA 2DTXA 5AP9A 5JDCA 1X7WA 3NHAA 5ALZA 4ZQIA 4ALMA 2VQ6A 2HMVA 3LCJA 5CAEA 4W5NA 2WB4A 4QUEA 3W6OA 5EG5A 3VPDA 1L4LA 1SD5A 4D74A 4XUCA 4FVTA 5JD3A 1SVWA 1T1RA 5K3EA 3HXQA 3TECE 1SOMA 2VJMB 2I99A 1T35A 5FBLB 4EHAA 1XPUA 2QE7A 3BIJA 1G1MA 5CX1B 3DULA 1ZUNB 3EVDA 4U7JA 4G9BA 3KU4A 3TH5A 3HLYA 3PFWO 3RC9A 5L3SB 4RMHA 1LX6A 4TSKA 2J46A 1UBGA 2O59A 5IDVA 2C83A 2A33A 3HHEA 1U04A 3VYVA 4D5EA 4L3WA 3PI7A 1SXJA 5EUCA 4EYSA 4BGVA 4TL6A 4Q4AA 4GLFA 3WGHA 1FTWA 1WE2A 2VUSA 3H75A 1XMJA 5FL7A 3VPBA 5IF3A 1WKCA 1D2HA 4HH1A 4MV3A 1RTTA 3WLLA 3Q85A 3ZDRA 2FQYA 2VDNB 2XTJA 5BNWA 4PGGA 2W98A 2HF2A 5FADA 4D9NA 2L19A 5KDOA 1Y1RA 5TR9A 1L7OA 3BRCA 4CTJA 1CR4A 4J0CA 4E88A 2DLNA 4MKGA 1KEKA 4GYWA 3G79A 4KXVA 3QE0A 4LFCB 3OZTA 1ORHA 1M2KA 3GWGA 3SD7A 3UJAA 2O8NA 1JL3A 1Z0JA 2IIQA 1UFOA 4BIMA 2H9YA 2H7VA 5BVGB 5BVHB 2O57A 1KOFA 4PYJA 4IIJF 1L4GA 1BXKA 1QO0A 2I1LA 1ZOOA 3B7PA 3NYQA 1Z36A 2QF7A 1U4SA 4FSHA 1ZUD1 5B5SA 3K2EA 4KBYA 4E5PA 3BG5A 4KWIA 5HS6A 3DO6A 1SUIA 2PUAA 3ITNA 4IP0A 1U7DA 3R75A 5GZ6A 2HBRA 4ZVLA 4FN4A 4K6CA 3OQOA 3OEYA 2YHSA 2XSZD 2ON6A 3Q3GE 2FSVA 1NJ6A 1KXJA 5JEDA 1J9ZA 3TFWA 2BIFA 4DVGA 3KQSA 3MCTA 1UEXC 2SHKA 2J4DA 4DDHA 2C4TA 1Y9JA 5C3MA 4QDTA 1CS0A 3BXEA 3OPNA 4AJNA 3UFBA 4JELA 3QUTA 2QLTA 3HFRA 3QKWA 3EN0A 4F8JA 5EJEA 2Z3VA 2BFBB 2PD3A 2JIBA 2ASVA 3VDMA 1Q95A 1RMTA 2X5JO 4Q9JA 3SE7A 4DQUA 1O95C 2CLMB 5IBQA 2D1QA 2TMGA 1KO4A 1NT2A 3IIJA 3R8XA 5KZMB 3KOOA 4O2AB 2FW1A 3EMVA 3PRKE 5C32A 5A7HA 1JR3D 1RWOA 1SRQA 3V2IA 2XAAA 3JAWA 3KNZA 1FNNA 4D8WA 1YF3A 1S5PA 4MYHA 2DPMA 4G01B 4MNTA 3OO1A 1WB5A 4EKDA 1KO8A 5DNUA 5KQSA 1GVNB 3Q15C 1RXSA 4GOJA 3QKTA 5KKAA 3ZV5A 4E21A 3PVCA 3N7UA 1BJRE 3Q0IA 3VNRA 2YZ7A 2QS9A 1UFVA 4EO4A 2C5AA 2WG2A 2OCYC 2D74A 4ND2A 1J07A 1PP4A 4L8LA 5FLEX 1QP7A 4MGHA 3NP7A 4ZCSA 2NSJA 4KWEA 4XXHA 1VKZA 1P5HA 2D1TA 2V4ZA 4QGAA 4YJ3F 4G4JA 2ZDHA 4IHQA 3UK2A 5BNTA 3SLRA 5ALOA 2C4KA 1AMOA 1UPAA 4QT0A 1FDIA 1GG2A 1M1YB 2W2TA 4KQEA 3T3DA 1QGED 1RM5A 3KZ1E 1XMOB 5LDDC 1XTQA 5EZYB 4FILA 1E0AA 1KZ4A 4MJ7A 1EFVA 4P81A 3BQMB 1OZFA 5HF5A 4OH7A 4Z0TA 1PFQA 1PEKE 1IHYA 2J0UA 4P0PB 3QU7A 3E1KA 2VWHA 5LUBA 4GD3Q 4JLNA 2I1VB 2G4LA 3QMMA 3RHSA 3WQQA 1AQYA 2HK6A 4N0MA 1E98A 3DWIA 4NOMA 2FW9A 1XC7A 3IB6A 1CUVA 2QLMA 3IBCA 3NBQA 5EJIA 1Q3TA 2A9OA 5LCXA 3MS4A 1SY7A 1R0KA 1TUBA 3X2FA 3BJRA 4G1BA 4DN6A 2ZRBA 2OCIA 1AKVA 1EX7A 4F9TA 4ZAVA 3STWA 3QIVA 1VCIA 3B9QA 3TUIC 2GH1A 4Y3UA 1TK3A 3BE8A 3MD0A 2AW5A 2WFMA 1N25A 4RF2A 1FSGA 2D0DA 3EQ6A 3ILXA 3I58A 3PEFA 2VNHA 4HLDA 4TLDA 5EJAA 4F45A 5HP4A 2C2ZA 4YP1A 1D6NA 3UGQA 3ZN2A 1AHHA 1T4GA 4Q7MB 1PT8A 4NEHB 4M6WB 2ET6A 4CMEA 4KAAA 5FXMA 2ANCA 2Y4NA 2FJUA 1E5VA 4HQFA 3UT6A 3UWOA 4JLAA 1IJKA 5BSVA 4COKA 2H08A 3E03A 4URXR 5I3CA 3DQQA 3Q11A 4GZ3A 4JVNA 4QPCA 5AJXA 4ARUA 1I80A 1A2OA 1JIJA 1YWGO 3TOVA 3QOFA 1W5EA 3LT0A 5DJ5A 5FO1A 2Q3DA 3KSMA 3L8ZA 1SOAA 2ZSBA 3LXXA 2QN3A 3FTFA 4G1MB 2ZRQA 4A36A 2H2DA 2VF7A 2QMUA 3ANYB 4Y7DA 2VPQA 3T0IA 1IAQA 2F43B 1VIMA 1QVZA 1YJCA 1H8EA 3L02A 1UR5A 2HV8A 2OOKA 3EB9A 1QIMA 2PGOA 4YACA 3RSGA 3WLIA 3H13A 1S4QA 3WRYA 5DYNA 3UJHA 4JA0A 4JB3A 1D1PA 2HWYA 2WF7A 5K0BA 2YFQA 3DPSA 3IQWA 3ORFA 3PI6A 5HDQA 5B37A 5G2OA 5IC4A 6ADHA 2O54A 3MRVA 1EDDA 4WY2A 1OWLA 4NV1A 3M6VA 