4KO4S

High x-ray dose structure of anaerobically purified dm. baculatum [nifese]-hydrogenase after crystallization under air
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
279
structure length
279
Chain Sequence
AKKAPVIWVQGQGCTGCSVSLLNAVHPRIKEILLDVISLEFHPTVMASEGEMALAHMYEIAEKFNGNFFLLVEGAIPTAKEGRYCIVGETLDAKGHHHEVTMMELIRDLAPKSLATVAVGTCSAYGGIPAAEGNVTGSKSVRDFFADEKIEKLLVNVPGCPPHPDWMVGTLVAAWSHVLNPTEHPLPELDDDGRPLLFFGDNIHENCPYLDKYDNSEFAETFTKPGCKAELGCKGPSTYADCAKRRWNNGINWCVENAVCIGCVEPDFPDGKSPFYVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic [NiFeSe] hydrogenase small subunit
publication title Structural foundations for the O2 resistance of Desulfomicrobium baculatum [NiFeSe]-hydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 85
structure length 279
sequence length 279
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ko4S01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ko4S02
3MYRA 1WUHS 1FRFS 1UBOS 1WUJS 1YQ9A 4UPEA 1UBTS 3ZE8A 5A4MS 1H2AS 5A4FS 1WUKS 4UE3S 4IUBS 4GD3Q 4KN9S 5JSKA 1CC1S 3USES 4KL8S 3ZEAA 3ZE9A 3ZE6A 4UCQA 4KO1S 4C3OB 5JSYA 4KO3S 4IUCS 4KO4S 3UQYS 1H2RS 5JT1A 4U9HS 4UPVA 1WUIS 1UBRS 3CUSA 4CI0B 1FRVA 1UBMS 4UE2A 1UBUS 3CURA 4TTTS 4KO2S 5JSHA 2WPNA 4UE6A 4IUDS 4UCXA 1YQWA 5A4IS 3RGWS 1E3DA 4UQLA 5JRDS 3H3XA 4UEQA 4UCWA 3USCS 3AYXB 4UEWA 3ZE7A 1UBHS 4UQPA 5ADUS 4URHA 1UBLS 4UD6A 5D51S 5JSUA 4OMFG 3AYZB 4UD2A 2FRVA 4U9IS 1UBKS 1WULS 1UBJS 1YRQA
chains in the Genus database with same CATH superfamily
4CV0A 1Q0SA 4WXYB 2A9PA 5LBIA 3DJFA 5F64A 3L7JA 1YZFA 2B35A 1T15A 1GGJA 1SEPA 1EX1A 1SG6A 1Z74A 1UBNA 2WFLB 4ZOLB 3LXUX 4DE5A 1M8GA 1GA4A 2Z95A 3HCPA 5FUYA 2R8YA 2H18A 4WFIA 1JFRA 5KJFA 3IOMA 5A7HA 2PMEA 2QX7A 3AP2A 3H19A 3BC1A 4QZVA 4YUVA 1CW2B 3GV0A 1OXTA 4M8NE 1X7XB 3ZV3A 2H1OA 3M8KA 3I2FA 4XA8A 5EGNA 3FUCA 1NYLA 3AF1A 1G4AE 4GD3Q 3G0HA 2I33A 3OM8A 1RT9A 2QUBA 3BMCA 1MH1A 4B43A 4RADA 3P0RA 4M87A 2G9ZA 2PKYX 4NU6A 5JSQA 1YR8A 8MHTA 3DDNA 1SBZA 3OQBA 5DV9A 3SBEA 3O8BA 4CG2A 5EIAA 4Z2AA 2XMPA 3OIWA 2XNCA 4TXHA 1G8PA 4J75A 1GYPA 3BT7A 3MK31 1XF1A 2QYOA 3KQTA 5HEKA 4YRTA 3D1JA 4O2AB 2A0FA 4XYEA 4BQIA 2O9JA 2SBTA 1Z0KA 4DW8A 2F3TA 2X2PA 1AD2A 1CZRA 4FT4A 5GY7A 2N46A 1JQJC 1J42A 5FNVF 4LJLA 1RC8A 1Y48E 1FYEA 1NY6A 1Z17A 5FWNA 2ZSAA 5JNLA 4L6IA 3R9KA 1OCEA 1E4EA 3IQIX 4UHDA 1AMUA 1OTXA 4RXMA 1GPJA 3DZDA 3OFVA 2VDLB 3RJ5A 4WASA 1F8FA 2FLWA 2YMMA 1PGOA 5JCPA 2ZUSA 4X93A 4EY7A 3T7JA 1O8BA 3UYLA 1CP3A 1XQWA 3CEPB 4G5SA 1ECJA 2NX2A 2CXQA 5KTTA 3PQ2A 2R79A 3UUEA 1ACLA 4EI8A 3IKLA 4EAQA 1SUIA 4ETWA 3VPHA 5ICEA 4US1R 5K2OA 5JAQA 3O95A 4E5VA 2WF9A 2XB8A 4OHCA 3D6NB 4UMEA 4ZT5A 1G18A 4GNRA 3UGTA 4EWLA 4MLCA 4P7JA 3WGGA 1Q50A 5D01A 1FDSA 1Z6XA 3RS7A 4E3WA 3EAFA 3T3PB 1G6Q1 1YMQA 3NTVA 1N8SA 1UOOA 4TUYF 3R7BA 1V25A 1EMDA 1JBEA 1WM1A 5BN4B 1GD1O 2I2DA 4CYMA 1VL6A 4YCCA 1GGFA 4QYWA 1TIBA 5AI6A 1XCOA 1GUBA 2JVIA 4KB5A 1XDWA 4LXGA 4QBGB 5K1ZA 2C3YA 3M4YA 4MI6A 3A0UA 4LIPD 1X9GA 1OX4A 4ZXFA 2CJPA 3WRYA 4LNAA 3KZ1E 4IZHA 5FLXA 1W96A 2O7QA 1WRBA 2GGSA 2GJ9A 2H1HA 2Z5VA 3AL2A 3IE0A 1YDFA 4PNPA 2MOKA 4CQMA 5C7LO 2MSNA 4O4JF 4RHTA 1LVUA 4A23A 4R05A 4D7AA 4AQDA 4CEHA 4A8TA 1EFLA 1HDEA 4RHFA 2PH1A 4QYTA 2B8WA 4LQCA 4TKLA 4Q93A 2QMOA 3H1EA 1ZEMA 5H02A 4YT8A 3C87A 2AC7A 1C3EA 4CMEA 4F71A 3CR7A 3KLBA 4DCOA 3FD8A 1MO6A 3TW8B 1A1VA 2XWPA 3DFFA 1YR7A 3ZD8A 5TR9A 4ZJPA 2RG1A 1CUGA 4Z4EA 1TQDA 4R7GA 5C3UA 1DP4A 4GOMD 4CV1A 1YZVA 2X5XA 1FFSA 3DBHB 2TS1A 3M6AA 1DBQA 3UJHA 2NXWA 2DBRA 1RRGA 3PUIA 3PYXA 1IPFA 3LKZA 3WGMA 2ZBGA 2P75A 3SPXA 4F2PA 3JASB 5KTNA 1Y9JA 3QF4A 4DM4A 3D31A 4ZU3A 3DLIA 4V2UA 1ELOA 5EPUA 2EQAA 5FHRA 1QQ5A 3FNFA 3NBAA 4ND6A 1UJ6A 3OIVA 3UFXA 4JC8A 3KT6A 4P4TA 2RGCA 3BE8A 3P32A 3UHJA 3MF4A 2A30A 4DANA 4IIYA 1MFZA 4PS1A 3URMA 4ZZ0A 5DM2A 2OCBA 2R62A 3GG2A 3UA4A 2H8GA 3W04A 3W7BA 4E13A 5EJ7A 3I8OA 5LNK6 2OV2A 4O5OA 1CR4A 1PR4A 3R23A 2QN8A 3HXMA 5ILGA 5SZKB 2XZLA 1G8KA 1E9FA 4WKNA 1EWRA 4KRXA 1EUQA 4XVUA 5DP2A 2XCQA 5HF8A 3V4ZA 3RF7A 4HH3C 2FMUA 3BXOA 1ZHOA 3EIEA 3EVCA 5HF6A 2X4GA 2PA3A 1K5GA 4C0WA 4TZ0A 4OJQA 3OC0A 521PA 1OH8A 2AR7A 1N2JA 2I8LA 1LTKA 2QA5A 5FX2A 2XECA 1JQBA 1G3MA 1E2IA 4P2GA 4QOGA 4EFKA 1IY1A 4GRIA 4POAA 3VJRA 1OKKD 3EXHC 4R7TA 3SJBA 3UXHA 2OXCA 1MAVA 1T29A 3GOQA 3WJ1A 2XQKA 1F8GA 2ZM5A 5IAKA 4TL7A 2OD9A 3WWZA 1F5SA 3JR7A 3DMNA 4YAIA 1OF1A 1DRWA 3AUJB 5KMGA 2QKYA 2QTBA 2VOJA 3C7KA 4UTXA 3H3FA 4Q7QA 3JZFA 2Q62A 3Q0TA 3KKKA 4IAOA 4ETIA 1CDOA 3H5VA 4MDEA 4KFRA 1J1UA 3OEEA 1IULA 1MP0A 1M6VA 1RABA 1KYVA 1VJ1A 2I29A 2J9YB 2ZIFA 3LWDA 2HOQA 1SBIA 4MUBA 1YR6A 4UCXA 2A0KA 4FYPA 2RK6A 4QJ5A 4RHCA 2RH8A 5CDTA 4PAGA 2CLCX 2MCFA 4MOWA 3IOBA 3M6WA 4JB2A 4PM4A 3NYIA 1YONA 3H86A 2OMEA 2C5AA 3PUZA 2V7VA 2X22A 1F8UA 2JGDA 3QHPA 4G81A 2ALJA 4XLZA 4C0XA 1OA0A 4JZKA 2UYHA 1G0NA 3A6HA 4UHHA 2PYIA 5G1PA 4X84A 3PP8A 1EFDN 2PR7A 4MUJA 3HKCB 5IT5A 2ZJ0A 3GUZA 4Z49A 5E3JA 4LZOA 4HKTA 3IMCA 1KR2A 3KZMA 4Y1RA 4IXTA 1R6BX 1W19A 2BMEA 1D5WA 3L7DA 4J94A 3B6MA 4LSWA 3RSCA 4E6EA 1FW8A 4BCCA 4Y18A 4JA0A 1EG7A 1XTZA 2ZVQX 1JLKA 1UMDA 3D0KA 4BVEA 3ETJA 3VZQA 1UBKS 1JA1A 3KR1A 3KQOA 