3NOVA

Crystal structure of d17e isocyanide hydratase from pseudomonas fluorescens
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
230
structure length
230
Chain Sequence
GSHMAVQIGFLLFPEVQQLELTGPHDVLASLPDVQVHLIWKEPGPVVASSGLVLQATTSFADCPPLDVICIPGGTGVGALMEDPQALAFIRQQAARARYVTSVCTGSLVLGAAGLLQGKRATTHWAYHELLAPLGAIPVHERVVRDGNLLTGGGITAGIDFALTLAAELFDAATAQRVQLQLEYAPAPPFNAGSPDTAPASVVQQARQRAADSLHKRREITLRAAARLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ThiJ/PfpI family protein
publication title Evolution of New Enzymatic Function by Structural Modulation of Cysteine Reactivity in Pseudomonas fluorescens Isocyanide Hydratase.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 78
structure length 230
sequence length 230
ec nomenclature ec 4.2.1.103: Cyclohexyl-isocyanide hydratase.
pdb deposition date 2010-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3novA00
5SYAA 3UOWA 3P9RA 4BIMA 1L9XA 2GK3A 3P9PA 4L7QA 4N12A 4P36A 3ZJ4A 2OR3A 2YWBA 3F5DA 4S0ZA 4Y1RA 1SOAA 4WINA 4ENSA 4ZDIA 3R75A 3RHTA 1FY2A 4OGFA 1QWSA 3R74A 3TTWA 3M3PA 1CS0B 1T36B 2WJZB 1P81A 1P80A 4UNIA 5K4AA 4B7AA 3SOZA 4B40A 3NOVA 4L8YA 4LGYA 1OY1A 2IUFA 2A9VA 1PE0A 2XF2A 1GG9A 4XLLA 4AUMA 1A9XB 4Y1RB 5BV2P 4RKWA 4Y1FA 1I1QB 4ENRA 1PDWA 1VCNA 2ZUSA 4RKYA 5IP5A 3ZJ5A 4I2NA 1GPMA 1N57A 2R1TA 1VHQA 4L95C 3TQIA 2FEXA 3BWEA 3TTYA 1I7SB 3BHNA 1R9GA 1ONSA 4UZSA 3GRAA 2VPIA 1KWKA 3MGKA 3CYFA 4PXYA 3WFZA 2ABWA 3FIJA 4ADSG 3UMMA 3TTUA 2R1VA 3TTTA 2VKTA 3L3BA 4ENUA 3TTVA 3SF8A 1GGKA 1GGEA 3PQ6A 4WXYB 4P5PA 3NOQA 2R1TB 4AJ9A 4GE3A 2RK3A 4ZDJA 4B5KA 3CZAA 1QVWA 4GE0A 3N7TA 4LRUA 4E5VA 4ZDKA 5JZOA 2ISSD 3UJNA 1M6VB 3PQ8A 1T0BA 2VDJA 2D7JA 4MNTA 4UCFA 3B38A 2ZUUA 1CE8B 1UCFA 4K2HA 3PQ4A 1IPHA 1IZZA 1P7ZA 1Q7RA 2R1VB 1VCMA 2H2WA 2LXNA 3FSEA 4QYXA 4BTEA 3B3AA 3PQ7A 4MTCA 4HCJA 3SF8B 2ZUVA 4P2GA 3MIIA 4L8FA 1S1MA 2GHRA 1Q2UA 3L4EA 4ENTA 1OX5A 4B31A 1OI4A 3EZGA 3NORA 3B36A 3CZ9A 1C30B 4P35A 1BXRB 2VXOA 4JQSA 4OJYA 4OIFA 5SY9A 3ZR4B 4OGGA 4AUNA 4Y0NA 3EN0A 3NONA 2VRNA 1PV2A 1VCOA 1PDVA 3ER6A 3P9SA 3PQ3A 4OFWA 5E9AA 1P7YA 3KKLA 3L7NA 2R1UA 4MGHA 3VU3A 4BFLA 1G2IA 2AB0A 3PQ5A 1GGHA 4OQ4A 3L18A 5SY6A 1KWGA 1O1YA 4ENPA 3TTSA 4E08A 2AD5A 2RK6A 1GGJA 3TTXA 2YWCA 3EFEA 1OX4A 1QDLB 2V4UA 3UK7A 2YWJA 4Y1EA 1JDBC 4QYTA 2NV2B 1I7QB 3F71A 3UGJA 1GPWB 2ZUWA 1IZYA 3CY6A 4ENQA 4B2YA 1KXJA 4I4NA 1OX6A 3EJ6A 1JVNA 4D1YA 5LIRA 1FYEA 3D54D 4L78A 2ZUTA 1U9CA 2NV0A 3NVAA 5JZMA 4UOZA 3OT1A 1KEEB 2RK4A 1J42A 3CNEA 4L8WB 4N0MA 4UOQA 4AUEA 3P9QA 1K9VF 3PQ2A 5SY4A 1OX4B 4ENWA 1QVZA 3EWNA 4ENVA 4GUDA 1SY7A 1WL8A 3R76A 1T3TA 4AULA 1QVVA 4ZGGA 1P5FA 4R7GA 1KA9H 1QF7A 2W7TA 3NOOA 2YWDA 4P34A 1C3OB 5DFAA 1GGFA 4I46A 4Y1GA 3OT1B 1CF9A
chains in the Genus database with same CATH superfamily
3PHIA 2HA5A 4Q19A 4QDOA 1I3CA 5CK5A 2R1ZA 3VYUB 2FR8C 2XVZA 1W4CA 2QPLA 1B15A 3TFOA 1U0NA 3DFKA 3NUQA 5HF5A 3U7JA 1XIVA 3IT3A 1QYWA 1XDUA 1Z0ZA 5KX5F 2HCJB 2DR2A 1NVXQ 5EEGA 5THXA 1KOGA 3T7CA 1Y8RA 2FG7C 3FTDA 3HPQA 3RHZA 4A1OA 2XYHA 1ZNZA 2CXPA 1MJFA 1T6XA 1V7ZA 3TAXA 5KQGA 1GCOA 1NMZA 4X7PA 4EABA 3ENNA 1A96A 2J3JA 3KCQA 1IAQA 4OLJA 3B8HA 3H1FA 4I19A 4QIHA 1ZN8A 2JKVA 4E13A 3GLGB 1DBIA 5PNTA 3EXEB 3BXEA 4R2KA 4BVEA 1NBOA 1C50A 1MG0A 2DPXA 1CERA 3W7BA 3SSOA 1YWGO 5AQ1A 4DRZA 5I9TA 5KREA 1NW9B 4ID3A 1EFDN 3CLVA 5FBHA 3WZ2A 1BOFA 1H2BA 1BVHA 4HZGA 1EA5A 5FA6A 1T8PA 5BRNA 2HO4A 2MYNA 2I0FA 5E1MA 2E7ZA 2V7BA 2MSNA 2A0XA 4OJKA 4QVKA 4UM9D 5FUXA 1YC2A 2GPSA 1OXVA 4L4RA 4R2IA 5FTMA 3Q85A 3GRPA 3S2IA 4O2LA 5LP6A 4FM9A 3DHVA 2GEKA 1XC7A 3D8SA 4UC0A 4UD2A 3RNOA 2QNRA 4GRIA 1DJPA 4QGSA 3E0QA 1WKBA 4B0PA 4NOLA 5DNEA 3QI2A 4TV9B 4Y2UA 3X0DA 1GAQA 2B82A 4J1TA 1R4AA 4KRYA 4K2HA 1Z7BA 4IRMA 1NNSA 4O1IA 3M83A 3E1KA 2BMAA 1AC5A 4ZOBA 3Q3EA 3KYDA 5HILA 3P32A 5A03A 1QO9A 4I50F 1CR2A 4FLMA 4QHTA 3A10A 5KMGA 1T6NA 3HFJA 1DELA 3OH8A 5EWLA 3IYLW 4DVGA 4NS4A 4J7AA 4DUZB 1G8MA 2PMWB 3DR5A 3QXSA 2UZ0A 1ISFA 4M99A 1WABA 1TMGE 3TKAA 2QORA 2ZYWX 3T7JA 4PPGA 3BWVA 3UMJA 3HYTA 3OQVA 1RVV1 1G6Q1 3HKBA 1FP4B 1R5NA 3GLRA 1CY1A 1OFGA 1ZK2A 2EQAA 2OEPA 1SH7A 3LXUX 1ISPA 1PTJC 2O2SA 4M0CA 4R1UA 5F7JA 3W6PA 2ZUFA 4C6SA 4DV6B 2I1QA 2QMUA 3NWOA 1M7HA 1I3MA 4AK9A 3D59A 4DWJA 3K0FB 1S2NA 5ITZB 3HB5X 1XR3A 1GN9A 3ZD6A 3BSWA 2N47A 3KV3O 2KE5A 3WIBA 4JWTA 4BNZA 3WKEA 2JZCA 4FEAA 1XD8A 2FVXA 5ESDA 5HBGA 3Q3IA 3RT1A 3TCXB 1OD6A 3TTXA 4UARA 1DQSA 4MLPA 4DC1A 4NBVA 2FKAA 4TS3A 1MABB 1RC0A 4M1TA 1BWRA 3GEPA 2HMYB 3KQQA 4DCNA 9MHTA 1A8SA 2ONYA 2XOKA 4OQPA 4MS4B 3ZDQA 1SVNA 3KU4A 1TCVA 3F1KA 3ZE6A 1T8UA 4HQLA 2O07A 2P77A 3BL8A 1U8UA 3TLCA 3WWYA 2P2SA 1HLDA 3GOQA 2HFJA 4I9FA 4RACA 4AG6A 5A4IS 1W75A 4MZXA 4PGAA 5CR9A 1WZNA 3SHQA 3CW9A 1UMDA 2G0AA 2MT9A 2QLFA 3ZU6A 2YOHA 2O3TA 1X1SA 4H7HA 4R1NA 4UOEA 5KPDA 3NDBB 3RSCA 4ZCTA 4Y2QA 5IKPA 1KQFA 4MR8B 4YRSA 2F1JA 2H59A 3AHEA 1S9HA 4TTPA 3KUCA 5I5GA 1BYIA 4NIMA 1SVMA 1XHFA 4HLQB 1Z4LA 4XA8A 4GPIB 1Y1PA 1G8FA 2C3YA 4MPJA 1D0SA 3SM3A 4DBLE 1STOA 1RR6A 3U7QB 2NWQA 4FP9A 4ZI2A 3A1FA 3BHJA 3QHQA 2MINB 4WKNA 1ZUIA 5K1ZA 3V9AA 4PN3A 4IDAA 4KUHA 3ISTA 5CDTA 5AFSA 5EJ9A 4KFRA 2BHRA 1SXHA 