4TLAA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
233
structure length
216
Chain Sequence
QAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTTGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEDLSALIERINYAIQKYRARRVSIDSASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Circadian rhythms. Atomic-scale origins of slowness in the cyanobacterial circadian clock.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
total genus 78
structure length 216
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tlaA00
3UIEA 4F7WA 2VA8A 3GLIA 4RZ3A 4RCYA 4PQRA 1GKUB 1LW7A 1RC8A 1N0VC 2EU8A 2MSCB 3TBKA 2J7PD 3I1FA 4ABYA 1XPUA 3QENA 2ZJ2A 1KYIA 1ZM4A 3QIAA 3SBDA 1CBUA 1EGAA 1KK3A 1MR3F 1OXUA 1P73A 2ZR0A 2ZYTX 3RANA 3VU9A 1EXMA 4F93B 1QHXA 3EWSA 3NEYA 1OXSC 2Q0HA 2NO0A 1G8FA 3L43A 1E9DA 5FOVA 5P21A 4LC0A 1RJ9A 4HAZA 1XTKA 2PCJA 3CZQA 5IK2D 1XEWX 1CKEA 4DDVA 2J41A 2ZSDA 3KFXA 3PEWA 1E32A 1Z2CA 2ZE6A 3QF4B 421PA 1WF3A 4G5OA 2IHYA 1ZUHA 3I92A 4W5JA 1ZD1A 2Z6VA 1XTJA 5DIFA 3G82C 1G21E 3V4RA 4V0ME 5SZKB 3B9QA 5JRZA 1R4AA 4UXIA 5FPKA 3NDPA 2D3WA 3VMFA 1G19A 2JJ2A 4RKEA 4C7OA 1EWRA 2YC4C 4EAQA 3AF1A 3N2EA 3JZMA 4BFZA 4B3FX 3HJNA 1IXSB 1RKBA 1GOTA 2DWPA 2REXB 5B30A 1YR6A 2E9SA 2NTYC 3O47A 3T15A 1ZU5A 4IFEA 3LXXA 4CZ2A 4IOMA 4BWYA 1K5DA 5FUXA 1R5NA 4GMDA 4B6FA 4TYQA 4A36A 4JLMA 3UG6A 1NN1A 3X1DA 1VG0B 5L3QB 1QHIA 4WOPA 2JEOA 5HPYB 4US1R 4NH0A 2BKUA 1EFTA 1F60A 4LCBA 4IVPA 1ZINA 1GITA 5L3QA 4RFVA 2ZUCA 5LB4A 1GM5A 3K0EA 1WBBA 1JEDA 3LW8A 4Q9LA 2QQEA 4R2HA 1YJ5A 1G5PA 1RPZA 2GEVA 2V54A 5CYPA 3RNLA 2H7VA 2YOHA 1ZUIA 1N5KA 4FWTA 2JIZA 1KK0A 2EW1A 1E0JA 1SVSA 2GXQA 1PUIA 4AWXA 4PZZA 1MV5A 3CBQA 4HB2A 4NP6A 2ZR7A 4C7OB 5L3SB 1KSGA 2YJTD 721PA 2G88A 4KSBA 4ON9A 2GCPA 4L9SA 4PO9A 5BXQC 2ZTSA 2CLSA 2AWNA 5FTNA 2HF8A 1D8TA 1GDDA 2XOKA 1DAHA 3EWAA 4M22A 4M2LA 4RKFA 3IEUA 3PUYA 4DSUA 4DSTA 1CJKC 2IXGA 2JDIA 4A9AA 2QU8A 1HYQA 1OH6A 4JJZA 3NKVA 1HEIA 5HZHA 1P6XA 1XXHA 2AR7A 4MH0R 3TH5A 2AWOA 4TYYA 1KMHA 1Q3HA 2NGRA 3EARA 1TU3A 4HLUC 3BB3A 5HTKA 1X8LA 5AJYA 1M7BA 2H17A 4GZLA 1JECA 1LTQA 1IY2A 4MITA 3D3QA 3OIUA 4Q4LA 1X3SA 3R8CA 2H92A 2V1UA 4KV9A 2QP4A 2FV8A 1J7KA 2X77A 4N0DA 3ZD6A 3NBXX 2F7SA 2BMJA 2Z83A 4XD7A 5CK4A 1R7RA 5HE9A 1XF9A 2YOGA 2X2FA 1P2VA 2F1RA 2TMKA 1VTKA 3EIQA 4P0TA 3CX6A 1WE2A 4HLCA 4GOKA 3MGCA 2RGXA 2VP6A 3B1VA 1Z0IA 2JJ1D 1UEJA 2W6ID 1KI8A 1HH4A 3KL4A 3EIHA 4GOXA 2GRJA 4Q5IA 2RHMA 1Q1EA 1UBFA 1W0JD 3H86A 1KO1A 5F98A 2ONJA 4DT1A 1IXRC 1XB2A 2FOLA 2PLRA 3BAFA 4TL7A 2AD1A 4QFMA 4Q18A 3REGA 2CDNA 3AKDA 2RGBA 2VHCA 3CRW1 1T3LA 2AL7A 2ZETA 2QN6A 4P4SA 2OFXA 5CK5A 3TRFA 4DB2A 2GF9A 2QRZA 1MT0A 1Q12A 2ZUDA 4XOIA 1VKJA 3OAAD 2XZPA 3HU1A 2W6JD 2RKOA 3SJAA 2RGCA 1N6NA 2FX3A 3O8BA 5JSZB 4M1SA 5AUNB 2H8KA 4NYMQ 2OT3B 3A4NA 1I2MA 5EZ6B 4CEJA 1ZMXA 3EG5A 1EWQA 2P65A 2WWYA 3GLHE 1R0ZA 3CLVA 1XDBA 5AJXA 2QQ0A 2G0NA 2ZI3A 3OHMA 3LRPA 1OFHA 3P4XA 2F3RA 1DELA 2Q9CA 2ZITA 1ZIPA 1SXJA 1NIJA 5CJ2A 2JLQA 3FGNA 4IDHA 2ERYA 4M9QA 1CXZA 2HF9A 1AS2A 3E1SA 1SGWA 5B57C 1LB1B 1E2JA 1FTNA 1WA5A 2E1RA 4GBMA 1E1RA 3K1JA 4C0SA 3EASA 2A9KA 821PA 3I8SA 2IC5A 2QRNA 3X1ZA 4BASA 4L16A 1JALA 3G5UA 2B6HA 3HPRA 4B3CA 4TYWA 3RSLA 1KI6B 3AQ4A 1Q1ZA 3LX5A 4D4KA 4LJ7A 5JJIA 4WVFA 3HR7A 5CB6A 2GESA 2IBMA 1XJ0A 3F5FA 2QMOA 2G3YA 2WPDA 4D80A 1AZSC 3IO3A 5FOXA 5DI3A 5G53C 3NHAA 3ONWA 4RFSB 2R6CA 2V7QA 3IQXA 4NDZA 5JSZA 3WRXC 2XZLA 3AVTA 1UM8A 1IY1A 4L4UA 5ELXA 2QENA 3SBEA 1AIPA 2IUSA 4H1UA 3FMIA 1E2LA 1N6HA 5AUQA 3BS4A 3BC1A 2BMFA 2H5EA 4B71A 3EPKA 1D9ZA 2RGNC 1XFAA 4C0BA 4LJ8A 4F4CA 3IIJA 4OBEA 3W8RA 1W1WA 2DPXA 5CLQA 2HCBA 3LQRA 4ZO4A 2WJYA 4DIEA 1COWD 5CLLA 1ZUNB 5EUQB 2XXAB 2QPTA 3KJIA 5JI3E 4HAVA 2JLWA 2DY1A 2YWFA 2QM8A 1KAOA 2I3BA 3AV0B 2YVUA 4Q4HA 2FEMA 2PZEA 3DO6A 4FW9A 1NMXA 3DM9B 3REFA 4TTPA 4AG6A 1CJUC 4GP7A 4RZ2A 5TB5A 5DE3A 3B2EA 3Q5EA 3GFOA 5E3HA 2OO7A 1X1RA 5TVKA 1N3BA 2VIIA 1IM2A 3FKQA 3EX7C 2BJVA 3FB4A 3MFYA 4K8OA 3BRWD 4BFXA 4H1VA 4B2IA 4KU4A 1NVWQ 1KO4A 1Q1QA 2ZE8A 3MWKA 1NLZA 3KXIA 2Z4RA 2F43A 4NCJA 4D25A 3U6BA 1SVWA 2PMKA 5FPSA 2ERXA 1VHTA 1ZW6A 4LY6A 3VHLB 2MMGA 2JGNA 4OJKA 2AFHE 2KBFA 4HZIA 3K70C 1GAJA 4DEYA 4CEJB 2XAUA 2QEQA 1NSFA 2FG5A 1QBKC 2JLRA 3L0OA 4TLCA 3K70D 4Q00A 1P5ZB 4GOJA 4Q9HA 3CR8A 4IEIA 4IJMA 3FFAA 2J7PA 3QEJA 1U8AA 3IKJA 3WRYC 2JCSA 4DUGA 1F48A 1PZNA 1U2RA 3M1IA 1R5BA 2FDCA 2EFGA 1KSJA 2BM1A 1M34E 2WJVA 3DEFA 4DEXA 1XNJA 1S0UA 2C78A 2H18A 1N6IA 1T6NA 2WIAA 4OQXA 1W7AA 1AQYA 4AI6A 1Z0DA 2XTZA 5DI9A 2DFTA 1JBKA 1AQUA 4FN5A 2F6RA 1Q21A 2FFQA 4NCHA 4RD4A 1YE8A 2BOVA 1U8ZA 3A1TA 3TUIC 5KO2A 2AXPA 5IF9A 4DKXA 3FKSA 1JQLB 3VKWA 4LK2A 3VR1A 1BMFD 3LV8A 1E2IA 2BJWA 1ZNYA 4XWOA 1VYTA 2B92A 2GCOB 2HT6A 3ADBA 5FBWB 5FI0B 3AF2A 2QORA 2JLSA 2EFCB 3K0SA 4QRHA 3SHWA 2GEDA 1GUAA 4HAYA 1F2UB 1XTQA 3ZZUA 3LWNA 3B1YA 3U7EB 4JS0A 1T8UA 2J7KA 3AVQA 2CL6X 1ZD8A 2VLIA 1N0WA 4QM6A 1PJRA 4A2WA 1P2UA 2ZU6A 4KODA 2VP9A 2W2XA 2OV2A 4TWZA 3FE2A 3SOPA 4DWJA 3K9LA 3UKDA 3A1UA 3AGPA 1ZJ6A 5EE3A 3NH6A 5LDDC 2GXAA 3FHOA 1AJEA 4B74A 4WBSA 1NLYA 2Q3HA 5ANRB 2J0SA 2C9YA 1SXJC 