1MF7A 2JAUA 3TTWA 3RBAA 1YCFA 2JEYA 3C3JA 1Y8RB 3LX6A 3W9YA 4IIJA 3WSVA 1T0IA 2ZREA 3K1TA 4MV9A 4NEHB 2C3OA 5CHEA 4OLHA 3DB2A 2IHBA 2NUTB 4QYIA 5ENDA 5EZYA 1X7ZB 5AH0A 2XIQA 4BL5A 2F43B 1V35A 3IT1A 2X2FA 5K0CA 3E22A 4IQFA 3AY0A 3OAAD 4KX3A 1X2BA 5EJMA 3MTDA 1FK8A 2PMCA 4O4HA 1WWKA 2C9CA 3MB8A 2XYQA 3GGSA 3D6VA 2BMJA 2JIZD 2N9UA 2VPXA 2Y0BA 1XTBA 3ACCA 4YRCA 4AZWA 2FUKA 3L41A 3D8BA 5EE5B 3UQZA 4XJXA 4EX6A 3T3DA 1ZDMA 4NMLA 1U6JA 3WTCA 1KEEB 4BNWA 3AESB 4N7BA 1TYZA 2OXIA 4RL4A 3FZNA 1IM8A 1C7QA 3MB5A 1N92A 2D0IA 4H3SA 4BN5A 1QFSA 2QGFA 2PZ8A 5EL0A 2VBIA 3G7UA 4UARA 3E9EA 2MSLA 5KZMB 2PUBA 4EEXA 5DT9A 1GCOA 3R0JA 4MCJA 4W99A 2IWRA 3WIVA 5D85A 3ZG6A 3ZKWA 4EDHA 4FCCA 4W9NA 2E55A 2LKCA 4YT2A 1NXWA 3DCIA 3PVCA 3ZWQA 3ENVA 2ZUDA 1H2RS 4XTCS 1OX5A 1WCV1 2EFJA 3K15A 4E03A 1HZJA 2JIPA 1F51E 3LZCA 4LXIA 3NTOA 1CT9A 4UDXX 5DPMA 1Y4UA 5C51B 1KI3A 4KOAA 3QLEA 2V1UA 4KPUB 3TEMA 1ODKA 2I8AA 4V0ME 3V8BA 1JYSA 1UK9A 3V55A 4LF6B 5HIJA 2PBFA 5JHHB 1BGVA 3JV7A 4NDNE 1FEZA 3ZHQA 1RFGE 2QLJA 1JAZA 3V8MA 4A0FA 3QLUC 3F78A 3WQBA 2ETVA 3D4LA 4ZT3A 3QYFA 2HMVA 3TIGA 4JWTA 1MB2A 2FHSA 3GJ0A 2AQ8A 2E3JA 2VVTA 4W63A 4ZVQA 4YAKA 1Z2PX 2H92A 1JRLA 1CZLA 4LRWA 4YIHA 3OSUA 2IE8A 4PO9A 2GZAA 2QAJA 4LS3A 5TQ2B 1HNXB 4TLCA 2C9MA 1T2DA 3NBKA 5ALXA 1O94A 1M1XB 2KW5A 3KM0A 1CFZA 4CFSA 1BCSB 3B6EA 4C2UA 4JEHA 4PFQA 1N1MA 1WOYA 2XVXA 1FDRA 4B83A 1ZBDA 4GOKA 4IGFA 1GXSB 1UOPA 4HEHA 4TTSA 4XM1A 2BFEA 5JAPA 3ZUPA 1QRTA 2BZSA 1LD3A 1KXJA 1M8FA 3A1NA 1PP4A 4AXXA 1A9XA 1TM7E 4GZ3A 4TZTA 3BE4A 4CR7A 3GIDA 2KMLA 2JI6A 1E1KA 1ZXXA 3V7YA 4WKGA 4YJDA 3X1KA 1Z0ZA 1ESCA 4BVLA 1AQJA 5DOZA 5CIWA 3HRHA 4IMRA 2YWFA 4DIUA 3Q3GE 4OP2A 4KU4A 2IHKA 4JJ4A 3TB4A 3D81A 1CDDA 3LLUA 4UD2A 3BZBA 3OPMA 5JNUA 4Q37A 4UOZA 1SCUA 4CVNA 1N0WA 1SC3A 3QPBA 4V0OA 2PKWA 1QHIA 3REOA 1IXZA 3NCTA 5DYYA 4A4DA 2ONZA 1ZNXA 2FX5A 2ODWA 1FF9A 5AXCA 3K9QO 1RCTE 3ZNOA 4IX1A 4B44A 1T6BY 4UU0A 3CLKA 3GLIA 3FBGA 4FEGA 3AGPA 1EVJA 2FVYA 1UZNA 2DQSA 2YXBA 5CIYA 4MCHA 5L4SA 1JA0A 2QPOA 1ORWA 1XLVA 4JNCA 3TE7A 1P2TA 4WBNA 1DC7A 5KYWA 5E6SB 3BA1A 2H4YA 2Y0EA 1C2TA 2QU7A 5I3CA 5KHLB 4FMPA 5LMUB 1SKYE 2HWXA 1JKJB 4HWSA 3LCUA 4WXMA 4FMCF 1P5JA 4LJKA 1JU9A 1P29A 1S1MA 3VYSB 2EFHB 3BBPA 3EC2A 4NPAA 3C4JA 3WC4A 3IEPA 3BAZA 1XTTA 4GX2A 4Q4HB 4KGXA 4AFNA 3MUOA 2VK8A 1M5UA 2QPAA 2ZJ7A 3IE1A 4GXTA 1Q7CA 1IN6A 4TMVA 2NVUA 2QD2A 1B7GO 1BAPA 1D2CA 5ILOA 2JGRA 3NWEA 5B7NA 3EPKA 1ZCBA 1TUIA 1DKLA 2XCRB 4F3RA 1RXYA 2V6FA 5DXJA 2CLFB 4IJKA 1SCKA 2C0CA 2QY9A 4YJ2A 1M74A 1MXFA 2CNWA 3G68A 2FMHA 4UZEA 3F5DA 2REQB 3PQ3A 4KDCA 5J2UA 4IY1A 2MR5A 1FQOA 2H1WA 3VR1A 4QPPA 1VPDA 4M1SA 3OOYA 4B35A 4F84A 2EZ4A 1PNTA 2UVPB 1SVKA 2B92A 2VZEA 3KZOA 4N6GA 2IV7A 1K0FA 2DPYA 3CN9A 5CT8A 4QNRA 4X92A 1KP2A 1DZ3A 4IIHA 3HU3A 2C29D 4KH1A 2FEOA 4AW9A 3T34A 1EZZA 1KP3A 2Z9CA 1GKKA 3Q88A 3RD5A 3B3AA 3WVNA 4C76A 4J8PA 4R1LA 2Q9UA 3RWOA 2EG9A 3FDZB 4ZVRA 3SXPA 1TVEA 2C1ZA 4DIEA 4FN4A 2VJAA 1ZGGA 2WNHA 1XD8A 2HUPA 3GWZA 1SKQA 1WXFA 4Z2YA 1DBPA 1Y5RA 1BNCA 3DMGA 3MNFA 4ZTZB 3HA3A 4WNAA 5AKZA 2FG6C 4R6XA 3EZNA 2GTHA 4I9UA 1HDXA 1CQXA 2P9QA 4OL9A 3ELBA 4I19A 1QONA 1TQ6A 3HZHA 1G5RA 3LKVA 4UTOA 4MGEA 4W7SA 4E5KA 3WLPA 2QN3A 2PBRA 2JF0A 3RWBA 3NHSA 1NXTA 1XQYA 1ZRNA 2BJHA 3HY4A 4GNKA 4G67A 4O63O 1CB0A 1J20A 1WX1A 2BRUA 1K88A 1W5FA 1Y4DE 2F9FA 5E1MA 4U7JA 3IUMA 1YOBA 1Z34A 3CWQA 5EAIA 2RE8A 2J41A 3FPGA 4BQEA 3KSBC 2ODEA 2IP2A 5KOIA 3ILYA 4MARA 2MYNA 2CCGA 3WKAA 1R0CA 2HLHA 4OFXA 4A8JB 2OM2A 1MENA 4G41A 2Z04A 3HU5A 3C5CA 4YONB 4EP1A 1C7ZA 3G0OA 4A91A 3DT8A 2V7GA 4JWKA 1ZUIA 3ONDA 1YL5A 3ZWXA 3JD1A 1CR2A 2VJBA 2BFDA 4G9GA 5CFRA 1NYRA 3FKSD 4MQ4A 1H0HA 1VKRA 2GCOA 4TV9B 4WL0A 1GLVA 3O1JC 3VRHA 4JOCA 2O23A 3VNQA 2G67A 4BLWA 4LRXA 3NP7A 3ZHCA 2DWOA 1KJYA 1QYCA 4LBYA 2QV0A 3GT0A 3LP5A 2OBBA 1QHGA 1I5EA 1BRTA 4B80A 3L4BA 4LXYA 4OGKA 1PGQA 1YMUA 5DULA 5HTKA 3AINA 5ARBA 4QM7A 3L18A 4KLZA 2QIOA 1NY5A 1QAMA 2AHOA 4FTWA 4NE9A 1OROA 3RUPA 4U7PB 3QYJA 4UU1A 5FNVA 2P6MA 3VGPA 1DT5A 5L51A 3EARA 4B71A 1L4BA 2J6IA 2ZULA 2C2MA 1MBZA 2GD2A 2N1MA 2VFAA 4IM7A 4TS3A 3OT5A 4TXNA 3W05A 5CFZA 2Q7OE 1Q83A 5EQJB 1RRMA 2JAOA 4M0MA 2F3QA 4J07A 4PIMA 2BUCA 4L5YA 4OKSA 3SQWA 2PPVA 4P4NA 2OORC 1SZPA 1YR2A 1Z5GA 2IUTA 2BFAA 1YULA 3BIJA 3QVSA 3W77A 5KQRA 3QFHA 1ZGBA 5TEVA 1A9OA 2ZQYA 5DM60 5NLLA 3DVAB 2GHIA 3UOGA 5A6SA 3V6MA 2Q4RA 3KJZA 3DWEX 1F60A 1E9RA 5BW5A 1I51A 1SCBA 5CNMA 1Y6QA 4KYTA 1KMHB 4PSKA 5G41A 3EPPA 1FJ2A 2Y1XA 3QU4A 2BELA 2C1EA 2QUAA 3LFHA 2J9FB 1CVRA 1G66A 3K20A 4J2HA 4JU8A 1QK3A 4FYXA 3K1AB 1JDNA 3FUUA 1U0RA 3O3MB 2WABA 3TLXA 2Z30A 5JYCA 1L9KA 4ALLA 1H2BA 4F86A 2IRWA 3UVEA 5IC6A 2R5FA 3RFXA 1NONA 2OAEA 2XUJA 2PYDA 4Y1GA 5LDDC 2X1HA 3ACDA 3KAJA 4FR5A 4ZYUA 4RM2A 3VUFA 4FNGA 1Z4KA 3KL4A 1BVHA 2AL7A 1Q0TA 2X6QA 1LNSA 5HMLA 5IF3A 2F2TA 3RHZA 4BZZA 4CR6A 4Z1MD 1KK2A 1R6TA 2R8OA 3GRPA 3BB1A 1XKTA 3NEPX 5FOUA 1A69A 2NG1A 3AF3A 1UP6A 4GEKA 2M6KA 4MVXA 1TZJA 2HN9A 3KLNA 1ZOIA 3EZXA 5IULC 1B14A 3O73A 3S28A 1LSUA 3UPUA 4GM4A 4REQB 2GUGA 2Z8XA 3ZR4B 4X6UA 1B16A 1EVLA 2H0RA 2I6TA 3ICVA 3O5AA 1E1QD 1MO2A 2V6BA 4JJ8A 4YMHA 1BGWA 2C8LA 2O2HA 