3EAFA 4ZGWA 3GPBA 5KWIA 5IASA 3GLUA 3AKZA 4E5UA 1IHDA 3OA0A 1T36B 1YZTA 4Y9RA 3G2MA 1S7CA 5REQA 2EERA 16PKA 4NOKA 4Z3OA 4AJKA 4F2GA 1KPHA 3DW3X 2P4UA 2VEOA 4K8OA 2NVWA 5HXAA 4LF4B 2Q2NA 3HR8A 2RH4A 1Z4NA 3DT8A 2PWYA 4NAUA 1GV1A 3GN1A 3KXKA 1WUKS 3U3DA 4D9NA 1Y1QA 3ANMA 4M37A 4F9TA 3ZJVA 3P0EA 2FZ5A 4EVSA 5BQXA 2GDZA 1SOUA 2M9MA 1P1JA 3F49S 3N5CA 1EVYA 2Q5OA 2CYBA 4OQFA 1YMUA 5FTWA 4RAOA 1ZP6A 2OZEA 3JRWA 3W9SA 2ABWA 1DZIA 5FKJA 2AJDA 4BQRA 5T6MA 3RFVA 1ZVMA 3P97A 4EVIA 3L6DA 3UK0A 1XZJA 2PLFA 4A1FA 3RYHA 5CBPA 3BK1A 1FJXA 1V3VA 1U7OA 2Q07A 3FR7A 1O9HA 1TLTA 1YAJA 2WEKA 2V6GA 3SIWA 3CEAA 4RVSA 5L51A 3CWZA 3V4RA 5JFGA 4QXRA 5EIHA 3CWCA 4PYRA 4S1OA 3SJBA 1J90A 3GC6A 2VBIA 1TKAA 1U0JA 1D4OA 1HV8A 2OL4A 3R3JA 4HWTA 4IQ0A 4F1KA 3BERA 3P2EA 3ZLUA 5CD9A 1KBZA 1P3JA 5AKGA 3OTHA 1NUUA 3FZGA 4LJKA 4HH4A 3FMVA 3DE5X 4IDDA 1ST3A 2VPYA 3LV8A 4KI0A 4QJ4A 2ZKLA 2CNWA 4RD1A 4KDCA 2CB0A 1JFSA 1DAKA 2E4ZA 1WZEA 4LDAA 2HBYA 3C3XA 3TM5A 4QXMA 1W0JD 2V9PA 1CIJA 4DUPA 5EZSA 1VLMA 4R41A 3HCDA 4O0LA 3N2YA 3VHXA 3PP8A 5EP3A 5KNDD 1NY5A 5KQSA 1NG1A 1DIRA 1MT0A 3IEUA 1UDRA 1AX9A 3N87A 3F5MA 5J40A 3Q9NA 4ALMA 3GA5A 1ZH2A 2AG6A 4MW9A 5JBNA 2EF0A 4OJNA 3KWFA 5KSPA 5LBTA 1YS2X 4N3BA 5H59A 2QP4A 5TY0A 3VUFA 1EP9A 4RKFA 1JFFB 2EDCA 2XB9A 1UDBA 4LNUB 2A0YA 3W9YA 3M9WA 4RCVA 2AIRA 1XN1A 4HGQA 3TPCA 3VR3D 1OVMA 4EY8A 4P92A 3IQFA 1YH3A 3KB6A 1GUFA 1EFVA 4I4NA 2JD2A 1G42A 2F9LA 2PR7A 3DNPA 3OEEA 3HP1A 1F51E 1Z3CA 4RQBA 4EHIA 3K35A 4HX2A 4Q3DA 2YZ7A 5FL3A 4F3RA 3BGWA 2DFKB 1ICEA 2ZS9A 3VU9A 1F5SA 3HCFA 3ZS9A 2QBYA 5AVQA 4CEIB 5K8TA 2J0EA 1DJOA 3V8EA 3B3FA 2O2XA 3AR9A 3KWJA 2CLOB 5J1SB 3FPJA 5TGDA 2QKYA 4QUHA 2FGKA 1GGFA 4Q7MB 2NZXA 4TMVA 5IH7A 3UMFA 5IEJA 1UJBA 3KOMA 1PR3A 2LW7A 3K8OE 1L5OA 1HLPA 1XMIA 2IHJA 2E5WA 2FRVA 1QRAA 4EPXA 1LA2A 1KMHB 1ZJ6A 2X1HA 7REQA 2HIMA 3WL8A 4B6RA 1R5BA 4LHWA 4RZ2A 1JB1A 3EEYA 3TFWA 1JQLB 3JD4A 1M73E 4M0DA 4Q6WA 3VFDA 4WQMA 3GLIA 4CKBA 2JVIA 3EDMA 3OY7A 1U9IA 1KAHA 1TUEA 2WT8A 3T9FA 1B6GA 1L7VC 4JQOA 5DO9A 5LLTA 2O3SA 4NH0A 4Z0NA 3E23A 4Y1RB 2A5GA 4YRRA 2CUKA 4CQJA 2FW6A 1XTQA 2V55B 1FFBA 4GF5A 2XTAA 5EVJA 1NXQA 1CLUA 3OEWA 2C58A 2CE7A 4RVHA 2Z1NA 5JS1A 1O5IA 3BHNA 3RS8A 4ZN6A 3FPBA 2X5OA 4OIMA 5CPFA 4KPYA 3HKCA 5JCJD 4BDSA 2EHJA 3QLTA 2IS6A 3H16A 4GPTA 5JALA 1B3BA 2FX5A 2V7PA 2A0UA 2J5KA 4U6NA 3CUVA 2B35A 2H08A 3QX3A 2WMNB 3KE9A 4I3FA 3FCUB 3DKRA 3KU1A 1JLLB 3NXKA 4FOTA 4A23A 1SCIA 2VSQA 4YRTA 5FTKA 1P8AA 4MWSA 1H22A 3GZNA 1C0LA 4NLLA 5AI9A 3B52X 2XOEA 3HJBA 2QX7A 2PJUA 3NKVA 3ROKA 3INYA 3U4IA 2CL5A 1LD3A 1UBTS 4P81A 4C0AC 5DJ5A 2D0IA 4LOLA 3TDMA 2GKGA 4WL0A 4UXIA 2ZYSA 3PFFA 3SYTA 4UHEA 2A5FA 4LE0A 3JVIA 1QOZA 4IH1A 4KQEA 1FS6A 4U6SA 2XWBF 1O2DA 1VL0A 5HBRA 4C7OA 3TQSA 1QLHA 1RP7A 3WKAA 1G6OA 3R3ZA 2O0HA 1TYZA 2PT7A 1JDJA 3JQCA 3T34A 1G8JA 1OASA 3GCDA 1LC3A 5B4VA 2QRGA 5FBZA 2XDQA 3I5UA 1A95A 5E9AA 1RWPA 2QX9A 5C7YA 3QEBZ 4O4HB 3RVBA 3NC0C 1CJBA 3D7RA 3MPOA 5ALYA 2R85A 2EYQA 5G4KB 3ONNA 1OH7A 2Y4OA 2PXAA 4FXPA 3RUHA 1IBKB 4RD4A 3UY4A 4NBSA 2NV2B 4FCCA 3MGCA 1VLJA 3KYCB 4YJ3F 1O0CA 1IXKA 1G66A 3OZFA 1W5SA 1WDLA 4GAEA 2H8GA 2G5TA 5BUCA 2IZ6A 3OIWA 3D54D 2UXBB 1QR2A 3D3KA 3QU7A 4JR1A 3EVTA 2AR9A 3OCWA 2IUUA 3AUYA 2HLHA 1P0CA 2FEOA 3CPSA 1K9VF 2CNKA 2HMVA 2HQSA 2JJMA 2YN4A 4EJSB 2J3IA 5C34B 1JA9A 1JQBA 2RGCA 3G5UA 4BE7B 4E51A 1NU6A 4REQA 1O97C 3LCRA 4F4FA 1CX9B 4CUZA 5JR3A 2QRKA 4U7WA 3A9SA 5K01A 1E1KA 3EY4A 4PCLA 2XNKA 3U3JA 4FN4A 3WLLA 2FZEA 1CEQA 4GT1A 1FTNA 2CVPA 4PQRA 3RTAA 3ZHTA 5F5NA 4C5BA 5KOHB 4BE4A 2J9YB 4EKDA 2NP6A 4B45A 2GVDC 4HDQB 3EVBA 1YS1X 3DZGA 4BO2A 5LB4A 1DBRA 4DIMA 4LXHA 5GTDA 2UZ1A 1QWSA 3SDBA 4BVLA 2R4QA 1J2JA 3VPBA 3VKWA 3WWOA 4CL0A 4LFBB 5TQJA 5ERYA 3UM9A 1IBLB 4GBED 1QYIA 3U48A 4FEGA 4Q1CA 5ALSA 3FVWA 4EKIA 1G0OA 1BHSA 1P74A 2YYYA 3DMTC 1RE1A 3FDJA 3MTQA 4GMKA 4ZHQA 2HLNA 2ZZMA 1B0AA 1FBTA 1UFOA 5DNWA 4FE3A 4J0EA 3SXUA 3ASZA 4B3HA 3KRTA 4DLBA 2CHGA 4RD3A 1KH3A 1GA1A 3BWEA 2BBSA 1I7SB 1FRZA 1IXYA 4LBZA 1CUAA 2HK7A 4H7FA 2VG8A 3PC8C 2ZEJA 4FYPA 4W7HA 2I9KA 3EPKA 2IH2A 1PSDA 2W6IA 4MWBA 1XVAA 1M2FA 1J23A 5CEFA 1B41A 2JFWA 1RM0A 4KAJA 4NCHA 3OJWA 3OX2A 4N5MA 1AZWA 1Y33E 6AT1A 2FLWA 4PE5B 3Q41A 5EQFA 5FFMA 1IJBA 1QRSA 4AG3A 4H1HA 1W76A 3ADKA 5G1OA 3SVZA 3AR8A 3L43A 5GJWC 3I2FA 3L79A 1WVIA 4N9QA 4K6FA 2IKSA 3LVFO 4MGZR 1F8FA 3ZU3A 2YZ2A 5BO5A 1ZO8A 1E5TA 3DW1X 2K7ZA 3QPCA 1ESMA 1RU3A 3N2KA 3RBZA 3BF8A 3QJYA 1WD7A 2ZU6A 5KAMA 3RBAA 3TOSA 3TOZA 4BKMA 1BVRA 3KVOA 2W00A 5EIOA 1RRGA 2CFTA 2O5EA 1YB6A 2QTVA 1UAGA 1ORTA 4G1UC 3W04A 3DV0B 4P80A 4BATA 5FWYB 1UANA 5CH8A 1E3EA 1RCUA 4ZCPA 3EXIB 1N2HA 1PFQA 3TRDA 1OXBB 1V6AA 4BP9A 4PNEA 1UBMS 3KKMA 1M1YA 3U62A 5ULLA 2V7TA 4YP0A 5JBIA 3RE1A 4WVLA 2X4IA 4ZMBA 4LXQA 2CXTA 4Y7CA 5DTIA 3ZJYA 2HSZA 4PLVA 5I7OA 1YCFA 1SBNE 3H5RA 1PR6A 3GLFE 2O05A 2QQEA 1RZRD 5HCIA 3CF0A 4PAQA 4DIFA 1KYVA 4N01A 4V24A 1JUDA 4RPLA 3R5FA 4RS4A 2GPNA 3HHEA 5D2CA 3TYXA 3JALB 3EF0A 4MR9A 1PQWA 4EFMA 5CLGA 1LPAB 1GSAA 1ZKMA 1ZK4A 5GV7A 2C7PA 1TTHA 2JNWA 4L5CA 4Y2YA 4LOAA 3R9XB 2Q0SA 3NVAA 5BVGB 5JZMA 1I51A 2GBLA 5LYJB 1A5SB 4WA8A 4AUEA 2GF0A 3QPUA 4R9NA 