3T61A 4BLPA 3AKEA 1F2TB 1D2MA 4JLPA 2V1XA 5GJBA 1GILA 1E1RD 3A1WA 4R2IA 1ZNXA 3DL0A 2DR3A 2ZRKA 3H4MA 2QMHA 2VPPA 3Q5DA 4YXWD 3KDSE 4OL0A 2P0EA 2QAGB 2QPAA 3AKYA 3OZXA 1YZQA 1W0JA 3WHKA 1DO0A 1T5IA 4B32A 5AK0A 3GJ6A 3WYGA 4X8OA 2ANBA 1E2DA 3U6KA 1OH8A 3TJZA 1UAAA 2YZ2A 2QTFA 3QNUA 2X1VA 1KO7A 1S1CA 1G291 1M1YE 1E2EA 3ND8A 3LD9A 1TF2A 1LS1A 1VECA 4YLGA 4HDOB 2AX4A 5EXSA 1XPRA 1G8PA 4LV5B 2EWWA 3P27A 3C16C 1NBMD 1YR7A 1VCNA 1M2OB 2XTMA 1S8FA 2MSDB 4Q7LA 4Q7MB 3IBGA 4I1VA 4BFYA 1SHKA 2EFHB 1MO3A 4QHSA 2C03A 2F55A 2AFIE 4Z8XA 3PG5A 1VG9B 1GFIA 3ASYA 1G6OA 1Z8FA 2QTVB 4JL8A 1OHHD 5FR2A 4CW7A 1SKYE 3AP2A 4YDHB 1S96A 3K0CC 1XD2A 4DLZA 3K9HA 1P3JA 1E2NA 2QI9C 3SU8A 2GJSA 1HY3A 2FGKA 4RSGA 3MSXA 2XB2A 1IN6A 1NY6A 5HKKD 3K9GA 3DKPA 3VR5A 1H8ED 1KY3A 2BWJA 1ZM9A 1EESA 4GRAA 1N6OA 1IJFA 1TQ2A 5BN4A 2X2EA 2WZQA 3LA6A 4A2QA 5CM9C 2ZPTX 1GG2A 4RD3A 1GWNA 4JBXA 4KCGA 4Y0VA 4AD8A 2GBLC 1QHGA 2ZRDA 2PZGA 3QQ5A 3JVVA 3FVQA 1J70A 1W49A 4MYHA 3CO5A 3B60A 1E79A 5L3SA 5CIQA 2WJGA 2KE5A 1GSIA 4URYR 1RZ3A 2DCUA 1OW3B 4QNMA 2CMKA 1X6VA 5HE8A 5IDVA 3E2IA 1QHYA 4FIDA 3RSOA 1R2QA 3SS8A 3OE7A 4EFNA 4AYXA 2RCNA 5KPJA 2BEKA 1KHTA 2J0UA 3LQQA 1E9FA 3Q72A 1C4OA 1QHNA 3UK6A 2XNSA 1A4RA 4FCWA 1E2QA 5JCZA 4HUQA 1MABB 1OFTA 4RZUA 3X1XA 4QBIA 4PPQA 2QAGC 2YWHA 3ZQJA 2H1LA 1X8JA 2VSFA 1XZPA 1AKYA 1U99A 1A7JA 1R0WA 2P2LA 1JB1A 2JJ2D 4QBGB 4DLWA 2ZI9A 1VHLA 4A0HA 1EFUA 5D3MA 4F4JA 3R8FA 3ZVMA 3ZYCA 3BH7A 3IDQA 3HWSA 2HLDD 4YDSA 4K46A 2J0UB 2WBLC 1QHSA 1Z47A 2RGNA 4CEIB 2QUZA 4M4SA 2QBYA 2GCNA 1X8KA 1P60A 2OBNA 1MO4A 3GFTA 5EE0A 3BK7A 4TL9A 3U4QA 3ASZA 1N5JA 1J2JA 4PTLA 2FSHA 3SNHA 2OBLA 5DN6A 5TY0A 3RC8A 1II8B 1CF4A 3W5IA 3GEEA 3H1TA 2W2TA 3QXSA 1L2TA 2JLVA 1G4UR 4C2TA 1RRGA 1TAGA 5SZIA 2Y8EA 2IYXA 2GJ9A 2QL6A 4MQBA 3CPHA 3GP8A 4FMBB 4P32A 1P2TA 4BE7B 2ZROA 1P9NA 4W9MC 1US8A 4OHZA 1OV4A 1OF1A 2IYZA 3EA0A 3B1ZA 4P4TA 1NG1A 1ZM7A 1ZRHA 4BEBA 3N5CA 4Q9JA 3RAPR 4OI1A 2ZE5A 3U44B 3LVRE 2GJAA 4G3XA 2JLYA 4FMDB 3NC0C 2AK3A 4EQ6B 3P1JA 2VHQA 1GIAA 2GHIA 3RRMA 3TSWA 1DO2A 1OIWA 1J8YF 2WKPA 2HDNB 4FCVA 1XJCA 2V6JA 1OPXA 2N46A 3FDIA 3HR8A 4URUR 5FBVB 1YRAA 4ESVA 1JXOA 4RD1A 4ZI3A 1WBDA 3NDBB 1H8HD 1AA9A 4PC1A 4TTQA 3DM5A 3SC3A 4A8JB 3I73A 4QGGA 4HAWA 2GKSA 2XTNA 3TQFA 3GJXC 1G9XA 3PR1A 4TSFA 1DAEA 2BMDA 3W34A 1OE0A 4PPFA 5FH9A 4JLOA 5J4YA 2DFLA 5K8TA 5KSYA 2ZYVX 1TPZA 621PA 5CJPA 3K0FB 2BBOA 4QHTA 2ECKA 5J4HA 2BEJA 4M53A 4HLUA 1T0HB 2BBWA 2FF7A 4LI0A 4AYTA 4ASUD 2PLFA 2QAGA 1SVOA 3CNNA 2IWRA 4JT4A 5HZKA 1NN0A 2W83A 2C98A 2QSZA 1NBME 1YZTA 2WMOB 3I72A 3NVAA 4NHOA 1ZM2A 4KYIB 4O0MA 2PT5A 2GF0A 2R6AA 3RS3A 2VEDA 1KKMA 4Z8YA 4M9ZA 2B21A 3PUXA 4OQNA 3UXMA 1HTWA 2A2ZA 5JCPA 3BH6A 4IXMA 4JLNA 3WYAA 3THXB 1ZVQA 1GNPA 1CIPA 1VCIA 1GRNA 4FI3C 1G41A 1H8HA 1XXHE 3D7MA 5FBRB 1UFQA 4LX0A 1LS6A 2IYSA 1SKYB 2LWIA 3ZH9B 5HKKA 1J99A 4UNRA 4RJLA 2NMVA 2WAXA 4PC3A 1C9KA 2IX3A 1CEEA 1J90A 4RD2A 1CJTC 2YWGA 2KWIA 2ANCA 3OESA 1G64A 2W0MA 4A6PA 4ESHA 1OT3A 4AIIA 1SXJB 2G77B 1TEXA 4HSEA 3DVLA 5AR1A 1E9EA 1XD2B 1KDOA 4TL6A 1FMJA 4MDEA 1QHHA 1PLJA 3FYHA 4DDUA 3VX3A 3KB1A 1U98A 4JSTA 4B33A 1CR2A 4DCTA 2C8VA 4Q7JB 3GJ0A 4TL8A 3OE7D 1G20E 2FPMA 3R20A 2V9PA 5HR5A 3KQLA 3C41J 5JMTA 3PFIA 1E9AA 1JR3E 3A1VA 4LUCA 1NN5A 4BRUA 3PCRB 1YR8A 2IK8A 4GSYA 3AB3A 3QKRB 5H8WA 2ORVA 3UMRA 2YHSA 5LB2A 1HT2E 2ZVQX 2ZRBA 1D6JA 1LY1A 2O52A 1NI3A 3I4LA 2ZI7A 1Q22A 1YU9A 3NHBA 5JI2E 3AP3A 2NO6A 4JVMA 4PC7A 4BPBA 4PAOA 1Z5ZA 4TZ6A 1N6KA 3B78A 1N5LA 2J0QA 2B8WA 1KJYA 1O3YA 2H16A 2NG1A 2VSXA 1B0UA 5EP1A 5JRJA 3CWQA 2JAQA 2MSEB 3C15C 3U3RA 4CT5A 4TMKA 3AVXA 3N70A 2CLCX 3EPHA 1OIXA 1P61B 4HZUA 3K0CA 2IWHA 2FA9A 2D2FA 4IHQA 2GA8A 4HAUA 521PA 3EC2A 4NCNA 1VCMA 2ZSEA 4N1AA 2R6GA 2C5LA 2J9RA 2ODWA 2WSSD 4WIAA 4XTCS 1CS4C 4OHWA 4URVR 4Q03A 1HA3A 2NO7A 1M7HA 1AN0A 3PQCA 5LBIA 2ATXA 2PZFA 1P2SA 1NP6A 1N2CE 2HXYA 3CRMA 3LFUA 4KLNA 4B6EA 3KTAB 4CRWB 2IEYA 3T34A 1R6BX 4BLTA 3HP1A 1JR6A 2FE4A 1W5TA 1E98A 4ZKDA 2IYQA 5EE1A 3TVTA 1XEWY 1R5OA 3NBYC 1MRSA 2GCOA 4WZAE 2R8RA 3R9WA 5EQTA 3CPEA 1KSFX 5FUVA 4FMDF 1KMHB 3VR3A 1KGDA 3Q9LA 4Q4JA 4TQAA 3RDPA 2PX0A 4EJSC 3IGFA 1CR1A 2QP3A 3BIFA 1KZ7B 4Q4AB 1EFCA 5IHPA 1IY0A 1KTVA 2OFOA 4DZZA 1UADA 3QOFA 4DIDA 1A1VA 1OYWA 3K9NA 3WNDA 3VNUA 4LDJA 221PA 2FSGA 2P6UA 1LNZA 5CITA 4GT1A 1W2HA 2BIFA 2YWEA 4KAXA 2CJWB 3U3KA 3CRVA 4JVNA 4XJXA 5GJWC 3RWMB 2FEOA 1AS0A 3Q3JB 4GFDA 3ADDA 4DLXA 4OK6A 1ZIOA 2QGNA 3EZ2A 1AS3A 3RS0A 4NMMA 3ZIAD 4LJYA 5EP4A 2AKAB 1KNXA 4V03A 3SE0A 5TXGA 4LYHA 5DNYB 3L82B 4LBYA 3U7HB 4Q1BA 3TIFA 1J8MF 3T06B 3T35A 3CX8A 4DDWA 1P4SA 3K09C 2X8AA 1L8QA 1W0KA 1OHHA 3NEJA 3MWLA 4PHTA 1PUJA 1QHHB 1U8YA 2D2EA 1N6LA 5EJEA 4G01B 3J81k 1NVXQ 1G7CA 3GJ7A 4V0LA 4A4DA 5H70A 4NTZA 3QXCA 4JVLA 5K8UA 4AKEA 1OFIA 1XWIA 3O8DA 2QAJA 4Q1AA 1A2BA 2RH5A 3CNOA 2N1BA 3VHXA 3SQXA 1SVKA 1UPTA 2OM2A 1NF3A 3VQTA 4OQMA 4ZCLA 4M1OA 2ZRLA 3C4JA 3GLGE 1XEXB 1BIFA 4O3MA 2A5GA 1FX0B 3EZ9A 3V00A 2ZI5A 2W0SA 1T3HA 4LHYA 4PHGA 3UATA 4N3NA 2GJ8A 2J3EA 3V4FA 1HT1E 5AUOB 1II9A 4IRUB 4PR0A 2WJIA 3LDAA 1VCOA 4JIMA 5B2ZA 4URWR 3K70B 