1PT7A 1Q7RA 1PZGA 1TKRA 1Y8AA 2OVFA 3I9V6 3S5JA 3THWA 2NADA 3KOXA 3EVGA 2IYWA 5LVAA 1IY9A 4JKOA 5I9NA 1E6LA 4GUDA 3E9YA 2ZXUA 2HV9A 4PC2A 3RH0A 4V1CA 2MYUA 2HF7A 1JIQA 2I3ZA 3AIIA 3LHKA 5HK9A 2VEDA 2Z6AA 5ALGA 4CLOB 1ZOLA 1S3IA 1YQDA 2ZTUA 3DGFC 1XZHA 3DDSA 3E9RA 3FZEA 3OOEA 3EF1A 3FSJX 4GVLA 4JCOA 4GE3A 2NTNA 1ESNA 1DDOA 4KTTE 3GJYA 1BA3A 1Q11A 1VMEA 1XEFA 3QVGA 3WKEA 2ERXA 1W9HA 2H0QA 4WFQA 1IC6A 2P6NA 1XWFA 2WILA 4RKEA 2AMVA 2QIPA 3PZRA 2PH5A 4BYGA 1QIKA 4DSTA 3CVXA 3MT0A 1FTQA 4ZGBA 2BT4A 1L7DA 2R6R1 1MTZA 3H2SA 1UXGA 3GU3A 3F4BA 2HWWA 3VHXA 3DKVA 5FBQB 4OMFG 2CHEA 4JK3A 4ECAA 1Z2DA 5FF9A 1J5EB 2H9AA 1ZUNA 3K09A 2JB9A 2BM1A 2YASA 1FJGB 3G5AA 3RC3A 2VQSA 1CQJB 2D13A 3K2QA 2FHPA 2ZYIA 3LVBA 4L07A 3EZ6A 5KOHB 2XQGA 4BLOA 7ADHA 2GHTA 3QKSB 1D7AA 1GPUA 1UJ5A 3JQBC 3WK7A 5E9AA 3EZ9A 3TG8A 3NV7A 3BD9A 3U2QA 1NX6A 1UEJA 1Q3KA 4TYPA 1H9CA 4ME6A 2B4YA 3GNLA 3DMTC 3GD7A 3MPUA 4DFDA 1IK6A 3NM5A 4IS3A 3WMRA 1H3FA 5JHGB 1R2QA 1IM5A 4GR4A 2R6DA 2OOSA 16PKA 1XCPA 2BGMA 2YWHA 3CWZA 4AZ0A 5K0ZA 3QITA 4C3UA 3E58A 4K81B 5EJ9A 1Q21A 2CE2X 2RK4A 3AFNA 1GUYA 3HCRA 3U4HA 4ENSA 5I4KA 3T1QA 3NBUA 2BP7A 2NYVA 2XITA 4PW0A 3E2MA 2IJGX 3O2NA 4QUIA 3T4PA 3V6LA 3COPA 4GZLA 1Y7PA 3LT4A 4K9MA 2WT9A 2O8VA 3KX2A 4MR8B 2V54A 3DZIA 2N0SA 4HTFA 1FDOA 1J25A 3GFPA 1SCAA 3DE7X 4HZGA 2QZ9A 1RAAA 2OBYA 1NAIA 2OG2A 4KQEA 4C1BA 3KBBA 4OJYA 3RRMA 1TU3A 5AQEA 4FLMA 2HEIA 1ULUA 4EW6A 3MYYA 4ZYYA 1HORA 3LF2A 5KYXB 2J7PD 3B9RA 2PKQP 3E4CA 3LJKA 1U28C 2JAPA 4BC1A 2PGOA 4YALA 1T5BA 2AFVA 4E2XA 2C7QA 1WXWA 1JZSA 3TD9A 3EXG1 4C6TB 3VA7A 4BO7A 2F9MA 3QE2A 5BQ5A 4BNDB 5AW2A 3ENWA 3IDAA 5JZVA 3VPAA 4PN3A 4REOA 4QO8A 3UHAA 1JA9A 2R85A 3INRA 5FH9A 1LPBB 1GNVA 3H5OA 1TUGA 3C3WA 3K6SA 1UBMS 4MUNA 4BFTA 4V1CI 2J3JA 1C30A 2ZU0C 1XA4A 1ZEJA 2XZDA 3PSHA 4M3NA 4C7JA 5K0TA 1T0HB 1UP4A 1IIRA 4J6EA 4G5RA 1SUDA 5ALHA 1LFDB 1ZX1A 2M6LA 3N2KA 1VIAA 3A06A 4HXGA 3AF5A 1JWBB 3UBMA 1XALA 5IHXA 2ZZNA 1SUAA 2AW5A 1V8OA 2W4MA 1CFJA 3ZLUA 621PA 4IDCA 2JARA 1W4AA 3B36A 4NKRA 4B4WA 2D5IA 4CFYA 5KVSA 1K98A 1AMOA 3RUFA 1E3EA 1JSZA 3H05A 2PM8A 3IUNA 1JHUA 3UUFA 5IBCA 2X4LA 4HDNB 5IM4A 1IFXA 4TMWA 1G5FA 3LQKA 3GFTA 1FQJA 1Q0QA 1FBTA 2VHXA 4R1QA 4WESB 3THYB 1Y1SA 2JKYA 3BM5A 1F3OA 4ACBA 3WHPA 4CKBA 7REQB 1EVYA 4YJGA 4A6DA 4BUZA 4TL8A 4OKIA 3ZWMA 3D5TA 3QV1A 1PTJA 3WK5A 4D9FA 2VXCA 1MT0A 3KWLA 4URZR 3IAM6 3PE4A 1PDOA 5C8YF 3GCGA 4PX9A 4XB2A 4A3SA 4D43A 2FMKA 1X13A 1ZONA 2O0LA 5K99A 1GKYA 1PG2A 1TM5E 2PFGA 2QGZA 3AOGA 2YJ6A 3JYHA 4XWOA 3KKNA 3WAJA 3FOFC 1H2HA 3DWIA 4F21A 1RI4A 1NWCA 1EUCA 3EQ9A 4O4IA 2QQ0A 3HYSA 1LLCA 3LCRA 3TN7A 2VNSA 3V8NA 4E1VA 1O57A 2RAFA 2AV6A 2GEJA 3HCDA 2JIOA 3TBHA 1NF8A 1BVRA 1DAPA 1C9JA 3NRJA 2AN5A 2Y77A 3I5AA 1FDVA 4FINA 1KA9H 4KAXA 4A5OA 4BB6A 3LQ2A 4YRIA 2FW1A 5HVNA 3SMVA 2YNMC 5A9RA 3ILSA 2INGX 2WRZA 1LC0A 4AYTA 1QQAA 1JU3A 1JPNA 3R5FA 4J1SA 3QLVC 4WT7A 1QGED 3ZE8A 5L45A 4KLRA 1TFUA 4QULA 2EF0A 4L73A 4F9TA 2DR0A 3E7WA 4RMNA 5AOCA 3RYTC 1E59A 2YFYA 3DEAA 3EVBA 2I6QA 5ESDA 3TD2A 4CRWB 1FDUA 3BGOS 3NRBA 2I71A 5EWLB 2XODA 4DMGA 2AUMA 5DHPA 2BMAA 2BLLA 4UE3S 1WEHA 4DIBA 1K6XA 3DYVA 2WHPA 1VRCA 2DTEA 2ZTMA 2MR6A 3KU1A 1KXZA 2IEDA 4NMHA 4QL3A 2NV0A 4UNRA 1L1QA 4GLFA 4PZ9A 2R4TA 2H7VA 5FL7D 4R1NA 5CDSA 3QMVA 2FR8A 1MV5A 2O1SA 4CLXA 2D4AA 5MGNA 3UV7A 3RHTA 1EZ4A 1LPMA 4PSUA 1MVLA 3OLWA 3GLKA 5JLJA 4MS4A 4ZQFA 3K1ZA 1ZICA 4MITA 1AKTA 4FFRA 4U2DA 1EKXA 5F3DA 3ISVA 1L5OA 1TE2A 1TGYA 3R75A 1B8PA 3HCBA 1JILA 2ZR8A 3FMPB 5JZ9A 2ORIA 4LNUA 3DVRX 3VDQA 2HK9A 4UM9B 2J9XB 2OCPA 4F1WA 1XNRB 1B3RA 2BZ1A 3V48A 5F5NA 3WJ7A 2GD1O 3ZWYA 2VF8A 3RC9A 2PGJA 2X8LA 1TF2A 4D9HA 1ZINA 2HIAA 2B8TA 1LSJA 2Y1CA 4FFWA 1TK2A 5JZBA 2W6ZA 1I7LA 4R1SA 4RIIA 4RVCA 1WUIS 1M34A 3SZMA 3HDHA 4AKEA 4YI5A 2VZ0A 1E77A 1U1GA 4EPWA 5JTUA 4LFAB 4CG3A 2W48A 1D1TA 1ZW1A 4XTRA 2FW9A 3T5BA 1MC4A 4EHBA 2O3JA 4DCTA 1BMFD 5EJ5A 4UE2A 2ZEJA 4KXNA 4PYQA 3LF1A 4DWJA 3Q85A 1CXZA 2IKQA 2P2DA 3QRWA 1TT5B 3PUHA 2CLDX 3GRAA 4RBNA 2ZLBA 3D0OA 3LC1O 1UF9A 3N2ZB 1V3QE 4LV8B 1AXRA 1DAGA 3WL8A 1ST3A 4O1IA 3DM9B 4E08A 1D6SA 3BN3A 1E6EA 1PSWA 4Y9SA 1E0SA 5M3BA 5C34B 1HMPA 1M66A 4W5QA 2CD7A 4I1PA 1UWLA 3IIIA 4QDJA 5E6RA 1BEEA 2FSFA 4XWGA 1SJ9A 4HQLA 4DJFC 4MIKA 3AW9A 2XE6A 4NCKA 2O57A 1ULTA 2VYVD 5J2TF 5JJKA 1Q19A 4HQRA 4M7OA 2XUZA 4NICA 2J0UA 4UDOA 3EIQA 1K7FB 1X0XA 2IZZA 3HSYA 3ZWPA 4AUMA 1NUAA 4E88A 1VLMA 3QVVA 3KBOA 4HYEA 2WU4A 3AETA 3HJNA 4UZFA 5KSPA 3O21A 5JD5A 3CZRA 2BDTA 2ZRKA 3N76A 3BIOA 3Q2OA 4E5SA 2IGBA 5U4QA 3JWIA 2ATIA 2ID4A 2PLWA 3HY6A 3N53A 4QFBA 2OCYC 3PIRA 4JL5A 3GVHA 1V6SA 1WDMA 1NW3A 4FOOA 4W9MC 2RGRA 1Z62A 5BT8A 4JI6B 1C8BA 2ZSKA 1TLLA 3OTOB 4ABYA 2V6JA 3REQB 3R1IA 1RVV1 1S96A 5CX4A 4TTVA 1XZBA 3MJHA 4OQLA 4RESA 5CEJA 3KWMA 1SC6A 1XMIA 2QS9A 5J1SB 1GSOA 1L7EA 4K6GA 1IOVA 1ZM9A 1S2LA 2FSVA 1T0PA 4OH1A 3RREA 2FWMX 5HZMA 4HK4A 2YWXA 3V2UA 3AUXA 1WU7A 3DBLB 2DLNA 1KI7A 4BE4A 2EG5A 3B1VA 3VYWA 2TYSB 1XZLA 3D6AA 4R8LA 1UBOS 1GAEO 3IDOA 2AEFA 1P0CA 2GXQA 3SNKA 5DNCA 1NF3A 3OI7A 4ZC1A 4BAZA 3AI1A 4F72A 1RFLA 3EIFA 5CAEB 5FPPA 5THQA 5B1YA 4NV3A 1BFKA 1TM2A 3E5MA 3FMGA 4KFSA 1CZOA 1CNEA 