4TLAA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
233
structure length
216
Chain Sequence
b'QAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTTGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEDLSALIERINYAIQKYRARRVSIDSASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kinase KaiC
publication title Circadian rhythms. Atomic-scale origins of slowness in the cyanobacterial circadian clock.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
total genus 78
structure length 216
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tlaA00
2R62A 4AYWA 5JJIA 3FE2A 1HE8B 4DDUA 4Q9JA 4KVAA 1P72A 2ZR0A 3K9LA 1MO5A 1VMAA 4IDPA 1W2GA 4XD7A 1UBCA 3TMKA 3N5CA 4Q00A 2FSIA 4AY2A 4V0NA 2F1JA 4DHEA 4LI0A 4PO9A 3SYNA 2WZQA 3AV0B 2ZRAA 1AKEA 1GWNA 3LD9A 4FD2A 1OH7A 1E1RA 4X8HA 1G4AE 2GXUA 2XJ4A 1CR1A 4A8JC 3VU9A 1E2GA 4QBGB 3WBKA 2PMKA 3B1ZA 3B60A 1J2JA 1HH4A 1FQKA 4F7WA 3FWYA 1M7HA 4MRRA 4KVGA 3S1AA 4CW7A 1ZRHA 3NC0C 3BS4A 1HTWA 4Q1EA 3OIWA 4C0AC 3B9PA 2OT3B 1D5CA 2OEPA 4RD0A 3SQXA 3K0EA 4ERNA 2ZVPX 2W58A 3DM5A 1WBBA 1QHHB 2BM1A 3HWSA 4KI0A 2KWIA 1XTRA 1F5NA 2ODBA 3GLFE 3SE0A 1AKYA 4HSEA 1RRPA 3VHXA 2C2HA 4L4UA 1S4QA 2RHDA 3NEJA 4Q1DA 2YKGA 4IEEA 1ZC4A 2IW3A 3IQWA 4TL8A 1GZSA 2HLDA 1OFIA 4M8NE 4URWR 1AZSC 5KHOC 2OBLA 2V6IA 4POAA 1P2SA 1JECA 4KLZA 3L0PA 2GBLC 4A36A 4CVNA 2ZI6A 3QJYA 2D4HA 1VHLA 2PX3A 1TF2A 2MSDB 2CNWD 2QPOA 2PBRA 1IQPA 5JS8A 2A5DA 1OFTA 2QUZA 3SJZA 2BOVA 1PLLA 4LJ7A 2ZXUA 4D2IA 1OB5A 2I1QA 3L8YA 1DAIA 1YHNA 4R7ZA 2QM8A 1MRSA 2EW1A 3B78A 2JDID 4M22A 5FOTA 3GLGA 1ZD1A 4DCUA 3TBKA 1WCV1 1IY0A 5F3WB 4HLDA 1A4RA 4M9SA 1NN3A 3R9XA 1G3RA 4PPQA 4US1R 3CM0A 2GK6A 3W34A 4QGFA 3CZQA 2H5EA 1Q1EA 2ANCA 2J5XA 4KSBA 2Z4RA 3EPLA 4B6FA 1E3MA 1W0KD 3REGA 1T91A 1HY3A 2ZITA 4KHZA 4LHWA 4OI0A 5EXTA 5BWMA 3IEVA 1CULC 1FUKA 1W5SA 2XOKA 4V02A 2Q9CA 4XTRA 2VQSA 4FMCF 2DWQA 1KJYA 2ZJYA 3KJHA 1YZTA 4XSGA 2O52A 4J0QA 1W7AA 2W6JD 4XIGS 1E79D 2XAUA 4PZZA 3ICQB 2FN4A 5FBLB 1DAFA 1NJFA 1Z0KA 2KBEA 3WYFA 621PA 5F9HA 2QU8A 3EZ6A 1ZM2A 1RRCA 2FEOA 2LWIA 1SVSA 3CPEA 3I73A 3I62A 2GCOB 1UKZA 2W2XA 4QC2A 5FOWA 4D4JA 1A2KC 1OYWA 1SXJA 2VP2A 4HZUA 1B0UA 5DSZA 4DUGD 2ZE8A 4PHHA 3WRXC 1YZNA 3LBIA 2VPPA 5DE3A 2WMOB 3B7GA 4KLNA 1BYUA 2GWHA 3IO3A 4D26A 2V1UA 2HCJB 2UKDA 5JEDA 4LCBA 3B9QA 3R8CA 3GFPA 3NWJA 5DN6A 1ZU4A 2WPDA 4ACBA 3RRZA 1CP2A 5AJXA 3R7WB 3K0AB 2IYLD 4YXWA 2REBA 3T61A 4PC3A 3PVSA 4OJQA 1DS6A 2QEQA 4D82A 4ZCIA 1XRJA 2RGCA 4QBFA 4LYFA 4PAOA 4DDWA 3CNOA 3PUXA 2JA1A 1C1YA 1G16A 5IRCD 3PG5A 3AH8A 1KI8A 2WWGA 3I3SR 4C9BA 2V54A 2R2AA 3CBQA 2B7BA 1YR8A 3KQUA 1CTQA 4TLAA 1IAQA 4Z8YA 1OH8A 1OLOA 3A4LA 3AGQA 3QKRB 2O5VA 4HZUB 4AYTA 3A58B 3O8RA 1DOAA 1NP6A 2JLVA 3SHFA 4QXAA 3BRWD 3LLMA 3QOFA 1G291 3C7KA 4ZKDA 1GIAA 1US8A 3WNDA 4QG7A 2IYTA 1KK3A 4KYIB 2O8BB 3GJ4A 2NO1A 1I4TD 3DOEA 5JWHA 2G1KA 2AKYA 1KOFA 1YRBA 3PCRB 2O8CA 2RH5A 2NPIA 2CL6X 3ZD6A 2BMEA 5SZJA 4EUNA 3LAWA 2FPKA 3ZDQA 2IYRA 3NDPA 2BBTA 2BBWA 2OBMA 1JJ7A 4Y0AA 4BE7B 4HUQA 4HYYA 3RS0A 3KXIA 3UANA 4HAWA 1Q12A 4OHVA 3QVUA 1KO4A 1AS3A 3QKSA 4AK9A 1Z0AA 3OESA 2ZEJA 3RS7A 5FUVA 4QNRA 1HUQA 5JI2E 5EJEA 4JL5A 1E6CA 5FUWA 121PA 3NXSA 4HB3A 2FF7A 3CW2A 1E2DA 1RFLA 3RWMB 1UDXA 3OFND 2R6AA 4MRSA 2YVUA 4L8GA 1E2QA 1SKQA 4DLWA 1NIPA 3T35A 2YNMA 2EWVA 1JR3A 1PUJA 1SVOA 1FL9A 4EFLA 4URZR 5HPYB 2BJVA 2PJRA 1R8SA 3X1ZA 2GRJA 3DDCA 4GZLA 3UG7A 3LDAA 3VR3A 3TUZC 2CMKA 3U4QA 1NVVR 1Z83A 4NCNA 4YMTA 4AKIA 2F1HA 3A4MA 4MUAA 5LDDC 4GOXA 1KO1A 1DEKA 2HUPA 3LX5A 2JLYA 2Q9BA 2OZEA 2OSBA 4Q5IA 5KSZA 3W3AA 2NO7A 3AP3A 5KSPA 4LC0A 4ILEA 2DB3A 4LV5B 4OK5A 1U9IA 5KYKA 2XGJA 3RABA 2B92A 2WAYA 2P65A 4JIMA 5JEEA 3B6EA 3HPRA 3LFUA 1IM2A 1G17A 1XF9A 4RKFA 1E2NA 2QP9X 3VFDA 1CJTC 4G5OA 1CJUC 3PJRA 1Z0DA 2ORVA 1AQUA 1E69A 1H8ED 1LY1A 1ZYUA 4LRWA 5IDVA 1T0HB 1UPTA 2UVQA 3DMDA 2ZU0C 1S3SA 2ZU6A 3JZMA 4HZIA 3LA6A 5CK5A 3SYKA 3QBTA 4HDCA 1AM4D 3U61B 1U90A 1XXHA 4LDJA 1OKKD 5JWOA 1DG3A 3UKDA 1YZKA 3I72A 2XB2A 1G7CA 2XX3A 2XNDA 3EIEA 4Q47A 3EPJA 4O25A 5FTLA 3K8YA 4EJSC 2ATVA 3AB3A 1Q1ZA 4ZCLA 3U3JA 1W49A 1XD2A 3RDPA 4UQOA 1Q57A 4B2PA 5JS7A 3UMSA 4MGYR 2ZRBA 5UKDA 2ZI5A 3GQBA 2J0VA 1L2TA 4NHOA 1P60A 1LV7A 2BVNA 1S2MA 3AVVA 3ND9A 1CXZA 1FNNA 2BMFA 2IEYA 2GJSA 2REOA 1G3QA 4KAXA 4WOPA 1OHHD 2IXEA 3H86A 1N5IA 2YC2C 4O3MA 3BB3A 1GUAA 1U8YA 1WRBA 2ZSBA 4JLJA 3U2QA 2NZJA 2CCKA 4GI7A 1ZM7A 3ADBA 4CEIA 4QRHA 2V1XA 2AXPA 1UAAA 1II8B 5G3ZA 3LX8A 3LV8A 2EFCB 1HT1E 2HJGA 3Q3JB 5IF9A 2JLXA 2ZRLA 2UZ3A 4DKXA 4A4DA 1YR9A 4JLAA 1E9FA 2G83A 1U81A 2ZE5A 1NLYA 4M1TA 4Q4HA 1KGDA 2O0JA 2QMUA 2VEDA 4LV8B 4MITA 4WAUA 5J4HA 4K8OA 2ZUBA 4I1OA 2PZGA 4F92B 4M53A 2CCJA 3UIEA 1II9A 2ZRMA 3OIUA 1G8YA 2IYUA 3PEUA 4M9ZA 4X8LA 4Z1MD 4Z54A 5FI0B 1P9NA 2VF7A 3X1WA 4BFZA 2OESA 4UJ3A 2QQEA 4D6PA 2JASA 1NG9A 3I32A 2GJ8A 3CRRA 4JBYA 3AKYA 5LD2C 4BEJA 1VG0B 3WHLA 4QJ3A 2L0XA 1E0SA 4DVGA 2AX4A 1AQYA 3VQTA 1WBDA 2PL3A 1NI3A 2VSFA 3T5DA 1X3SA 2EYUA 5G41A 4D0LB 2W0SA 3R9IA 1R0XA 2NO9A 4URUR 2CE2X 3R9WA 1XX6A 1J90A 4KITB 4M21A 1YZLA 3REFA 2VL7A 4RFSA 3WMGA 5A5GA 2ZJZA 4HATA 5FL3A 