4TLAA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
233
structure length
216
Chain Sequence
b'QAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTTGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEDLSALIERINYAIQKYRARRVSIDSASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kinase KaiC
molecule tags Transferase
source organism Synechococcus elongatus pcc 7942
publication title Circadian rhythms. Atomic-scale origins of slowness in the cyanobacterial circadian clock.
pubmed doi rcsb
total genus 78
structure length 216
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tlaA00
2VSOA 3Q72A 4EPRA 3THXA 5FPTA 3FKSD 3ZQ6A 1A4RA 4EPVA 4TT3D 3I62A 2GJ9A 3F5FA 2IYTA 2XB2A 4LJAA 2FG5A 4RSGA 4YMTA 4QHSA 4F91B 3UWOA 2FFAA 1P5ZB 4XD7A 2ZRMA 4G0NA 3U6KA 3SQXA 5K8IA 4I1SA 3T12A 3KL4A 5EZ6B 4V03A 5HR5A 3ZVMA 4NCKA 4Z54A 4LJ7A 1BIFA 2IWRA 2QGNA 2ZYUX 4OHWA 4H1UA 3QBVA 1RYFA 4LCBA 3AUYA 4KLNA 2A5YB 1W44A 3RRMA 2ZJ5A 1KI6B 4KVGA 5C2JB 1EESA 4I1UA 3P27A 4MGKR 2CNWD 1T91A 4A82A 3CRVA 2YC4C 2V55B 3LD9A 2WAXA 4LBVA 1LTQA 3J81k 1E1RD 2ASEA 4Q00A 3AKCA 3RS2A 3W8NA 5CB6A 2OHFA 4LJ4A 5LB2A 1OXVA 4P4SA 5KNCA 1SVKA 1NP6A 4IHQA 2E1RA 3SZRA 3VQTA 3IEUA 1RIFA 1KSHA 4NP6A 4TQUS 1EX7A 1KIMA 2XAUA 3BC1A 4LV8B 2ZPTX 3B78A 2JJ1A 2G9NA 2GK6A 4DRZA 2XZLA 1QVRA 1EFRA 3BFKA 2OUKA 2Z83A 1CTQA 1SVMA 3IGFA 4YDSA 5TVKA 4DWJA 4WZAE 4M9XA 3GPLA 3B1VA 1P4SA 3RWMB 5L8VA 3F3YA 2RMKA 2TMKA 4QJ5A 1UADA 2QM7A 1KJZA 4IOLA 3PEVA 2RHDA 1E1RA 2N1BA 1A82A 5JS8A 3TSWA 2GESA 2FGKA 1U90A 4TWZA 2AKYA 4HAYA 5EE1A 3ZVRA 1DAEA 3M6AA 4IW3B 4QJ4A 2VHJA 1L2TA 4W5WA 5B64A 4PHHA 3U44B 2DFNA 4R2IA 4GOJA 3QOFA 3VX3A 5C18A 3CRW1 3Q85A 4M53A 1ZINA 2F1JA 1OFTA 1DG3A 2JCSA 5DYGA 1CRPA 1QHHA 221PA 1S4QA 4PPGA 1N0WA 4S35A 1YR9A 4QNRA 5FUYA 1RRFA 3LH5A 4KLZA 4JJKA 4W5HA 3HDTA 1A2BA 1T9HA 2CK3A 3VHLB 4LRWA 3EPLA 5FBQB 2RGBA 1EFUA 1LV7A 1NLZA 1U8AA 2NZJA 4A1FA 3BH0A 1KHTA 2GNOA 2ORWA 2PEYA 2V7QA 2XNSA 3LRPA 2ZU0C 4YMSA 1UBCA 1OT3A 1FQKA 1PZNA 4JLVA 4LOAA 3IQXA 3I5YA 2VP0A 2ZRFA 1E2DA 2PL3A 4A6PA 1X8KA 3ND8A 4CW7A 1G3QA 2HUPA 1PVOA 1MRNA 1S1CA 4P0TA 5FUVA 2VHQA 3DKVA 1P75A 1OJLA 3ND9A 3LLUA 2DFTA 4TQ9A 1NN0A 1Q12A 2EWVA 2OESA 2ZRIA 2ZVPX 4MGZR 3S1AA 1GZSA 1L7VC 3UWKA 4IEEA 1HY3A 4M9QA 1IJFA 2ORVA 1B23P 1XNJA 5DO9A 1YHNA 4KFUA 4LHZA 4WIAA 3SR0A 1RVDA 2OLJA 3AUXA 3THOA 121PA 1YRBA 2H17A 1G9XA 1OIWA 2IYSA 1FX0A 4B33A 4R7ZA 2JGNA 1SXJB 2BWJA 3QXCA 4LHWA 4O3MA 4HUQB 3SJZA 1U8ZA 3GJ4A 1BMFA 3K8YA 1DOAA 4DVGA 2IYLD 5FBWB 3Q7PA 1JR6A 3U6BA 2YINC 1Z6TA 1CR2A 1ZU5A 2ZS9A 3DOFA 3FHTA 5H8WA 1XD8A 4Q7JB 2BDTA 3NKVA 3SBEA 3ZD6A 1RE0A 2PZGA 3ZZ0A 3PEWA 1JPJA 1IN8A 1FQJA 1KGDA 4GOXA 4C0LA 1M7HA 1FPMA 5P21A 4GFDA 2AFHE 2IXGA 4B3CA 1L4UA 2GBLA 4C0BA 1K5GA 1XPOA 1NBME 1U0JA 1G19A 4H1VA 1E9RA 5KDOA 3A6PC 4EQ6B 2PLFA 5EQTA 1F48A 1OW3B 4QM7A 1GWNA 1LS6A 3LNCA 1W0KD 1KNXA 2VP6A 1E94E 2HXSA 4Q9JA 1Z5ZA 3P20A 2IEYA 4BUJA 3GLFB 1KI3A 1BS1A 1P6XA 1XCMA 2QAGC 2CXXA 1A5TA 1XTQA 4MGIR 4XH9B 2CNWA 2BEJA 4OQXA 3U4QB 1CR0A 1KJYA 2QZ4A 2ZRDA 4R71A 2FDCA 1UBFA 1BYIA 3QG1A 1SXJE 4DCVA 4M4SA 2X19A 4Q1EA 1W36B 2F3RA 3CX7A 4G5QA 4OI4A 4A15A 1GRNA 5IK2D 1E9CA 3DMNA 1T5LA 1KI2A 3DZDA 4B75A 1KO7A 1VYTA 4C9BA 4FWIB 1OHHA 5B30A 1PUJA 1QZXA 1KO1A 1II0A 4MRPA 5FTKA 4MDFA 1TMKA 4KJZA 1P72A 4L8GA 3CR8A 1E99A 1EK0A 4LDJA 1XF9A 3NDPA 3T1QA 1OH8A 2CCGA 1DPFA 3EA0A 3C5CA 3U3OA 3AEZA 2H18A 4F93B 1CKEA 1E69A 2B6HA 3CPEA 4NPHA 4C0AC 4O0MA 4U00A 4IJMA 1SQ5A 2W0SA 2G3YA 1E0SA 1W4AA 2RKOA 4D4KA 1YQTA 5KDDA 3KKMA 2OCYC 4ZO4A 3QPUA 4ON9A 4PAMA 3MJHA 1L4YA 2V1XA 1W36D 3A37A 4DCTA 2QORA 3BWDD 1E2FA 2QY9A 2ZAMA 3AVQA 4KODA 1EFCA 4NKRA 2MSDB 5KPJA 4A0RA 3CO5A 1U94A 2IUUA 1G6HA 4NMMA 2QROA 1G6OA 3QEOA 5E4FA 2HF8A 2Z5FA 1GVNB 3DHWC 1YRAA 2WIAA 4HEJA 3K0FA 1SVOA 5DGXA 