4HEJA 3B5JA 3QJYA 3W6NA 3KTAA 4XVRA 3ZIAA 5LPNA 4MGZR 2O8DA 1E3MA 3HU2A 2DB3A 4NU0A 5AJZA 1FNMA 4URXR 2IF2A 3G0HA 2UKDA 5DSZA 3U3MA 1BOFA 4LPSA 3ICEA 4UNQA 1LVGA 5K8LA 4S35A 4U7DA 1I4DD 1T4GA 5G3ZA 2PJRA 2ZS8A 1GKYA 2OLKA 4QBFA 3TW4A 2FGJA 2FU5C 2OXRA 1NVVR 2NO1A 1OKKA 5DH9A 4Q1CA 1A2KC 2VBCA 4IW3B 1T5LA 2IUUA 4DLSA 4IDNA 3LLUA 4U5XA 5JJLA 2OFWA 3W6PA 1W36B 4NYJR 4KSCA 3UMFA 2ZRGA 1OXTA 4P4SB 1KI3A 4BZQA 1E2MA 4WXRA 4TMVA 4KVGA 3GLIE 4L15A 1CRPA 2Q6TA 4A2PA 3RS4A 5FUWA 1GRRA 2WAYA 4LBWA 4ZI2A 2LCFA 1Z6YA 2QZ4A 1ZNZA 3THOA 3AP1A 3JVUA 5FR1A 2ZM5A 2CEAA 4B2PA 4M1YA 4Z54A 4FMCB 1H8EA 3X2SA 2IYVA 3PEYA 1T91A 3MG9A 1II0A 4OKSA 1RRCA 2ZAOA 3FMOB 3LBIA 1BYIA 2XITA 2O8BB 1R8SA 3THYB 3WMGA 4DLRA 3PENA 3TGPA 2QE7D 3TVDA 2ZRIA 4W7SA 1MKYA 5A5GA 1E9CA 3B82A 1YZGA 1TMKA 1ZAKA 4X8MA 1KI6A 2Q3FA 5IK2A 1FX0A 1HQYE 3T1OA 4V0OA 1GKIA 4B47A 4R71A 5AWFC 3BOSA 3RS7A 3GJ5A 1ZC4A 1IN7A 4EUNA 3HYRA 3IBYA 3MWYW 4E09A 2CCKA 4URZR 3W3ZB 2G0TA 3BXZA 2QGZA 1NIPA 4JBWA 4XD7D 2E87A 2EWVA 1HURA 3BFVA 2VSOA 1BS1A 4MGIR 4QGFA 2WOJA 4ZIRA 2A30A 1O87A 2GZHA 3ND9A 3KQUA 3KKOA 3ZQ6A 2EFEB 4HLDA 4CF7A 1W4AA 3PV0A 4DJTA 1U9IC 1JJ7A 2DYKA 5J4LA 3C14C 4IOKA 4OK5A 2QT0A 1EG7A 4U02A 2HLDA 2IHBA 4TLEA 3IHWA 4EFLA 1JPJA 1VG1A 2J0VA 2XSZD 2C9OA 4OJQA 2R6FA 4TQUS 4W5HA 5BYJA 1YRBA 4OI4A 4PSKA 4Z1MD 2L0XA 4R7ZA 3LAWA 2OILA 3RHFA 4PFSA 4KFTA 1ZU4A 2VHUA 3H0KA 4QGAA 3BFXA 4LYFA 2XX3A 2CK3A 3QKTA 5E4FA 3CRRA 4BFVA 1ZCBA 4CDGA 5JECA 1CRQA 1TQ4A 3CM0A 5G3YA 1HE1C 4HI0E 4DBLC 1YVDA 4BEJA 4MA4A 2DFKB 3MD0A 4AYWA 3QF7A 2A5YB 1E4VA 3GJ4A 1Z28A 3WP1B 3ZDQA 1TADA 3AH8A 1E0AA 3IO5A 1Z83A 2VTKA 2P6NA 2JATA 2ZRJA 4RD6A 4RD0A 3MCAA 3Q7QA 4IEEA 2BCGY 4YMSA 3PUVA 5G40A 3I5XA 3CWZA 3SYKA 3EPLA 2Z0MA 1W2GA 3I61A 1Q1BA 4JSYA 2XEXA 8OHMA 3C7KA 5JLJA 5CM8B 1XCMA 1MABA 1KJWA 1MRNA 3KKNA 1QDEA 4DSNA 1P7CA 1QF9A 5JZVA 3DHWC 1Z0KA 1TF5A 5C1BA 4EQ6A 4TYNA 4Q02A 1ZBDA 5KU1A 4XVQA 1FQKA 2CXXA 3U44A 1BMFA 1KNQA 2CHGA 3MUFA 1CR0A 2QP9X 3AGQA 3BD9A 2CK3D 4Q66C 4BFTA 4ZIRB 4ZPXA 4XIGS 5KUTA 5IRCD 3AVOA 4OHYA 3DKVA 3B1XA 2ZI4A 3I5YA 3W6OA 4Q1DA 2O8FB 4PC6A 2J1LA 1ZYUA 5A4JA 4LHWA 4DCVA 4LHZA 2XJ9A 1EX7A 4NYJQ 1NKTA 2V3CC 2D4HA 1MH1A 2W6IA 4IKEA 3R9IA 2IYLD 5KOYA 1OXXK 3BJIC 3PITA 1PLKA 2D74A 2OCYC 1S9DA 5JS8A 2VP5A 5C46F 1R0YA 3AVPA 2X19A 2VRWA 3LLMA 1OKKD 3UANA 3SFZA 3OIVA 2F1IA 5FUYA 4KLZA 1QRAA 1Z22A 3LO5A 4GI7A 2PCLA 4CIDA 1YKSA 4JLVA 4UNSA 4FD2A 1DAIA 4ARZA 2GZAA 2JASA 1D2EA 1XJQA 1XMIA 2GDJA 3WNCA 1WCV1 1K8RA 3CPJB 3KKPA 3NG1A 5JHHB 3U61B 2OEPA 3RYTC 2ONKA 3F0TA 4YXWA 1KO5A 1Z0JA 3D31A 4MYCA 3GJ8A 4TZ0A 1W46A 4O25A 1JI0A 2BKEA 2CNWA 5DHAA 2O8EB 4LSGA 3BB1A 1OSNA 2PBRA 4DLYA 4PHHA 4Q7KA 3GPLA 1AM4D 3DOFA 4LBVA 4MKFA 4ZV4A 3QF4A 3U7FB 5K8IA 3QBVA 3RABA 2AXNA 4EPYA 2UZ3A 4LJAA 2NPFA 4Y0AA 1UKVY 4GNKA 2BVNA 1TX4B 1UF9A 3CRQA 2ZAMA 3K0AB 3QKSB 1NG9A 1YR9A 2Z5FA 1COWA 5DN6D 4BUJA 2V4ZA 2ZREA 2FWRA 1TEVA 2ZRMA 4C0LA 3QG1A 4I4LA 5EXXA 2CL0X 4IXNA 1U0JA 4MGYR 4BFWA 1IHUA 1HV8A 3E70C 3QVVA 2ATVA 3TMKA 4HUTA 3A6PC 1FQJA 4FCTA 2ZRNA 5SZJA 2ZJ5A 4RVCA 5GJVC 2QG6A 5UKDA 1DADA 2KBEA 4TMZA 4C30A 4UQOA 1Q3TA 2IXFA 3UG7A 3R7WA 2YINC 2WHXA 3CF2A 4EPVA 1P9RA 2CE7A 1K5GA 4D4LA 4JLAA 2WICA 2D7CA 1MO6A 1GTVA 2QPOA 1C1YA 1CULC 1ETUA 4KO8A 2ODBA 5KSPA 5KDDA 2ZANA 3GFPA 3TK1A 1Z63A 3CF0A 2HUPA 4P4UA 3GEIA 1WXQA 2HJVA 4AKIA 2WWHA 1DARA 1U9IA 2F9LA 2F1HA 2R44A 3GLIB 4CEHB 3VR4A 1WRBA 2JDID 2YNMA 5KNBA 3UWOA 1UJ2A 1E96A 1W0KD 4X8LA 4I1UA 5CYOA 4Q21A 4A1FA 2R9VA 4DUGD 2BC9A 3LNCA 3RC3A 1DTSA 2J59A 1OLOA 4LC1A 3QPWA 1G3IA 4LJ9A 2FFHA 3H84A 4UJ5A 3ICQB 2IS2A 2FH5B 4NONA 1VG8A 2CHVA 3B7GA 2VP2A 1NMYA 1I4TD 2KJQA 3E5HA 3U2QA 2VO1A 2FPKA 1GL9B 1XMJA 4S2EA 2GVZC 1TUIA 1UKYA 4WZBE 2JIZD 1XCGB 1FW6A 4LHXA 1RVDA 1PVOA 2CLDX 1EFRD 1ELOA 3ZZTA 5BN5A 2JLXA 4R9UC 3B9PA 4F91B 4TLBA 2CHQA 2V6IA 3U7GA 1D5CA 1U94A 1S3SA 4US2R 3HU3A 1JQJC 1KOFA 2XJ4A 1GRQA 2IEZA 4MYTA 5FTMA 1XPOA 2R6DA 4BLQA 2O8DB 1Z07A 2FFAA 3TAHA 2H57A 1IOZA 2ZYWX 3W9YA 2XZOA 2HJGA 4KJZA 1U90A 1E0SA 1VIYA 5E7MA 4JT2A 5E7JA 4ASUA 4A0GA 1II8A 2W6JA 4BRWA 4PO8A 5G41A 5FPHA 4JLJA 2I1VB 4PX9A 1F6BA 1Z6TA 1Z06A 2ZEJA 2BDTA 2XB4A 2QBYB 3KJEA 3BFKA 3KJHA 4LBZA 2REBA 1G4AE 4ZDJA 2B7CA 4JLBA 2O8BA 1Z6XA 3BERA 3C8UA 3IIKA 1GP2A 3EA5A 4PQFA 2P5SA 4E5UA 2OXCA 4CVNA 4L9WA 5J4VA 2OG2A 2ZYUX 5KYKA 1UDXA 4G5QA 2ZR9A 3OIWA 4TMXA 3SR0A 2QNRA 2QMUA 3AVVA 2B7BA 1SXJD 2JJ1A 4C0KA 2JJ8A 3A37A 2ZJZA 4AKGA 2VHTA 5FPYA 5KPDA 4DCUA 3TUZC 3VNVA 2ASEA 5EP3A 2CBZA 1NBMA 1E1QD 1OB5A 4RFSA 2YV5A 4OK3A 2OCAA 4C0QC 5F9HA 1Z2AA 4POAA 1NJFA 1G8HA 1JR3D 1K6MA 3I8XA 3PJRA 2CCGA 5C4GB 3QSYA 3FTQA 3TR0A 2WVJA 2C04A 4PO1A 3DMDA 2FJUA 4IFBA 3W5JA 1KK2A 4LYJA 3QKRA 2FSFA 3GLFA 5JWRA 2QSYA 1IBRA 2ZQ5A 1N0UA 4BZXA 2C9CA 2OHFA 3BGWA 4C0HA 4MKIA 1EFHA 4O2RA 4UXHA 1DEKA 1ZD9A 2XOKD 4CEHA 1V43A 1YZKA 4H9GA 4BZPA 2ZI6A 5EUMA 3CB4A 2BHRA 5KNDA 2A5JA 1U81A 5KDOA 5JJKA 5BYKA 4FXPA 4Q4JB 1CLUA 4ZCIA 4G0NA 4Z1MA 5DYIA 2W00A 3OEEA 4M1KA 4Q9KA 2V8OA 3PUZA 3NC1C 3QXJA 4D0NA 5FI1B 2QTHA 4EIWA 1KI9A 2YOFA 2AHOA 3P4YA 4FINA 4C4PA 4Q01A 3CH5A 