4OKSA 4G5RA 4Q4HB 4DLTA 2QN6A 3MSXA 3T06B 3OEHA 4FIDA 1JQJC 1ZCAA 1XPOA 4XWOA 1IN7A 5HZKA 5JLJA 1KJWA 2J46A 1TMKA 1E2JA 2X2FA 2MMCA 4B33A 3NBZC 1XMSA 1NY5A 3OEEA 1GKUB 2W0MA 5FTNA 4JYCA 2RGBA 1N6RA 1ZW6A 4GSYA 4TTRA 3P4XA 2WIAA 4F4CA 4R2HA 3NDBB 2PEYA 5FPYA 5CITA 2JLRA 1FX0A 2RGNC 1P2UA 3KTAA 5FUYA 4AKGA 2GJKA 3LRPA 4N0DA 2QT1A 2JJ8A 3THXA 1QHGA 3I5XA 5EE1A 2EFHB 4A6PA 2C9OA 4ZI2A 1KI4A 4JVSB 2VHTA 1E1QD 5J40A 5TARA 4BLTA 1G3UA 1BKDR 1GNPA 5TB5A 1VIYA 1T5LA 1CEEA 1KHTA 2OLJA 5FPSA 1RPZA 1JI0A 4RFSB 4PXAA 3T5GA 1OPXA 3BWDD 4RZUA 4F93B 4OYHA 4TLBA 5CJ2A 1R10A 2QROA 2CL0X 1KK1A 4TYNA 3SBDA 3B85A 1X8LA 3F0TA 3MRSA 2P6NA 4KFTA 4TYPA 4QFMA 1FUUA 3C15C 4C7OA 1JNYA 2PT7A 3HDTA 5FOVA 1S9DA 1E94E 2PEZA 4B34A 5FL7D 2W6ID 3SNHA 2QPTA 2C8VA 3LVQE 4EJSB 4ITRC 1OJLA 3KTAB 2GXAA 4D25A 2QI9C 1E32A 4NONA 2QA5A 1TUIA 1QZXA 3NC1C 1E0AA 1KKMA 4A2PA 3K0CC 4BFSA 3QY0A 1KSGA 1UEIA 3K70B 3AQ4A 1QVAA 4MRVA 3KUCA 4PPFA 4JLMA 2IF2A 1KY3A 2R6DA 3Q5DA 2VHQA 3NBXX 3FHOA 2BC9A 1DAEA 4WZAE 1W5TA 2ZE7A 5CLQA 3OIYA 4PPGA 1JQLB 3DOFA 1T3SA 5JRJA 4I1VA 3EX7C 3THYB 4UNRA 4PQFA 3WNCA 1FNMA 2JEOA 1NF3A 2Z43A 4LOAA 4PC1A 2DCUA 1LVGA 2IHBA 3ZLJA 1CR0A 4NCHA 3AVOA 1R7RA 2XNSA 1GFIA 1JPJA 2N42A 1LFDB 1U99A 2DYKA 1J8YF 1KO5A 3QPWA 5FUXA 4JLVA 3GCGA 4TLDA 5FTKA 1H8HD 1L4YA 1P62B 3GLFA 3VR4A 5F98A 3FOZA 5IK2D 4TZ6A 2O8EA 1CJMA 2IC5A 221PA 2GVZC 4AWXA 3AUYA 2A5JA 4HAZA 1L7VC 3A1UA 3DEFA 2E9SA 2F1RA 4C2TA 4R98A 3SJAA 3CNLA 2VYFA 1Q22A 4PSVA 4IW3B 1LTQA 4P4TA 4QM7A 4HLCA 1QHNA 1LF5A 4F4JA 3Q5EA 3AEZA 1MV5A 5GJBA 4JLOA 5JSZA 1S1MA 1OW3B 5LD2B 1Z6YA 2ZSEA 1TX4B 3L0SA 2CVHA 4DLZA 4MUBA 2JIZD 1XMVA 1G8GA 6Q21A 1GRNA 2YWHA 3B1VA 2HDNB 4Q9LA 2P5SA 4NZYA 3OAAD 1NMXA 1VYUA 2GZAA 1OIVA 1NBMA 2CXXA 1OIXA 4LK2A 4G3XA 1VHTA 4HB2A 4IKEA 1LS1A 2IUSA 4DLUA 4BZXA 3CPHA 2WIBA 2R6CA 3EZFA 4AC9A 2VSXA 4KSCA 5HTKA 4BFXA 4DB2A 2RGGA 3WMEA 2ZYWX 4B3XA 1ZU5A 1DARA 1Z28A 3A1TA 5JMTA 2QSZA 2Q3HA 5JZVA 1TADA 2DFKB 4TL7A 2CLSA 3ICEA 2F7SA 4LHYA 1XWIA 3O47A 1T5IA 2OBNA 3B1YA 4D4MA 1A7JA 1MO4A 1NVVQ 1M7GA 4MYUA 4TT3A 1GDDA 1M74A 2OV2A 2PCLA 2ECKA 4Q1AA 1T6NA 4WZ6A 3LW8A 5JSZB 3ZVMA 2ZJ2A 5CYPA 2WTUA 1L8QA 1XCPA 5E7IA 4BQSA 4EPTA 1ZUHA 2A30A 3MJHA 3CIOA 4BLSA 1Z6TA 5HKKA 1GTVA 1BO6A 3W8RA 1N6PA 1HA3A 1QHSA 4M1YA 1BIFA 2WAXA 4OHZA 4HLUA 2ZYTX 5BQ5A 4K46A 1CIPA 4PAMA 1E2MA 1KNXA 3UPUA 3GJ3A 1E9AA 2NZ8A 4ZKEA 4JLNA 1NKTA 3TVTA 4ZDWA 3SFZA 2YOHA 1I2DA 3ZVRA 3U6KA 1Z06A 1BS1A 3SC3A 2JJ2A 3EIQA 4GFDA 4M2LA 4P0TA 3HU2A 1KO7A 4PZYA 1R0WA 4A15A 4N3NA 4W5HA 1KJZA 2I1VB 4TL9A 3OE7A 2V7QA 4ARZB 4ZIRA 1RZ3A 1D9XA 1FZQA 4CYMA 3VNUA 4M9QA 3O8CA 3F5FA 1KMHA 1PLJA 1X8KA 3UMRA 1KO8A 3LXXA 5FOUA 3ZZTA 3KKOA 3I5YA 1GITA 4DLYA 3NHAA 4MKIA 1AS2A 2ATXA 4MGZR 3QSYA 4OQFA 4EPWA 2G3YA 4XD7D 1KZ7B 2QAGC 2GDJA 3B82A 3KZ1E 5EXXA 2A9KA 3BBPA 5EP3A 3W90A 2WJIA 1G18A 1JAIA 1MT0A 1W4RA 2ORIA 3C8UA 1E1RD 1TUEA 3QPUA 1VIAA 3K09C 2VIIA 3AGPA 3MAAC 3VKGA 2WJVA 2FJUA 2YV5A 4S35A 4PANA 4XWKA 3LO5A 5JFGA 2VSOA 3TSWA 3CONA 2NO0A 3IPXA 2ZJ8A 5BN3A 1YR7A 1AIPA 1WMSA 4CDGA 4QM6A 1MH1A 1N0VC 3IUYA 3UWKA 1E2FA 2DFNA 4B3GA 4V0ME 4DIDA 1VPLA 4B43A 1QG4A 2FEMA 2YHSA 3NBFA 4ZIRB 1NNEA 1Z47A 2CLDX 1S1CA 3H2YA 1OB2A 1UDWA 3NBYC 2B6HA 2PT5A 2YZ2A 2JGNA 1KMHB 2AFHE 1ESMA 3GMTA 2PZFA 3FKSA 3MG9A 5K8LA 3NG1A 4Q02A 3WMFA 2HLDD 2GF9A 4A0GA 1XNJA 1VKJA 1G6OA 3QG1A 1UEJA 2YWGA 4WVFA 3KDSE 1W0JD 1IJFA 2FGKA 2GCOA 4B2IA 3A1WA 4ZCMA 1NBME 4GT1A 3Q85A 1TU3A 2OE2A 4BFUA 1KI6A 3EC1A 4H1VA 1Y3AA 4NYMR 3W9YA 3C4JA 2FFQA 2JDIA 4FINA 3OZXA 1P2TA 4TL6A 3QQ5A 4V03A 3CNNA 1TEVA 3TLXA 3PFIA 1ODFA 4LJ8A 4OI2A 4KU4A 3R7WA 3WP1B 3K0AA 3QNUA 2ZAMA 2W2TA 4A6XA 4B44A 3RAPR 2AHOA 4W5WA 5B30A 4UNSA 3K9HA 1KK0A 1SVWA 4KBFA 4RZXA 2BCJQ 2XZPA 4DSNA 2QRNA 4LBYA 5TV2A 2J0UB 1K5DA 3SDZA 4XWAA 3UG6A 5LB2A 3ZZ0A 2XITA 4Q4LA 3H0KA 2Q6TA 2R44A 4TQ9A 1G3IA 4MYHA 3M6AA 5AWFC 4FWTA 4MYTA 3QG5A 2TMKA 1G64A 1E79A 3F8TA 4F4IA 5KSOA 3UWOA 2WJHA 2QGZA 1RYFA 4HB0A 5EE3A 3QKRA 5TMPA 1TEXA 1OXTA 5FBWB 1M8PA 4XVUA 4BWYA 2D74A 2BKEA 4GNKA 3CX8A 2G6BA 1AN0A 1KI6B 4DEXA 1J70A 2VHJA 1N25A 1G6HA 2EVWX 2ZRGA 3FFBA 4UNQA 2RAPA 2H17A 2O8BA 4D0GA 3ADKA 2GEDA 1N6NA 4JJKA 1MR3F 3MWJA 4V0KA 3KB2A 4H1UA 5DYGA 1GILA 1TL7C 1DE0A 1VCIA 3SZRA 1FTNA 1SXJD 4OJKA 3CRVA 4WZBE 3RSLA 1TF7A 3QVVA 2Z0MA 1EX7A 1XTSA 4PHTA 3SJCA 2ZJOA 4YMVA 2IWHA 3A4NA 5BYJA 1F3OA 2WV9A 4A2WA 2WPDD 4OQLA 4Q18A 2ZYUX 1M7BA 1K6MA 5KNDA 1A5TA 1N6IA 3C16C 2FV8A 3U7EB 3SFVA 2QENA 2FX3A 2G1JA 2I4IA 4EKDA 1KTVA 1ZNZA 3CWQA 1DAGA 4LJ5A 2QP3A 2VRWA 5IT5A 2WSSD 2KE5A 1PLKA 1HEIA 2B8TA 1M34E 4DDVA 3KXKA 3AVTA 3G0HA 2FGJA 2RGXA 2GBLA 5L3RA 5BN4A 2ODWA 5E3HA 4ABYA 1BH2A 3HR7A 5JI3E 3CO5A 1O3YA 4LUCA 1WDTA 2YWFA 1Q1BA 1LNZA 2CK3D 3EZ2A 3NKVA 1SKYB 2ONJA 3Q8XB 4A8JB 2FDCA 2F9MA 3CRMA 1CRPA 2O0KA 1YR6A 4A0RA 3BOSA 4NPHA 2IYQA 3SS8A 1Q20A 4MGKR 5C4GB 2FWRA 4DCTA 2H18A 4IDNA 2ZRPA 4D81A 4HAYA 1HQCA 3I8SA 2K5UA 2QAGB 1X1RA 1ZNXA 2WJGA 3K9GA 3AVPA 1J7KA 3GEEA 3WYAA 3H84A 4FN5A 2RMKA 3KKNA 2N1BA 1KNQA 2J59A 4WXRA 4BRWA 2IS6A 1E0JA 2IBMA 3KQNA 4FWIB 4P4UA 3V4RA 2Q0HA 2AN9A 