1V5WA 2CL7X 2ZI5A 4NE2A 2DWPA 2J0VA 4L9SA 5HE8A 3U3MA 4DDUA 2QBYA 1ZRHA 1UBEA 4POAA 2IS4A 1G8PA 5HCIA 1EX6A 1OKKA 1Z6GA 1NNEA 2J5XA 1KY2A 2OSBA 1GFIA 1YZNA 2GCPA 2HXYA 3UMRA 4WAUA 1E2GA 3QXJA 3V00A 2ERYA 1ZNYA 3UPUA 1R0YA 2ODEA 1I2MA 3RRZA 2O8DA 4MGYR 3FFBA 3U7GA 5EUMA 1G17A 3BE4A 1C9KA 4LV6A 4Q1CA 5FOVA 3NBYC 3LVRE 3WNBA 3O8DA 2V4ZA 5BQ5A 2ZS7A 3RHFA 4WXPA 2AWNA 3P4XA 4AURA 2CCKA 1NG1A 3GFTA 5ELXA 3TVDA 1ANKA 1XTKA 1ZYUA 1UPTA 3I5XA 2WWHA 1HA3A 2ZREA 1G18A 4LHYA 3PG5A 3CPJB 1XZPA 3EG5A 5C4MA 4ZI3A 1W7AA 2ZE7A 1ZM2A 3CF2A 2OBLA 1JXMA 2P65A 5KOYA 4C2TA 2GEUA 2O0JA 1Z0JA 4DSTA 5AJVB 2FPMA 1P60A 3K0CA 2A5FA 5H70A 3NC1C 4B73A 2VF7A 2R6GA 4BFWA 4Q1AA 2XJ4A 2ZTSA 1MO5A 2J46A 1ZW6A 3A4MA 1UKZA 3A8TA 4GMDA 4EJSC 4DXAA 3TKLA 1IHUA 2C9YA 2G1KA 4D6PA 5DLQC 1KKLA 4DEYA 2AHOA 3RABA 2MSCB 5FBVB 2F6RA 2GXUA 2AK2A 5JECA 3H2YA 1JB1A 3CRMA 1S2MA 1G7CA 2RH5A 4P32A 4BEJA 4KFTA 3IIKA 1M34E 4GNKA 3LQQA 1Z63A 1RZ3A 3WP1B 4N3NA 4XOIA 3A1VA 3BB1A 1M7BA 2YOFA 1N6IA 3QKSA 4DIEA 2WWFA 2REXB 4MRVA 1CJKC 3RS0A 5KDLA 3GJ3A 3KKPA 3GEHA 3PUVA 1U9IC 5E7MA 3I1FA 3RLFA 3PUWA 4QL3A 4B3FX 1X6VA 2QQ0A 4DBLC 3IEVA 4KXFB 1G7SA 5JJKA 4KU4A 3KXLA 1GILA 4IDHA 1R4AA 1J2JA 1RFLA 3A1TA 4TZ0A 1GKIA 1R2QA 1MRSA 2IHBA 3FMOB 4OQFA 4O25A 1N6LA 1D2EA 2O5VA 1G4AE 3ZYCA 3DMDA 4HUQA 1WF3A 3T61A 2W6ID 1OXXK 3MD0A 4IOKA 1W47A 4QNMA 2RGNA 3DM9B 2RGEA 5EE0A 2GZDA 2IC5A 4I1VA 4V0LA 4V0MA 1IXSB 3GLIE 4JLKA 4PZZA 2QU8A 5EP3A 4TYYA 5SZJA 1KI8A 3GLGB 2EFDB 1P73A 1OKKD 4HDQB 2JLUA 5J4VA 3ONWA 2QT1A 1V43A 3MUFA 2VYFA 3GD7A 4OHXA 2REBA 3IPXA 2O52A 2QM8A 1DAMA 1F6BA 1WB9A 3BIFA 3AV0B 3LVQE 3QQ5A 3VKGA 1U81A 3U3KA 3FWYA 3MSXA 2I4IA 1SVIA 1TPZA 3MCAA 4IDQA 1XRJA 2YZ2A 1D6JA 1XB2A 1COWD 2BMJA 3K0CC 5TMPA 2JIZD 4PANA 1YZTA 4G1UC 3EZ9A 2W00A 4MKHA 2ZRNA 2IX3A 2GCOA 4LJ8A 3HYRA 1JQLB 3MWKA 3N2EA 4IVQA 3W90A 4OJQA 2P6UA 4TL7A 4LUCA 3X1XA 5KSYA 2G0TA 5J4KA 2QNRA 1Q1BA 3IHWA 4HAVA 1E1QA 1HV8A 1RJ9B 2HLDD 4P3YA 3REFA 4B6FA 2BBTA 1G20E 2FX3A 3Q8XB 2JJ2D 5K8LA 4AKIA 1NVWQ 2BKUA 3ICQB 5J4YA 2H57A 1LS1A 2BMDA 3EZ2A 4BQSA 4BZXA 2ZM5A 2P3SA 2XZOA 4NCHA 4II7A 4C4PA 1NG9A 3QIAA 1SKQA 1XTSA 2GCOB 2IYXA 4W5JA 5EE9A 4AKEA 1ONBA 2WZQA 4C2UA 4FCVA 1OHHD 1N0VC 2BMEA 4X8OA 2JLRA 1XFAA 1F2UB 1Z47A 3MJRA 2F7SA 5DSZA 4QGHA 3TQCA 3QF7A 4QGGA 5JHGB 3K0EA 2IYWA 4A0HA 1TEXA 2QN6A 3FPAA 4B3DA 5F9HA 1J8MF 4ESVA 2H92A 3AF4A 2ERXA 2IW3A 4C30A 3C16C 4TZ6A 2DFKB 4N1AA 5CLQA 1KO4A 3JVVA 2PX0A 4GZLA 3AP2A 1FMLA 1YZLA 1Z0DA 2JJ8A 1TNDA 4JVSB 2WTUA 1Z0AA 1O3YA 4C0KA 3U60B 3QSYA 2IYVA 5CYOA 1XJQA 4Q4LA 3TBKA 2DCUA 2OM2A 3UG7A 3Q3JB 2HLDA 4RY2A 4PPNA 4IFBA 1G8YA 4MRSA 1Z28A 4TMXA 3P4YA 1RKBA 1N0UA 1Q1ZA 4FIDA 2QBYB 1YVDA 4CT5A 2GZHA 2QAGA 4E03A 2WJJA 1JR3D 3K9LA 3QI2A 4V0NA 4TYWA 1VG8A 2Q3FA 3W5IA 4CDGA 1LNZA 4AKGA 4FWTA 2CHGA 1E9EA 5H68A 3TW4A 3WYAA 5JEEA 4FINA 4DLYA 2QPTA 5E7IA 2IF2A 1XTIA 3M0EA 4LYAA 4FMCB 1M2OB 3PCRB 5EE5B 4JL8A 3RDPA 1W36C 3VNUA 1HURA 3TNFA 2FEOA 4A0GA 4AIIA 1NN3A 1X86B 2WOJA 2XSZD 1N6KA 1CEEA 4URZR 2D2FA 4I1OA 4DZZA 1JEDA 2BBWA 3IUYA 1CR1A 1PJRA 4R2HA 1N5LA 5B2ZA 4LI0A 5SZHB 1ZJ6A 1OXTA 4Q7LA 4XWKA 1P62B 3EIQA 3PUYA 3UIEA 1QDEA 1SVWA 3NTUA 1E4VA 1OF1A 2QT0A 4PZYA 3PJRA 1E2JA 2OT3B 1E2QA 2A2ZA 3LBNA 1A1VA 2OV2A 2GAAA 3R8FA 4LV5B 4M1KA 1W0JD 4HLDA 1U0HC 1GSIA 4RD6A 4ASUA 4LX0A 4ZDJA 3MFYA 1QG4A 4RKEA 4MKGA 4Q9HA 5JSZA 1KSGA 2PZFA 5CITA 3EW9A 3PQCA 1G8FA 3NHBA 2RAPA 5DHAA 4FMCF 2OG2A 5JJIA 1W46A 1US8A 4G3XA 4B47A 3CW2A 1A2KC 4DSUA 3P1JA 2VHUA 2F1HA 3X2SA 1ESMA 1W4RA 3RWOA 2EYUA 2NO0A 3FMPB 4ERNA 2FNAA 4D0NA 1IY0A 4D81A 1VCIA 3W6PA 4TSFD 1XJ0A 1XWIA 4GPTA 5EP2A 1BMFD 2CMKA 1P2VA 3MRSA 1Q21A 3NEYA 3DVLA 1M7GA 2ZEJA 5BYJA 4LPKA 1Z0FA 3ECCA 3B9QA 5TDHA 2JDIA 4DCUA 1ZAKA 2ATXA 1R7RA 3GJ0A 3L0PA 2RGCA 4DLWA 3CH5A 1Z8FA 2Z43A 1OLOA 3U61B 