3ZHQA 3SJCA 1JWAB 1W1IA 4OJNA 5J4LA 1P4SA 3OQ6A 4CIDA 3KSBC 2D3WA 1ULBA 1U0SY 3GUVA 1VOTA 3KB1A 1H0HA 1RI4A 1Q7CA 1UFQA 1ZRSA 1AF7A 2WU0A 4U9IS 4IQ8A 5EE1A 4IUBS 1L5KA 3D9QX 3OTOB 4WZBB 3GNSA 3OZUA 4TV9F 2Z9CA 4WK6A 3BC1A 5KYXB 3A6KA 2OHOA 3ZY3A 3O8BA 1MC1A 3E5MA 4D4HA 3VBCA 3OSUA 3BJZA 4PO3X 3CUVA 4HVLA 3WA7A 2OHGA 3JYLA 3KQWA 4HB4A 4BEBA 1RBQA 1NI4B 5F4ZA 5JQGF 2I3DA 3HCBA 4D9KA 3K70D 2GHRA 3CIOA 4II2A 4DUPA 2G63A 1FYXA 1K0FA 3G2KA 1CQXA 2YL2A 3OEHA 4KIUA 3ZWBA 2KS6A 3A8TA 1G8KA 5F3RA 1RRVA 1D4AA 3FYUA 2ADMA 2V5UA 4BLSA 1XK7A 3G6WA 1DX6A 1YR6A 4KRXA 3QG1A 2QVCA 3I6BA 4JJ6A 3WK5A 1PLLA 3T9FA 3DE1X 5FNVB 5IXYA 1NVMB 1G20E 1Z7GA 2IKSA 2Q3MA 3Q7TA 3TLYA 2AHOA 2O6HA 2HYDA 4RY0A 1JEJA 2A30A 2JFXA 1ODLA 5FUBA 1BWSA 3WP1B 4ED9A 5IZCC 2WYVA 3OPYB 1XAHA 3MFQA 2HSJA 1W1UA 3B38A 4ZO6A 3DBRA 4Z1MD 2YWHA 4KYUA 1H2FA 2AYYA 3E23A 1YCFA 1B16A 5K4AA 1WQ1R 3NASA 4M87A 1GYQA 2QTTA 1KWGA 4DCJA 3V5NA 3BD9A 1XAGA 1E4OA 1XU4A 2ZT8A 3QP9A 3VSDA 2O8EB 1XCOA 4JS0A 4NTZA 2AI1A 3A26A 2AUNA 4CEJB 4FGWA 1YQGA 1UADA 4TZKA 5DM0A 4B6EA 5DH9A 3MJFA 4MTCA 1E6CA 2XUOA 3UXHA 3WL7A 5I7UA 3LQFA 4JJ8A 4AN4A 2PIDA 2FMHA 2AXPA 3K9NA 1P1CA 4JJEA 1SBIA 3PLAE 1MZPA 5LMCA 1UWKA 1J6UA 4L7QA 5T4FA 3TQHA 2X3YA 2BJHA 3D4IA 2FK8A 1NWHA 3TLAA 2Y1CA 2YXLA 3SF8B 4EW6A 4N6OA 5EI5A 4EJSB 3IDAA 1ODTC 3OZAA 3NCTA 5C81A 2X7XA 2EZTA 1IUPA 3M3PA 1S01A 5FTMA 3PDJA 4LRTB 2P2YA 3EXG2 5AK0A 3TW8B 2MT9A 3O31A 3OY2A 1RWPA 5KINB 4UFPA 2DWPA 5EHNA 1E60A 4QNMA 5C8YA 3ZZTA 2ZI3A 1FVXA 1YL5A 1X7YB 1Z4JA 4J0IA 4RLSA 4L4ZA 5E9AA 4CMAA 1GPJA 1T5HX 3CZMA 2YASA 3E53A 2XWQA 4XTRA 5EPUA 1TB4A 1ONOA 1CUBA 3FMGA 3QXSA 1QR6A 4QSMA 4C0SA 1G4HA 1DXHA 2CNKA 1D1QA 1TD1A 4PG6A 1QTQA 5TPZA 2F3QA 2Z0MA 3IJ5A 1Z6PA 3GU3A 3EEOA 2GJKA 4DT1A 3LUPA 2D1RA 2PFSA 3WKCA 3RFTA 3RIEA 2DHRA 5B2EA 1AA9A 1KI3A 1Y6RA 3T3MB 4LBVA 1NUUA 1B8UA 2RHWA 3K0BA 3OE7D 1U7OA 3WLSA 1CJTC 3UK1A 4CLOA 2IWRA 1IVSA 5KOJB 3PTAA 1DOAA 2EFGA 2IXDA 3GB9A 3KB2A 2G06A 4B48A 2Z8YA 2Z5FA 1D5WA 1C30A 1J23A 1PKXA 2FEOA 2HA4A 2PEZA 4C22A 1Q2XA 1QGZA 3AHIA 1WXFA 4RORA 1PS0A 4BE9A 3M2TA 5I7VA 2XVAA 3PZRA 5CFLA 3YASA 3PHJA 1PD0A 2ZJ1A 3GP5A 5A2GA 5ARBA 2AVNA 3EUAA 2DU8A 4MWTA 3OUUA 1F9AA 1FL9A 5EMMA 3GLGE 1WZEA 2WVAA 3FNIA 4V03A 4MW1A 5KTYA 5C35A 5EERA 4I3GA 4KO1S 1P2VA 2CMHA 2ZQ5A 2WA1A 2XB6A 3OCUA 4LHWA 5FWXB 3R2JA 1RQNA 2A0UA 3LT5A 2Q3HA 4PVDA 5JMTA 2WEKA 2HJGA 1MNAA 1QAMA 5IBCA 3CF2A 3U3XA 2IELA 1Y8RA 2I8AA 3CRNA 2EVWX 3KX2A 4CG1A 1M6EX 5FUMA 1Y9DA 1II0A 1PL0A 2NZYA 1Z0IA 3OZIA 4AJ2A 4EW1A 3ZWKA 3I9V6 3PICA 3AOGA 5IDXA 3EEIA 3VQTA 2NUPA 1INLA 5EHIA 4UQPA 1XQWA 4E07A 4PPQA 4JLVA 4CL3A 1YI8A 2BUBA 3KKQA 1OA1A 1IN7A 2OM6A 4BUCA 5BUQA 2VZEA 3A04A 4DZZA 1WXIA 2BMVA 4XOUA 3RYIA 5LMUB 4POAA 1OAOA 2LVBA 4PLGA 2C7OA 1J0EA 2IDZA 3FOEC 4HRVA 4EG0A 5AUQA 3E1SA 3K70C 2D54A 1SULA 3IVXA 1YFZA 4ER5A 1KKMA 5EL0A 2E49A 2YJNA 1VBFA 3Q8XB 5KUTA 4ZAZA 3BPSA 1G6HA 4QQRA 4KDEA 1KMCA 3KG2A 4HD8A 5LA6A 2XGGA 1Q1QA 1SC4A 5EIOA 4E5YA 2WI8A 4ZMSA 6Q21A 4DR5B 3D1LA 4LV6A 3BD6A 2DWOA 4PFJA 1ZGBA 1W5SA 1KIAA 2NIPA 2GHQA 2JHAA 5E1OA 5SZKB 4X8OA 1L8AA 3L8DA 4HDQB 4ZVUA 4AG5A 2PRJA 2ACKA 4FD3A 1UWLA 2WV7A 2BKEA 2VK8A 4R81A 1JJAA 2OCBA 3GG9A 5CPFA 1EXNA 4MI1A 3H87A 