3IHWA 4BFYA 1XEXB 3PITA 2GEVA 4G5SA 3L2OB 1JXOA 1XMJA 2BM0A 3MMPA 5KNBA 1BMFA 2ZREA 1CS4C 4GMDA 4ZDKA 2BMJA 3CH5A 3PEVA 5J4YA 2H57A 4P4SB 1AGPA 1N5KA 2J7PA 3DM9B 5H8WA 1XU4A 5HZHA 1UM8A 4LPKA 5KOYA 2QMOA 4BASA 1JPNA 2IK8A 2ZJBA 3IO5A 2OAP1 4GPTA 2C5LA 3EIHA 5EP4A 4N1AA 3M1IA 3QBVA 1U0LA 1EFUA 1GRQA 3E1SA 2IYYA 2Z5FA 3O8BA 4WBSA 4B2LA 4EIWA 4HDQB 3CF0A 1K5GA 2OILA 1EG7A 1IJEA 3BD9A 5TDHA 3MCAA 2LKCA 1W48A 2CEAA 2C9CA 3SN6A 1KSFX 1E9EA 4JSTA 3U5ZB 1UF9A 2OFOA 3BFXA 1EK0A 1VYTA 1OYYA 5DNYB 2JJ1D 1ANKA 3AF3A 1KI9A 1GVNB 2JLUA 2ZYVX 2GF0A 4DXAA 1DAHA 1JR3D 3DPUA 3GLIB 3Q72A 2WWIA 4LJAA 4M1WA 4TMWA 2IL1A 1R5BA 2ODNA 4R71A 4DLRA 2YOGA 1Z08A 4DZZA 5J4VA 5JCPA 2DFTA 4HEJA 4OK3A 4ZO4A 2Q3FA 2ZM5A 2XB4A 3FPAA 5C1BA 3I1FA 2VH5R 1XMIA 4JYBA 3TSOA 1YVDA 2X19A 5AJVB 3ADCA 5B64A 1II8A 3PV0A 1N6OA 3BH0A 1T3LA 3HU3A 2W2VA 1SKYE 2FMXA 2D2FA 4IHQA 3KL4A 4BGDA 1S3GA 2GA8A 4JLDA 3KKMA 2G0NA 2ZETA 4JL6A 3U44B 4BRUA 1P9RA 1DVRA 1FFHA 2ZQ5A 1QHIA 5L3SB 1BYIA 4PO8A 4DEYA 1L4UA 1ZMXA 1OKKA 2BEJA 3B1WA 3LXRA 5SZKB 2CBZA 4PHGA 3RS2A 2QE7A 3A1VA 4MYCA 4BFVA 5D3QA 1DG1G 2G77B 1UKEA 4A0HA 2JLZA 2GK7A 2JLWA 4B3BA 1IONA 3W5IA 4N0EA 2AR7A 2HCBA 5LPNA 4DWJA 2IF0A 4TN1A 5J4LA 3AVQA 3ZQ6A 4IXNA 4P3YA 2PMDA 2ZSAA 4DLSA 3KQHA 1T9HA 2ZRIA 1HV8A 1CBUA 1WA5A 1J99A 1U8AA 5H70A 4Q4AA 1OXVA 4GOKA 1UBEA 1XEWX 4B35A 3TAUA 1P73A 4C3ZA 2C78A 4RD3A 4EPRA 1IBRA 1NVWQ 4G0NA 1Z6XA 4E5UA 4TMZA 5KPJA 2J0SA 1ZINA 4MH0R 3ONWA 1U0HC 1HYQA 3TUIC 3TQCA 4RCYA 4EFNA 3DHWC 5AK0A 2GXQA 4NYIR 4F91B 2ZJ5A 1RKBA 5KU1A 2BBOA 3TR5A 3FB4A 2DFLA 1NY6A 4LC1A 4Z51A 3GLIE 1GNQA 1KDPA 1VG1A 2WJJA 4JS0A 4PC2A 3SOPA 3TNFA 3U7GA 2IYZA 2WOOA 2J41A 4OL0A 3EWAA 3KUDA 4DCSA 5DO9A 2ZS7A 2QP4A 2V6JA 5CJPA 1EFTA 5E95A 3RANA 2P3SA 2IUUA 4NKRA 1YKSA 2YJTD 2ZE6A 2BKUA 4Q4AB 3VAAA 3GEHA 1T4GA 3AVXA 2NG1A 3KB1A 4JBXA 2AD5A 2F43B 1XD8A 4MQBA 4Q7MB 1XPUA 1NLZA 1D2NA 3AVYA 1IN6A 1F60A 2LCFA 2H92A 1D8TA 3A1SA 1G5PA 1EFRD 1WE2A 2XSZA 1W46A 3W3ZB 4B71A 1FTSA 2NO6A 4LBZA 1NL3A 3WY9A 2IS1A 4Q9KA 4LJ6A 3WNBA 8OHMA 1G5TA 3SHWA 1G7SA 2WKPA 4HAXA 2IYSA 3NHBA 1ZIPA 3LY5A 5C4MA 1R0ZA 2FSFA 2IWRA 2IA5A 2R6FA 3CUEF 5JRZA 4P33A 3FHCB 4LX0A 4TMTA 3EZ9A 3L0IB 1S8FA 4DB4A 2J1LA 2IHYA 3FMIA 4LHVA 4Q1CA 5E4FA 2PX0A 4RZ2A 2AK2A 3HPQA 3OF5A 3PUWA 3W6PA 2RKOA 3WHKA 2VO1A 2V3CC 3EG5A 2AFIE 4CT4B 1N5JA 3ZVLA 2Z83A 4EJSA 1X6VA 3IPYA 3G5UA 4TYYA 3D31A 5L3QB 1OSNA 4IFBA 3U3RA 1AS0A 2J45A 4QHTA 1IY1A 4C30A 2ASEA 4DCVA 4DT1B 5GADl 1XJQA 4B47A 3P20A 4M0LA 2C99A 4NYMQ 4GDFA 3OEED 4Q1BA 4TZ0A 3NTUA 1KAGA 1NIJA 5D3MB 2GAOA 3QXHA 2DHRA 3A36A 3LQRA 3IDQA 1SULA 4FMBB 1Z0JA 3U3KA 1GAJA 2PZEA 1EGAA 4D4LA 4LYAA 1R0YA 3GFTA 4B32A 2ONKA 3L0OA 2FSGA 1M6NA 3QXSA 2WHXA 1YRAA 5BYKA 1C9KA 1GKIA 2IYVA 3AF4A 3THYA 3AKDA 1ZP6A 1IY2A 2QG6A 2RB4A 1Z8FA 4ON9A 4RZ3A 5EE9A 2O8DB 2VP0A 3RS5A 1SGWA 2QPAA 3AKEA 4MDEA 3K0SA 2GZHA 3DVLA 1T0JB 2OO7A 5BN5A 4YDSA 1G4UR 2VHCA 2QL6A 2CLCX 1KSJA 1E0KA 1IN8A 1GP2A 1LS6A 5CM8B 2W00A 3AKCA 4LV6A 5FBRB 5HR5A 3WRYC 1D2EA 2GXSA 2ZRFA 3MJRA 4Q4JB 5FL7A 4C0QC 5H1YA 1EFHA 4M1OA 3MGCA 1PV4A 3LLUA 1ETUA 3RRNA 1NN5A 3BORA 3UMFA 2SHKA 3VMFA 3N2IA 4O0MA 5CYOA 1G7TA 3KJGA 5FR1A 2WM9B 2GTPA 1Z22A 4AI6A 4B3FX 1OXUA 1ZVQA 2ZIAA 1KDOA 2GETA 5EUMA 4FMDB 3K1JA 1S96A 3SU8A 1U94A 2D62A 3GJ0A 3P26A 1OT3A 1YU9A 4MKHA 3ZJYA 1FW6A 1OE0A 2CHQA 4BPBA 4JVMA 3PUZA 1ZD8A 4PTLA 2N46A 4RJLA 1G9XA 2XTNA 1NRJB 3BE4A 4QNMA 2OCAA 1SVMA 4TSFD 3RRYA 2HT6A 3PEWA 4JKIA 3MWLA 2HF8A 3GJ5A 1G20E 5FBVB 4KJZA 3HYRA 2ZI9A 2QAJA 4ASUA 5ANRB 4MKGA 4MKFA 3VR1A 4PQRA 4MRNA 1RE0A 3GPLA 3FYHA 5BW8A 5FFMA 2IT1A 3IILA 3I61A 2IEZA 5KUTA 4O2LA 2XEXA 1P2VA 4C2UA 2LKDA 1H8HA 1N0WA 3DMNA 4CEJA 3EPKA 5IK2A 1HURA 2YWEA 2Z4SA 3FTQA 4V0MA 5DISB 4ZDIA 3R8FA 1YQTA 1N6HA 2YC4C 3K0FB 1GM5A 3ZQJA 3N70A 3QXJA 3BB1A 4B3DA 1RJ9B 4TMXA 4W7SA 2ZTSA 3GJ7A 3NVAA 3ZGXA 1MRNA 2OAQ1 1F2TA 2RGNA 1ESNA 5G40A 4D4KA 1V5WA 4DC9A 4LPSA 4JLPA 4Q19A 1PVOA 3P4YA 4XTCS 2WICA 2BEKA 4GZMA 4O2RA 3PUYA 1GG2A 5DGXA 4LJ9A 5J47A 2V4ZA 3ZS9A 1CR4A 4RCZA 5B2ZA 5CB8A 2ZANA 5CDFE 1KAOA 1II0A 1LF0A 4YMSA 5HE8A 4FCTA 3LNCA 4URVR 2GHIA 1ZIOA 2ZI7A 3OAAA 3VR2A 4RD1A 1Q0UA 1XEWY 2CHGA 4I1SA 1Z6GA 5K8UA 1A1VA 1N6KA 2FG5A 3QXCA 2C98A 5EXPA 3BXZA 4RSGA 3J81k 4OQNA 1KIMA 5LBIA 5P21A 2WWWA 4CEJB 2MSEB 4BLRA 1PJRA 2G9NA 4ARZA 1DBSA 3V00A 1UBGA 1CF4A 2WBLC 4BFTA 1LB1B 3CH4B 4IVPA 4E22A 2H8KA 3JVUA 1K8RA 1VYVA 1JEDA 1VCMA 2OM2A 1YZUA 2P5TB 2ZRNA 2H7VA 4NL4H 5FBQB 4AD8A 1TNDA 4TLEA 1IN5A 2GILA 3BAFA 4YMUA 1ZUNB 1F2TB 2C03A 1XZPA 2IXGA 1IHUA 4ZI3A 1W4AA 3ZIAD 3GEIA 2W83A 3K0CA 1D6JA 2GVDC 1X86B 4XVQA 1QBKC 2AK3A 2R65A 4AKHA 2C95A 2Q9AA 3MLEA 1IXRC 3Q9LA 3KKQA 4TT3D 3ASYA 4YQFA 3RC3A 2DY1A 3QE0A 1XJ0A 2VP5A 5AJZA 4CEHB 2QTHA 2OLKA 1N5LA 1TQ4A 4MRPA 1COWA 2KJQA 1E9SA 5CIQA 3ETLA 2QM7A 4US2R 1E2PA 2DWPA 1DTSA 1S9HA 2F3TA 3U3OA 4B3CA 1QVRA 1MABB 4WIAA 2ZSFA 3EPHA 2OFXA 3UXMA 3QF4B 2GCNA 4JT4A 1G8PA 2R9VA 4YC7A 4CRWB 1X1SA 2G0TA 3B1XA 4PX9A 3U60B 2ZUDA 1JAHA 1P5ZB 2B21A 4Q7LA 3TUJC 1W36C 4GP6A 4L9SA 2ODEA 4LGMA 3FDIA 421PA 2WWHA 1XDBA 1AZTA 3RHFA 4OI4A 4AG5A 