3ZVLA 4A92A 1XPRA 5KSPA 4KYUA 4OI1A 3HWSA 2Q3HA 2A30A 4UNSA 1W2GA 3DDCA 1OIVA 3FE2A 3VMFA 2HF9A 2VTKA 1KAGA 4IFEA 2CLCX 3RYTC 4EFMA 2X2EA 3K09A 5JHHB 2RGDA 2KJQA 1CJUC 4X8MA 3BORA 3QVUA 3PFIA 1G1MA 2WPDA 4LBYA 1SHKA 1CIPA 3GP8A 3VR6A 3BAFA 2OLKA 1NVUQ 4OK3A 3L8ZA 1KI4A 3TRFA 4CEIA 1ZD9A 4CYMA 1AN0A 2JJ1D 2D3WA 4BLPA 1VPLA 2HEIA 4PC7A 5TXGA 3U5ZB 1XEXA 2WJHA 2XB4A 1U99A 2IYQA 5GVSA 2IF0A 1MT0A 1TF2A 2R65A 2FPLA 2VSFA 1GNPA 5J4HA 2P5TB 2WICA 2W6JA 4OI2A 3Q9LA 2HT6A 2GXSA 2C9OA 5DISB 3PUXA 1VHLA 2Q21A 5EP4A 5FPHA 5L3RA 3A36A 1T0JB 4JLNA 2NPFA 1FNNA 2QMHA 1E96A 1MO3A 1NI3A 3GCGA 1NVXQ 4UXJA 4GMXA 4E09A 1ZU4A 2UZIR 1UFQA 3FB4A 3VR2A 4OHYA 1IQPA 4Z1MD 1XEFA 3NC0C 3OE7D 1DARA 1N25A 2EQBA 4NHOA 1CLUA 1E98A 3TH5A 1S3SA 2O8CA 2EFCB 1NKSA 4ZCLA 2OXCA 2H1LA 2QTFA 4ZDKA 1DS6A 3ZS8A 2WWWA 4LC0A 1Z08A 4MKIA 5G53C 3AGPA 4AI6A 2C8VA 1VCNA 2UKDA 3H86A 1GTVA 1VG0B 1Y3AA 1OH5A 3M4YA 3I4LA 1T3SA 1BKDR 1UJ2A 4CEHA 3B6EA 1Z3IX 2J0UB 4NONA 3TK1A 1MO6A 2ZANA 3W5JA 4QFMA 2PLRA 4L5BA 1GL7A 1EFRD 2FOLA 3MAAC 1XD9A 4TT3A 3CNNA 1K8RA 2VH5R 3QNUA 5HPYB 3RS4A 5E3HA 2C77A 5FTJA 5HTKA 3LX8A 1KDTA 1YE8A 2ZRGA 3EA5A 3IQWA 4GSYA 5FBLB 3CH4B 3QPVA 1XX6A 1MO4A 2A5JA 3IO5A 4TN1A 3HYTA 3K09C 3REGA 1KKMA 5CM8B 1DO2A 3H1TA 3UMSA 2R6AA 4JBXA 2JASA 3KTAA 4FMDB 5E95A 2HCJB 3AP3A 3B60A 4A8JA 2QEQA 3GJ6A 4HB0A 2X77A 1JJVA 2ZE8A 4KSCA 4A4DA 2F55A 1DO0A 4IEIA 1WBBA 4HB2A 3E5HA 2ZJOA 3QUSA 4YXWA 3WNDA 2AFIE 3ADKA 1OB5A 1SVSA 3KQNA 3R20A 4RD2A 4RZUA 5EUQB 3ZVNA 3PENA 1ZCBA 2WJVA 2XX3A 3OIWA 4HLQB 4L15A 4OQMA 4AK9A 1N3BA 1R0ZA 2L0XA 2XOKA 3A1WA 1S96A 2VF8A 3OIVA 2PMKA 5JWHA 5BN3A 3HPRA 1SHZA 1GL9B 5CLLA 4LY6A 2KE5A 3K9NA 4L16A 2YYZA 3KX2A 4UXHA 5CJ2A 3B9PA 1XCPA 1WBDA 1KMHB 3W6NA 4Q21A 2ZI7A 4RJLA 4IOMA 4GP7A 2J59A 2B7CA 4Q66C 2JLZA 4TLCA 2REOA 3TUZC 4LJ6A 2IS6A 3RSLA 3SU8A 1IXRC 1OV4A 4C0QC 2G0NA 1S8FA 1W5TA 1ZM4A 4ASUD 5FOUA 1AIPA 4BFXA 4IDOA 1PLLA 1BH2A 4HAWA 4N0DA 4PPQA 5CK5A 4Q4HB 4YDHB 3EIEA 4BLTA 4Q4JB 2WJIA 1ZP6A 5FL7A 2B8TA 2FZLA 1KMHA 4X8HA 3LXRA 3C14C 1IN6A 1II8A 3THYA 4TLEA 4US1R 3ZIAD 2ZI6A 1E79D 4LBZA 2R6CA 4PR0A 1C1YA 1COWA 4U7DA 4LGMA 4MYTA 2RB4A 2WAYA 3TE6A 5FH9A 2YC2C 4CEHB 2XNDA 2QMUA 5DHFA 4NBSA 1TL7C 4NYIR 3OEHD 4BE7B 5CK4A 4F38A 3VR1A 3K0FB 2RGGA 2BV3A 1I4DD 1KO5A 3TUJC 3L82B 4HB3A 4M2LA 3SC3A 1II9A 4JLMA 5FUXA 4Q19A 2Z0MA 1CJVC 4Q1FA 3AVTA 2H7VA 1NY6A 1Q20A 1ZVQA 3WHLA 5JMTA 1HT2E 1PLJA 1X3SA 3SE0A 3P32A 4MKFA 4C3ZA 4ZDIA 4IDPA 1QHNA 2YOGA 3EWAA 4G01B 1DG1G 1FUKA 1XP8A 3L2OB 3LQRA 1KI9A 2GF0A 4R98A 3EC1A 1KDPA 5CDFE 4JT4A 4QBFA 2GJKA 4PPFA 1GAJA 1WDTA 2NIPA 4JLDA 5BYKA 3I73A 1E1QD 1PLKA 5AUPB 2O8FA 4Q7KA 1SVLA 2X2FA 4OQNA 1IJEA 2FU5C 1DADA 4BECA 3N2IA 4EJSB 3E2IA 3LLMA 1GP2A 2XGJA 4URWR 3VR5A 1SGWA 4TYNA 1JBKA 4NH0A 4ZPXA 3QF4B 2DY1A 4ACBA 1FTSA 2J0QA 4OKSA 4Q03A 3CZQA 1I4TD 2BM0A 2QP3A 2QAJA 3CLVA 2A7QA 4A36A 3QY0A 1VCMA 1G21E 5FOTA 3VHXA 8OHMA 4D0GA 4MA4A 2WSMA 2XSZA 5L3SA 1J99A 1G7TA 3GLHA 4QM6A 5SZIA 2IYRA 1H8EA 2IK8A 4WOPA 4EAQA 5B58C 3X1DA 3B1XA 3VR4A 1S9DA 1OE0A 5JI2E 4M8NE 1Z6XA 3GJ5A 3ZZTA 4KO8A 1VHTA 1Z0IA 2CE2X 4HAXA 3ZD7A 2ZIAA 1XTJA 4P4UA 2ZI4A 3ADCA 2Q9CA 4MRNA 4HATA 2VQSA 4YONB 4AYXA 1E3MA 4OQLA 4C0SA 2EW1A 1DTSA 1CU1A 4FCWA 2MSEB 4NYJQ 4OHVA 4JIMA 4B44A 2PMDA 3GJ7A 3SYNA 3VKWA 1ZNWA 2O8BB 5KPDA 3WBJA 5JRZA 5JI3E 4UNRA 4I81A 3BB4A 2XTZA 3QE0A 1JJ7A 3OFND 5CDFA 3RNLA 5K8TA 5C1BA 3BS4A 3VNVA 4RFSA 4B2IA 4JYCA 3TQFA 2J87A 3HU3A 4A0FA 4PC6A 1I4LD 4HZIA 3D31A 4S2EA 3SJAA 3AGQA 2GILA 1UEJA 3KKQA 2FE4A 3V4FA 3KKNA 4UXIA 5EP1A 4LWZA 4K81B 3VR3A 3X1ZA 3G0HA 5AK0A 4BRUA 4M1WA 1U2RA 1GUAA 4AYWA 5CYPA 1T5IA 1LFDB 1IY2A 5EZ5A 4EPTA 3CF6R 2FFBA 1F60A 4Q02A 4LJ5A 2NTYC 2R8RA 2XXAB 4RCZA 1AM4D 4ILEA 5EXPA 5CIQA 4D26A 1KOFA 4DLSA 4KHZA 3U7EB 2YNMA 2PX3A 5F2EA 1DEKA 4EJSA 