2V55B 3GJ3A 4ZDKA 5KSOA 2WV9A 4FMCF 5L8VA 1ANKA 3THYA 4A8JC 1UBGA 2IF0A 5TMPA 5J4KA 1DVRA 1G7RA 1KJZA 3ECCA 5FL7A 4KYUA 5SZHB 1BKDR 1JPNA 2K5UA 2GAAA 4KBGA 1JR3A 1ONBA 1E9SA 4M0LA 3WMFA 4M1WA 4D26A 4Q47A 3OF5A 3GLFB 2ZRHA 4HB4A 3AM1A 4HZUB 4C0AC 3ETLA 4NZYA 4MRSA 3MWJA 1ODFA 1KI2A 4CT4B 2NO9A 3NXSA 1XRJA 4LYAA 2EVWX 4MRRA 1OJLA 1ZP6A 3QE0A 1RYFA 4DHEA 1DS6A 2HT1A 4F38A 2WPDD 3D8BA 4Q9IA 3THWA 2PT7A 1NRJB 3DZDA 1NL3A 1WQ1R 2OE2A 4DT1B 2WIBA 5GJCA 1TTTA 3A1SA 1HE8B 4EPRA 3O8CA 1OB2A 3A4MA 1E6CA 1KDPA 2P6RA 4D0GA 2ORIA 1W44A 3BE4A 2GK7A 4AK9A 5DGXA 3VX4A 2RAPA 1TUEA 3U3JA 4TN1A 3HPQA 3WY9A 4EFMA 3FPAA 1DAGA 4WAUA 4NYIR 1M7GA 2F1JA 3SYLA 4MRNA 3P26A 2WKQA 2HCJB 2ZRPA 1E9BA 1E2HA 4OQFA 3EZ7A 5H68A 4UNPA 3P32A 1BH2A 3VTKA 3PVSA 3AVUA 5FOWA 2RHDA 1DOAA 4QBHA 1AKEA 5KDLA 1X1SA 4UNNA 5FOTA 5BWMA 3DPUA 5FOSA 3DZ8A 4UXJA 4Q19A 3I32A 1G3RA 4DLVA 1XEXA 3L0PA 1RIFA 2A3RA 3OEHD 2F9MA 2QA5A 3L8YA 4MKHA 1HQCA 2GK6A 4P31A 4C2UA 1Z29A 1ZNWA 1SULA 2AD5A 5KNCA 2YKGA 4KFUA 2Q9BA 4D82A 2IUTA 5AJWA 1FUKA 5JWHA 3LBHA 2VP4A 3IHLA 2EYQA 4YMUA 5KHOC 3T5DA 4JBYA 1KDRA 1XX6A 1GNRA 3BB4A 4D6PA 1FZQA 5HCIA 2RGEA 4E07A 3GLGB 3WP0A 1XP8A 1CR4A 3HYTA 2FZ4A 4Q1EA 4NBSA 4I81A 5M04A 1EX6A 1XTIA 1DBSA 4I99A 1OXVA 1E2GA 3KZ1E 3W3AA 6Q21A 3L0IB 3PUWA 1ESMA 1Z0FA 3TKLA 1G1MA 1NVUQ 4YONB 4KVAA 3MAAC 2ZJYA 4V0MA 4NE2A 1WMSA 3W8NA 4PZYA 3VAAA 1G7TA 2CJWA 1T3SA 2NZ8A 3ZVNA 1G3UA 4MUAA 1L7VC 4OHVA 1QG2A 5JS7A 3LXRA 4L8GA 4OI2A 4D4JA 2IS4A 4AURA 4X8HA 3LY5A 3B6EA 4D81A 1SZPA 4DRZA 4F4IA 1SVLA 3RS5A 2D62A 2VP0A 2C77A 4CEIA 2C95A 2P3SA 3FMFA 2DWQA 4PPNA 4Q1FA 4KBFA 3B13B 4D0LB 1OH5A 1W4CA 4OQLA 1W36D 2UVQA 2HYIC 4LHVA 4EPTA 3TUJC 4B35A 2HYDA 4M8NE 5CB8A 1WDTA 4LGMA 3KXKA 3K53A 5E95A 3CR7A 3EIEA 3FOZA 1UBEA 1OIVA 1P72A 4E22A 3F8TA 3TW8B 5F3WB 2G83A 4JVSB 4EJSA 2WTUA 4MDFA 1IONA 1MOZA 1G16A 5C18A 1D2NA 2YYZA 2WWWA 3QPUA 2BBSA 3KUDA 3TSOA 1FUUA 1UKEA 1XTSA 2IXEA 3SZRA 3ZS9A 3KQNA 4F92B 5TDHA 4BLSA 4PQYA 5EXPA 1NJGA 2R2AA 2FZLA 4DC9A 2XXAA 3GEHA 4R98A 4AG5A 2FFBA 2PL3A 4WA7A 2FN4A 1IN8A 2EQBA 4QOSA 1JEEA 2OCPA 2ZJOA 3M0EA 5FTKA 3TE6A 3ADCA 4D4MA 5BN3A 4QKQA 3V9PA 1SVMA 5J47A 2GETA 4EDHA 2IA5A 4ACAA 1NSTA 2GXUA 1G17A 4CYMA 2RMKA 1G3QA 4II7A 4NKRA 2J87A 4I1OA 1Q20A 4IDQA 1EFRA 1F5NA 2VF7A 5L3RA 2XGJA 1I2DA 2OZEA 3ZGXA 4NL4H 1B23P 4LWZA 1I4LD 4KI0A 1N6PA 1XMVA 4G1UC 3I62A 2I1QA 4AC9A 2ZJAA 3T12A 3KXLA 4N0EA 1S1MA 2Q21A 5DI3B 1RYHA 3EAQA 5AJVB 2A5DA 3FKSD 4XVUA 2G1KA 4L5BA 4G5RA 1G18A 1M8PA 3TSZA 5JHGB 3O8RA 1TU4A 3KFVA 3AVWA 3VKGA 1E9RA 2ZJ8A 1P75A 2VYFA 3U3OA 3UMSA 4DCNA 3X1WA 4A8JA 2AK2A 4US0R 2CVHA 1UKZA 1DG3A 3LW7A 5EP2A 2WMNB 1TF7A 2WSMA 3A4LA 3IQWA 3W90A 1XTRA 1Q57A 5J40A 1YZLA 3IUYA 2IT1A 2BV3A 2DWOA 2N42A 1VMAA 2C2HA 2GNOA 5JBQA 2QY9A 4B3DA 5BQ5A 1VPLA 3Q8XB 5EXTA 3MJRA 4WZ6A 4TLAA 4GP6A 4PAMA 4IOJA 2D7DA 4AY2A 3RWOA 4JLDA 4DSOA 2UZIR 4NYIQ 4J0QA 4C9BA 2GWHA 4I1SA 5KTYA 3KKQA 3QPVA 3QY0A 2RGDA 3VR6A 2GVDC 2A5FA 4DCSA 5FL7D 2RGGA 3RRZA 5AUPB 4QGHA 2J5XA 3Q85A 3ZJYA 4ZDWA 1AZTA 1FPMA 4NYMR 1FP6A 4TLDA 1UBCA 1S9HA 3ZS8A 3D6TB 3WHLA 2NOAA 4V0NA 1KKLA 3Q7PA 3LBNA 5E7IA 2ZSBA 3K8YA 2VHJA 3U4QB 2B8TA 4UJ3A 1KSHA 2VH5R 3OFNA 4MYUA 5FBQB 4BQSA 1W36C 2OESA 3S1AB 2PEYA 1MO5A 1TQ6A 4BFSA 1U0HC 1W5SA 3H2YA 2ZSAA 4B3XA 2F3TA 4YMWA 1KY2A 4G5SA 3SQWA 2LKCA 4FWIB 3FMPB 1M74A 2IYWA 3WXMA 2WWFA 3B85A 4C3ZA 2BBTA 3LH5A 4XWKA 1OYYA 3T1QA 2ZRCA 5DO9A 3K09A 2O8CB 2BM0A 2YC2C 2ZXUA 2REOA 2O0HA 4DXAA 4KITB 3CW2A 2IYTA 4XSHA 3TNFA 3ADKA 1XMSA 4PXAA 5C2JB 4GL2A 1ESNA 1T9HA 4HUQB 3UWKA 2VF8A 3QEOA 3C5CA 1KMQA 1VDZA 2O8FA 4PZLA 1E0KA 3MRSA 5JEDA 1QVRA 3CX7A 4HB3A 4GPTA 1QZXA 1Q0UA 1R0XA 1DG1G 3TLXA 4IDPA 1CU1A 1ZCAA 5FL3A 3MLEA 1G8GA 2IS1A 1BYUA 1LF5A 2OCBA 4IVQA 4MRVA 4P3YA 4B43A 5FBLB 5TV2A 3GQBA 1LF0A 2BMEA 4TSFD 3IPXA 4QJ5A 4JL6A 2G1JA 1QG4A 1FTSA 3GLHA 3FFBA 4ZDIA 1XZQA 1RRFA 3CONA 3L8ZA 4LV8B 1FP7A 4EJSB 5FTLA 2ZS7A 4A92A 1SHZA 4ITRC 4Q4AA 3WYFA 1DAMA 1H65A 4A6XA 2GEUA 4JYBA 3CZPA 1SXJE 2G9NA 4EPXA 4DLUA 4QC2A 2F43B 2ZRFA 1U0LA 4ZKEA 3SJZA 4CGZA 3EPJA 1JAHA 1G5TA 2CE2X 3L2OB 2CL7X 3AKCA 3PEVA 4JMPA 4MUBA 1R8QA 4B34A 1OH7A 1E1QA 4OHXA 4PPGA 2ZS9A 1IAQA 2QM7A 3T1TA 3VFDA 2FPLA 1T8TA 3AUYA 4AKHA 4B76A 1HUQA 2FSIA 3KUCA 4G5GA 4LRWA 1YZUA 4QL3A 2WWXA 5FTJA 2KI5A 1E79D 4W5WA 4HB0A 4YC7A 5JEEA 4YMVA 4V02A 3GD7A 2BCJQ 3NTUA 3TQCA 3KQKA 3I3SR 2ODNA 2PX3A 3B1WA 1N25A 5CIWA 4XH9B 1CJMA 2Q3MA 3NH9A 4MRPA 1RE0A 2GZDA 2WJJA 2HEIA 4HATA 3R9XA 1JAIA 4HDQB 4ERNA 4ZCMA 2FNAA 1IJEA 2ZRAA 2O5VA 3WBKA 4A0RA 3L0SA 2PH1A 2O0KA 2IW3A 3GLGA 3FHCB 4QJ3A 2QE7A 2PMDA 3F3YA 1KO8A 4ILEA 3KQHA 4QHYA 3SYNA 3LX8A 2VQSA 2P67A 2LKDA 1XCPA 4O2LA 3U60B 1V5WA 2DFNA 4BGDA 3B8HA 3M4YA 1Y63A 4LV6A 1E69A 2W58A 1VYUA 4YQFA 4BFUA 5FFMA 2PJZA 3QXXA 1E99A 4MKGA 3AEZA 2O0JA 4BECA 3DOEA 5B58C 1NN3A 1FNNA 2MMCA 3IIMA 1GZSA 2GTPA 1RJ9B 1DAKA 1A5TA 1G7SA 3MJHA 1VYVA 5FPTA 1GVNB 3CH4B 3DMNA 2QT1A 1AGPA 1XBTA 5HCNA 3VU9B 2OLJA 3GMTA 1CJVC 1KI4A 2XNDA 4PSVA 1IN5A 2C96A 3TR5A 1LV7A 2OAP1 1G8YA 5FOUA 1AK2A 4M9SA 2PEZA 4RZXA 4B73A 1JNYA 4M1TA 4QXAA 