3HRHA 5KNDH 1JHZA 2H0AA 4JLOA 3EQ9A 1I5RA 1D09A 3T4PA 5HKOA 3NM5A 2ZVDA 3NETA 3RFFA 3ZNOA 1T8WA 1DCFA 4AKEA 1QRUA 1PJSA 4DCOA 1DFHA 4OHOA 4YJ2B 1T15A 2CBGA 1OWOA 2HAEA 2R3SA 2VWPA 4BNXA 1U2GA 2RHDA 4NBTA 3GELA 1FDVA 4OK6A 2Q2WA 4B7UA 3LQYA 3OTIA 4V0KA 1V16B 3JCZA 4YAFA 5LBUA 4Z7NB 3TBFA 3KXPA 4E4TA 1J06A 3O82A 1F17A 4TKVB 1E8DA 4BRZA 1W85A 3O95A 4H7EA 1CS0B 1UPUA 2BUBA 2NSDA 4G5OA 4G1MB 1F3LA 3MERA 4YRDA 3WO1A 2WQ6A 5KTMA 4XYBA 4BJ6A 3NRCA 1DO8A 2AFHB 3I1JA 3JYHA 4M8KA 4BQOA 3VPFA 4URVR 4U0KA 3SE0A 3ZBTA 1E2MA 1KHTA 1OZHA 4A16A 4TN1A 4MVYA 2AK2A 4UTPA 3PLRA 2VXYA 2GRJA 3EG9A 5K2OA 2FQWA 2N0SA 2JGMA 1F4VA 3O8LA 4G5SA 4HB3A 4X3OA 1JJVA 1JDNA 2XXAA 5LKRA 3RTBA 4HQOA 3BWMA 1IM5A 3BYZA 4O1HA 1K6XA 2BTQB 3WFZA 3W8DA 1NLMA 3DJYA 3HXLA 3OPNA 5AKKA 3I45A 2WIDA 2Y05A 4HUJA 4YIKA 3VC7A 4G24A 5AM3A 4IPTA 4C78A 2HL6A 2ZTUA 2I4RA 3BRSA 4DQUA 4KO8A 2WU3A 3WYDA 1F0YA 2OFWA 4N3GA 3B5IA 4AXBA 4IF6A 2HPZA 2GBGA 2CNOA 5IAGA 1RLJA 3PRJA 4UPDA 2PKYX 1T8RA 4WH0A 3SDZA 4URYR 1GTJ1 3O1HB 4Q1BA 2B9EA 3A6JA 4OQMA 1RLUA 3AETB 4LDJA 2J5BA 2CNBA 3NHAA 5FA8A 2PRKA 4MUFA 1T9GR 1C4XA 4GOKA 4L8FA 4I6EA 1E6MA 4GQIA 4PBSA 2CSUA 3RV4A 1H4QA 1YK1A 1VGQA 4ENTA 3AR6A 2C5SA 2HWXA 1JDUA 1ZS9A 1HTBA 1FU7A 3Q1KA 5K20A 2G5GX 4PZEA 4RWZA 2ORIA 1GZ5A 2C83A 1JLRA 4GM1A 3BJEA 5GZ6A 5A5VA 4G9BA 4WKPA 1AQIA 1P91A 2G5CA 4CLOA 2XGJA 4YRMA 5KTSA 1GLNA 2XCUA 2H2IA 4TRNA 3TH5A 1ZAYA 2PMBA 3T3HA 1ISSA 1NQTA 3NEJA 1U9YA 2O8EB 2BSAA 3ASUA 3A6EA 3LYAA 3GVCA 4JYBA 3NVKI 3P4UA 2IP4A 2ZITA 1RJ9B 3IAUA 2OZVA 1K1EA 3W9BA 2Q21A 2JFNA 2PT5A 1OJ7A 3UYKA 5K3OA 2IIBA 2K7FA 1NJSA 3FB4A 2PMCA 3OKPA 5DYIA 2NIPA 4B6PA 3Q5DA 1Y37A 4LHVA 2JH3A 1WCIA 3PTLA 3ITDA 3FPGA 1JIKA 4NBWA 4R8VA 3HSKA 2FAXA 2JG3A 3A4VA 1B7GO 2CJWB 5DYNA 2UYYA 4DYVA 3G0BA 3SICE 4K05A 1QP0A 3W2GA 4D99A 4TQGA 4BZXA 1PKXA 3SSNA 3KPWA 2G28A 2X4LA 3WA7A 3R6TA 3VVMA 2J3QA 5H68A 4LF8B 3IVCA 1V96A 2ZK7A 1JAYA 2GSWA 1E9SA 2XUDA 2C9CA 2HSJA 3TUJC 4RS3A 2XVMA 3LI2A 1TJNA 3G1WA 4TWZA 4EELA 4M6WB 3O31A 4Z49A 2X4GA 3EODA 1I4OA 1D1SA 1V9SA 1Z39A 1EUDA 4W1SA 1Y3IA 2Z57A 3IOBA 2QJFA 4X1YB 2AX3A 4RGBA 4CM5A 3OPMA 1T2AA 3U3MA 4BJ1A 2VZLA 2VJPA 3MB5A 4MRMB 2NO7A 4ARAA 1M5RA 1J9GA 1M2GA 4UEOA 4F06A 4C1BA 2ZJ6A 3R3YA 3C6QA 5DM4A 3NBZC 1C7JA 4YMIA 2HHAA 4WHMA 2GZSA 4ZO8A 1E0AA 4F3KA 2I91A 1CZKA 2LIPA 2A6PA 2F3SA 3SQWA 2HNKA 3DBLB 5GZ1A 4IZIA 4N03A 2I2WA 2XKBA 3KJZA 1XMXA 1H8EA 5DOVA 5ED4A 1PFKA 4ALKA 2VYND 5J4YA 1Y4AE 3A3PA 3C6KA 2QN7A 1NBEA 2V7QA 2HNAA 3THRA 5JLJA 4RW0A 3E6AA 3NIGB 2Z5LA 4R84A 2H2DA 1K66A 3QUQA 4CMAA 1ZDMA 4ADSG 5CYPA 2ADMA 1J2RA 3DOIA 1NX9A 3PVSA 2X58A 1W4LA 3D6HA 1WQ3A 1Y1KE 1RTKA 3SSMA 4KX3A 1BCSA 1UH5A 5AK0A 3X2EA 4X41A 2FFHA 2HQBA 3WDKA 4CG0A 5JBQA 2OC9A 5BV1A 2YIMA 3GJTA 1DLIA 1N2SA 3N76A 4LDPA 4FFMA 4DA0A 2F8SA 1LPSA 3BE4A 3MXOA 4DDUA 4JJZA 3KJXA 3QYPA 1E5XA 2BL4A 3OMWA 4G9GA 5JPDA 2IOHA 3HC7A 3NZEA 4UVDA 1FCJA 1XFDA 2AUTA 1S3GA 2ZI5A 4YFVA 1GNRA 5F2NA 3BH6A 3OESA 1XKTA 2ZJBA 2P4EA 4KO1S 3SYLA 1U0TA 2WA1A 3W79A 4Y2GA 3NHWA 3P20A 1M34E 4MV4A 3WLJA 1ZRMA 1Z4KA 4KN9S 4BO6A 4PTLA 2W0SA 1MX5A 1U1GA 2MJLA 2RHMA 3HEBA 3IPAA 3QEMB 1WG8A 3QXCA 2D5LA 4MITA 1SG9A 4INPA 4LJAA 1SBHA 4KR0A 3DONA 4WMLA 4QL3A 4DLKA 3T5AA 1W1UA 2OG2A 1DRKA 1JHAA 2KPOA 4RMHA 2CEKA 5GV8A 3UT6A 3TX2A 2YCLA 2DM6A 1II8B 2HDHA 5ALQA 1QXSA 1WF6A 4FJ1A 4XASA 2MSWA 2X8JB 2JIRA 3DDCA 3F7NA 4B4KA 1DJQA 1GKUB 5EL0A 1N2EA 3SR3A 4UBOA 1ADYA 1ZA1A 1EGMB 1G6HA 1SHLA 2QG9A 3B2QA 3C98A 3KAKA 3WIDA 2ZUWA 4HQRA 3K0EA 1MD9A 3KR1A 3EJ6A 3RVLA 2G9UA 2NTYC 2X40A 4FE7A 4JJ6A 1L6RA 2D2FA 2DFPA 5I7VA 3NT2A 1A9PA 3T7DA 3HVIA 3K72B 1XRJA 3Q9SA 4MQ6A 2VJMB 4GI2A 4P84A 2Z5VA 4HSEA 1THMA 2KM1A 3BGIA 3UUFA 4DHWA 4BXOA 1VYTA 1DL5A 2OILA 4FGZA 4F6RA 3MFQA 2QN2A 3BSSA 4EY7A 3JQFA 1UL1X 5JXGA 1YQXA 1P77A 3DMTA 2PZKA 3GRYA 5IWCA 3ZVKA 1MC5A 1W4BA 4B4DA 1UZNA 2GESA 2HSDA 2I22A 3LQ1A 4KN5A 3ZE0B 5BUSA 1N7JA 1ZD1A 3STHA 621PA 3W4IA 1FYVA 3ZCUA 5IJ0B 5E1DA 4CHTA 4LY3A 1TK3A 4U7TB 1IY0A 3VZCA 4C87A 3HZOA 1R4MA 6REQA 3GZJA 3HWWA 4WLNA 1X7WA 5EESA 4EECA 1FNNA 5IZCC 1JQDA 4U2EA 4DMCA 2Z4SA 5G2OA 1FMTA 3TRHA 2RHLA 1RYDA 4II3A 2I6FA 5F64A 4C0KA 3KV1A 4ETIA 5DT2A 4LZNA 3MW8A 3ZK7A 2RHRA 1M34B 5D86A 2XH8A 3TNDA 2AOVA 4ZQIA 3GV0A 3TL6A 4KQXA 4P82A 3P5BA 2VZ8A 1GPNA 3VGPA 4DLPA 1CVRA 1WMFA 1XCBA 2TS1A 4UHBA 4YJGA 1OYOA 3RKSA 4CV2A 3QKTA 1ZD4A 1NQ5A 1B8OA 5DBIA 4P1ZA 4QU9A 1OI7A 1GPMA 1JW9B 1OHHA 1QH8B 3L92A 3WFJA 2G9NA 1L0BA 5KVVA 4V02A 4UU7A 1NQOA 1BXGA 5IDWA 1BW9B 3RUFA 3V55A 1DT3A 4HVCA 4XCVA 4Y2RA 5C81A 3LLSA 1XRQA 1MLDA 4QBKA 5DISB 1TI7A 5IK2D 2WSIA 4BNJA 1UMCB 1WB4A 4JLBA 5I7AA 3IKLA 4FC6A 3HJRA 4GFDA 3Q15C 3MOSA 3SEFA 2QTCA 5TLSA 1ID1A 5IDYA 3PRKE 2C7BA 1TQDA 5JZOA 5TDHA 3EYAA 5KWJA 2G40A 2XZDA 1HEYA 5CM9C 3W2TA 3SQXA 5BN1A 4EGSA 1R12A 2BFOA 4NE9A 4OM7A 4CHGA 5BYAA 4FX5A 3PICA 4IVPA 3B3AA 3QXJA 3V48A 2P1RA 4TGLA 1QIEA 3TIGA 4LE2A 1ZW1A 1MC4A 3OLVA 2EBUA 3HKEA 3MJ4A 3NWJA 1GDTA 4IDPA 2ETVA 1DKLA 2ZKIA 3TPFA 1X94A 3PFGA 3PGKA 3R7FA 4JK3A 4I1OA 3L1UA 1EWRA 3HZRA 3HU2A 2WHPB 4WIAA 2B8NA 4JN6B 5JFTA 1XQYA 2C92A 4HDNA 4D92A 7YASA 1HDXA 4TVOA 3JQ8A 2IEGA 