4KO4S

High x-ray dose structure of anaerobically purified dm. baculatum [nifese]-hydrogenase after crystallization under air
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
279
structure length
279
Chain Sequence
AKKAPVIWVQGQGCTGCSVSLLNAVHPRIKEILLDVISLEFHPTVMASEGEMALAHMYEIAEKFNGNFFLLVEGAIPTAKEGRYCIVGETLDAKGHHHEVTMMELIRDLAPKSLATVAVGTCSAYGGIPAAEGNVTGSKSVRDFFADEKIEKLLVNVPGCPPHPDWMVGTLVAAWSHVLNPTEHPLPELDDDGRPLLFFGDNIHENCPYLDKYDNSEFAETFTKPGCKAELGCKGPSTYADCAKRRWNNGINWCVENAVCIGCVEPDFPDGKSPFYVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural foundations for the O2 resistance of Desulfomicrobium baculatum [NiFeSe]-hydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Periplasmic [NiFeSe] hydrogenase small subunit
total genus 85
structure length 279
sequence length 279
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ko4S01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ko4S02
4KN9S 1UBKS 3ZE6A 4KO2S 1UBHS 3RGWS 1UBJS 4IUDS 4UCXA 1FRVA 4UE2A 5A4FS 1FRFS 3H3XA 1UBMS 4UCQA 1WUHS 1CC1S 3USES 1YQ9A 5A4IS 5JSHA 1H2AS 3AYXB 1WUKS 1YQWA 3CUSA 1E3DA 3MYRA 1YRQA 1UBUS 5JSUA 3AYZB 4KO1S 4OMFG 4UEQA 4UEWA 4C3OB 4GD3Q 4KO3S 4UE6A 4UD2A 1UBOS 1WUIS 4IUCS 3ZE7A 3ZEAA 5JRDS 5A4MS 1UBLS 2FRVA 4UPEA 4UE3S 1WULS 3USCS 1UBRS 5JSYA 5ADUS 4KL8S 4UQPA 4CI0B 3UQYS 5JT1A 2WPNA 4IUBS 4U9IS 1WUJS 4UCWA 5D51S 4TTTS 4UQLA 1UBTS 4UD6A 4URHA 4UPVA 4U9HS 3CURA 5JSKA 3ZE9A 3ZE8A 1H2RS 4KO4S
chains in the Genus database with same CATH superfamily
4M7WA 2E87A 4YNBA 1V71A 4XB1A 4B7CA 3TW6A 3HDYA 4ZEMA 3V80A 3HM9A 3R9WA 1SIBE 3K9LA 1AQIA 3E3AA 2O4CA 3LBIA 3QWIA 3H3JA 3OBIA 4L27A 1V6CA 5D84A 3TQIA 2W2LD 4FSHA 4BKRA 4EY7A 5JHHB 3H6GA 4FD2A 3BILA 3ZCTA 2JFPA 2H8KA 2XGSA 4YXFA 2YWFA 2ZRNA 4M2LA 3MUNA 1LVHA 2XLCA 3ACBA 1Z4JA 2W6OA 5GIOE 1ZVKA 3QTLA 3UM9A 1AZTA 2C82A 2H7XA 4KIFA 1PYOA 2OY0A 2A6PA 1E1CB 2WOJA 3ESDA 1R0BA 4P8RA 1K9SA 1R74A 2AC2A 1UZMA 1XKXA 5HF5A 1I9GA 4QHSA 5TPZA 4UDOA 3W8NA 4W5OA 8LDHA 2KW5A 2WPDA 3OKCA 3D6UA 3WYGA 4CKYA 4V0KA 5CPBA 2DWPA 4PINA 4QJ4A 1JQDA 3IRVA 2X8LA 1PWXA 2YYYA 5FADA 3UK0A 5ALVA 1V1MA 3RKRA 4DCTA 1OW3B 1D5WA 1U1GA 3M4JA 3B8EA 1JLRA 3NB0A 3P9NA 4PX5A 5HIJA 1YFLA 1IK4A 1PFGA 1TX4B 4Q9AA 5K8CA 5L3QA 4EB0A 3HKDB 3DZGA 3GGDA 4CDNA 2IELA 4K3UA 3HKEB 3SYKA 4D97A 5K0LA 4LOLA 3OFJA 2LNDA 1XMQB 1BVHA 3KJZA 1DIAA 3PZRA 4KRXA 1WDTA 3DHVA 5G40A 2DBVO 1JHPA 1Z73A 2UVDA 3QUSA 4J7CA 4NSNA 3TI7A 2XOKA 2QTGA 3JYOA 2XUJA 1Y8QB 3OEWA 3UAOA 2WZCA 4DLSA 5B7PA 4X8HA 4FNGA 4Q1DA 2IYYA 1FTGA 1YZNA 2O3QA 3ACCA 4CKBB 4QX6A 3TLBA 3JZFA 3VO1A 4ACBA 4ZREA 5AM3A 1FOEB 1JBKA 3LW8A 3O8OA 2BJHA 3RARA 5A02A 1I7QB 4HH3C 1GGFA 4YP0A 3SIXA 4ZYTA 3KKKA 1PX0A 3UKDA 3LP8A 3M82A 3VDXA 3OQPA 5TGZA 1UXIA 3AVYA 3GJ0A 4AZ0B 2WWTA 2AZDA 5CAEA 2J3LA 3HADA 5HJ5A 2WVAA 3G9XA 3MQ2A 2PBLA 3TSWA 1S7GA 2JLXA 2FR1A 2HPZA 2BBWA 2QL6A 4HQ6A 2IXDA 4R5MA 5LB2A 4ZKEA 3WE7A 3ZHBA 1YQDA 4AJPA 2O6LA 4G67A 4CN9A 1Z68A 2YQZA 4KXFB 2E49A 5CXSA 4EKGA 5AVQA 3C6BA 1H8HA 1ZIYA 1T34A 5GGXA 1CULC 4AKEA 1QHGA 4URYR 2R7KA 5BSVA 4E31A 2FZKA 3B1JA 4XPIB 1Y0BA 3I5AA 1PDOA 4WESB 4ZVQA 2G25A 4TRRA 4DMLA 2MSEB 5H81A 2HIAA 2J9XB 1U6KA 2WYUA 4X1OA 2ZSFA 3MCAA 1LSOA 1A82A 2DZDA 1BVUA 4YJ2A 2GBCA 4FHDA 1XNJA 2DUMA 4OXYA 2DECA 1VLLA 3A25A 3ZNPA 4EMTA 1XX6A 5I7WA 4ESHA 1JI0A 2WU8A 4UBNA 4ZRDA 1Q1EA 3K6SA 2IYZA 3LIIA 4RSRA 3S2SA 4Y2YA 4D5EA 2GETA 1JEEA 1A5AB 1J09A 3H9QA 3UB4A 2EKZA 1NT2A 3Q3HA 4H6PA 3UK1A 1O57A 2QRZA 2PMCA 3JQDA 4N5DA 4DE5A 3E3LA 5CB4F 3HU3A 3TJMA 4D45A 7MHTA 4MR7B 3JD4A 4IJUA 4G4SP 1NVVR 2XMBA 1PN3A 3CLRD 4DQ0A 5KREA 4A0HA 1D2AA 4HQOA 5A62A 1XCBA 1IZYA 1AZSC 4Y7DA 5CM2Z 5I9MA 2XWSA 2VZ9A 3MWDA 5BUCA 3REGA 2WC1A 3CF2A 3QELA 5EPEA 5IDVA 1UBHS 3T7DA 1I5EA 3WLFA 5M29A 3IMGA 2B7LA 2GBLA 5G3YA 1ZG3A 1BJTA 4XYEA 4X61A 1SGWA 2JATA 3MYRA 1U9ZA 5KYUB 4OHXA 1I32A 4IH1A 1CTQA 1YQQA 3F9RA 5LXTB 3VH3A 4D0RA 1JFFA 4OP2A 1YZTA 1MUUA 3OEED 4HYTA 3B8HA 3GPBA 2H57A 3FRIA 2XVZA 4MW0A 5JJBA 5K2OA 4GZ5A 4C6SA 2W42A 4JP3A 1P0PA 3VPHA 1XELA 3IDFA 4RMNA 1GRRA 4I6EA 5EIFA 3BFVA 1VM6A 3ESQA 5I7VA 3C4JA 1RYBA 2B5WA 3LCRA 3GNLA 4KO2S 4N0QA 4OKSA 1Z75A 1QGOA 5AW2A 1TZCA 1Q0TA 1WZIA 4EG7A 3AEYA 1XRNA 5KOHB 1EFAA 2J0QA 4B2LA 1BCSB 1QS0A 1KSGA 3IMCA 4WFQA 1EGQA 2FQXA 2ZITA 3CE9A 4L74A 2VHTA 5J2TB 2O8BA 3BERA 1H1DA 5CG2A 4ZT5A 3NFRA 4QFMA 5BO5A 1R8XA 5E0KB 2CNLA 4KQFA 4NG5A 1ZJ4A 5J4YA 1NSTA 4AB1A 2CL5A 3RBVA 2RCNA 2ATCA 1TGYA 2YRFA 4RZXA 1TJ5A 2J67A 4ZI7A 3KZXA 4ZARA 2DP4E 4R9UC 1GN9A 5CFMA 1E6CA 1F4LA 4R6XA 2JI9A 4X54A 2AWNA 2P2YA 3V9PA 3QJYA 2F4NA 1PYGA 2J6BA 4R1UA 5F4BA 4ZO7A 1BXRA 3KKZA 5L95A 1WB9A 3NANA 1TE2A 2VUSA 4G2NA 3LUBA 1BWRA 3OVMA 4RF5A 1X39A 4MUKA 1XK6A 4H7FA 2FQ1A 3U31A 3W79A 5KYVA 1L5RA 4JLNA 3WGGA 5I45A 2HDWA 4RHYA 3UMCA 3USCS 5ALLA 1GITA 4JT2A 4D8WA 1ZPDA 2G6BA 4R3WA 4RPHA 1M2NA 2CUKA 1AKYA 2PCLA 1AMUA 4ZGBA 2G4VA 2VDNB 2XA2A 5AT1A 4BNTA 3QRWA 4F1KA 1OSNA 4BBPA 3GPCA 1WTCA 4IMIB 1NSYA 4TTRA 2NUBA 2EU8A 1RRVA 5K0JA 1AG9A 2QTAA 3WGTA 5EZQA 2B99A 3X1YA 4CG1A 4JXJA 2LZ0A 3BCHA 5MF6A 1FMFA 5LMUB 1KEEA 3BCRA 3TMYA 4JVSB 1PL6A 3VR6D 2GA9A 2ETVA 