1W4BA 4JZKA 5GVSA 2J46A 1W47A 4GDFA 1BO6A 2DHRA 3KKMA 4P33A 2KB0A 4A0FA 3U5ZB 4GZMA 3SI7A 2RB4A 2OSBA 2GXSA 3CKLA 3T1VA 5IT5A 4EPWA 3EZ6A 5EZ5A 3IEVA 1DPFA 2WJHA 3IPYA 2NPIA 3MMPA 3KX2A 3VR2A 3OEED 2EYUA 3EC1A 2HV8A 2WSSA 3CIOA 2CCJA 4GMXA 4B2LA 4E03A 3NBFA 5GADl 4JKYA 3OFND 2JLZA 3FWYA 4M9XA 4D2IA 1RRPA 2WWGA 3SDZA 3CNLA 1Z6AA 2WOOA 2IYRA 3BWDD 5L3VA 4DLTA 4XWAA 2GAOA 4RCZA 121PA 1FMLA 1TL7C 2QROA 5KSZA 3RVBA 1NLFA 4WW0A 4WXPA 3PXGA 4ACBA 2WWIA 3OEHA 1SKQA 3BBPA 1NNEA 2OBMA 1NMZA 5TARA 2FMXA 3K0FA 3GLFE 1CP2A 2Z43A 5D3QA 5LD2B 1TQDA 3QI2A 3THWB 1XD8A 1F2TA 1E2FA 4TTRA 1PLLA 3UPUA 5JWOA 4QJ4A 1XEFA 3BORA 2ZVPX 1JXMA 4QM7A 1PV4A 3PEUA 4HYYA 2V7QD 5C4MA 3A58B 4JJKA 4TMTA 4Q48A 1Z6GA 1KAGA 4QG7A 1KK1A 3RS2A 2NQ2C 4TT3A 1GL7A 2QMEA 4RY2A 3SEAA 1Q44A 5B64A 1WB9A 3P20A 3WBJA 3LVQE 4LPKA 2JLUA 1YHNA 4NCKA 3SFVA 1KZGB 3ZZ0A 2P5TB 3AUXA 1AGRA 1ZC3A 1Z0AA 3T5GA 5CDFE 5DHFA 3EW9A 4LJ6A 4BLRA 1F2UA 3RLFA 2AKYA 1W48A 4TYPA 3AF4A 1DE0A 5DYGA 2ORWA 4Q4HB 1E2PA 2NIPA 1OFUX 1S2MA 3QG5A 2JA1A 1UDWA 1Z08A 2D06A 2NZJA 4PANA 1L4YA 2OAQ1 3THXA 2A78A 2KSQA 3KB2A 1XXHB 1CTQA 1US8B 3N2IA 4PAQA 1S3GA 1G5RA 2J45A 2ODEA 2IS6A 3IILA 2R65A 2R62A 2ZU0C 1EK0A 4B44A 3GLHB 2AN9A 1SQ5A 1RFLA 4LZZA 1NY5A 3QUSA 1Z3IX 1T0JB 1IQPA 4LJ5A 1SVIA 2GILA 4KXFB 4V0KA 3WNBA 3A36A 5CDFA 4DVGA 1FL9A 4LOAA 3AF0A 4YMTA 4TT3D 1M6NA 3A8TA 4C0JA 2IYUA 4HLQB 4JLKA 1NVVQ 2OUKA 2ZUBA 1KI1A 2ZJBA 1XD9A 2Z4SA 3DDCA 4KFRA 4LJ4A 5F9FA 4KHZA 3GCGA 4OI0A 2C99A 2G6BA 1XU4A 4PC2A 2VL7A 5A0FA 2WM9B 4PSAA 3S1AA 5D3MB 4IDOA 1N6RA 3QVUA 3X1YA 1UEIA 1W4RA 2Q9AA 1R10A 4XTRA 1IN4A 3AVYA 3QKUA 4B3GA 4KFSA 2O8CA 2CVFA 3R7WB 4B48A 1ZM3A 1WP9A 4HAXA 4M21A 2CNWD 1P9WA 1S4QA 3SJCA 4IVRA 4NPHA 4M1MA 1YQTA 2GJKA 2A7QA 1A82A 5JFGA 5F2EA 1F3OA 1X86B 3NBZC 3QBTA 3BH0A 3ZVLA 2XSZA 3AF3A 1QVAA 1VIAA 4JKIA 4TMWA 2DBYA 3SJBA 3NWJA 1G6HA 1KI7A 5J5CA 1TNDA 4HDCA 1GL6A 1E4YA 3EXAA 3SHFA 1FOEB 2WKRA 4A82A 4DDTA 3OIYA 1Y3AA 4DB4A 3K0AA 3QKSA 2RGAA 3HDTA 4NCIA 4U00A 5GVRA 1DAFA 1G3MA 4TQ9A 3RRNA 4IOLA 1NKSA 2XNDD 5EE5B 3ZVRA 4XSGA 2I4IA 3VKHA 1GNQA 1JJVA 5LD2C 2W2VA 3M6AA 3ZD7A 2O8EA 1KDTA 3C5HA 3JZAA 1YZNA 1RW4A 1P62B 5EE9A 3ZLJA 3FHTA 1LFDB 2ZE7A 3CUEF 4UKDA 5DISB 5H1YA 2HXSA 4JYCA 1FFHA 1E94E 4K81B 3EZFA 3PIRA 4Z51A 4ARZB 1KIMA 1L4UA 3NIBA 4B3BA 5BW8A 3SN6A 4MGKR 2EFDB 2IL1A 3OAAA 2ZIAA 3TAUA 4QNRA 4JL5A 4A15A 5DLQC 1IXZA 1D9XA 1E2KA 1N5IA 2GBLA 3QXHA 4PHFA 3KJGA 4EKDA 4BLOA 4OYHA 4B75A 3RRYA 2SHKA 3WMEA 2ZSFA 3CF6R 2IYYA
chains in the Genus database with same CATH superfamily
4X65B 3CLHA 3I04A 1SOWA 1K98A 5D5HA 1E6UA 3AC0A 3I28A 5J2TB 2I7CA 3EG9B 1VSUA 3HL0A 2NU8A 3O9ZA 4EA9A 2BH2A 1RM4A 1W87A 3D43A 16PKA 3ZWNA 2EU8A 4BE4A 2MSCB 3FGZA 1MT3A 5A1JA 3GCZA 4RMNA 2ZJ2A 1KYIA 3QIAA 3SBDA 5FLYA 1MR3F 2VTDA 1G98A 3F7NA 3FFXA 4QRDA 2R4QA 5DHSA 3RYCA 3U9SA 3PNPA 3VU9A 1QHXA 3EWSA 3NEYA 4YBRA 1OXSC 1PL8A 1O6ZA 1EA5A 1USUA 2VJOA 2NO0A 1WW3A 1G8FA 2DHEA 3L06A 4H7PA 5P21A 5K6TA 5IPFA 1O94C 3E5MA 4HAZA 3OFVA 3WRWA 2PCJA 3CZQA 4K1LA 1Q11A 1U5BB 3OQJA 1XEWX 2D5LA 1CKEA 2MTBA 2AUNA 2FHPA 2J41A 3GMSA 3P0RA 3KFXA 3AG6A 3UV3A 3PEWA 3OTOB 3QVMA 2NYVA 1Z2CA 2ZE6A 4KMRA 3ZGZA 5JAHA 2IHNA 1ZD1A 1X80A 3EVFA 1XTJA 3ZU2A 3RTEA 5DIFA 1U28A 1G21E 2GZSA 3FPEA 4V0ME 4Z4FA 1ZK3A 5SZKB 5CFOA 1CUIA 1E4OA 2IVFA 3NEPX 2GHQA 4OHOA 4UXIA 5BVGB 5JRZA 1EDEA 3NDPA 2D3WA 1G19A 4RKEA 4GRIA 1EWRA 3MHPA 1C3OA 1LPNA 2QN8A 3N2EA 2DXIA 1FZTA 3JZMA 1L8AA 4NEHB 3LKDA 1RKBA 4BGVA 5B30A 2QK4A 2JBHA 4EUSA 1QIKA 2NTYC 2PKQO 1JLLA 3INNA 2KHZA 4CF3A 3EQ2A 1H6BA 4IOMA 5B6IA 5B1YA 2XUGA 5BV8A 5IJ0B 3KKZA 4HP8A 3TL3A 4WE3A 4A36A 4KI7A 5A6SB 1NN1A 3BYZA 3EIXA 5CGQB 3PWZA 3G5LA 1QHIA 4RZQA 1UBJS 1WM1A 4QARA 4MI1A 4YV7A 5HPYB 4EVSA 2OSVA 1EWYA 2W5UA 4LCBA 4NFHA 1LJUA 1LBTA 3I2FA 4OU5A 3IP3A 2ZUCA 4ANFA 3EYWA 2R8EA 4CG2A 2AFHB 3C3YA 2C0PA 4JYPA 3U09A 4AAYA 4FHGA 4OP3A 1YZ3A 3QUAA 1LVHA 1G5PA 3CTMA 2GEVA 4EYGA 3DOHA 4FZVA 2JJYA 3RNLA 4GH5A 4DWWA 3C7DB 3OJLA 2JBAA 4V0SA 4FWTA 2JIZA 3INRA 3TEJA 1GPDG 4L08A 3UKOA 1KK0A 2EJTA 3DAHA 2V7XA 1SVSA 4P4GA 3UT0A 4LRYA 3TECE 3SZ3A 1KXZA 2GARA 3K6SA 4BFLA 1FBNA 1DXQA 1RMTA 3CBQA 2H7XA 2KMLA 2O8NA 3CUUA 3FFWA 4GLOA 5ICFA 3WL8A 2P3LA 3EFOB 3FWKA 1MAAA 1MEJA 3TEMA 5L3SB 2YJTD 721PA 1BXGA 1Z73A 1ZVKA 3QPAA 4L9SA 4CQNA 3P5SA 4BS9A 1CRZA 1FYEA 3OOYA 5LZ2A 2FOIA 2VQDA 2RAFA 1SOAA 4JDUA 2R66A 5LLTA 1VJRA 3D6MA 1QRDA 4EB6A 2UDPA 1CE8B 3T95A 3TMAA 5CDHA 3QA9A 4M22A 4DSTA 3GPIA 1NUAA 3IEUA 3PUYA 1EXDA 2YDYA 5E1MA 4A9AA 2WFLB 1HYQA 1OH6A 4XRRA 4O2BF 1CWUA 4JJZA 2ZZNA 1HEIA 3IV7A 5HZHA 3E27A 2IZ0A 4NESA 3FTFA 6REQA 2DQKA 2H1RA 3QTTA 1WSAA 5EJ5A 4OH7A 4QECA 1TU3A 3BB3A 1M7BA 2XMGA 4TVKA 3O75A 4MITA 5KC8A 1TZJA 3D3QA 3OIUA 4Q4LA 2JVJA 3GYGA 4YQYA 3UNXA 4NBNA 5K99A 3SZOA 1RXSA 4H7HA 1N78A 1R7RA 5HE9A 5HUJA 4WOKA 2R25B 3ACCA 3M33A 2TMKA 4WGFA 5BN4A 3A4VA 5EJ7A 4DBZA 4Q24A 1KQPA 4GOKA 3ZHBA 5CNKA 4L75A 5JH7A 4LNHA 1Z0IA 2JJ1D 2Q5EA 2H8GA 2B37A 2OC9A 3PC8A 1QB7A 1ADBA 1ENZA 3AR9A 3JAWA 1QZTA 2H06A 5IFKA 5AI5A 3ZWBA 1RJWA 1UBFA 4RA6B 3ROFA 5EZQA 3WBFA 1W0JD 