3NOVA

Crystal structure of d17e isocyanide hydratase from pseudomonas fluorescens
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
230
structure length
230
Chain Sequence
GSHMAVQIGFLLFPEVQQLELTGPHDVLASLPDVQVHLIWKEPGPVVASSGLVLQATTSFADCPPLDVICIPGGTGVGALMEDPQALAFIRQQAARARYVTSVCTGSLVLGAAGLLQGKRATTHWAYHELLAPLGAIPVHERVVRDGNLLTGGGITAGIDFALTLAAELFDAATAQRVQLQLEYAPAPPFNAGSPDTAPASVVQQARQRAADSLHKRREITLRAAARLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords ThiJ/PfpI family protein
publication title Evolution of New Enzymatic Function by Structural Modulation of Cysteine Reactivity in Pseudomonas fluorescens Isocyanide Hydratase.
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 78
structure length 230
sequence length 230
ec nomenclature ec 4.2.1.103: Cyclohexyl-isocyanide hydratase.
pdb deposition date 2010-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3novA00
4LRUA 1GG9A 2AB0A 3PQ7A 3PQ8A 2YWBA 5E9AA 2VRNA 4AUEA 1CF9A 4ENPA 2R1VA 2VPIA 1OI4A 3PQ4A 1QWSA 4UCFA 2ABWA 3TTSA 4ENWA 1U9CA 5SY9A 3TTXA 4N0MA 3P9PA 3SF8B 3UOWA 3ZR4B 1T0BA 2W7TA 2ZUSA 2ISSD 1JVNA 1Q7RA 4Y1RA 1WL8A 3M3PA 4B31A 1KA9H 1FYEA 2A9VA 3B3AA 2R1TB 5SY6A 4OJYA 1GGEA 3L3BA 4I46A 2NV2B 1GGHA 1OX5A 1A9XB 4P5PA 4UOQA 3TTTA 4P36A 3P9RA 4RKYA 1CS0B 1PDVA 3NOVA 5SYAA 2H2WA 4B7AA 3TTVA 4PXYA 2VKTA 4ADSG 1Q2UA 4P34A 1VCNA 1P5FA 4Y1EA 4GUDA 3CY6A 3F71A 4WINA 2ZUTA 4B2YA 4ENSA 4RKWA 2D7JA 1GGFA 2AD5A 4AULA 2IUFA 1IPHA 4L8WB 1N57A 3L4EA 1VHQA 4MNTA 4Y1FA 2GK3A 4WXYB 1SOAA 3SF8A 1ONSA 1PV2A 4P2GA 1L9XA 4ZDIA 1KWGA 1KEEB 4GE0A 1QF7A 3PQ3A 4R7GA 1T36B 3SOZA 1VCMA 3FSEA 5BV2P 4UZSA 4OGGA 5DFAA 3UGJA 1CE8B 2R1TA 4ENTA 1SY7A 3P9SA 2YWCA 2RK3A 2ZUUA 3TQIA 4XLLA 2GHRA 4BFLA 3EWNA 4ENVA 3NOOA 4LGYA 1GGJA 2V4UA 2XF2A 1P7YA 4K2HA 2RK4A 4OFWA 2VDJA 4ZDKA 1M6VB 3B38A 3CNEA 4OIFA 4ZDJA 1C30B 4E5VA 4D1YA 1JDBC 2YWDA 1FY2A 3PQ2A 1QVZA 4ENUA 3R74A 5JZOA 1I7SB 4L7QA 4AUNA 2R1VB 3KKLA 3NVAA 1OX6A 4Y1GA 3OT1B 3TTWA 4P35A 3CZAA 2R1UA 4HCJA 1PE0A 1KWKA 1I1QB 3UJNA 3TTYA 1UCFA 3EJ6A 4QYTA 4E08A 3EN0A 3FIJA 4MTCA 3B36A 4L8FA 3UMMA 1G2IA 3CYFA 3PQ5A 1GGKA 2RK6A 1GPWB 1QVWA 1R9GA 1OX4B 3NONA 1O1YA 3L18A 2ZUWA 4AUMA 4JQSA 4UNIA 1T3TA 3MIIA 4Y0NA 1C3OB 1J42A 4QYXA 3ZJ4A 3F5DA 4L95C 4UOZA 3EZGA 4B40A 1I7QB 4OGFA 1GPMA 4ENQA 3R75A 5LIRA 5IP5A 2WJZB 5K4AA 4L78A 3NORA 3VU3A 4BTEA 2VXOA 3L7NA 3R76A 2YWJA 3N7TA 3BWEA 3CZ9A 2ZUVA 1P81A 1IZZA 3OT1A 3ZJ5A 4B5KA 2NV0A 1KXJA 3EFEA 3NOQA 4I2NA 1IZYA 1P80A 3WFZA 4ENRA 4ZGGA 1VCOA 2OR3A 1P7ZA 3RHTA 1K9VF 3P9QA 3TTUA 4N12A 3D54D 4Y1RB 3ER6A 1OX4A 4MGHA 3GRAA 1QDLB 2LXNA 3PQ6A 4BIMA 1OY1A 4GE3A 4L8YA 3UK7A 5SY4A 4AJ9A 3BHNA 5JZMA 3MGKA 4I4NA 1PDWA 1QVVA 2FEXA 1S1MA 1BXRB 4OQ4A 4S0ZA
chains in the Genus database with same CATH superfamily
3V3TA 1Y3HA 3NHFA 1D9XA 1UMCB 1PEDA 3WWOA 3O7MA 2W5UA 4P84A 3WRXC 3PD7A 4ZIRB 5CRIA 5KX5A 2JIMA 1FP4A 4HKTA 3F73A 1M6NA 2JGDA 3C3BA 3AJRA 4DA7A 2KW5A 5JOQA 4C4SA 1SCUB 1E0DA 2OENG 1K0FA 3CUUA 1IDN1 3T1VA 1RACA 4B6RA 3A9VA 3KR0A 1T0IA 3ROMA 1X13A 2C9DA 3AI3A 3P19A 2OZKA 4NBSA 4C0QC 3OTQA 3TEMA 2JJ1D 3OTOB 3M1YA 5KTKA 1JT2A 2ZUSA 2QM8A 1E9SA 1NVVQ 3AJDA 5JSKA 4EY4A 5C2JB 3FCUB 1UBFA 2YNMC 4WFIA 3QQ5A 1T2CA 4RIGA 2P7IA 1PP4A 1SHJA 4F5DA 1P60A 2H7CA 4ZQCB 4PRKA 4CHGA 2BKAA 2QRNA 4RUKA 1CS0B 1BXGB 1LLFA 1O95A 4UM9D 4E5SA 2DFDA 1IZ9A 2VPTA 3BMCB 4ZRDA 3J7TA 4JK3A 4BE7B 3GDHA 3OO1A 1D1SA 3IIKA 2QL9A 1FK8A 1OBVA 2R44A 4M98A 3LP8A 1ZGCA 5KCMA 4CCYB 3PE4A 4X24A 1Z3IX 2QM3A 4A8JC 2EG9A 3ZVKA 4AYXA 3OOSA 4FEGA 3BZUA 1JVSA 1UC9A 3AU8A 3MLEA 2JK1A 1H2ZA 3KDSE 3UOAB 5I48A 3UPUA 3M6WA 4NFHA 1YCFA 3GEHA 1OVMA 1VG0B 1K97A 2EP8A 2GD2A 3RRJA 2HSGA 2ZSUA 5EXEA 3HUEA 1YKGA 1PGPA 3PEVA 1MORA 3C1OA 3TI9A 3U31A 4L8VA 3MNFA 5IARA 4YMUA 1MAVA 1FY2A 1TQ8A 3VHXB 4NTZA 1OBHA 3WIDA 1Y8RA 3I45A 4U0KA 3K9QO 3W7BA 4TROA 4CM8A 4D4GA 1Y4DE 3K20A 2APJA 4UU8A 3ZE9A 4LY3A 4JI0B 4P93A 5HA5A 1LWNA 2MSDB 1RXVA 1K63A 1TYCA 1XXHB 4Q3DA 3S1LA 2IXAA 3NQ41 2WVAA 1GA1A 4E08A 2YJZA 3BG5A 1EE2A 2CXTA 3IBYA 1XDWA 2RJOA 3ONWA 3SYLA 3OJXA 3SYKA 3P9NA 1L5MA 5KSYA 4I3HA 1EESA 1P75A 2FPLA 4D9MA 1JRLA 1UINA 3IRVA 4KXYA 4KOEC 2IBMA 3IILA 5F9FA 4G2NA 4JC8A 3G0IA 4ZVLA 1UK6A 1JJAA 2IV2X 4AJ4A 1E2UA 3OPXA 5KJ1A 3WGUA 3ELUA 4FB4A 5IH3A 1M5RA 1AK2A 3CM0A 4L5BA 3B3QA 3EGEA 3QFFA 4YUYA 1ELOA 1SKYB 1UWVA 1QG0A 2AE2A 3C3YA 5FFFA 4CV1A 3B6ZA 5A0FA 1Q0RA 4DV7B 1G20A 5D00A 4O2AB 4RA6A 5ALJA 4DJJA 4QLBA 3DGFC 4JBNA 4KVZA 1LD3A 3NCHA 1ECFA 4Z99A 5CMLA 3WGKA 3DL4A 4LFCB 1DNPA 5ED0A 5HMMA 3ESRA 3L0BA 2OUKA 1PRYA 4GT1A 2QN6A 2R6JA 3A7DA 1KJQA 1Z6GA 2IZZA 3LWNA 3PRKE 4L72A 1RFGE 2YJTD 3LQKA 2W8BB 4A2CA 2PS9A 4GLBA 1IEXA 4RQBA 3LY7A 1DKNA 1GL9B 2LZ0A 1W44A 2XRZA 1N34B 1RI3A 4L0QA 1ODTC 2CKMA 4XDHA 2Z9BA 3K31A 4MARA 4NQZA 1XNQB 4LVUA 4O8ZA 1R8JA 2IV7A 2PUVA 4E7PA 3GLGE 2DPXA 1C80A 2DUNA 3Q8XB 4MWBA 4A8HA 3F49S 1VC2A 3DO5A 3EQ6A 3WIVA 2OO5A 3WV5A 4EA7A 1S6YA 3FGZA 3K2BA 5DTMA 4CLHA 5KOIA 2P2NA 3H1TA 4KPGA 3TZ6A 1AZLA 2C2BA 5CVTA 1XTSA 2X76A 5KTMA 1ZOIA 3PGVA 1OYWA 4PZCA 5G4KA 3S99A 4EA8A 3GRYA 5AHKA 1E3TA 4PYNA 4ZVVA 2RH4A 4U0JA 3TOCA 4LPKA 