4A0FA 1OHHA 3HJBA 2PCJA 1EDEA 4IICA 5JWRA 3KZMA 1PWEA 1ZH4A 3FVTA 4TZ6A 1I14A 3URKA 1TJ4A 4GUDA 2HA7A 5DI3A 1X7XA 5JNVA 3HBLA 1NVAA 1TI7A 1VRWA 1TDJA 1YVUA 2IYUA 4WINA 3EUFA 3PUHA 5FUBA 4A26A 1QOPB 4DA4A 4DMCA 2I1QA 2VNJA 1KZ6A 1TADA 3DFKA 1NR1A 2HMTA 1OTXA 5IP5A 3CLHA 1DXHA 4J7AA 3OIDA 1QYRA 1FMJA 3L4JA 4LDPA 1IONA 2H2IA 3DC2A 4YAKA 5B12A 5L9AA 1RHQA 1GGHA 2EX4A 1M33A 4GKVA 4DLBA 2R2GA 1ORDA 4CMIA 1JNXX 4N0DA 5CT6A 2ZI9A 3EMVA 1RLTA 4EJSA 1ELOA 3FJOA 2IZZA 3LRXA 3GRFA 4NZZA 4DF3A 4N7MA 1U1IA 2P2DA 2Q2QA 2W2KB 5HG0A 2QQ5A 1Y8CA 3RV4A 3PA6A 4PFQA 5LSAA 4B7AA 4J0FA 3QV1A 4ER5A 2AFIE 3WLKX 3AEKB 1BA2A 2LKCA 2C07A 3LKZA 4JASB 5D01A 2E89A 1K8RA 3B3AA 1TD1A 5JS7A 2ADOA 5HF6A 2I6GA 1Y1TA 4GOJA 3SGLA 2PGOA 3OZCA 3LY5A 1S3FA 3HWSA 3LDAA 3EZYA 5EWLB 1NLUA 3DDNA 2LIVA 1KH2A 3OTGA 4KZPA 4OOFA 4QDOA 3AU8A 4I1PA 4DV1B 4J2OA 3PEEA 2LCQA 3PKJA 1DFIA 4DUYB 4CKEA 2KLBA 4ZHQF 3Q0IA 4KIGA 4KB5A 1C5KA 4AF6A 3S2EA 3PNVA 1ILEA 2PGDA 4TV8B 4HRXA 4MKZA 3RS3A 1JBQA 1PEKE 4UU8A 1JHVA 5BQOA 2AXNA 2JIDA 2DVMA 2L82A 1Z4MA 3IAS1 1K3UB 3DL7A 1JYFA 1B14A 1OZHA 3DFFA 3RSLA 2X7JA 1YJAA 2F1KA 3P9IA 1T6NA 5F33A 1KVSA 4N9WA 5BWMA 4LOAA 1M2OA 1NYTA 1T25A 1ZI6A 4PHCA 5AW8A 4BVEA 4FYWA 4I4TA 5AKEA 4OI0A 3CW8X 3HB0A 4DWWA 1PGNA 2Y1XA 3TJRA 4W7SA 3F7MA 2KSQA 3DWEX 1G63A 1YR9A 3NKLA 1IRXA 4UBLA 1Z5NA 5DNYB 1DC5A 4RCVA 3RIHA 3HSKA 3UG6A 4QM7A 2JD1A 3T9CA 3D0RA 4J9VA 3F47A 1VE9A 4KP7A 1RACA 2SKEA 3QJ5A 5ICMA 2YHUA 3F6YA 3ZIUA 1EX1A 5A05A 2ZDQA 3WVNA 1WHTA 5G41A 3SYNA 1R4AA 5E2AA 1TQ8A 1IHOA 1JPNA 2VG8A 4D26A 3MD0A 4Q3BA 3KWFA 2CV1A 1G5FA 4JOBA 4AZWA 2J32A 3TSOA 4RPCA 2PSDA 2FG7C 5DSZA 5JR3A 5K0BA 5EKXA 1GM5A 4I50F 5JJIA 1WXFA 1E79D 1IE3A 1HRKA 3SQNA 1H66A 3DUWA 1E9AA 2V8BA 1TEZA 3VPDA 2PKQO 1TQHA 1ODKA 3I72A 1JEQB 4N5MA 1ZD2P 4QFDA 4YRKA 1ULHA 2GCPA 3M5WA 3D3NA 2BFEA 3OE1A 3PD0A 3MN1A 4LHXA 3OP4A 1U0NA 3V2UA 4TXHA 2ZVJA 4PLVA 3LG2A 1YJQA 3GX1A 3R0IA 3FRJA 2W98A 5JEDA 1G59A 4CM7A 2UUOA 2X3UA 4L7QA 3NHLA 4TLCA 1RVV1 4P0TA 5AESA 3CF6R 1P39A 2R6CA 3PYLA 4HB0A 5AWFC 4ZCIA 1G7TA 5I9SA 2ZRFA 1N0WA 3HA2A 1XCJA 1NLFA 3DAOA 1B26A 3FUXA 5JSQA 1A5TA 3GA7A 1ZITA 3KWMA 3PWZA 3RS5A 1SOWA 1P6QA 2VXYA 1U0RA 4D9NA 2ZUFA 1ECFA 2IU3A 5CVEA 4U6SA 1GTSA 3NMUF 3WNZA 1LWOA 5DB4A 1EVJA 2P11A 5CLGA 3KJNA 2J3JA 4JK3A 4JUFA 1DRVA 4NPCA 1J70A 1C7FA 3EQZA 4BN4A 1M7BA 5CB8A 3ZX5A 3AZPA 5ULLA 4L5IA 5IBQA 1AU9A 5KNLA 4ZXFA 3DDUA 3W5JA 5B6IA 1NURA 3CTMA 2SNIE 4DNFA 4MI1A 5A9SA 5J4LA 1RJ9A 4W1PA 3CSSA 4CTOA 3CWCA 2IH4A 3GVPA 2EJWA 3P9CA 1HX7A 2Q8NA 1E2MA 4OQPA 1S8NA 1U7DA 1K4MA 1A77A 2OMKA 1OA0A 2VPWA 3OJ0A 3ZDRA 2JLUA 2CYCA 4MWEA 3DPIA 3B1XA 4CLDA 2XIQA 1DJMA 1RP7A 1X7WA 1SBHA 1W36C 1I1QB 4RD0A 1UK8A 2ZBUA 4DT1A 2Q6TA 3AUSA 3MMSA 2IXBA 2PANA 1BFKA 3ZIAA 4MV4A 2Q50A 2BR4A 3DTYA 3MTIA 1Z6ZA 5ADUS 4C05A 3IJEB 2BAGA 3LL7A 1CEXA 3LO8A 4RD6A 5PGMA 4YQFA 1QGDA 2FEPA 3LAWA 4CKCB 4J0DA 2G9ZA 4RPKA 4BVBA 3CH6A 2NMVA 4LWQA 5K8UA 2BUBA 2FPIA 3R7DA 1VG8A 2FWNA 3W78A 1G20B 2F9FA 4HYEA 3L6EA 3AR4A 3TK1A 1H0SA 5BSUA 3TQSA 1GFZA 4ZJZA 3MJCA 4EA6A 1WY5A 3IP3A 1GFSA 4FW8A 3TR0A 1QMPA 2OPBA 4FYHA 4N6NA 5T4EA 1SURA 2JJ2A 2DHCA 3CZ5A 1X86B 2M32A 3O90A 1IAQA 2HMWA 1RADA 2VNIA 4NESA 4HOYA 2JFFA 1J1ZA 2HSZA 2XVMA 3AFOA 4MQLA 3RUAA 5JBIA 3ENNA 5LUAA 1MT0A 1K2WA 3BA1A 1TTHA 3KCQA 3WKCA 3GF4A 5I7FA 5HJ7A 2D2IA 2AS0A 3CNQS 5EINA 3N0WA 5GVRA 2AWOA 3GV0A 5EQTA 5SZHB 4RVFA 3UFXA 5KB3A 1YL6A 1CUDA 3DM9B 1DLIA 3H2JA 2PBZA 1ZINA 2QNRA 3BVPA 3UWKA 3VYVA 4UUQA 1X1CA 3TVYA 3MJVA 3ZY6A 5TARA 3HR4A 4DQXA 1F2TA 1XZPA 4GWGA 3G17A 2GXAA 4NFHA 3W4JA 1WW3A 4F04A 1RM4A 3ES9A 1A9PA 4N49A 3IVXA 5BVGA 1N1GA 2E4AA 3K0AA 1Q22A 2EEZA 1EE9A 1G21A 2IX9A 3PCRB 1IIRA 3H0EA 2BKEA 4MR8A 5E8RA 1IZ0A 1TM4E 2IWHA 2ZT5A 3ML1A 1XN1A 3T3PB 4AF7A 4MOWA 3ZY3A 1DGQA 1RABA 2C1XA 1H5NA 4D56A 2PUBA 4ASUD 2VDRB 2EV9A 5IAOA 3SBDA 2C2ZA 3F3YA 3GDHA 1IWPB 3EVFA 1T9DA 4KNVA 1YUNA 3CTPA 4MWTA 2P0AA 2CV2A 4CQJA 2OV6A 5K3FA 3OPYI 2PA3A 1VL1A 5AUNB 1OLOA 2QVLA 4U4AA 4YV0A 4DLTA 3AUJB 2OXTA 2OP0A 1TIPA 1XIVA 121PA 1JFRA 5I9LA 5ITZB 3L6RA 3FCAA 4NCAA 4G1FA 2HT1A 4WERA 3DW1X 1GYRA 4X84A 1IQUA 4D96A 4OJQA 2Q1TA 4BVLA 1PJLA 1NN0A 5IAJA 4ZN6A 4W9MC 3PT9A 1GTL1 2QTVA 2BCEA 2ONCA 3E3NA 2H2FA 3Q5DA 2WWVD 3RRFA 2ECOA 2QF7A 3DV9A 4S2EA 5J2UF 3VU8A 3T5CA 1DOAA 3I30X 3THXB 4PVDA 2XW6A 4M9QA 3TQHA 5LM3A 2DULA 3IUBA 5B3AA 4QVGA 4LI3X 5CAEB 2XZTA 4OQMA 3E15A 4JODA 5FL7A 2CD7A 3GVXA 2R84A 3HXPA 3FW1A 2AEFA 3K0KA 3FOZA 4OJTA 4XXHA 1IY0A 1OOEA 5T8KC 3V4SA 4CEHA 3COJA 2V7GA 3SLGA 4XIGS 4P3PA 4AQDA 1VIMA 3D64A 4HTFB 5KVAA 4RTSA 2F1JA 3V4RA 4A82A 5I48A 3RS8A 2VT6A 4XEUA 4BVFA 2P62A 3LT0A 3EEOA 2P79A 3OEHA 5EKDA 1XTIA 2FY8A 1HDCA 2QUAA 3HUUA 3JALB 1RFLA 2H1OA 4KR2A 4WKCA 4WL0A 2PTHA 2WQZA 4E21A 3NIWA 2AUMA 5SY6A 1Z2PX 2L19A 4G4JA 4RA9A 3VJLA 4MKXA 5JD6A 1K8XB 4G23A 5KNDD 3KOUA 3MA0A 5D8DA 1RI2A 4G0WA 3TBHA 1E79A 3V1NA 4F11A 4RTQA 2H06A 2V7PA 3HB1A 4MMZB 2G4LA 2BHNA 3WL6A 5C8VA 1JEYB 3AU9A 3EDCA 1FXSA 3BDVA 3BIFA 3AHIA 5CBPA 3JAKA 4PG7A 1NAHA 2ILTA 3VZQA 3GPIA 3Q1LA 3EIWA 3R7NA 3U48A 5FBLB 4QELA 4PNHA 1HXHA 1R37A 4I8XA 5TEWA 1NPDA 4D9GA 4UPDA 2QP9X 