2O8FB 1SHKA 4JZKA 5HE9A 4E07A 3AF2A 1YJ5A 2EWWA 4B74A 5TXGA 4UXHA 2J9RA 2Q21A 4IDOA 3JZAA 5CLLA 2RCNA 3ADDA 3THOA 4BEBA 2KSQA 4G01B 4QJ4A 3M4YA 4ZV4A 1GL7A 3ZH9B 1I4DD 2MMGA 4LWZA 2KB0A 1SXJC 3T34A 3T1OA 1XPRA 1R4AA 1RVDA 3THWA 1E96A 1EFCA 4QGHA 1XCGB 3FKQA 1OH6A 5M04A 4A0FA 2A78A 5DH9A 1XB2A 4HI0E 4AKEA 1WB9A 1WXQA 4PFSA 2CHVA 1T3HA 2YYZA 4DIEA 1YE8A 2A2ZA 2VP9A 3KJIA 4OI1A 3EW9A 2A5YB 4NYIQ 5EZ6B 3RWOA 3TSZA 3AVUA 3GJXC 2J0UA 3P32A 2GEUA 1W44A 1E9DA 2MSCB 3DZDA 5FR2A 3MWKA 1JR6A 4LYHA 2BDTA 1ZD9A 3EA0A 4NP6A 1NJGA 1JJVA 2ZPTX 2E1RA 2F6RA 5AJYA 4JMPA 2VP6A 4UXJA 3QI2A 1Z6AA 2CNWA 2X8AA 5EZ5A 2PLRA 2CDNA 2FU5C 4XH9B 1RYHA 1D9ZA 1KDTA 5AUNB 3TKLA 1N3BA 3U6BA 1NMZA 1JBKA 3Q7QA 1FMJA 3AF0A 2B8WA 5JWRA 4EPYA 4NU0A 3CRW1 4NE2A 1W0JA 3FKSD 3NEYA 3FHTA 3D8BA 3QEJA 5JHGB 1NMYA 1TQDA 2PJZA 1TTTA 2GESA 3G82C 1C4OA 3ECCA 3GD7A 1N0UA 4FCVA 1RRFA 2HXSA 2P2LA 1JEEA 1Z5ZA 3MWYW 721PA 3THWB 2C9YA 4JJZA 3VU9B 4IEIA 4JVLA 2XXAA 1E9CA 2AWOA 1ZM9A 3S1AB 2VBCA 4L15A 1W0KA 1KI2A 2BBSA 1M1YE 3DKPA 4V0OA 5TVKA 3U7HB 1U0JA 2C04A 2FA9A 3D7MA 3VKWA 1J8MF 4I81A 3H4MA 1IN4A 4Q01A 4W5JA 1QHXA 4OBEA 2C77A 1Z29A 2AXNA 4AG6A 2GZDA 2OUKA 2W6JA 4R2IA 4BFWA 3CF6R 2NQ2C 2XOKD 4C4PA 1H65A 3QIAA 1W36D 4E09A 3V4FA 4C0LA 4YDHB 2PCJA 1FP7A 3SI7A 1XTIA 2WOJA 2WKQA 1SQ5A 4QL3A 1AK2A 5A4JA 2FNAA 4PQYA 2Z6VA 3IIJA 2ZI3A 2XTZA 4TYWA 3GJ6A 4EPVA 2XZLA 1V43A 5L3VA 3CX6A 1XEFA 3IIKA 3TH5A 1SZPA 4FCWA 4DUGA 3BJIC 4P31A 2GKSA 2ZR9A 3CLVA 4EFMA 1XTJA 4JVNA 4QHSA 4FMDF 4PC6A 4C0BA 3DO6A 3X1DA 2XXAB 5IHPA 3RS4A 2QAGA 1ZUIA 2H16A 2NPFA 4B6EA 4EQ6A 4YONB 3RLFA 3SEAA 2WVJA 1DO0A 4TYQA 1XTQA 3QENA 1G3MA 4P32A 1CKEA 5EXSA 4RFVA 2QZ4A 5DI9A 1Z2AA 3F3YA 3GLHA 4IDQA 3GLGB 5DN6D 1UBFA 3K09A 4S2EA 3I4LA 4CT5A 1XEXA 4NYJR 2FH5B 3IQXA 2QRZA 4HLQB 3TAHA 5JCZA 1E2KA 4YXWD 1CU1A 3U7FB 4UJ5A 2ZI4A 1U9IC 4GOJA 1Y63A 1Q3TA 1GOTA 1EESA 4IOLA 1AA9A 4P4SA 1XCMA 4Q9HA 5FH9A 2CL7X 2WSSA 3D6TB 4LHXA 4B48A 5JHHB 1JALA 1W36B 4QGAA 3IEUA 1TQ6A 2BWJA 2AKAB 2B7CA 3PUVA 4M9XA 1NVUQ 5HCIA 2QGNA 5C18A 1PZNA 4DSOA 3KQKA 4OK6A 1XZQA 1U2RA 3K9NA 1G41A 4Q03A 5JJLA 4NDZA 4RD4A 4JL8A 2CK3A 2IX3A 1HT2E 1W2HA 2D06A 1TAGA 1VECA 4TQAA 3CX7A 4NH0A 5G3YA 4BECA 3W8NA 4IDHA 2ZRHA 4EQ6B 2BIFA 2P6UA 2GNOA 3GLIA 2FPMA 2V8OA 1QG2A 1IXSB 1DPFA 1SXJB 2VLIA 3DKVA 1P6XA 1VDZA 2OCPA 3GLHB 1MO6A 2GJ9A 1KI7A 1UKVY 3EAQA 3VNVA 1F2UA 2X77A 3LWNA 1WF3A 2FSHA 2HF9A 2YINC 3W5JA 4Q7KA 3RC8A 3L43A 1S0UA 3SR0A 4U7DA 1SHZA 1TPZA 2F3RA 1E9BA 3RYTC 3KX2A 4I1UA 3TIFA 4DSTA 4IVQA 2ZJAA 3ZZUA 1ZJ6A 2A7QA 5GJWC 5GJCA 1KZGB 1GL9B 3FGNA 5KO2A 4RY2A 3JVVA 2CVFA 4TWZA 5FTJA 4C0KA 2HYDA 1ZNYA 4OQMA 4MDFA 3KJEA 2D3WA 3U44A 3OFNA 3VTKA 2KBFA 2AWNA 5L3SA 1BMFD 3B5JA 2Y8EA 3CB4A 4Q48A 4HAUA 5DHAA 4QOSA 2WKRA 3LBHA 1ZBDA 2VP4A 3LQQA 4C0JA 1KYIA 2J7PD 4Z8XA 1Z3IX 5F9FA 4AIIA 4R9UC 1BOFA 3KFXA 4FW9A 1GKYA 3EASA 4PSAA 3GLGE 3T15A 4AYXA 1XFAA 3CR7A 2F1IA 1KSHA 1RIFA 2R6GA 2ZRDA 2JJ1A 1OFUX 2OHFA 3KXLA 2J87A 4IVRA 4A1FA 4Q7JB 3O8DA 4G5GA 4UNPA 5K8TA 5KNCA 4DSUA 3AUXA 1Q21A 1VTKA 3D3QA 5GVSA 3VHLB 1US8B 1FPMA 3W6OA 3T12A 1F2UB 1Z07A 2FFBA 2ZSDA 4V0LA 1NN0A 1FQJA 3TW8B 3W6NA 4KBGA 2RGAA 3X1XA 5AUQA 2O8CB 3BIFA 1FP6A 1UKYA 3RS3A 4OHWA 4QGGA 5DI3A 1UADA 4GMXA 5FI1B 3BC1A 3GP8A 4QHYA 4QKQA 1H8EA 1Z2CA 4FXPA 4HUQB 1A82A 3TE6A 5JJKA 3X1YA 1G21E 2DBYA 2O0HA 3I92A 3KKPA 3QKSB 3T1TA 2QBYA 2RHMA 2VF8A 1ZAKA 3PQCA 1VCOA 5FPKA 2FFHA 4RKEA 3DZ8A 3IBYA 1JB1A 1U98A 2OG2A 3R20A 4ESHA 4B75A 2JLSA 1F6BA 4Y0VA 1SXJE 4L9WA 3FMPB 5EQTA 1Q1QA 3GLHE 3SYLA 2NGRA 1Q3HA 4ZPXA 1MO3A 4CIDA 3ZVNA 1G5RA 2EFEB 1XD9A 2XNDD 4WA7A 2G88A 5AJWA 1SVLA 2WJYA 2QE7D 1I2MA 3BH6A 5FPTA 2EQBA 4NCJA 4IRUB 1W1WA 2ZVQX 4X8OA 3CF2A 5EE5B 3CKLA 3U4QB 2F43A 2KI5A 2QTVB 1OHHA 4BLOA 1P7CA 3DL0A 1QF9A 3I8XA 1TU4A 4RD6A 2ERYA 3CZPA 1CRQA 1YZGA 1W47A 1HE1C 4GL2A 1OIWA 5HCNA 3SJBA 3K70C 5DI3B 4HB4A 4DJTA 5H68A 3C5CA 3MUFA 4U00A 4A92A 5B57C 2JAQA 3EWSA 5C2JB 3BH7A 2QBYB 1I4LD 1JXMA 2ANBA 4W9MC 4K81B 2JCSA 4BLQA 3RNLA 1MOZA 3CR8A 1OXXK 1EWRA 2IYWA 1TQ2A 2P67A 3BFKA 5AUOB 5JECA 4BZPA 2RGEA 3SQWA 3LW7A 5G53C 4PC7A 1P61B 4M1SA 1Z63A 2XZOA 1WP9A 1XXHB 4Z1MA 4LJ4A 1ONBA 4PR0A 3VX4A 2ZRCA 1ZM4A 2Q3MA 5SZHB 2NTYC 2VA8A 4TTQA 2WWYA 5L3QA 5EUQB 3UK6A 1NG1A 1DAMA 1DO2A 1R2QA 5FOXA 4DT1A 1G1MA 3FVQA 4UXIA 4DBLC 2XJ9A 3C14C 2A5GA 2JATA 2NMVA 1NSTA 5D3MA 1XD2B 1OV4A 2PH1A 1NN1A 2EFDB 2OXRA 4NMMA 5SZIA 1E98A 5E7JA 4U5XA 4A9AA 1B23P 1HQYE 2D2EA 3T1VA 2ZRKA 3AVWA 4LHZA 3HJNA 3LVRE 3RSOA 4IFEA 3EZ7A 2QT0A 4OHYA 3A6PC 1EFRA 3E5HA 5EP1A 2A3RA 1GL6A 1OF1A 2BV3A 3TJZA 5KPDA 4KODA 2O8DA 2A5FA 4OQXA 1Z0IA 1U8ZA 2XSZD 4XVRA 5FTMA 1R5OA 1R5NA 3TK1A 2VHUA 2GAAA 5GVRA 4L5BA 5C46F 4GRAA 4CEIB 3EXAA 2NIPA 3BGWA 1CJVC 2PLFA 1JR3E 4TMVA 4BUJA 1X8JA 5EP2A 2ZS9A 5CDFA 4KYUA 2FOLA 2QNRA 1D2MA 4LZZA 4TTPA 5KTYA 1G8HA 1PUIA 3OEHD 3A8TA 4I99A 3FMOB 4LSGA 2D7DA 5B58C 2V55B 1DADA 4Q4JA 3OHMA 4DCNA 3TRFA 3QPVA 3UATA 4GBMA 4KFSA 4EPXA 2HYIC 1GSIA 4RD2A 2EU8A 2GCPA 3TVDA 4BZQA 4URYR 4ESVA 3L8ZA 4DDTA 1O87A 1P75A 2YOFA 4II7A 4JSYA 4M1MA 2OXCA 4CF7A 4HAVA 3AP1A 3TGPA 