4QNRA 6REQA 3HV0A 3SC2B 5IAAA 3VO2A 1KPGA 3OMXA 2WI8A 1FP1D 4B7AA 4PXYA 2CXPA 3OFNA 3OAAD 2V6GA 2OXFA 3QKIA 4AECA 2LD4A 1NYQA 2IS4A 4CMBA 5IVPA 3OLYA 5IEBA 4W1PA 3UJAA 5JJBA 4R0NA 1G6HA 1BX3A 1S3GA 1LBHA 1USUA 2RHTA 4R8LA 3VO8A 4FDUA 2ZCJA 2DWUA 1FXSA 1LGYA 1D04A 5HW0A 3EODA 4H17A 1Z5VA 1T36B 2MJLA 3ABQB 4MB6A 4MX8A 3RASA 2XRYA 1JVBA 2CL5A 4TUYB 2NYVA 3UUFA 5LQUA 5FTNA 3WFIA 4ISCA 4P92A 2YFQA 2XTAA 1AH2A 2VHJA 1EHCA 3KQTA 1HT0A 3KB6A 4JEMA 1CG6A 4TV8A 1MIHA 1SA0A 3QEMB 4CU5A 5TMBA 2DLNA 3RKUA 2H4FA 3QPUA 1G8KA 2H52A 3FSGD 6AT1A 2EFEB 3ZXIA 5BWNA 3MS2A 1Z26A 2H1CA 4IDAA 3SHWA 2HLNA 1VQ1A 2P7HA 3EZFA 3IKVA 1UP4A 5IDYA 3UUWA 2I91A 1MR3F 2AF3C 1YVEI 1KJYA 2B2XA 4ZZ1A 1X3SA 3EVEA 4L2IA 4OH7A 2AJDA 2WHPB 3CLRC 3M81A 4KDEA 2UXCB 1BDJA 2W6ID 5AOVA 3RVKA 1W581 4FONA 2AUMA 2H5IA 3D6FA 3P52A 1VDZA 3IV6A 3V7WA 4IIHA 5HRCA 4A1OA 1SO8A 1UXOA 3UFBA 4DWVA 2CBGA 1P18A 3FRIA 3NBFA 3W04A 4ETWA 2IZ5A 2JCSA 3L18A 1Z74A 3O4JA 4GEGA 1XTTA 4MK4A 3KTFA 1SQ5A 4WKOA 5IKPA 4KVGA 2EEZA 4O4IA 1LWOA 5JXJA 2F3PA 1C9NA 4XWWA 1U2PA 1H6BA 3X3HA 1HDGO 3SWWA 2AE1A 4MR7B 1VI5A 2A5GA 1QGUB 2B1RA 5AUOB 1XDBA 3TRKA 5JMTA 5LOVB 2F90A 3TX6A 1SM4A 1W5EA 2ERXA 1H1LB 2X7HA 2FHSA 1G9XA 2BMVA 2CVQA 3D1LA 4NAUA 4RELA 4U2KA 5TQVA 4NBNA 3QWHA 5BRAA 1DIRA 2ZAIA 2GAIA 2W6ZA 4N65A 2CMHA 3KFXA 4WIAA 1CR6A 2JLAA 3HL4A 4WKPA 4EB3A 1PJRA 5ES4B 2VDRB 3HSYA 2DKNA 1SBCA 1ZVKA 1QDLB 3QBVA 2V9ZA 3EEYA 5HM6A 3S5UA 1WLYA 3VYTB 2WBLC 2YCBA 1SIUA 4QDOA 3LZCA 1GQOA 4N6OA 5I47A 2HQOA 3C8UA 5TGDA 2XNSA 2FV8A 1U0HC 1Z18A 3RTAA 1B14A 3NFYA 1M9NA 4BVHA 3CE6A 2G1PA 5EZSA 2A5JA 5KVCA 2FX2A 1KSHA 2GEKA 5BUQA 4RE5A 1KORA 1P0FA 3IHKA 5FDFA 2Q9BA 3GZNA 4OVKA 1WMSA 4CIAA 1T0HB 2H9IA 2Q3EA 3DV0B 2FVYA 2X0FA 2B25A 4BNGA 4BUZA 4BJ1A 5A0TA 2H2FA 3P2YA 2QM7A 2ISSD 3LU1A 5IC4A 2IXGA 3DE2X 1MAUA 2BD0A 1AHPA 1LQUA 1PWZA 2FG5A 1EKXA 2XYVA 3ORQA 2FWJA 3FH0A 2F3SA 2ZUBA 3CMCO 2ZRLA 4F3NA 1YS6A 3R7BA 5I9LA 4DR3B 3L3BA 1O87A 3PFHA 3SHFA 1SQ6A 3KYDB 1QZTA 3RUPA 5FRDA 3EH2A 2ZXFA 3OCVA 3KG2A 3MYRA 1ZOPA 4KXWA 1JB9A 5F3WB 2WIKA 5SYNA 3VGJA 1QIKA 2QLMA 3NHBA 3W78A 2VJBA 4UEJA 3L8HA 3KXPA 3KE8A 1VPVA 1PZMA 4NG4A 2F64A 4PIVA 5DASA 1RWXA 2B4RO 1JEEA 3MTIA 3ZHSA 3BS4A 1B8UA 3V1YA 2QR2A 1XDZA 1VJRA 3IXMA 2FWIA 3UGJA 3UMYA 2HYIC 2ZUEA 4HEA6 3AG5A 3FR8A 4AWXA 1X1TA 1N6HA 1S8OA 5LA6F 4IHJB 2FZVA 4JITA 4FLFA 1TIKA 2EQ5A 1V5EA 2B1IA 1JV2B 5EQDA 3ZTTA 2AR7A 3I4FA 1IZ0A 3FOWA 4E5YA 2VPQA 4F4JA 5BN5A 1UDRA 5EZ6B 4OXXA 1NXWA 4JP3A 4DMMA 4EP1A 4EGCB 4MS4B 5IM4F 4ZTZB 2I55A 2WYOA 3D3KA 3HU5A 4TKVB 1MX1A 3KKLA 4MIEA 4BO5A 4ZYUA 1G5HA 1OX6A 1R5OA 5LPNA 1VP9A 1BN7A 1SPXA 3K0FB 3TTWA 4CNQA 3MTBA 3H16A 1UM9B 5JCOC 2LDBA 2GZSA 4DLKA 3UMGA 2YXEA 5H9WA 5KNBA 1SVNA 3D4IA 4PGGA 5EHNA 4BXOA 2AFHA 3PGJA 1Q20A 4N3GA 5EFZA 2Q3CA 3GFGA 2PD6A 1EVZA 3RKRA 1VE7A 2DM6A 2J9YB 3EMVA 3RAGA 3E9MA 4PZLA 1YCDA 4EUHA 2NUPB 3VPAA 3C7KA 1S7CA 2GBIA 2P90A 4IY1A 2NU9A 4QOIA 1Z2EA 1GTG1 5IYZF 4MR8A 3ADBA 2JFOA 4INJA 2QP4A 3VKFA 5KX5B 1FP4B 1RRFA 4ETMA 2JGDB 3OIFA 1KP9A 3OT1A 1DCFA 4BASA 4JD5A 4ZVQA 3QVVA 4BLWA 4XUCA 4DRZA 1CVRA 3G8AA 4UTNA 3E1GA 1GY8A 2Y0BA 4DRXA 2WJWA 3N87A 4NXMB 3A1DA 4J91A 3RHTA 3QNUA 2B7BA 2DECA 1BS9A 2GDJA 4OPMA 4V2UA 4X1KA 3BXOA 5JPDA 2WU4A 3E61A 4ND6A 4EBFA 2WD7A 3DV9A 4U00A 5EJMA 1J2EA 5G0SA 3UK0A 2BFFA 5HG0A 4AJHA 1PJBA 5A9RA 1QRTA 2DTDA 3QKUA 2RGRA 2A33A 2HK6A 1LPSA 1PT6A 4B71A 1J56A 1TIPA 2J6HA 2HTFA 3ON5A 5DRYA 1GZHB 1Q7CA 1JLHA 6YASA 3GFOA 4C05A 1M10A 3C24A 3AT1A 3DMYA 1WXDA 4NF2A 1ATIA 1XPJA 1NUHA 2GM5A 3IYLW 3OIVA 1ISHA 2WUEA 4IMPA 1HQYE 2Q1SA 1QCDA 5CFOA 5K0SA 1T0BA 1XYGA 2PH5A 4WNIA 2FMTA 1HLPA 1UF9A 2OBFA 2WZQA 2HRZA 1SIBE 3IOMA 3LQ4A 4DBZA 3ZTYA 2W6NA 4NNPA 4XYLA 1IN7A 1E5LA 1PFGA 4C0LA 4KHPB 2H08A 3RS4A 3JS5A 2PH3A 4IWYA 2PWZA 4P82A 1BHSA 4IJ6A 3MCTA 4RKYA 5L7WA 1VDMA 4WSOA 4KLNA 4W63A 1S3FA 3QE9Y 1ZU4A 3DSRA 5EJAA 1UQRA 1IB0A 3A3KA 3AYXB 2YQZA 3BAFA 3NC4A 3TOVA 4MDFA 2V9PA 1E8DA 4RKWA 2GPNA 3M1AA 1UQUA 2QLTA 2V7TA 2VPPA 4KI0A 4MKRA 2XVXA 1A88A 1Z35A 2XUIA 5DCLA 5G0VA 4CM8B 3IIIA 4KPFC 3HH8A 1ONSA 3OAAA 4EO7A 1E59A 3V9PA 2Q1UA 1DEHA 4QASA 1O57A 3IULA 3QU4A 3O3NB 4HQ0A 1WF6A 2GEVA 2OCLA 4MV1A 2O54A 4WD3A 3DKIA 3KKKA 4YHBA 3V48A 1E2BA 5CCEA 3E84A 3I8XA 2P9TA 5IN4A 5C5CA 4MAFA 3CF4A 2IRWA 1F2DA 5E3HA 4LHSA 3RANA 3UT5A 2GN1A 2O7QA 5EMLA 1V16A 3S2GA 3IV9A 4Z2YA 2BUBA 4GLFA 1NJ5A 1KFJB 2WWHA 4LTNA 2VYVD 2VK4A 1OF1A 4F84A 3KLMX 3GFTA 4QTXA 3K92A 4WNCA 4LOAA 1I3MA 3N8KA 2HX1A 1QHFA 4PPQA 4R9SA 4MQMA 2ETXA 4X6XA 3KJHA 1CQIA 1G20B 4QG7A 1LRJA 2JNWA 4LSMA 1YR9A 1Z8HA 4G36A 4ND1A 2H0RA 4KIJA 3VJKA 4X8LA 3EF1A 3Q2KA 4KYVA 3KDAA 2YW9A 4L3VA 1NQXA 1FP6A 5TPWB 1G3MA 1G2IA 4E3WA 5CM8B 3PUKA 3BHIA 2V7GA 1N9ZA 3ZLVA 3LY5A 1MLDA 2PRYA 3UA3A 2NVUA 2IU0A 2SKEA 3CKYA 4L76A 1MEEA 1W8DA 3FHLA 3VO1A 1ILEA 3EEBA 4FNGA 4BNJA 2J48A 4H0NA 3HZOA 1AS0A 2VJMB 1RAGA 1INLA 2V45A 3HEBA 1WVMA 1ZK2A 3OJCA 4IZOA 2V98A 2YR0A 3EH1A 3ZJUA 5B1EA 3MBOA 4GMGA 4QU8A 4BKRA 4EL0A 3TRHA 1NBHA 1I5OA 1TXGA 1UKBA 4YRCA 4ER6A 2JLXA 1NV8A 2TSYB 4A8PA 2QP3A 1M1UA 1NP7A 4Q9HA 4N3BA 1A77A 3ER6A 3T1OA 2Y71A 1RI5A 2Z3ZA 3N6XA 4BNMA 