1PDWA 4N3GA 2N1BA 5FWDA 1WV1A 3OPYA 2LCIA 4FDAA 1Q15A 1J2UA 3JX9A 3LC0A 3UC9A 3UWOA 3W77A 3JWJA 1PHRA 3HP4A 3MJ4A 4MUXA 3QVGB 1PJSA 4RCZA 1Z17A 1KVUA 3A58B 3ZCRA 3V8BA 3CUKA 4G2TA 3GJZA 2O2ZA 4HB4A 3OD5A 1DJNA 4JJZA 1ZFNA 4PFJA 2E3JA 2BI7A 2VATA 3PR2B 1VKZA 4E6EA 1KAGA 2IIQA 1TZ2A 1WRBA 1J39A 2QRQA 1AQYA 2ZSUA 3DVRX 5H16A 3SS9X 3KSBC 3W1EA 1J0XO 2GK3A 1W1WA 5KTOA 2C3PA 4KACA 2IS4A 1W75A 1JV2B 4RWEA 5IJ9B 3REFA 1T2NA 1UDXA 5EFOA 3OPQA 3QI7A 4QGGA 4BVJA 5IXYA 2H8GA 2H5EA 3BG5A 2ORED 2P9EA 3JD2A 4RX1A 4G8BA 1W581 5ECYA 1L7BA 4IJQA 4D8VA 1PE0A 2ZRPA 3EGIA 2WG2A 2AOVA 3BOSA 2B69A 1Z38A 2WYVA 1XDSA 2ECPA 1NLZA 4FHEA 4OL0A 5FUMA 3FGOA 4IUBS 5B6JA 1LBTA 3MPUA 5ENZA 3NBZC 4E03A 3JZDA 2PKYX 3UNXA 1X7YA 3B2NA 4JD5A 4J1TC 3M5PA 1ADYA 3DJYA 3MSXA 4F2PA 4L51A 2AJCA 3R9IA 1KIMA 3BF7A 4GP6A 5KPJA 3DPSA 2I9KA 1X80A 1UZNA 1AS0A 4JR2A 5BURA 3U09A 2Y0CA 1IHYA 3DM5A 3HYLA 4UXIA 5DI3B 2YZ2A 1UKAA 2QTMA 3LQ4A 4FYYA 1HPLA 2JDIA 2ACKA 2Q3BA 4P6VF 4I1OA 1U3WA 4OP3A 4R2IA 4A23A 4GI2A 4R83A 3ULKA 4CG2A 5F1KA 4GOMD 1XEFA 2RGWA 3VR2A 1NVWQ 3MWJA 1KMMA 1JILA 1PZXA 5EZYF 3PUKA 5KNCA 1NXVA 2I54A 3DB2A 3AINA 1U0TA 1UPCA 2FUNB 3R0ZA 4HD8A 1TM3E 1UFOA 4JP8A 3GPDG 3SS7X 1UDCA 5JIBA 3CISA 1OQAA 3IUNA 4NZNA 4JLAA 5C4MA 4ZO4A 2W43A 3IC5A 4IKPA 5EZSA 2G1UA 3C4QA 4CMEC 3UN1A 2OBXA 4Q6BA 4C4OA 4X20A 2IIVA 4N47A 2X13A 2VRCA 3A1CA 4JLDA 4K6CA 4PAGA 3B52X 3RK1A 4MDEA 2NUPA 5YASA 4IDBA 1E7RA 1TAUA 4Z51A 3KHSA 2PD4A 3PFHA 4RGQA 4IS2A 3REOA 4KQXA 1M2EA 3VR6A 3DMNA 4ZTZB 4IDFA 4OQNA 3DG9A 4XSGA 4FEEA 1DIRA 4X95A 4F6RB 2YVUA 1V9SA 3A1VA 5E4TA 5L51A 1U63A 2Z57A 3NHAA 3F4KA 1QU3A 2RONA 2A0FA 1ETUA 2GD1O 3R77A 2CLHB 1A2QA 4RV5A 1V95A 3LHKA 3WXMA 1TO1E 1TVCA 2EW1A 1UDRA 3B38A 3ELWA 3B1FA 3OFVA 3ETNA 2JCGA 3HSSA 1LLDA 1IQ0A 2HAEA 3ZKWB 4BMNA 4OSPA 5AFSA 2W37A 3NUGA 4GOXA 2YRXA 4O4HF 2PV0A 3TBFA 1XYGA 1NUHA 5A9SB 1ZJWA 4C0HA 4GZMA 3D31A 1QONA 4I8DA 1FXWA 1LJLA 3EOAI 3MTEA 3AVPA 3D2CA 3RFUA 2CFCA 3ETCA 4KAAA 2Q0QA 2P65A 1Y5IA 4CI0B 5EJ6A 3LC7O 3EPHA 2DSNA 4M38A 4MUIA 1Z28A 3FI0A 4TS9A 4DIUA 3D7KA 4RHUA 4WT7A 5IRCD 3DEZA 1QGUA 2IY7A 3KL4A 1G8YA 1R50A 1U8YA 2H48A 3C5VA 1BEEA 3X1KA 1R5OA 1XCOA 2IEYA 1JHDA 2HQBA 4Y6PA 1BD3A 3QUAA 4HDKA 1CUAA 3ZDFA 1ZNYA 4Q4HB 2VWGA 4JC8A 1YL5A 4BE7B 1E6KA 1FSPA 1L1QA 4KXUA 4LE2A 1KDPA 4GQAA 5NULA 4TV9B 3AWIA 1P60A 1FSZA 3S1AA 2VH2A 4K26A 4ZAWA 5K09A 1NWCA 1QAOA 3FYCA 3KU1A 5D3MB 4N3AA 2BFBA 1H9BA 1F8GA 1I4DD 3PYMA 1O97D 2J3DA 3D1JA 2XZDA 3SS8A 3RTAA 3GBSA 5BORA 1EXNA 2A86A 3A1EA 3GI1A 3AEXA 3KOZA 2ZWAA 4PYLA 2LGJA 1L3CA 1VJDA 5JEEA 4OMUA 1E4EA 4O4HB 1W5TA 1SELA 1D4ZA 1NI4A 1VPLA 1GGKA 4CCYA 1BWQA 3UFXB 3ZK9A 2ATVA 5DBFA 2J30A 5K8TA 4JV5B 2IQ5A 3S8MA 1JKMA 5IHXA 2D1FA 1PSZA 2F7SA 3ITKA 3OIGA 3B5IA 2Y1CA 3U9LA 3ND8A 1B6TA 2IRWA 4ZTBA 2PU7A 2GPWA 1VI5A 4ZT3A 1QLHA 1UXJA 4DG8A 2IU6A 4Q4HA 5I9BA 3K1YA 2Q28A 1ZLXA 4F92B 4E07A 2VBCA 2EIXA 2JH3A 4DCUA 2CXNA 4HT3B 3D0OA 2PH1A 4RJLA 3OE5A 4RGVA 1W8IA 3QOFA 4U2GA 4KLZA 3B1ZA 2NVUB 1Y63A 1XPJA 3VPFA 1GNLA 1XYYA 3V4FA 4CM5A 1JWAB 2A4MA 3CW2A 3OO1A 2Z1DA 4FDMA 1O87A 1W5SA 2UYQA 2ZIAA 4NIMA 2ENWA 2KBFA 3F5SA 1KI4A 4WX2B 1NMYA 1VSUA 3C7KA 3VMMA 3U44B 3MRSA 2F3QA 2VF8A 4AY4A 4GRDA 3LP5A 4E70A 3EEYA 2GEDA 3CRVA 4IG4A 1DKUA 2COKA 2JFVA 1RZUA 1FXUA 2BFDB 1H2YA 1J25A 1JALA 2FEKA 1PS0A 3RRMA 3KQSA 4BL5A 4X90A 4N18A 3NBYC 3IP1A 1UAAA 1YMVA 3IFSA 4M76B 1JG3A 3BH7A 4V0QA 3ZI4A 2D1TA 1ENYA 1Z7EA 4JB0A 4X8MA 3JQAA 3HR7A 2C0CA 1CF4A 4JMLA 2P6UA 1KH1A 1YQUA 3KTDA 4Z4QA 2ZUWA 3AUTA 1K92A 4FT2A 2P7HA 4DRYA 2FPWA 4UBOA 3FMIA 3D3QA 1KHTA 3LUKA 1OV4A 4TZKA 4LZJA 2P6NA 2VPZA 3GEBA 4PQFA 2ZETA 4GS5A 3PXGA 5LKAA 5AYVA 1GVNB 4PYNA 4CBVA 4TZ0A 1VGQA 4LY6A 4IQ8A 1V1MB 3SKVA 2JGEA 1NE7A 4HH1A 5HK9A 1MB3A 4EJ2A 3IP7A 3A10A 1Y8RA 4GFDA 3L0CA 4CQMB 2QU7A 3L0IB 1Q0UA 4BU0A 3T95A 5BSKA 3NO4A 1TB4A 1GQSA 1G17A 3LUDA 1IU9A 4EB6A 5BR8B 1ISGA 1MV8A 1B3BA 2FFQA 2P6OA 3GY0A 3PHJA 4JR1A 2FEMA 2XGMA 4ZAYA 2HK6A 1GADO 3FMFA 4YT4A 1UDAA 2TMYA 2ZYGA 1TFRA 1K8YB 4OB7A 1AKNA 1WE2A 4GLBA 2LWIA 3WIBA 2DH5A 1NVMB 1UZAA 5EVJA 3E48A 4ZVMA 2Q5FA 3EJ6A 1TTTA 4KKVA 4FFLA 1SVKA 4L4UA 4OK3A 8OHMA 1GKIA 1QE0A 1IUPA 4FINA 4Q3CA 3V42A 5JMWA 1ZGBA 1ZC3A 3S5UA 4L75A 4X62B 5IVIA 1OTHA 4X93A 1RMTA 2ZKIA 3KJHA 3H2BA 1A8HA 1XF9A 3BCSA 3NM6B 1QIKA 1KBOA 3SNKA 2ISCA 2G80A 3A3PA 4JEUA 1D1PA 4LZNA 1W0KA 3VR5D 4DNXA 3K0CC 5JT1A 3L06A 1PVDA 3DOCA 4GOKA 3BB1A 4KNYA 4XWTA 5JSKA 1B73A 2YXDA 1EQ2A 1NXPA 1P77A 4QUEA 3L1JA 3Q8WA 4MTLA 3WC4A 3NRJA 2UZ0A 2HXSA 4FI3C 5C3MA 2O07A 2ZBPA 2WPDD 3KJFA 4MS4B 4GMKA 4D02A 5L40A 3K94A 3G0CA 4IIUA 2VXCA 3QU2A 1MB0A 4AZTA 3T3HA 4ZYXA 5CXUA 1CZOA 1ZD9A 3T7IA 2VZ0A 1G16A 3EVAA 1HQKA 5TQVA 5C53B 1T0HB 4CEHB 5T4HA 1ST2A 3PNPA 1Y3HA 2VN8A 1E9FA 2LW7A 1MO4A 4AAYA 1X1EA 3I9JA 4JQCA 4AMYA 4Z7NB 5KVVA 2C0PA 2G0AA 3V1KA 4ZGGA 2Q6OA 1P2SA 1PEYA 3IEMA 2W2LA 4YC7A 1XHLA 3VYWA 4AULA 4LHEA 1XDUA 4MIYA 5HFAA 4C21A 1PR6A 1UAYA 5ALIA 4ZPXA 3R3VA 3HL0A 5TLSA 3PQCA 3KUCA 2V6MA 2YRWA 1IVNA 1E3JA 1USWA 3I0ZA 4MVJA 1Y6GA 3R5XA 2WSSD 5IBCA 1E2UA 1ZXLA 3KE8A 4RFVA 5K3BA 2UVQA 4KLRA 2G70A 4TXNA 3K05A 4L5CA 1Q0QA 3RHSA 1ZCAA 