2NOAA 5CM9C 3BK7A 4WXPA 2VTKA 2AL7A 4D80A 5K8IA 1P3JA 1E9RA 5FOSA 2AD1A 3TR0A 4QBIA 4IOMA 3ND8A 1R6BX 1E1QA 3VX3A 1ZNWA 4GP7A 3U3MA 3K70D 1LW7A 4C0HA 1TF5A 1UJ2A 4URXR 1E2LA 1MKYA 3B13B 3ZD7A 3X2SA 5CK4A 5CB6A 5DIFA 1XBTA 3BB4A 4XOIA 5DHFA 3CPJB 1ZM3A 2FZLA 3IIMA 3IHLA 1XXHE 1Q44A 2CJWA 4IJMA 2BJWA 3NH6A 1E4YA 1QDEA 4OHXA 4PAQA 2RGDA 4QJ5A 4EDHA 1E2EA 4DRZA 4UKDA 4B73A 1KDRA 2J3EA 4NTZA 1VCNA 5E7MA 2REXB 4Q9IA 4NBSA 4PO1A 3M0EA 1N2CE 5A0FA 2X2EA 2W6IA 4FMCB 5KDLA 1A2BA 3QKUA 4KFUA 4B76A 1W4CA 2F9LA 2XTMA 3PIRA 4H9GA 1G7RA 3VR6A 4ZDJA 2OCBA 3K0FA 2OFWA 4UNNA 4X8MA 3VKHA 1F48A 1RJ9A 2DPXA 1UFQA 5EE0A 1R8QA 2EFGA 1ZC3A 4CGZA 1QRAA 1N6LA 1RRGA 1SVKA 4I4LA 3WP0A 3HYTA 1FX0B 2FZ4A 4LY6A 3AM1A 4BLPA 4JBWA 4US0R 1VG8A 5ELXA 2WMNB 5KDOA 4NYJQ 3HR8A 4Q21A 4Q66C 3THXB 2P0EA 2QTFA 5TY0A 5GJVC 2QY9A 2C96A 1ELOA 5FPHA 4TLCA 4YLGA 4PZLA 3B2EA 1OFHA 2CJWB 1E2IA 1KKLA 2ZUCA 3MD0A 4HLUC 2HEIA 5LB4A 1NLFA 4LBVA 4TSFA 2IYXA 3WYGA 4NCKA 1NVXQ 4G5QA 2QORA 2FFAA 4JLBA 1NSFA 1AJEA 3B8HA 4TQUS 1RW4A 1VG9B 3E70C 3AF1A 2QMEA 1P4SA 5AR1A 3WXMA 2BCGY 1G8FA 2J0QA 2ZR7A 4ASUD 1GNRA 3TQFA 1DAKA 1CR2A 1ZCBA 5L8VA 4XSHA 521PA 1XP8A 1Z0FA 3PENA 3V9PA 4C7OB 3EC2A 4MA4A 4PPNA 4A2QA 2I3BA 3N2EA 1KI1A 4ACAA 2P6RA 2ORWA 3C5HA 4LYJA 2ZRJA 2GJAA 3QUSA 4QBHA 3RVBA 3EA5A 2X1VA 3WBJA 2CCGA 2DWOA 5JBQA 4NCIA 2IXFA 2JIZA 4D0NA 3GFOA 3C41J 3NIBA 3KFVA 3PR1A 2FE4A 3CWZA 2QQ0A 4FI3C 4CEHA 2BHRA 1EXMA 4C0SA 3LH5A 2ERXA 1KY2A 1IOZA 2WSMA 4TMKA 1AGRA 5DYIA 3QXXA 4XJXA 4M1KA 4PHFA 1NKSA 3P1JA 1FMLA 3AP2A 2V9PA 2H1LA 1GRRA 1MABA 3CRQA 3OIVA 3LBNA 5KSYA 3PXGA 2UZIR 4KFRA 1KK2A 1KI3A 4U02A 5F2EA 3QF4A 3ZS8A 4KO8A 4DLVA 4WW0A 1NBMD 4PSKA 2IS4A 4L16A 1T8TA 5CIWA 2DR3A 4MGIR 2E87A 2HJVA 2WWFA 3PEYA 4M4SA 4JKYA 3IBGA 1E4VA 1E99A 4KV9A 1CLUA 4IOKA 4IXMA 2O8FA 3NH9A 4HUTA 1T8UA 2CE7A 2WWXA 4E03A 3GLFB 3HU1A 4AURA 3Q7PA 1P9WA 4EAQA 3KQLA 1RC8A 1W4BA 2ZROA 1XTKA 2O8EB 3K53A 4LJYA 3VR5A 1KMQA 1WQ1R 3H1TA 5DLQC 1E2HA 1EX6A 4YMWA 3ZIAA 5J4KA 1M2OB 3BERA 2EYQA 2R8RA 4KCGA 4LBWA 2OCYC 4KXFB 1SVIA 3SBEA 3TW4A 2F55A 3QEOA 3QF7A 2QMHA 5AUPB 2IUTA 3P27A 4Q1FA 4DLXA 5HKKD 2J7KA 3GJ8A 1OXSC 3T1QA 3ASZA 2ZAOA 3FMFA 4CZ2A 4A8JA 4IOJA 1YZQA 3EARA 4HDOB 2FPLA 3FFAA 1OH5A 5BXQC 1IXZA 1G19A 4RVCA 5J5CA 821PA 2BMDA 2JLQA 3A37A 1CJKC 2HV8A 1COWD 1QHHA 2ZS8A 1DELA 2HXYA 4G1UC 4F38A 3ZYCA 3E2IA 3IKJA 1XJCA 1FOEB 3QKTA 5KDDA 2HT1A 4JT2A 3HP1A 2D7CA 4A82A 1EWQA 2QSYA 3IGFA 2JJ2D 2IS2A 3BFVA 3RRMA 3OE7D 2V7QD 4JLKA 1QHYA 3L82B 3MFYA
chains in the Genus database with same CATH superfamily
3GRAA 3NDRA 1Z34A 5C51B 4BEWA 1K6EA 5H7XA 3GAZA 5BWBA 5LQUA 1GA6A 4D8XA 1JQKA 2DQKA 1DINA 1MO5A 1VMAA 4IDPA 4XD7A 4BMOB 2GTHA 3FTEA 1GZ3A 4AY2A 2Q1SA 3KT8A 1ZH2A 2F1JA 1P74A 1WVGA 5IYZA 5ALSA 2P6MA 4DHEA 3SYNA 5C53B 1VL2A 2ZRAA 2XYRA 1GWNA 1OH7A 5BY2A 1E1RA 4X8HA 2Z5VA 1G4AE 4A8JC 5HUHA 1H3EA 1Y4SA 3WBKA 5DVZA 1QX4A 1LWOA 3KM0A 5AW2A 2GERA 3MPUA 1J2JA 4JQZA 3THRA 5IH3A 3HNPA 3S1AA 1WPQA 2BISA 2YYAA 3NC0C 1HTWA 4KQIA 3COWA 5IVDA 3OIWA 2XCUA 5PNTA 3B9PA 2OT3B 4C0AC 2GN6A 1Q2XA 4MVJG 3ZNQA 4L3WA 3SQXA 3IV9A 1DKNA 3DM5A 1WBBA 4QICA 5K0EA 2XMZA 2O1WA 4RO0A 5GONA 4RE5A 5CLGA 4KI0A 2MYPA 1XTRA 2BZGA 2ODBA 3A4VA 4MW9A 2BP7A 2NLOA 4JQCA 5JY1A 4RTRA 1Z39A 4UM8B 1BCSA 5F5NA 2IHZA 3HJAA 2NU9B 1C80A 2PTGA 2XECA 3NEJA 1NHWA 1DKRA 4Q1DA 1GZ4A 4UVIA 4DILA 1ZC4A 1KFKB 2DH5A 4G5XA 3OD1A 2YDXA 4FOLA 3UB2A 1N4AA 4TL8A 4URWR 3O31A 4O4IB 5SV2A 4LJLA 1L5NA 1JQ5A 5ICMA 2XUDA 3EG9B 1EP2B 4DNXA 5JZMA 1KQGA 2OBLA 3PTZA 1JWBB 3A2KA 1UJCA 2C9MA 3KOWA 2CXQA 2I91A 2AR0A 2DR0A 3R0VA 1S6YA 2JK0A 2D4HA 1VHLA 1UDAA 2Q6IA 4RTPA 1X1DA 3EFEA 1GUBA 1VPVA 2QPOA 1H4VB 2PBRA 5KAPA 1EUDB 1OXBB 3N75A 2MHCA 4TVKA 4UU0A 3UAZA 5L4LA 1S8OA 5JS8A 3EDCA 2H4WA 2A5DA 4MINA 4QYTA 3O4HA 1KERA 3ND7A 3CEAA 1JYSA 4QNNA 2PX5A 1PLLA 1Z3CA 1XN1A 2ZTVA 2H1VA 1JFTA 3TSCA 1LC0A 4X1KB 1OB5A 4Q3BA 1CLEA 4BZWA 2QX6A 1YHNA 4OSEA 1MRSA 1UPFA 3CIFA 5FOTA 1Z15A 1ID8A 3LBYA 4OGGA 4DCUA 3MRVA 1WCV1 3RFCA 4K5QA 3LUKA 2ONZA 2ABWA 4M9SA 4B3JA 3MBIA 3P7MA 2ECOA 4QPCA 5DHQA 4CKBA 3GVIA 4PPQA 3E3NA 4MUMA 1CHNA 2GK6A 3CM0A 2IIPA 1GCOA 5L3ZA 1L9KA 1DNPA 2J5XA 5EIAA 3LTNC 1XNRB 2OO5A 3EPLA 4B6FA 4IDFA 4ND4A 1E3MA 1A2QA 1K5PA 5THKA 2I29A 1PZGA 1T91A 4QATA 1HY3A 1C3VA 4CR6A 1RHMA 5F5XA 5GWXA 5G4KB 4MQ6A 5D3ZA 1TYZA 3DL4A 4GD3Q 1W5SA 4LVUA 2VCHA 4V02A 3NKFA 1ZGZA 3VKFA 1LFAA 1ZEJA 3OCUA 4MI1A 4UAUA 2VZ8A 5BSGA 1SRRA 2G07A 3LT1A 4J0QA 4W9NC 1W7AA 2W6JD 3OZRA 1UPUA 4KQ6A 4PZZA 4FZRA 2FN4A 2BAGA 2NU8A 1R4NA 4K26A 1DAFA 5A1JA 5JR3A 1RBMA 4MRMA 5CPFA 5F9HA 1WY5A 4L8VA 1OZ0A 2QU8A 1L1RA 2D2IA 2FTKE 1QJCA 1U0EA 3HNOA 5HRAA 3PT9A 1KC3A 1RRCA 2FEOA 3VAZA 4YRLA 1AKRA 4CHGA 5LXTA 1T8WA 1SVSA 2FDXA 1FUYB 3ZW8A 2W2XA 3H4TA 3N6XA 4QC2A 4K9SA 3FPFA 3TIVA 1A2KC 1EHCA 3VC1A 1IZ7A 1SXJA 2K2WA 2VP2A 3SSMA 3WRXC 5DE3A 2P9TA 3K15A 1MCZA 2WMOB 1JA0A 2HSEA 1VPWA 2UYOA 2AJ8A 3IDSA 1CQPA 4ZEWA 4ZEXA 1RYYA 2HCJB 3EIWA 4FNGA 5I9LA 3ZCRA 1I7QB 2Q6KA 1YVPA 5FFFA 3VHQA 5J5VA 1AF7A 4AWBA 5T3UA 5JTTA 1CPYA 1I2AA 2V6BA 3PXAA 1BH6A 4HNSA 5CDGA 