2JLQA 5KNBA 4URVR 4JLPA 3I8XA 5SZKB 1WQ1R 1G3IA 3K9GA 1Z0KA 4PQFA 4LYJA 1TTTA 1P9NA 3QXSA 4QGAA 5CB8A 1U0LA 5L3VA 2FA9A 1N5IA 1TQ2A 4RKFA 3EPJA 3AVUA 5JCZA 2Q9AA 2PH1A 1AA9A 5JS7A 3IPYA 4C0JA 4MH0R 2NO9A 1E9DA 5C46F 4NL4H 1SKYE 4NYJR 2ZR9A 1DE0A 5JFGA 4XWAA 4Y0VA 3RSOA 2RGXA 1WP9A 5JJLA 5IT5A 4BLOA 3K70C 4NCNA 3RAPR 4EPWA 1WMSA 1NRJB 4QBIA 1VCOA 2ZSDA 4BFZA 4D4MA 2PJRA 1E2MA 2G6BA 2FZ4A 1TX4B 3ZQJA 2CBZA 3KXIA 1DAKA 1OFIA 3WXMA 4D2IA 3GLIB 2D62A 1QHXA 2C9CA 3C5HA 1H8ED 4DCSA 2QP4A 4G5GA 1J70A 4PQRA 2JLYA 1TUEA 2YWGA 1KNQA 2NZ8A 1T4GA 3G82C 1F2TB 2R9VA 2OE2A 3OE7A 4TTQA 3KFVA 4JMPA 1EXMA 3B1ZA 4B3BA 5G3ZA 2MMGA 3QPWA 5F3WB 4D25A 4HLUA 2C95A 2ZUBA 3C8UA 1KI6A 2GJAA 3JZAA 4RVCA 1FP7A 3O8CA 3QKSB 5AJXA 3RC3A 1FW6A 3FMFA 2C96A 4D80A 3X1YA 3ZGXA 2KB0A 4ACAA 2DWOA 5KSZA 2OFOA 2Z4SA 3LW8A 5DI3A 1Z06A 4URYR 2QRZA 3A1UA 2ZS8A 4GI7A 3HP1A 3F0TA 3GFPA 1N6OA 4JLOA 2V54A 5FL3A 4LPSA 4BWYA 1IM2A 4DSOA 2BM1A 2GKSA 2UZ3A 3TAUA 4FCTA 3WY9A 3EXAA 3Q5EA 2ZRLA 2IHYA 2QRNA 4Q18A 1P7CA 4IXMA 4JS0A 4JL5A 1IBRA 2ATVA 2BCJQ 2ZRKA 4B35A 4D82A 2AXPA 4US2R 4O2LA 3K70D 2QPOA 3DO6A 5FTMA 3CM0A 4M1MA 4RFVA 4HDCA 4F4CA 1EFTA 4JVMA 3B7GA 3DEFA 2E87A 3I72A 3KB2A 3HU2A 4M0LA 2C5LA 4JLBA 4TTRA 2A9KA 1MABA 2KWIA 2EVWX 4KFRA 3WNCA 4KI0A 4YXWD 2PEZA 3C7KA 1DELA 4OJKA 1EWRA 4QC2A 1G16A 2ZJZA 4K8OA 2VL7A 1HE1C 2ZQ5A 5TY0A 1LW7A 5DN6D 2BJWA 2SHKA 2XITA 3GEEA 4M1SA 1VYVA 2AN9A 1D5CA 2NOAA 3VU9B 3BOSA 4LZZA 3JVUA 3BXZA 1M74A 1P2TA 3TMKA 4BRWA 1G5PA 2OEPA 3VTKA 2FFHA 3TUIC 1SXJC 4L4UA 3WYGA 2XXAA 1Z6YA 5FTLA 2Y8EA 1Q3HA 1AGPA 5EXTA 5AUQA 3QJYA 2BCGY 4ARZB 2JATA 1G5RA 4DHEA 1J90A 2WMNB 2CLDX 5IF9A 2FSHA 3TVTA 3MMPA 4KBGA 3THWB 2ZSFA 1L8QA 1JALA 1XXHB 5CIWA 3AP1A 4HLUC 1ZM9A 3VU9A 1CBUA 3TGPA 3AVXA 2PT5A 2GHIA 4BPBA 2ZI9A 4LJYA 4M1TA 2CCJA 3KJEA 3PVSA 4M1YA 4Q5IA 1XMVA 3L0IB 2F9LA 3T5GA 1UDXA 4RZ2A 1LB1B 4A2PA 4XTRA 2ODWA 1TADA 2HDNB 2QMOA 2Z4RA 1KI7A 2XOKD 2J7KA 1KK2A 3R9XA 1E2LA 1OYWA 2V1UA 3CZPA 2JEOA 3IBGA 2G88A 3OEHA 4EPYA 2IXEA 2NG1A 2XNDD 3KTAB 3VAAA 4ESHA 5DNYB 2ECKA 4PO8A 2QI9C 3QF4A 2FF7A 3I8SA 4OHZA 1P2SA 2H5EA 4GL2A 3TR0A 2GXQA 2H16A 4Z8YA 2ZJBA 5AJZA 2QMEA 3SBDA 4D4LA 1T6NA 3GLIA 1BYUA 4ZKDA 3SYKA 4PC2A 5AJWA 1KI1A 2FSIA 1S9HA 4DKXA 2ZE5A 5HE9A 1W4BA 1JAIA 1NSFA 4M9SA 4PX9A 2X8AA 2J45A 1C4OA 2W2TA 4RD4A 2VA8A 4P31A 4B43A 1XBTA 2J9RA 1OYYA 1AJEA 2OZEA 3KJIA 5FR2A 4O2RA 3SEAA 4HZUB 5JWOA 1EWQA 1S0UA 5JBQA 1CRQA 1JNYA 2MMCA 3DZ8A 2YHSA 5DI9A 4Q48A 2IWHA 2VP4A 4TLBA 4B48A 3LFUA 3CNLA 2ZVQX 2BEKA 2JA1A 3ADBA 2QENA 3IIJA 3TSOA 3SJCA 1CJTC 4DEXA 3RC8A 4V0KA 1CF4A 3EIHA 4Q4HA 5TB5A 5GJCA 4H9GA 2IYZA 4EQ6A 1KYIA 2D06A 2E9SA 4WZ6A 2VO1A 3PV0A 4Z1MA 2V9PA 1K5DA 3W8RA 1GG2A 3AVWA 2BC9A 4TMZA 4LC1A 3HPQA 1E0JA 1NMZA 1E9BA 621PA 1IAQA 2ZUDA 2F3TA 5AWFC 1E0AA 2R44A 3BB3A 3U3RA 3BH7A 1E0KA 3NDBB 1YR7A 3LY5A 4JZKA 2CL6X 4A8JC 2VSXA 3AF2A 5DH9A 5A0FA 3SFZA 4P4SB 3GLGE 2HT1A 3MWJA 1TU4A 4Z51A 3ZZUA 2WOOA 2AX4A 3KQHA 2CLSA 4US0R 1XMIA 4XD7D 4NU0A 5GADl 2WKRA 4RD0A 2R6FA 2Q0HA 3K0SA 1P3JA 3QBTA 4DT1A 3UXMA 2NO6A 3QKRB 2BVNA 3GQBA 1GDDA 4RZ3A 1NVVR 1E2EA 1ZUIA 4FMBB 3ZJYA 4BZQA 4NCJA 4LHVA 4GRAA 4LYHA 1X1SA 2VP5A 1AQYA 2GJSA 4CGZA 1KK3A 3OIUA 1VYUA 2A3RA 5CM9C 1CXZA 4ZCMA 3ZS9A 2EFHB 4HSEA 5F98A 5JZVA 2GEDA 3LBIA 3U7HB 4PHGA 4WW0A 4ZV4A 3L0SA 3U44A 1YZQA 1ZIPA 2OAP1 1W48A 2ZUCA 4FI3C 4B71A 3THWA 1S1MA 1ZD8A 2ZYWX 3D6TB 1G64A 2JDID 2ZRCA 2QSZA 2NGRA 5AR1A 1Q3TA 1Z83A 1KSFX 2VRWA 5E7JA 3IIMA 2V8OA 2WWXA 1NJGA 1FUUA 4A2QA 1N6NA 1D8TA 4HDOB 3EZ6A 3KXKA 2WWYA 5G3YA 1B0UA 2A78A 5AUNB 3R9IA 1AZSC 2AWOA 3AKYA 1MOZA 4MITA 3SI7A 3UANA 1RRCA 3TW8B 2IBMA 3BFVA 1X1RA 1YR6A 1NVVQ 3U7FB 2ZSBA 2WMOB 3GJXC 4XSGA 1M1YE 1ZIOA 2P67A 4Y0AA 2R2AA 4UJ5A 1N5KA 2RCNA 4RZXA 3WP0A 3U4QA 2HYDA 1DAHA 2W6IA 2O8EB 1CS4C 5GJWC 2CL0X 