4DQUA 4EF4A 3A9UA 2WILA 3UK7A 4A2WA 4M1YA 3HYNA 1OUMA 1MRSA 1S1CA 1SVWA 1SXJD 2R65A 4FFRA 4PLGA 5DMHA 1FFDA 3RVLA 4D9FA 2P68A 5A3RA 2XHZA 3RC3A 1OC2A 3PNBA 1BNCA 4QVIA 1ZK3A 3OZFA 1DIBA 4PC1A 1CUEA 1JIVA 4JT2A 1C9MA 1NUAA 3GVHA 4Q3BA 3KU4A 1UJ2A 1AF7A 3ENQA 1GZUA 2MDTA 2NTJA 3N8NA 3QFCA 4JLMA 1V3TA 4E5DA 1OH6A 1NI3A 1PTJC 4EUFA 3G9UA 1ZD8A 1RXSA 1W1WA 1ZLXA 4RVOA 1ORWA 2ZIUB 3A4LA 2ZI9A 5E1OA 3V34A 1G8SA 1QHIA 3ZU6A 4DMGA 2X9LA 3B1YA 4O2AF 5JATA 4UUQA 2XB8A 3WIBA 1P9NA 1RWNA 3LUCA 4G56A 4X1YB 3WJ2A 3ZQ6A 2DQSA 4C7KA 2D7DA 1NVMB 2HH9A 4YCNA 5KSWB 2NIPA 1NMEA 4U7GA 1KERA 1NR7A 5IANA 4J1TC 3DPUA 2DUWA 2D1FA 1MJGA 4WV3A 3ZIDA 4OJYA 3RIHA 4TV8B 4RMGA 3IALA 4FGLA 1SA0B 3C39A 4G01B 5EE5B 3ZGXA 3MCVA 4N82A 2IHBA 3NOVA 2JIOA 1C9DB 2HFKA 1BHQ1 3A3OA 3IIEA 1SD1A 2A59A 2XJ9A 3PXUA 5A4AA 2G1JA 5K05A 3BE8A 3AZQA 3I09A 3ZCVA 1THGA 1G6KA 1FLAA 4N0EA 4WZZA 1GT91 1KP2A 3YASA 3NEJA 3RO7A 1FJHA 1DMSA 4L2IB 2E4WA 1L9XA 3HYTA 2NXWA 2XWSA 5ERYA 4DF3A 2I67A 2VCHA 2VZEA 3OT5A 1GDHA 5BSWA 2HIAA 4IZHA 4U2EA 4P4TA 4RZXA 4B4KA 4YY3B 2X0IA 1N5MA 4HEA1 3WA7A 3KU1A 4MHSA 1DWUA 4O4IB 4DABA 1XU7A 4PCLA 3UCXA 1J23A 2HO4A 3DHEA 3EXG1 1M8JA 3PYMA 1M7BA 3PXCX 2PE5A 2R79A 4TVKA 3FD8A 1LY1A 2O3RA 1MQAA 3DDWA 3O2NA 3KJZA 4TXNA 1F7UA 1P0MA 1NNSA 1C4OA 1V4BA 1X1DA 4DJ5X 4ALIA 4MH0R 5CYOA 4K1XA 5CPFA 5SZHB 2E87A 1OI2A 2C4WA 3U49A 4OHOA 4UTXA 1T26A 1XAIA 2VDWA 1Q1NA 1YJXA 2RGCA 2ZXEA 2DWOA 3ES9A 2QR3A 4G0QA 4PU0A 4QOSA 4D4HA 4Q4HA 3MMZA 4RIFA 3HJAA 1QO9A 4TUYF 5AKJA 1H85A 1NX9A 1GVNB 4I2VA 5CBKA 1QHXA 3L5OA 3I83A 3N75A 3RU9A 3WLSA 2GILA 2HA6A 3IAFA 2D6FA 3F3MA 3CZCA 3ZJ4A 2R60A 3CPHA 1G8AA 3JQFA 3Q7EA 1KFBB 2H4HA 3HEMA 3R7WA 3SJAA 4EIWA 5EFOA 4QVGA 3ZDXB 3KVYA 1D2CA 2X23A 2WW8A 5JVDB 2Q6TA 2Z56A 3RRNA 3FTNA 2LCFA 3BWMA 1ZL2A 2J0UA 3K1YA 3GHYA 2RGNC 4V0KA 5ALDA 3JWGA 1PJLA 5JFGA 1F3OA 1CEEA 1PL8A 3RSOA 4KN6A 3GZNB 4CM4B 3NO4A 1VL2A 3EFEA 2AN5A 5EIWA 5D7NA 1DJMA 1G21A 2P5UA 2RAUA 3P71T 2MIIA 3IB6A 5IBCA 1CP3A 2CDAA 3VNSA 2C03A 3DC2A 3PQ6A 1E4VA 4NFLA 2O3QA 2QMHA 3WBBA 5EHGA 4BPBA 1SKAA 3ITEA 1QK5A 4CF3A 2WJGA 1SMKA 2PN1A 2XMSA 1PU2A 3LLSA 3MT7A 1DC7A 2ETVA 2DHCA 4NZ9A 1L5GB 2LVBA 3AVPA 5CM9C 4ZQBA 3S2YA 5A05A 2IXFA 1I4OA 1RWQA 4N54A 4QU9A 3LPDA 1TMKA 3KE9A 4KSBA 1RHRA 1HUQA 1QIIA 2I4OA 4G65A 3Q7QA 3VMMA 5BMVA 1Z68A 4FGSA 4P7FA 3VQTA 1SIWA 2FR8C 2H85A 5ELMA 2QEQA 1PR5A 2V7QA 4OJTA 4WZBA 5MN5A 1AG9A 2YY7A 3IBGA 3PUWA 2DRIA 5DX0A 4D8UA 1QF6A 1UDBA 3WLJA 1NR5A 5AW0A 3NMUF 3ESQA 4OHPA 3O0DA 4MWOA 5TXGA 4AWAA 2DT5A 4D8YA 2O5RA 3N8GA 1N2GA 3A1WA 3SDSA 3O1HB 5C34B 2B4KA 3RC7A 1VCNA 4UNQA 5KQSA 3LC2O 1O4VA 2J9RA 3GGDA 3EMBA 4JLNA 1WDTA 2QN1A 1G4AE 2Z58A 1HTTA 4PG7A 4C6RA 1YK1A 2QLJA 4AT1A 3PFCA 2ZU6A 3MGBA 3EHEA 3G9ZA 3VPSA 4ECAA 4MJ7A 2VS1A 2Y3IA 1CY6A 1MTOA 1VCMA 1O7JA 1XN4A 3D4NA 3NBMA 4HFNA 4XQ9A 3MJEA 5FP0A 3S40A 4Z6KA 3K70D 2FG6C 2PWAA 4BXOB 1E4YA 2AFHB 3STHA 1Z5NA 4KIGA 4YAWA 3RWMB 1VSUA 1GXSA 2AFRA 1JKFA 5DTRA 4FMCB 1PAUA 3MWGA 3R0VA 4K6OA 4O1MA 1WOMA 4EELA 2NXEA 5THKA 5I8WA 1Z8NA 1ZN2A 4ENUA 2JIBA 2V7XA 4F8EA 1I3CA 1NXVA 4MR8B 4Q1VA 2WVJA 4FW9A 5A71A 4PTZA 5FR1A 5AJWA 2FMHA 1LDGA 3QV2A 2C7OA 4OHYA 2XODA 2BEKA 1USGA 5C4IA 2XDYA 3OT1B 3UZUA 3V97A 3E5RA 2VP5A 1V8FA 4MYTA 4G4SP 1UCFA 3C48A 3MELA 4WUVA 3WIUA 4C4PA 1SUWA 1CE8A 4DRXB 4EMBA 4LBZA 5I4IA 5KOJA 2CHUA 1TVMA 2QDKA 1HRDA 5CHYA 3P2OA 1L2TA 3X2SA 1J8QA 2O0JA 4M0KA 4JGBA 4IHJF 2YZKA 4JQOA 5EJ6A 2WD7B 1UDWA 3CRNA 5IULC 1VB3A 2Z43A 5GM2A 5THQA 1NJGA 2Q46A 4WQMA 4DCTA 4GO1A 3DHNA 1GPMA 4DBVO 3C85A 1NWCA 3R44A 4GIBA 3V1MA 3SZUA 4LSZA 2J85A 2QT0A 2XF8A 4LBVA 4CLOA 2CCJA 3JPYA 2WE7A 1QIFA 1J8FA 2G4LA 3GB9A 1BQ4A 2ZUDA 1X92A 4OQLA 2I87A 2ZM5A 4LMBA 1RP7A 4JUAA 5IBPA 2C0QA 1NQUA 5HUJA 4I2NA 4EMTA 3TEJA 3OZBA 2IA5A 2CBXA 4QOFA 5DLDA 3LI2A 1XFDA 5BNIA 5AQEA 2QXUA 3HP4A 3THWB 1AU9A 3MD0A 1YF3A 4RA9A 4UXJA 1SVLA 1NAHA 3K1JA 2RH9B 2GM4A 1N8SA 1CZOA 2ZS8A 3IA7A 3VPFA 4CM9A 4UTRA 2CDBA 2X8BA 2RD2A 4XLZA 4YP7A 3D7SA 4LRUA 5AW2A 2P41A 3NIGB 4JJIA 4MB0A 4Z9FA 3HL0A 5FUXA 4QGGA 1RM4A 3L41A 4J75A 2DP4E 1BGWA 2I4RA 1RPAA 2X7JA 4ON9A 2QSYA 5DIFA 5IC5A 4BFXA 1CULC 4IDHA 3ZGYA 3OEHD 1U7DA 2PRJA 2NTYC 2F8LA 2II6A 1A8PA 1XK7A 4L5CA 5FAXA 1MX9A 3TTXA 3WLOA 4DFDA 2BGRA 3AJ8A 3ETEA 3OI7A 2HMYB 4OQPA 4K1LA 4X63A 4O2BB 4WL0A 4J3FA 5E4JA 5EJ2A 3TUIC 4HH4A 3RJ9A 1T5IA 2I6SA 3L6UA 4CEJA 2I5PO 3ZNNA 1Q3KA 3KUDA 1P7CA 4OIMA 5KYNA 1H4VB 1VL0A 2N3ZA 3UT5B 4P0PB 1SOMA 4J0DA 3C2QA 1NVXQ 3TINA 3LS2A 4IPTA 2OCIA 3FTCA 2J3DA 3K5HA 4GS5A 4WLVA 3VI4B 4EB8A 2W22A 5JMWA 2PUAA 2G9VA 1QQ5A 1MO5A 1NW9B 1SD2A 4KXNA 4TOIA 4ZAWA 2H1WA 1TUBA 2H4JA 3NR2A 3Q41A 1BA3A 2VH5R 4LF8B 2GXUA 1AKUA 1W2HA 1TW3A 1CQIB 1W0KA 2JGJA 2QD3A 1Q0UA 4F4IA 1T1RA 3AK4A 3ZY4A 3KLPX 4H16A 4BWFB 5FUWA 4KODA 1Q1BA 2XYQA 4PW0A 2XCRB 4HD8A 1V47A 4AKSA 1U0OC 2VCEA 1V2GA 4QQNA 1P45A 2NVUB 3MJFA 2Z8ZA 3IQFA 1YA4A 1J2UA 4R1MA 1P0IA 4OHVA 1SC4A 4WKNA 3HLYA 2SICE 2J32A 4LXIA 4W7HA 1KO7A 2PL3A 3JSAA 5F9HA 4K26A 1R0SA 1ID1A 2I3AA 2O1WA 4EYQA 2QOEA 4JBGA 4OI1A 3KAPA 4NQRA 5M29A 1EE1A 2ZSAA 1BWQA 2D62A 1C9JA 4IQ8A 4XSHA 3ANNA 2FFBA 3RUEA 3HB4X 2D3WA 2X6QA 1SFRA 