5DLQC 4URXR 3ZI7A 4X8OA 4OXRA 3VC7A 4HX2A 2ERXA 1TJNA 1X1DA 5DP1A 1JG2A 5BQ5A 2PZFA 1J2TA 3F49S 3HRIA 5AICA 2XMRA 4OLAA 3DDOA 1Y81A 1V3UA 3E3OA 3O4JA 4Q03A 2WIKA 3ENKA 4RWZA 2HF9A 3FPKA 1DO0A 1KEUA 2LD4A 1TTPB 3ZE1B 4D4GA 3AF5A 4L4XA 3OPYB 3GRUA 3PRYA 4Z4HA 1CUUA 1POXA 1WMEA 2P9QA 5T5QA 4A8JB 3DO5A 4NNOA 1Z16A 1PTJC 3L7NA 1QNLA 1IN8A 1YXMA 2PLRA 3DEKA 3NOQA 4R0NA 2AFIB 5JADA 3CLUD 5CLLA 3HCWA 5AK5A 4BEWA 2JHAA 1OROA 4RJKA 2W0SA 2ZRAA 3CLSC 3L40A 3FOCA 1DCKA 2DHDA 4YDHB 5IF9A 1G5QA 3JAWA 4ZQEA 4D9FA 4YAJA 3M6AA 5K4HA 5D2CA 3DCNA 2VSOA 4FHZA 4RJ2A 4BCDA 4BZQA 3NGXA 5ITZA 3T1HB 1ACMA 4C4TA 3IT0A 3ZK7A 4OJNA 4WOPA 4Y30A 4DARA 5CT9A 5FBQB 5JSFA 3O93A 5CUQA 1KMHA 2NQ2C 4B3FX 2D2XA 4HVLA 4LTNA 3DR5A 2CLKB 3QXGA 1I4EB 4WZ6A 5K3OA 1Z12A 4COOA 2DGDA 4UHKA 1T9ZA 4MR9A 2D7DA 1KFEB 3RT7A 4L22A 4RIHA 2DPYA 3UA4A 5EWJA 1ZONA 3ZVLA 4E5MA 2IOHA 1A27A 1E9CA 2D2VA 2DAPA 2X9LA 4J8PA 3UATA 3UQZA 1E1MA 2IZ0A 3KAJA 4XZ3A 6LDHA 1SM4A 3HCPA 1G6KA 4G5QA 2C96A 2EKBA 4GBED 4KO1S 4XQEA 3VPSA 4IWNA 3DMGA 4RF2A 3DTVD 4EFLA 2Z2ZA 1Z2EA 1DC3A 2DTEA 1C9MA 1T36A 1YBMA 1D6JA 3I2YX 3D9QX 3I01A 3MRTA 4FYVA 3G13A 4I5IA 4Q1FA 4QVKA 4ZC8A 2A1UB 4PGMA 1LFDB 2L18A 5BVHA 1YA6A 2GNAA 4D81A 2I87A 2FPGB 2VK1A 4HFJA 1QIJA 4RVDA 3WQSB 2A1TS 3KOYA 1WO8A 1OXTA 3AW9A 3KPJA 5B53A 4YPVA 2Y99A 1FP4A 3MZ0A 4LTDA 4NU6A 5CGQB 3ZCPA 4PS1A 4EMBA 4CGZA 3QWAA 1NXOA 5JSHA 2GN8A 4MLPA 5DMXA 4P38A 3QXXA 3AETA 2G1KA 3R23A 4MW2A 5ALRA 3W5CA 3K09A 2ZSEA 4HN4B 2X1VA 3FMGA 2QRJA 3IULA 2XYHA 3A8TA 4NMLA 5EPOA 1PZMA 2XDYA 3X1XA 2GZ3A 4B8YA 2QX6A 5JPCA 3EGDB 5EFZA 2B25A 2QQ0A 5DTQA 3NIDB 2G71A 3N6VA 4JITA 4OLHA 2JZNA 3ZGOA 4BLWA 4DJFC 2J4DA 2HRRA 2O0JA 3FTCA 4WJLA 3SQLA 1CS0B 2J46A 5DYTA 3V4VB 5A3JA 5C1BA 4ZT2A 1D2CA 2CMGA 4A0SA 1GILA 3UIEA 2F4VB 1KFCB 1G1MA 5JZVA 3O4IA 2QLMA 3AXTA 4MVJG 4ZIRA 3RF6A 1ZRNA 3HCDA 3FH0A 4R5HA 5WRFA 5J2UA 2I9PA 3EWNA 2JIZA 2FX3A 1J1IA 4L07A 1GVHA 5JISA 4HNAA 3VNVA 3U0VA 2XMCA 3KLMX 1XYVA 4KPFC 2XJ9A 1MO5A 2R8BA 5COBA 3AY3A 3E6AA 5AM1A 4PAQA 3QMPA 5J58A 2WHPB 3AJEA 4ND3A 2B4TO 1Y4ZA 4IVPA 3O4HA 3AOEC 2GJ8A 1CUHA 3CHYA 3E8SA 1UBLS 3H4TA 2ZRCA 1D9ZA 4Y6RA 4G4GA 1MVNA 4AI6A 1A7KA 4JXKA 1DXQA 5HCUA 2GFIA 2WKWA 4CN8A 3M70A 3N86A 2IUSA 5B2FA 1VIVA 5EXSA 3U4DA 1LI5A 4GPAA 4OQDA 3O8NA 2ID4A 4DEXA 4AYWA 2LIPA 1JR6A 1DBSA 2OV4A 2XYPA 3EQ9A 3M9XA 2GLXA 4C4YA 2CN1A 1K7SN 3FPAA 1BEZA 3GJ6A 3N7AA 4MRMA 4QODA 4YGYA 4LV8B 5BP7A 4MGIR 2G67A 2CNKA 3C4VA 1CS0A 2ZSIA 3FTDA 2A7QA 3OTHA 3WGNA 3ROGA 5IJ0B 1OYYA 2GKGA 1ZGHA 5E3IA 3INTA 3SQOA 3EJWA 3QWHA 3IVCA 4UHCA 1MQ8B 1UT6A 4EHIA 4IJVA 3D2AA 2VLBA 2QORA 2ZYWX 2CJWA 2BSAA 3CBGA 3JQ8B 4Z9XA 4GOOD 4GLLA 5D6OA 1QYDA 2FP4A 2ZRHA 2J4CA 5H8WA 4PYQA 1SHKA 4UUNA 2F8TA 4JWTA 1NVTA 3UOGA 4YUWA 3HKDA 2AJBA 3FDIA 1CWUA 3UK7A 3H5RA 1FB5A 2V55B 2HDNB 4OHPA 3RFCA 5DHSA 1O0CA 2QSJA 1U99A 4KUHA 1Q0RA 4BO1A 4YT2A 4KKXB 1G0OA 1IAVA 3F6SA 5EZ5A 1DFHA 4LBZA 4DIMA 3N28A 3Q8LA 1R6TA 3X1WA 4PAWA 1XZNA 1SVUA 3EBOA 5EUCA 3EUAA 3ANXA 2DQSA 4EFDA 4P83A 1QRDA 2JGFA 2C7VA 4HXYA 1L5NA 3QG1A 1EFCA 1CR2A 3OCWA 5A71A 4H7HA 1BKSB 4OHWA 3H16A 4DUZB 3T15A 3EXHC 1E2NA 2QAGC 3AI1A 4INJA 3V6LA 2V6JA 1NTOA 2DQYA 2NSHA 2O2JA 3F90A 3PBKA 1M73E 3QIAA 4V2UA 5HS4A 1E62A 1E4OA 3U13A 2W2VA 3SMVA 1UQTA 1W30A 3EFOB 3LBNA 4MCHA 2WV9A 5J23A 5AOCA 1KJIA 1DE0A 4PF1A 1DUVG 1ISHA 2IFTA 1OGJA 1DEAA 1I4TD 4EKIA 2NP7A 3QVXA 1NIPA 1IWBB 2H3HA 2O50A 1ZEJA 2Q5IA 3F8TA 3BEDA 1TCVA 3NZEA 1E1YA 3NNNA 3PVZA 1EHCA 2ZSDA 5AI6A 4HQNA 4D9BA 4KQ9A 1U31A 3PXBA 1PYDA 3LWBA 4YCSA 2OLEA 2Q1YA 2A92A 2BGTA 3AHGA 3BTVA 3F8SA 4LXUA 4XRGA 3CCCA 3LUHA 4Z86A 5E6UB 4HRYA 4AO8A 2ZIZA 1TIBA 1I51A 1N5RA 4KE7A 1E2KA 1NI5A 1WPRA 2CF5A 4IZHA 5K6RA 1KFBB 1J97A 5AD1A 3D8BA 4O4JF 3NBXX 5LNK6 2ZWIA 3MTQA 3T94A 1ZJ5A 1S5PA 2WTEA 3OT4A 5IASA 1XSEA 3MG9A 1U3DA 5H70A 1E96A 3Q8MA 1G38A 4EG3A 3QA9A 1U2TA 3LECA 5E6RA 4LBWA 5FR1A 2W0MA 5A9TA 4M7RA 2PX0A 4MA4A 4R8SA 4UZFA 1CC1S 1SQ5A 2EJVA 3NIBA 5EI5A 1W4ZA 4RZSA 1F06A 1O77A 1KSJA 1PQWA 2BGKA 1M8GA 2NZ2A 4RCYA 2C83A 3SN6A 2ARKA 1EFRD 4K05A 1DHRA 3FWHA 4QEZA 6AT1A 3QTBA 5MFZA 2O7NA 4RADA 1IUKA 4NBUA 4ALMA 2PUCA 1USUA 1AUVA 3KC2A 1N5IA 4HAXA 1C3OB 2WABA 1N78A 5KC8A 1OXXK 1VHWA 1PZFA 2RSLA 3GRRA 3QVSA 3SQDA 5D51S 4P80A 4YBRA 1U8FO 1Q6YA 4CPDA 1GL9B 1PW7A 1C80A 2UZAA 2DFPA 2JF0A 2PGAA 3BHIA 3JAMA 3DMDA 2HJRA 4QFCA 1TU0A 4L02A 3OZFA 4L28A 1P0QA 4BVGA 4GWLA 5DGHA 1KFJB 3E84A 3AY6A 2MINB 2ZWPA 4UNIA 5AHWA 1C1XA 1MB2A 3BREA 2CDRA 1EG7A 4NS1A 4ERXA 5CD1A 3L93A 1EUZA 1G3IA 3L18A 4HN9A 3VFDA 1CU1A 821PA 3CNNA 3CNBA 4ZYYA 5B36A 4KPYA 2ZWOA 1NZJA 3PGXA 2BEUA 3RNOA 3LPNA 4AIRA 2J3HA 3VMFA 3K1JA 2I4NA 4X0EA 3WYDA 4EVRA 2BZGA 1P74A 2JKYA 2B21A 1U2GC 3WNVA 4A5OA 4B44A 4F4DA 1N2JA 3PJGA 4ND4A 4LXYA 3LX6A 5AJZA 1Y5LA 1HNXB 2ZK7A 4N3BA 3JQFC 3H5IA 2H4HA 2JGMA 4LJAA 4RK6A 3DFUA 3Q1KA 3U3KA 1HE8B 2VAMA 4XX1A 4KOAA 1FU7A 4MUFA 2NU9A 5LDGA 5HKAA 1VA4A 2QR3A 1NLMA 1Y9DA 3OQHA 3EVCA 3Q88A 4MS4A 4Q48A 4FIZA 4YLEA 2RGCA 3IXMA 4S12A 5CK4A 2QL5A 1RXWA 3NTOA 3WRYC 1EE2A 1CSEE 1NE2A 1CZNA 1EQUA 1ORIA 2WUEA 3O0DA 4CFYA 1B6GA 3UUFA 4OIFA 1WLYA 1MB4A 3GAMA 2G1PA 1XZ8A 