2VP2A 1ZC3A 2FGJA 1E9FA 1JR3A 2C78A 5TARA 1A7JA 1UKEA 3FHOA 3FKSA 4KAXA 4CZ2A 4BFSA 3CX8A 2WKPA 5M04A 4B3XA 4QOSA 5HCNA 2ZR0A 3SDZA 2J7PA 4TL9A 5GJBA 4DDVA 1JAHA 1P9RA 2W83A 2ZRPA 1LF0A 4KBFA 4DJTA 1XEWX 4OK6A 1U9IA 1XEXB 1JECA 3S1AB 4I99A 2DR3A 2FJUA 5H1YA 3KQUA 5J47A 1E9SA 1UDWA 4E5UA 5KYKA 4W9MC 3R9WA 1Z07A 1FTNA 3FKQA 1II8B 3THYB 2VHTA 2A5GA 1R5NA 4PTLA 3WBKA 3LAWA 2O8FB 2O0HA 1F5NA 3BFXA 1SXJA 4HLCA 4PQYA 2FV8A 4DLVA 1TEVA 3EZ7A 1RW4A 5FPSA 1Z29A 3QXHA 4IXNA 5FUWA 1MR3F 1QVAA 2O8DB 4PZLA 3D8BA 3C15C 4EFNA 3TLXA 4NYMQ 3OF5A 2BJVA 2WWGA 2GVDC 3VFDA 3DKPA 4EUNA 3WYFA 3T1OA 4OL0A 4XWOA 1E79A 3G5UA 3EARA 2I3BA 3HU1A 3MGCA 1FFHA 1NF3A 1NIPA 1KK1A 1YZKA 3OIYA 4EDHA 3THXB 2PCLA 4DT1B 3R8CA 2LKDA 4FXPA 4YC7A 4KSBA 5FL7D 3KQKA 3ICEA 2CHQA 4TYPA 3SN6A 3FHCB 3CWZA 4PXAA 2DB3A 1T8TA 2EWWA 3ETLA 1CJMA 3EZFA 4Z8XA 4F7WA 4Q47A 4V02A 4A6XA 1HQYE 1H8HD 4GZMA 3VX4A 2F9MA 4GT1A 2BMFA 4XIGS 2N46A 2PBRA 4HB4A 3WRXC 2F1IA 2QUZA 2JIZA 1VTKA 2J41A 2OO7A 2Z6VA 1BOFA 3QKRA 3E1SA 2XJ9A 4IVPA 2BBSA 1F2UA 1GKYA 1Q0UA 2AK3A 4JSYA 4XSHA 1OSNA 5BXQC 4TMTA 2IYYA 2AD5A 1G7RA 1DBSA 1NSTA 2QG6A 1YZUA 4BFUA 4ZDWA 2DPXA 1ZM7A 4U5XA 1NLYA 5L3QA 1R0XA 4JJZA 4AG6A 4YMUA 3AKEA 1IY1A 1IXZA 1X8LA 3PXGA 5L3SB 4BFVA 2YWHA 1M6NA 3AM1A 1OFHA 1G8GA 3LBHA 2ZSAA 1XZQA 3CPHA 4Q9IA 1KDOA 4DUGD 3FGNA 1GNQA 1TAGA 4XVRA 4TMVA 4B32A 2BHRA 1YR8A 2WHXA 4AD8A 3LXXA 1K6MA 5FBRB 1E32A 1Q57A 3L0OA 4U02A 1UEIA 2NMVA 1P61B 1GIAA 2ZYVX 3FTQA 2VEDA 2FSGA 3PEUA 4J0QA 5J4LA 2ODNA 4R9UC 3GFOA 2OCAA 3D7MA 4B74A 4N0EA 4AG5A 2KBFA 3SOPA 4IDNA 5LPNA 2EU8A 1QHIA 3AF1A 2ONJA 3SYLA 4TLAA 5IRCD 1OH6A 4BGDA 2WSSD 1QF9A 3A4LA 2C2HA 3KFXA 1DAGA 3R7WB 3W3ZB 1CULC 1D9ZA 3OESA 4B6EA 2V6IA 1XMSA 3B1WA 5KTYA 3CB4A 3RRNA 2G77B 1M8PA 3CWQA 2J0SA 4JYBA 2CEAA 4PHFA 2QE7A 4DSNA 1R5BA 1ESNA 1UKYA 2BOVA 4LK2A 1E6CA 4BLRA 2FSFA 3CUEF 3LO5A 2PZEA 3MLEA 2ZITA 3BERA 1G3UA 1RYHA 3FVQA 3LV8A 3DPUA 5FPYA 2HV8A 3CR7A 3HR7A 3SS8A 4Q1DA 5A5GA 1G5TA 1NN5A 2QP9X 3OAAA 4ZIRA 2GRJA 1NLFA 2K5UA 4JT2A 4YMVA 5FTNA 3KJHA 1W0KA 4P4TA 3OFNA 4PSAA 2Q9BA 4HUTA 1Q1EA 4GOKA 2GAOA 2W58A 4QXAA 2P6RA 3RVBA 5G40A 4TYQA 1E2IA 2OBNA 4DDTA 3B82A 5J40A 521PA 4LJ9A 5LB4A 3QENA 4DC9A 3BJIC 3NWJA 4DB4A 2IA5A 4IKEA 3IKJA 1ZBDA 2GK7A 4KCGA 2R6DA 2VLIA 1CP2A 4K46A 2ZRBA 4MYCA 4NTZA 5A4JA 1N2CE 3ZDQA 1FL9A 4AKHA 5AUOB 3IDQA 3A1SA 2WPDD 2GXAA 3EX7C 1T8UA 2GDJA 3HJNA 2P0EA 3KQLA 5IDVA 1QHSA 2CJWB 5DYIA 2EFGA 2IYUA 4JLJA 4EPXA 2OCBA 4DB2A 1ZNZA 1NKTA 4HZUA 4X8LA 1ELOA 1Q22A 3QG5A 4RFSB 3P26A 1VIAA 4PSVA 3WRYC 1SXJD 4B2PA 4AY2A 4M9ZA 2FMXA 2GBLC 4JSTA 5J5CA 2IUSA 3SHFA 3V9PA 1F2TA 4F92B 2P2LA 2B92A 3W3AA 2ZRHA 3KZ1E 3IO3A 4F4IA 4NDZA 1IONA 3KKOA 5D3MA 3LA6A 2D7DA 4DIDA 3BH6A 2V3CC 4XVUA 4RCYA 5LDDC 1AGRA 2CDNA 2EFEB 2AKAB 2QAGB 2V6JA 4TL8A 3EC2A 1MABB 3B13B 1NMYA 4NZYA 5GVRA 4CEIB 2O0KA 1KDRA 1VDZA 2JLSA 2ZU6A 4UJ3A 1UAAA 4UNPA 2F1RA 2AR7A 2IS2A 4JBYA 4LHXA 2YV5A 3SHWA 1GKUB 2Q3MA 4UNNA 2OFWA 4MDEA 2J3EA 4UNQA 1DAIA 2GF9A 3N70A 4CF7A 1YU9A 1GM5A 4PC1A 2VIIA 1P9WA 1UF9A 3EPHA 2G1JA 1U98A 4JKYA 2BIFA 1NL3A 1W49A 1XTRA 1KSJA 3AB3A 4OI0A 5IK2A 2A5DA 821PA 2WKQA 2G83A 3KUCA 3LX5A 4C7OB 3K0AA 3AQ4A 2PT7A 2X1VA 3HR8A 1MH1A 2C98A 1E2PA 3DM5A 4JLAA 1W4CA 2FWRA 3RS7A 4AYTA 3T35A 1G8HA 3D3QA 3WHKA 2JLVA 3L43A 4L9WA 4MUBA 3CBQA 3DOEA 5FI1B 3CF0A 4ZI2A 1GRRA 1FP6A 2ORIA 4RD1A 3UATA 5LD2B 4PC3A 4DDWA 5EXSA 2IXFA 2F43A 2YWEA 1OH7A 3NEJA 2FEMA 4UKDA 2WBLC 1JI0A 2WV9A 4E07A 1E9AA 3C41J 3GEIA 5FR1A 3SFVA 3KUDA 4PO9A 1GNRA 5F9FA 2FPKA 2W6JD 5KUTA 3K70B 1QHYA 1U8YA 2J0UA 2ZJAA 5FOSA 4IRUB 5EE3A 3PEYA 2ZYTX 1PV4A 3H4MA 1VG1A 1ZUNB 4I4LA 4ITRC 4QBHA 1OIXA 3EAQA 5BWMA 4BASA 4B34A 3BGWA 5BW8A 3GLFA 1R0WA 2OCPA 4XVQA 1XXHE 3GJ8A 3PIRA 4PHTA 4Q7MB 4ZCIA 4CVNA 3T1TA 3BD9A 4HYYA 4E22A 3ZLJA 1KJWA 