4HTFB 2AJCA 3MJDA 1FFXB 4UBNA 2J5BA 5AW6A 3E5RA 2ISSD 1DS6A 3AG5A 4JDUA 2ZWIA 1YS9A 1ECGA 3QJ5A 2WMYA 2XRZA 1Z4NA 4LYFA 4PAOA 1GFWA 5LP6F 3LX4A 3TB6A 3CNOA 1HYBA 4GPD1 1ADCA 5A9TA 4Y9RA 3FYSA 1NJSA 1Q0RA 3AH8A 2A14A 3MCZA 3COVA 1I1HA 4KR9A 1KI8A 3VNBA 1HNNA 4XA8A 2QM3A 3HBLA 4L95C 4CGYA 3GDHA 5JXHA 1YNOA 2GFHA 1FNCA 2M1XA 1Q1GA 3CBQA 2IEGA 1YR8A 4JJEA 4MVJE 4FYWA 1IAQA 1MGPA 1A8SA 2NNLD 3HYCA 4WFJA 5IARA 3BRSA 1OLOA 1NDUA 3G17A 5KTRA 3A4LA 3AGQA 1LDEA 1N2BA 1XTZA 2O5VA 4NICA 3ROZA 3UMBA 1UQUA 4QYIA 1L5HA 3O8RA 3BFJA 1NP6A 5EMKA 2JLVA 1UK6A 4Q9AA 3FCYA 3QOFA 4LJSA 3KD2A 4Q34A 4BO2A 4OY3A 3U62A 3WVNA 1VOTA 3VAYA 5EG5A 1I3OA 3UAGA 1DXOA 2IYTA 4FFPA 2O8BB 4EHIA 3OI7A 2BELA 5ESXA 3UT5A 3SF8A 3BCRA 2ZAYA 2MJLA 2RCYA 1KOFA 1PV2A 2C82A 3WHIA 1IVNA 1ZO8A 2RH5A 2VSNA 2WB4A 4JP3A 1U4NA 3TTYA 2NPIA 2JD2A 3F49S 3LT2A 5GPBA 3WFZA 5I7HA 1WDLA 1GSOA 1H69A 2XQIA 3JD4A 4H7HA 4JQYA 1J2RA 3HV0A 1UJ6A 2IYRA 2Y0DA 3NDPA 2C7PA 1YS6A 2I2DA 1JTEA 3LT4A 3S2YA 4INJA 4Y0AA 3Q12A 4MA5A 3D02A 2F2TA 4HYYA 1NR5A 4HAWA 1Q12A 4OHVA 1U1IA 3C98A 1NUPA 2NVOA 4FILA 1Z0AA 5FULA 1UJBA 5AJUA 3UGTA 4D02A 4DV5B 1TD9A 1HUQA 3R0XA 4AJJA 5JI2E 2NT3A 4JL5A 3LL7A 4NV1A 3TNDA 4QA9A 4EG1A 3OC6A 3PVCA 4HB3A 2FF7A 4IO1A 1E2DA 4P54A 2J6IA 5TGZA 1UXJA 2YVUA 4L8GA 4MRSA 1QAOA 5LMUB 4AU1A 1CQJA 4FFDA 4MOWA 4DLWA 1TIKA 2X8LA 3AZQA 4KN5A 4NF2A 4ZQBA 5IDXA 1E4EA 2YNMA 3FFWA 3CZCA 4G1MB 1PUJA 1UQRA 2NYUA 4URZR 4GNRA 2A1TS 1CD5A 1FK8A 5JE8A 1JSRA 1YGPA 2Z8YM 5LQCA 3X1KA 5JJ5A 1CE8A 2I78A 3X0DA 1XYGA 3L1JA 3B6ZA 4DR6B 4W82A 3TLAA 2O23A 5COAA 1MQ9A 4NCNA 3O0TA 4D9CA 4AKIA 1NJ8A 5DDIP 4MUAA 3VR4H 1K7YA 3QSGA 1JQ3A 2OGUA 1OCEA 2HUPA 3SX0A 4ALNA 5DNUA 3AZOA 3ID6C 1FRNA 1Y1TA 4JXKA 5EOVA 2VDPB 2X0DA 3L01A 4LNUA 4Q5IA 5KSZA 3ON5A 2O19A 8GPBA 4BQEA 4QSHA 4WKCA 4LC0A 4OX9Y 1D1TA 3CHYA 3EVTA 4FW8A 4ZI7B 5HZMA 3PDUA 1M10A 1U9IA 1DV2A 3BRQA 4DS3A 2XGJA 2B3DA 4R3UC 3RABA 2B92A 1C1XB 1U6JA 2WAYA 3OM9A 3K31A 4KNYA 2NXJA 1G17A 2I62A 1SUCA 1E2NA 3MMXA 1UCFA 4QPJC 4X91A 1CJUC 3ZK9A 1Z0DA 4E2FA 2PT6A 1AQUA 5DT9A 4IJQA 1PJLA 2XOEA 1XVVA 1AKMA 1ZYUA 3COSA 1Q7GA 2ZTMA 2UVQA 3AESB 4HZIA 3SYKA 1MXHA 4XDYA 1YJXA 2VJLA 4J03A 3E9YA 3QPAA 4B6GA 5DYTA 3EUAA 2GHQA 3CLTD 1OKKD 1QK5A 1DG3A 1OX4A 1TVCA 1B2LA 4I4TB 4P7BA 3RYIA 3TNYA 3UKDA 4ER3A 6CHYA 2I3AA 4Y1FA 1K88A 3PQEA 3IAUA 2XX3A 2XNDA 3EZLA 5G0WA 3V1NA 1B2RA 2JA2A 2O6HA 3EOAI 4JITA 4O25A 3ZWXA 5F51A 4Z0PA 3DKRA 1A50B 3D4OA 3FW1A 1W49A 1LRKA 4UQOA 1Q57A 2PAFA 4FGSA 2YL2A 4HN4B 4I1IA 1Q6ZA 2JEYA 4B2PA 3NXKA 4CKXA 3OTWA 2PK3A 1AT1A 1JU9A 3DV9A 4XLTA 5AI9A 1L2TA 5K6TA 1ZKMA 2G9UA 5JFOA 3A32A 1M6EX 3HJRA 2FX5A 1LV7A 2BFWA 4ND1A 4BIMA 2QRJA 1KU6A 1YDWA 4DA0A 3RIEA 4ZZ1A 2REOA 3E15A 3OE5A 2XNCA 1ZVKA 4IIYA 4WOPA 5KMGB 4B7AA 3H86A 4MULA 1SD5A 4KE9A 3H2GA 4NC9A 2G1AA 2OAEA 3BF7A 1B43A 1QGAA 1WRBA 2ZSBA 3F96A 1DBQA 4XW2A 3SAJA 5E2AA 3VPSA 4C6SA 3TGWA 4U7HA 1DC7A 1HGXA 4W9RA 3VOBA 1CUWA 1VRCA 2ZSUA 4LVOA 3FM9A 1II8B 1TZCA 5G3ZA 2FRXA 4FSDA 2HJGA 3Q3JB 4IJWA 4KXVA 5IF9A 5KYVA 2GFIA 1FLAA 3HB1A 1T2NA 3BWMA 4A4DA 1TDJA 4GYYA 1NNEA 1YV9A 4DA6A 2ZB8A 4L6IA 2BHSA 1U81A 2BEVA 1NLYA 3H1EA 4M1TA 4P3PA 4WZAA 2P9HA 4G85A 2ZIXB 2IPNA 2AGVA 3N0XA 1FBTA 4F92B 2QX4A 2CCJA 1ZJ5A 2VJBA 3HA5A 1II9A 1MX9A 3FDJA 4G4SO 2I1WA 2MSKA 2JFBA 3BCHA 3PEUA 3UWSA 4W4TA 4RY9A 1P9NA 5FI0B 1H2FA 1LLCA 1I80A 1IXKA 1O94A 1P7YA 2YV3A 3X1WA 4DSZA 2NVUB 1DI0A 1WXIA 2H5IA 2JASA 4MLZA 3I32A 4Y98A 4AJKA 3ZK8A 3LFTA 3O93A 1MORA 1XZGA 3CRRA 4A10A 4JR1A 4K9RA 3AKYA 5LD2C 1SUSA 3JYPA 2LTAA 4W5TA 3WHLA 1FRZA 4BO9A 4RTJA 3VBEA 2H07A 3W04A 3D4BA 4P82A 1L4LA 4H7PA 3A1DA 1E3LA 4AS2A 4P35A 2O54A 1U2TA 2PL3A 2VSFA 2YIMA 4KIFA 1CDEA 4M9UA 3ANYB 1PP4A 2D7JA 3CW8X 3I04A 4KQ1A 4QEZA 3R9IA 1MJFA 5FO0A 1O96B 3G1TA 1XX6A 4OQ4A 1T1SA 1J90A 1OU4A 4M21A 4AUNA 3REFA 3GUUA 1XDUA 3WL8A 1RWKA 5A5GA 2AF4C 3GBSA 2Y1OA 1PJTA 3OUTA 2QLBA 3EPPA 2QN6A 3MSXA 2AUMA 3D8RA 3OEHA 1Y1PA 4PR3A 4RMJA 3V8BA 2GKGA 2ZIGA 5K3EA 5JLJA 2J46A 1U8XX 1TMKA 4UVHA 1XL1A 3CTMA 1M5RA 2MMCA 3F4LA 3UJHA 3AILA 3T4XA 5JO0A 4O4HA 5CTJA 3CG4A 5GGXA 2WAOA 4H3VA 3GDWA 5BWNA 2C5SA 3V7NA 1GKUB 4MQMA 4R31A 1MEEA 1KVSA 3QYPA 5CR9A 4IICA 4KI7A 1GZVA 4NV3A 1SA0B 4LGCA 3DLPX 4TKUA 1N6RA 1A4UA 1ZW6A 4NENA 4OJYA 4RV5A 1AUVA 3P4XA 4HKTA 2WIAA 4TTRA 4BQOA 1U3CA 4E94A 5FAKA 1RXVA 2P9FA 1J23A 1WZIA 1QFMA 1TO6A 2PEYA 1GZHB 4D98A 3J80A 4UAGA 1FX0A 1WU8A 3PPWA 3Q88A 2CVPA 4NESA 4MYSA 3FNHA 2B3TA 4N0DA 4K86A 1RJGA 1G59A 2X13A 3H19A 1HORA 2YMPA 3L49A 3OO1A 1LLUA 4YUWA 5EE1A 2EFHB 2OGWA 4ZI2A 3LVBA 3BM5A 1UXKA 2VHTA 3PXXA 4V0QA 5TQ0A 4GI2A 4DQ0A 1BKDR 1ULBA 1UL1X 2HU2A 1YI0A 4L5AA 1VB5A 4H3KB 4YMHA 3OKFA 4RFSB 3T5GA 4HFRA 3WXBA 4IUYA 1ZVVA 4QASA 4RZUA 4OYHA 3EFOB 5J5AA 2BFFB 1R10A 2NNWB 2QROA 3PR3A 1KK1A 4LFBB 4GKVA 1JQEA 3PGJA 3GRUA 3MZ0A 2GBCA 5HW0A 2P0YA 4M38A 3ZWWA 3B85A 5BVHA 3PXBA 2Z1MA 3EQ6A 3F0TA 3SZLA 2ZVDA 3QJGA 3WYCA 5AOAA 5GGYA 1D6SA 1HNWB 4KFTA 2QTRA 4IGIA 1MOSA 1DJOA 1LD3A 1E9VA 3DZJA 2WMDA 3HDTA 5FOVA 1DC4A 3FHJA 4DNQA 1HE3A 1UFVA 1YS4A 3VBCA 4NXMB 1UPXA 2A86A 4B34A 5FL7D 3L6UA 3KOOA 