1ZO8A 1NXXA 2JANA 2OORA 2QSJA 3PHLA 5BUCA 3FVWA 5EZQA 2HA5A 3QFHA 3ETNA 5DP1A 5DYYA 1IM8A 2JI7A 3E03A 4XFJA 2PMEA 3EFOB 1RXCA 3SPXA 5AKXA 4JOSA 1XPUA 2GEJA 3LVFO 3O26A 2J87A 2NQ2C 1R74A 1UT6A 1Z5UA 3ODGA 5FF9A 4M9UA 3FZNA 2EZTA 2QF7A 5BT9A 4W99A 2XBLA 2D2EA 1SUBA 3L7NA 1YHZA 1HKUA 4WXHA 4GPTA 3X0DA 4CWAA 3F8WA 4PN7A 1QTNA 3HXMA 3EFBA 4BQOA 1KIAA 4IDBA 3G3EA 1L5SA 5C7YA 2VQEB 5G40A 1EK6A 1C7RA 4ZANA 1IN1A 1RXIA 3ZWCA 3TQCA 3D5TA 1Y8ZA 2EGGA 5DF1A 4A27A 1QIDA 3DEZA 1XZJA 1JQDA 5A3SA 5TC4A 5IWAB 1DHTA 1XTIA 3KIPA 4Q4AA 4TTTS 1X1QA 2IPLA 2N46A 3F9IA 3AETB 5SY4A 3VOBA 3A1TA 1UPCA 3EZ9A 1ZGAA 2YY5A 2F43A 1UC5B 1LF5A 2RC6A 1KZ9A 1SXJC 1E7MA 3DTVA 4GRDA 3UJ8A 3MT9A 4YCBA 4D2IA 3FHTA 1K88A 2H1RA 2MYPA 3G49A 4ZODA 5B1HA 3G8BA 4DQXA 1TYEB 2P2YA 4LQCA 3WNBA 4FM9A 4LI3X 4RQAA 3VR3D 2CV0A 5K3OA 2RHGB 4TRRA 1Q92A 4OAOA 1R8SA 3KQNA 2ONYA 2CNWD 3H2HA 2VSFA 4FW8A 1C7JA 3Q7IA 3WKBA 4QYSA 2Z9CA 2YKGA 5TGTA 4OBXA 2FW1A 5E1DA 3UH0A 1ZQ9A 3GGPA 1CB0A 1KKLA 3HNOA 5ALUA 2B78A 1FU4A 3SY8A 4R7ZA 2K7ZA 1K6IA 2NUTA 4TTIA 5JZVA 3O21A 2CLKB 4XJVA 1DUVG 2OXCA 1IPFA 1J9GA 2OC9A 2VP3A 3I9LA 1JR3D 1MC1A 4M7RA 3P9XA 1WB5A 3QVMA 1CCWA 1SC6A 1A5BB 4CMEA 1XVIA 3HG7A 4F4DA 1BJRE 1N2ZA 2BFBA 4J3JA 2JI8A 2V5VA 3UTCA 2B3DA 3ZUGA 1U6JA 3HSKA 4WN3A 1RHKA 2HUNA 4YP5A 3RYCA 3EDYA 4YROA 3IQGX 1NQVA 4FZJA 3GUHA 1SQSA 3Q3GE 4JP1A 4KLRA 3EDQA 3QY0A 4WRRA 1B74A 1QK4A 2VDWB 4UZSA 1W5AA 4FFOA 2QORA 2JAPA 2Y1XA 1BVRA 2V59A 3DLAA 2VDOB 3E7WA 3IQIX 4FTWA 3GVIA 2FPOA 3N2KA 4HVLA 1AK1A 1JDUA 1GPKA 1YDFA 5EEHA 7ABPA 1QPBA 2H07A 3BD8A 3FLAA 1C8KA 5F64A 1PDOA 4M8KA 2RGXA 4C0HA 3IAS6 1PVVA 3RYHA 2VP9A 2N75A 2Y6VA 2VUHB 1VGQA 4RHEA 3R7WB 1JDBC 2V0NA 4WT7A 2IF0A 2JB9A 4BEBA 2JH9A 3ESZA 3WHIA 1YC2A 4L28A 2OFWA 1U9JA 4BIIA 5KEIA 4JVNA 4LF4B 2A86A 4X45A 4ZPXA 2J0UB 5ES3A 1NVTA 3QUQA 3B1FA 5TVKA 2UUPA 3AI2A 1T3SA 3N9IA 1EWYA 4FGKA 1P31A 1QLJA 3CW2A 2Q5EA 2QTNA 3EGVA 1FFYA 3BMXA 3MYYA 3RJZA 4XIGS 1MRNA 2UYOA 3R0QA 3PEYA 4IAOA 4ZJYA 1SRQA 5AP9A 3TQSA 2EW2A 4UDNA 2QJWA 1O6BA 4BE4A 1TKBA 2AMYA 3EIOA 4MS1A 3DJYA 3KPWA 4FC6A 1EK2A 3PNVA 4FJ1A 4RJLA 5C53B 4O4IF 1CFZA 2BMJA 5COQA 1ZI6A 5JAQA 2NPFA 3PUZA 3QWBA 1KZHA 4ZN6A 2FA9A 5JNSA 3A2MA 3QFRA 3Q3IA 4N5IX 3V4FA 5C1PA 1D0SA 4FS3A 2H1SA 4RZ3A 4FYVA 2DJIA 4HDSA 3GNSA 2HPVA 4U6NA 4FYXA 2I8LA 1F8FA 2CJPA 3MWKA 2IEIA 5BMVB 1UWCA 4MW2A 1DQNA 1E9RA 1UH5A 2Y4NA 2FUCA 3TIXB 1LJUA 3JQPA 2DVMA 4L4YA 4G5HA 5CVDA 3ZHOA 2AYXA 421PA 1FRFS 2C4HA 1XQVA 3R9WA 4NMWA 1W5TA 1I3NA 3FSJX 1ZICA 2D7CA 4LWOA 4CIWA 3F8SA 4JXZA 3ILYA 4IGAA 2QT1A 4IVPA 4B7CA 4DYHA 5TJ9A 3SCZA 1TVKA 3CF4G 3EXHA 1BYIA 2FFQA 2X1HA 2QD5A 4MLPA 1ULHA 2HK8A 4IP0A 1CF9A 3UIEA 5JVDF 1WZ2A 4GPIB 1RRMA 5CH5A 3CEPB 4K6GA 4V0LA 4UU7A 2AZDA 4JI3B 4IJMA 3MSXA 5KBYA 1FZTA 1R18A 4OI2A 3W5JA 3ZGZA 1PGQA 1T3LA 4WFJA 2IGBA 1Y6FA 1HORA 3GLIA 4MIOA 1L7QA 3O8QA 5KWVA 2ZIFA 3ITDA 1TLFA 1S4MA 2VAWA 1Q3TA 3G6WA 2AL7A 2D5BA 2BEUA 3NHRA 4PLTA 1CERA 2FMXA 5AXAA 1MJGM 1GXSB 2VHUA 2QN8A 3H0CA 3JYLA 3EPRA 1T8WA 3MQ4A 4B3FX 3OPNA 1QGAA 4RM2A 4U6SA 3NJ4A 4J29A 1IQ0A 2HHLA 2BFWA 3KT3A 4E3ZA 4BLOA 2L42A 3Q8KA 2QMUA 4MIKA 2Q4RA 1OASA 3CLKA 1VXRA 3PU6A 4EATA 3IHLA 2ZUTA 3U9SA 4LX8A 1BAPA 1TCAA 2AJTA 2DH6A 3HI6A 3OIGA 3X1XA 1OXUA 1Z9BA 1H8ED 4L8WB 5M5BA 1NVWQ 2H1LA 3A0RB 4HWKA 9ATCA 2BM8A 3D6AA 1RRKA 4PSKA 5LUAA 3V2HA 4X6YA 1N8NA 3MZ0A 1CE8B 4DLTA 5DLPA 3K70C 3FYCA 4MO9A 4ZYVA 2Y0DA 4ID3A 1YXMA 3JY6A 3FR7A 4J9VA 3UICA 1AE1A 1PG5A 1XMXA 3KJGA 3ZS9A 4KPEC 3S5JA 1QV6A 2ZOSA 3AKEA 4UCXA 5G2OA 2WA2A 5CW1A 4UZEA 1IHYA 2JLQA 3AF5A 3DMNA 4WN9A 2WF9A 1BD4A 1EFLA 3F1KA 4XB2A 2CWDA 1G4UR 1EXMA 2H06A 3BL5A 2X1VA 2P27A 3O7WA 4IFTA 3SJBA 3W77A 4CLOB 4CQJA 4CKWA 1RNLA 5JJKA 1T4CB 2CVFA 4DVJA 3L1JA 5LQMA 2Q4OA 1BFUA 2QX6A 2RAVA 5ALVA 1JR2A 3UJNA 2JLRA 2C4TA 2ZB8A 3LYLA 1TA0A 4FFBB 1GPYA 3ABRB 2AKYA 2F1JA 2XEXA 2EJBA 3DW3X 3NM6B 3NRJA 2BONA 4GKBA 3LT5A 2I2BA 3OC6A 3X1WA 1XJQA 2QY6A 2Z2ZA 3AW8A 3IUMA 5JNTA 4BB6A 3VR5D 4RA9B 1P4AA 5KJ6A 2IBTA 2UKDA 4RF5A 3CXUA 2HJWA 1U3DA 1WZCA 3WK4A 3IBTA 1Z3CA 1USIA 2W0MA 4FMCF 3LLUA 3ED5A 2RHLA 3NASA 1TM3E 3MGAA 3OU7A 1A2QA 4OXIA 1FSPA 1XZHA 1DRKA 1IZ7A 2IX9A 3ADPA 4OJKA 1QRUA 1VI6A 2NU7B 1FNCA 3G9QA 5ESDA 2O8DA 3SP1A 3O4VA 4TKZA 5JZSA 4TWRA 2G9QA 1OTXA 4G0OA 1RYHA 4CIVA 3NTRA 3QXHA 3AY6A 4TGLA 5HF5A 5BSTA 2V96A 4B34A 4LJAA 2OGZA 2QJTA 3G2LA 3P4YA 3A6DA 3P9QA 2DBZA 3LQ1A 2JIPA 2ZJ0A 3VKHA 1Z8DA 3EC2A 5EP2A 1M66A 3UPTA 2DY1A 2XCLA 5KTRA 1GUFA 1EVQA 2XLBA 4RK0A 5B1SA 1M83A 1OBFO 1DWQA 2K2WA 4PBTA 5T5QA 3D64A 3TLAA 3VKVA 1M34B 1Y3FE 3EXHC 5E2BA 4EDFA 5LL6P 4QWMA 4US0R 2WWXA 3BQNB 3H5NA 1R0BA 2FW8A 4G0NA 5IASA 4QM6A 5JJLA 2UZ3A 3ZKWA 2XTZA 1L8AA 4J1QA 5FLEX 4DT1A 3I8OA 3ZU2A 1YA8A 2K2QB 1GG5A 1SZPA 5EQJB 4CF4A 1EXVA 2QKYA 2A5YB 2P35A 3EC1A 4ZO6A 4WJLA 3G8DA 5F21A 3T0IA 2WSSA 4J94A 1RCTE 1X38A 3GPIA 3TE7A 3WRWA 4D99A 2LE0A 1TUBB 3O4GA 1Y4ZA 3QX8A 3PHCA 3G0BA 1WUTA 4M46A 1WPQA 4BMYA 4DDKA 3E9ZA 4H7IA 1VIMA 4JJ6A 2Y6UA 3PTAA 2VDQB 3EG9A 3NGMA 4OQYA 3NTOA 1FMCA 4C2TA 2HCJB 1KHTA 5AVUA 4AJJA 4TN5A 3QXJA 2I29A 3VC3A 5I7OA 1DQRA 4Q6WA 1GGEA 1ZGZA 5KC8A 1LC0A 1Q74A 4I4IA 