2O5CA 1BS2A 1KO1A 2FG6C 1A9TA 3MM4A 1T3GA 1V7ZA 3PDJA 4QVGA 4R1QA 4ZAZA 5KHAA 1XB2A 2PLRA 2TYSB 3BAFA 2XGMA 2AD1A 2X5JO 4ND1A 4Q18A 4QFMA 1RACA 4OB7A 4DY4A 4BY9E 2RKBA 1T3LA 2ZETA 2W2MA 4CNBA 5HFAA 4TV9A 4OMUA 3SQNA 4U7FA 2CZGA 3P96A 5KNBH 3JALA 2FPXA 5CLIA 2ZUDA 3BE5A 4O29A 2OD9A 4UFPA 3L7YA 5DT9A 3EWIA 3FSJX 1RHUA 2VDPB 4G4JA 4ARVA 1NUQA 1B26A 4ZODA 2NQTA 4KWTA 3KLNA 1BDHA 5L95A 3O1LA 2EL9A 4UTZA 3O92A 4YP0A 4M1SA 1FDUA 1YS9A 2RHJA 1P3Y1 4F46A 4TRJA 1NNI1 2DFVA 2WP0A 5DNDA 3GDWA 1JDJA 2OT3B 4YHBA 4CEJA 4Q9AA 3GT3A 4JAVC 2P65A 3GLHE 1A9OA 4FEYA 4C05A 1R0ZA 2QMZA 2I3AA 2EV9A 3L0DA 5AJXA 4ZYXA 2XMCA 4YCLA 2B94A 5ICEA 4Q37A 3KEFA 2HR1A 4DYVA 4BC0A 5JVDF 1OFHA 1TRHA 4LZPA 1DELA 1Z36A 2G06A 2Q9CA 1ZIPA 2Q46A 2ZITA 3KOMA 5KMGB 5TIIA 1VFNA 1PFGA 2G28A 2ZTVA 4PSUA 4F4DA 3ODPA 2DLCX 1QZUA 1JFRA 1QIFA 4IDHA 3UUGA 5B57C 1SGWA 1W94A 3TXYA 1FTQA 1LB1B 1FTNA 1WA5A 2E1RA 4GBMA 1E1RA 3K1JA 1DBVO 2BGIA 3UH1A 2VHZA 3A6HA 2FDXA 2QR2A 4A16A 5ECGC 821PA 3PD0A 4UEOA 5CGZA 4ZO8A 3GIDA 3L4BA 1NXOA 1LLFA 3RSLA 1QXSA 3FJ1A 2C2GA 5AH0A 1KI6B 3JQ7A 3CVXA 3NAZA 3QX9A 1UUFA 2ZT8A 3LX5A 4LJ7A 5JJIA 1L4MA 4AG3A 4CDMA 4WVFA 2W70A 1SRRA 3ZE2B 1JAXA 1HDCA 3M1YA 2IHKA 2IBMA 3I0NA 1HDRA 1XJ0A 2QMOA 2YIMA 3F5FA 3L1HA 2G3YA 4O08A 3UWSA 4R40A 4DEXA 2V5UA 5FOXA 4ZEMA 1E18A 3AV3A 1I14A 4OFXA 4MCAA 3NHAA 3OLWA 4X1KA 1BMDA 3HB7A 5KYYB 4RTPA 4RFSB 3VJKA 4TVSA 5KKNB 2R6CA 2J4FA 4TYMA 3EEBA 3VYVA 5JSZA 3WRXC 4WEQA 3MLBA 5HKBA 4QOIA 4MW1A 4MCJA 3RV4A 3BIXA 2IFTA 4K7JA 3LUFA 1RABA 1O08A 1DT3A 1E2LA 3L07A 3P9NA 4RCVA 3KKEA 3HWRA 1QPGA 3QWAA 4KQ1A 5JADA 4YCCA 1C3JA 2X40A 3CYFA 2AEEA 3BHJA 3UHFA 1CYDA 1XFAA 3HHEA 4DZTA 2YRXA 4C0BA 4LJ8A 4YX9A 4F4CA 4CGYA 4DIFA 2LBPA 4EATA 1T36A 2HCBA 2GLUA 5JLAA 4JWKA 4FB4A 2OD2A 1QF6A 3B20A 1COWD 1ZUNB 5EUQB 4YRBA 2G09A 2QPTA 1T2EA 3ZHOA 2XXAB 1DTWA 3BF8A 2RHGB 5MHTA 4FLFA 2QM8A 1NX9A 4AROA 1H4VB 3I05A 2R00A 3CA8A 3LG2A 3WGQA 3N2KA 3TFWA 1ORHA 2PZEA 3REFA 2VRCA 4TTPA 4AG6A 3W79A 1Y82A 2ERCA 4UVDA 1CJUC 3PXBA 4LK3A 4QFBA 4MAAA 3GFOA 2OO7A 3L7BA 5AMXA 4REQB 4IXDA 2VIIA 3PLAE 3FKQA 3EPRA 3K1YA 3FB4A 2PKQP 2Y1GA 3T7EA 1HE5A 2R97A 3BRWD 3PQ2A 4H1VA 2QQGA 3K1ZA 2A1UA 3BIJA 1M6YA 2ZE8A 1FW8A 5CEJA 4ENSA 4FQ5A 4XR9A 2EEPA 4NEQA 4JCOA 1TO6A 2ZJ6A 4INJA 1PNRA 3AESA 1ZW6A 3P9IA 1TW3A 4BVHA 2P3OA 3Q88A 3DXZA 2JGNA 1TJ5A 3E03A 3IP6A 2KBFA 4B4UA 3MJTA 5LFAA 3S8YA 3K70C 5H3LA 1TKBA 3L0OA 5LVAA 1VKOA 2GO7A 4UC0A 4H4EA 1NYLA 4P92A 3WAKA 4GOJA 1I94B 3VYSB 1D6MA 4X44A 4EW3A 1WY7A 1MAHA 1SCUB 4HDMB 2H7CA 3T6KA 1U8AA 3IKJA 1YDMA 2JCSA 1F48A 1UBOS 1U2RA 3M1IA 1R5BA 5LJIA 1XAIA 2D6FA 2YHIA 3ZU4A 4MUGA 1DG9A 1SBHA 1ULBA 2ZIFA 3CHYA 4WX2B 5COBA 1D7AA 2WD8A 3V4LA 1HDZA 3LK7A 4D9BA 3SR4A 1BJKA 1PZHA 3DEFA 2XE8A 3RF7A 4DC0A 1HORA 2P9ZA 4JFRA 2WIAA 4OQXA 3MOGA 4RS3A 4XGQA 3A6FA 4PWYA 1ODJA 2GERA 4B46A 3AB8A 5G0UA 2NU6A 2F6RA 1Q21A 2FFQA 3HDGA 5HIJA 4CR8A 4DR4B 1FYDA 1JU3A 1L7AA 5KO2A 4RELA 3A04A 4RKYA 4RX1A 1R0LA 3F73A 4LK2A 3DBLA 3A9VA 1E2IA 2BJWA 1SU4A 3VDRA 1VYTA 5TQJA 3U56A 4EYSA 3ADBA 2CLLB 2JLSA 4EY8A 3STTA 5I4IA 1GUAA 3GUCA 3HVUA 4PG5A 2BISA 1XTQA 2HA7A 1CUYA 3TRDA 3RRXA 3ANSA 3B1YA 3RYIB 1RKUA 4JS0A 2F8SA 3NHUA 1GQOA 4CJXA 2Z2YA 1IPFA 4LNUA 4PYQA 3O8QA 1M2KA 2VLIA 2V0CA 1N0WA 1NMEA 3RUEA 1PJRA 3S4YA 1ZD3A 5C51B 1O7JA 2ZU6A 4E5SA 4IJKA 2VP9A 2J3LA 1Y1SA 3BXPA 5A6VA 3NRCA 1PU2A 5JNRA 4O1HA 3G9QA 3L01A 5JZBA 2WD7B 2PUAA 4CMBA 4J0IA 2GXAA 3NH6A 1SQFA 3K73O 1AJEA 1AG9A 3GG9A 2QL7A 3CUSA 3HLTA 1NLYA 5KX5F 2P8SA 4IQGA 3T4UA 5K6AA 4H0NA 4GKBA 1XA3A 1EUDB 1GU1A 1I3KA 1IH8A 3E8SA 2V1XA 3AEYA 3IB6A 4NHEA 5AI9A 1MOSA 3A1WA 1V1MB 2PUEA 1ZNXA 1H2RS 2W11A 2QVYX 2ZRKA 3H4MA 4OIMA 3GRUA 2P9JA 3JQEA 5GWXA 2FFRA 4XWGA 5AI4A 3R77A 3PHLA 3TGWA 2GNAA 4AL4A 4JN6B 2QPAA 5A0VA 2FXIA 2YHUA 1X77A 3M82A 4C4OA 4MICA 4BBJA 3WHKA 4MCHA 3P0IA 3PWTA 4JZYA 3OD1A 4WZBB 5C1PA 2IHUA 1P1KA 2OCGA 3BCUA 4Y2RA 1L5HB 3TJRA 2ANBA 1T5BA 3D5TA 3TKYA 1VSBA 2QVGA 4JX9A 3GIWA 1OH8A 1MQ8B 2IW1A 1UMKA 3D3JA 3WLHA 3SICE 1M1YE 3CQ9A 3ND8A 1FS4A 2ZT7A 4QOGA 3S55A 4YLGA 1Z2OX 1M2OA 3ZJVA 1LX6A 3ITKA 2P9QA 5I4KA 1EYZA 1G8PA 2R5NA 4RE5A 1RXUA 4UBOA 5HRUA 1ZJWA 1EP3B 1Y6QA 4NS1A 2HRZA 1ZR4A 1IHOA 3ZV5A 4YRQA 3BMNB 2D0PB 1BCSB 1VCNA 1QWSA 4C3OB 1T34A 4BNGA 4FW8A 1QGUB 3F6PA 1M1YB 1MH9A 1TCCA 1XQXA 2PLNA 3IHTA 4NATA 3RFTA 1ZONA 1KZ6A 1W8IA 3A2NA 3FF4A 4GG1A 5I7RA 4QHSA 2F55A 2J4DA 4DQUA 1MVLA 2NQ8A 2YXBA 1WMBA 1GFIA 1AUXA 1G6OA 3OZVA 4JBLA 3RCBA 4EHKA 1SXQA 3E2PA 4KDRA 1XRLA 2NNWB 4ICIA 4FKBA 4UCQA 3L05A 4WFQA 4YDHB 3EODA 4C3VA 4EI9A 3PKZA 3CLUC 1S96A 1XD2A 1XDDA 3HEAA 1OZAA 3BSWA 4DLZA 2Y0CA 3K9HA 3C48A 2CUNA 3KALA 2GJSA 4LXYA 4HVLA 4DMRA 3MSXA 1ZQ9A 2G5PA 4C6TA 1D3AA 4L8YA 4UQPA 2H2DA 3K9GA 2PKEA 2FETA 3VR5A 3T7CA 4GWGA 3RU9A 2JGKA 4CQJA 4K0RA 1N6OA 3R41A 1IJFA 1TQ2A 2X2EA 2UVPA 4HSGA 5T6BA 4A2QA 2GD2A 4OP1A 2Y92A 3A10A 2YBDA 5E4TA 3ITEA 2JZCA 4H35A 1UJBA 2QX6A 5DNCA 1BN7A 1QHGA 2A3NA 2I7DA 5ULLA 2QTGA 2FYTA 5EUBA 5CAEA 2BZGA 1W49A 4MYHA 5DYYA 1JMKC 1DRUA 1E79A 3B60A 4YI5A 5ADWA 2P30A 5I47A 1KEEA 1IB6A 5F76A 4MV8A 4URYR 