3DPIA 5HOQA 4NFSA 1ACLA 1C9NA 1XKTA 1SZJG 1I7LA 3GD5A 3QY0A 4HLUA 3EF1A 4WFQA 3S8MA 3UB3A 3UOWA 4CQJA 1O0CA 3IP5A 3T7EA 2DF8A 3AHEA 4YB8A 2H3HA 2N42A 2XE6A 1Z88A 1OLXB 3RU3A 4CEIA 3OLWA 1OILA 3DZGA 4ID9A 4PZ0A 2R4UA 4TXNA 4BP3A 3DB2A 1XCMA 2VDUE 3D0RA 2XCQA 3IUEA 4U0KA 1TA4A 1T2NA 2CVHA 4WZAB 2QB5A 2J48A 4PBTA 3BKXA 4TLCA 3NS7A 1DIHA 4ZVQA 3DQZA 3W3ZB 4BKUA 4IUCS 1U8FO 1ULTA 1V8DA 2GZ1A 3OZVA 2OZVA 1NC1A 4CFSA 1I6KA 1V3TA 4UCQA 2BFFA 3GARA 1KIFA 3GQBA 4OREX 3NIWA 1SHLA 3B1KA 3O3NB 4KQ2A 5AUPB 3X0DA 3ZDZB 5AVWA 4LXUA 2I67A 1WVIA 3G8DA 3U44A 5IAAA 3F4BA 1AG9A 3K30A 3BFJA 2JLXA 4OOFA 3W4IA 5CB8A 4M21A 3OQHA 3E58A 2Z6QA 1NQXA 3FETA 1EUZA 3MYRA 3ZGXA 4TXJA 2VTBB 1R8JA 2Q1YA 3UATA 4ZI7B 1C9DB 4BATA 3K0SA 2J9YB 2BUAA 3DJYA 1Y48E 3DMTA 2CNBA 4CXMA 5CG2A 2V6JA 2M6KA 4TV8A 2FNAA 1R5NA 4UULA 1U8EA 4XPIA 5EFZA 3SS9X 5WRFA 2XDQA 3NH9A 5HIIA 1GL6A 4J0QA 1WDMA 5JJLA 4KPFC 2E7ZA 2J9FB 1X1SA 3BE6A 5G02A 5TE9A 3CNQS 3HDYA 2BBTA 3WHKA 4B17A 4DM3A 4HB3A 2H31A 4HDSB 2PX2A 1ZWKA 1GPLA 2X42A 3GDHA 1YR3A 4Q39A 5JXJA 1XPJA 1PNRA 2NZXA 2Z8ZA 4Q6WA 5ALXA 2CYBA 1NFRA 2JFYA 1N3LA 2YINC 3ZY2A 1T5IA 2ZRGA 4H6XA 1ODSA 2JFOA 2Z98A 2R7MA 3O83A 2VC2B 4CUZA 3GJZA 2AYXA 1E4VA 4IEFB 4DXAA 5BRAA 3LBAA 4OI4A 5DASA 4OYHA 3IX7A 4BZQA 3UPUA 4D26A 4WZZA 1Q84A 3MJEA 3O1IC 3LCCA 1PR5A 5IK2A 3MQ4A 4DJ5X 4BO4A 2Q6LA 3DZHA 5BSMA 2HWWA 5AOBA 1GQRA 1RC0A 5K0TA 1C1XB 3EUWA 3OEEA 3O6VA 1AKUA 1U2GC 4J0DA 3EX7C 1ATIA 1U7TA 3UKDA 2P11A 5ELXA 4PG7A 1C3JA 1EJ2A 2P9EA 4XARA 1C4KA 4MQ5A 4J1TA 3QVGA 2PR7A 1YR7A 4DABA 3DV0A 5F3WB 1MX1A 1CZRA 3LBHA 4H7FA 4QUDA 2VDQB 3EPRA 3JSAA 2C3PA 4BZXA 1UBRS 4Z54A 1NF8A 3TSZA 1TMYA 2NSDA 3OHPA 5BOSA 6YASA 3C3PA 4LNAA 3SKYA 5PGMA 3OLYA 1MABA 4HLCA 3LUHA 5AKIA 3DEFA 1E2BA 1N6OA 2ZWAA 4O8CA 5L3VA 1VI2A 4R9VA 1SXHA 2B78A 5EZ6B 3ESZA 1JT2A 2CXHA 4LVCA 2V5VA 1P1IA 2WWGA 3BE4A 3NHUA 4FC6A 4LZZA 4XTCS 4D3SA 1RJDA 3THXA 1L7DA 4GMXA 3CZAA 4G8JA 5ARCA 3GT0A 2P69A 3WV4A 5FNZA 4AJKA 3TIGA 1I1HA 4P38A 2VDJA 2CVZA 4C88A 5BUSA 2HA6A 3EXIA 3G85A 3HA7A 3I6YA 1LKZA 2P67A 3Q40A 1N2CE 2VSNA 4J2TA 3SQOA 3KPUA 4CKZA 3RE1A 3AQ4A 2PH3A 2B35A 5L4NA 3C5CA 4Z9FA 2HUNA 1BYIA 5TQ2B 3UAWA 4OXYA 1BDJA 2V7VA 4TMVA 4WK0B 3SXUB 3V8BA 4NENB 4UZEA 1ISHA 1Y8QB 5EIFA 1VYTA 4EG5A 4BNKA 1RXWA 3NWPA 4CV2A 2CXOA 2I2WA 1AK9A 2GNAA 1L7RA 3R0QA 4LXTA 3NEYA 1TIKA 2ZRKA 4PS1A 5AVXA 4QYSA 4S1TA 5M7EA 3NBZC 2UZ4A 3N0TA 3SC3A 4D8YA 2BKUA 1DIRA 1SUFA 2NPFA 4D44A 1U9ZA 4HDKA 1BHQ1 2OZLB 3HCFA 4WXPA 5FTLA 5KYTA 5LOVF 2WJWA 2O8DB 3W7AA 3BWEA 4DCUA 3PJDA 1Z18A 2UUOA 3IBGA 3ROPA 2FX2A 3Q7IA 4QIHA 3RRJA 4Q4LA 2AT1A 5GJCA 3WJ1A 2NV0A 3W05A 2YN4A 1PG5A 2AWOA 2XKAA 1Z7WA 5CCBA 3B2EA 4JSRA 2B21A 1CETA 4AY4A 2CFOA 3JRXA 3QU5A 5CFZA 4ZREA 4A6XA 3D4BA 3GAFA 1XTKA 3NHJA 1UPBA 4MO2A 4Q03A 5DM4A 1OI4A 4G8BA 2R00A 4F5ZA 1JFFB 2CBXA 1ZNQO 1J7JA 3A9CA 3DVAA 3G9ZA 4XOIA 5K8IA 3PVSA 3DLBA 2X9QA 2VJMA 3KD2A 4YRIA 3AR3A 5DISB 3DBVO 1U3UA 1XQ6A 1ZUNA 2VK1A 2YYZA 3QSGA 3HKCB 5CX1A 2ZR9A 2AB0A 1HMPA 1TQHA 5FLKA 1EFTA 4BPRA 3DT9A 5REQA 3H2HA 5H9VA 3O4GA 2PTHA 4L3VA 2EJCA 3KPVA 5AKKA 5M5BA 2A9FA 3MWGA 4F7WA 2W42A 4FLFA 5JG7A 1W8IA 4DNQA 4ZEOA 3U60B 3P9XA 3NORA 2BBSA 5IWAB 4JEMA 3C7KA 2OHFA 3QWFA 2EFYA 3FDXA 2CT8A 