1HO3A 1WCV1 4Q7QA 2BH2A 2K7FA 5CA0A 3FMOB 1WBBA 4HQNA 4R41A 1E9DA 3DDCA 3A1UA 2RGWA 4D46A 2RAFA 4Z8XA 1KI3A 4GICA 4G5FA 3AF6A 4HMQA 1VG8A 3C3PA 2DUMA 4OL0A 1LFDB 4HSEA 1UKYA 2PJDA 4GR9A 1REQA 2P65A 5FYQA 2C4KA 3WGTA 2P0AA 3EUFA 1P2TA 2VRBA 2W6CX 1J0AA 3L49A 1ZW1A 5DM0A 2I8AA 3K6RA 3WV4A 2VNHA 2UYCA 1XWWA 2VRCD 1RXEA 2RDMA 4Y2PA 4TYPA 5E4TA 5F2NA 2ZR7A 1R6TA 3Q40A 3JAKA 4C5AA 4XIFA 1QFYA 3B82A 2DWCA 1QYRA 4M9RA 4Q3OA 3TEFA 2GR9A 2GYYA 3BRWD 5DI9A 5TB5A 3I2HA 3A0UA 4L16A 4PN3A 3ER9A 1TEZA 1ZNWA 5MHTA 1M0WA 2PA0A 2QYHA 3I9MA 3OUZA 1JQBA 4N49A 2NPIA 4KB5A 3VZRA 4D9GA 1MVNA 4JZYA 1T13A 1R0KA 1M2NA 1RZ3A 4XWGA 3TQQA 2ZJ5A 4H6WA 4TN1A 4BV9A 4P3OA 2LKCA 3QPDA 1XU9A 2PRKA 1FA9A 4YXWA 3RVBA 3HBFA 5K0JA 4BWVA 4C2AA 2Z8XA 1XXHE 3MHPA 2BSXA 2L82A 3P9KA 4TL7A 4Y3UA 5HILA 4Q4AB 1NMXA 2R1ZA 4OMFG 1RHMA 2JARA 4BX3A 4R68A 1X2BA 2F43B 2YMMA 5T41A 1BYUA 2G9RA 3DE6X 5G41A 2A1UA 4P54A 2ENWA 3R75A 1JQ5A 3ILVA 4LJRA 1CUUA 2IYFA 2RJNA 2IHJA 1P81A 1DRUA 1YI8A 3EOBI 3F6EX 1JF8A 3G8CA 3LYUA 4GYKA 5FUVA 1QNLA 4NBUA 1FVOA 1SKYE 2P0EA 5ALSA 2WJ3A 3AF0A 2DAPA 2HJRA 3E8MA 3HJNA 3NAMA 4FFWA 4UAJA 1JZSA 1DBSA 2O2YA 4LTMA 3TLCA 1KL7A 3SDZA 3CH5A 1I30A 4JENA 2BUAA 5BNTA 4BU0A 3WGMA 1W5BA 4DWJA 5DM4A 4MLZA 2NUTB 1W88B 1NHWA 1XZIA 4DLUA 3BZWA 2N9UA 1XIVA 1ZH0A 2D5CA 3JQAD 2WZDA 1T1GA 4QUBA 2RCYA 3ASYA 2R00C 3FPGA 4BJHB 3A05A 2UV8A 4YMGA 5JAHA 3FMFA 5EUBA 3MFQA 1AM4D 2ZQYA 2WT4A 1PQ4A 1QAQA 2OFPA 2NPOA 4QECA 3SIXA 3UMVA 3VNUA 1XKTA 2CNKA 2G7MC 4M3NA 1NM5A 3GLVA 3I1FA 3KSDO 5DNDA 3UVEA 2QXTA 3DKVA 4HNTA 3LXXA 4PX3A 5C8YA 1YJAA 1KYZA 1HDRA 3QBDA 5KPDA 1Y5NA 4Y9UA 1HG0A 1ZNXA 2WF8A 3EVZA 2AW5A 4JI5B 3TKYA 1HMPA 1WUIS 1FFCA 2R6FA 2HPZA 4AQDA 2NTEA 5BORA 1NOIA 3E48A 1R4AA 1TZJA 4F97A 3CHYA 5T64A 2XQVA 3N2KB 3ITNA 2YFKA 3U0BA 1OX5A 1I9GA 1RHUA 1FRVA 2FK8A 1KOJA 4M1QA 3OSZA 4L1KA 3QVKA 1J2TA 3MAGA 4NMHA 3RYHB 5CDFA 4MROA 3D43A 1G8YA 1LFAA 3MXTA 4YRJA 3S2FA 4W8GA 3ZBUA 4UUNA 2ZVPX 3CLTD 4LZJA 4D96A 2F8TA 3D6UA 3FWKA 1L5QA 4G5GA 2ILTA 2OQ2A 1KKMA 2ZYRA 4Z3DA 1AC5A 3SX0A 1U0GA 3NIWA 4BNLA 1T8RA 5CB4A 4F04A 1RYEA 2BELA 4FSDA 3SEFA 4WLNA 1SHTX 3PKIA 1MHPA 1WXEA 3S81A 4JDPA 3KHTA 3CR7A 1MV5A 3FTPA 1F51E 4ND5A 5K51A 5CGZA 4QGFA 1HL3A 1GG2A 2YBEA 1FFBA 4GW3A 2CE2X 4CM7A 4XLTA 5DHQA 5CEEA 1XVLA 4BOYA 4EY5A 2FEPA 1GILA 3NYQA 4MS1B 1MAAA 3HBNA 2XGMA 3PWSA 1ST3A 3K9WA 4MYCA 2CFRA 1SEPA 5DSTA 3JZFA 3R6WA 2X19A 4YMTA 2NYRA 3N0VA 1R6BX 3D0RA 2ZREA 4HQFA 4LUCA 1V25A 1EDBA 4O8CA 1TM5E 4IRUB 5B1DA 5KTSA 5GOZA 4TYNA 4HDSB 2J07A 2QVCA 2R25B 2LW7A 2Z83A 4GI5A 3CW8X 3LPNA 2F7SA 4HCJA 1KWKA 4N41A 1GNVA 1UZAA 1PFYA 4PHHA 1WU8A 4WOBA 2Y66A 3TIVA 3WMRA 1PV1A 3Q85A 2JLBA 5CVVA 3G13A 2Q1YA 3CUVA 1T3TA 2GGSA 4ID9A 4RY8A 4BFTA 1H0RA 5KSOA 4LN1A 3Q87B 4JODA 3EZGA 4FSHA 4N18A 3VAZA 4KITB 2H63A 5JC8A 4N9QA 1IYZA 3AINA 4M2LA 5DGTA 1Y7HA 2X4LA 2XT6A 3VR5A 4KAAA 2JJ2D 1TVKB 4HK4A 1MIOA 3UFXB 3EXHB 4PR0A 5J4YA 1ZBQA 3DKRA 2HREA 4EF6A 3GF4A 4TYMA 3E81A 2W6MA 3FTQA 5JAPA 3H1FA 1RMQA 2JAXA 2B7CA 3NYRA 4UVHA 4HXGA 1T5OA 3W06A 4B7UA 3DMPA 3F8TA 1CZRA 1G38A 1AMOA 1MO4A 1U3CA 2EZ9A 1THMA 2DQYA 2QMOA 3GLIB 2PBRA 3O8QB 4IDDA 3V8VA 2WIBA 2BEUB 1J39A 3QRWA 1JWBB 4XIJA 2J30A 4FYMA 2B4TO 3FPEA 1DTSA 3LHFA 2DPYA 4LF5B 3UOGA 1S0UA 1T43A 2QTFA 4N47A 5B6IA 2BAGA 4MQ4A 4NX2A 1KMHB 2BGMA 2OK8A 4GWKA 1RYNA 3KR9A 3UW3A 5HJ7A 3TG2A 1QRRA 1XB2A 2WIAA 3LKDA 2QRVA 4MPRA 1LQ2A 4Z0HO 4FBMA 2FLWA 1AURA 4OQQA 3UOWA 4BP1A 1TQ6A 3HVJA 2G08A 3PJGA 5BMVF 1X1BA 1ST2A 2DFNA 3KVVA 3BTUA 1YL5A 3CUTA 3IP7A 4G84A 2QRLA 2X42A 4NPHA 4PHTA 4QUHA 3CN9A 5H4HA 5I9MA 3EISA 3I8SA 4LYEA 1ABEA 3KYBA 1XZ8A 1MJFA 1DQZA 1SUFA 2I33A 1R6UA 3L7LA 1EM8A 4Z4IA 2X41A 2J09A 1TW2A 2P9FA 3LRPA 3F6SA 2OYSA 3TTVA 5KYTA 2COUA 3BGOS 3H5WA 2GHTA 3JWPA 4WN9B 3Q6IA 3RSQA 2NU8A 2VNKA 4BC1A 2O8BA 4PAOA 1Y8AA 5AHOA 1TIBA 2R6GA 3H2YA 3FWHA 3S4YA 4H31A 3G88A 3V7UA 3HKDA 3F78A 4YV7A 4CKWB 1FMLA 3T3IA 1QONA 2CV1A 3MJRA 4G0ZA 2O05A 1XL0A 3TLGA 2WYWA 3FKQA 5FCDA 5HEKA 2QMZA 4M7PA 1A7UA 3T7RA 3NUGA 1USKA 4BQQA 2E3JA 4AK9A 3QOYA 3WGNA 4AZWA 3DYBA 2FF5A 4F45A 1OKKD 4XVHA 1XX6A 4RD3A 5DPMA 2OV1A 3DOHA 1RAAA 3ZBTA 2JG3A 1T2FA 1M1NA 5DHTA 2XD4A 2BUCA 4NK5A 3SZ3A 3FPLA 4BNFA 5CDGA 2HZBA 4G5RA 3D81A 1LSSA 1LH0A 2G9UA 2QZ9A 4B45A 4MQ5A 2X0DA 3ISVA 5FHRA 2HBRA 1S4QA 1Y8QA 3E2MA 3SBXA 2O8DB 1SKUA 2WJ6A 3TI7A 3IVMA 3R8XA 1CWUA 3HBAA 4QYWA 4IOMA 4NJEB 4BFWA 1CDDA 3I52A 5A5FA 1AGNA 5J4LA 2W93A 3FRHA 3L0ZA 1QVWA 4RSMA 5ALGA 4Q6BA 1QFXA 1X1AA 4FI3C 4G5SA 4B9EA 1RWKA 4PG5A 2JHAA 1U0JA 2NADA 3FUTA 5EINA 1Y7PA 2BHTA 2OCGA 3M7IA 4CLRB 1JA0A 2F48A 3AESB 3F7NA 2SCUA 4NAHA 1NF3A 3QJGA 4IRMA 4Q3LA 5CNKA 2JK0A 2GFIA 3IAXA 4KH0A 3ZKWB 4DDMA 4DT1B 4XD7A 3WKEA 2YV3A 3OTGA 4NCAA 1UR5A 2WJYA 4KRYA 2YJNA 2QPLA 4O4JA 4EJ6A 4MUBA 3MWEA 1AK9A 1O77A 3LTEA 3O8LA 1VL6A 5E6RA 1NC1A 3D3NA 3R3UA 2AUTA 4UZFA 2HADA 3ORHA 2FHPA 3E22A 1LBEA 4XRRA 2WY2D 1JJ7A 1JPVA 3EXEA 3RC8A 3MEQA 2PD4A 3EG9B 2P9JA 3QIVA 1ML4A 2A9RA 4KO4S 4FYIA 3E23A 2YWRA 2ZSBA 3NG1A 4J0EA 2D4HA 4E33A 3QE3A 3K1ZA 1P6UA 3AR9A 4MVJD 4UBKA 2ZJ1A 5F3DA 2GRAA 2H48A 2PANA 2C3UA 3ZD7A 5HYVA 4D26A 1XD8A 1H5UA 