2R1VA 2ZIVB 1W59A 2V58A 3DBOB 2WUGA 1GGVA 4NH0A 4RVDA 1A9QA 1Y1KE 3LCJA 3UJDA 3GFQA 1EP2B 1H8ED 3BFVA 4DMKA 3FPAA 5B2EA 1QF9A 4MYUA 5KUTA 4AY6A 2BGIA 4IJVA 1KTIA 5CNKA 1Q0RA 2OPHA 4ZZ3A 3N0VA 1KEWA 4B3FX 2PSFA 2RARA 4CLRA 3RTDA 3E18A 3BWEA 3NEAA 1DRUA 1W0JD 4MUFA 2FN8A 1OBFO 2QTCA 4H1WA 5SYNA 4J3FA 1ISRA 4M8LA 2Z5GA 4V3BA 5ETJA 2PAAA 3I0MA 4MV0A 4EYOA 5JVDA 5GV7A 1AUOA 3A7EA 1BTOA 3COZA 4X3CA 3H6HA 4YT4A 2RHWA 1T2FA 1L5KA 3A4IA 3EWAA 5K3EA 2VDOB 3TJRA 2BDUA 2G1JA 2IOQA 1BS1A 3TOSA 4DHWA 1JECA 2XD9A 1P2BA 3JAKB 3ZC3A 2AF4C 1TZKA 2I2FA 1ZUD1 3KVVA 4R2JA 1JPUA 4U2GA 4FS3A 1AUXA 3DE0X 4HRVA 4FW9A 1PLJA 4IJWA 2EWVA 3LLSA 3IEKA 4BAUA 2CUZA 2YHAA 3V7UA 4ZHQA 3EG9A 4EB3A 3KK0A 1OWLA 5DCLA 2CHGA 2NZ2A 4ECEA 5DI3B 1A5SB 1UMKA 2C2KA 3BDVA 1BDHA 3G3EA 1NM5C 3JYOA 1AA9A 3BK7A 3IP1A 4ZMSA 2QRJA 2FEKA 2R6ZA 1QHNA 2IZ5A 1XCLA 5L95A 4LSMA 2P2YA 1S9DA 3W1EA 3T3EA 4E5MA 3DDUA 4HYYA 4EL5A 5TEWA 3N59A 5M29A 4DLZA 1LBIA 2BUBA 3DVLA 4PXYA 2CXTA 5EI5A 3NHPA 2ZYSA 4KQKA 1BD3A 1M8KA 2VRBA 1QCDA 2HCBA 2AS0A 1VG1A 1SUSA 2JI4A 4IDBA 2XKJE 1OWPA 5EQTA 3OWHA 3HFRA 4Z0HO 4YWHA 3ZS9A 4BO2A 4UU8A 1J9ZA 3R0QA 3OTQA 4MGHA 4LPSA 4XB6B 5C7IO 3ZU4A 3NMUF 5BNZA 1ZD4A 5IARA 4KRFA 4H0NA 1BOFA 1DINA 1G0OA 1C4OA 3EA0A 2HJWA 1JWLA 3BH7A 4MQFB 3C8HA 3KZKA 1UZMA 1XTQA 1HYBA 1MDFA 2G5GX 1HY3A 4P84A 1U4NA 2VXOA 5DLEA 1PVDA 1Z82A 2WD7B 4GMFA 3HXQA 1T3ZA 1T9DA 5K8VA 3EPHA 1WXDA 5IKXA 1MUUA 1P7CA 1QVRA 2AW3A 5KC9A 5CXSA 4JMPA 3TNDA 2EERA 3DOJA 1SRQA 3NUGA 4D82A 4XDHA 2NXCA 2FQXA 4UW9A 1EA7A 1QGDA 3N2GA 2JGEA 2QTTA 3P26A 3NETA 1XZ8A 5FAKA 1OI2A 3AXTA 1JSRA 2MWMA 3H4TA 1CPYA 1SQ0A 4NXNB 1E3WA 2PTHA 5KNCH 4EA6A 5KX5F 1M76A 4PXAA 4RUKA 1C0KA 2RHJA 1XD2A 3DSRA 3EUFA 4MQFA 5C4IA 3FPKA 4PZPA 5K05A 5KINB 2GERA 5DX1A 4Q1DA 5ANRB 2Q29A 2WJPA 3JAWA 1IRIA 2O6LA 2XMBA 5D5HA 4B3RB 1E5VA 1PR1A 8ATCA 2B9EA 1N3BA 2D1FA 2IEIA 1U3GA 3Q8XB 4BU1A 2ZJYA 4WZBA 2IV2X 1C1XA 3H7IA 1GWNA 3RJTA 4BY9E 2JIBA 1Z63A 5BVHB 1CC1S 1Q1ZA 3WGOA 3LBNA 4OOEA 4HCJA 1IZYA 4K9DA 4XOIA 3C3DA 4KR6A 3DB1A 1WCIB 2C94A 2QTVB 4U2EA 4X65B 3MS2A 1II8B 3TIXB 1AGXA 2VT2A 2OGSA 2AMLA 4P82A 4KK4A 2JLWA 4LV6A 3HXTA 1AHPA 2GZ1A 5I9IA 1YKFA 4U7GA 4JI1B 3U4AA 4RTNA 3C3CA 2IYXA 3E3AA 2WWVD 5ECWA 5JEDA 1XVVA 3OUTA 1FVHA 1YJXA 3EGDA 4MTLA 4KTVE 4X1KA 5CBKA 1LH0A 2R8RA 1IY0A 3ZHXA 2K4MA 4UXIA 5FFNA 4DV4B 4Y2XA 3RF6A 1C3XA 3EZGA 3BL8A 3QW2A 4JOBA 4YYZA 5BMVB 1RWBA 4DV7B 4H17A 3I5MA 5AJXA 3IESA 3ADKA 3FAKA 2J07A 1K66A 1T9KA 2PZGA 5B5SA 3IUEA 4D5GA 4L0CA 2DQKA 4W7HA 3OG9A 2WZCA 3JQ8A 2DSNA 4GL4A 4IDNA 2BSXA 1FTWA 4JYCA 3UAYA 4CM5A 4DCVA 1GG5A 1IG3A 1N9GA 3D5EA 3Q72A 2VZLA 4JIMA 3PHJA 1M1NA 1EWKA 4X7PA 3IELA 2P2GA 4A0GA 2VJPA 4DR2B 3ZDZB 2FUCA 3VNBA 3KZVA 1FSGA 3ZQ6A 3ORHA 4MW2A 3ZLJA 3MTIA 3ZZUA 2XWJI 3GEPA 1M1YB 1A4XA 3NC4A 2VQ6A 2HSJA 3VSCA 3LNCA 5DSZA 3QM1A 2CV0A 4LE1A 5K8TA 1TB4A 4OHRA 3BL5A 4EVSA 4UNNA 2YWCA 3FLEA 4CF5A 5JJCA 2GQ0A 2CL5A 1BCRA 1ZAKA 1W52X 3CLUD 2B98A 4QICA 3DV0B 2H4WA 4K8RB 3F7MA 2GAOA 3SSNA 1OFIA 5K6AA 1CERA 5DHSA 3R4VA 1PJRA 4C88A 5D5PA 1MHTA 3I32A 4LZPA 4MYSA 3AEKB 4D92A 1ZU4A 4YPFA 4K87A 2ID8A 5FRDA 2UZ1A 3P0IA 2M32A 2XCLA 2H2WA 4GXRA 4HL6A 4LVCA 2XXBA 5LIPA 3S40A 5TNXA 3TUJC 2EBHX 4R6WA 5F5LA 1MGOA 2HRCA 3HB4X 1HDYA 5F77A 1R9GA 3AL3A 3A36A 3DF9A 1ULBA 3CRVA 4AF8A 2J87A 3IPLA 5T3YA 1DTSA 2W9XA 3DONA 1XMVA 2B21A 2BKUA 2GA9A 4MVJM 3RRBA 1QHSA 3FPLA 3CG4A 3M82A 4IL5A 4CI9A 5I7OA 5LQDA 4P32A 4R2KA 4MRPA 1BN7A 5HXAA 1OI4A 3EUWA 4RIEA 2E0IA 5C8VA 1WMAA 2ZSEA 5F52A 5H16A 4OI2A 3FCXA 1BWPA 4NDZA 2X41A 2GRJA 3D59A 2YDXA 3F0TA 3BREA 4TQ9A 2RHTA 5DK4A 4TRJA 1PL0A 3YASA 1KVRA 5BSMA 5BW6B 2D5LA 4YDSA 4ICIA 4MV7A 4OSPA 2NSDA 4ZO4A 3T95A 3UMGA 3ZGNA 6CHYA 1PJZA 5DTRA 4HNUA 2LPMA 2YDYA 1SCNE 4JJFA 1N2IA 4FFDA 4ZQCB 2RKWA 2NO6A 2DWCA 3EEOA 4OL0A 1J24A 2ZP1A 3KSMA 1JHQA 3KVOA 2VHTA 2EDAA 1MJNA 5CU7A 3SBDA 1Z75A 3WIBA 2F1JA 1UANA 4DQUA 4FB5A 2GXUA 5EMHA 2QZJA 1OHHD 3ZE9A 4ZYWA 4A8JC 1DWPA 3EGEA 3KT3A 4MVYA 3C6QA 5J63A 1OE0A 1YRAA 4YIKA 4EHAA 2J4FA 1XLUA 1Z29A 1RWPA 5IJZA 1IY2A 2VKTA 4DYHA 1C0LA 1XTSA 1T9HA 2OHFA 3EMVA 3PQDA 3B12A 4RK0A 5LA6B 1DTWB 4O2BB 1E3TA 2G4CA 3OESA 3D4PA 2ZRCA 2HPVA 1ZN7A 4UAUA 5AUPB 1V11B 4GP7A 3T3NA 4BNKA 5EY5B 3HG7A 3U3OA 3PA8A 5CDYA 6ADHA 3RYCB 4E4TA 3FTPA 3N05A 3LH5A 2IHUA 4P4GA 3M5DA 3LDHA 4RZIA 3R7LA 5LMCA 4UNPA 2GPBA 5JR3A 4ZICA 2MU1A 4MWOA 3B6ZA 4W6QA 4J0KA 1CF9A 2EGUA 4FGWA 1HEYA 2OEPA 1MN6A 1Y4AE 4HDMB 3GLSA 5C8YA 3C6XA 3Q41A 3LTEA 2GFIA 4HPXB 1Z73A 4DJEC 4MUEA 1E3SA 5DLPA 1Z37A 3G89A 4CCYB 4I1VA 3OZBA 4D3XA 2VPZA 1VOTA 1DEXA 4Q1CA 5C8ZA 2I67A 1YRBA 5B6IA 2P9BA 3G79A 2QTHA 3EG5A 3R40A 2XGJA 3LA6A 3K8QA 1D4OA 4UUBA 3OVMA 1Y9EA 2AFIE 4KN8A 5AHXA 1XZGA 1QRSA 3O8QB 1IN4A 4NYIQ 4AMUA 2VP0A 2PBZA 3SQLA 1PGPA 1YQGA 2FUG1 3NCHA 1T43A 3F9RA 1E2GA 3B85A 1EUDB 4N49A 5AMXA 1HT1E 1KMQA 3ULKA 4BO4A 3RTGA 2BEUB 4LI0A 1W2HA 5HJ2A 5BVGA 2BI7A 5A5VA 3KQUA 2QX4A 3FVRA 3M9WA 4CMAA 4CJXA 4GVXA 1QUFA 2IU4A 5B4TA 3SX4A 3M6XA 3ER6A 4ALKA 3L8YA 5DMXA 3RANA 3ZJYA 4ZJUA 4JLAA 1IBRA 4BVGA 2M1ZA 2VT6A 5TV2A 5GJVC 1CRPA 2AH5A 5AT1A 1U9ZA 1HFKA 3FVTA 1FNBA 4KLCA 4EUSA 5I01A 