2X4GA 4RPKA 1YJ5A 1P1KA 3UMJA 3HN6A 3HYLA 2WF6A 5J5CA 2CE2X 2I4NA 1EK5A 3HBAA 3CQ9A 5FFNA 4Q4JB 2UUBB 5P8WA 3JWPA 5GTDA 2I6UA 4LOLA 2G07A 2ATVA 1NP7A 3BL6A 3JQBC 3KTDA 4NL4H 4RJLA 5AKEA 1Q0ZA 3HDQA 2G9NA 4RCYA 2H1IA 4QEKA 5B2ZA 5HF8A 5B3JC 1TF2A 2IHKA 2JFVA 1JHXA 1IHOA 3AM4A 3K0FB 1BQ4A 1J00A 1KFEB 4KI7A 5BVHA 5BVGA 1ZD3A 4KQXA 1BC5A 3EBLA 3DAPA 2XDAA 4IXMA 4WLVA 4DIBA 3O75A 3RT7A 4MVJF 1Y7IA 3U16A 1HRDA 4PNEA 2EZ4A 1W0CA 2CE7A 2EX4A 2WSLA 1FLAA 2YFKA 3BMOB 2MR6A 4FXOA 4TTSA 4W6ZA 3ZCPA 3GFRA 5JBNA 1G21E 3L0SA 3G2QA 1GRNA 1ZD2P 2IEBA 3GNLA 2HPAA 2LKDA 1E5DA 1KYYA 1FXWF 1CF2O 5I9TA 1A2BA 1GTVA 2EBWA 2C8KA 4BEVA 2I4LA 1RDFA 5B7GA 3IXLA 2IEDA 5B57C 4YI3A 4URWR 3T3PB 1OV4A 1YAJA 1IXKA 2G3YA 2QE6A 3OLQA 3DA8A 4K9PA 4CZ2A 2W48A 3STHA 4EVSA 2LDBA 1CDZA 3IDZA 3W9BA 5JBQA 1U0GA 2IF2A 4E30A 4BTEA 5BR8B 2NSYA 1ZC3A 3DNFA 1HKUA 3L0IB 2V6MA 3K6KA 3PFHA 1W4LA 3HJTA 4O25A 2B1JA 1M2EA 1QTNA 4MGZR 5IULC 2I34A 3L3BA 1COWA 3HJNA 4TYMA 4BQQA 3NM6B 4LJYA 4EPRA 1YFLA 1IZ7A 1LB1B 1U0LA 4CTOA 1DO0A 2YWXA 1I32A 1KEUA 3C1UA 3MQFA 4HSEA 3WL8A 1E7WA 3H5VA 2Q6VA 2Z3ZA 3UOGA 1IOVA 1HLDA 1N0WA 4DXDA 5LFAA 1OFGA 1J0AA 1YMVA 2EKBA 2VT3A 2QUZA 2E5LB 1NW7A 1MB4A 4ZHQF 1IXYA 3IAEA 1D1TA 2XZLA 2AW3A 4MW5A 1LLCA 1YE5A 4MHSA 4EHKA 4G0NA 1ZK3A 3H2GA 1AZSC 3B9RA 3QFTA 2H54A 1XDGA 1ZUHA 2IDJA 3DEZA 3QWAA 1JYEA 2DHCA 1JJBA 1Z73A 2VYVD 5C5CA 5K6RA 4EITA 4I9FA 1FQJA 2H1VA 4C4PA 1L0BA 1Y6QA 3DHVA 3E0QA 4IO1A 4LPKA 5DYGA 4DDUA 2O7RA 1JHUA 2Z04A 4O33A 5SZJA 2XY4A 2FSUA 2I9PA 3FCEA 4NEQA 1M1YA 2HLNA 1VJRA 3BXZA 3ITEA 2NP7A 4G1UC 4I1OA 4Y9TA 2OY0A 3VNVA 1E20A 1QDUA 5LBIA 3STTA 2EG9A 5EZYA 5IDYA 1D7OA 3S1AB 3UMMA 1J90A 4KQJA 4TMKA 3RBXA 4MMYB 1XCJA 5LLTA 4CV3A 3DDWA 1X7GA 5LN1A 1E4YA 4HAXA 4UVHA 4B3HA 2QLFA 5KNCD 2P3SA 3OY7A 1C81A 4PYOA 1PYDA 2N46A 4N5LA 4GQAA 3BXFA 3DOEA 2BGTA 2CJWB 2XKBA 2QTHA 2QQFA 2ZUDA 5AKZA 4E7OA 1T0JB 1NXSA 1VM6A 3L6DA 4OU5A 1USWA 1NF2A 5JXGA 2H4FA 3DZJA 1WUHS 2C3YA 3QQPA 1E5LA 3ANNA 2B5OA 1LQTA 4BP1A 3MGAA 3BSWA 1NJ1A 2CNNA 3HGQA 2QUHA 1EDBA 1SBCA 1FS5A 3C48A 3UAOA 4QASA 3VPHA 1FSZA 4QFCA 3DYBA 1GGFA 3C1TA 3EQ8A 3MGBA 4MJXA 4HFNA 4MV0A 2PJZA 2HIHA 2YXNA 5FPQA 1NF9A 1N8TA 1UBMS 5AW5A 3UV7A 1SCJA 5MGBA 1NAHA 1B0AA 2QJOA 1IULA 3AVPA 4F9FA 1TYBE 2P3QA 4X92A 1O5TA 2J9XB 1VKJA 4UUMA 2M1ZA 5FCDA 5G0SA 3VHLB 4AK9A 2C0PA 3QSYA 4XJVA 3L1UA 1KJWA 4RE5A 1CBUA 4RTSA 1E5QA 4RVNA 3W5CA 1QCYA 2OECA 3ETCA 4HH3C 1C0KA 3U80A 1KRXA 1NDUA 1PHRA 4MHOA 4UW9A 3ASUA 1XB2A 4DLKA 3D8RA 3ROFA 1JHOA 4Y2GA 4AKEA 5HSGA 1GV1A 2C5FA 3I9LA 1IU9A 1U2ZA 3IAAA 2JARA 1LQ2A 3NG1A 4E09A 3Q7QA 3TNJA 3MSXA 1M1YE 1F2VA 5JRZA 3SQXA 2F43A 3DE3X 4NYIQ 3R76A 1RAAA 3O5AA 4BXOA 3PFFA 4S1NA 4YT8A 1OWPA 3G1WA 1AJEA 3HCDA 3TMAA 4C4RA 1VKRA 1TTTA 1ZVKA 4DLWA 4R7ZA 1U6KA 3SZLA 3W2FA 1ZZGA 3TEFA 3UKOA 2G4VA 3T3HA 2D0PB 2G80A 1T2EA 2OCGA 5FH9A 4CE6A 4NC9A 1JA0A 1WSWA 2GRAA 4BJ1A 1FZTA 3UC5A 5G4LA 3T5PA 1UT8A 4RIHA 3UMYA 1FLDA 3D1VA 2ISQA 3GAAA 2ZRDA 3AMVA 1PZHA 4M86A 4CN8A 1YVPA 2DH6A 4UE2A 4CR8A 4WZBA 5H5JA 2V7PA 1AKMA 3HCCA 2E6KA 2IYWA 5JAUA 3H2BA 4ZVNA 4CLHA 2NADA 3C74A 4LF9B 2E3JA 2HA0A 2PLWA 4LGCA 5D00A 2ZLBA 3ESBA 2DAPA 1ZA2A 2GD2A 5THKA 1NI4A 4FPXA 2MMGA 1N3YA 2B37A 3CR7A 4HVAA 1HL3A 