3DEIA 3SNHA 2QD4A 2VCEA 4AZ0B 5BSHA 5HFNA 3MINB 4MR9A 4EJSB 5A3RA 1PJ4A 2EX0A 2GXAA 4E2ZA 2J48A 3EQ8A 3NBQA 2QRVB 2SKDA 3T7TA 5J2TA 1PWXA 5BYAA 2CZGA 4ZAXA 1CYEA 4KP7A 3AEKB 3D1LA 4IFTA 4DRXB 2QX7A 3AQ4A 3OJWA 1IH8A 4PZ0A 4UCQA 4PPFA 1YVUA 4JLMA 2O3TA 1QYRA 2IF2A 4LF5B 1RZVA 2R6DA 1N8NA 3NBXX 2PUDA 3FSEA 3PKZA 3CNBA 2ZB3A 4PPGA 3DOFA 2G08A 1EBBA 1RKQA 1T3SA 2XKJE 5JRJA 3EX7C 3THYB 1UXGA 1G42A 5JASA 2X0EA 1HFJA 4PQFA 3WNCA 2VRBA 3VVBA 3GLUA 2WZBA 4LOAA 2IZ7A 1BKSB 4TKLA 5FLEX 4G0WA 2WJZB 2WTAA 4NCHA 1D4AA 3AVOA 2FLKA 5BN5B 2BFAA 4EZBA 2TMGA 1U99A 4JX9A 1Y1QA 2DYKA 1QXSA 3STWA 3RYCB 3WL7A 1OVGA 2NUPB 2QTCA 1KO5A 4ZOLF 3PLNA 5HUQA 1KE1A 4JLVA 1NWCA 3TEMA 4TLDA 5FTKA 5C8DA 1QSGA 3VR4A 2ACWA 1KGSA 4P4LA 2R00A 4YGYA 1T25A 1NOKA 3FPKA 4TZ6A 1HMYA 2CXPA 3OX2A 5K3SA 2IC5A 2MOKA 3NGLA 2OHGA 3DL7A 1VLJA 3LCJA 3R3HA 4RVUA 4ARSA 4AWXA 2XF2A 4ZYXA 1KRWA 3DEFA 3BMQA 1LI4A 2VYFA 1RPTA 1Y8QB 3NASA 4IW3B 1LTQA 3RR2A 4PLPA 4MQEA 4QM7A 1YWGO 5L6LB 1QHNA 4D44A 3Q5EA 4S0ZA 1MV5A 3ZYZA 3ZGNA 5GJBA 4JLOA 4RQUA 5FEUA 5JSZA 1S1MA 1OW3B 3JALA 1YRQA 5LP1A 5EN4A 3RCBA 3V4LA 3L0SA 1PS8A 3CNHA 3KTDA 3C6XA 4OX9B 4ZI7F 3VH4A 3EGVA 1XMVA 1G8GA 2JJQA 4GXQA 3QEMA 2O2ZA 3CW9A 3SPXA 4P2BA 2VK1A 3ER9A 2Z5LA 1MB4A 4EL0A 5LZ8A 3S2ZA 3D7SA 3OAAD 3BTVA 3QFTA 2IPOA 4MVJM 1JXAA 5ER6A 1OIVA 1O6CA 2CXXA 3A2MA 4TRMA 4A91A 1CUGA 4BO8A 1NX6A 3IDOA 4G3XA 1CS0B 2P9JA 4HFJA 3SC2B 3TYXA 3PC3A 3E9ZA 3KYCA 4RHXA 4KYVA 4R1QA 3V1MA 3W4JA 3WL4A 4L51A 5CU7A 2ESRA 2HMSA 3DDHA 4I4TF 5FJJA 1JB9A 3QHQA 1Y8RA 2FDRA 4B5KA 4U2BA 3K8QA 4G97A 2AZDA 1YBHA 2N1MA 2ODQA 2QVCA 1HDRA 2Q3HA 3JWGA 1KQNA 3T1YB 2DFKB 5LQKA 1A95A 2F7SA 2VBGA 4HH1A 1VFNA 4LHYA 5CVEA 1GNTA 2FSPA 3AJDA 1QPGA 3I1YA 1U3TA 4IF6A 3PE3A 5FIUA 3D2CA 1E7MA 3ROGA 4G6ZA 4B2YA 4BUZA 3CVJA 1N2SA 1NVVQ 1YMVA 3AMVA 3QA3E 7MDHA 4GSLA 1M74A 2OV2A 3L8GA 1DV1A 1ZICA 1C8VB 1T6NA 3D6HA 1D2RA 2I6SA 5ENDA 3VJMA 4OD0A 3PXEA 3MWDA 4UTRA 4HDRA 2AFHB 2W37A 1ISFA 1ORDA 3HKDA 3OZSA 3OP1A 4IIJA 3MJHA 4OHFA 3ZBTA 1JAZA 5AXDA 4P08A 1HPLA 3ELUA 4BLSA 4ZWNA 3HO8A 2HA4A 3AK4A 5HKKA 3W8RA 4QOIA 1WEHA 1HA3A 2WAXA 3VI4B 4K1LA 1KYYA 5BQ5A 4K46A 3TDKA 1YT5A 1E2MA 4FEAA 3UPUA 2Y93A 1WHTB 1O4VA 4ILKA 1PL0A 1IOLA 3OBBA 1ABBA 4IV8A 1ULAA 1E9AA 1PWYE 4JLNA 4FDTA 1ULZA 3W3AH 4RY0A 2ECFA 4PYMA 3H75A 4WNYA 5BO5A 3U4GA 1W88B 1WQ4A 4NSNA 1AD2A 2OQIA 3DWGA 2P4UA 2Y1KA 4JGGA 3OIFA 4Q6BA 4GFDA 4M2LA 4RC9A 4N3NA 2FI1A 4W5HA 2R2GA 4TL9A 3OE7A 5FWYB 3DC7A 3ET4A 2NZWA 3DBLA 4XDHA 4CYMA 1SQ0A 5DXFA 3VNSA 4M9QA 3UMRA 2X41A 3P71T 4UREA 1NBWB 1PJAA 3BXXA 2PX2A 1G8AA 4FR2A 3BJEA 1BC5A 3NHAA 3OQVA 3V2IA 4B4VA 4WCVA 5E9WA 3QSYA 4OQFA 1PJQA 4LE0A 3K20A 1ECPA 1FTQA 3KSAC 1YFZA 4AECA 4UZEA 2JHFA 1F06A 3RT7A 4QDUA 1U3FA 3HC7A 1G18A 2AG8A 3W90A 1FTGA 1GAEO 2D1YA 4NBVA 4MVJI 2XRMA 2IBTA 3QPUA 3O8NA 4RZSA 3B20A 2QUHA 4OSOA 4KNVA 1RM5A 4QOFA 1NQVA 3MAAC 3VKGA 4MQLA 4RWEA 4L78A 4OGLA 2CHFA 3IEPA 3LO5A 3LY7A 2VSOA 1A8HA 1JE0A 1CUUA 4I8DA 5JFGA 4JK3A 3IPXA 3RODA 3T9BA 3F4KA 5BN3A 1AIPA 4CDGA 3AEUA 2QG4A 3IUYA 3GMIA 4GX1A 4P58A 1BFKA 3V8NA 1BE1A 5EIBD 3NHWA 3PWZA 2A0YA 2YR0A 2B94A 2PWZA 1F2VA 3LQYA 5FRDA 1F9AA 4AF8A 1H93A 2FW1A 4ZIRB 3K1AB 1Z47A 2XVAA 3QWHA 5C7YA 1KRHA 3OTOB 1UDWA 2ECQA 3QMVA 1JYFA 2PT5A 2J6BA 3EAFA 3DTVD 3DA8A 3CZ4A 2CFOA 4Q24A 3VYVA 3WDLA 1SUFA 2V6FA 3C3KA 1A7KA 2B9EA 1F2DA 5K8LA 1OGYA 2IH4A 1V4VA 2W90A 2PNJA 1KXJA 2HLDD 4EAAA 2O20A 3OCWA 4UHBA 1FMTA 3QG1A 1UEJA 1SELA 3GGPA 2J3QA 2CWWA 1YIOA 2E5WA 3EWNA 3IQGX 5HZGA 2C88A 4GUDA 4ZCMA 1EUCA 2EP5A 1QR2A 4GT1A 4GX0A 3Q85A 4OOEA 4F5YA 2GMWA 4PVCA 5DLEA 1Y3AA 4A26A 3LP6A 4EYGA 3OZXA 4CU2A 1E3WA 1OAOC 2E4AA 3EOZA 4PBSA 4Y2GA 3CNNA 1TEVA 5AOVA 3E4DA 3NYWA 3PUIA 1EQ2A 2Z04A 4LJ8A 4NAUA 2ZJ7A 4BFCA 1JMVA 4MYDA 3OT1B 2HA3A 3ACBA 1L1EA 5CX4A 3VH2A 3VTZA 5CXQA 3R7WA 3WWEA 2C7RA 2AMVA 4AY3A 1NU6A 4PGMA 1PSDA 1RQNA 4A6XA 3FRIA 3RAPR 3VH3A 3LVFO 4QFCA 4YJGA 5CX1B 4CG0A 1PDOA 3K9HA 1IWOA 4KBFA 4QOEA 4RZXA 2BCJQ 1TRKA 2PM8A 4ZU1X 4N5MA 3PGA1 2IXDA 2G28A 4UTNA 3HO1A 1T5SA 4BPRA 3F6SA 2QJRA 4C43A 3JQBC 4IZOA 3CGGA 5BT9A 5LB2A 3JTEA 4Q4LA 4YO7A 4ARBA 4TQ9A 2G6TA 2NSHA 3N1UA 3NATA 4WXHA 1ZSVA 3QG5A 1B76A 3TKAA 1G64A 1V8PA 1W52X 3UA4A 4C88A 1YK1A 4L27A 2OKCA 3PFWO 3S8MA 2VR1A 3GRPA 2FFJA 3K72B 4PU0A 4YJ3B 4BVBA 2QGZA 1RYFA 4HB0A 3UZUA 2H2WA 4EP1A 5TMPA 1XVUA 1MC4A 4R2KA 3T5AA 2P9BA 4GNKA 1G63A 3PGMA 1TAUA 3CX8A 1CQZA 2G6BA 4UHFA 4DEXA 4Z2AA 2PUBA 4JI6B 3RV3A 4F46A 3ADKA 4BVFA 2V97A 2CDRA 2R1VA 1MR3F 4DYDA 4TTVA 9MHTA 4PXYA 4RGVA 4R8MA 4OBWA 4H6PA 2P1ZA 4WUVA 1L5LA 1G6Q1 1FTNA 4WZBE 3CRVA 2FSVC 5FFNA 4ZYZA 2Z09A 1L7EA 5DGTA 3IS3A 1ZJWA 2PKEA 3BXFA 4PHTA 2ZJOA 4LNAA 4NQRA 4N5IX 4YMVA 5BYJA 4C4ZA 4BX0A 3EXEA 1SUBA 2X8WA 4IY1A 3LOQA 4ARAA 5HJ5A 2PRJA 1NONA 1T3ZA 1ZN9A 5AVYA 1NMSA 5EHQA 1IQRA 1BWSA 2BZ0A 2W71A 3O74A 3S99A 1A5TA 3WNZA 2MCFA 4QPPA 1W25A 3LPNA 2I4IA 1GQFA 3ROEA 4ESOA 1SR8A 3K1TA 4NMWA 4CUKA 2VRWA 2VKTA 1T8RA 3H5NA 1QK3A 2WF5A 2WSSD 2AUNA 3UAVA 1L6RA 2G06A 4Q3OA 1M34E 3D8SA 4IDCA 4DDVA 1A9YA 3DBRA 3BHNA 3UTCA 3G0HA 3IKLA 1CDZA 1L9XA 1T9CA 1AZWA 