2V6FA 1Q0RA 2W4MA 1U4NA 1IOVA 1OW3B 1IVYA 4L8FA 1FUYB 1X6VA 2WJ3A 3O5AA 4BFZA 1NJSA 3RSOA 4IMIB 2AG8A 2RCNA 5KPJA 3CKMA 5EYPB 1J7JA 1E9FA 2W93A 4B3TB 4QUJA 2CZQA 2XNSA 1A4RA 2FN8A 1E2QA 2BMVA 2H11A 1HXHA 2NO5A 5JCZA 4HUQA 1D4OA 3CXRA 1K86A 4WKNA 3LF2A 5JXIA 3JASA 4JASB 3UBMA 2Y9MB 1YOVA 4KXLA 2JLAA 4RZUA 1OX6A 3OJ0A 4QBIA 3B3JA 1OFVA 3FOCA 5D7BA 3ZQJA 1JEOA 4IQ0A 4LS3A 4BGIA 2R8ZA 4XWTA 4ZCSA 5HQ3B 5LP6A 2VSFA 1AKYA 1JB1A 1XZKA 4FUQA 4ZJYA 5G4LA 3FSGA 3OQOA 3R8FA 1XDZA 3KUXA 1A3CA 3HM2A 3ZVMA 4RQUA 3WHIA 3PX2A 3ZE7A 3HWSA 5K20A 1UKAA 2AMVA 2DJIA 2YBEA 2WZDA 4JC4A 1SHUX 4LDNA 3HSKA 5K0LA 1AC5A 3F74A 4REMA 1QV7A 4CEIB 2OWDA 2QUZA 3PVCA 5KSWB 2QBYA 3FROA 1P60A 3RJTA 5SYNA 1MO4A 4IS2A 4PAGA 5J43A 2HJ9A 3GFTA 4TL9A 3TLGA 2MDTA 2O14A 3E6AA 4PTLA 3RJ5A 1KAQA 5AOCA 5TY0A 1QQ7A 1II8B 1BHO1 1CF4A 4EFDA 1ADFA 4V1CI 1OYVA 4PVCA 3H1TA 3B6MA 3QXSA 4AZ3B 1L2TA 3IE1A 2JLVA 2ISQA 3BXGA 1RYBA 3IESA 1TAGA 5HIKA 2AE1A 4IP0A 2UV8A 4JQCA 3QWIA 4PXYA 4PW0A 2L17A 3FLAA 2BEWB 4C7XA 2QD3A 1WNFA 1M76A 2L69A 1WKBA 2I7XA 3CPHA 4P32A 4BE7B 2EAUA 5KTSA 1E3QA 2QS9A 2W22A 4P35A 3N0TA 1NQOA 1P9NA 1DHRA 1US8A 4OHZA 3RSHA 1JF8A 4S2UA 3ZHYA 5IU6A 4G26A 3NJ8A 3UGQA 5L6MB 1J25A 1GNVA 4Q3BA 3PGA1 2ECPA 4Q9JA 1SK9A 1TLTA 3BEDA 3HB5X 1QRUA 2R1VB 4YCAA 5KYVA 3DGEC 3WA6A 2X8JA 4RGBA 1V0JA 4G25A 4G3XA 4CUJA 3V2UA 3NC0C 3NI2A 1EAYA 1RZVA 4EQ6B 5I7WA 5JE8A 1AHNA 2D5IA 3RRMA 3PPXA 3WLAA 4YK7A 3PCXA 1OIWA 1OI3A 3EGCA 4EF4A 1D4AA 4U0KA 4RXMA 5FWDA 4C4XA 1IZ8A 2WKPA 1P19A 1X8XA 4QE3A 3HR8A 2V6JA 1OPXA 3IFSA 3KTDA 5FOUA 3SDBA 5FBVB 1YRAA 4DV3B 5FWYA 2QDXA 5EJ6A 4PTYA 4RD1A 4ZI3A 4CR7A 4Y1RB 1WBDA 3NDBB 1H8HD 1AA9A 4OBXA 3DM5A 4FP9A 3I73A 4QGGA 3TW6A 2XOXA 4HAWA 2R5WA 3TQFA 1Y0BA 3GJXC 1LX7A 1P1HA 2CLFB 2ZWPA 3JQQA 3PEEA 4WLVA 4BO3A 1YTUA 4GSKA 1I9CA 1G5HA 3AHJA 4M7PA 4YH1A 5F77A 3W34A 3E9DA 4IZHA 2GBGA 1BQ4A 1RJFA 2MSNA 3O8OB 3TM4A 3W7VA 3P0HA 4CIXA 1J21A 1OXKB 1CYEA 5JNSA 4QBTA 1IVSA 5ILGA 1TI7A 4D79A 3IVXA 3K0FB 1FU8A 1S2GA 4QHTA 2PMBA 5LP6F 3K2BA 2P77A 5LYJF 1QFYA 3R3JA 3DAGA 1OC2A 3KE9A 3LSTA 1BXKA 3M4ZA 3LPLA 1KE1A 3TL2A 3CNNA 3V7YA 4JR1A 2GKGA 2C9DA 3C1TA 1ISGA 4I1YA 5G4KA 5HZKA 2JZOA 2QSZA 2ZYRA 3HABA 3KZXA 2Z6AA 4FJ1A 1YZTA 2WMOB 3M9WA 3R5FA 4D3FA 3NVAA 1UFRA 1ZI8A 3B3GA 2P79A 3EXFB 2R6AA 3RS3A 3LOUA 2VEDA 2I67A 4CUZA 4WN3A 3DE1X 3FNBA 1F5SA 2JH3A 2OL4A 3PUXA 4JSRA 4OQNA 5H83A 1S3FA 2B35A 1HTWA 4ALIA 3SOZA 5K45A 1H1LA 2A2ZA 3WAGA 1UFVA 3CG4A 3NW9A 4BU1A 4Z4CA 3FFTA 2GI4A 4QOFA 1DRWA 4LECA 4C4RA 3HKBB 1L4FA 3CCCA 3T3IA 4AQYB 1ODSA 2C0QA 3OPYB 1BD4A 3QPDA 5JRDS 1UFQA 1HFEL 2LWIA 4N65A 2CNLA 2H00A 4QGBA 1KYTA 2OY0A 2K2WA 3IUEA 5HKKA 3QXGA 1QH8B 4RJLA 2NMVA 2D3TA 1C9KA 2IX3A 2B6NA 1CEEA 1GU7A 3FBTA 3MGAA 5C7LO 4QT0A 3ZDZB 4RD2A 2DR0A 2EL7A 5SY4A 1ZMBA 3TL6A 1T6ZA 1Q1AA 1Z2NX 2ANCA 3OESA 2W0MA 4HRXA 3O0TA 2QZSA 1X38A 1OT3A 4WXEA 1SXJB 4NPAA 2G77B 2FK8A 2KLHA 3O93A 5FADA 3DNPA 5JG7A 2GYVA 3OTGA 3P2KA 1DWQA 2YJ3A 1ISJA 3GLRA 5AHKA 1EZZA 3EAGA 3FYHA 3VYTB 4DDUA 2P9GA 4HN9A 4J75A 4HZGA 2PWYA 4JSTA 1P0PA 1ZFNA 4XR4A 3KT0A 4YJGA 2LZ0A 1N1DA 4LCJA 3VH3A 4W8OA 1YASA 4TL8A 3OE7D 2FPMA 2C4TA 3EGOA 3PHJA 2P5UA 3DLHA 3VHXB 4MV4A 6ABPA 4N0MA 2WW8A 2FQYA 3PCRB 1YQDA 1QVZA 2I6TA 2Q4OA 2IK8A 2WEKA 3QLTA 3AB3A 1MB3A 1YMUA 4BN4A 5K03A 5KTMA 2IE8A 1FJXA 2FPSA 4ZREA 3CZ5A 1HK7A 2PUWA 4KWCA 1TECE 4JXXA 1TGYA 1HFJA 3L7DA 2QT9A 4Z9XA 3I4LA 2AW5A 4NARA 2CUZA 2ZI7A 3JQ9A 2I4NA 5AHRA 5C34B 3OQNA 2V7GA 5SICE 1RAEA 2J3DA 3N86A 4KPEC 4FR5A 4II3A 1Y9EA 1SA0A 1Z5ZA 4PC7A 1N6KA 5C8XA 3ZY6A 3QEAZ 4R1PA 4IH9A 3OIFA 3TNJA 3G79A 5GGXA 3ZXUB 2J0QA 1MX9A 3UM9A 2CDAA 2ZKIA 3CWQA 4Y2YA 4CT5A 5B6JA 5JRJA 1IY8A 3K5HA 5FQNA 3WQHA 4X6YA 3ILXA 3BDAA 1OIXA 1ZR2A 1P61B 4KO4S 3HY6A 2VDNB 2IWHA 4XX1A 3IRVA 3LQ1A 2X1LA 1DWOA 4E11A 4HAUA 1DIHA 1YI1A 3OY7A 4J76A 4NCNA 4G4SO 2CYCA 1U1DA 1HRDA 2XB9A 4N1AA 3WP1B 1CDZA 4KXWA 1TJYA 5E2IA 4AUMA 2H0RA 1MD9A 1E6MA 2BEVA 3OTIA 4OHRA 2NO7A 4UNIA 4BJ3A 4K03A 1HG0A 1AN0A 2FUG1 5LBIA 2DERA 4ZOLB 1DEAA 1ODKA 1N2CE 3HYLA 3TCXB 2MT9A 2Q6IA 3FMVA 4WKBA 4C22A 1ECCA 1VIVA 4CRWB 5JCJD 1N33B 4N49A 1XWWA 4BLTA 4IIEA 2FUG6 2XVAA 2JVIA 3MS7A 1P2GA 3NYRA 5DT2A 5LC1A 1XEWY 5HJEA 1MRSA 2PSEA 2GCOA 4QFDA 3WDSA 3R9WA 2ZDHA 4TXMA 1G6KA 3FOBA 5K0BA 3DMHA 5HGXA 3RDPA 4CMIB 4WOBA 1RT9A 1NRWA 1RCFA 3F6SA 3W77A 3WLJA 1A9XA 4HPWA 4PLFA 5DGCA 2C31A 5CNIA 1NOKA 4NU8X 2OXIA 5IHPA 3GAAA 1LLUA 3E48A 3G8YA 2EERA 3QOFA 2EOAA 3N2LA 5EWLB 1U04A 5LNK6 4MVWA 1LNZA 1ZLYA 2ZBQA 3BHNA 3PUJA 2OOSA 4JT8A 2YWEA 4XLTA 4KAXA 1K97A 4LF7B 1DT5A 1PT9A 1REQB 3CRVA 4XJXA 1B8VA 1OREA 1EDZA 5DYWA 3RWMB 3U3KA 3LDFA 4DLXA 3UO8B 2OZLB 8ABPA 2NXJA 5A3JA 3QEMB 1AS3A 3ES9A 4NMMA 5EPEA 4EYOA 4LJYA 3I0ZA 5EP4A 3UMCA 1XTBA 5TXGA 4C89A 1L4HA 1P44A 4QJ3A 4LBYA 4MWTA 5DHPA 5KWSA 3TIFA 4RACA 3NRBA 3T06B 5JNUA 2X8AA 4HGZA 4OXIA 3SXUB 1L8QA 1OHHA 1UBTS 3S1LA 3NEJA 3MWLA 4HRVA 3E9RA 4CODB 2DUNA 2NV6A 4YN3A 3IAM1 4P5EA 4S0ZA 1OZHA 1KZ1A 4ZZ2A 1NFFA 2ZYIA 3JWJA 5ERGB 1I3CA 5IH3A 4AB1A 4E94A 4NZ9A 5FWAA 5H70A 3QXCA 5DRYA 3W2FA 3EYAA 2HY7A 2M6RA 3MTJA 