3VGJA 3L7KA 4YAKA 1IBRA 3NHYA 5JWRA 1G8AA 1FU4A 2V7TA 3D0QA 3F90A 1ONSA 1Z2NX 3O3MB 4JBWA 4XD7D 3VVBA 4AUNA 2QAGC 1EJBA 2GESA 3V48A 1C7JA 1CJMA 2B9EA 4ROSA 4NAUA 2FDCA 3W7BA 2G67A 2X58A 4HT3B 3FOZA 5K3CA 1X13A 1JAZA 4E31A 5JTTA 3BRWA 4LV5B 3CVOA 4TKMA 1RQLA 1KJQA 1II8B 1FDWA 1T5DX 3GJYA 1W25A 4BU0A 3SZOA 2BSXA 4PLWA 2F8LA 2AI3A 4EO7A 3PRYA 2ZRCA 3I61A 3DEKA 1IPEA 1OVGA 3OPYA 4FOSA 3I1FA 2ST1A 1AQLA 4HGPA 3ZU5A 4R9NA 3L7LA 1NJSA 1VIDA 1B0PA 1BH2A 3VAAA 4E5KA 3ANTA 3S2FA 4M2LA 4A1FA 1Y98A 3CUTA 2FRDC 3SQDA 3U37A 3E9RA 4PLPA 1T10A 3V9PA 3ZY5A 2G4CA 1L5QA 2I5PO 1H2RS 2WSYB 1PT5A 3CZ9A 1XDZA 3RTBA 3RIHA 3AF1A 1I4TD 1LZLA 2WWIA 4N03A 2B4YA 4PANA 4WA7A 2ZTSA 3AFOA 3EUFA 2IEZA 1JE0A 1SHKA 1FU7A 4QQFA 2OB2A 4X41A 1LI5A 5BR1A 1RWKA 3PXXA 1D4ZA 3ESXA 1U2DA 1NC3A 4IM7A 2OV8A 4F5DA 4XM0A 1R5OA 4PGAA 3TOSA 2WFLB 4CUJA 1E64A 1M7BA 1ORDA 3LY9A 1YFJA 3HJBA 2PL1A 5KWIA 4DDWA 1MOZA 4QTXA 3ZGOA 5BV1A 4PBSA 9LDTA 4KHZA 3O8NA 1E2PA 5F77A 2H8KA 1TEVA 3G5MA 3TW8A 1DMSA 1U1IA 4U2BA 1JA1A 3TJZA 3W0LB 2OG2A 2EJUA 4CMBA 4ZCPA 3WGTA 3RS0A 1MRSA 2GOYA 2W2LD 3SIXA 1YTUA 1MVNA 2AOVA 3U31A 1R8SA 1X7YA 4G9GA 1P2DA 2QMYA 4G36A 3ZDAA 4LE2A 4P5EA 1F4PA 1P3Y1 1MC8A 4X63A 2Z5VA 5BQXA 4L16A 4X3OA 2F1KA 3IJEB 3JQGA 2PZJA 5FX2A 1XZ8A 2A7QA 3LDGA 5HW0A 4B0PA 1XWFA 1XDDA 4HI0E 4LC0A 1WF6A 4JQZA 1AN0A 3K8ZA 3AZPA 5AD1A 3LFUA 1G3MA 4ZAYA 1XZFA 1UJBA 1HURA 2HU2A 4DLRA 1SN7A 1I1OA 2G1KA 1EP3B 1M2OA 1W93A 2AX3A 3GMSA 3NX4A 3R20A 2IHZA 3EAGA 2ZTVA 2Q2NA 2GTHA 4LQDA 3ZOKA 4HNUA 5KOJA 4Z7NB 2V7QA 2Z57A 3F5DA 3AV0B 1L1QA 1ZL2A 2JLWA 3DMYA 3FDIA 1XZHA 4KRYA 3AHCA 4HXFB 4WTOA 4IIFA 1UAGA 3UQZA 1I5EA 2M1XA 3GGCA 5B55A 2GJ8A 1W36D 2WWVD 4JDPA 4R4JA 4LRWA 1DG3A 3RSHA 3C45A 1M67A 4R16A 5B3KA 3CNOA 1W19A 4AKGA 1JFVA 4WBNA 4U2CA 3N2IA 4EW2A 3B53X 3CF4A 5AW9A 3IKTA 1DKLA 3RFVA 2I7TA 1K89A 3NIFB 3ZDEA 4BNFA 1DO2A 3HXTA 4LX0A 3IOYA 5FWXA 4BNIA 4ZKDA 3AY6A 4JYZA 5F5LA 3A1SA 5A62A 3B6IA 1SCIA 4HH4A 4OI0A 5FTJA 1EA7A 6PFKA 5JWOA 2HM7A 4GHWA 3KRTA 5AW2A 3ER8A 1DWQA 1PL6A 2M32A 3EZ9A 2PZKA 4R68A 1C4XA 1CY0A 1H4TA 5A1TA 2XBMA 2O8CB 1PWEA 3VH3A 3VPAA 5IYZB 4ZV7A 4WN9B 3DP9A 5CNJA 4C07A 4ETMA 3JQFC 1V8OA 5CT8A 4EHDA 2A3NA 5DK6A 1QKJA 3UAVA 3E35A 3URKA 2JGFA 2W6PA 2JCBA 3E22B 2PV7A 2D06A 1QH0A 5B4VA 1AZWA 4XVUA 4MYSA 2B25A 4C4ZA 1YJAA 2YIJA 3BWCA 2CLFB 4RKFA 3T99A 2LCIA 1GSHA 2O2ZA 3U4MA 1J99A 1OLSB 2XCTB 1SFRA 3PNBA 3OU7A 3AOEA 1RBZA 4XUEA 4BN5A 2ZKLA 5HNKA 3CVXA 3QW4B 1EFCA 1JWBB 3V3KA 4S0XA 4YQFA 1WA5A 2ZBGA 2XCOA 5K51A 3R3JA 1Q16A 3RUIA 5HTOA 2W2KB 5AW6A 2OGZA 1U8UA 2ETVA 5K0NA 5H81A 4OI1A 4OKSA 4YAUA 1I3KA 2Q2VA 4UDOA 1R66A 4KSCA 3QUCA 2SKDA 3AY3A 3B85A 3TB6A 2B5VA 2CLSA 1TT5B 1XCPA 3D8NA 1NRJB 3KOYA 3ADBA 2O5VA 2XOKD 2KYRA 4GXQA 3IBSA 5C8YF 4RKEA 4DA0A 5JFTA 3O2SB 4YQEA 1Z5NA 1IUOA 4QICA 4RFLA 5ALPA 1BVUA 2CD7A 2FUNB 3EEQA 4N18A 3ZXUB 2RGGA 3DYVA 3LPDA 5ALKA 1JPJA 2F59A 1MGOA 1A8PA 2DWUA 4I3HA 5BMVB 3VU0A 1QO7A 4PQEA 1N5KA 2FPOA 3I8SA 4JVOA 1KZGB 1VLLA 1X74A 3FWHA 4MW2A 3B1YA 1Z37A 5JS8A 3GLSA 3KR0A 2ZIVB 3TRDA 1VA5A 2RCYA 1VGQA 4FYJA 2W0SA 4YXWA 1K7SN 4P92A 2FHPA 1Y3DE 5T4BA 3ZS8A 4AF7A 1Z4QA 2W2OA 3DVLA 4F6LA 2FUCA 2FEAA 4DMGA 2II6A 1OH8A 3I0ZA 4WVFA 2ZU6A 5E0OA 5CTJA 4RIIA 