1DZIA 4IQGA 3T12A 1UM9A 2JB9A 3DDCA 5FL3A 3SEZA 3U17A 3ZOKA 3JQ6A 1JXMA 4FE4A 3WDMA 1WHSB 3RREA 4I81A 3HDTA 4Y1GA 1LQ2A 1SVMA 2DXIA 2G7ZA 4HQLA 1GCGA 2BDUA 2H1WA 4RELA 3FYUC 1B7GO 1RFGE 2I78A 5I7EA 2QM8A 3UJ8A 2XGJA 5DXJA 1WD7A 3WFJA 2P69A 1W0KD 4L8WB 2AI1A 1RT9A 4GICA 2BGWA 3T1QA 4RHEA 4R8MA 3USZA 2D0OB 4MH0R 1C3XA 2RIRA 2ZSJA 4UCFA 5FTMA 2X0EA 2A0XA 3TFQA 2WB4A 1UF9A 1Q2XA 4JFAA 4C2AA 3PJFA 4GVPA 5BV0A 3BMQB 2F9MA 1VSQA 4FMPA 1Y9ZA 2BMWA 2ZIWB 3I04A 3PF8A 2GHIA 2R7AA 4EAQA 2AOWA 3ODPA 4Q3OA 1AQLA 5I8WA 3OQ6A 3CUYA 1W0JA 4R9RA 3TNLA 3WFIA 3LOUA 1FNDA 1MJ5A 3AO0B 2OZLB 5ENDA 3ZDZB 1O58A 4ZI7B 1HFWA 3N8KA 1H05A 4ZT6A 4AKHA 5DXAA 3U49A 3OZWA 4CQLB 3J7TA 3NEPX 1P29A 3OTOB 3NDRA 3K4HA 4JQSA 2MHCA 5BWBA 1EAMA 5FV4A 1SXQA 3TDKA 1D0VA 2QROA 3MWYW 2VBGA 1CZHA 1MAAA 1Z6XA 3NIFB 2AC7A 1D8AA 2XTMA 2VXBA 1K06A 1Z7WA 1S2MA 1T2CA 2OGTA 3QWFA 3FIJA 4WOCA 5DDIP 3VR4D 2WQ6A 3U61B 4MHTA 4MVYA 1IRIA 2AI2A 4P4GA 2IYWA 4D2IA 1W87A 3RROA 4R0VA 1OVGA 1Y3IA 2ZRJA 1P91A 1VKJA 2UV8A 2YIMA 3KUKA 1TAGA 4S2UA 4ISBA 1VB3A 4BWVA 4C07A 2FMXA 4KVZA 5EE9A 3HBFA 1WCIA 3U37A 1JQLB 2Q6KA 2R4TA 3Q2OA 4LSMA 2MSDB 3UWSA 3GN1A 6CHYA 3DTVB 4LUCA 4C76A 3A9TA 1NRXA 3AYZB 2SCUA 3PNYA 1ZICA 3ZZ0A 3DT9A 5J40A 5KSOA 3EIEA 5JD5A 1I6WA 5B55A 1HBJA 4KIUA 4L76A 2X14A 3HGQA 5JY1A 5CK5A 3MQFA 4M9ZA 4OM8A 1U8CB 4UM5A 2E4ZA 3ZW8A 5KDOA 2V6GA 3QYPA 4S3MA 3LZDA 5IYZA 5J3JA 4GBGA 4G1UC 4XPZA 1MEJA 3GFBA 4EI7A 1VIYA 3QFFA 5JXGA 3KALA 2HRDA 1NX6A 2IDJA 2UVPA 2VUIB 3BFKA 3NH9A 3UH1A 3VKFA 2IS1A 1Q5PA 2DR2A 2HV8A 1JFLA 2LCFA 2NLOA 1KI9A 4D9KA 3AIMA 4BQFA 1M1NA 3ENQA 3P2MA 2HMVA 5AVVA 2PZJA 3BE8A 3G3EA 2AE1A 1UMBA 2IY9A 3D4IA 5BQPA 2KHZA 3K6RA 5UKDA 1GZ5A 2ATXA 2NACA 4TQUS 1DTWB 1HSZA 2JFZA 3FKSA 3I37X 4QTXA 3ZKWA 4B76A 3K31A 4YRIA 3MJDA 5BW5A 1Y4DE 3SHOA 2G9UA 2RH4A 1DX6A 2BKUA 2IU4A 3PNQA 2QTNA 4AECA 3V1UA 4RQTA 1QH8A 1R0ZA 5IVPA 2FN3A 1QFZA 5BPFA 3L9WA 3OJCA 1V7ZA 2BUCA 2HLPA 1YZKA 3KQYA 3LXMA 4NWIA 3OFSA 4YRZA 3N6RA 1NU6A 1RWWA 5IXJA 3FDXA 5LLDA 2VWPA 3K71B 1KYZA 2Q3HA 3C1UA 3IJRA 1J9ZA 3IT3A 2D3WA 3GZTB 3LL4A 1GEEA 3IT2A 3E61A 3LY8A 4MRVA 4D43A 3PQ5A 3QA3E 4LW8A 1CNEA 1ZXBA 2H0RA 2O2GA 1JDSA 1NP3A 2R87A 2ZS9A 3EZFA 3JD1A 3QFCA 4HVTA 1T3LA 4M8LA 1RRMA 1UQRA 2P4UA 4U8GA 4XARA 1FDVA 4IVRA 2MU1A 1QC5B 1JLSA 4OXIA 4NQRA 4R1LA 5J5AA 1PG2A 3FTQA 4RC9A 3WIVA 2J45A 4DQUA 5KWSA 3ZD9A 3JYNA 3OM1A 5EKUA 1V25A 4J1QA 1RU3A 4YRSA 3UZUA 4PLTA 1A96A 4JLSA 2GZ1A 3SR0A 3G68A 3GLHA 3N7TA 2TMKA 4YT8A 1K08A 1UMBB 1XQVA 4E5NA 4QOSA 4KHPB 4Y6OA 5JLAA 3D4LA 4YYEA 2B9VA 5BQXA 3WAJA 4PNEA 1XHEA 3HCOA 3NTVA 4OJMX 4IV8A 4LCBA 1D4FA 4ZGWA 2PS3A 5AVTA 3QLUC 2QVXX 5B3LA 3TIGA 1OREA 4J4TA 3GH1A 1F9AA 4JBXA 3D3JA 1G4AE 1XZEA 4JUAA 2OOKA 4XOUA 1PLLA 5FA5A 1NRWA 4E7OA 4B3DA 4NCJA 1C4XA 5EE5B 3ONDA 3KKNA 4KQ1A 3LCVB 4DXAA 4MV9A 2V3CC 2CL6X 3KDPA 2Z8YA 3TMKA 4E30A 2I99A 5IWAB 1S89A 1SCJA 2VUUA 3ZJUA 1Y7HA 1DXOA 4KH0A 4ON9A 2OQVA 4WOJA 1PKXA 3P0FA 3LLVA 4LF4B 3FJYA 4K03A 3PE3A 2DQKA 3FOAA 4YXWD 4CKEB 1C9NA 1A9TA 1P9WA 1SNYA 5DYNA 5ADWA 3F9IA 2A30A 1G2PA 4Y2GA 1SRRA 1M8FA 1QJCA 2FPGA 4F2DA 5HM6A 3K16A 3H5WA 1V6SA 4H31A 1FFYA 3KELA 4OHFA 1N8TA 1QG0A 5EWMA 3KZVA 2AZTA 2RHHA 2WFAA 4OA8A 4D74A 1DI0A 1AGRA 1JT9A 2OILA 3MJHA 1PJ3A 3CNEA 4P92A 4UZEA 2VSYA 1IDOA 2CLMB 2BRUA 2QUBA 2CVFA 1GPWB 1TO2E 2O23A 1SPBS 3UJ3X 2HLDA 2QNBA 2ZGVA 5IAEA 4BV8A 1KK1A 3SSAA 2X2FA 2A9QA 1CE8B 1G18A 4H59A 3F1KA 4UC0A 2PT9A 4ZU6X 3STXA 1LDYA 1S96A 1AQ6A 1FRFS 3QFSA 2WM8A 4JLBA 3UUEA 4YONB 2PMKA 4MVJM 1RAEA 3PQEA 4U3JB 1NVXQ 2PRJA 4I5DA 5JFOA 4TX1A 3VU0A 5HZKA 3ONNA 4RYLA 5FQNA 1XCMA 1E3LA 5AXAA 3L6BA 3Q7SA 1VPDA 4IF6A 4P22A 3WMRA 4G0MA 5AKYA 1LLCA 4EK9A 4EZBA 2REOA 1VFNA 1NOKA 2DQ4A 4BGDA 1BDMA 3L6DA 3VR2D 2BGRA 4WLEA 1WIWA 1C4KA 4EYKA 4X66B 4QJIA 1YS6A 4Z4GA 1GO2A 5KYGA 3ZVNA 4OK6A 3UAZA 3K8OE 4P4SB 1SB9A 1ZD3A 1UWLA 1PQPA 3NHWA 4PG8A 3E82A 1TAQA 1W93A 1RHMA 3EMBA 1ZAKA 2FWBA 4FNAA 5I9IA 1HK7A 2VTVA 3AJ9A 3N53A 5IVKA 1WDKA 1BW9A 1V8BA 2Q3MA 1JIQA 4QARA 4BC0A 2XBUA 1K8QA 1QVWA 1OBCA 1P8AA 5DTJA 4D3DA 4ZICA 3KAKA 5JH7B 2OFPA 3CJTA 5E2IA 2B2XA 5THKA 2VBIA 2G5CA 1RPNA 4Y9RA 4CCSA 3VOTA 1SHLA 3H8JA 3I2JA 1UDBA 4JQZA 5FOXA 2Q5CA 3DHNA 1TT5B 4ME6A 5LZ4A 4R8VA 5H68A 5ER9A 4JJ8A 5HKKD 2ZI6A 1KBQA 3NHJA 3RLFA 4ARUA 2XMPA 3DHYA 3AWDA 4JEMA 2ADMA 5DYGA 3UXEA 4OHRA 2IUEA 5J9FA 1W88B 1KAMA 1Z8NA 3OSZA 4GWKA 1I1NA 5EIWA 5CYGA 4BKPA 4G1VA 3HDVA 3Q6IA 3KWJA 1VYVA 4B3BA 4EPRA 4DSAA 1AMNA 2B82A 2X5JO 1Y1KE 4Q47A 4FFBA 4H3KB 3AUKA 3TQCA 2D3TA 4AP6A 4ENRA 1NUTA 4QBGB 2IBSA 4MQBA 1TKCA 5KDLA 2HU8A 2ON6A 2IU0A 2XOXA 4PC2A 4UEQA 3L8CA 4GD3Q 2PIAA 1YQEA 1JFSA 4MWCA 3RPEA 3SBOA 4P0PB 3EAQA 3QF4B 5JRZA 3GJQA 3S28A 2BDEA 5MGBA 2D6FA 1NYQA 3H8VA 3HB9A 3PDHA 3BRWA 2FETA 3A6GA 1CEEA 3P9SA 1SN7A 1D7AA 1DIHA 2MSKA 2ODWA 3HDHA 3EXIA 1EP9A 1BU8A 2OCYC 3FCYA 1LPOA 4Q7JB 3ZQ4A 1EXWA 3L02A 4JA0A 3MOGA 4XTRA 4TN1A 3BJIC 4BCCA 4DCOA 3O0TA 2HQ1A 4FFOA 3H4MA 1OD6A 4GMHA 1MPTA 3TQTA 2NOAA 1DBWA 2WZDA 5DW3A 4BWFB 1JLKA 1VGRA 1KDTA 3CA8A 5TPWB 1OI4A 1UJ2A 4F60A 1M0TA 2B1GA 3OOYA 3FUTA 1LD3A 2IITA 2DE0X 3H0CA 3KYIB 3ZTTA 2H92A 3CG4A 2E37A 