2BM1A 2WVHA 1Y9ZA 4WKBA 4YJGB 5KQRA 4Q7KA 5CA0B 3GLQA 5F1YA 3UM9A 1E0SA 1TC2A 3UMRA 3WK6A 3CT4A 1WA5A 5TT1A 4D9CA 3I6BA 3C5EA 4HDOB 4IIYA 3G82C 5FOVA 3V8BA 4OJQA 2FOIA 3JQAA 4ZYYA 4C14A 2O19A 1M2WA 1W4AA 3H5VA 3PCXA 3OPYA 1GRNA 3L4BA 1YL6A 4OL9A 1U9CA 3K2IA 1COZA 1IAQA 2PLRA 2HB6A 5AVSA 3IOCA 2PM8A 2ODPA 2RHJA 4HNAA 1B8NA 3MCWA 4Q9LA 5KHAA 2FUNB 3WXMA 4A03A 3LO5A 4Z7OB 1GAQA 3HNRA 4FZ3A 1DQSA 2BSAA 4LGMA 4B4OA 4WBXC 3QJ5A 5ADWA 4HUQA 4KBFA 3JAKB 2EBHX 4B33A 4I19A 3SOPA 2NQTA 4OKIA 5C8DA 1M8KA 2AW3A 2ZRAA 3EVGA 1Z29A 5KJFA 4MI9A 1T4GA 2Z1NA 4W9NC 3PDCA 1SU7A 5LJIA 4YACA 3E9YA 4I5GA 1TC1A 4GDMA 1Q2UA 2IEGA 5EE9A 3H2JA 1RAHA 4DCGA 1MN6A 1CLEA 5CHEA 4KV7A 4I4LA 1UPAA 1V5GA 2WRZA 4E2FA 4AMVA 2VN8A 2W4MA 5KYGA 1BMDA 1L4HA 2GAAA 1PL6A 5B37A 1GR1A 3ED1A 5CLIA 1XMPA 3EB9A 3UMCA 1XRPA 2AC4A 4P7JA 1GNPA 1PD1A 3AW9A 4B6OA 3NHJA 5CT9A 3AUFA 2DGDA 3CRRA 3HZZA 5J2UA 4B47A 2YOHA 3I9JA 3BSSA 3OCYA 3H05A 2PLAA 4ETNA 2PEZA 1LLDA 3PA8A 5AIAA 1VKNA 2JFBA 2VATA 5BR8B 1GGVA 3NPAA 3RUDA 2R48A 4HWTA 3VFDA 2QXYA 4INOA 3OQ6A 4BMZA 4OFWA 3BIJA 1F7VA 1GN9A 3G79A 3M34A 2HMTA 5C46F 2A1UB 4IJQA 4OATA 3WGVA 1RXYA 4QL3A 4TSKA 2HK7A 1RM0A 1IXRC 1CC1S 1SZJG 1FPMA 2X8JA 1ORVA 2EX1A 2PMDA 4M0LA 3ZI7A 3LY8A 5JSUA 1RE0A 2KPOA 3D8BA 1UKAA 4IUYA 3T3EA 4C0KA 1E3LA 5GZ3A 1QTIA 2IP1A 3LYAA 3LFTA 4PCVA 1E3WA 5DK4A 1W0JA 3WNVA 1G20E 4QRIA 2PUGA 3I5UA 5F4ZA 4H7KA 4F7WA 5KZMB 2VTBA 2D0PB 4R1QA 2IIVA 5F2EA 4IHKA 3I5MA 4JQSA 2EJCA 5FADA 1HTBA 1CUCA 2XNCA 5LVAA 2A14A 5K0CA 2BFNA 1DAPA 1G19A 2H65A 1S9HA 5GZ6A 2HWXA 1D2NA 4J90A 4OMDA 2WTAA 1X14A 1ULSA 2AMLA 1VG1A 2Q07A 3DMRA 3FLMA 3EG5A 3PQFA 4WJZA 1IG0A 4D0SA 3FUUA 3SC6A 3CRVA 1FVXA 3DP7A 2JJ2A 2QZZA 5HFNA 3PL5A 2NV6A 4I9GA 1O9BA 1EIWA 1N8KA 5B3KA 4IV5A 5SICE 3DL0A 2B6NA 3WVNA 3W34A 1B3BA 3EJWA 1NY6A 1J8VA 1VIAA 3PKZA 3KJXA 4L9SA 5CXUA 2J3IA 5IH7A 3V3KA 2VUUA 2H51A 4JS0A 4IJVA 3U6KA 4ACBA 4UNRA 2CZCA 3DAPA 4G81A 1NI4A 3R3JA 1FFEA 1L5VA 1YVRA 1ZHHA 4FYKA 3ZCRA 2W48A 1P5JA 4O5AA 4P22A 4C7BA 3VSEA 2ZYDA 1GKUB 4CLXA 1ZMXA 5FT9A 4F9GA 3HGMA 5B1YA 5JHHB 4Z9BA 1QIHA 3L8DA 3WYGA 5HOEA 3D8NA 2AD1A 3L4SO 5EHIA 4S35A 3G59A 8AT1A 3PR2B 3KL4A 3HU1A 4MCIA 5TY0A 2R8BA 2F3QA 3EZNA 3MBKA 4M6WB 4Q66C 3ZQJA 2JGNA 5SV2A 4QRHA 3FRJA 3VSCA 1U0LA 2OCBA 3JCZA 1WXWA 2FFJA 4QDXA 2HM7A 4ME6A 3TF5A 1YS1X 3H87A 3ZVRA 1H2XA 5DYGA 1YRYE 3E5HA 1JUDA 1W5FA 3C43A 1PFKA 2O9JA 3CPEA 4RL4A 1RS0A 2X15A 3C98A 1PR9A 3KEGA 1EHYA 1P91A 3VTAA 3LX8A 3ZCTA 3SR0A 1SC1A 5AYVA 4C4RA 2YN2A 4JBLA 4MULA 3CLTC 3QJYA 3ZG6A 5BV0A 4C3VA 3RFTA 1E92A 1L7XA 3R23A 3UANA 3DFKA 4QRDA 5HUQA 5B30A 4D6PA 1CUGA 1UAYA 1UK8A 3D2BA 4PNPA 1N2SA 4PYRA 1DIHA 3QYAA 4ITUA 3T06B 3TOXA 3L7JA 5MN4A 1S02A 3RW9A 2WTMA 3I64A 1AY0A 3ICCA 1Y5LA 2VK1A 4PC6A 2JF0A 4Z1MA 2HF8A 4PR3A 3A6KA 5EMJA 2JGEA 2REBA 3ETLA 3IDSA 4RYDA 3R7FA 2I4TA 1NNUA 1II0A 3N05A 4MGIR 3TD2A 4E5KA 4DOMA 1M2EA 1OLUA 1XAHA 2O2HA 2QX9A 2RKBA 3ADCA 1FTNA 1C30B 2GBLA 4ICIA 1LVUA 5JU6A 4JSRA 4XIYA 4NLLA 3RF6A 3U62A 3JVEA 4X94A 1TYAE 3T3PB 1MIOB 1QE5A 3L79A 2VP0A 4CKCA 1J2YA 1JGTA 1YNOA 3AUAA 3DOEA 3PS9A 3SZOA 4Z7NB 4C06A 1ABBA 1D7OA 2IHYA 1MT3A 3N5KA 4DV1B 4RW0A 2ZRPA 5FA5A 5KB3A 4IDPA 1RXUA 2PAFA 3EX7C 1XMIA 3O2QB 3IDQA 3UAYA 16PKA 3CJQA 4GPZA 1V1RA 1JI0A 2AG0A 4RDIA 4B40A 1QP0A 1XJWA 2UYQA 3H2IA 5J1SB 4FCTA 3FZQA 4GXQA 5ECWA 5KHLB 4RC9A 5ARDA 1Z2CA 4BFSA 1GWNA 1ZUD1 1P73A 2EFDB 3PNYA 3ZE1B 2PU5A 5HJ5A 4CFSA 1M7GA 3EXIB 4IXDA 4HXFB 5JLAA 1QBKC 2QRVB 2IVFA 3H9GA 4GVLA 3T5TA 3ZJVA 4CN8A 3AJ9A 4ZCMA 3FTEA 4KRFA 4DGQA 1JX6A 4R1TA 1G60A 4U5QA 4RCYA 3CURA 5EKTA 5BR1A 5ICEA 4I1PA 1W6UA 4LC9A 2CNNA 2O3UA 4YPOA 2W42A 1QF9A 4J0KA 4Y2QA 5P21A 4FN4A 4LJKA 5F7JA 4HGYA 4KN5A 4AO6A 3W5AA 3E15A 1A9ZA 3C4VA 3MS7A 5M7EA 5L7YA 4DAEA 3PUXA 4EQ6A 4WK4B 4PSCA 1EM8B 3QUTA 4NCBA 3MMXA 2VT2A 4Y2UA 4XEHA 4ATNA 3WIOA 4NE2A 1L7DA 2CCGA 1N5IA 3JU3A 2DHEA 4DJFC 1A9QA 3C3JA 1BKYA 3HKDB 3U7EB 4PICA 2H2AA 4POOA 5C7IO 5A7FA 1TZCA 1V39A 1JVNA 3BJEA 2GBPA 1GNQA 1F2UB 3ADKA 5TEVA 1D9ZA 3NXSA 3KWMA 3NHSA 1VHJA 2BI8A 3DM5A 2V65A 3GCZA 1NPYA 2Z3VA 3BSFA 1QK3A 4OB7A 2GM9A 5ILGA 3JTMA 3DNFA 3OPMA 1QX4A 2DKOA 2RH5A 1A9TA 4MHOA 5CCBA 1X80A 2ESRA 4BV8A 4X66B 3G89A 1TO2E 1C1XB 5TEWA 2P62A 1M1NB 1EZZA 2HWYA 1QC5B 1KJJA 4KH1A 4M37A 4RNDB 1V3UA 4ZQEA 1AA6A 4FINA 1BJTA 1N4DA 1Q0PA 4IIVA 4I8DA 3GBPA 1U63A 1VJCA 5CG1A 1ZJZA 3SF8A 1DV2A 2VP6A 4PVDA 1B16A 1U3VA 4FSXA 2AVNA 2IY7A 4YN3A 1VGRA 4DYVA 3KAJA 2W4IA 1TRHA 3ADOA 1TGYA 2O20A 3CGWA 1ZK4A 1DHRA 1G98A 2C97A 4YEDA 5AI5A 3SKYA 2O4UX 2WUGA 3F98A 1HETA 4CIXA 4MICA 4JV5B 3LX6A 5C1BA 5DKFA 5EKUA 2AFHE 3WLPA 1IOZA 4CUJA 4EEKA 4DA6A 4FFSA 4C20A 2W9XA 1IQUA 3RUAA 3BXZA 1RI2A 3BD7A 4KXXA 1WKCA 2SCUB 3HTXA 3PIRA 3ZQ4A 2G07A 1M1YA 1S2DA 1V7CA 2QZSA 4BNXA 3RV3A 2Q50A 3B20A 4K6FA 5JCPA 4I66A 1Z0AA 4QQFA 5BSUA 2ZBFA 3W9YA 3JD0A 5L3ZA 3CSSA 3O0TA 3WRYA 4DCJA 3O73A 1UOOA 1V11A 1XNJA 3PNSA 2KSQA 3SR4A 1A9SA 1NVGA 3WHLA 1GZ6A 5IDXA 1T5HX 5LMCA 5E6RB 4ESVA 4U3JA 3AI7A 821PA 2FPRA 4R3NA 1FW8A 2F00A 2Q9CA 1MKYA 4N8EA 3E22B 3BH7A 1GAXA 4M9XA 5LZ7A 3NNNA 3EXEB 2F8SA 5CFRA 2EL9A 5D86A 3IMEA 3QVGA 1TYZA 4ZT5A 