3NUZA 3FDZB 5I7AA 1R4ZA 3AVWA 3WYNA 1ND6A 1GYRA 1TQ4A 2FJ0A 2C5GA 3AXTA 4X20B 1NW6A 4FR0A 2A88A 5TARA 2B8JA 4W6QA 1TE2A 1KI1A 3B36A 4I8DA 3U7HB 4WT7A 3A32A 3MT7A 2Q0XA 2JCVA 4Y1RB 3ZGNA 4ZZ3A 3SHTA 4M1SA 2VJKA 3TXXA 1J49A 3GW8A 1C2YA 4GSKA 1BA2A 1DDOA 2C2BA 4AT1A 1OU4A 5DNCA 2VTBA 1OZAA 4JMPA 4ZI7A 4KSBA 2LKCA 3DTVB 1B1AA 2AN4A 4K9NA 4C03A 2O19A 3SDZA 2VTVA 3A0UA 3NAMA 4GZ6A 1E7MA 2ICAA 4LWQA 4I1VA 1D6SA 4OVKA 3RTEA 3PE3A 4GBED 4L0DA 2RGRA 1K5DA 1XTSA 1UXJA 1EVLA 2WYHA 3ABSB 4D8XA 1FVOA 3IXQA 1U0OC 2J9FA 2YNMA 2O2HA 3ZHRA 5L9AA 3KT3A 3TIFA 4MVWA 2GJ9A 1F7VA 5BWLA 4GR4A 3EXHC 1T0BA 1Y8CA 4QD3A 4UXIA 4OQXA 3KT0A 5KWSA 5BT8A 1OT3A 2Q5JA 5DGHA 2MSKA 3CLRD 2D7DA 2YS7A 1FPQA 1YJQA 4I50A 5D3QA 1VI6A 4ZJZA 4JI0B 1Z0FA 3U7QB 2QRKA 4ZZIA 3M4XA 4FYXA 1NE7A 1Z3CA 4TMXA 5EN4A 5GONA 2H0QA 5LP1A 1ONNA 2BY4A 3OOWA 3OTQA 1A8IA 1VL6A 4WZAE 4I19A 1A5SB 3EVBA 1GPMA 1GKUB 1XD2B 3P19A 1KNQA 4L74A 3NHZA 4YT5A 1W36C 3ZZMA 3VKHA 4OIFA 4WESA 4YASA 4Q9DA 1QHSA 3TPZA 1Y4AE 3O8CA 1ULUA 5T57A 1OXSC 4QQNA 2BFDB 1GPDG 2WHYA 2ZBQA 2PT9A 1V35A 5AVVA 1C1XA 5KJ6A 5CLJA 2AS0A 2Y8EA 3GHYA 1AB6A 2WVGA 3K0CC 4IW3B 1GFZA 3GHHA 1C9EA 2HWUA 4RKRA 5LA6F 3T54A 1AS0A 4CG2A 2UUPA 3FRJA 4B2YA 1P7CA 2YQ5A 4L5IA 4QBKA 4BLTA 2AEJA 3O3CA 1H3EA 4QOIA 3ABQB 5I6DA 3DTYA 1ZITA 4HQOA 3PSAA 1QAOA 4ILEA 4RTKA 3OJOA 1MR3F 1KJNA 3V42A 5KCMA 5TY0A 4JXJA 1D4OA 2OHVA 3IDFA 2AFHB 2C3UA 1K6JA 3LQ1A 3ZQUA 1PFWA 2BGRA 5AM2A 2FLWA 1JS1X 4DWWA 2O1EA 2YQZA 2OPHA 4QO8A 1GEGA 3IP6A 5LLSA 4CODB 1CVLA 3QYJA 3EWNA 1DBQA 3CCBA 4RV4A 1IRXA 2PYDA 5ALEA 5C3UA 3WGZA 1MJHA 1USIA 4RX1A 2HFKA 4ZQHA 4DKXA 4FZ5A 1HR0B 4QXRA 5J63A 1GGNA 2RKWA 2VHQA 5EUQB 2FQ1A 3DVRX 2AZTA 1ISMA 2JAHA 3GA5A 2PDAA 2YXPX 1DX9A 2H1OA 3EF0A 3NHBA 3CJQA 1ONPA 1N1MA 5TQ2A 1DFHA 3FJ1A 3GJ3A 3HR7A 1FTYA 3HYNA 4XUDA 2QIPA 2P5SA 4PC6A 2YFYA 4MI6A 1IY1A 3UENA 1WPXA 3WHLA 4A26A 1Y8QA 3BD7A 3NLLA 3OICA 4L57A 3BWVA 5FWNA 3DD5A 4XQ9A 3PTZA 4LPSA 4UNNA 3C97A 1AKNA 2PXHA 2OCDA 5ILQA 1F20A 1UXGA 2EW1A 1C7ZA 4EMUA 2HV9A 1E3EA 2UYCA 2GAFA 2QD5A 3D3NA 4KMSA 1UM8A 2KI5A 2OZLA 1ELOA 2Q5LA 3CKLA 1JILA 4PIPA 4R31A 4YBZA 4F4JA 2O8DA 3AX6A 3IUBA 3LLUA 3H4VA 3ICVA 5I9SA 5I7OA 1NJGA 5DLEA 3LRXA 3DFUA 4TV8F 4IQGA 1XTZA 3T9AA 4CRWB 2P9JA 5FB3A 3BEOA 2NXEA 3KJEA 4IMIB 4PU0A 3ZHVA 4UQLA 2QZSA 1HA3A 1JQBA 3BRSA 4QE3A 4ZOLB 5KNLA 2VRNA 3RABA 9MHTA 4U1RA 3H17A 3F6SA 3HY6A 1JIIA 1NU8A 1L9XA 1U9IC 2UVDA 2ZIAA 2WE8A 2ZJ4A 3UAZA 3ZIDA 4H17A 1SOVA 4H60A 4HRAA 5AH0A 3SC2B 4RY9A 4IOKA 3GVIA 1Q0PA 1J2TA 1XRRA 2GCEA 2NUTB 3FMVA 3J80A 1WHTA 2PL3A 3FR7A 1Z12A 2IPAB 3HVKA 1ZGHA 3INRA 1S2MA 5DN9A 2I7CA 1NI3A 1X92A 3JQRA 4P9NA 3HKCA 1UZMA 1YOVB 1OHHA 1UBKS 1EPUA 3LLCA 4D56A 3EJWA 2OZPA 1JJVA 2O14A 1GNSA 3EIOA 5KVVA 3P9QA 2PVSA 4G5XA 1JDZA 1P81A 1W2HA 1N1EA 2GX6A 3H04A 1EX6A 1DAGA 1DC8A 1TJ5A 3OP1A 4DV7B 3TE7A 4GF5A 4KXLA 4JR2A 4MITA 3K32A 4NKRA 4LSWA 2PZGA 4PPNA 4R6XA 3FUWA 1C3OB 4M1ZA 1NVEA 4G67A 3ZH9B 3PQCA 4ENTA 2O2GA 2POCA 3FW1A 4Q4JA 3UWDA 4WOBA 5C7IO 2JLBA 3LV8A 2J9GA 4Q15A 1NJ5A 4G8DA 4PYQA 1DKQA 4NBWA 4Y2UA 5I4BA 3SIPA 2F1JA 4ZO9A 5KNDA 4OQYA 4R1OA 4RD3A 2GPNA 5LL6P 4LMPA 3ZE0B 3LDHA 4O6VA 3HLKA 5TF4A 2Z3WA 1Z6AA 3UWPA 1DKUA 3ZHXA 1XXHE 1DPFA 2GYYA 1SXGA 