1R8SA 2YJTD 1FMJA 3CIOA 3E70C 4AWXA 4MUAA 1XXHA 1EFHA 4CIDA 3RANA 1DVRA 4QG7A 3GLFE 4IVRA 3SJBA 1F3OA 1ZMXA 4RD3A 3VKHA 4KFSA 2O8EA 2CHVA 1ZC4A 3OEED 4TMWA 2GETA 3T15A 3A4NA 3WMEA 5CJPA 1KAOA 2QQEA 2KI5A 4V0ME 2OAQ1 1R10A 2B7BA 4JVNA 1LVGA 1SZPA 4M1OA 1MKYA 1Q1QA 1QRAA 1R8QA 1ZUHA 2IEZA 2ZROA 4BLSA 4F4JA 2JLWA 1VKJA 5DIFA 5BN4A 2RHMA 1TF5A 3IILA 2N42A 1KZ7B 2WIBA 4CEJB 2D7CA 5GJVC 2PJZA 2IS1A 1UBGA 4D4JA 3W6OA 2P5SA 1H65A 4Q01A 2W2VA 2BKEA 2ZE6A 2UVQA 3O8RA 3QKUA 1TQDA 1Z22A 2QGZA 4OBEA 2QTHA 4DLUA 4Q4AB 3GMTA 3L8YA 1IN5A 2HJVA 1NN1A 3WMGA 1E2HA 1W2HA 2DBYA 1FOEB 1QHGA 4JBWA 3IHLA 2WJYA 1EGAA 5JEDA 5JSZB 3A58B 3B5JA 3CNOA 2CK3D 3PR1A 4B3GA 4V0OA 1XU4A 3AKDA 3B1YA 3QEJA 4EIWA 2ONKA 5JWRA 2W0MA 4B76A 3KDSE 3O8BA 1TUIA 1Y63A 4PFSA 1G3MA 1WA5A 2PCJA 4NYIQ 5KSOA 4BFYA 3F8TA 3IBYA 5DN6A 1OFUX 3OHMA 3ADDA 4D0LB 1O87A 2YKGA 2FH5B 4QKQA 3UMFA 3SNHA 1VG9B 3CRQA 3NBFA 2HYIC 1E4YA 3NH6A 3TSZA 2Q6TA 4Q9LA 5ANRB 2WJGA 1NMXA 4QBGB 3NBXX 5LBIA 5HZHA 2GCNA 2CVFA 2JLXA 3UG6A 5UKDA 1XMJA 1KZGB 3T1VA 2ZETA 3LDAA 4CRWB 4WXRA 2IL1A 1JEEA 5JCPA 5JLJA 2VPPA 4P33A 1J7KA 3QVVA 3WMFA 4JL6A 1NIJA 3NVAA 1XJCA 4WVFA 3TR5A 3CX6A 2OILA 1Z2AA 2H8KA 3B85A 4TLDA 4IOJA 4DLXA 1RPZA 3CKLA 1OXSC 1HQCA 1HT1E 2V7QD 4LBWA 4G5RA 4ZIRB 1AZTA 3PITA 1Z6AA 2VHCA 1SKYB 3I92A 4MYUA 2LCFA 3U2QA 1AKEA 2NQ2C 3QXXA 1EG7A 1MV5A 2D74A 1G4UR 4HAZA 5DE3A 4A8JB 1E2NA 1G291 1DAFA 3N5CA 4Q4JA 1GL6A 5HKKA 1FZQA 1R6BX 1TU3A 2ZJ2A 2XEXA 2W2XA 1I2DA 1X8JA 2OFXA 1SULA 4PO1A 2QSYA 2B8WA 2FN4A 4GBMA 2ZAOA 5FOWA 1UM8A 4EFLA 4JVLA 3FFAA 2YWFA 2NO7A 1ZNXA 2QTVB 2ZSEA 2GA8A 4YQFA 3TIFA 3T06B 1HUQA 1AKYA 2YVUA 3OEEA 1KTVA 3CRRA 2JAQA 2RGNC 3EPKA 3NBZC 1N6RA 3I61A 3MG9A 2O8CB 4Q9KA 1WE2A 3EWSA 1D9XA 1HH4A 4QRHA 1D2NA 3DL0A 4PAOA 3QKTA 4BZPA 5BN5A 2WM9B 3UK6A 1QBKC 2C99A 2BBOA 1LF5A 3W9YA 1KMQA 4C7OA 4DCNA 2O8BA 1WXQA 2J1LA 2IT1A 1KO8A 1GITA 2WWIA 4CEJA 1JR3E 3H0KA 3RRYA 5KHOC 421PA 2JJ2A 1CR4A 3B8HA 1W0JA 3RS3A 1VMAA 2NPIA 4HAUA 3NIBA 1T3HA 1IN7A 1N5JA 3BBPA 1ETUA 4LYFA 4W7SA 4EKDA 4A9AA 2F43B 1OB2A 2EYQA 1FX0B 3JZMA 3KJGA 2C04A 4PAQA 1HYQA 2B21A 4B2LA 2ZR7A 2D2EA 3AF3A 3T5DA 1ZCAA 4ARZA 1FNMA 3I32A 4URUR 3BRWD 1YJ5A 2DWQA 1TQ6A 1KY3A 2QL6A 1TF7A 5EJEA 2KSQA 4KITB 3O47A 1S3GA 4QJ3A 3K53A 2VP9A 3OZXA 4BEBA 1N6HA 4FD2A 1OPXA 4TTPA 4MYHA 2ZXUA 2ZJ8A 1VIYA 1Z2CA 1G3RA 3PUZA 2ZRAA 4FN5A 1AK2A 4DLRA 2GJ8A 3AVYA 1JQJC 2P6NA 1T3LA 2VBCA 3GLHB 1XDBA 3AH8A 2HJGA 2I1QA 2WSSA 1IN4A 2GEVA 4HI0E 1HEIA 1D2MA 3C4JA 3X1WA 4CT4B 1QG2A 2ZI3A 5KO2A 4WA7A 1XCGB 4WZBE 1XPUA 5G41A 2GTPA 4QGFA 1US8B 4URXR 4PSKA 4YLGA 4AC9A 5C4GB 5L3QB 3UKDA 3MWLA 1P2UA 1XEWY 4XTCS 2CE7A 1R5OA 3M1IA 1ZD1A 4FW9A 3MWYW 4QHTA 4NCIA 3TJZA 2GZAA 1N6PA 4QHYA 5TV2A 5K8UA 2DYKA 3LWNA 5AJYA 1OXUA 6Q21A 1AS0A 1IOZA 1NBMD 4LSGA 3ASZA 2IUTA 4TQAA 5D3MB 2WVJA 3ASYA 3OAAD 4A2WA 3SQWA 1QHHB 4KV9A 1AS3A 4M21A 3AF0A 1RC8A 3AVVA 2ZRJA 3GLGA 2I1VB 2ODBA 2XZPA 1XD2A 4MRRA 1HTWA 4DLTA 2OBMA 4FMDF 2D4HA 2CJWA 3LW7A 4TSFA 2ANCA 2ANBA 3AVOA 3NXSA 4KVAA 3Q5DA 4G5SA 5FPKA 2XTMA 1G41A 5LD2C 1J8YF 5KNDA 3CONA 4TL6A 2ZJYA 3Q7QA 1XD2B 4BFTA 5B57C 1NJFA 1Q44A 1T0HB 1KK0A 3ZIAA 1PUIA 4GP6A 4JKIA 3KB1A 1E2KA 3I3SR 4KYIB 1AQUA 2KBEA 1NBMA 3V4RA 2XTNA 5DI3B 5HKKD 5HZKA 3K9HA 5JRJA 2CVHA 2HCBA 4WBSA 5EXXA 1ZM3A 1VECA 3ZH9B 4ABYA 3B2EA 1HE8B 1LY1A 2AL7A 2J7PD 3RS5A 2NO1A 1UKVY 4UQOA 3FOZA 2R62A 1WRBA 1RRPA 2YOHA 3TAHA 3FYHA 1RRGA 5IHPA 2GVZC 5FFMA 2OXRA 4Q4AA 1WCV1 4DUGA 1W5SA 2DHRA 2QPAA 3GLHE 2LKCA 4C0HA 3NG1A 4G5OA 3BK7A 2DFLA 4NYMR 3W34A 4BLQA 2QE7D 1ODFA 1GRQA 2LWIA 3NHAA 4MQBA 4XJXA 3T34A 1AS2A 2GWHA 3R7WA 4YMWA 4OK5A 4DLZA 3H84A 5FOXA 3AVPA 1JPNA 1BO6A 1GOTA 3K0AB 3U3JA 1W1WA 3K1JA 1RJ9A 2AD1A 1YZGA 5D3QA 721PA 2AXNA 1YKSA 4ZKEA 4OYHA 5KU1A 2FFQA 2RGAA 4TMKA 5FI0B 2C03A 4M22A 3NH9A 4Q1BA 3FDIA 1H8HA 1JXOA 1TQ4A 3EASA 1NY5A 3FMIA 4GDFA 2QA5A