1FS5A 3GIWA 3ZIAD 1L5WA 2NTNA 2DETA 1P2FA 1UMBB 4OLFA 3ONFA 1LF5A 3JAWA 5J1TB 4Y6PA 1ZMOA 4HZUB 2AYYA 3TTSA 1PEYA 3L8HA 2VPWA 1TCCA 2C88A 1KOLA 4NU6A 4O2BA 4KK4A 3GLTA 1M1ZA 1RYFA 4D41A 3RR2A 4HF7A 1BCRA 4QYTA 2JI6A 2O7RA 3PD0A 3I76A 1RMQA 4EO7A 3LT5A 2HH9A 3LUCA 3N5KA 1FU4A 2ISQA 5CIWA 4A8JC 2FU5C 1Z6GA 3RWOA 2HK8A 2WIAA 4KTTE 3VO9A 4OAPA 3BMXA 3KTAA 2PZAA 4ER0A 1QOPB 1VXOA 4FLEA 4HQ6A 1T4MA 2EJCA 3ZWQA 4DT1B 4B7ZA 3JQBC 4JCOA 4WGGA 1NPTO 1QLJA 1D07A 4GUAA 1J2UA 1NQWA 3EUEA 4O02B 3DDNA 1Y5MA 5COQA 3JR7A 3KSDO 4B3RB 2CXOA 3RGWS 5CVUA 3PDIA 3P9YA 5BMVB 1KO8A 2I4TA 3KO8A 4EJ0A 3A70A 4ZVMA 1IH8A 1M2KA 2ZYIA 4MI6A 3DLTA 3AF1A 5ENZA 5F1OA 5A2GA 4UXJA 4PZYA 3MJRA 2DFTA 4POAA 4F1WA 1ATIA 1BG6A 3GMDA 1Q0PA 2VVTA 1L7OA 1EM8A 2VQSA 1FY2A 1H2HA 1V11A 1J20A 3MHPA 2BR4A 1I0LA 1YBVA 3OWOA 1GL3A 4DCVA 2FMUA 4TXLA 2PRIA 3SXPA 4DA9A 5CEEA 1O9GA 2JDID 2GXSA 3HJGA 1SUEA 2JFOA 4L8YA 1MO4A 3ZY6A 1Y98A 4PLWA 1ZCJA 4JI5B 4HWSA 3P96A 1DV1A 1FLVA 1BJRE 5ALXA 2ZUEA 1WMAA 1YI0A 3OPVA 4LF6B 3PXBA 2CNNA 3JWGA 4AD8A 4TLAA 2B8TA 3PXEA 2QL7A 2Y99A 4U7HA 3U4HA 2R8EA 3K32A 4OXRA 1L4KA 4RZXA 4B2LA 3OSUA 3RTGA 1P39A 4KDEA 4G6ZA 2ACVA 3EPRA 2CDNA 5JPCA 2QUBA 1Z17A 4S1NA 1VSBA 1ZOSA 4FMDF 5E0KB 5I9MA 3JWJA 4B4UA 5L40A 3A28A 1LLCA 5TQ0B 4ER3A 3HSSA 1PK9A 5KJ1A 1U7XA 3B85A 4K9SA 4CV0A 2BGTA 1ULHA 1N5KA 4X71A 3ROZA 4BKPA 2IYTA 1A9YA 2JKZA 1CDOA 3GJZA 4CR8A 1V5GA 4WI1A 2N46A 5IN5A 4HRAA 3EVCA 4QRIA 1YFKA 1KI8A 5IJXA 2XQJA 2J07A 4YONB 4RKRA 5BNTA 1KO1A 3DM5A 3O4FA 3NEYA 3P1JA 3DMYA 1JMYA 2DUWA 3KQWA 4XTRA 1VHWA 5CVJA 4G1VA 1TEZA 1J56A 3ELYA 5FBWB 1X9GA 5FUMA 3NX4A 1SUIA 2XTJA 3GBSA 4GL2A 2HWYA 1OGJA 3I01M 4WK2B 2IUYA 4XUDA 3I12A 3F8TA 4I1RA 4XE5A 4HADA 4NBNA 1OI4A 1VPLA 2WFLB 4MX8A 1H66A 1KEZA 3VNQA 1FTSA 1JKXA 1BXRB 2OMKA 1OWNA 4M36A 1YBHA 3SWWA 3P2YA 3C4QA 3NVMB 1PT5A 4HPJB 2BEWB 2WP8J 1XZPA 3CRNA 3NMUF 4RGVA 4D82A 2D1SA 3I64A 4GPBA 4BMDA 3H7AA 1GM5A 2WU1A 2ZBEA 4OGLA 4L4SA 2QAIA 3SX4A 1OZGA 5HSGA 2VPQA 5HR5A 3COZA 3LUJA 1NNEA 1EX6A 3OWXA 3ENKA 3BGVA 1QR6A 2APJA 1KY2A 1U4NA 4D0RA 2UZ4A 1POWA 2ZB4A 5HFJA 5A71A 1NFFA 1V1RB 2CFIA 2FZKA 5EE5B 1G2OA 1W30A 3O1JC 3E9DA 2WFMA 2BAGA 4P08A 2RB5A 2BFCB 2PQ6A 3OJXA 4I1UA 4PAMA 2A0WA 1GUBA 4UM5A 4XRRA 3A1UA 1W0JA 4YQEA 4PLFA 3D9QX 4P4SB 2VTDA 3N58A 4KXXA 2J08A 1Y9ZA 4HN9A 5KNDA 4DY6A 2MDTA 1FTQA 1M2WA 3B70A 3ESYA 1UQRA 1V8BA 3LMKA 4HDAA 1G18A 5AHXA 3U56A 3EUWA 2IXTA 5E9WA 2IW3A 4QDZA 4IMJB 1YD7A 1AKQA 5AW0A 3RSOA 3MTGA 2PMDA 4ITVA 4MVJE 4B79A 1DJLA 1F4PA 1K68A 2GN1A 3NASA 4G65A 1XZFA 4K9DA 2VEDA 5CLLA 4E88A 3S1AA 4HFMA 2ZT5A 4BUJA 2IVFA 3VR3A 4BTLA 4UHKA 1CY4A 1RI5A 3L7LA 3D7KA 4FBMA 4IP0A 3H4TA 3EXHB 3ZWAA 4ALNA 4EYKA 2XD4A 1QZUA 1FE8A 1EFLA 4FYXA 4DSAA 3OJFA 5DV9A 2AKYA 3WLRA 3L6BA 4DC9A 1S01A 3TLGB 2OVFA 1PFYA 1ZC3A 4AZTA 4OI0A 4YX9A 1OY1A 2XE8A 2JGIA 3COSA 1Z9BA 3T1OA 2Y66A 2PT9A 3MXTA 2QR3A 2YUIA 4N5LA 4YR7A 5LWQA 2O3JA 1SN7A 1P2GA 1ZUNA 5G53C 3ER8A 1DFIA 1SBQA 4JZKA 4KU4A 5DXJA 4XB6B 5C0OE 5AW4A 2WG0A 3L0ZA 4Y98A 5DE3A 1P45A 4IIXA 2NV6A 1GRNA 5TARA 4A36A 3KELA 2WF7A 1RHRA 3OQBA 3K20A 2JGKA 4QPCA 3PEYA 1G20B 5EHGA 3QBEA 4RVFA 1BH2A 2A7XA 2FJ0A 2MR6A 3AERA 3NC4A 4OQLA 2YTZA 2ZS8A 5CBKA 1XQVA 2ZJ5A 3OETA 3P9NA 2P5TB 4IIJB 4F4UA 3M8KA 5CXUA 1E0JA 3MC1A 3VTZA 4QPNA 4E5VA 5IT4A 2ZXUA 4GGMX 3MWEB 4ZDWA 2QTAA 4M0FA 4V0QA 4U4AA 1U02A 3AY3A 1LNSA 2D59A 3EZXA 2I2DA 4HMOA 4ITRC 4REMA 5CG1A 2WA2A 2IF0A 3WIUA 1NE7A 1RACA 2ZRIA 3FAZA 3OX4A 3U3XA 2BZSA 2H31A 3PNSA 4XARA 1SBTA 1PKEA 3HBNA 4QTUB 5CW1A 3GRKA 1ACLA 3BCRA 1R4NA 5JCJA 1WDKA 5DOZA 5JDCA 5DEOA 1V37A 3D3NA 4DDTA 1WTCA 4O6VA 4OIFA 5B1YA 1CSEE 1BX1A 1DQZA 2VPTA 3DP9A 3I04M 1XJQA 4AZWA 4KVGA 2XA2A 3FPAA 3O8QA 2EX0A 3OLCX 4DBVO 2I1WA 5IYZB 1AK2A 1UBNA 3LY7A 4JWKA 4J90A 4D8XA 3HB9A 1E2DA 4BFLA 1OB5A 1KTVA 2A88A 3D81A 5TV2A 3GUYA 1GPAA 2R86A 4M0EA 1A71A 5TJHA 2XZOA 1DKQA 1U3WA 4H4CA 3AEQB 5I9IA 4QLOA 1MU0A 3CLUD 2BJWA 2P9CA 4MUJA 5E6RB 1RRVA 2D1RA 3ILXA 4M0UA 2GK6A 5WRFA 3NHBA 3OC0A 3M3DA 3UVEA 3UT0A 5A1JA 5DHTA 5JS7A 1P3Y1 1SVUA 4X8OA 2H9AA 4BE9A 2GCOB 5EJ2A 2MOKA 1YZNA 4EOGA 3QOYA 5A5GA 1DC8A 1P4AA 2ZULA 1J42A 3ES9A 1XNGA 1PYOA 1ZXXA 1UXJA 2WIFA 3BL5A 5ESRA 3PXAA 5CXXA 2FPXA 4TPKA 5KJ6A 3KKOA 4CKEA 3EXFA 1Z4IA 4OXIA 4WEOA 4XEUA 3GA0A 3V80A 1T2CA 2R44A 3SQOA 2RHGB 3FTNA 3L6RA 2C95A 5KPJA 1Q11A 3PZBA 2DECA 1I7DA 1N3YA 2XYPA 4AMBA 1W96A 1V5WA 3OLWA 4J0QA 3UHOA 3WYEA 2IS1A 2PKEA 1W49A 2VNIA 4KV9A 4W1PA 2HY7A 2IUEA 3QJ5A 3G88A 4LA4A 4N7MA 4QM6A 3AR7A 3OZ7A 4G8CA 4HDKA 4BNIA 3QKWA 4LDZA 4GU5A 3ZVLA 4H60A 2JJ1D 3H18A 4TUYB 4B75A 4ZQHA 1JIUA 2M6RA 4TL9A 1ZGJA 1ZSNA 2NNLD 3WWCA 3FKQA 3V32A 5IEBA 2C4WA 4WBSA 3RDPA 3RF6A 5L45A 4ZVPA 2GD6A 2XE7A 1E6LA 1LJ8A 4S2EA 5K8LA 2ZJ7A 3VH3A 2QRVA 3QVUA 4YMTA 5KYGA 4KYTA 3OE5A 1W7AA 2FPPA 2WWWA 3AUJB 4XEHA 2LCQA 3C5HA 3H2SA 4KFUA 4NEHB 4DWWA 4KXWA 1KJNA 5LUAA 4IX1A 3EPHA 1TT5B 3Q5GA 4AWBA 3FBWA 4EI9A 3EHDA 1R9GA 3VZPA 4WD3A 4DLSA 2C1ZA 4LV5B 4G09A 3WTBA 3QQ5A 1Q7CA 4R83A 3OO0A 3ZGZA 4Z5XA 1M2VA 5SZKB 1K2WA 3P9IA 3DWGA 1E3JA 1SCKA 2HQRA 1Z34A 2PG3A 3BMQB 2BFWA 3OPYI 3TIFA 4A27A 2DAPA 3LFHA 3OQHA 4NMHA 