5ALJA 4KE6A 5BN4B 3VPAA 5BNTA 4IJ5A 5LQCA 5KNDA 1EINA 3EWAA 2HWYA 5AUQA 4WXHA 1GOTA 3ZHTA 3LMKA 3S99A 3E9QA 3HVUA 4HTFA 2XMDA 5B1SA 4EW6A 4WADA 3HK2A 2J0UA 1VL0A 2O2DA 1H2EA 1QYWA 3LFHA 4KUEA 4MRSA 3ZVRA 4C01A 4UTZA 4NZPA 5KYYA 3IUMA 2HWKA 4PY2A 3Q3GE 3I6IA 5FEMA 3BIXA 1PK8A 2PV7A 4Q34A 1U3FA 2E1RA 3RG2A 2FXIA 3A70A 5FWYB 5JMOA 3H2ZA 3UCXA 3ZEIA 2JJQA 1EIWA 2FYTA 4XB2A 2V65A 3TS1A 4WLUA 5LVAA 3HJCA 1VOTA 2HJVA 1T35A 2PXAA 2X15A 1QQ6A 1N6OA 1QWOA 1X8KA 4L15A 4W8HA 4XSVA 3WL5A 3R24A 3S7TA 3LWZA 3GLQA 5AKJA 2F3RA 1QZZA 3FOFC 1RI5A 2WM3A 4EI9A 4AZVA 4IGEA 2QTVB 4RH0A 3AVQA 4DPKA 4HAIA 4QRDA 4HGPA 5A5EA 3TDNA 3NHSA 3BMXA 3TIVA 5TS3A 2P9ZA 4DB2A 2YY5A 3CZ9A 4N12A 4C6HA 3V97A 2W6MA 2AR7A 1JZSA 5BVGB 1NWHA 2QTZA 5IT5A 2BLLA 1TYEB 3M1AA 1Y7TA 1F4VA 1E3EA 3IRUA 2EW2A 4QSHA 3ST7A 2VYND 4ZZ2A 4LEIA 3KLPX 1JVNA 4M86A 1RTKA 3RRBA 2QR2A 5AJUA 1ND6A 1WCXA 3G5LA 1H6CA 2HU7A 4NAUA 3T5PA 4QXPA 1ZI8A 1XEXA 4YRDA 3A3NA 3NAQA 1X14A 3CQ9A 3HZZA 1C30B 2BEJA 1SAYA 4KNWA 4MV5A 4ZP1A 5AVJA 4WQMA 4XSHA 3S29A 3CMMA 3JRNA 2ADFA 1CR6A 3FNBA 2CKDA 3NHYA 4J4HA 4BB6A 1NF2A 3KKOA 1JSCA 1KOJA 4ZU1X 1JLLB 3CVWA 1UZLA 1TCUA 4PPGA 4S0XA 4CQLA 1WUTA 2JLRA 3W9YA 5IAKA 5IX8A 1X1QA 1Z4IA 3AW8A 4ZK6A 2FH5B 4XQGA 2PJDA 3TX6A 1V3TA 1HTTA 1P3DA 3E5NA 4LJ8A 2Q3DA 5H02A 3ZCQA 4D8TA 5F2EA 3DV0B 5KC9A 4ZYLA 3RS0A 2JASA 4BNHA 2CHQA 3OY7A 4HZIA 4JJGA 3KXKA 4XWOA 5EHXA 5EIOA 3RTCA 1XD2B 2XNSA 5AXCA 3WR5A 4H15A 1W85A 3QYJA 2CXUA 3UK2A 3U4IA 2G72A 2RI0A 3A7EA 5LDDC 1QH8B 2OFWA 4HGOA 5CCXA 3H5NA 3OE4A 1Z0FA 3O83A 4Z3DA 1E1QA 5E1OA 3TL3A 4PSUA 3UV3A 2SCUB 1AJEA 2F43A 1LV7A 1OAAA 3TPFA 4C5CA 2QD1A 3I6ZA 4JJEA 3O75A 3R3UA 5CVCA 9GPBA 3B1VA 1P7YA 2JW5A 1KAQA 1W4BA 1G8GA 4UVEA 2GR9A 3WWEA 1FS6A 3LUCA 5HVNA 5H3LA 2BBOA 5JCXA 3JVVA 1J56A 1NRJB 1U8ZA 1XZCA 1SOAA 2XUHA 4WMLA 4F0JA 3QVWA 1JLLA 1KEKA 3WNBA 3JSXA 5F2KA 3G9TA 3R3JA 4C1NA 4K0RA 4O2BA 4X24A 4NF2A 3LBYA 4MDYA 1RI4A 4R71A 1K6JA 1QH9A 3RIYA 4DIBA 6GPBA 3PNSA 3B7PA 4G5XA 1YHZA 4HO1X 4YCMA 3QITA 1VJTA 5CX4A 3WL7A 2FSVA 2FZWA 1B42A 4DCSA 4WKGA 1OH6A 1ZKDA 2JFBA 2QEQA 3W6OA 2PY6A 3ZIAD 4C7JA 4EGJA 2YZ7A 3DBHA 1ONNA 5LDHA 1JMYA 4Q3LA 5LD2C 1MHPA 5EJEA 3HL4A 1JJ7A 2C58A 3E8MA 4LYEA 2OB1A 4IKOA 4Y0NA 2NV2B 3NDBB 4OQ4A 3HU1A 3UANA 2A5LA 1WMDA 4I50A 5ER6A 4MCJA 4EKDA 2QLJA 1H0RA 1P1IA 2Q5EA 3KKQA 2Z6AA 4ZV7A 1BOFA 3HMQA 4LRYA 4NBSA 4TT8A 1KJ8A 4YJHA 1I8TA 4NCBA 1KORA 1PV2A 2CGEA 2XAUA 1OFTA 5DGCA 1G64A 5A06A 5J2TF 3SSMA 2DY1A 5HBGA 5JXWA 1DEHA 3E2IA 1NTRA 4TVKA 5IKXA 2D4HA 2JHGA 1LCIA 2HMYB 1FDTA 2VSQA 3H83A 4HWSA 4YRCA 5FI3A 5A2GA 4ZXPA 4JVNA 4I36A 2ISSD 1C30A 3OOEA 4J16C 3T35A 1NMXA 4K81B 3WGHA 1SU7A 2Z04A 3GNSA 3EODA 1XXLA 3IALA 2R8ZA 3KEQA 3TLGA 3EWIA 3TOVA 4A6PA 1RJWA 1JIIA 2ZZNA 1JHYA 3DVAB 3G1UA 3OOHA 2IHNA 3JYLA 2NPFA 4BZPA 1BJKA 4HXFB 3R7BA 5J47A 5JANA 2RHWA 3MS4A 2VP3A 4IGAA 3PRKE 1P0FA 3HDQA 3LCUA 4EJ6A 1LY1A 3H9BA 3H05A 5EZYA 1IOVA 1XTZA 4CMGA 1GL7A 4EEKA 4E88A 5EP4A 3H1FA 1PEDA 3OUTA 2Z2IA 4QLAA 1JH9A 2A78A 3NT5A 5MHTA 3L8GA 5JDIC 2AQ8A 2OXRA 2D1YA 2MOKA 4FLFA 4DJDC 1PIWA 2PVSA 3KUUA 3I12A 4DDUA 1O0BA 1HQDA 5DHTA 4GDFA 2OE2A 1R6UA 3DHWC 3WBKA 3HRKA 5F2NA 2NADA 1DQNA 2RAPA 3HLTA 2P7IA 3T5TA 1EUQA 4MUHA 5KNBH 4K86A 3SZGA 1WHTB 1AT1A 4MUEA 4PLCA 2XZPA 3AT1A 4A2CA 4A8JA 1NQ5A 1MRNA 4NQZA 4F7DA 3E81A 1FYVA 1U6JA 3ZYZA 2AFIA 4AS1A 4BZZA 1IY9A 2QL9A 4DTIA 1T5BA 5DKFA 4HB2A 4B4KA 1KDVA 4I4NA 3PT5A 3WHLA 4MJXA 3PTAA 2Z3VA 2A67A 2QRVA 4TTPA 3IAEA 2JHPA 3I1IA 1HG0A 1T6BY 1QSGA 2D5LA 3GMTA 3K9CA 3VTZA 2Y1LA 1EB9A 3D8RA 4KXQA 3KKMA 3WDSA 8ATCA 4UU0A 3MMZA 1Q1BA 2WJJA 3JATA 1K4YA 1QPGA 3FHCB 2ODNA 3IQFA 4IEEA 3VGJA 4CKWB 4CIVA 4EL5A 3W5BA 4DMMA 1E6EA 2FW9A 5FWXA 3N87A 1CE8A 1P62B 4A03A 1VMAA 2P40A 3AILA 1Y5MA 1HT2E 1X7YB 1ACJA 3E7DA 2R8XA 3RRXA 3JWGA 2I1WA 2VYQA 1QZ3A 1K75A 4P3NA 1O7JA 3D7RA 3V7WA 3LBHA 3TR6A 2XDQB 4YR9A 1FX0A 5CLFA 4UBMA 2Z08A 5IU6A 5TC4A 4OLJA 4P3XA 3DMTA 2AG0A 4C9BA 4XLTA 1ZK2A 3KHTA 3C8ZA 3ORHA 3HZRA 4GHWA 3ZHUA 4NOJA 4YWHA 1S9HA 4G0QA 4MO2A 2RBEA 2HBRA 3F4BA 2GBIA 3OIFA 3NORA 3ZD8A 2ZTMA 4E7PA 3FRHA 2YNMA 4PQEA 1PT5A 3MCZA 1W44A 5COQA 3GEEA 1J5EB 3RU7A 1GPYA 3KJXA 1SCQA 5KHLB 4YIKA 1KYXA 2X6QA 3G6KA 7YASA 3JR7A 1EI9A 4EFKA 5AW6A 3N59A 1DAOA 5GAJA 3THWA 1M1ZA 1KY4A 5HF8A 4NEHB 5BMVA 1QQ7A 1YC2A 1RRKA 4RE6A 3SF8B 3VC3A 2PJZA 2IYFA 2Y68A 4LDQA 2CVHA 4M83A 1MFZA 3WYBA 1P80A 4CUKA 2HCRA 3FMPB 3T3IA 2IQIA 2X2EA 5IFLA 1KZYC 1OI3A 4M0CA 1TF2A 2CZGA 1B0AA 2HU5A 1ZZGA 4KDRA 3GLUA 4KLCA 3GT3A 4YTEA 1AZLA 1GV0A 4PG4A 3SPXA 4U9IS 1E1LA 4FCTA 1Y7LA 3VH2A 4MGYR 4H4CA 4PAMA 2HDHA 2P9GA 1N6LA 2JLCA 2GCEA 4QO7A 4P7GA 4CM3A 2ZCVA 4G85A 2QYSA 2JFWA 1H2XA 2ONKA 1VE7A 4FZJA 4EYQA 2AG6A 1SU6A 2ZTSA 1REQA 3EGOA 4O1IA 4ZI7F 4UQOA 2VZLA 4Y8VA 2EYQA 3RHZA 2C5GA 2HA3A 3M6MD 3PUVA 4JHLA 1BH2A 3F98A 2NNWB 1C3EA 2PZAA 2J3QA 2CMFA 2FPIB 3G0IA 1UZUA 1Z5WA 1TCAA 1TQDA 2ZI4A 1HZZA 4WXEA 5IEJA 4GKBA 5DBGA 1DJLA 1Q84A 2V5UA 4YJFA 4NR0A 3V4OA 3UJ7A 1YBAA 4J7XA 3I34X 2E6KA 1JN0A 2G5TA 2Q1WA 2Q5HA 1EM8B 1AQUA 3AFHA 3BORA 3HXLA 1ISFA 4Q9NA 4GLJA 2OCXA 2PMDA 4YMWA 4F8EA 1TW3A 1OHHD 1M8JA 1RRCA 1A5BB 