4P3PA 2PU7A 2YJ3A 5EXDA 3ZUGA 1BAPA 3PIIA 2YCLA 3EFBA 2GN0A 4M9ZA 1F8YA 4TT3D 1PWHA 3STXA 5JROA 3CLRC 3L8GA 2XQVA 4X24A 1I7SB 2NO6A 3JRWA 2FN3A 1S3SA 3M70A 5E9JA 1QC5A 4Q82A 4P3KA 3BMOA 4LV8B 5ALDA 5I9BA 5EJ8A 5FWDA 1IZZA 4KQMA 3U1BA 2UYYA 3QWIA 4FIZA 2MYPA 1DSSG 5ALWA 1JLLB 4ZYWA 5KJFA 3REFA 5DXFA 1JEYA 3AIOA 1MH1A 4IKPA 1ZMTA 2E4VA 3K0KA 3PENA 1BQ3A 2HGZA 1D2NA 4DA9A 1GXSB 1PYGA 4Q1VA 2BFNA 3D0OA 3OESA 2AH5A 3OZ7A 3T41A 2A1TR 2GERA 4DV1B 4PC3A 3MK31 3KLMX 1BDHA 4NICA 4BDSA 1KEEA 2OO5C 1NXOA 3E3MA 1Q1NA 4WLOA 3OQPA 4B6GA 3OT5A 1GCGA 2BJWA 3M81A 2QRVB 1PUJA 4IEIA 2WAAA 4ESOA 4C21A 1WX1A 4EVIA 4N76A 2X0IA 5EKDA 5L8VA 2C2XA 3D3KA 4ZDJA 1L5GB 13PKA 4D9FA 1FX0A 3GDFA 4FHZA 1JQKA 2RMKA 4IUDS 5GP1A 2XTAA 2VVTA 3EA0A 3OQVA 4JQYA 3L79A 5CNKA 4OSOA 3W6ZA 3X3HA 4U63A 5JY6A 1JSZA 4LQLA 4AO8A 4GP6A 4A2WA 4E3ZA 2R8RA 1CT9A 4YJHA 1A5AB 3DLPX 1IE3A 2E89A 4XGNA 5JO9A 1K7XB 4EX6A 5TQJA 2YN2A 2J6CA 4EIWA 3RKUA 3KUUA 1H6DA 3V6MA 4J29A 2IPLA 3GVHA 3ZH2A 1SUBA 3P0EA 3CRZA 1T9BA 4MB2A 5LIPA 4RHUA 5K8LA 3BD8A 4L9AA 4DV5B 3VVMA 2IYNA 5F78A 3B82A 3FZGA 1NMSA 2R62A 3U62A 2VHCA 1QNLA 5K09A 5FEMA 4ZI3A 3GMIA 3T5AA 4TKUB 2W37A 3TO5A 3W8NA 5CEEA 5JJCA 1MAVA 1XCBA 1XROA 2W6OA 3HDTA 3ICCA 4MUYA 4B5KA 4A91A 4YMWA 4EA7A 4KOAA 4XCVA 3O9VA 4Q1BA 1E1RD 2GFIA 3S1AA 4XI9A 3CZQA 2FZVA 1OX4B 3F5SA 4WXRA 4E4YA 1VHQA 1QLHA 4HXGA 3QU2A 4HVTA 4EA8A 2JK1A 2OSVA 5K6AC 5LNK1 3FTEA 4M8NE 3PUZA 2CL6X 5H59A 4WKGA 3BIWA 4MV4A 5FFMA 4JUAA 5IASA 5JU6A 5DBFA 1EVKA 4OQZA 4KPYA 2CJWA 1D03A 4D4GA 5FLYA 4CM4B 5CA0B 2V1UA 4C5CA 2H29A 5AIBA 1QV9A 2E5FA 4XWOA 5C18A 4Z8XA 3QMPA 1WM1A 1AK1A 621PA 5KKCA 4OCZA 2ZROA 2BFCB 1ZJ6A 4I2VA 3TMYA 2I76A 2B1IA 2PZEA 2Z1NA 3GZNB 4RBNA 4ZDWA 4R2MA 2EDAA 3WI7A 1QONA 3HH8A 3Q1KA 2JZOA 4R3WA 4QT4A 4J7UA 1ND5A 1NBME 2X7JA 3HB9A 2R8EA 3F3MA 1RAIA 3KUDA 3C4VA 4M8SA 1ZD8A 3L4EA 4CV1A 5IJZA 5JCOA 3ZLJA 4DLPA 1DX4A 3H97A 5EC8A 1LSSA 1AGRA 1QNFA 3OE1A 5KVQA 1Q1BA 4EFMA 5IKMA 5KTTA 3QFHA 4E1AA 1FF9A 4RIEA 4OL0A 3RUEA 4A03A 4N41A 1MB3A 4ZT2A 1QU3A 2E21A 2DT8A 1I51A 2RHDA 4RXMA 3NJRA 4OG2A 5FAXA 3RYTC 3TRKA 2W4MA 2NTEA 4UBLA 4NE7A 2NSHA 2CLDX 3A3NA 4FYMA 2AC7A 4X91A 4PG8A 1O4VA 2G5CA 1TVEA 4RYLA 3M33A 3LXUX 1JHAA 3AETB 1YHYA 2YZNA 1LFAA 5J59A 4E6EA 1UIMA 1NBOA 3C5EA 5KYWA 2HR1A 3IEPA 1PR2A 4BKPA 2IYQA 3ZBUA 2I22A 4OOEA 1ISGA 3W2EA 4GC5A 3VR5D 3OIVA 5F7OA 2XGJA 5BQFA 1U7PA 4BNLA 2JGLA 2PKRA 1ZSVA 3Q7RA 1U1CA 3M0EA 1RZRD 2KM1A 2XWSA 2MYUA 4YYZA 4D96A 1GHTA 1EZ1A 4RKWA 2G9QA 1SUPA 3P9ZA 5KQMA 2IYEA 2H00A 1N2XA 1DDIA 3T1YB 3J81k 5KOIA 3I6QA 4DSOA 2BL4A 3IVRA 1F0KA 2C7GA 2JKVA 3BIXA 4P7BA 3RT1A 3IV9A 2XMQA 2XD9A 3C6QA 1E2GA 2PV0A 3DWEX 5JPDA 3PGKA 1XZIA 1R15A 2ID9A 5HRUA 2Y1LA 4LI3X 1EVZA 2OEPA 3AB3A 4RSMA 3D4LA 4L0CA 5C8DA 4JLMA 3V4ZA 8MHTA 5I4IA 5JC1A 1JN0A 1WRBA 3NWOA 3HI6A 4M54A 4M0UA 2VSOA 3TJRA 5I7RA 3SDBA 1S8OA 2CVFA 3CZPA 4RVUA 4PSUA 4RKYA 1J0BA 1IZ0A 3SFVA 3NWBA 2QMQA 4C6TB 1I7NA 2ZWPA 5JZOA 4G0QA 4XLLA 3RU9A 5BXQC 4ALKA 3DMPA 5EZYF 5L7TA 1RI2A 4JVSB 5AESA 2ZI9A 1TCBA 1II8A 1WSBA 3OCCA 1TLTA 4LHSA 4LSZA 5T41A 4HEHA 1KMHB 3KKKA 4X6UA 2DY1A 2Z08A 2V59A 1DUSA 2L17A 4I9GA 3F8TA 2Q5HA 1NW5A 2CZQA 2KLHA 1SKBA 1FRNA 1DRKA 2QRJA 4L02A 4UDXX 5JZBA 1V96A 