2D0PB 2OOKA 1L3IA 1I9GA 1P0QA 2ZSBA 4MP3A 4MUNA 5FIUA 2EXXA 5JI2E 2IU0A 2YS6A 4BY9E 4ZDJA 3M49A 1QE3A 3HGQA 1D4ZA 3KYBA 3ZG6A 4GX1A 4QEZA 1BA2A 3C8UA 4B3JA 4V1CA 5I3CA 2JLSA 2O8BB 2ZE6A 5MGNA 4Q9JA 4CIAA 2GN8A 3FF4A 4N5IX 4ENQA 5LA6F 4BX3A 1OXKB 3C8ZA 4TKMA 4FGJA 4KAAA 2UXDB 4RH3A 3C48A 4YQFA 2CFCA 2VZ9A 3R0JA 2FMTA 4MPTA 3ROEA 3MJHA 2ZRLA 4AY5A 2HSWA 3ID6C 4BX9A 1X74A 3C8HA 3HL0A 4BVGA 1ZJZA 1X9HA 2CKDA 3EBOA 4AZSA 2RI0A 3EZLA 3FZYA 2I5PO 1C30B 3ECSA 1P2BA 2JLYA 3QKRA 4TROA 3BD8A 4D6YA 1T2UA 4WZBA 3WS7A 4I3HA 1USWA 1F9EA 4L7VA 1D4FA 4QO8A 4A8JA 4PX2A 3I9MA 3QW2A 1OFVA 5ELMA 1OZAA 2G3YA 1F2VA 1R50A 4GSKA 3HYRA 2Q5FA 1DMSA 1GTL1 3JASB 3PDUA 3OZAA 4FZVA 3NIWA 4ICIA 4DAEA 1NG9A 3RUEA 4BWVA 3OT4A 5HS6A 2A59A 2B0JA 4FNGA 1DO0A 4G0UA 2ZBGA 3PYXA 2C5HA 3FTPA 4YDRA 1HETA 1AY0A 1JPJA 2EDAA 1XWWA 4BFCA 5CB4A 2M2IA 3B3QA 5F5XA 1SCDA 4NPCA 4JOSA 4JS0A 3SAJA 2C54A 4C4RA 2SICE 4C7VA 2VNHA 4BKUA 2NTVA 4EWLA 5U1PA 4NS1A 3QE2A 3FTCA 3ACBA 4BO1A 1E3WB 1FUUA 2Q2OA 2YBEA 3JQ7A 3DA8A 4RYLA 5AW7A 2VSOA 2PR2A 1L7XA 4D42A 2Q5CA 5FPTA 5E1OA 4JP5A 1YFZA 1E6KA 3HGMA 4NX2A 4BP8A 3CKLA 2BISA 3TEMA 5UKDA 1N2ZA 3HWRA 4GH5A 4I9GA 4C9BA 4AP6A 5A6SB 3I0NA 2PUBA 4YTEA 4MVJF 3IQIX 2YYSA 3RADC 3HN6A 1Y1TA 2D4HA 3AT1A 3HR4A 4CM3A 1T1EA 3ESXA 2D06A 4BLUA 1Q20A 1X86B 4BB0A 4NFYA 3DGFC 3DZCA 3TW6A 4UBNA 2EIHA 4PCUA 3TLKA 1RZRA 3UICA 2CYCA 3TQOA 3ZQ6A 2PYDA 4L02A 4E70A 3BGDA 1N5JA 2ZS7A 1QGZA 5CG2A 3M34A 1VG9B 1MA0A 1UT8A 2CD9A 3S2UA 4HL6A 1D3AA 3VTFA 3W8EA 3LQKA 3PUJA 3R3VA 1CEXA 4QG3A 2IX9A 1FMFA 2CL0X 4S0XA 4CI0B 1ISMA 1DOHA 4QTZA 4XPZA 3GCGA 3ST7A 3VBEA 6ADHA 5E8JA 2VC2B 1FTGA 3BXGA 5F4ZA 5A3VA 1OFIA 2OCXA 3MRVA 1QF6A 1M9NA 3LQRA 3UKJA 4LSWA 1E2BA 4WNAB 4GC9A 2BGUA 2FWPA 2X2EA 4S3MA 1NIJA 3MJFA 3L0YA 4CM6A 3JD2A 4OXYA 4LK2A 1OCEA 2VK1A 1UR5A 1E4EB 2R6JA 4ZAGA 2ZM5A 3M5DA 2IWRA 1TUGA 4I4TF 4MRSA 4X1IA 1W44A 1T3LA 2FZCA 1GEEA 1M3SA 4BO9A 3USZA 2ISCA 2NG1A 1N2CA 4R8SA 3DLBA 1Y80A 2HF7A 1T6BY 1EB8A 2WK1A 1SXJD 3ESDA 3GAAA 3M1AA 2G70A 3KYDB 3W1WA 1GTSA 2HOQA 3K9WA 4OJMX 3TINA 1E5QA 2RK3A 4ZOQI 1FNMA 2FKNA 1X15A 4G9EA 4XQCA 1IHXA 3JQGA 2WTXA 1K5HA 3G02A 1WSDA 1GRCA 1MIOA 3DCIA 4RIGA 5EN4A 3KBOA 2XR1A 1YZKA 1DAFA 3HKBB 2DJ5A 3IVXA 2P1ZA 3MJCA 1CG6A 4FR5A 4U5QA 4ARSA 3FWPA 3PC4A 1R0SA 4OJQA 5T4HA 3ZY5A 3W8FA 1S2GA 4DJDC 2HV8A 4LJ7A 4HEHA 1MXHA 1KPGA 5DTQA 1SM4A 1ZONA 4WACA 3H86A 2DERA 1EFHA 1QHHB 2ZRKA 5CDSA 1TJYA 1EVZA 1CIPA 1FNCA 1L7MA 1YONA 4TL7A 5HP4A 2Y1LA 3IODA 3T38A 6CHYA 3QVSA 4ZO4A 7AT1A 1WBBA 3Q4GA 3GEIA 4IYRA 2IPLA 4L27A 4UFPA 1PL8A 4QAJA 2MIIA 4EW2A 1OIWA 3QVGA 1EH5A 4HEA1 1MAWA 3AZPA 4L28A 4L5IA 1XJWA 3SZ3A 5ICSA 2ZYRA 3ZE7A 1RDFA 4L8LA 2NUTA 2Q0HA 4TQAA 3W6OA 2IGTA 4EFNA 1RFGE 4BASA 2BTOA 1NATA 3IUMA 4UBJA 1Q5PA 2GAJA 3UGQA 1O5TA 3DMDA 1F6WA 1XQ6A 5H3LA 1UMDB 5LLDA 4NCKA 2V7UA 1E20A 2IY8A 1C3OA 3O8OB 5LIRA 1YJ5A 1LI5A 3SHVA 3RU2A 5FV7A 4TL6A 3W6NA 1QPGA 1J2TA 2A1TR 5M3BA 4IOLA 4IUDS 4LW8A 1IU9A 4L50A 4QOGA 3FNHA 3MT9A 4J0JA 3FNIA 3RC1A 3QNWA 1X7ZA 3FWHA 1BHQ1 2B8JA 1KA9H 3O84A 4EH1A 1AIPA 1H65A 1OAKA 1UJ5A 2PX8A 2LZ0A 3LA6A 3QLUC 2ZIXB 3RREA 3TD6A 2XQGA 4ILKA 1VSUA 2LCFA 1JG1A 2P6UA 3AHFA 3D6NB 4COKA 4JT8A 4CMIA 1L4MA 4O4LA 4CCWA 2WWYA 2HWKA 4BC1A 3QYJA 1MOZA 1XTJA 5DI3A 1O4WA 2FV8A 2HX1A 2D00A 4LRWA 4H7DA 1JSCA 2IQ5A 3MWKA 2C0QA 2W98A 1U2PA 1ZNQO 2O19A 4JDPA 2PBZA 2BBWA 3K9LA 3RYFB 1Y8ZA 1C9KA 2LKCA 4CETA 3G59A 3MELA 3IAFA 4P3YA 3G2LA 1PUXA 2FPMA 3KTFA 5CYFA 1XXLA 4JI1B 2VAMA 3VISA 2FPSA 1JVSA 1JFLA 5LU9A 3AILA 1I01A 1NMQA 3EDOA 1V6CA 1H0KA 2P65A 3EGXB 3HFSA 2AR0A 1OGIA 4CXMA 2JFHA 3HDTA 4LHSA 1YRWA 3OM9A 4TM8A 1SVSA 1PSWA 2VA9A 2Z08A 1VIVA 1T0HB 4FYYA 2OD7A 4HJXA 2EZTA 3EW9A 4M76B 4ZRDA 2J45A 2DGDA 2IYSA 5EWJA 5LZ8A 2PWZA 4GBGA 4ONEA 2P3QA 1GTZA 4QNRA 2EGUA 4LECA 4RORA 2YHUA 4GMFA 1K06A 4CLHA 1U04A 2I8CA 1NLUA 2J3HA 3R3UA 2ZI4A 4FGWA 1PL6A 2E21A 4JVSB 4KGXA 4WLEA 2OLJA 4NQRA 5ELLA 3CCFA 5FORA 3DSRA 4KR3A 1ONOA 2O4UX 4OOEA 4Z7OB 3MS2A 2CF5A 1HNXB 2A0FA 3JWHA 3GLIE 3JTEA 1U0OC 1DWUA 1ST2A 3FMIA 4HTAA 1YRLA 3B12A 3O9VA 1RYBA 3K4HA 3FYCA 4IDOA 2C2ZA 1NYRA 3C6YA 2OXRA 1OA0A 2QVZX 3UJ9A 2FJUA 5KJEA 1AUQA 1SKQA 3IPRA 4D80A 1ZGCA 3PYMA 5FUVA 2Z2YA 1D8TA 3O75A 5AKYA 2VYNA 1BXZA 4OQZA 3FG9A 4F0JA 2P40A 5HFNA 2YHBA 3H13A 1JJAA 4O29A 4Q18A 4R2JA 2P9JA 3ZCVA 2FFBA 4OHVA 3GJYA 1XAJA 3TQTA 5LP6F 4X24A 4JMLA 1WVMA 4QFBA 3V8PA 4DCCA 1RBZA 3ZU5A 1KZ9A 3Q2OA 1GUDA 5J2TA 1UM9A 4KXFB 4ZYLA 5BN5A 4IHJA 2VQ6A 1Z15A 2BFAA 5JJ5A 2QRJA 1L4HA 1LDGA 5P8WA 3IAHA 1UBEA 3PWZA 3V97A 1W9HA 4TWJA 3CM0A 3FF1A 4DQVA 1QZZA 2VS1A 2BM9A 4EUKA 2JANA 2QE7D 1SO8A 1XV5A 1EFVB 2WUVA 2PKQP 4NV1A 4Q15A 4R1QA 4WOBA 3ZZ0A 4F12A 1U8CB 5KJCA 3LLUA 2G0TA 2JCSA 2PMFA 1C3EA 4L0MA 2B0CA 1AGRA 5LZ7A 1GGJA 1GPYA 1MGOA 3I52A 3Q5EA 5CM2Z 3NGLA 3HCEA 4C4AA 3K05A 1RPAA 1U8XX 4DQXA 1USIA 3ADCA 4XVRA 5K0JA 4DA4A 1XMOB 1K4MA 3F6EX 2B4RO 2YHIB 3S1SA 1WNTA 3FWZA 4HBZA 5IKEA 2QJWA 3BM5A 1DBQA 4G0QA 4AKGA 4U00A 4BGVA 1YS9A 5JWOA 1YU6A 2OD2A 5CLIA 1E9EA 1X42A 3ZY3A 2IBMA 4Q3CA 1JN0A 4CDRA 3B5JA 1VJTA 4AS2A 5KOIA 4YLYA 4BLWA 5CNMA 1QS0A 1E1QD 4RKQA 3W0LB 1N1DA 3E22B 1V4VA 