1ECPA 1P31A 3N8NA 4EAAA 4EITA 1I3CA 1Z13A 2FSSA 5JAUA 3N2KA 1RRGA 2P75A 4HDSB 1PRYA 4L0QA 2DWUA 3A2LA 5DYWA 3GPLA 4FZVA 1HYEA 2ZUUA 4GOLD 5K51A 5A4DA 2NXEA 1AK1A 5T4BA 3TKAA 1ZWKA 2A5GA 2GBGA 1SKAA 1XMIA 3QYFA 4HUQB 4JR0A 4WNYA 5JC1A 2CHEA 2OHVA 2X9VA 4PBRA 1HTBA 1OXUA 2CXSA 2REQA 6REQA 3X1ZA 1G5RA 1AE1A 5JO9A 1N34B 5IW8A 4JGGA 3CVYA 1AZWA 4YMHA 5AJVB 2I7CA 5A6VA 3EA0A 2J0SA 3O21A 1QTIA 1MC4A 2EYUA 1HEIA 2HHCA 2QAGB 2VDLB 2X1MA 3LDUA 3OETA 1NNUA 1VJ0A 1V96A 3DKPA 3OM8A 3PWTA 3HP7A 2ID7A 2EX0A 2JFYA 3ZCUA 1ZRSA 1J5PA 2WHXA 5T57A 2BGJA 5BWLA 3BGSA 4BKOA 3JZMA 4I4TF 1FFHA 1XE3A 1BXGA 4A6DA 1K5DA 2ISQA 5IZ4A 5DHPA 1Q0SA 4GLOA 4WBNA 1KKLA 2GKSA 3CSUA 4W1RA 3RC9A 4X1YA 1QLJA 1EFKA 2JEZA 3L1HA 3BKWA 3AM4A 3QNMA 2H1HA 3QU4A 5FV7A 4B4UA 4DSOA 1BRTA 4FU0A 4US2R 4JYZA 2RDMA 3DF9A 3ETJA 1NJ8A 4NRDA 2BFDA 1FVHA 3B1YA 3L0ZA 3LOPA 3QPCA 1GUAA 2CK3A 4E13A 4CIAA 1W5EA 2QD4A 4C0AC 1RC8A 4LZAA 1E4EB 4M0EA 1P7CA 3KWLA 2GF2A 4PIPA 3OZ7A 5ELLA 1LX7A 3T3GA 1LBSA 4KQ2A 1MKYA 3EEBA 4DLVA 3KV3O 5A5VA 5F64A 5KVCA 3TTUA 3U7FB 3ZBPA 8ABPA 1HG1A 4F5YA 4FKMA 3CT6A 3DBLB 3O95A 4YV2A 3LXXA 2UYHA 3GDGA 1JG1A 2LP4Y 3OX2A 4G41A 3HYTA 5KX5B 1JTEA 1O6FA 4IGKA 3FTPA 1W4LA 1SUEA 1XRQA 1JHMA 3BMOA 4KW7A 5ARCA 3UMGA 4PCAA 4E12A 5KWJA 1QXSA 3GLIB 2I55A 3RHFA 3OX4A 1TU4A 4TMKA 4KSBA 1CUWA 1I9CA 4OI1A 1Z4PX 4WWHA 1RWKA 2QKYA 4OHZA 3LRTA 3GOHA 4DQVA 2OFOA 4DG9A 4P7BA 4A27A 3HM2A 2FOIA 3RSQA 4J0KA 1SFRA 3UT6A 4DYDA 1FNMA 3Q11A 4EUHA 3QV2A 3CVXA 1ZBDA 5ETJA 1F2VA 2F1IA 2IPAB 2ZDHA 3C7DB 3HSYA 1IZ7A 3KFXA 4K9RA 1G21E 3IILA 3JARB 4HH0A 1UJ6A 3HMKA 4B8ZA 3DV2A 3PRHA 3RSSA 4V0NA 5TQ2A 1YKFA 3CM0A 4U8HA 3FTEA 4AM8A 4KE9A 1I1HA 1DAPA 4NCHA 5LMZA 5JNLA 3U39A 4OJYA 3T0GA 1BGXT 5GONF 2DFTA 1C8BA 3D4BA 3QW2A 1I7PA 4E1AA 5KSZA 5L3SA 1CZRA 4JBLA 3TSCA 1TZJA 4PYIA 3TKYA 3O38A 1Q12A 2JFOA 3KT6A 1PV4A 1KC1A 4DW8A 4DR6B 4QQKA 1KZ4A 2VYCA 5L6MB 3C7AA 4ER7A 3MWDB 2R6HA 4OX9Y 2Q4RA 2E5WA 4HUQA 4BS9A 5K0ZA 1QV7A 2EZ9A 3U80A 2V5AA 1E59A 1QCCA 3QLUA 4PVCA 3N0TA 4W8OA 2Z6QA 1XZIA 4WCFA 2FFAA 4FBGA 1KMNA 2CLCX 1CNFA 1N8KA 1EQAA 2OXCA 2FW1A 4PEVA 3QWBA 3RC3A 4Y3UA 2ZJ1A 2CJPA 4ARIA 1AUOA 1PNQA 2PYZA 3LBFA 4ESOA 4KN5A 4Q19A 3K0EA 1ZHHA 4F4IA 3ICCA 5KTRA 3PU6A 1U5AA 4BJ6A 2Z2XA 4MP8A 1AQNA 2NXWA 4D4JA 1GGNA 4QULA 3RFFA 1Q19A 4FS8A 3W6NA 2G3YA 3FYUA 2X0FA 1ISJA 2AIRA 2Y6UA 3Q3VA 2FCRA 5EEHA 4C3VA 2OSVA 4ND7A 2W6CX 2XJ4A 4P84A 3MWFA 1F0KA 1N0UA 2M1XA 1KRHA 2CFTA 4DHEA 4CF3A 1KO8A 1LNQA 2RGBA 4H1HA 4QLOA 3K35A 4UXHA 3ZWQA 3HO6A 3VJRA 4M1ZA 5IJAA 3WZ2A 5T7BA 3D7NA 3ZHZA 2O59A 5IXSA 2QLLA 4L9WA 1HT0A 5JH7F 3NTQA 1E3IA 2CW5A 3P2IA 4WVLA 3ADCA 2PX4A 1VPEA 4PZDA 1CW2B 1AKUA 3AFMA 1UBMS 2NYVA 1P2GA 1UKVY 4MGEA 2YJ4A 3ABSB 3J80A 3ZWOA 3GCXA 2MYNA 3DWIA 4MRAA 1VPVA 1H65A 2C2XA 1PWYE 3OUUA 2QXUA 4YASA 5LIRA 4E2WA 2A2ZA 4F1WA 1LRJA 3HPQA 3DOEA 4HDNA 4IO0A 4X6XA 4KUGA 4E46A 3F9CA 5F3WB 3P9PA 1CUBA 2PX6A 1A3CA 4D9EA 3AR6A 4BU1A 3ROMA 3LGAA 3ISTA 4QRHA 1L4YA 3NKVA 1EGVB 1DAHA 1LTHR 1ESMA 3F1LA 3CX8A 3NTUA 3T34A 1OZFA 1LA2A 1M10A 1SHJA 4ZJPA 5LJIA 2IBMA 1ODCA 4DAOA 9LDTA 5CLJA 3G1WA 1GCIA 1OAKA 5LYJA 3RB8A 5TF4A 5IZCA 1D2MA 1E18A 5JCOA 1YOVB 3CO0S 3QPVA 4K88A 4UU7A 5H80A 1XC7A 5DTEA 3W9UA 1QHEA 1TK3A 1G8PA 2IIBA 2VJBA 5IMSA 4REMA 4PPQA 1ZYUA 3R3XA 4YDSA 3AESB 5A2QA 4MYDA 1PG0A 2BFFB 5BYJA 2P6PA 1Y80A 2QK4A 1AV7A 4P86A 1F7UA 3FDFA 1BVYF 2V6BA 4B3GA 1CETA 3NJ8A 1ICEA 1WW8A 5K20A 3MQ4A 4KXVA 4AIIA 1DKQA 1QORA 4AC9A 4AN4A 3FWPA 2H63A 1IM5A 2V7UA 2W2TA 4GKJB 1N2XA 2Q45A 3ETEA 5A3SA 3W8RA 4D8YA 3D8TA 1GPKA 3SBXA 4ZCTA 3TRHA 1FFBA 3G49A 3GJXC 2OENG 1E32A 2QUJA 4QPCA 4H0FA 4NCXA 3IDAA 3HU2A 5LZ9A 2FVYA 2X0KA 4EYSA 4OHOA 2ZBGA 3Q2IA 1HSOA 3GJ4A 4UAGA 4AMBA 2VZ8A 2BTQB 3NTLA 1BDHA 3G89A 4CYMA 3QKRA 4UEKA 4JI7B 4RDCA 3SMQA 3I76A 3LFUA 2XNDD 1GPNA 3VR1A 2OV3A 4EMUA 1YAJA 4A92A 3I32A 1AHPA 1EE1A 3W9BA 4DWVA 2WU0A 2KB0A 2ZE5A 2C9CA 3EZ2A 3FCEA 3FYUB 4KDFA 3RSFA 1XTRA 3M81A 1E4YA 4FSDA 4L8YA 1B8VA 2WJYA 3SJ7A 3SZ3A 1ECGA 3T9AA 3JALA 3RHTA 3ROQA 1O95D 2OQ2A 4CCAA 1NQVA 2DCMA 4WCDA 2QM0A 2BFWA 2EHDA 2I3DA 4PO1A 1OIXA 4S1NA 5A7FA 7REQB 1UPAA 1MC5A 1SVNA 1O94D 2PPLA 4IZIA 3TL6A 2YYAA 4LGCA 1ZWLA 5AHXA 3PA8A 3IQIX 5TT0A 3WHPA 5T3YA 4HDCA 3DL2A 3ZEAA 3C74A 1IATA 1TO6A 4F4HA 4US1R 1FLVA 3CLVA 1XPOA 1JB9A 5H0IA 1WMBA 1W7AA 3W5AA 3HGMA 2H5JA 3TAUA 3VSEA 1EK1A 2EKPA 2RG1A 4I46A 2DBYA 4YCJA 5DGTA 1EFUA 1Z5GA 1LF5A 4QUGA 5EWLA 3DKVA 3R7FA 1O5TA 1SXJB 1IOLA 3EIHA 4TTAA 3ZWPA 3AM1A 2HRQA 3I6BA 1A9QA 1ISRA 4WNIA 4EEZA 5KTKA 2VQEB 3U4QB 3CX3A 1HYQA 4QDTA 2JC3A 4CL3A 2PR2A 4TSRA 2BMEA 4DLWA 3A1DA 3HUDA 2BFBB 1EMDA 1QCDA 1ZVQA 1JYSA 2CDNA 1JVBA 1Z47A 3I58A 4MYSA 1ECLA 4H77A 4WK4B 5D6NA 4DC9A 3ENZA 5CURA 2BFNA 3BWDD 4XJXA 5KPDA 5EHIA 1YOVA 3WI7A 3KUXA 5AM5A 2Q7DA 3B13B 3GH3A 3TLJA 3WIOA 2H6EA 721PA 1PTJA 3JATB 1VL5A 2NSJA 1CXZA 3I9V1 4M21A 2C9ZA 4TWAA 4W63A 4ZEOA 4NVRA 1HDEA 3FNRA 1TW2A 3A4IA 4NOKA 5LC1A 5LP6C 3L8ZA 4D9MA 4JY7A 4RFSB 1M1UA 3P9XA 4RU1A 2D2EA 4IRXA 4HMPA 4DADA 3K70C 3PKIA 3ZGLA 3B3GA 4ND6A 3TSAA 4ZVSA 3ONEA 1XRSB 5L7YA 3CUTA 4ZFNA 2EBHX 2IPNA 4D6XA 3KKEA 5ITWA 4TYWA 5CA0B 4I3GA 