4KXQA 4GMFA 3O8DA 1BC5A 4Q1AA 1YDHA 2GKOA 5JH7F 3CNOA 2C7QA 5DCUA 3UYLA 2Z5GA 3D3WB 1BJRE 4ZQGA 4DABA 5BURA 5JO0A 1LPAB 1NF3A 5A4DA 4I6GA 2PUGA 3V55A 1GVHA 3IR5A 1DXOA 4KQ6A 2AC4A 3WZ2A 4WN9A 3ZCRA 4E7OA 2SCUB 4JEMA 1NDQA 3CVOA 4ZCLA 4BO7A 3C4JA 3EVGA 2FMHA 3A1NA 3NPAA 1QGAA 3GELA 5K2MA 1JSXA 5AVKA 5HXAA 1KQGA 1FX0B 2EDAA 3F8SA 1UPCA 3UFXA 2G9VA 1XRMA 4HQ0A 2GJ8A 2VH2A 4P81A 5FYDA 3V4FA 2XCUA 1HF3A 3W9SA 1E1CA 2WJIA 3ECAA 4PNEA 4FU0A 3E1GA 3ZV4A 3K70B 4DQVA 1WDKA 4EECA 4B2YA 1C7RA 3QJYA 4HX5A 1F51E 3M49A 1L7EA 1OGIA 1YBHA 2AJTA 4LMPA 2CFSA 4INOA 3HU2A 4CL0A 5AXDA 1O9BA 3LUDA 2IF2A 3ZHRA 4X71A 3U3MA 5ADUS 5ICMA 2EBFX 4LPSA 3LK6A 3F6CA 3PE3A 3NS7A 4UNQA 5K8LA 3K1AA 4COKA 4NZPA 1T4GA 4FHZA 1IWOA 2A0KA 4IRXA 5G3ZA 3ZWPA 2ZS8A 2PJRA 4IUBS 1NVVR 4IIXA 3GU3A 4UATA 4Q1CA 2VZ0A 2I8LA 2VBCA 3AFOA 2CJYA 2EFYA 5A06A 4U5XA 2C57A 4ZU6X 3P0EA 4NYJR 3I30X 3PVZA 3UMFA 3KHUA 4MQ6A 3QU9A 4NVRA 4R81A 1J0BA 4XCXA 1WSDA 1KI3A 3U7QB 3U4AA 2AE2A 2W98A 4BZQA 5BSVA 3KR0A 1V5FA 4LDAA 1P77A 3FETA 2AVDA 2O5RA 2Q6TA 3VZSA 1V48A 1MJFA 2WF7A 4L72A 3JZFA 3D7SA 4HGPA 4BGEA 3O7WA 3OPMA 4B7ZA 5FORA 2WAYA 4Z53A 2LCFA 1Z6YA 3PR2B 4DADA 3LC7O 1X7YB 2RKWA 3JAKA 4N01A 1IWBB 1PGJA 1XQ6A 1C5KA 1SG9A 2FEAA 2GEBA 3RSSA 2DZDA 4QO7A 5GPBA 3TTXA 4B2PA 4ENRA 4Z54A 1H8EA 3X2SA 4KUEA 2ZAOA 3CX3A 3I8OA 2PFSA 5GOTA 1BYIA 1RNLA 2XITA 2OHIA 4DLRA 4JP3A 3PENA 3AL3A 3CUTA 3P0JA 3TGPA 4JJ7A 1YCFA 2QUAA 3EN0A 1OILA 2PQ6A 4KLCA 5U4XA 2VQ3A 2WIKA 2ZKLA 4J0KA 2B4TO 4W7SA 5GZ1A 5ETJA 3H11B 4G2NA 2OHHA 1RBMA 1HQYE 3W2EA 3RYFA 1V1RB 4B3IA 1YQQA 1QH9A 2N0SA 4FZRA 2EIHA 2A94A 1KMIY 3PUKA 1OQAA 5H9VA 1ZC4A 2WUFA 1IN7A 5EMMA 5HF5A 4TTSA 5D01A 4EUNA 4ZYYA 1R00A 4E46A 2OG1A 1V3TA 1Z6PA 5FX2A 1OFUA 1DRJA 4YJ2A 1E20A 4UBLA 1Z4LA 3EVAA 4INAA 1NIPA 4RMHA 4X7MA 3FLEA 2VYND 3GUYA 1HURA 3IXQA 4XD2A 1NJ2A 1RTTA 1QU2A 2NYUA 1BS1A 4UBKA 3PF9A 2WDZA 2GZHA 3KKOA 4ROTA 3ICPA 2XWQA 3QV2A 4HLDA 5E9QA 1JJ7A 2C4NA 4TXHA 4IOKA 5CDGA 5JSHA 3B51X 3ZY2A 2DQZA 3GJTA 5G0SA 1JPJA 1VG1A 1NW6A 5IXYA 3TLMA 2C9OA 2LTAA 3NXKA 5BYJA 2RI6A 1VRVA 2OGWA 3OG9A 4HOYA 4CNQA 2L0XA 4R7ZA 1I3OA 2Q29A 2Y9PB 3RHFA 1WHTA 2HPVA 5LZ7A 4WY8A 5B1IA 2ZVDA 4Y3UA 5JUWA 3QKTA 3W7AA 1UWCA 2RFLA 4NV1A 4BFVA 1ZCBA 4IWNA 1JHYA 1EM6A 1SIBE 2A9RA 4CDGA 5JECA 1O0BA 1TQ4A 2C4WA 5J63A 1ORDA 4R0VA 5G3YA 4UU8A 4DBLC 1L3IA 1QKJA 4QTYA 1BA3A 2HDWA 3HKEB 4MA4A 4W5NA 1BWQA 2YDXA 3MD0A 4W82A 1E4VA 3GJ4A 3U7RA 1E0AA 2X0IA 4OA5A 1MB2A 2P6NA 4ZVPA 1YSCA 2PJUA 3H2HA 2DUUA 3A6EA 3O7MA 3Q7QA 4IEEA 2BCGY 4RD0A 4YRTA 1TM3E 5C8ZA 3L46A 4B0PA 4KKVA 3C7KA 2YICA 3O73A 2ZYDA 2F00A 5LZ8A 5ALPA 2O20A 2JFGA 1X80B 1Q6ZA 2WMDA 5EAIA 1LW6E 1YKFA 4DSNA 4V39A 6NULA 4FNOA 2C97A 3CEAA 1NP3A 4J2OA 5JZVA 2JIRA 5K01A 1N77A 4GP9A 2WKWA 4Q02A 4Y1EA 3G85A 2MSWA 3GDHA 4XVQA 1KRXA 2O50A 5B4UA 5IBCA 1L1EA 3I2JA 4ARAA 2Q27A 1BMFA 4QRIA 3WGVA 1DKUA 1A4IA 1KNQA 5K05A 1CR0A 3AGQA 2FKAA 1O5OA 2PIAA 1L8OA 5ALQA 5BQXA 4XIGS 3A4YA 2AS0A 4JU8A 1B3BA 4UCFA 2PS0A 2JFFA 3WE7A 1ONSA 3H65A 5IYZF 1NTRA 5EIAA 5F35A 3NTOA 3ZWDA 1T4BA 1UJNA 4TWIA 1UDAA 1XJ5A 5KNCD 2JIQA 1ZYUA 2QIPA 2WHEA 3OQPA 4W7IA 3U31A 5CXXA 3CLKA 4DCVA 2PSFA 2V3CC 1PV1A 2RAVA 4IKEA 3DA8A 2IYLD 1DJOA 2IEBA 3GXBA 4RADA 3HN2A 3P5BA 5F2KA 4E5YA 5BV7A 3MBIA 1ZGBA 3SGLA 1Z35A 1FDIA 2EJCA 1XZJA 4C21A 1NJ6A 3DLCA 1T1EA 2VP5A 2CFCA 3ZWOA 4CXMA 4GVLA 2VRWA 4QYWA 1GSOA 3UANA 1U7OA 3SYRA 1X9IA 1GRVA 3PNSA 1NQAO 4U2BA 1BKYA 5DU2A 2VUTA 1QRAA 3EGWA 4G1MB 4XM2A 4BO2A 3SVLA 1M8GA 4PO3X 1A5BB 4CIDA 1D03A 1U02A 5JDIA 3HBAA 4ARZA 3G0GA 1D2EA 2OCIA 3O3CA 3SQOA 5I01A 1M9NA 3EJ6A 1XJWA 2QRVA 1NXVA 3BE8A 3WNCA 2XNCA 3U61B 1DIBA 2HPAA 3JAKB 4MUHA 4ZXPA 3F0TA 1Z74A 3ABSB 1JPVA 1X7GA 3D6HA 4F9EA 3TF5A 4O25A 1DL5A 3MQ4A 3TQQA 3FZEA 3H6KA 4MLZA 1DJMA 1OSNA 4FGZA 4PHHA 3HDVA 4OAPA 2QTMA 4A0SA 2IPXA 3DOFA 3A31A 4FC6A 4LBVA 4B3RB 4LDQA 4G0UA 4CCYA 4DN6A 1NBEA 3CU5A 3HUDA 2MU1A 2ILTA 4PIMA 3S2GA 1ETHA 4ZI7B 2BVNA 1TX4B 5IZ4A 5IP5A 3K0AB 1IBLB 2ZULA 3OC0A 1H9BA 2JW5A 4ZPJA 4HX9A 1UWKA 4YRAA 4ZVRA 4C0LA 4CLRA 2QD2A 1OAAA 4PHCA 4M8SA 4RUKA 2QV0A 1V9LA 1DNPA 2D8AA 2XZTA 3JQRA 3E70C 3QVVA 4ZRMA 1WVMA 4HGYA 4ZJUA 2XECA 3MCZA 4KB5A 4G67A 1NAIA 3V5NA 4FHCA 5GJVC 3RVOA 2VXOA 2GBPA 4WH0A 2KBEA 2JD1A 2VNSA 4AZTA 1Q3KA 1NQWA 3P9SA 1VZ3A 2WHXA 3NT5A 4G5YA 1PD1A 5IWAB 1WZCA 1ZRSA 2XOEA 3TNDA 4D4LA 5FAKA 1H3NA 3PDWA 4D97A 3LVBA 2QRMA 5KSPA 2FMIA 5DVZA 1AH2A 3GG2A 4P4UA 4X94A 4EY6A 1HLFA 3AEQB 1I6LA 2O2HA 1WMAA 1J8FA 1G21A 3AIMA 4BV9A 4WLFA 3U16A 3W5BA 4R9RA 5K0ZA 3NEAA 3LGXA 1BNCA 1U3GA 2MHCA 3OZDA 4Q21A 2R9VA 2AW3A 4DUGD 4EI8A 4ZK2A 3RC3A 1DTSA 1KARA 1OLOA 2EW2A 2H08A 4UJ5A 3WK4A 1CQWA 1QP0A 2IS2A 2VSQA 1RCUA 1XZLA 2E4UA 1DC3A 3B7GA 1NLUA 1YIDA 4NABA 5ENDA 1O96A 5I3CA 4HGNA 3WADA 3VZBA 1I4TD 3E5HA 3HCOA 5EWMB 1ZIYA 2M9MA 2UZ0A 5JCJA 2GPTA 4JYAB 3TOSA 3G7UA 1XZCA 2RBEA 2FN9A 4JMLA 5G02A 4HMOA 2CLDX 2GFIA 1DEOA 5LDGA 3UAYA 5G1PA 4Z86A 2H9IA 3PYXA 1QYIA 1F38A 2ZVJA 5DBIA 1RYEA 5BN5A 4RIIA 1HE3A 1ULSA 4KR0A 4R9UC 3RS9A 1C1DA 3BQ9A 3MYRA 2VNAA 4L5JA 5DM2A 5JQGB 3I3OA 3E8MA 1LRKA 3LM8A 3HU3A