5D5HA 4Q9LA 4E21A 3SJUA 4YRAA 4ZVVA 4MKHA 1NP7A 2IOFA 1G8KA 4JIGA 1L5HB 4IV8A 2E2WA 2ONCA 3UWSA 1NKTA 5SYAA 3LPLA 3Q3JB 3B1YA 2QQ5A 1Q0HA 3K94A 5H16A 4BGEA 4C4OA 5LDDC 3PVZA 1G5IA 1PWEA 3CSDA 2PY6A 2FSVC 3OUUA 5TQ2B 5MN5A 4OGFA 2JCYA 1J39A 4YMWA 3GOHA 3AJ9A 3EIQA 3HEMA 4MDHA 1G9XA 1CQJB 4HWKA 5B1HA 5AW9A 3AFOA 1JDPA 3PUWA 4FDLA 3WWZA 2E82A 4CKXA 4IDFA 4ZPXA 1K63A 4AYWA 2Q27A 4Y8VA 5FBKA 3FOCA 4CLEA 3OCVA 1NRWA 3AM3A 1KZHA 4P31A 5FRDA 3IAXA 3KUXA 2ZSDA 2WD7B 2KHZA 4FUTA 4CEJB 2QGZA 1QCCA 4LBWA 5A4FS 1YZQA 1RQXA 1WW8A 2CK3D 2RONA 2ODQA 3LHFA 5CU7A 5EUCA 2PRYA 4J7XA 3ZE2B 2C9MA 5B58C 1T1SA 5JS8A 4ARZB 1E2UA 1Z4JA 4LQLA 4D9HA 2QQ0A 4QQKA 1ZHOA 3KJFA 3BIWA 3Q88A 4NYJQ 2DQSA 4DOMA 4KE8A 2FZWA 3KXIA 4M9ZA 3RVKA 5BORA 1DCMA 3GB9A 2F90A 3FI9A 3FHJA 4A6PA 3NWPA 2WZCA 4Z86A 3F4LA 5DRTA 3SQMA 5ADUS 1HE2A 3NDJA 2AMYA 5ICMA 3JYPA 1FMJA 2RC6A 4BFSA 1MVNA 2EKLA 4DIKA 3P2OA 3I58A 5DN9A 1U8EA 3CRQA 5B3AA 1R0XA 3OFJA 4ZQFA 2RBEA 1OXTA 4FS8A 4OAQA 2IOYA 2JD0A 2NU8B 1HEUA 3T3MB 2GZ3A 1GO2A 4YA6A 1LDYA 3OQ1A 3TFQA 4JC0A 4PPFA 4G8JA 3U16A 1R6BX 2VRWA 4PX9A 1HQCA 3IMFA 1JQ5A 4U0JA 1FJHA 1LLDA 2IPMA 3CRW1 1SXPA 2WSSD 3WIOA 4F8EA 5KHLB 4HEA6 2DF8A 3NXSA 1JB9A 3NU1A 1UC9A 2WJ3A 3L7DA 5IK2A 4RLFA 1SOWA 3DOUA 1QGUB 1TYAE 2QVLA 3SC2A 4L5YA 3AVPA 5T5QA 1JKJB 2D1FA 3TLAA 2Q2QA 5DBGA 2J87A 1YGPA 4M87A 4S35A 2BFDA 5HF9A 1SFRA 3X1YA 4BN0A 2G36A 4E08A 1SC3A 2QG4A 1XO1A 1ZRHA 3KVVA 4BNGA 4DSNA 2WM2A 4UTNA 2N9UA 3FZNA 1O08A 3V8MA 5LXTA 2HO5A 3E8MA 3ISJA 2Q6KA 3LFUA 4OY3A 2FN9A 1EXDA 5IJ9B 4C06A 1IZ9A 3C5CA 1K97A 5SZJA 3FUUA 4G84A 5INTA 5AM5A 2IHNA 3RFTA 2IGBA 1KQNA 1ZM2A 4BZZA 4MRAA 2FF5A 4O4IA 4J3FA 2B2NA 4FOPA 3ZXSA 1E2KA 2F43B 2GEFA 2W58A 1BDIA 4YHBA 4MYUA 2Q4RA 2YXNA 4IOMA 3HK2A 1M1YE 3MPUA 2E0IA 1D1TA 1GADO 1KP9A 1QYCA 4UPEA 3EFOA 4BOYA 2XJ9A 5CUQA 1JU3A 4BCBA 3ZIAA 3PLAE 1S8OA 2UZ1B 2WYVA 5EE9A 4FDVA 1E9VA 3LC1O 3C1OA 4LDQA 1K0FA 1KNQA 3VZDA 2JIBA 2OP1A 3AMVA 2WWTA 3E3MA 3ZH9B 1V1JA 5DYWA 2W2VA 3CZRA 2H1HA 3NT5A 2P8SA 2X3UA 2PCJA 2V1XA 2I1VB 1WB6A 4CDNA 2ST1A 3OLQA 3WICA 4WK6A 4PZZA 3SHTA 4PR3A 3KK0A 3SXUB 3OVMA 3V1MA 5F9FA 4V0NA 4BNDA 4DIEA 4NV3A 1IQPA 1FTYA 3MIZA 4MRPA 2II6A 3PHCA 5BOSB 1RWWA 3KR2A 4OBWA 4YWHA 1EJ6A 1PCXA 3WK5A 5J4KA 1CUVA 4ZEVA 4JSYA 1XKXA 4NCNA 4HUQA 2WWXA 4J94A 1VLLA 4EHDA 5BSGA 4DREA 3C8MA 4NYMQ 4RDHA 2FPLA 2PO7A 2VHZA 2DWPA 2B1JA 3CLTD 3CX8A 3HBAA 1BFKA 1MPTA 3K6RA 2P69A 1RWKA 2GVNA 4F97A 2UYHA 1NR1A 3VKFA 1AH2A 3DT6A 2A9OA 4QQ8A 4ENUA 5KYYB 3TTVA 2Q7DA 1GRRA 5IANA 1QIHA 2J3MA 4H0CA 3VR2D 5J43A 1SPXA 2FOXA 2WOOA 4RFVA 1RSZA 3AEKA 5AJUA 2ODNA 1MB9A 4MDYA 3W5AA 4YDSA 4LC0A 3NTQA 4MNTA 1YHNA 4DDWA 5FF9A 1P5HA 2FEWB 3K0SA 5AXBA 5CAEB 1NC1A 3FW1A 2PD6A 2OCLA 5BQ3A 3INNA 2RGAA 3EH2A 1XZDA 4HHEA 4NV0A 2GZMA 3PNQA 2G5PA 3UKDA 4MVJM 1SVIA 3WL7A 3BAZA 3NBFA 1HFEL 3GFSA 1JE1A 1QIDA 1NMEA 3LP8A 4Y18A 1VLHA 2ZJAA 4MKFA 2HLPA 3O2JA 4AJPA 2I33A 3B36A 3S2SA 2QHXA 4BBAA 1VA5A 2Y1XA 4DIBA 3WGYA 3L8MA 2HMTA 4XFJA 2FUG1 2WWIA 1CKEA 3K6SB 5IKMA 4IQGA 4ZA2A 1N6NA 1C80A 2AVNA 1SD1A 2HU5A 3NC1C 1XLUA 4FEEA 1QHFA 4MGHA 4DRYA 1N0HA 2AB0A 3CC8A 1ZCFA 5FOSA 4OLBA 2CBXA 1ISRA 1G5HA 1K7SN 3PCXA 2OAP1 1NV9A 1O1YA 3WLNA 4JGBA 4G0XA 1OZFA 1FFXB 4C7KA 3R0IA 3PJGA 1XA0A 1GKKA 1AB6A 3LRTA 3AINA 2HZ7A 2RGWA 4YP9A 5B7NA 3I2YX 2IWHA 3WGHA 5A1TA 3K6KA 1T10A 2FUNB 1X7XA 4F04A 1ORWA 4WESA 3D8HA 5EHXA 4D1YA 2VHTA 3AV0B 3RUCA 3NH6A 1SXJC 1ADFA 2CC2A 1TB4A 2PWPA 4IG4A 5FEMA 5IKXA 1RE0A 2Z30A 2OKCA 5K2MA 3IILA 4RTNA 1N3IA 1T5TA 1DG1G 1LQUA 5KYWA 2PVCA 3I83A 2H0RA 3K0AB 3D3WB 4X95A 5C4MA 3KQKA 2FOIA 4LQ4A 1SG6A 5ALDA 1D03A 1OBVA 2NP7A 3PNYA 1W85B 3T1NA 4A6DA 2EU8A 2C1EA 4QAQA 1KAMA 4QOSA 4U6QA 2HA7A 2EIXA 4HNRA 3RIGA 4RPCA 2J9GA 2IYEA 2P2CA 2FSSA 2E1PA 3NHZA 2FW7A 5DMXA 3EH1A 1IYZA 4IIVA 3C6MA 3IP5A 1E2FA 3NM4A 2W2LD 3JV7A 4WZAA 3Q7QA 2FE4A 1GYQA 2G6TA 4JHXA 2Z6QA 1J8YF 1NL3A 1XLTA 3BJRA 4YPOA 3PX3A 4OP2A 4XWAA 3UXEA 3WJAA 3IDZA 1YE3A 2QRMA 3F98A 1TCUA 1Y9DA 5LUBA 5F51A 5EWMB 3UJ7A 3WNQA 3TQQA 1NQVA 3KWMA 1NXXA 4H2DA 3I5AA 5HRUA 1U2DA 4G5XA 4LGCA 2DE0X 1EP1B 1KRXA 1J8DA 1KHHA 1QMGA 4PRYA 4V3CA 4JXKA 1K7YA 1BNCA 3BMOA 2EARA 4IJMA 2E18A 4NZPA 2R1TA 2BRUA 4QJIA 3LT1A 3RYCB 5K5EA 2P62A 3CJQA 5K0SA 2JCVA 3SZMA 4E4RA 1ZK0A 2EP7A 1YASA 2VJKA 3N8DA 2AG1A 1H6AA 3Q87B 1EA7A 4LRYA 5D3ZA 3QVXA 2WAXA 4B87A 1SPBS 1QJCA 3DVAB 3PCRB 3A6FA 4P4UA 3TNLA 3TTTA 1ZMRA 3DHEA 4MKGA 2H11A 5CMLA 4DARA 4CTOA 4ZHQF 5I7FA 2O8DA 2HA3A 1NVDA 3IELA 1IXRC 2I3ZA 1DEOA 4QJBA 3SBEA 5BWLA 5E7QA 1OFUX 3LY8A 3R3HA 5JHGB 1D7AA 4Y30A 4S24A 4CIXA 3SJZA 2JFYA 1GG2A 3LCCA 1G8HA 4L5AA 2QTLA 3MCUA 3P9CA 4JT9A 4EHFA 2KB0A 1CY0A 1VKJA 1Z13A 4EEXA 1MNAA 4Q7EA 4JJ4A 1NPYA 2GPAA 3FKJA 1SVWA 4ZI5A 1BE1A 4MK4A 2Z3WA 1SCJA 5DCWA 1EUCA 2AZTA 1GR0A 4K7JA 1FQJA 4ZYVA 3R24A 1YJBA 3NNNA 1P0FA 2ECFA 1JSXA 3EOBI 5AVVA 4Q9KA 2UVQA 5CHEA 3WAGA 1H1LB 4Y9DA 1AQ6A 4W5WA 2D7DA 3CA8A 4G1BA 4L2IB 3KDAA 1PI3A 2X13A 3DHWC 4W6ZA 2FLKA 3QMWA 4MUYA 1Y7IA 1VGRA 4S1TA 1W4AA 3G2QA 4OQ4A 4PYQA 2I54A 1NLYA 4GQAA 1CIVA 1U8YA 4QYMA 1T25A 3DTYA 3USCS 4RKEA 4OQXA 5FPSA 4L4UA 2R8OA 1H2RS 3ONWA 4JBYA 1ENPA 