4M36A 1EESA 4BIMA 1VLVA 1NQAO 1WLSA 5CG2A 2CDCA 1U2GA 3I05A 3EY4A 2PUGA 3K5WA 5I7HA 821PA 1MVNA 1UM8A 1IJBA 3QU5A 1X7WB 1GR0A 4PYLA 4BBZA 3KOYA 4FEYA 4CQMD 4WNIA 3MQ2A 3RLIA 4Y2RA 2JASA 2FG5A 3CKMA 1LXCA 3CF6R 4YAJA 4DJTA 2R00C 3DOUA 1KY3A 2PZMA 2HZBA 2RHRA 1VSQA 2P1ZA 1ZQ1A 2RIRA 4JBWA 4L28A 2IYAA 4YXWA 4A03A 3WGVA 3ICQB 4HI0E 4HWRA 2QR2A 1C9YA 1J90A 1W93A 1ZGAA 2E4ZA 4RVSA 2PUCA 4F3TA 2FMXA 4WLOA 2WUVA 3LQ1A 2FFAA 2V03A 1PI3A 1RJDA 4R1UA 5AW6A 4P0PB 3DBIA 5KVQA 2WVGA 2KHZA 5IMSA 1OZFA 5I9MA 5JD6A 2OCIA 4FDVA 4G4GA 3RAPR 4LUCA 2EFGA 3R0IA 4YMIA 4EH1A 3WL7A 2QR3A 4HDQB 2BGUA 5JJ5A 4AJ2A 2I3DA 5K8IA 1U9IA 3Q9UA 3CEMA 4X63A 1MX3A 2FSPA 4UMDA 3OM9A 4BKUA 4IXMA 1H2XA 1JR3E 6AT1A 2WFZA 2DC1A 3GF4A 1BN6A 1DXHA 1UKAA 4Z99A 5BV0A 3GEHA 1L5HB 2X5NA 3CRMA 2P6UA 3KXKA 3AHHA 1F6WA 1KO1A 5B3LA 4IH9A 3PEYA 2HI0A 1HSOA 3P2IA 1XE3A 4X5OA 5LZ5A 2XE7A 5H9VA 5LQNA 3KEGA 5A4IS 1DL5A 5I7SA 1CY4A 1X94A 1TTQB 3ILHA 1B2LA 1FOEB 2FZKA 4QGFA 5LFAA 5J2TA 4NCAA 2J3EA 4WLFA 4X1IA 2XMZA 3JVUA 4U7FA 2PEYA 4DLKA 2O06A 3R0ZA 1KVTA 4A1FA 1BIFA 3EZ7A 2IHZA 4KQJA 4WNYA 3L7OA 4YS6A 2PUWA 3P9IA 3CX3A 5FO0A 2BJWA 2VJMB 4E1BA 1CYEA 4O4JB 2X2EA 4GLOA 5AHWA 4JXZA 3FPJA 1BXRB 4MIYA 1VJ5A 4CCAA 4M0PA 2C59A 3EXFA 1A88A 2QTLA 4K3VA 5AW4A 2Q3MA 2VDWB 3CW2A 2XCSB 2C04A 5LYJB 5F21A 4XPZA 2NV6A 1QP8A 1XHEA 4RO0A 4S2UA 1EBUA 2HWUA 4UE6A 2IP1A 1GU7A 2ZT5A 4FDLA 3RS0A 1J5XA 1EE1A 2QTFA 4H1VA 4EW3A 1QHHA 5T57A 2FR0A 5DEIA 2D0DA 4UQLA 3P27A 1Y3FE 4AJKA 4OQFA 1E9DA 4HBGA 4EGCB 3H3XA 1TU4A 3DE5X 5AJTA 1EQAA 2H1SA 1Z28A 3PU6A 2F9LA 3OEED 3E0XA 5AJHA 3S6JA 5AK6A 3K73O 4R2XA 4MK4A 2A6PA 3S2EA 1WDKA 3T7SA 4MVJH 1OGJA 4DREA 4K05A 1SOAA 1LWOA 2EEZA 3ZGLA 4ENVA 1DPGA 1M72A 4Q9AA 1Z5VA 1ZSYA 1S9HA 3NHMA 2AQIA 3VNVA 4B7UA 1R1DA 2BGTA 3PFIA 1E2EA 3Q8LA 2M1XA 1I10A 4G4JA 3UANA 4X20B 2KLBA 2ZWVA 4DRXB 3H2HA 2B61A 1MT3A 1ZRHA 5SYAA 3ZDDA 1C14A 3LT2A 3LXMA 2VAMA 2WM8A 4HRYA 2DVMA 3V8EA 4YP0A 5DFAA 4F7WA 4G0PA 4UD6A 4OX9B 2FFRA 4IXDA 3A2KA 5F7ZA 1G21A 1Z6TA 4IWNA 1N36B 1LY1A 3IO5A 2VBGA 1W85A 1P44A 4PX5A 4D6XA 1J9EA 1XCGB 3OKPA 4D9JA 4EW1A 2FN3A 1XPOA 2O19A 2ZRAA 4QOHA 2XRFA 1TMYA 2KX7A 1OMOA 4Q3BA 1JTVA 3THXB 1H69A 2V45A 3W9BA 4P3YA 3BMQA 4P0TA 1K6IA 4TYWA 3W6OA 2JZNA 4D3DA 1NV8A 1NSFA 5D6NA 1KDPA 1RKVA 2JHCA 4G1BA 4AI6A 1JMVA 1I2BA 1NATA 2BBWA 1E2PA 3RSHA 1Y33E 1NMZA 2O1WA 1NKSA 3JQAA 4OLJA 4XGNA 3TO5A 3CVVA 5DI9A 4GKKB 2XGMA 4HNHA 1GZ7A 5CTAA 5L3ZA 3WIUA 1DBIA 3DE6X 1EK2A 1EBBA 4LECA 1Q14A 5D86A 3Q2KA 1IXSB 1D2EA 3F98A 3SK0A 4HN9A 4E31A 5BN1A 2BFCB 2QXUA 4OQMA 2DJ5A 4G23A 4L5BA 3CUEF 1NU8A 3HY3A 3V00A 3RAJA 3WHIA 2Q3BA 4H7IA 4BTEA 1O97C 4D3FA 2G1UA 2IQIA 4FW8A 4DUZB 1HGXA 1U0BB 2B6HA 5J1TB 3PT5A 2VSQA 3IP6A 2A9FA 4Y9UA 1B8UA 3OLCX 2FPSA 1YK0A 4WOJA 5U4XA 2ISSD 3V1LA 1IONA 1K06A 4D9KA 2PKQO 3EPJA 3K32A 4PFSA 4TL9A 2PZLA 4ARIA 3QU7A 1JDZA 3AFHA 4D8XA 4P3NA 3UNXA 1VLHA 4BGEA 1NVBA 2Q6OA 4XIYA 4RF3A 4MHTA 1WPQA 1OB2A 3RWMB 4PTLA 2CZGA 2CVFA 2WEKA 1P72A 3CEHA 5FT9A 4BMDA 4P31A 3MWYW 4OHXA 3C1UA 1LDMA 4R9RA 3EC1A 2VTVA 4RJKA 3MLBA 2A0XA 4HNRA 5BQFA 4DA9A 4N5HX 5KBYA 4FQ5A 5D3MA 4ITVA 3C6BA 4LX0A 5U9CA 4TWZA 1SULA 4HLUA 3NNSA 4QC2A 1ZESA 2R2AA 2QLTA 3GK3A 4AKIA 1PJ3A 1KS9A 2NP6A 1EP1B 3ZW8A 2AMJA 2Y99A 2J4DA 5BT9A 5B2FA 3F2IA 1YTLA 3N0RA 2PE5A 4EG4A 4ZCLA 2BGKA 4DN6A 5UKDA 2BFMA 1G6KA 4NZ9A 1RMTA 1QWOA 4HWTA 2JD0A 4NQZA 1NSTA 4WFJA 3OLXA 3GNQA 3HWSA 1Z16A 4G01B 3RYHB 4B6PA 1KZ7B 1Q2XA 3GRZA 2W6NA 3UENA 4K1LA 2GASA 2VPYA 5HIAA 5KX5A 4BQNA 5C5IA 4KQGA 2NTJA 3KG2A 4IIFA 2IHYA 3T4UA 4E1AA 2J0SA 2H2FA 1B6TA 2ZW9A 3A6EA 2PLFA 1L6RA 1NBHA 4PRLA 3RIGA 3UATA 1TZBA 5GZ1A 3AWIA 2B36A 1DJMA 3H13A 4B4UA 5K0JA 1KDVA 3KZXA 4CM1A 1O94D 4Q66C 3K35A 3WFJA 2XJ9A 4I6EA 3V9PA 1PKEA 3KR9A 3EXEB 5LQRA 2Z2KA 4HFMA 2QZ4A 4C6RA 1YS6A 4OHUA 1PZEA 1DKUA 1TF5A 2G1PA 1SU6A 1M1ZA 1V8BA 2KBFA 4WJLA 3I9KA 5TE9A 3HKBB 3E5HA 1FFXB 3KQSA 2CWWA 4TKMA 5SZIA 2L82A 4MP6A 5K3SA 3RE1A 5CX1A 3MGAA 4HUJA 5ALLA 5F2OA 4DDMA 1GDTA 4NG4A 4U39A 1XZCA 4J0FA 5EMMA 4GMKA 3ME5A 3ZGZA 1LKZA 3AB3A 3MYRA 4E2ZA 3UJ3X 3VC7A 3ROTA 3HPQA 2D0OB 5AK4A 1WIWA 2IHTA 2DB3A 3ZCUA 2ZFUA 3WMEA 4D26A 3WZ2A 3EJWA 3KR2A 1I4LD 4OFZA 3EHEA 1Q6ZA 5AWFC 3WOVA 2F55A 5SZHB 2ECQA 4TLDA 4BAGA 2ZB8A 3VR2A 4I8IA 5KTSA 1KOJA 2QRLA 3QLJA 4D4MA 3AILA 4QM6A 4IDFA 4EMBA 5F4BA 2D5CA 2I8CA 4ZAGA 1E8MA 4ZI5A 3U4GA 4S1WA 1OWOA 4UOQA 4F9FA 3USES 1NPDA 4NFYA 3QE3A 3U1BA 1L4LA 2XE8A 2Q6VA 1HYGA 1QYIA 2GK7A 2YV2A 3I83A 3KJIA 4C4OA 3L1JA 2RC6A 5TQJA 2AN9A 2XEXA 3JQFA 4XDGA 1VKZA 3MT7A 2GK4A 2R9VA 2EGHA 2JW5A 2FCRA 4DKXA 2AEEA 1H9AA 4W5HA 3DQQA 2WSLA 4UXHA 4EJSB 1F8YA 1RLMA 4BASA 4PQGA 4GU5A 4KP7A 4ZP1A 1NJGA 5HE9A 1FIUA 4PG8A 4YBZA 2JKZA 4B7XA 2NQ8A 4NYJQ 1X9IA 2QROA 4JLBA 2H06A 4R2WA 5HF9A 2J0VA 1VA4A 3LXRA 2FWIA 3MC1A 1C7FA 1EK5A 3TVTA 3I45A 3PBKA 2W6IA 5TMEA 5AVXA 5GIOE 3RVLA 1KPHA 1XC7A 2QRHA 1IXYA 1VLLA 3FB4A 1UDRA 2CNWD 5HMMA 3I09A 2PUTA 3TR6A 3AVUA 1KI4A 2QZZA 3BTSA 4BBAA 3P0JA 1CUSA 1PJ4A 1ZWLA 1AM4D 2PWZA 4DC1A 3NVMB 1VE5A 3VR6D 5KNBH 1LVGA 2BMWA 1UAGA 3D6HA 4ENWA 4V0QA 2OO5C 2PSEA 4YMGA 2PXCA 3TI9A 1ZVVA 3GPBA 2HJGA 3ESDA 2PUAA 