4X97A 2GAOA 2M98A 3HN6A 3KRTA 3RLFA 4IEIA 1FBTA 5LZ2A 2VZ0A 3DDUA 1J49A 1S89A 2JIZD 2AG6A 3C8ZA 3ZEIA 4D42A 4KX3A 2H2DA 2NP6A 5K0GA 1RCFA 3ABSB 3TAXA 1D2AA 1EP2B 1TFRA 3CZ9A 3SE0A 4D82A 5KIAA 3JQAB 1IMOA 4ZHQA 2E5WA 4PQGA 4TLDA 4EECA 2D1SA 2ZYGA 3NS7A 1KK3A 3HKCB 5DHAA 1ECPA 1FQOA 1U8UA 1JDNA 3KKNA 4AJPA 4MEBA 1W87A 4CM3A 5JSQA 1JA1A 1E1MA 2R8EA 4HNAB 5JT1A 1WE2A 2GRJA 1DB3A 1TPZA 2JZOA 1ORHA 4C22A 2WM9B 3K9LA 3ROFA 1EB8A 2D1YA 3CFYA 2J67A 4HUQB 3GIWA 4YRQA 1DMRA 1HEIA 1G17A 1JNYA 2AQ8A 3BMQA 3FVVA 5L6LB 1UMBA 4UU1A 1VA4A 1DT3A 2FUG6 1XZNA 4OUKX 4DQLA 3AVUA 5IK2D 2PXHA 4JB3A 3T9AA 1I7PA 2DC1A 3NVDA 4NJOA 3K9NA 1A27A 1IXKA 1JFSA 4M1WA 1W9MA 3TIIA 1V5FA 3V8PA 2VK8A 3KHUA 4Z8YA 1U0EA 5A6VA 5I7UA 4YRSA 3TSZA 3TZEA 1J97A 1T9KA 5JRJA 2AMJA 2O0LA 4H6VA 2EBWA 2R8XA 3T54A 3ZJYA 5I7RA 1W49A 3ZNPA 5JCZA 3TCNA 3KPYA 4ML3A 4CXMA 1ZR2A 2IP2A 3QENA 1QH8A 3IUPA 4AROA 3GNLA 3CNOA 5J2UB 4FGWA 2V4MA 3ONNA 2HPHA 1B73A 1M73E 1TRKA 2H57A 4K0KB 2VAXA 3F0TA 1P4GA 4GMHA 4U2CA 3W5HA 4FWBA 1GTSA 4XRGA 2BT4A 3OX2A 5BWBA 1RKBA 3JYNA 1J00A 1E1NA 4J1NA 2QNRA 2WJAA 3IJEB 1J70A 3LT1A 3X1JA 2HMWA 3OE7D 3L6OO 4ZT4A 2HMUA 4CT4B 2WJIA 4TT3D 1NMYA 5CA0F 5I9IA 3UK1A 2ECQA 3TPCA 1HNZB 1W29A 4FYWA 3LA8A 2Z09A 1RWWA 3OQVA 3PQCA 3C3EA 1NLMA 4LHYA 4KQ9A 3A7EA 3ZIAA 3S2SA 3ZWQA 1SCKA 4WTOA 1N6PA 1K7EB 1VHQA 2X8JB 1HEUA 3BWVA 4WXYB 4CIYA 3A8TA 4BNTA 4IOJA 2PIAA 5JD3A 4URUR 1RWOA 3D2CA 2XIQA 1JEAA 1WXQA 3AMVA 4HLDA 2GJ9A 2H0QA 2QI9C 1E3WB 4P38A 2QV7A 2PXCA 5CLQA 1ETUA 1N7HA 1UZLA 4BBPA 4CR6A 3AL0C 3OQHA 3OQIA 3PSAA 1OAOC 3GGCA 1U2GA 5ALLA 2C3MA 2ZUUA 3HKEA 2Z57A 2GFHA 3SKXA 4CR7A 2D00A 4RVDA 2RJ3A 4OP2A 1QYCA 1XQXA 4BBAA 1MZPA 2O8FA 2QW8A 3NI2A 4K2HA 3DF7A 4L5YA 4BQEA 1II9A 1L8XA 1A8SA 1FS4A 3UENA 4MV9A 4M38A 1KYQA 1O94D 4QJBA 1W73A 2HU2A 2PZMA 3KOXA 3QW4B 4PAGA 1V95A 5G1PA 4BJ3A 4YRNA 2BMEA 1QKKA 2H4ZA 1HFEL 3AR8A 1SHLA 1KC1A 1ZD9A 4K3UA 4TRJA 4YGYA 5ALTA 4A0QA 1AO0A 3PIIA 5LP6A 1E69A 2A67A 3L0YA 4NDZA 3Q6NA 3R5FA 1A0OA 1FFSA 2MR6A 4XVQA 4BV3A 4DA0A 3O92A 1U8FO 2DCUA 1LA2A 1OGIA 5GP1A 2QUJA 3RRFA 5DNVA 3OZUA 2VSOA 4YDQA 2ISQA 5KKAA 1H4QA 3KEMA 2QR5A 1NUUA 5GV7A 5JEEA 2WWFA 1JH9A 4E5NA 3GC6A 4KL8S 4XW2A 3VZBA 2HHJA 4R40A 1FYDA 1A2BA 3NGXA 5T4EA 4FYPA 2IEBA 2WTEA 3NEAA 1R1DA 2HJSA 5HIKA 1BMFA 3QU2A 3ZWNA 3OE4A 2YC4C 2Q6LA 2A1TS 4CDNA 3R76A 4N03A 2PRSA 3B7WA 2ZUVA 2JVJA 3K9CA 2V74B 5ALOA 3C4QA 4HZIA 1X1RA 3D3JA 4HRAA 3NTLA 3A28A 1WG8A 4FDTA 4CE6A 1XLWA 2SHKA 2CW5A 4XM1A 3HBLA 3B6IA 3SLRA 3HPRA 2XCOA 2IUSA 4HDMA 5BOSA 3EIXA 2Q3DA 2GK6A 3MGCA 3TB6A 3NBZC 4MGHA 1WDMA 3ONVA 4UQOA 4DLNA 4B3MB 3PDIB 2W2LA 4RCVA 1WULS 2RH8A 4FIDA 3HN2A 2B36A 4UMFA 3HVHA 4FQ7A 4CFYA 2E6KA 3PUVA 3Q5GA 1DO0A 5KVQA 3UHFA 4TTRA 3O8NA 1Q57A 5C18A 2QRQA 3HXKA 1AQIA 2QYSA 5C4MA 3LF2A 1UMKA 1VZ2A 2VPWA 1GP2A 2VRNA 4MRNA 2BGJA 3RSSA 3FCOA 3KQWA 1JILA 4HDQB 3ND6A 4FXOA 4XCQA 4FE7A 5T6MA 4EPTA 3JD2A 4G0VA 3DYVA 4IYRA 3GQVA 3CLUD 1E2MA 1XO1A 4IINA 4BS9A 1MJ5A 2KYRA 2CJXA 1TU4A 1JAYA 3OTIA 3S2UA 1PX2A 3C7TA 4IXMA 3GJZA 2OOSA 4YJFA 1QWOA 4L0CA 2O2DA 1MPTA 2PR7A 3DZJA 5CEFA 1Y7LA 2FH5B 1FQWA 1N3LA 3AL3A 4KEAA 5K4HA 4M7OA 1MB0A 4NS1A 5LM3A 4C4YA 5IX8A 2LRHA 3CONA 1U8EA 2JIQA 3HVUA 1OLUB 2VKTA 2JATA 1RE1A 1JHAA 3R0JA 2OEPA 4ZYLA 3BN3A 3R7AA 4JEIA 2FWPA 4C2BA 4M60A 1ZN7A 4UTOA 1P1BA 2PMFA 3AERB 1EP9A 3EA0A 4KG7A 3GLHA 2XUOA 4K6MA 4ZD6A 1NMSA 3ZZ1A 4CV2A 4CKCB 2QLBA 3GW8A 3ECCA 5JXIA 3GUUA 3ZHQA 4EGSA 3WQBA 3ND8A 1T6YA 2C2HA 1AVTA 1E64A 4YRRA 3SJCA 4DLSA 3SBOA 1IEQA 4QZVA 1R7RA 2JD2A 4AJIA 5FB3A 1ZHFA 2P3SA 3AOEC 1OXVA 4K9LA 1ADBA 5DULA 1H23A 1V1RB 4EJFA 2HD4A 1KSJA 4NCIA 2VDJA 4N7JA 2RGUA 3FHCB 1JZTA 4J16A 4PO1A 1D03A 2J6CA 5LP6C 2Z8YA 3ICWA 5DNYB 4XUDA 1QP7A 3Q7RA 3IHWA 1VSTA 2QD1A 1DKQA 2PWPA 3RAFC 4ZV7A 1EYZA 1OXTA 3NYWA 1WPXA 1JFVA 3DS8A 4Q21A 1HDCA 2JJQA 3WNQA 1T25A 3FKSD 1ZH4A 2NM0A 3KFVA 3AVVA 4F2PA 1RLMA 4LYFA 1HQKA 5K3BA 4DA9A 721PA 4BLRA 1JDSA 1IHDA 4DLPA 1DFGA 2GA8A 2Z95A 4RTOA 5JDCC 1EFHA 3ZZNA 3Q5DA 3DWGA 1RBYA 1G0NA 3N0XA 4F2WA 4IIEA 4Y98A 4EQ6B 4PCUA 5LZ5A 1BOOA 1J0CA 4FI3F 4OAPA 5M34A 2QQGA 5JARA 1Z0UA 2Q4BA 1IZZA 5LQCA 1JDJA 3BWBA 3C3WA 4OFBA 1KFCB 4ENVA 1XZKA 4QXPA 4B84A 4HDRB 3L0OA 1VLHA 5BSVA 4H7DA 5C7OO 3DAOA 4X91A 3OECA 5FPSA 5HUHA 5H0IA 3BH0A 1ZIXA 3DFZA 2QS9A 1DZIA 4WZBE 1CRZA 5IXYA 2BTQA 3W6UA 1E8MA 1QVVA 2FEXA 2H92A 3MFYA 4Y6OA 4NATA 1L6RA 4Y2XA 3DC7A 1Z22A 1PZGA 1QO0D 3SZLA 4MA4A 1XN1A 2B94A 1Y3DE 4HSGA 1V71A 3FOBA 2FUG1 1LXCA 2YHSA 5ALHA 2FWRA 4KQIA 3UMSA 4EX6A 1YKFA 3MG9A 3LTNC 5EWMA 4LBYA 4C4ZA 1AHIA 5ARBA 5IF3A 4PPYA 5JPIA 3UHJA 1R9MA 1SQGA 3A3YA 3D8HA 3ZR4B 1K3UB 3MWLA 3SF8B 5LWQA 4LYGA 2Y92A 2DFVA 4PG4A 3I42A 5K3SA 5IJ9A 1MMFB 2OV6A 1CETA 1HDXA 5E7MA 5F33A 4C21A 1YK0A 1E3MA 1JR4A 2YXDA 3C5WP 3JWIA 4D81A 1JEJA 1I6WA 3RHSA 2N1MA 2JFYA 3H5TA 2J7PD 1EI9A 3GRPA 1UBUS 3F7MA 1L1RA 4HDCA 2KWIA 2HXYA 3KXLA 3REQA 3FTFA 2REOA 2CZQA 4B7ZA 1TX4B 1M0EA 5FNVA 3L02A 2VBCA 4RHFA 3SQNA 1KRHA 1M1YB 1RZVA 2H3HA 1ZESA 4KLCA 3TSAA 4Q4CA 1GSIA 2AD5A 3UXHA 1R5JA 1XJ5A 5CLJA 1ODIA 1XNGA 3ODPA 1R0RE 2JCVA 4BMOB 1V11B 4MV8A 1FDUA 2AYZA 1FDOA 4LW8A 1DC5A 1KVRA 