3USES 5ALEA 3FYUB 4DTIA 2JLWA 1DAPA 5F2EA 3HVRA 2E6UX 1DE0A 4YRIA 1CRLA 1NI4B 1SZCA 3N6VA 3O4GA 1GD1O 1SHUX 2DR0A 4PG7A 5CVCA 5BSFA 1FFDA 1WLSA 1MC8A 2YDYA 3L8ZA 2YR0A 1Y5RA 3TD9A 2JVJA 1AZTA 1ENOA 1WSBA 3UFBA 2EZUA 3L04A 3I8XA 3OU6A 3WGGA 2R8YA 1G8YA 1P5JA 3DD5A 3GT4A 5EZYB 3UAGA 4ZYTA 3RSHA 4B8YA 4CMKA 2P9QA 4ARBA 2GNPA 4OA8A 3CT6A 4EUHA 2ZTMA 3L8GA 3OT5A 1Z62A 4B6OA 3K2IA 2H7XA 3J7TA 1CDDA 4IGEA 1SK8A 5L3RA 3LVRE 4ETWA 4JYCA 1XTKA 1BGXT 3H5TA 4J16A 1AUXA 2GLXA 3S70A 3WOHA 4TKZA 3BFKA 3ZVMA 2F4NA 4WDQA 1U0LA 3IQGX 2W8BA 4HFJA 4UM7A 4YP6A 4B40A 2LBPA 2W6ZA 3LIPA 3LO8A 5E7MA 1F14A 3T95A 1ZVKA 2Z2KA 4GX2A 2PSDA 1Z74A 5SZHB 3KPJA 5ER6A 4G5YA 2HV9A 3RBVA 3T8YA 3PHJA 1LEHA 3T9AA 3FYSA 1DV2A 1TQ2A 2I4LA 2P67A 1ARZA 1THTA 2CXRA 4ZZ1A 4IO1A 2X0NA 2AN3A 3ZDAA 4MW6A 4F96A 2XV1A 4EB6A 4BHTA 1BMTA 1YU9A 4P54A 5LJIA 1QTQA 4IHQA 4YP7A 1RVDA 5I9LA 3NYRA 4KYUA 2B7LA 1M7GA 1SC1A 5K05A 1L8OA 2AFVA 1Q95A 4J0CA 3CLKA 3DTNA 1I4DD 4HXEB 5GMOA 5DNCA 1H9BA 1BKSB 3UAXA 4DPMA 2WTUA 5MHTA 3ONVA 1OWMA 3QNUA 4DNPA 2JJ1A 1TM3E 3KEGA 4FMCB 2VZ0A 1UQUA 1I8TA 3FFTA 4LMPA 4JBLA 5EGNA 5FBQB 4Z3DA 4Q7JB 2BD0A 1E94E 2JF0A 2FGJA 4MYHA 3SGLA 3QTBA 4GW3A 5AJVB 3PHLA 2GCPA 2VP5A 2EL7A 3TRIA 1DHTA 1GQRA 2VTVA 3A27A 2W83A 3AI2A 3EVZA 2J30A 3E5HA 2NGRA 1E2IA 3OCXA 4IEIA 2VXBA 4WXMA 5BYJA 4G67A 2FUG6 2WUWE 4IFBA 1YA4A 2XF8A 2QTFA 2PCLA 3NHMA 3SNHA 5JTUA 5LOVA 5KOJA 4MLCA 1ZUHA 4X20A 4HFNA 1EUQA 2GT1A 4RU1A 2FOLA 5JD5A 4Y2HA 1NBWB 1WIWA 2FWMX 1GUAA 4S1WA 4YPFA 1E4YA 2AJTA 3FOWA 3MVEA 3K1ZA 4RHFA 4ZVOA 2ZSKA 4EUEA 3QP9A 4JBWA 2AW5A 2PD4A 1QH1B 4KACA 5TNXA 2ID9A 2A14A 4F6CA 1VKNA 3LNTA 3O47A 1PZXA 1E4VA 1VL1A 1GZHB 1KJQA 3EEIA 4DBLC 5IXJA 1USUA 4PG5A 5D7NA 3V6MA 3VKGA 1TU4A 3WADA 5BSHA 3CVVA 2JJ8A 2JI8A 3V2UA 3OFND 1VPVA 1O77A 2VPPA 3FPFA 4PX5A 2J3LA 1VI6A 4CG3A 1RQGA 2R7LA 1ZINA 5TS3A 3WKDA 1EVIA 2I29A 4WXPA 1DCTA 3F6PA 1ICIA 1S7GA 2J8ZA 3DWFA 3ETCA 1GEGA 4GVPA 1ZJWA 3DCYA 3DB2A 3I34X 4RDCA 3TO5A 4GR9A 3ETDA 1EQAA 3HXMA 1JRLA 3BX1A 1G3QA 2KW5A 1SRRA 2JBAA 2FP4A 3LWZA 3Q3CA 4J43A 4JIMA 5FUWA 3RD5A 2BHSA 3CISA 5I7SA 5CT6A 4FFLA 2X5KO 4GLOA 1Z2AA 3ZDEA 1JFTA 4GSLA 5TRTA 1T9BA 1U7DA 4DMFA 1NF8A 3EC7A 2ZW9A 1RPZA 1X7WB 4A91A 3FETA 3HYCA 1LSUA 5LC1A 1T2EA 2VK8A 3B1JA 3LGSA 3RC7A 1VXRA 3OQJA 3H5WA 1RKQA 4IH4A 2SKDA 4Q3EA 1XJ5A 3YASA 1EWVA 3Q7RA 1DEAA 3L9XA 1IBRA 1IFXA 1N7IA 2WAMA 4O5OA 1T1RA 3MB8A 2JLRA 4YJGB 1XRSB 4F4IA 1KDVA 3U0BA 4TQ9A 5IAAA 4HDRB 2I76A 2JATA 3HUTA 1UJCA 1JTFA 2B1IA 4YRCA 5HF8A 2IDMA 2P11A 1P81A 4PLCA 3WLMA 2PO5A 4JKOA 1XNHA 2XYQA 2Z04A 4U2KA 1XTBA 2ZI3A 4B6JA 1FX0A 1PT7A 3L9WA 1CUCA 4PIMA 1WV0A 2J31A 3EULA 3BDIA 4KXLA 3FOEC 5TIIA 2KBEA 2XIJA 1L4BA 2Y0DA 4XPIA 1QHIA 2BMDA 3KXLA 1P6XA 1HK7A 4WE3A 1VMKA 1I5OA 4L4ZA 2PZEA 2FPGB 1C1XB 1IAVA 2MSKA 2VZEA 3RUDA 3WYBA 1GNPA 3J81A 3N7UA 5EMJA 3UB3A 3OU7A 3B89A 3CUUA 1WU7A 3GWZA 1Q1ZA 3R3XA 4DNOA 1Z56C 3FSRA 3HXTA 3SBOA 1RQNA 2IE0A 3A1VA 4Q4HB 3AOEA 5C8DA 5JEEA 5DM1A 1SKUA 1QGAA 2COEA 2BFMA 2VNKA 3M6FA 4TTRA 4Y6SA 1IJKA 4U02A 4C2TA 2WKRA 3ZHVA 1EDZA 2JCXA 2W9XA 3G2NA 4NFSA 4TMTA 4P4GA 5IXYA 1LBTA 1KK2A 1MGPA 4PAOA 5EJAA 4ZXPA 3SYNA 3URMA 1TKCA 2C96A 5E7IA 2M6KA 2QMZA 2FSUA 4RQAA 3QZUA 4AJ2A 1CR1A 4UTZA 1V4BA 5BRAA 1JIXA 3WB1A 2CMGA 4XX0A 1VP3A 4LHYA 3A6ZA 5EJ5A 4XD2A 4BO0A 3VKHA 3I6YA 3ESAA 1SC9A 4RXTA 1H1TA 1RAFA 4KL8S 1EDDA 2BEVA 3ECAA 5EYPA 3T4XA 4F11A 4GDMA 4W9NC 4B0OA 2H65A 2IDJA 5FOXA 2ZJOA 1WX1A 1KK1A 1HMYA 1Q1EA 1G21A 1TIKA 2AHOA 3IJPA 1K75A 4BQQA 4F9FA 1NNLA 4I5IA 4LXGA 1YIAA 1G3UA 3AEZA 1SXJA 1DOAA 2PTHA 3MCAA 3KKLA 4G2NA 4AF6A 1A7AA 1T9ZA 1FIUA 3RSSA 3ENVA 1SIOA 2BUAA 3KFLA 4ZAYA 4XUEA 3FIUA 1ETHA 1YDFA 4RF3A 3L2OB 2O8FB 3GZ4A 1DS6A 3CLTC 1QNFA 4E2FA 4GOLD 2YJNA 2HJ9A 5AQEA 3F73A 3JY6A 4HXFB 4LDRA 4PVDA 2YQZA 1KVSA 4OM8A 1EM6A 4PZPA 5ALOA 1OWLA 5MN4A 1JXQA 2EJBA 2AXEA 2BCJQ 4YMGA 3WNBA 2ZR9A 3QX9A 5DSXA 2FLVA 1I6MA 2MYUA 1R7RA 3WNDA 4D5GA 1QRTA 2YYAA 3A6LA 4L8WB 4EHNA 1ISIA 4FFBB 1BSVA 3QV1A 1UDAA 5E0OA 4JENA 3N8NA 5K3DA 2WHRA 1DADA 3RHFA 5LL6P 4YALA 4QE3A 5DHSA 1KYWA 4MH0R 1S9DA 4Q3LA 3CX3A 3SFTA 3ABRB 3FZEA 1EM8B 1P2TA 3A3OA 1P4HA 3AUKA 1VCIA 3B3JA 3CJTA 3QUAA 2XA9A 4RK4A 4XQ0A 4YNBA 1JECA 4GOMD 3RI3A 2I03A 4PLYA 4J49A 2ZZNA 2C20A 3IOEA 2WZDA 2VIIA 1VLQA 3UCFA 2YWBA 1QH0A 1RADA 1GUYA 3PNBA 3JZMA 4Y9TA 3GLGA 2WHXA 3EXEA 3LLVA 1YRQA 3UK1A 3TF5A 4QXAA 1L2TA 1IOLA 1C7ZA 1JI0A 1XQXA 2DVMA 3EF1A 4MI3A 3VKVA 3EGCA 3P0JA 4PHTA 4RIFA 2X42A 2B1GA 3NOVA 3AR5A 1EK0A 1OPXA 3VHQA 4HO1X 5EP1A 3F3YA 2UAGA 5G3ZA 2DLCX 4DR2B 1I5EA 1YCDA 4IV0A 2C77A 4PC3A 4R8LA 4CIVA 2NO6A 5ILGA 2PIAA 1SB8A 2Z1DA 3NAGA 4JJFA 1AXRA 3K8YA 2RFLA 3HUDA 4L74A 1VHQA 5F1KA 2J33A 4BFWA 3U3ZA 5SYNA 2P6NA 1Z6ZA 2O8VA 1LTKA 2XODA 1R64A 4TSKA 4UBIA 4ER5A 1YB2A 1LVUA 4RZ3A 5MF6A 1GU1A 1QUFA 3H5OA 4AMUA 3I3SR 2JIQA 2GN0A 3ORQA 2YWXA 1P6UA 1DC4A 2BKUA 4NQZA 5C52B 5AWFC 3LUBA 2BKVA 2JK1A 4ZVSA 1U0SY 1NHGA 4H27A 2PFSA 3MMSA 1DIBA 5AK6A 4F5ZA 4RA6B 3SQDA 3M9XA 3ETEA 1I14A 4U7FA 1HXHA 1QE5A 1DB3A 1TPZA 2Q3BA 4JUDX 4WV3A 3WB0A 2R0QC 4KRFA 3O9ZA 3FD8A 1VB5A 4M88A 1UC5B 4PS0A 5LQMA 1DC3A 3A2LA 1NLZA 1AKRA 