2H5JA 5CDYA 2DRIA 1LH0A 1NU6A 3AVTA 2XGMA 1KYWA 2BR3A 4EVQA 1CZNA 1RLOA 2EJVA 4RU1A 2IYAA 2NO5A 4Z53A 1A7AA 4HGZA 2CK3D 1VYUA 3F8SA 1JDBB 2ZQYA 3MAJA 1F6BA 1NBEA 1SPBS 2XZTA 5K01A 1NASA 3SYMA 2W00A 3RKSA 3TTXA 1N57A 2GM3A 1THGA 3C7AA 4LYGA 5K6AA 1XLVA 3EAQA 2ID8A 4LOIA 2H11A 3WGJA 2P6OA 3ABIA 1B3BA 2M6RA 3M5CA 1E61A 1HUQA 2D2VA 2VNJA 1Z0SA 1ZCBA 3C6ZA 3CWZA 4NFLA 4QSHA 4D9MA 1KSHA 2IGBA 1XOIA 2Q41A 5KNCH 5FOSA 4PZZA 4YAIA 5IJ9B 4CDNA 1H2XA 4C7KA 5HJ7A 1X42A 5TVGA 1DJNA 2FQQA 2FLKA 2OBYA 3ER6A 3EVAA 4EHIA 2R6GA 5AVSA 3SBEA 3RGWS 3IEKA 1E66A 2BISA 1ECCA 1ZJ4A 3D6JA 4FFLA 3OFVA 4CU2A 2QLBA 2YOHA 4IYJA 4NCAA 1SVKA 1X8KA 1IDN1 1ZLXA 2HF7A 3DZIA 4D97A 4JT4A 3RRFA 1TU0A 1UJNA 4BEJA 4RACA 1HG1A 3DPUA 3RC8A 1AO3A 1J8MF 3CGWA 3EQ9A 2FSPA 2R2AA 1Z8FA 1ULHA 2XX3A 1S8NA 4L4RA 3EOZA 3EVNA 4IV8A 3WNVA 1BSVA 3IBFA 4QBFA 1OLUB 4JLUA 4LA4A 4DRYA 1UKAA 2BC9A 2NUBA 3DAHA 3ELUA 3IPAA 5NLLA 5BQ3A 1M5TA 1L4EA 1RJWA 2ONYA 2I2XB 1QCCA 2X4DA 4KODA 2OCLA 2VNAA 2RC6A 5FBQB 3ZBQA 3HEMA 4GXTA 1GKKA 3JQ9A 3K05A 2HLPA 2AEMA 2WLTA 4KE8A 1FA9A 1MMFB 1SK9A 1S2DA 5PNTA 3V1NA 3DOHA 3T52A 3TAUA 4CF7A 3DTTA 3HG7A 1TMKA 3L0CA 3L7CA 2AOTB 2BTQA 2P4SA 2HCJB 1YIOA 4MUFA 4QTUB 2PZMA 3SSAA 4AULA 3LYHA 2GTPA 3WOHA 5IMBA 2PRZA 5FP0A 4DDVA 3MWYW 3L4JA 3S8EA 3LCUA 3EDYA 3WDLA 2AG5A 2WJ3A 2YQ4A 1OXVA 1R9NA 2B7CA 5CDHA 4JI6B 2GGSA 4IXNA 1YA4A 1FOEB 2C7VA 3SX0A 5AWFC 4CMHA 1H65A 1LNQA 3HBLA 2VDVE 2HY7A 3F67A 1X94A 1ISIA 3C3DA 4GPD1 1JYFA 4URHA 6REQA 4NRDA 1OIVA 1S2NA 1X7DA 3U7JA 3WYEA 5JJIA 3BICA 4HDAA 4MZXA 4OFZA 1T2AA 2Q99A 4OQEA 1ECLA 1LWOA 3C1OA 1C0LA 3WK8A 4K3VA 4FDMA 3SPXA 3IVCA 4YUAA 2HPZA 3LL7A 2ZBPA 5GVSA 3E22A 3COZA 4Q4CA 1W581 1FYVA 2KBEA 1LI4A 1XLTA 4ENSA 4I14A 2IBSA 3V32A 4EPTA 3IA2A 4FYHA 4G0PA 4EB3A 4ITUA 1GN8A 1IQUA 1OLSA 1ORIA 4V24A 2R47A 3WP0A 1QGOA 3AEUB 1DOHA 1QZTA 3RC1A 5EZSA 1AQJA 4B1FA 2CNWD 1SA0B 4OHRA 2X8JA 4TWIA 1DU4A 1HEIA 1GGKA 1E5XA 1I3NA 4YMUA 3OETA 4E5UA 1ENPA 4D1YA 4UNPA 2IHTA 1TC2A 3I0MA 1NNUA 1Q5PA 2EQ5A 3RYHA 3DMGA 3K1YA 4MYRA 1N3IA 4HJXA 1N8KA 3FKSD 4QOSA 1FSFA 1MDBA 4BQRA 4TMFA 3P9CA 5AMXA 3G9XA 4HX9A 5EY5B 1TT5A 2E4XA 1RJ9A 1P18A 4XWTA 5HGXA 2QBYB 3QLVA 4UEWA 4JBHA 4E13A 4F1WA 4OM7A 4FOPA 1A8SA 2A2ZA 2C9OA 3G02A 4CMGA 1QHNA 4IDQA 3WQHA 5BV2P 3EC1A 4UD2A 5HIJA 4Z4HA 3HKDB 2G7ZA 2R6FA 1ADJA 1PR9A 3M34A 4ICIA 2JPDA 1IWBB 3BJEA 3NP9A 2DQYA 3FYTA 2C3MA 3ONDA 4B3GA 1IQRA 3E7XA 2Q62A 8ABPA 3PJRA 4XSHA 4YRDA 5KO2A 4EB0A 3L04A 3CF6R 4EHLA 3VR6A 4I8IA 4G1EB 5EXEA 2F9LA 2G9ZA 2EWWA 4X1IB 5KSPA 3AVUA 2FE1A 2EQBA 3FZQA 3GJXC 4LYHA 2Y4OA 4AECA 4CMIB 3FPCA 2C92A 2P9TA 4UOZA 2K87A 3FDZA 3I09A 1AKQA 2ACVA 3FPEA 3PV0A 2CNDA 4FK8A 4JLDA 3PXGA 4C4XA 4ERXA 4X20A 3LQ4A 4JKYA 1AMNA 4RLHA 3KQYA 2C20A 4YYEA 4OPMA 4QBHA 3F47A 2RKBA 2PEYA 3UW3A 1SURA 2O3RA 4Y1RA 1ETUA 1H3NA 3VYUB 3S44A 2RGNC 3K09A 1FNMA 3I5UA 4C7VA 1HORA 2FVXA 4MV5A 1PDOA 2RAVA 2ZJFA 2YMLA 4WBNF 4Z4FA 5KEIA 2Z4SA 3DTVA 4MYCA 3E9DA 3I32A 4I3FA 1ZOIA 2H9IA 1G9XA 2CFCA 3ESYA 5CW1A 1QHEA 3D5QA 1EVQA 1P75A 3GZTB 1GAQA 3N0VA 2PH7A 4TS9A 4UJ5A 2PBZA 4GI5A 4RCVA 4D0NA 3K71B 1P0QA 3DGFC 3IOMA 3LT1A 4HMQA 4HXYA 4PRKA 4N8SA 4X7PA 2IBTA 3HB0A 5DHTA 4QGSA 2FWNA 4J2OA 2GASA 3FOCA 4MQBA 4KMOA 4UEOA