chains in the Genus database with same CATH superfamily
1C7EA 4EY7A 2VSOA 1ISPA 1R66A 1RYDA 4DCJA 1KJIA 4MR7A 2ZTLA 1W85A 3FKSD 4GPZA 8ADHA 1IAVA 3R40A 2P4SA 3I5AA 2FUCA 1PR4A 5A04A 1PS8A 2VCYA 4LJAA 3X2FA 3IFSA 2PS0A 4OM8A 2CFRA 2EOAA 2IDJA 3GI1A 4QHSA 5PGMA 4QRDA 4E5PA 1Z2PX 1AG9A 1KY5A 2FFAA 4I1YA 1V5EA 3RCBA 4XD7A 4OVKA 1PWYE 1DUIA 1EZZA 3BJMA 3STHA 3U6KA 3SQXA 1JSCA 5BN5B 1QH8B 4FFNA 3OCWA 4NCKA 1N7JA 4AS2A 1BIFA 5IC4A 2IWRA 1GGJA 2P7HA 3KUKA 4DG8A 3WZLA 4YJ3F 4N5MA 5C2JB 4F2HA 4ZQCB 2IU6A 2RIPA 3OZBA 1Y98A 5AVQA 1RYFA 3AI3A 1YVPA 4RXMA 2CY0A 2JI9A 3V8MA 3RGWS 1E6EA 2ZJ5A 1KI6B 4H08A 2QX6A 2JKZA 2XUHA 1G20B 1FFXA 2CNWD 1GVHA 4JFAA 4LDNA 4O4JF 5SY6A 3TTYA 3LPNA 5FF9A 1QV7A 3LD9A 2WJZB 2WAXA 4MS4B 4BO6A 4R0MA 3A10A 2BFAA 5GINE 3AKCA 2W6PA 2O8VA 3W8NA 4HPJB 4DJFC 4LF9B 5JASA 1DXHA 3V1TC 3A27A 3EIOA 4MCIA 4A0QA 4U7GA 4CMCA 3DB2A 5LB2A 3WJ1A 3QEMB 2ZUVA 1Z7YA 3QHPA 4IG4A 3HR4A 3HUTA 4P4SA 3VAYA 5E2AA 4C1NA 3FOFC 1NP6A 1SCBA 3CUKA 4IHQA 2E1RA 2BTQB 4PCLA 3VQTA 2PRSA 5IDQA 1Q3KA 2ZIWB 4Z4GA 1KIMA 4OY3A 2XAUA 3H04A 3VDXA 3MCVA 2G9NA 2I1WA 4DRZA 2GK6A 1JDBC 3CT6A 3P7MA 4RH0A 4P3NA 1P31A 3B7PA 1JEQA 1MIOA 2Z83A 1KQNA 1L5MA 3L8MA 3ZIUA 4YALA 1LSUA 2ZDHA 5G1NA 4Y2RA 5K3CA 3GFQA 1SMKA 2QTGA 3GPLA 4RF5A 1Z74A 3WGUA 4IMJB 4UBIA 1JHQA 2NNLD 1VA5A 4ZT5A 1P4SA 3SHOA 4BL5A 3CA8A 3IVXA 2RMKA 4PN7A 4EL5A 2G06A 2B4RO 1TMGE 1U7XA 1M10A 2ZBDA 2Y9MB 4MA0A 2O59A 3RJ5A 4RK7A 2OWDA 1ZH2A 1PW7A 3VSAA 3H13A 1A82A 1KJNA 4P08A 5D1NA 3TLAA 2HNBA 3ZU4A 1N77A 1NUTA 3LQ4A 3JALB 1WMDA 4NMLA 5ITWA 1T4MA 2D1TA 2VHJA 1PJ4A 5KTRA 2R7LA 2Y1DA 2Z08A 2X42A 1NC1A 3FCOA 1ULZA 1SBHA 1BW9A 3FZEA 3MZ0A 4OA5A 3VX3A 4B6GA 5C18A 2X8LA 4BFCA 3KWMA 5LA6B 5JH7B 5LR6A 2DRIA 1X70A 4EOGA 2QNBA 5L7WA 1OFTA 3COJA 1C8KA 2D6FA 3PD0A 5LP1A 2IEGA 3KVOA 1LFAA 4OA8A 2X8BA 2XBMA 1MXHA 3BCUA 2C54A 221PA 4U5QA 3RSGA 5DBFA 4PPGA 4DL9A 1PS9A 1PIWA 5FUYA 3W78A 3LH5A 3ESCA 2B1RA 4KLZA 1UKCA 5I4IA 4WLVA 2D1RA 1MB9A 1A2BA 1POWA 3HI6A 5BURA 2QUKA 2X4LA 3PL5A 1Z33A 4FFDA 1ZXBA 1U8AA 2NZJA 3DKIA 4JODA 4EZBA 2GNOA 2ORWA 2V7QA 4M3NA 4ZCQA 4E46A 2XNSA 2HXGA 4L76A 1ISSA 4XWTA 3LX4A 3OOEA 3LRPA 1E3DA 4R51A 1QOZA 5G2OA 1YFJA 4MO2A 1UBCA 2YRWA 1FU4A 1PZNA 5EZYF 2JVJA 5I45A 5LOVF 2NNWB 2R1VA 1NDHA 2VP0A 3HBJA 2C1ZA 3IT2A 3SPXA 4E21A 3JPYA 1KEUA 1G3QA 4X44A 2JIOA 1XFDA 1TK3A 1RQLA 3O4IA 2DAPA 3P9YA 2E37A 2VHQA 4NFSA 2R7MA 1P75A 3Q3VA 4O63O 3UWSA 1A4UA 1ZMRA 2HUNA 1NN0A 1REQA 4R84A 2EWVA 2R4UA 1HRDA 2OESA 2ZRIA 4MGZR 3TOVA 3V4VB 1Y3HA 1L7VC 1WVGA 2V3WA 3UWKA 1HY3A 1TIBA 2NO5A 1TC1A 2ORVA 3WB1A 1XNJA 1JDNA 2WYIA 4KFUA 5DO9A 4F9GA 1OLUA 1QIIA 1VE1A 3AB7A 5FYDA 1GNLA 1OUMA 2VEOA 4ZZ1A 3AUXA 3DB1A 1I7DA 4MJLA 1PEDA 5T5QA 1G9XA 4LKRA 1L5HB 4X6YA 5G0WA 5LQSA 3L7KA 4I55B 1NPDA 2K7ZA 4TVOA 2A4MA 3MNFA 1UDAA 2E4XA 2BWJA 3LYUA 1Y9ZA 1BMFA 3K8YA 3P2EA 3ZE7A 4CHGA 1U7UA 3ER6A 1YRWA 2H1SA 4HK4A 4EVQA 3LIPA 3VAZA 1X7ZB 3B53X 1AX9A 3JD1A 4C87A 1ZRSA 1X87A 1PRYA 4QJIA 4PLZA 5EZYA 5DF1A 5LOVA 3DOFA 3WTBA 1ML4A 4Q7JB 3NKVA 3GX1A 3IERA 3ZD6A 1ISRA 4O4IB 2JGRA 2HRBA 1CS0A 3ZZ0A 4CQMB 1M1YB 4XX1A 4C3UA 1IN8A 1FQJA 1Z25A 3ZHZA 2D1QA 2C8JA 4AP9A 3C7CB 1U2GC 1T8RA 2YW9A 4LJLA 5EHQA 1VGVA 2EGUA 3K72B 5P21A 3I3OA 2IXGA 1YBMA 4GFDA 4B3CA 3C3KA 4I7EA 3MGGA 3UJHA 3GJQA 4K1LA 4AJEA 4DY4A 1D04A 1NBME 1XPOA 1G19A 3HGMA 1E9RA 4EMBA 3KYDB 2XUKA 4CODB 1F48A 1OAAA 3OC6A 4ITVA 3OFJA 1MQSA 3KR9A 5AVZA 1W0KD 2YJ5A 2HLPA 3QU5A 1E94E 1V4VA 3KHTA 2C4UA 4Q9JA 5JNVA 2B25A 3FZGA 3K7EA 5HK8A 1KI3A 2OECA 4BUJA 3G2IA 4IIHA 3B1JA 1TK9A 1XTQA 1YJQA 2R47A 3P52A 1Q91A 4S0ZA 5E3JA 1L7EA 2R6HA 1DX9A 2X3YA 1FXSA 3DPIA 5ALJA 1RWVA 3B3FA 2RHJA 3MS7A 1WUTA 1TZJA 3EGVA 4R71A 1GPWB 1ZK0A 2UXDB 4GPEA 5JTTA 1YBHA 1UBFA 2CEKA 