3BBPA 3ZC3A 1WEHA 4DEXA 5B64A 1GRQA 1L5YA 2POCA 3A6GA 4U3JB 4GC9A 4MS3A 1UIMA 4Q9IA 1FLNA 2CXXA 4X0EA 3GZTB 3VPDA 2C7GA 3UB3A 2UUBB 1YRHA 2Z1MA 2GHRA 4Y2TA 2HA3A 3FPCA 3QVGB 1CDEA 4KQ6A 4EI8A 1H9CA 2XF2A 3AZOA 4MMYB 1N5KA 1KI6A 4JB0A 1XCJA 1R4ZA 3EGDA 1WB6A 1VG9B 1XG5A 1XL1A 1SOUA 1XZBA 3K7EA 1P6XA 3ORFA 4FFVA 4IKOA 4BN5A 4DIOA 6PFKA 4QBKA 3VVLA 4Z1OA 2WKWA 1AUQA 4AI6A 4C0AC 1NUSA 4D4JA 5EEGA 4LISA 2RBGA 1I7DA 4ZHQB 4E09A 2GZDA 1T8YA 3N8HA 4JU9A 5BVGA 4X20A 1PNTA 1KR5A 1QO7A 1K3TA 4A36A 1KEUA 1BDIA 2C29D 2HQBA 3VR4H 1HXHA 5A06A 5A1JA 1D8TA 2ZBDA 4FX2A 2IPAB 3Q11A 3WSTA 5K45A 3HE3A 1KEKA 2VNAA 5FFMA 1R88A 1KMQA 1Q3HA 1K27A 2PSFA 3KKPA 3MWJA 2OYCA 3BMQB 3HDHA 3W5SA 1UMBB 3OEYA 4Q01A 2IUTA 3ANXA 1H8HA 1OLXA 1SU6A 1X7DA 1YUNA 2PSDA 4UHCA 3VU3A 4MEAA 5TARA 5K5EA 3PHBE 1O97D 1MP0A 4TYWA 2DFPA 5E8RA 3R2JA 3GFBA 2EDAA 4U7WA 3RC2A 3B7PA 4IJKA 5JYEA 5K0FA 3AUXA 4ZVUA 3RADC 4IICA 3EPPA 3ONEA 1AB6A 5K3EA 5CYGA 4V0NA 3C14C 3U4QA 1A1VA 1QVAA 1QH8B 2HF2A 1YBVA 4NYIQ 2GTHA 3IIMA 5E2IA 5LZ9A 1BEUB 2BFEA 1ENPA 2CXNA 1EGQA 1P29A 4FOTA 4P5EA 1OTHA 3LUFA 3NKFA 3TLXA 1HDEA 3HB0A 4WI1A 1YZQA 4J0QA 2GH1A 2ZS7A 2B83A 1F0PA 1ZOLA 2BCGY 1LI7A 5BXQC 3J80A 3EW9A 4L8GA 1KJWA 1T5BA 2YWBA 4NNJA 3CUSA 5K20A 1UZUA 3MILA 2VC2B 3UJBA 2XZOA 4PAQA 3TSYA 1JR6A 4R2WA 2A94A 3L7IA 4PM4A 3HFSA 4MI1A 3ZWDA 4ER5A 1J5EB 1DC8A 1NMQA 2CNLA 1Q7RA 1UBJS 1JXQA 3QF4B 1O0BA 2PSEA 1ONBA 4MQEA 5MFPA 4IGKA 4DPMA 4ZT3A 2XZTA 4UNSA 3AWDA 4XYEA 1WVGA 4WE3A 4AWBA 4XUGB 1RP1A 1CKEA 3OQIB 2OCXA 2ACKA 1Z0KA 3A9TA 3HKEB 2XUHA 3NC1C 4TMXA 3SICE 3W9UA 4BLVA 4DXHA 1IUNA 5FEUA 2O8FB 4GQBA 4LHWA 2FW9A 3P9RA 4KN9S 3PWTA 2VYND 3QU9A 3U7JA 1UM8A 1ZUNA 2WG1A 4W82A 5CX1A 1EBBA 4DTCA 4K9SA 2O2SA 4IIJA 3RYIB 4UEOA 1YVDA 2QYTA 1UPXA 1AKYA 1IULA 1NYRA 2HHCA 2P9GA 2XAAA 2X3FA 3DWIA 4OTZA 3U1BA 4PQEA 4HNVA 3I37X 5LP6B 5CFLA 2EC5A 3SOZA 1DGQA 1MNAA 5C3UA 4PEVA 5TGZA 5NULA 1ZXBA 2BM0A 3H4VA 4JLBA 5I5EA 1GN8A 4CMAA 2IEYA 4B09A 4YRAA 1KC3A 4ALMA 3C5CA 1PW5A 1WCYA 4I9HA 1SQFA 2JVKA 3NVMB 4W4TA 5AVOA 2AEFA 4X1IA 1GQRA 2I6QA 1Z5WA 5IZCA 4JP8A 4R1UA 1SB9A 5EYPA 5BQPA 3EAQA 3V1KA 1O94C 3LT2A 4RJTA 3MJVA 2PZAA 4BZXA 5JAIA 1Z7BA 4A0SA 4WK6A 1OZGA 3QHPA 4AY5A 2AG1A 1Z2OX 2Y05A 1XE3A 4GXTA 3DXYA 3RG2A 1FDIA 2OCYC 4PFQA 3GL9A 4HDMB 3V8EA 2FP3A 5BOSB 3ACCA 3THXA 1AS3A 1LPBB 2ZJOA 2ZATA 3WGIA 3GNTA 1KVSA 2VYFA 1JJIA 2P5SA 3SX2A 2BZ1A 1F38A 4LX0A 4QELA 5FFNA 3GMIA 2A5DA 4MGEA 4W9MC 2OGUA 2QUAA 1DLIA 4E6PA 4ER0A 3PX7A 1NBEA 1NXQA 1UJ5A 2NT4A 4QFBA 1Q14A 1GPNA 3SAJA 5J47A 2PGIA 3VAAA 4LDRA 1E9FA 5CBPA 1Z73A 4NNOA 1Z4MA 2O2ZA 2ZRKA 3AFGA 3SQWA 2WHQA 2CB0A 5KCZA 3Q5EA 1OT5A 2C77A 3IEPA 5A4KA 4N8SA 2OBLA 2OD9A 1RKVA 2Z2KA 4YJFB 2XMGA 2NNWB 3RC1A 1C3LA 3M6LA 4HI0E 4JJZA 5JJCA 1ZM2A 4O08A 3T7JA 4DB2A 4I4TA 3H86A 3AEKA 1HE8B 1FXWF 2R8OA 5AH0A 5FLYA 5TJHA 3VTKA 4QNNA 3H1EA 1CR1A 1LVHA 5CVEA 4D3XA 1BRMA 3I5XA 3OA2A 1XELA 4TYYA 1OH7A 4N7BA 3DDZX 4I7EA 3L1UA 4LXHA 1THZA 1CB7A 5K3AA 1E4EA 3DMTA 3OEEA 3AB7A 5ER6A 4BKMA 4HQKA 5SY9A 3VDQA 3UMBA 4BMVA 2DPMA 1FFWA 3GLHB 4GSLA 5I7VA 4MPPA 1MB3A 2Q3BA 1MH1A 4G4JA 4HFJA 3TJRA 3ZWAA 5LNK6 3CLUC 4AYWA 2OT3B 13PKA 3UHAA 1ULAA 3HBJA 4UPDA 3UKJA 4AJEA 4F5WA 1AGPA 4Q7JB 1I4LD 1KJZA 2ALJA 3GJ8A 2DBYA 3QUAA 4W8OA 5FUQA 3HY3A 4M36A 1Z06A 1F12A 1ZONA 3D6TB 2P6UA 3IDFA 1M3SA 3V4OA 1U3WA 2P9CA 1T8SA 1U8YA 3LUBA 1H2BA 2CYAA 2H54A 3JYOA 2AIRA 7YASA 1GKIA 3BX1A 4LYHA 4B7XA 3TR0A 4DTIA 3VISA 2UYYA 3PGXA 3GQBA 3VNQA 3CTPA 1I5EA 1G1AA 3E7PA 5IKOA 3UMFA 1TAGA 4X9XA 5K0EA 3MWYW 4M53A 3RVNA 4ARIA 3KJFA 2VP2A 1HSZA 3OM9A 1NKTA 1IBSA 3KZOA 1PW7A 3B1VA 3JQ8A 2ATCA 3QYFA 3VO9A 2EFHB 1ILWA 2XUDA 3NRCA 1V8ZA 1CY7A 4RZHA 1LPNA 2H29A 4YP9A 4Z5XA 2G67A 3DLTA 3QLEA 3DZ8A 4IZIA 3G0CA 5C8ZA 2C3PA 4P53A 1NC3A 5DYNA 2ZJ6A 4CR8A 1WETA 1UAAA 1AHHA 1SK8A 3R40A 4Z4HA 3GP5A 2CHFA 3BK7A 3IAEA 4RLSA 1M1XB 1PUJA 2PT6A 3I72A 2F1RA 4ZEXA 3ZXYA 4DIEA 2ORVA 1GUDA 1U1DA 2FLVA 2WINI 2D2IA 3JR3A 4UVGA 4A0HA 3C41J 3R6DA 4TWJA 4KQ2A 3RJMA 3ZN2A 5I7EA 4GKKB 1YQ9A 2BTEA 1RW4A 1ULTA 4Q3CA 3J81k 4TXJA 1BD3A 1GCGA 1X9IA 3O1JC 2Y2UA 3TR5A 1RHQA 4ERXA 4J7CA 1UANA 5CFNA 2BTQB 1E5TA 1NVKA 1L4EA 3V6LA 3WMFA 4XQ0A 3TFOA 3P2IA 4OGFA 4Z4CA 1H3EA 4DIKA 2O3TA 1YHYA 4PNZA 1KQOA 2QVXX 5IP5A 1YRWA 3NORA 3Q72A 1Z83A 4MMXB 4R8MA 2EATA 5ISMA 1I3LA 3CX7A 2H3EA 3W90A 2LPMA 2PFSA 1VXOA 4PG6A 5ENVA 1V8DA 1FQKA 3P32A 2WJHA 1WP4A 3W3AD 4R0MA 4PHCA 1FP7A 4TTVA 4RJ2A 4KNWA 4QG3A 2DR2A 4DLWA 3TFWA 4DSOA 3V80A 3O3CA 5IJ9B 1RAFA 4FEAA 3WDSA 4BLTA 4D25A 5FI0B 3DL2A 4YAFA 3GZ4A 1HYEA 2PGNA 4HPWA 2O23A 3VC1A 3GLIE 5LYJF 1TI7A 1I80A 2VWGA 3WG9A 3QW2A 1PZEA 4PZ0A 2WIJA 3OKPA 1W30A 4MZDA 1HFKA 3SMQA 4XSVA 3BQ9A 4EFMA 1Q0TA 3REQB 1LDNA 3DMTC 3ZDFA 3MGGA 4FZVA 2OQRA 2HNBA 3G7UA 1Z0JA 2WU0A 3RBXA 2O1XA 2JFQA 2PU7A 4GZMA 3HVKA 1EP3B 4KFSA 3SK0A 1NY5A 4URYR 3I3SR 1YOVA 4DQVA 5DK6A 4YYEA 2C04A 3DR5A 3W7AA 1Z7EA 1FYEA 2VJPA 3M5PA 4LV6A 4Q3AA 1TLTA 2DLCX 7MHTA 3MJDA 1EK0A 1GTRA 5DSXA 4MS3B 4AQYB 4K3VA 3PC8A 4LVCA 4G97A 2B20A 5ERGB 2H1HA 5IVIA 5K8IA 4QUAA 4Q1CA 1Z2NX 2QL5A 1X8XA 2QIPA 4EKGA 5B55A 1KDRA 2W2OA 4B73A 4AJLA 1KI6B 2NSJA