1JNXX 3AFIA 4QLAA 2BGTA 5L3RA 5E3HA 4KZKA 1BH2A 4C20A 3CO5A 2PHZA 3IP5A 4UARA 1EDZA 1WDTA 1UWLA 2VDJA 4L76A 4Y6SA 3T3MB 5EJ7A 1C3OA 4LC9A 4WOBA 2AI3A 2K7ZA 1EVYA 2V96A 4YRCA 4KPFC 4MUFA 1SKYB 2P1RA 1OY1A 3LOUA 4D3SA 5JBIA 3HJGA 3Q8XB 4A8JB 5K0LA 1YCDA 4PGFA 1CRPA 1S02A 1B26A 3N0TA 3T95A 2IYQA 1Q20A 3E0XA 2X3FA 3VC7A 5KSWB 5C4GB 4B1FA 3RSZA 4HAYA 1JT9A 2CXOA 2XTJA 3I8SA 3R3XA 2K5UA 4RZIA 5KC8A 1X1RA 1X80B 4GGOA 1ZNXA 3W4KA 2ZUVA 5KYGA 1XSEA 4FN5A 4M7PA 3KKNA 1KNQA 2MR5A 2ID4A 4MIYA 4WXRA 1SIUA 2XCQA 2GUGA 4L74A 5H5JA 4FWIB 3IHWA 5KVCA 3TRHA 4G4IA 1MJGM 4YIKA 4G23A 1HDIA 1X1AA 1XMJA 1H1DA 3O4JA 1CCWA 4PQEA 3DTYA 2FWNA 1NFQA 2I2FA 1NMEA 1J2UA 3FPHA 4DPMA 1A5SB 4ZDKA 1NQ5A 5D1NA 2WM2A 4LDAA 2CZQA 3AR5A 4BOYA 3N8NA 1K8ZB 2H57A 1OMOA 4O1IA 4P4SB 3T3DA 2J7PA 3IULA 2AOWA 4UATA 2ZUEA 3WLKX 3E22A 2W2LD 2X0IA 3LXUX 4LOLA 5DK6A 3UK2A 5BN4B 1JPNA 1QFXA 2FUG6 3FR8A 2IK8A 3IO5A 3O92A 4N3CA 4OHMA 4AF6A 2OAP1 1IZ8A 3EIHA 1S5PA 4YO8A 2POQX 4KRFA 1EFUA 4JC5A 2MDTA 5DMXA 4QBKA 2ACKA 2K87A 4WBSA 3HH8A 3H2BA 2R5WA 1OZFA 5TDHA 1IRXA 2WT9A 2QN8A 2WYWA 3PWKA 1W48A 1GPWB 2CEAA 2DHQA 2QUIA 5EWJA 1KSFX 1CP3A 1ML4A 2Z57A 1UF9A 2CKDA 2W6MA 3JRXA 1UBMS 4I7EA 4JH0A 4NBWA 5ELLA 1OYYA 1EE9A 4N54A 5DNYB 4JA2A 1M8JA 1KI9A 2PKQP 2ILTA 1GVNB 3R5KA 4HJRA 2ZYVX 4DXAA 1DAHA 1M2EA 2PGDA 3P2YA 4L6CA 3ZV5A 2YX1A 2WWIA 1H5QA 4M1WA 4TMWA 2FETA 4J1SA 4M36A 3C0KA 5LZ9A 5IZCA 5ILOA 3AUTA 1TTQB 2DFTA 4HEJA 5JMWA 4Q3CA 5A2GA 2ZM5A 2CJXA 1FSPA 3QV1A 4LXGA 3CISA 5IM4A 5T4EA 3ZHZA 2HA6A 3LNTA 3AEXA 1J20A 2B8EA 2VH5R 1PZHA 5EIOA 3CLUD 2JL1A 3HHPA 2IPAB 3G8DA 3FWKA 3PHIA 4Y6GB 3SXUA 3ZHCA 3ADCA 3FX2A 5D87A 5C52B 3FPJA 5AVKA 4EYEA 1J0CA 1WZEA 2W2VA 1WDWB 4J4HA 1LA2A 1Z4OA 2FMXA 1OI7A 4BGDA 1OI4A 3I1IA 2GA8A 2ZB4A 2OGTA 1JTVA 2G0NA 5K09A 1EUYA 3L7BA 3JW8A 1DVRA 1FFHA 4KR2A 1A4IA 1QHIA 4Q39A 4H4CA 3T94A 3UYLA 3RGWS 1BYIA 1WDKA 2I4OA 3NTLA 4ZQFA 5T7BA 3M9XA 3L84A 2BEJA 1L4UA 1EPUA 1OKKA 3B1WA 5CM2Z 1U4OA 3RS2A 4BFVA 4ZYLA 2QE7A 3A1VA 1WHSA 3DE3X 4HRXA 4XLZA 5ADUS 5AKHA 4OA8A 1DG1G 2WUDA 5C8YA 4Z4HA 2OV4A 1N33B 1P0PA 2O59A 2F3QA 2QI9F 4JI0B 4DV3B 3O26A 3BMOB 3NQ41 1TC1A 5AVWA 4E5PA 5LMZA 2G4LA 4C7MA 2IQ5A 1Y42X 1GHTA 5LPNA 2EDAA 2PAAA 1QONA 4OFXA 5TS3A 3J81A 4TN1A 3ZQ6A 1JG1A 2R25B 3KQHA 2QTGA 1T9HA 3FUTA 2VUSA 3TR6A 1CBUA 1PR4A 3VDNB 1WA5A 1U8AA 4ZU6X 1MGOA 2NSYA 1OH8A 1JLLA 3FSGA 4PWYA 1XA4A 4J8PA 1Q2UA 2FUEA 3HUDA 3O1LA 3UOAB 3OOSA 2C78A 4NMHA 2QLFA 2WJAA 3QEKA 4ZTUB 4E5UA 2YJ3A 3BCSA 3REOA 1EIZA 5I9MA 1W5FA 4ZYVA 1FC0A 5LA6A 2LCIA 1HYQA 2RC5A 4DQVA 3K96A 4RQTA 1BD4A 2PL1A 3N2NA 3M89A 4NYIR 1MPXA 5KU1A 1UP6A 1Y37A 3DLCA 4NOKA 1RU3A 2PE5A 1Q1AA 4BTVA 1JEYA 4LC1A 1BJTA 2NO5A 4IKPA 2DBQA 1DKOA 2AUTA 1XQXA 4PINA 4EJ0A 3GLIE 4ARCA 4JYZA 4G65A 1IXYA 3AF5A 1VJ0A 1BMDA 2WJJA 5DNAA 4PC2A 3OCVA 2QVXX 3TBHA 3OHSX 1CZNA 2A59A 3U7GA 1QIJA 2IYZA 3MMNA 3VV3A 1Q7BA 2P4QA 3WQHA 1CWUA 4I46A 4ERXA 5BRNA 4OL0A 5IJ0B 2EZ9A 4GOMD 3ANTA 5DO9A 2JAHA 4DCSA 1XU9A 1RDFA 1YRWA 1EFTA 2OZVA 1N1GA 4NKRA 1SG6A 3G7UA 1YKSA 4MCIA 4DREA 4YI5A 4EUFA 1K7SN 2BKUA 5JAIA 1T26A 1W5BA 1T4GA 3TW0A 2NG1A 1PFWA 2UDPA 1RKUA 1L1FA 2AJDA 2LCFA 3M3HA 2R4TA 4W99A 3SY8A 2H92A 1D8TA 1UBNA 1YACA 4INPA 5JS6A 1X14A 2Q1TA 1FDVA 5K4GA 3OZVA 3ZI4A 3ECAA 4JUDX 4NFYA 3K5WA 5JH7F 1YFLA 2PU5A 2BGGA 1FTSA 3I2YX 3WY9A 1DEXA 1GPJA 3MAJA 1WJGA 4G0MA 1E3JA 3CR3C 4NZNA 2A1UA 4IHKA 1LLQA 3H3FA 3GJZA 2G36A 2WKPA 3CUTA 1T9GS 4YALA 1ZIPA 4FHZA 2V7VA 2I2CA 5C1PA 2FSFA 2IWRA 3T1NA 1SM4A 2W6OA 1W4ZA 3HKBB 4NBTA 2R6FA 3ZU5A 1ISIA 1BU8A 1NV8A 1JHQA 3OX3A 1L7PA 3FHCB 1NM5C 3GFQA 4EF4A 1ACMA 3L0IB 1S8FA 3NRCA 5IXSA 1KDYA 2W6PA 2WG2A 3FMIA 4LHVA 4YJ3F 4Z99A 1MAVA 2YHAA 5F33A 1Z4MA 1ZH0A 3HPQA 2FMKA 3CMCO 4YR7A 1MEOA 1ZR4A 4R84A 2P7HA 1C14A 3CKYA 1N5JA 3T5TA 4DTIA 4OFWA 3IPYA 3G5UA 5L3QB 1KP9A 1PJCA 1NQTA 1ND5A 4UBJA 3WGLA 5IBRA 3UMCA 4QHTA 2J45A 3GPCA 1IY1A 2I6TA 4PHCA 1CFZA 2C99A 4I9FA 3OEED 4Q1BA 3U81A 4AMYA 4RFLA 1G2IA 3NTUA 4NJOA 2NXEA 1GT91 3U3KA 1GRCA 3A36A 3PQ8A 1GO2A 3R09A 4B09A 3OKCA 1DX9A 2IE8A 3D8TA 3KALA 1A5BB 3GFTA 1KEUA 3LHFA 4B32A 2A0WA 1SXGA 1M6NA 3PLRA 2D8MA 5FLXA 2JAWA 2LD4A 4R2WA 3HBJA 5BYKA 1GKIA 3AF4A 4K6MA 3KYBA 1VPDA 3AKDA 3R5TA 5LYJB 1SPBS 2AJBA 2YRXA 1IY2A 3HCAA 4ON9A 1Z8FA 1JU3A 3DBOB 4A7PA 4EHNA 4KK3A 3GGCA 1QCZA 1WSDA 3ILHA 3RS5A 3Q8KA 1FRFS 2Q5HA 3AKEA 2GZHA 3BN3A 3DVLA 1FFAA 1T0JB 2OO7A 2OZLB 4G5YA 5C32A 1YULA 1U8CB 3Q7SA 4UEJA 3VHRA 5L7TA 4BNWA 1RPJA 1G2OA 4ECAA 4DANA 4LXTA 1C1DA 3EXIA 3A04A 3RVMA 3H9EO 3JZDA 3WO1A 4C6TA 2E6KA 2QU7A 4HGNA 1BEZA 4TWAA 3ZXIA 5F23A 3AKCA 4LV6A 4WJLA 4GBED 3ZY6A 5AI4A 3PSHA 13PKA 1UFRA 5IUKC 2X58A 2E1PA 2RI1A 3TAXA 4NG5A 5CA1B 5JUWA 1J24A 2L69A 3QLVA 5FL7A 3OP4A 3RH0A 4M1OA 3VO8A 2ORYA 1PV4A 1N5OX 1SZJG 3OZWA 3L6DA 3RRNA 3UMFA 2X0JA 2EZTA 3FLEA 3AFNA 3T0GA 1M67A 2WM9B 4ID9A 3KUUA 3BMNB 5EGNA 1Z22A 3G2JA 5A4DA 3GMDA 5BNTA 4CQMD 1KDOA 3HQ4O 3AU8A 2LNDA 3DNFA 3HVKA 4HLNA 4OHUA 1BXRA 3OE1A 4PLCA 4W7IA 2W4QA 4H31A 5A4MS 5KWEA 3EXG2 4C06A 4LFCB 3GFGA 1ZY2A 1ST2A 1T43A 2C54A 2D1TA 3ZJYA 3IX7A 1FW6A 3EULA 1OE0A