1STOA 5IBPA 1NW6A 4H3HB 5CM8B 1C3OA 4HHEA 1CHDA 1TJYA 3RT9A 5CA0F 2AMLA 2NYUA 4BEBA 3E7FA 2CVQA 5J2UB 4GDMA 2CT8A 3HLKA 4RLFA 3SIRA 3RTGA 1XJ0A 3EBLA 3WTCA 2CDCA 4AS2A 4LNHA 1U8TA 2XCUA 1PL7A 2R7MA 4OFXA 5HILA 1MZVA 1Q17A 1PJ4A 2B3DA 2JLSA 2YJ6A 4MJ3A 3ZW7A 1M5RA 1NXWA 4EPTA 1AUPA 1FP6A 2R00A 3EDRA 3L07A 1CV2A 3QFHA 3COPA 4NPAA 4ZOBA 2FN8A 4HNUA 2JAXA 4Z8XA 3TLGB 3EQ2A 3W5VA 4S1VA 4L72A 3RFXA 3RVBA 3EQ6A 3U5TA 2P4HX 3NXSA 1KJWA 5FH9A 1R0KA 1AB6A 2IL1A 3SFTA 1OWPA 5SYMA 4J75A 3MWLA 1Z2AA 4LY9A 2XRZA 1GDTA 3N8DA 2MT9A 3DHEA 3G2QA 4GIBA 4NDNE 4RPIA 1OYWA 2V7EA 3K5WA 3FSRA 5T64A 1QK4A 3RYFB 3V4LA 1XLTC 4FHFA 5G4KA 4W5HA 2ZBFA 3EFHA 3ELDA 3FYHA 1FUEA 5HFJA 4EHDA 5JOQA 2MTBA 4RXMA 3EDOA 2BN4A 1XQ9A 1XMPA 5KYTA 3KOMA 4FFWA 4EVIA 1C3LA 5CNJA 3E03A 3OCVA 1UCFA 4LQLA 4OUDB 3GVHA 4RH3A 2PXXA 4E15A 2FMFA 1LK5A 2OP1A 3HWX1 4YAWA 4RVGA 1TC1A 4YR7A 4LV5B 3M5DA 5U4QA 5LQKA 1YCHA 3LHFA 5CJ2A 1IC6A 5CHEA 3OFND 1NW4A 1M74A 2QN9A 2GCNA 3T61A 2MYUA 1T4DA 4CMKA 1YD7A 1Z22A 2IP2A 3BMCB 1ZM3A 3Q40A 4PHFA 2P91A 4TWRA 4U7WA 1YKGA 2M6KA 4M8NE 4N1AA 4G8DA 2C7BA 2CL7X 3HB5X 4HNSA 2PFSA 3NONA 2FDCA 4KGZA 1UJ5A 1QHHB 2HIHA 5BSRA 2JCBA 3ZWDA 1DKMA 5CLHA 4Z4CA 5FX2A 2BONA 3BFXA 1RLMA 1YWGO 1RCFA 3H5OA 3P0RA 4QDXA 4DNQA 5DBIA 3NBAA 1AGYA 2AG8A 5TQ2B 1HQCA 2PR7A 3CUVA 1KYWA 3WRVA 3LYAA 2OYRA 4HS4A 3L49A 3WBBA 1W6UA 4RW0A 4NJEB 4YJGB 3N39C 4X64B 3RYFA 3R1IA 4RK4A 3JW8A 5LQJA 4TPKA 3KXDA 4L9RA 1MO3A 1WBJB 6REQB 3MNFA 5HQTA 1N5LA 4IH9A 2B83A 1HMPA 1CRZA 1PSWA 4EM6A 4IDEA 4YAUA 1AO3A 3FSEA 3KEMA 3TG2A 3WWCA 1RCTE 2CFIA 4U39A 2QAGA 2NSYA 3T7KA 4FOOA 3U26A 2QIOA 3WDLA 3FVQA 2X3YA 4Z0PA 5KX5F 4S35A 1DIGA 1DX4A 1RNLA 4KSYA 1PHPA 1T1RA 2GUWA 2IZ1A 3O1HB 1A4RA 5FFFA 4ANFA 3T38A 1E1RD 2BEVB 2FW7A 3IV7A 4MEBA 4UNQA 3MFQA 2C97A 1K0UA 1PTKA 4FFBB 3RG8A 1WF6A 4BLTA 3HUTA 4WBNB 2J6IA 2HF7A 2G28A 4EUSA 5ICFA 3PC2A 3IHKA 1M67A 1C8LA 1ODFA 4YK7A 4YRLA 3QE9Y 5DGDA 3AF6A 1JHRA 2A9FA 2YMQA 2XBLA 1BE6A 3HUFA 4HLDA 4MHOA 1E0SA 1NNLA 3HYSA 1X1AA 5FF9A 4IQ4A 3UXYA 4WDRA 4ETWA 1R0XA 4J0GA 1C9JA 3ZCXA 2DH6A 2ZT7A 1RYMA 3AXSA 4RHCA 3V3KA 4TKUB 4PN7A 5HTKA 1K7YA 1Z8HA 1WHSA 3ZYCA 2HIMA 1DDGA 5DN6A 4ZDWA 5T67A 4FGWA 4IAOA 3WK6A 3KQUA 5TPWA 2NT3A 5E2BA 1SXHA 3B6EA 4RNCA 5DGXA 1J8QA 4LF6B 2BDTA 5I4IA 1OLUB 4OH1A 4ZCLA 3VI3B 4E3WA 2KBEA 3WLIA 2VNSA 2WW8A 3V3TA 3UAXA 3KCNA 4CQNA 1T0JB 1VC2A 1YBFA 1YB7A 3PIRA 2HJHA 4CMBA 2GXQA 2BMVA 2J0VA 2QX4A 3PEVA 5E6SA 3WDKA 4CM8A 2OO7A 1BQ4A 3WGYA 3FBWA 1VBMA 1LEHA 3ZV6A 3LM8A 1YAHA 1O4WA 4Y2UA 4BBZA 4ICIA 3LQQA 1USIA 5K0EA 1UPBA 3MJFA 2A0WA 4KGDA 1PK7A 4EENA 4EHNA 1UDWA 3OG9A 3EZNA 3DOOA 3QLVA 1M2GA 2FU5C 3HEAA 1MX1A 3B9RA 3G0OA 1LI7A 2IVZA 3FDZB 4G84A 5CH8A 3WNQA 1NR7A 4K9LA 5J4KA 2BEUB 1DBRA 1S2DA 2O1EA 2ACEA 3LYHA 4X5OA 3VYTB 3U6BA 1CYDA 2HSGA 2ORIA 3DCYA 1QHSA 4CIDA 1G5HA 2VXOA 3NHMA 3GGJA 3OF5A 1GPDG 2HFKA 1BO6A 1DUSA 2JFGA 3C1OA 4GXTA 4NNJA 4Q9JA 4UAJA 1PD0A 3VOAA 4CDGA 1ETHA 4ILKA 1JECA 3GJ8A 2W9XA 3MTAA 4NBTA 1J2JA 1OLSA 1V47A 1GDHA 2C5EA 1WB4A 1N4DA 3KBBA 3KSUA 4K9SA 2EWVA 4OQYA 1SPXA 3I3SR 1FE8A 1ZA1A 2FSVC 1SEPA 2QP3A 5BT9A 1M2VA 3QBTA 4C7BA 1VJ1A 1DKLA 1OFUA 2KE5A 3BM5A 4UNSA 4XFJA 2PIDA 2QRGA 2PE5A 4F4UA 4NK4A 4Y2PA 3PQ3A 4RESA 2C31A 2VQ3A 1E3QA 3NFYA 1CDEA 3B6JA 3ZV4A 1CJBA 1ONPA 3RWOA 4LJ4A 3SOPA 3TW8A 4AL4A 4F2HA 2D0IA 5KJ6A 4D3XA 1BS1A 3T52A 1T13A 4PC6A 4QYTA 4X1IA 3GIDA 3QPWA 3P2YA 2D5CA 4P7JA 2I4RA 5HOQA 1PEAA 2X9GA 5FAXA 3BE6A 1WQ3A 1F6DA 1J2RA 4UHBA 5K0NA 1HKHA 1V8OA 421PA 3FUVA 1T0BA 5BN3B 5L8VA 1G9XA 2CLDX 4B09A 5LOVA 2Y1FA 2LRHA 4CE6A 2Y93A 3EXFB 1NVGA 4NK5A 1T2UA 3IBCA 1K9VF 4Q4JA 5EGSA 2BHRA 1CHNA 4YP7A 1CIJA 1KJ9A 4Q16A 1KY2A 4A0GA 2PD3A 2XV1A 3D6FA 1L6IA 3IBFA 1Q21A 1DDOA 2HGSA 2R96A 3C16C 3KJGA 4JZKA 4ROTA 4ENWA 4MPPA 1QRUA 1SA0A 1Z56C 4EJSB 2FLVA 3DNFA 4I2NA 3S40A 2OM6A 5DIFA 4WY8A 4HFMA 2PHZA 2ZJ8A 1MAUA 1P7ZA 2EIHA 4OB8A 4M1MA 5D5QA 1NM5C 4NOMA 1GR0A 1I3OA 2GJ4A 2HOQA 2O52A 2GVDC 3C3AA 3DVSX 1GG9A 3LVRE 3MM4A 4NEQA 2IYQA 1GPAA 4D6YA 1MDBA 3AEUA 3TCNA 2WRZA 3HO8A 3O31A 4XM0A 2QT0A 1M0SA 4GM4A 1AA9A 3QVOA 1I30A 5AHRA 1BS2A 2OBBA 1R16A 2MSLA 2XIJA 1O9HA 4Q3AA 3TB4A 4LFBB 4W5WA 1LF0A 3STUA 1M8PA 3UGKA 5ITVA 3W5IA 4B31A 4TS3A 5LA6B 3HG7A 4MW7A 3TLAA 3A4MA 4MS3A 4DR7B 2C84A 5KYWA 2BMDA 2R7NA 4X7RA 2OGWA 1N9ZA 1JSLA 1NDQA 4RZIA 3A6LA 3CPHA 2Y3IA 4Q3KA 3BXGA 1XPRA 4IP0A 2IY8A 3EDMA 3L8HA 4EGQA 5MN5A 2H4XA 4L6CA 2ZU0C 5F1YA 2C2OA 1AUXA 3PQFA 4MRMB 4RKQA 3KU4A 4DXDA 4BPBA 3HV0A 3EIOA 4CI9A 1Y1QA 2OBMA 3QY9A 5CBKA 2JAWA 4MTCA 3GT7A 4OB6A 1Q77A 2HZ7A 1PUXA 3A1SA 1U2PA 1NJGA 4J2TA 2Y67A 2WUVA 4D8UA 1ZVMA 3ZJ5A 2UZ1B 3GUZA 4OGFA 3U3DA 5CYFA 4JB8A 4F45A 1XXHE 3PSAA 4P35A 2ID9A 4LOJA 3F3MA 2JGKA 4C06A 1KC3A 1OCEA 4W82A 2AX3A 2AKAB 4ZRMA 3X43A 4B2IA 1LLFA 1YB4A 3DEAA 3L77A 3W2FA 2GJSA 4MIOA 4NHEA 1TVKA 3LUAA 3QUQA 2NXNA 3U5ZB 2P9JA 1J33A 4N0MA 4UTNA 4L9AA 4MWGA 2HN9A 2QY6A 4YYZA 1FEZA 1Z06A 1A9OA 2K2WA 2Q1XA 1PSDA 1FFXA 2NU8B 1QAQA 1W96A 2IHBA 3LT1A 4IYRA 4LJKA 4Q02A 4W99A 4BFCA 4O2BF 3RFVA 1LDMA 1MG5A 1P1FA 2QRLA 1RHJA 2RHCA 3A1UA 2XT6A 1CUEA 1KH3A 2P77A 4R51A 5H7XA 1XTJA 3AF0A 3VOBA