2QL9A 1IQRA 1QFJA 2Q8PA 4MKRA 3GPCA 5FOXA 1YFLA 1JEAA 4AT1A 5FFFA 1ZHHA 4Z7JA 4GQBA 2OM6A 1OZHA 4PXSA 3D1LA 1SU7A 2X6RA 2I54A 3DCNA 4R54A 3RKUA 2BEVA 1ACMA 5T3UA 4L8FA 4NCXA 2BIFA 1ABBA 4W5RA 1W4ZA 1OU0A 1I4TD 1SHJA 3JRNA 4C4YA 1H66A 5K09A 3BUSA 1AGRA 1KBZA 3HCWA 1FLVA 2B4TO 3FWHA 1RYNA 3T7CA 3ZW7A 3ANMA 4F1KA 2PGLA 4J1TC 2WG0A 1GTVA 5JW6A 4K03A 4M9ZA 3ZE2B 5BWLA 5AXBA 4WPGA 3RT7A 1KAHA 1NXOA 4GZMA 4E5UA 2G8LA 3B3FA 3W3AA 2GCGA 2WD9A 3IAHA 4OQYA 4Q05A 1RPJA 2OXEA 1SUWA 4RC9A 4XCVA 2ODPA 4K6CA 2ZJBA 5ABPA 1KRWA 4L4UA 5JO9A 2FPXA 4TMTA 1DV1A 1ECLA 4DRYA 4OGWA 2BEWA 1UZAA 3BFXA 4ZANA 3BX1A 3UC9A 2X5KO 1DKPA 3DT9A 3OCWA 2FPMA 4ARCA 5K3FA 4JR0A 4XJTA 3NOXA 3QTBA 3PNMA 4FI3C 4PPQA 1U31A 3BDAA 3RLFA 2G40A 4RTQA 2E9SA 3FUWA 4NU0A 3C15C 2AMFA 3SC2A 3NIBA 1WW3A 1I1OA 1TFRA 2DY0A 3PC8A 2ZUCA 1K6EA 1Y3AA 3JPYA 3A9RA 3N8HA 2WIAA 1NLMA 3KXIA 1T6NA 1X19A 2HADA 4AC9A 3EXAA 3N3BC 1L8LA 4LTNA 1PFYA 4D80A 4CQLB 2DWQA 1U7DA 3HKDA 5B58T 4DARA 1OLSB 4GWLA 1FY2A 2YHIA 1CJUC 1DKOA 2PX2A 3C7DB 3EQ8A 3LPAA 1Y9DA 4XGRA 2COEA 1VJCA 4ZU6X 1NW7A 5TARA 4J2OA 4DLBA 2NXJA 5FPQA 2YV3A 1A4UA 1WB5A 2O2XA 1EGVB 4IIBA 1PZMA 3K0EA 4MX8A 5A4KA 4I9NA 2H31A 3QUBA 1PFGA 2FQYA 3N0TA 4CEJB 1PFQA 3LUCA 5A3JA 3AHIA 2XLCA 3I28A 4UNQA 1C80A 2PX4A 3BJRA 5E95A 3VSEA 3L0BA 3F5SA 3WY9A 2ZRIA 4GI7A 3BCRA 4R1OA 1TJ4A 1V4VA 2AFIA 2PG3A 4H16A 4L2IA 4AJHA 4ZI3A 5F7OA 4OHYA 2O48X 1FSZA 2BKXA 2VDMB 4Z8XA 2VSYA 1LK7A 1SHKA 2C98A 2JDID 3LBIA 4M55A 3CZMA 4HQOA 2EIXA 3LUHA 3KUUA 1M2EA 3PEVA 5DXFA 1YS2X 5D3KA 1J2TA 1CEQA 4M60A 1TEVA 5DNVA 3C6MA 3MBIA 5IPFA 1GGHA 1A04A 3GDGA 5KCMA 3UUGA 3OQHA 3K53A 3FFBA 4AAYA 1NKTA 3RW9A 4CKWA 3AFOA 1IBSA 1II0A 2I3AA 4URXR 1EK1A 2GYWA 1EWVA 1KQOA 3LG2A 4S1NA 4ZYTA 5ICMA 1TGVA 4ERXA 3DF7A 3NZEA 1BDJA 1LBSA 1CEEA 4LYHA 3ZDBA 1R4NA 2WWHA 2NM0A 3LUJA 1EGQA 5FXMA 5HGXA 3G9TA 4E5NA 1SXJE 3QKRB 3SNHA 2DKOA 3FXAA 2V97A 1GL9B 4IIXA 4EYSA 3L05A 3T5GA 1L4GA 5EHXA 1DQSA 4GOND 3JRXA 4ZQHA 1EB9A 5AIBA 5K9ZA 1QP0A 2A5LA 4YGXB 3H9CA 2GN0A 1IEWA 3INYA 4YUWA 1NVEA 4HAWA 4BZWA 3PB3A 1PR0A 5HRAA 5EUQB 1PFUA 4LAFA 5DBIA 4PLGA 4ZDWA 4BMSA 2WWXA 4UEKA 1NJ2A 4HZIA 1N25A 2ID7A 3LY7A 1JYEA 1SIOA 4E4RA 1KQGA 4MRMB 1K8YB 4UBMA 4PG6A 2FI1A 1U1EA 5B7GA 3C24A 4ZO8A 3PI7A 3GCZA 3O9MA 2ACWA 3FOZA 2FPLA 2EZ9A 2HNBA 2IIBA 3FOAA 3DZCA 221PA 1N0VC 1TKBA 2DUWA 3HGMA 4JUFA 4UHJA 4XQEA 4YAGA 2JFZA 4PGGA 5COQA 1T1RA 1U3DA 3AV3A 3LYAA 1J07A 1U0TA 1R4MA 3BVPA 3FY4A 5TQVA 3LRXA 3GT4A 1B0UA 3A27A 2PSDA 2WJAA 3KVNA 1JR3A 2R7AA 4KZKA 2J9ZB 1UT8A 1KAGA 3X2FA 4BE7B 2PH7A 2IZ7A 2AZXA 2WUEA 1CG6A 3QBDA 3ZCVA 7AT1A 1FXSA 2P8JA 3TK1A 5A9SA 3BRQA 1VPWA 1J9GA 3FPBA 4MA5A 2UV8A 4JKYA 4MV6A 1NW4A 4HXFB 4KN5A 1G6HA 1FMTA 2BD0A 1HDIA 1Z38A 2NU7A 2MINA 1ECGA 1V6CA 1HT2E 2A5FA 3OTHA 1D3AA 4H7HA 2REBA 4EVIA 2Z4TA 3L7NA 2X3UA 4IMJB 2H7CA 1UFQA 4X85A 2VDPB 3U4CA 1I4EB 4QDKA 4ZIRB 1Q7BA 4DV2B 3QEAZ 1BZYA 3UK0A 4R31A 5GP1A 4H1TA 3L0DA 1LB1B 2AWNA 4EHDA 2FSUA 2CZCA 5DHAA 5KQMA 1MX9A 2FP4A 1E1CA 1T8RA 1WMBA 2YOFA 3B1WA 3GEIA 3X44A 4KX5A 4A2PA 1Y8ZA 1DMRA 1MLDA 1T3LA 4QDUA 4RS4A 2Q8NA 3CM0A 3L0SA 2XOKA 3LV8A 4FLEA 3VNAA 3OLVA 2V9CA 3BHMA 3NKVA 1R5JA 4M88A 4C89A 1XTUA 4D5EA 2ZWAA 5KTRA 1CS4C 2EX0A 2IVFA 1X1QA 1LEHA 2C78A 3KJQA 3LCVB 4JBXA 4P58A 1G5HA 5BWMA 1SBNE 4TTIA 2A88A 2WVAA 3JQ7A 1QYRA 2HF9A 1EJ2A 1D6JA 2OCDA 1A5AB 4UXJA 3ZHSA 3SLGA 1JBKA 1XVTA 4GPAA 4RA6B 1K2VN 2X0JA 1TVKA 1GTL1 2I91A 4FCVA 5LQSA 2WV7A 2AK2A 4NBSA 4R3NA 4U9UA 2BGLA 4DPMA 1AHNA 4U6SA 2O5RA 1H2WA 4KQXA 5IC4A 3V8PA 5C1IA 1RNLA 1QF7A 1ZKMA 4YACA 3W4KA 4EA8A 1D03A 2YHBA 1W49A 4IDPA 3RK4A 1IWPB 4KXMA 1EE2A 4QJIA 5DK6A 4ZAZA 2JGAA 3C3MA 3SGLA 5E3HA 5KVVA 4DGSA 5GJWC 4KE9A 5D7BA 4JBIA 3MHPA 1ZD2P 5JH7A 3KYCB 1T3HA 2FW8A 4W1SA 4G0UA 2FYTA 1GG2A 2AJ8A 2GEKA 3O3CA 1K8RA 3CZCA 2IUFA 3HKEA 2EP5A 4FHZA 2I87A 2AKYA 3RV3A 3WNZA 3GAAA 3L0IB 4I7EA 3VR6A 1U5AA 4QPZA 1VG8A 3P9XA 1QE5A 2H00A 1QVZA 2Q0HA 1ZOPA 3P9PA 4UEWA 4IEEA 2OZLA 1AF7A 1Z0IA 1UJBA 1VHDA 2G72A 4JR1A 4ESOA 2ZYWX 5DBOA 4BNYA 1DBVO 3GYBA 2FJPA 3ZHBA 1WHSA 2OV3A 2NVOA 3OCCA 1LSOA 1XWIA 2VDNB 3ESXA 4I55F 4TV8A 3WGJA 3IQFA 3F6PA 1U8CB 3HI6A 1SCDA 5HDQA 3RIXA 1UT6A 1JXOA 5LMZA 3RTAA 1PK9A 3CXRA 3NTQA 1K63A 2IPAB 2HDWA 4B1FA 4Y2UA 3EIHA 1KY4A 3FHTA 3GAFA 4RHUA 4XFJA 3MIIA 5EZSA 2IY7A 3E9QA 2CCKA 2O0JA 3IA2A 3KFLA 5DWDA 3G13A 3RVMA 3W2HA 5A02A 3UMYA 5C7OO 3NHKA 3B52X 3MBKA 2IW3A 4DA8A 2CLSA 1XRPA 3BMNA 5I4IA 3NGXA 2FEXA 1ADYA 5EKSA 5BN5A 3OQNA 1J1IA 2QDKA 2XX3A 4LC0A 2BC9A 1T13A 3I5UA 3HS3A 4IQ0A 4TWIA 2CFTA 4O8CA 3UKJA 5CA1B 3IURA 3DLPX 1M2FA 3NT5A 2WNIA 3FSRA 3AR4A 5AVQA 1JUDA 1Y8QB 3DQZA 2CMGA 4Q3AA 2AZTA 1C81A 1YXMA 2Z2YA 4L9RA 4WBXC 4PPYA 2XOXA 3K4HA 4RA9A 4XJSA 1Z5WA 3CIFA 5KS2A 3D4IA 4TYYA 1D2RA 2CXHA 2PRKA 1B15A 2XR1A 4GBGA 4QPJC 4DF3A 2VTKA 5A05A 1FBNA 2H65A 3K96A 3PUYA 4EEZA 1NPYA 2WJ3A 4JL6A 1E4OA 1XMSA 4BVKA 4D74A 2X58A 4EW2A 4QHSA 2G88A 4L1KA 1E0JA 3CPEA 1B6RA 1HWYA 4PG7A 3VX3A 3U61B 1H0RA 3GPLA 4M2LA 1Z7WA 1BKSB 1HPLA 4LHWA 4MMZB 4HH4A 1IZ9A 1CYDA 3R6GA 2ZI7A 4CXMA 1JSLA 1IEQA 1A9TA 2FF7A 1GNTA 1EM8A 1RI5A 1WNTA 2ZZKA 4ZZ1A 5BUQA 5AVWA 