2H8KA 3HB4X 1RI4A 3K0FA 5ITZA 3RUAA 5CLQA 2V3WA 5KWVA 2BFEB 2QJOA 3HQ4O 4QU5A 4KQ6A 2V1UA 4MEBA 1LVHA 4ZVNA 2CDAA 2VWHA 1XGKA 2ZTSA 2RGYA 4OMFG 1T43A 4AJEA 2QTTA 2R11A 1XE3A 1MABA 1A69A 3UEOA 3ZNNA 4E1VA 3R5SA 3C7CB 2GFQA 2E4UA 4E3WA 2PAFA 5JJIA 1L7NA 4MS4A 4N0PA 1YA6A 2WV9A 1JIQA 2OECA 2RHWA 2J85A 3ZU4A 4M83A 1O8CA 2JFZA 1NBMD 4FFOA 2WTBA 5FOWA 3DM9B 3UJ6A 3F8SA 4JR2A 1W94A 4J1SA 1KI6B 4CTJA 1XZEA 1VBNA 2AEJA 4JNCA 1O95C 1KJIA 2NO9A 2ZYAA 2CLLB 3L6OO 4RSRA 1SULA 5D7BA 1P73A 3MWGA 4ESHA 1OH6A 4MR8A 3R4VA 4DLTA 3ZHZA 4PG6A 5HZHA 1FP1D 4FQ8A 3ORYA 1G5PA 1M8KA 3Q6NA 3H2KA 2H0QA 4WAUA 1O6CA 4GMHA 4URWR 3TCNA 3TQRA 2CGEA 3F9CA 3KJNA 3P9QA 1UP4A 4G2TA 4LTDA 4RE6A 5ECDA 3U7QA 2CWDA 4B80A 1EVEA 2JJ2A 3WK7A 2MINA 3EZ7A 1PN3A 4O2BF 1CUJA 5HPYB 4B9AA 1HNWB 1P5FA 5FLXA 1HNZB 5H81A 5J58A 5FD8A 1CK4A 2QE7A 1T36A 2G1KA 5COBA 1G8GA 2PUTA 1N8KA 1PZNA 1ZPDA 2CBZA 2E4VA 4K40A 2XAAA 4IIEA 2VTKA 1Y63A 4TMFA 4CM8B 2VNAA 2OHIA 4JUAA 2X8AA 1SEVA 4GOJA 5CX1A 3D8NA 1JHUA 1U2QA 2EW1A 1NC3A 2ZBDA 3NV7A 4I1YA 2P2DA 4MV0A 3KOZA 1JWBB 5K3AA 2FHPA 4ACBA 5EUQB 2O0MA 3NGXA 3PNLA 4OQNA 5EJGA 4B81A 1GQYA 3MSCA 3RU3A 2Y1DA 4MB6A 2H4YA 3HXOA 4KO4S 2UVPB 2ZWIA 4JX8A 1G9TA 5FHRA 5CFPA 2WJIA 3OIDA 4O4JB 5EIWA 3UTDA 2W71A 4I08A 3I5XA 2P27A 3E03A 1Q3HA 3I6QA 1EQUA 1ZYUA 2VDRB 2ZR7A 1A8PA 1E1QA 3QBDA 5B7QA 3AWDA 2XB6A 2AG0A 3HB0A 1M67A 5LZ4A 5JAIA 3RKUA 3M81A 4BNVA 3B6EA 2YNMA 4TMXA 5EJFA 2G1PA 3PXCX 1A1VA 1Z29A 4E1BA 3I5YA 4OATA 3CEJA 2K6GA 1KYIA 4ISCA 4UDYX 3CN7A 2IV3A 2Z9CA 3T5TA 2C29D 2W6NA 3ZHRA 1NVFA 4BX8A 2QGNA 3GFPA 3ML1A 1GPKA 4GBJA 3A1DA 4MVCA 3Q8MA 4EAAA 5BUQA 1GGEA 1OSNA 2WJYA 3G8AA 3LUHA 2XCIA 1C3XA 1LQTA 4I9NA 4JFAA 3QBTA 4GE3A 4X63A 5TR9A 5K8JB 1NXVA 1KS9A 4F46A 4RYDA 5J5CA 3B9PA 1KC3A 2H6EA 3DE6X 2ATEA 3AEYA 3SCZA 5I01A 2CMFA 4ERXA 4N3CA 3BFPA 2X1MA 1HH4A 4DMMA 1W581 3ENZA 4CU2A 2O3RA 4PSVA 1I3OA 4O2RA 4Q66C 4C0SA 5B58T 3C3PA 1HYQA 1KARA 4FXOA 4D0NA 1FDUA 4IDHA 4PQEA 3LUDA 4C3ZA 5D01A 1JEOA 2QVCA 2CK3A 2R8XA 1EFAA 4RELA 5H7XA 3GDWA 1CUBA 1JFFA 4MYSA 4R69A 5CNJA 1FSFA 2OV1A 4Z54A 5KSOA 1VG0B 3WK4A 5KYUB 1ACJA 4PYKA 2XOXA 2NXNA 2ZCUA 1K6MA 1K6IA 4DCJA 5BW6B 4F4CA 4DJTA 1QO7A 4U8GA 1K8XB 4B8ZA 1KVQA 1IQ0A 1RXWA 2GZRA 3VU3A 2C98A 1K6EA 1GT6A 2AT1A 1MO5A 3Q0TA 5L9AA 3I2HA 9LDTA 3WWEA 1QZXA 2H5EA 3PEEA 4G56A 4QOIA 2XLCA 3HO6A 3DDWA 3S5UA 1NVAA 2YWCA 3LVQE 2QK4A 4LF5B 2O0JA 3OURA 4FW8A 4IJKA 3IP7A 1FOEB 3ISVA 3L4BC 1KKMA 3TQHA 3W1VA 4CEIA 4ZCIA 5A05A 1FXWA 2IYNA 1KXJA 4L5BA 4JJGA 1UPTA 4GYYA 4G1FA 2B21A 1HDEA 2WSSA 3U1BA 2PSSA 2PVSA 3KVYA 4IMRA 1R2QA 2YIVX 3F6SA 4QQNA 4XYLA 1Z08A 4EGAA 1Z0FA 3IMKA 3PQ2A 4J7CA 4WZBE 2O2ZA 1QM5A 1Z5GA 1ZI9A 4HRVA 3UW3A 4A0RA 5K03A 4CEHB 1KMHA 4GOND 1U5BB 4B1FA 1J99A 1RZVA 3E9RA 4UU8A 2OWDA 5AVYA 1JAIA 1QF7A 1O89A 4AN0A 1LPNA 4FWIB 1RQPA 1RZ3A 3Q3VA 5DFAA 3RYIB 5JSZB 5LZ9A 4X94A 3ZHQA 5KTOA 1CF9A 2V74B 3IIJA 3AJAA 1YOBA 4S2UA 1E0KA 1E8NA 1N6PA 3DFUA 4QECA 2D8MA 4ZPJA 2W70A 2BM1A 1XWFA 2QM7A 1W5EA 1LDBA 3KIPA 4Y1RA 3DZ8A 5BQ5A 4YAKA 1U2TA 5LQUA 1BE8A 3T4UA 3WLPA 3KSZO 1Q0QA 2P4QA 3AUAA 2FPPB 4GGOA 1MFPA 2QTBA 4RNDB 4D4JA 3OP4A 3H0KA 5DM2A 4I4LA 4CI9A 5FAKA 3EMDA 5AM1A 2OV8A 2HBQA 4K6CA 2NZWA 4MUBA 5ITSA 5JNLA 3KQLA 4BGUA 1QP8A 4WLVA 3AF6A 2H54A 2POQX 3CEPB 4FCTA 1A3CA 3ZKWB 2Z09A 1A2KC 1E2PA 5E2AA 4BKRA 2L19A 1XCPA 1C5KA 1G4UR 3RC8A 2NVUB 1JLLA 1UAYA 1NW7A 2G1AA 3FE2A 2XD9A 1V5EA 2X3FA 5T8KC 3OKAA 2Z2ZA 2W2PA 2XDWA 1TZBA 5DKFA 3NW9A 2VDLB 4PFQA 3WGUA 1KFCB 2AUMA 2P9BA 3ILVA 5LOVB 1J7KA 2EGHA 3H4MA 4PXYA 1YBMA 2XA1A 4UULA 5E9JA 3FOBA 3SZRA 5JRDS 3PDCA 2PXCA 5LQNA 5FXMA 2FWAA 3M82A 3T3OA 2G63A 3M3HA 5B36A 1DPFA 3KQPA 2G76A 4MUIA 5E8RA 4YRNA 3ANTA 1A82A 4Z99A 4UTVA 1T5SA 3LBAA 4Z9BA 5K0FA 3QMPA 2O5CA 1Y7TA 3D2LA 2WAAA 2Y8EA 4EDFA 4QICA 5LCXA 3JPWA 4DLVA 2FI1A 3PQ8A 1LDMA 4QT4A 4KXQA 3AGPA 5FR1A 1U2SA 1JKFA 2E9SA 1UK7A 4CIYA 3KSMA 3DBVO 4WPGA 4NMWA 2VSNA 1G98A 3B8EA 1JPNA 5J4VA 2ATCA 3LUGA 5ERGB 3E27A 4O4HA 1VRVA 1ADBA 1KP3A 3DDHA 2WJ4A 4MKZA 2HN9A 2Q62A 1J6UA 2BKXA 4GWLA 4K1LA 5G4KA 3VPGA 4B4VA 5L3QB 3G2IA 4YQYA 3MLBA 4NRDA 1CZOA 5LBIA 5D1NA 1D8AA 2YJZA 3BA6A 4MYDA 2QYTA 4KIGA 2RD2A 1N2CE 1MQ9A 3ZZMA 4KR2A 1V0JA 1F12A 1ODSA 3KYCA 5AVRA 5JYCA 3L7NA 1Q12A 3VR2A 4Q01A 4LHZA 2RGDA 1FW8A 3H9BA 4D2IA 5IHXA 2PLWA 1YZ3A 2J6BA 3PDWA 1II0A 5JW6A 2EL9A 3IT0A 2B83A 2BF7A 3OP1A 4ZAZA 2VCEA 1NDQA 1E1CB 4EJSA 2ZGVA 2FN4A 3EMKA 4JXJA 1BGWA 3GMSA 4MCHA 5EHNA 3L0SA 4NESA 3T41A 1AMOA 3IMGA 4D9BA 2YMPA 4MCIA 1GY8A 1LJLA 4MOWA 4RPGA 4EEZA 2IIQA 2ZE8A 2GARA 4XFKA 4RD6A 2YBDA 4HYYA 4R68A 3BZUA 2ZR0A 3T0IA 5KNLA 1W29A 4FGUA 2XKKA 2ZSEA 5CK4A 5TF0A 1UK6A 2HXGA 4EYQA 1IULA 4LMRA 2SCUB 3IXLA 221PA 4QYIB 4BMNA 5KOHA 5DWDA 3KX2A 1U9ZA 4JB0A 3AFIA 4Q47A 3RYTC 1Q84A 3QFFA 4RVUA 1ANKA 5K3FB 1WL8A 3C97A 5EJ4A 1VG8A 2N1MA 4RTOA 4GVLA 1G5RA 3MOIA 4UBLA 1YJ8A 3I0ZA 4H17A 2VYVA 1FRNA 1NW8A 2PQ2A 3AGQA 1E9FA 2M6SA 1L1QA 3GCWA 4D3YA 2HJWA 5JVDA 4BIMA 3JQRA 3NKFA 5HF6A 3WQBA 1CQPA 3K2BA 4UUOA 2P5UA 2M98A 4XKJA 3K70C 4MQEA 1P44A 2HCBA 4ND2A 2CV2A 2Z2IA 4KTVE 3QIAA 3ZDYB 1NYLA 2WM3A 1Q44A 4M22A 4MGIR 1MUUA 3Q7PA 3O4RA