1JFFB 4WI1A 4BQRA 1LBQA 1G8JA 2HUNA 1X87A 1RYMA 2HGZA 3Q10A 4I4TB 3AR7A 3T0FA 1N77A 5HYVA 1R8XA 2X3YA 1PR9A 1ZUWA 4L9SA 4U63A 4AX8A 1XEWY 4IUYA 5A0VA 4NHOA 3I2YX 3ZQ4A 1WXHA 2CFRA 3N1UA 5KNDD 2K7ZA 2H9YA 3SCZA 1KH2A 2OESA 2A1TS 3ET5A 3P1JA 1M0WA 2IZ0A 4RWZA 1UEXC 1IHOA 1P1CA 5EXEA 3PCTA 1FFCA 2YQ4A 5B57C 1GITA 2FETA 3I9JA 1H23A 4FGSA 3IXLA 3T12A 2Q5JA 1Q3TA 2CLKB 1CHNA 1P2GA 4ND2A 5AUNB 2Z2IA 2ATVA 2H4ZA 2JFBA 3GJ5A 5I9SA 1JHPA 2OZKA 2HT6A 2QMZA 4LYAA 5K3OA 1MR3F 4YCLA 2AQKA 3RU2A 3F3YA 4BFUA 4KGDA 2F1HA 3GVPA 3CC8A 1KZGB 3BXPA 4ND1A 4R8MA 2DF8A 2AXQA 4DEVA 3L6UA 3G6WA 4X1YB 5EN4A 3PRYA 1L7MA 1SOMA 2WMDA 4YRQA 5K0GA 2NTVA 3SSAA 3MD9A 3TECE 2P9HA 1UXKA 1K4MA 3Q7IA 3FB1A 2ON6A 4OUDA 2G82A 3WGHA 4NZPA 2OUIA 1W5TA 1DOAA 4XE5A 4RX1A 1WB6A 2VJOA 1B76A 1IHYA 1PW7A 1RM4A 1SBHA 1U7UA 1QLJA 2NTYC 3ETLA 1VYVA 1YIDA 2XYHA 3EFOA 3FKQA 3U1VA 3OX2A 1QRUA 1AH2A 5GWXA 2VHYA 2FE4A 4FFLA 4OQNA 3ZK8A 4QLAA 1U3CA 3LXXA 3HM2A 5JY1A 3QW4B 3LUAA 1UDBA 3M81A 4NP6A 3R5SA 4DJ5X 5JSZB 3QFSA 1E2BA 4JI7B 1FC0A 5C1BA 1R6DA 3JU3A 2PX3A 3AHFA 5AVRA 3GLGA 2P9YA 3M3PA 4AKTA 1ONBA 3NIFB 1EM6A 1RQNA 4XZ3A 2VJCA 1B41A 4AJNA 4TROA 3B2EA 2ZZMA 5DBEX 3OECA 5PNTA 5COBA 2X8JA 2PAFA 2XTAA 4J4TA 4TXLA 3RYFB 4EQ6B 5LZ7A 4MSUA 4HHEA 4IWXA 1RBQA 4WK0B 3W3ZB 3RADC 2YJ3A 2WMNB 1AUPA 1EDDA 1LRKA 1WUJS 2NYAA 4BJ6A 1CZUA 1YQ9A 1KPGA 1XDGA 1R64A 3DDWA 2IXBA 1TAHA 3D7NA 2Q07A 2RFLA 1ZVMA 2HU2A 1E4YA 2RBEA 3CONA 4IV5A 4LSGA 3W6PA 1FP4A 3W8NA 3SX0A 2JLAA 2CY0A 5CDGA 4FDUA 4L3WA 4ZU1X 2OQ2A 1L5ZA 2DYKA 3KHTA 1X0VA 4PYKA 2AYXA 2O8BA 3JATA 2AXEA 3DO5A 2JLXA 1Q84A 4HYTA 4QXMA 1EXDA 4RE5A 1ANKA 1I0LA 1W0CA 2LV8A 3ADOA 3WLRA 4KYUA 4EB6A 3U4QB 2YBDA 4MROA 5ADWA 4A0QA 3JARA 2NUPA 3FNGA 3DAYA 4ZQGA 4QXQA 3PSAA 1NGSA 3DKPA 5KSZA 5G1NA 5LP6A 1L0BA 4BJ3A 1QR6A 3OJFA 5C2JB 3F1LA 4DNOA 1L5YA 1YFKA 4RPIA 4LY3A 1QV7A 1OU4A 3NBFA 3KLMX 4RULA 3SEFA 3K2IA 4DLLA 4JVLA 1T24A 2R7KA 4OK6A 4Q18A 4YTEA 1P5RA 4MB2A 1XJCA 2Q6LA 1FLDA 3JYPA 2UKDA 1QHYA 4KC0A 4MO9A 4QUBA 3P4UA 2BISA 2OL4A 3KETA 5BSTA 3RKSA 4NOJA 1NUUA 4KIWA 3M70A 5JECA 1C0IA 4V02A 2ZJOA 4LCJA 3N0XA 1PZXA 1KARA 2FLVA 3IFSA 4Z0PA 5EJGA 3SY8A 1HE5A 1UKCA 1RCFA 2XVZA 3B89A 3NBXX 4CGYA 1P61B 1ORTA 1NHWA 1UFRA 1UPUA 1VTKA 2RGNC 2WTEA 3IQGX 5E8RA 3WQHA 1XJQA 1R6VA 3I37X 4OTZA 4MAFA 4HGZA 2GLTA 4ZGWA 4G1VA 3ZCXA 1E5TA 3SJCA 3VC1A 1FJHA 3AUUA 4XX1A 3PFBA 1FPQA 2BDEA 1SZCA 2C82A 3PGVA 4BLPA 1JMYA 1GQ2A 3BDIA 2OVBA 3DOFA 1YJCA 1QWSA 3Q8MA 3EGXA 2GN4A 1NUSA 5CEEA 1VQ1A 1F9EA 2PL3A 4ZRNA 2Q45A 2PTGA 4I6GA 1KVSA 2WPDD 4QRHA 2Z58A 1L4KA 3EMBA 3SI7A 5IABA 1EHIA 1NXSA 3K0AB 1DS6A 5IZCC 5KTOA 4M1MA 3W8RA 2HMUA 4DIKA 2FRDC 4Q7KA 3TTYA 1O96B 3EXHA 4OI1A 4KWEA 2J3HA 2RGGA 2Q5HA 3L01A 5E2AA 4RANA 2RONA 2A2ZA 3CKYA 1FTGA 2X4DA 3AVQA 4IZ6A 2TECE 1MVOA 3D64A 2W6CX 1CNMA 4IHJA 4JENA 4FOTA 4MKFA 4ZYXA 4X0EA 3NGMA 3KTFA 1T9CA 4CFZA 4YNBA 5KJCA 1VYUA 1UJMA 1N5OX 1U2TA 3X1XA 2M98A 4PIPA 1WZUA 1P75A 1TUBA 3CRRA 4DSUA 2GESA 3G9ZA 3ETGA 1J8QA 1ULAA 3FBWA 3X0DA 1ID8A 4E51A 1FCJA 3I76A 4LZJA 1FUUA 3VDRA 5CB4A 1PUXA 2XNKA 2VTBA 1YI8A 4JELA 5JATA 2YZGA 2Y93A 1P8AA 1GKUB 2XGSA 3ENNA 1Y3DE 1WSWA 4C5BA 1D0VA 3OC6A 4FOLA 3OZRA 3AIKA 2OCGA 3PNLA 3AFMA 3T1OA 3R0VA 1WXIA 3W5IA 2K7FA 1INLA 2O3SA 2HLNA 1BC5A 2IP4A 2YY6A 3K9HA 3DDOA 2DY1A 3NP9A 1M1UA 5BO5A 4ZOLF 2C4WA 3LDGA 5C31A 5DDIP 4GM0A 3QPAA 3A9TA 3FPHA 1GPDG 1A2KC 4K88A 2PZAA 5CXUA 1UC4B 2JIMA 4FX5A 1H85A 4RJTA 1N8NA 2JS7A 4POOA 2JJQA 4FZRA 4CM9A 4UVEA 4CQMB 2H0AA 3BILA 1RZRD 2ERCA 1ISPA 3NT4A 2OSVA 4H7DA 4LRUA 3ETEA 3DZFA 4XWAA 1J5PA 4V38A 3MXTA 1TVCA 2BMVA 4NU8X 3PKZA 1SNYA 3ENZA 1DEHA 1V7QA 1BX1A 4NZMA 4R9SA 1SXJA 1Z2AA 4RVUA 3HUUA 4Q01A 5BWCA 2C9ZA 2DWUA 1QS0B 4WCFB 3DLAA 4WN9B 4ALIA 3FYUB 1J39A 1IU9A 3BK2A 5KYYB 3G2HA 1MIOA 2NZ8A 1L4EA 2WT8A 2P27A 3F97A 2H6EA 3V4FA 4EG6A 2BMDA 3HRKA 4WX2B 3WL3A 4B3BA 2X86A 4WIAA 2QX8A 3L8MA 3UV6A 1PT9A 2PWYA 2RB5A 2Q3CA 3IEXA 4TQAA 4QXOA 5TB5A 1DCTA 2GN2A 1E66A 4YHBA 4C0QC 3PXCX 1QIEA 2HRRA 3TQRA 1RW4A 4ES6A 2VTDA 1YWGO 5EIEA 1J33A 2QQEA 4MA4A 1ZI9A 1N2CE 4NEGA 4WK2B 5JDCC 1J09A 2QAGB 1GOTA 1TM4E 2VZ8A 1QOZA 3KKPA 1U9YA 3O8OB 1JDVA 4Z8YA 1ODTC 3QEOA 2ZYGA 4MNTA 2DHQA 1UXOA 3GDWA 4GR9A 1I6MA 3ZQUA 4D8WA 1CLUA 4EZIA 4US0R 2ZRFA 5LSAA 4FC6A 1USIA 3F6RA 2VYFA 1P9NA 1R15A 2OCLA 2W8ZA 1OGYA 2AB0A 3GN2A 1JTFA 3SQNA 2GVZC 1XTVA 4NATA 3RFUA 2XUFA 3TEFA 4DABA 3S1AA 3K9NA 1XFDA 5EQDA 1DMSA 1WZCA 3GJ4A 3NKFA 4HXYA 4CE6A 2ANCA 3O4RA 2ODTX 1MNAA 2FXVA 3A4LA 4I1SA 4KKVA 1NW6A 1VECA 4PCLA 5FUXA 1QPGA 2EEPA 2AWOA 3CH5A 4MIOA 3ZCPA 3AOEA 2F3PA 1QCYA 1QZTA 3K1JA 5TF0A 1ZM7A 4MR9A 3E3MA 4IVPA 4OB7A 2HFJA 4HAZA 3LO8A 4K2HA 4Y6QA 1XL1A 4CMIB 3GNTA 5CT9A 2GYVA 5BSRA 5KMGB 3SG0A 3QSYA 4U9IS 5IJ9B 5I5GA 1TCUA 4K5QA 3IT2A 4R8KA 3I73A 4NZYA 3SF8A 4Q5IA 1Z4OA 2AZ4A 2O2CA 3F6EX 3PUVA 4JOSA 5IVHA 3C7AA 1K7YA 1A9SA 2DFTA 2PT6A 3LL4A 3SZ3A 1QK4A 3TMKA 1Z4IA 4M1TA 4A2CA 1JNYA 4OQEA 2PJUA 4BXOB 3S7TA 1YJQA 4FQ7A 3ZBQA 2OHXA 2CDNA 1BH2A 2N42A 3HSSA 3R6WA 4E2FA 4HNTA 4CQNA 3GFRA 2OP1A 3A6GA 3ASVA 4IDGA 1VGVA 2DJIA 1UQTA 3ESCA 3LWZA 4MKIA 4OMDA 1QTNA 4N1AA 1YZ3A 4IG4A 1DAFA 2HCTA 2WIKA 2BR5A 3KUCA 2JVKA 2XD4A 3L6OO 4MKXA 5GGXA 4B8YA 4P2BA 2XVMA 3AM5A 4HS9A 5DLYA 1IUNA 1QO9A 2V55B 5EMJA 1EFHA 1CDEA 3BULA 3FJYA 5JS7A 5F78A 2O05A 1FXWA 1B3BA 2Q1WA 4CHTA 5KO2A 4Y2SA 4C3OB 3PNPA 1QQTA 1OXMA 2OBNA 1W5EA 4AS3A 1OC4A 2UU9B 4WKBA 2JHAA 3OQ6A 2PIAA 4L72A 5TMBA 4J0CA 4D9IA 1KJZA 4YRGA 1NLYA 3JWEA 4V03A 5JD3A 1D8TA 5ESRA 1ZM2A 4DJJA 5CLJA 4RY9A 1CJVC 1RPZA 4CWAA 1M2VB 2CB0A 5B53A 3LT0A 1Y6GA 3QX8A 2O0HA 1U0EA 4RW0A 1J23A 3U7IA 3KHUA 1V1MB 1CZHA 1WPRA 1NU6A 2WU3A 2ZIWB 1YDHA 4LE2A 1J70A 3TX6A 3MJTA 1XKLA 4IIJB 4LZNA 2AZDA 3AUKA 3WLLA 3O26A 1GEEA 2F62A 1TVMA 4HADA 2PD3A 4AZSA 4KPFC 3QYAA 1CWUA 2UYYA 1MJHA 1Y1LA 4LF7B 4IV0A 4ZCSA 3FTFA 1QIIA 2CC2A 1ZJ5A 3E35A 3NWOA 5HK8A 4LA4A 4S0XA 3SKXA 1M3SA 1ZISA 1JAHA 4HAVA 1Z4MA 3KQLA 2D7CA 3NWPA 1ZGCA 2XDYA 4AVYA 3IAXA 3H5LA 3KD3A 1V8PA 4BC0A 4LRYA 1R6UA 4PZLA 3BGDA 3EA5A 4PZUA 2R25B 4NESA 3U0BA 5T7BA 5BR7A 3L0ZA 1P9OA 3O03A 3EDMA 3OHSX 1UL1X 4KXQA 3RQSA 5A6VA 1N6OA 1QG2A 4YBRA 4B34A 4G2NA 2CFSA 4Q15A 2RSLA 1UBFA 2JJ1A 3VKFA 2ZJZA 5EXTA 2ZIUB 4IVQA 4KRYA 3RTBA 2PKRA 1AKQA 4N47A 5ES3A 3OE7A 4GPD1 3DCYA 3LECA 3K0SA 3VR5D 4RD1A 1MO5A 4I8DA 2QAIA 1APBA 4HDRB 3I04M 4MJLA 1H5QA 1M2KA 4KH0A 3Q7PA 3NASA 3DL2A 3ZV4A 1Q1GA 2OFXA 3QG1A 3D5QA 1SKUA 1LBTA 1P60A 4JD5A 3X1DA 1N5RA 4DLTA 2KS6A 3H1AA 5E6UA 1OFVA 3UPDA 4EX7A 1ML3A 2EQ5A 3D7MA 4DLAA 2BGGA 3VR3A 3UEOA 5AP9A 3WNCA 2FMFA 5EA2A 4FYVA 2XTJA 1T4DA 4QDZA 1ZNQO 5ELXA 3ZXXA 4DCCA 4DGQA 4Z9BA 5G4KA 4R69A 3WDKA 3HDJA 2HXGA 5C7YA 4DV6B 2XWBF 5JD4A 1YRQA 3NRCA 3DZHA 4MVJE 4D9NA 4JJEA 4LHZA 2J3LA 2ZTVA 3ZVNA 3SHTA 1Q7TA 5JO0A 5LLSA 4FYYA 3H0EA 3MT9A 2W2KA 3E3NA 4BUCA 1K8QA 1P5ZB 3U39A 5LOVA 5IAOA 1JDJA 1M6NA 4RGVA 4R51A 4BLSA 3ZZNA 3CZPA 2PLAA 2VQDA 2QK4A 5EVCA 3KKLA 4WZAE 1MCZA 2DAPA 1JLLB 2ZB4A 3LGAA 4BGDA 3T9DA 2CYBA 3D8RA 1TDJA 3W8DA 4EHNA 4N65A 4YXWD 1KI6A 2YINC 1HYHA 1D0SA 3DWGA 4IFIA 1LC3A 1RM0A 5D3QA 4IKOA 4KFCA 3PL1A 3EYAA 3IOYA 4ZCRA 5HS6A 2AK3A 4Q24A 2VF7A 1Y37A 5CVVA 5F33A 5IS2A 2O8FB 3W4JA 1XLTC 1GGMA 1ZRSA 4LDJA 4P98A 5IEBA 3VYUB 4FP9A 3GLTA 3QI2A 2H29A 3O83A 4KQ6A 1GUAA 1C7EA 1JV2B 2VF4X 4KO3S 4I3GA 2CK3A 1GRCA 3STYA 3UB3A 4DM3A 3K0CC 4IFEA 5C0OE 3OJCA 1W1WA 4FWTA 5EYPB 4F11A 3A4NA 1OGIA 4C43A 5KTKA 1IMOA 5JT1A 3W2GA 1CBUA 1Z33A 2EIHA 2GN6A 4KJXA 5HG0A 3SQXA 4M1EA 5J5VA 2J59A 1JLSA 3KCNA 1NQVA 4WXHA 5BW8A 1EP3B 4O5AA 4Z4CA 1LV8A 1C0EA 1USWA 1Z4LA 1E3LA 1BXKA 1FNSA 1OQAA 2WV9A 4OHKA 1E1LA 4B46A 1LS6A 1L5LA 4FKBA 4DA7A 4WACA 5KEIA 3AEQA 3V1KA 2YHSA 1IB6A 1EHCA 1R0YA 3HSKA 2HJRA 1CNFA 4HNAA 4JUAA 4YLYA 1CF4A 3RIEA 1UM9A 2WA2A 4FDTA 4Y3UA 1TJNA 3TLCA 2OORA 2X6TA 3S55A 1WXQA 2Y27A 3PC4A 1PGNA 4RM3A 5HFJA 3TR5A 5BXQC 2QBYB 1F0YA 3AVYA 1I3NA 4FFVA 4XDYA 1P6XA 2HD4A 5KHAA 4RH3A 2DFKB 2Q46A 1SK8A 2PQ0A 4MA0A 2JLYA 1DQNA 3HH8A 1FUKA 2FX3A 5A0TA 3RUAA 2I7TA 4RTJA 2G0TA 4ZEVA 5E4JA 1ZWKA 1GV1A 3QPUA 1DKQA 1LFAA 4HX9A 1VJ0A 4LXQA 4XGQA 2OZEA 2JZCA 3SSMA 2TMYA 5IAGA 3SDSA 3SVLA 1NE2A 3VOBA 4WECA 1C1HA 3SOPA 2Q4OA 4NOLA 5D3ZA 4ZCTA 2YOHA 2ZKLA 2O2JA 1UFOA 4DCNA 2NSLA 3HABA 3GAMA 2O4CA 3M89A 3Q6MA 4HB0A 5CNIA 3MMNA 3A6ZA 4W5OA 3GP3A 3LYUA 1WW2A 5GJCA 2QTWB 5CURA 3UY4A 3ASZA 3T41A 4OD0A 4LYYA 1F20A 1GCGA 1N3YA 2MYPA 3M0EA 4LFBB 3UM9A 1NJ6A 3PNBA 4EKDA 1Y4SA 4OO3A 3W4IA 5CM9C 2VWQA 3C3XA 3H9BA 3I0ZA 4JUIA 1WMSA 5D51S 3VPXA 1R7RA 5IKMA 1OT3A 5BSWA 1KDOA 4EBFA 1Z5ZA 3LFTA 3OICA 4MRVA 3L7MA 5J4YA 3HMQA 5DMHA 3RJZA 1S2IA 3TZ6A 1AO0A 1EFPB 2ASEA 4H18A 5DSTA 3DE2X 5EMLA 2MHCA 5FLYA 3DUFA 1PZNA 1WF3A 3TINA 1GSHA 4JIGA 2W43A 3AR3A 4LHSA 2O50A 2NU9A 3PUXA 3GQBB 1MFPA 2WYVA 3LZ6A 2J8ZA 3UC5A 1BWQA 4CGZA 1ZGHA 3KHKA 3LD9A 4R4JA 1A5TA 2P6RA 1L7OA 2OC9A 4LJ8A 2B8NA 1XEXA 2QRPA 4YCDA 3W5HA 1M2JA 1G60A 3OD1A 1M9NA 4C4RA 4YR7A 1VCIA 4DXHA 5KC8A 3TLGB 3G5MA 4ASUA 2V0GA 1QZ3A 1OYYA 2IEYA 3H5IA 1USKA 2VQ3A 2YQZA 3MJEA 4HX5A 1XRNA 4WRRA 3VV2A 4DT1A 1JB9A 1MB0A 1RJGA 1U7HA 3RFCA 4DNXA 1Q44A 2VUIB 4UCQA 1X8LA 3DPUA 1R9JA 3MINA 5IWCA 1Z6AA 2D62A 3ZX5A 4HDKA 1U2EA 4PSAA 5I8PA 1RQ7A 1QTQA 2F67A 2FH5B 4RKQA 4H6XA 1XPUA 4KQFA 2Q5LA 5THKA 1AHIA 5DX0A 4RPLA 4BTVA 2ZWMA 3ZHRA 1KTVA 1WVIA 1TM3E 1ZJ4A 1E3JA 1UMBA 3CY6A 3W6ZA 3LP8A 1M5RA 2XBMA 3D0RA 1V8ZA 3ZHYA 1ZR2A 3H7AA 3O4HA 5DRYA 1O1YA 3ZN2A 3BMOB 4C0JA 2IPOA 2OSBA 3BZUA 4P3PA 4PG4A 2XB2A 1RJWA 1HFEL 4QE3A 2HO4A 2RMKA 1WVGA 2JA2A 3JQBA 2A1UA 3C41J 4Q4JB 4AP5A 3FE2A 2CL7X 1E5LA 3OQ1A 4CKZA 1MC5A 4EHLA 4UTZA 4FZ5A 1MOSA 4IVRA 4MWCA 3DMTA 4YJ3A 3SS9X 2ZWPA 1Z7EA 1I36A 3V8QA 1OYVA 4O1HA 1NHGA 3PWZA 4K9PA 1EFTA 2EX1A 1CF2O 2P2CA 4MQ5A 2B2CA 5IC5A 1UK7A 1ZNZA 2AFHE 2GYYA 4MGZR 4IZOA 1UKYA 5EC8A 2PUFA 3LQRA 1WXXA 3CZAA 5LP1A 2CJWA 2ZGVA 4MV1A 4QTYA 1VBFA 3J7AC 1ZCFA 2TMDA 3G8DA 3HXKA 3D9QX 3K94A 4REMA 4ZVTA 2B0JA 2C57A 1OPXA 4M49A 3TKLA 1HYQA 1S7CA 4KGVA 1T8TA 3AHGA 2ZRHA 1VIMA 4QQRA 3GRCA 4CM7A 1MMFB 3GVIA 2FPGB 3DW3X 4GXNA 3BJIC 4YR9A 5T4FA 2XY4A 4AUEA 1NZFA 3HNPA 3Q3EA 2NZJA 2DG2A 3U4MA 3I8XA 4TQUS 1RE0A 4LGMA 3Q15C 3BWXA 4MR7B 4A7PA 4FE4A 3RAGA 5HKAA 2ZWOA 2UXBB 2B37A 1OXKB 1Y63A 4MPDA 2FPIB 2P0AA 2ZBUA 1PJBA 2GWRA 3AQ4A 3INGA 3WLEA 5JQWA 1PD0A 1QB7A 4DCJA 5TT1A