1SXJE 2VDLB 2UXCB 2QM0A 4KR7A 3ICWA 3PCXA 3CX7A 4RU1A 3DZIA 4OI4A 1FXWF 3OZDA 1DFGA 1ZOLA 3CUWA 1E9CA 1YH3A 1KI2A 1S2DA 3K8OE 1KO7A 3HB1A 1BA2A 4HAIA 3IBTA 5TJHA 3L41A 1OHHA 2E5LB 2G72A 1QZXA 4AROA 1KO1A 1UP4A 4QOFA 4D8TA 1OT5A 4MRPA 2BYTA 1EFDN 1TMKA 2BKVA 4KJZA 4UAJA 3IAUA 4EDFA 3E27A 4MDFA 1Q7TA 2AOXA 3OCJA 4D0SA 1T2CA 3GFRA 4I9FA 5E7QA 5CW1A 3GVPA 1U3TA 2FZEA 1SK8A 4GOMD 3C5CA 4IMRA 3R3HA 3G0IA 1W6RA 4HCJA 2XYVA 1PYOA 1TCUA 3KLNA 3U3OA 1L5SA 3D81A 4M0KA 3T7DA 3NI2A 1CKEA 3ZX4A 4E11A 5C35A 2QN9A 3I09A 4MDYA 4IJMA 3BXOA 2OO5C 1SQ5A 4NE7A 3E22A 3HBFA 2Z2IA 1E0SA 1M34A 1W4AA 5I5GA 4D4KA 1YQTA 4E70A 3VYVA 2IHVA 3IUMA 4JITA 4LMBA 4ZO4A 5HKAA 1RJFA 4FD3A 2YHUA 1VBNA 2G8LA 3CIFA 4NAHA 3BUSA 3HTXA 5JATA 3G89A 4O4JA 1ACLA 3AVQA 4UDXX 2JIPA 2ET6A 1NJ2A 4NKRA 2ICAA 3NRCA 4P7BA 2YNMD 3ZWDA 4AY5A 2HO5A 5D6OA 3VKUA 4AP5A 2Z5FA 4KBYA 4CKZA 3DDWA 1G21B 2I4LA 1K8QA 3OZRA 4QGBA 3B70A 4RABA 2ZB3A 4C4AA 3BK2A 2ZI5A 1RTKA 1JHVA 2DWPA 1FP4A 3AW9A 3FLMA 3GFBA 4YFVA 3SYMA 3OT1A 3OT4A 3OOJA 1UBEA 4I6JA 1Y5IA 3KV3O 1CUEA 4YO8A 2IS4A 5FNVA 4AN4A 3IRVA 1GPLA 1VL1A 3ZZNA 1NOKA 4EJMA 3CVYA 1MAHA 1KY2A 4TXLA 4KHPB 2HHAA 2OSBA 4LOJA 1E2GA 2QJTA 4G97A 3ROKA 1DTEA 1HDRA 3AHDA 4EKNB 5LP6F 3B1KA 1LDGA 4NZ9A 5EFZA 4PYRA 4BEWA 3R41A 1I2MA 4Y9UA 4X66B 2CBXA 3FFBA 5KQSA 1WSDA 2IIQA 1YV9A 1C9KA 2CFCA 2OENG 5D01A 3LVRE 5FOVA 3O8DA 1HE3A 1JVNA 4M9RA 3VKVA 1XELA 4YJ2A 1JEJA 3BMOA 2AWNA 3AV3A 4X3OA 1EXDA 3D3NA 4N9QA 3GFTA 4ZGGA 1VJ5A 1RPTA 2FXVA 2NSLA 3D3WB 1UPTA 1WMEA 4CLDA 4DA0A 3I5XA 2WWHA 4JYPA 3T5TA 2UV8A 3T1HB 4LQLA 1P7WA 1G18A 1AZLA 1UM9B 5TT1A 3EODA 4EATA 2Q1UA 2UYQA 4P34A 5BUSA 5C4MA 3I28A 2ZE7A 3SS9X 3C4VA 3NXKA 1M0EA 4H2DA 2O0JA 4P4LA 1CEXA 3S28A 4DSTA 5AJVB 4CNQA 2FPMA 3OMXA 2P4EA 2B4TO 3N2LA 1YNOA 4W82A 4YAWA 3NC1C 1EVIA 2BDEA 1G9TA 4D96A 1B3BA 4FYXA 1SVNA 1UR5A 3VU0A 1ZW6A 1UKZA 3A8TA 4EJSC 1GDTA 4DXAA 3QYJA 3PI6A 2G1KA 3D0KA 1ZN9A 3TTTA 3WHPA 3BQ9A 4DEYA 3I9V1 4WASA 3T5MA 1JA0A 3RABA 2OORC 1HE5A 2HK7A 2MSCB 4AY3A 1ZD4A 3H2YA 3CRMA 3EZNA 5CFMA 9GPBA 3GRFA 4JBGA 5F5XA 4BEJA 1KEWA 5THXA 4GNKA 1M34E 4RHCA 1Z63A 3D8UA 4R1UA 2PGOA 3OX4A 3WP1B 4H3SA 2Q1TA 4N3NA 1MFZA 4OM7A 4MVJE 4C5BA 1M7BA 2Q99A 2YOFA 4S1PA 5F2KA 2BL4A 3HXPA 5ILOA 3CXRA 1DU4A 2J31A 5KOHB 5IW8A 3C5WP 2Q7XA 3IEPA 3RTAA 1T2DA 3N2GB 4MMYB 2C7GA 4RPGA 4UZFA 3GJ3A 3PUVA 2LVBA 4REQA 1TECE 1O57A 1O95D 2H5JA 5E7MA 3RLFA 3JSXA 4R81A 1KL7A 2NXWA 3RFFA 5HRUA 3DTVA 1X6VA 2QQ0A 5A9SB 3IEVA 3OQIB 1G7SA 2W6CX 2YFQA 3EDOA 4DV0B 1YK0A 4KU4A 3KXLA 1RPAA 1GILA 1YJAA 2IITA 2OCLA 4KIUA 4IDHA 3KLOA 4ATNA 2B2NA 3AUJB 5I8ZA 4C7BA 3JSAA 4LZPA 4UDNA 3ZTYA 2IHBA 1VDMA 3CUYA 2IDZA 4HRXA 4OQFA 1Y33E 2EJTA 3ROTA 4JOSA 5HX7A 3DMDA 1FFWA 1Q0TA 4GR4A 4L73A 4Z7QB 3TPCA 4FQ5A 3AEUA 2PUAA 2IU4A 3D7SA 3DM9B 4YPVA 4AJPA 4YH1A 1XDSA 4WCFB 4I1VA 3TEJA 3L04A 2JBAB 1EFVA 3UH1A 2EF1A 2KLHA 4KQCA 5FWXB 5CFLA 3GRUA 4JLKA 4JXJA 4O4LF 4PZZA 2WR8A 5EP3A 4DIBA 4ITUA 4DS3A 1KE2A 2EFDB 3GLGB 1P73A 5F12A 1TB4A 4HDQB 3VOTA 3ZW7A 1QH8A 4FIZA 1ZIXA 3MUFA 1RPNA 3G7SA 3GD7A 4G56A 4NK4A 3WB9A 2O52A 4ZO9A 1DAMA 1U65A 3WKAA 1WB9A 1NLMA 3VKGA 3U3KA 2ZB2A 4Q7EA 2I4IA 2B4KA 3MCAA 1EH5A 4CHTA 2SKCA 5CB4A 4R2LA 2X13A 1F4VA 2GBGA 2NM0A 4J8PA 4CIYA 4PANA 4B84A 1SBZA 1YZTA 3IOBA 1U2TA 1QZ3A 2QSJA 2JCBA 2W00A 2ZRNA 4EMTA 4LJ8A 2G9QA 2ZBPA 3W90A 1L4KA 1BRTA 4C1BA 1XE3A 4LUCA 5KSYA 4XARA 3D8HA 3VKFA 4P3YA 3WLQA 5EJFA 2JFQA 1RJ9B 4KVZA 2FQQA 3ZGOA 3WGVA 4EA7A 5J63A 1E1DA 5EHZA 2GFIA 2XR1A 4BN0A 4RTOA 1O0CA 2V9ZA 5AW2A 2H57A 2BMDA 2WFLB 3EZ2A 3PX2A 4BZXA 4EYGA 3GAAA 4BMPB 5IJ9B 2P0AA 1CVRA 4PINA 5ADVA 4DV6B 3JWEA 2GRAA 5JQGF 3TGLA 3VPXA 3H9GA 3RJMA 4QWWA 3DBOB 3PD1A 1EG2A 3CR3C 1HR0B 1ZQ9A 3WSTA 2CMFA 4AJKA 2WZQA 4JXXA 3PR2B 4JDUA 1GUBA 4FCVA 1YT5A 1OHHD 1N0VC 1V1MB 1I3LA 2B99A 4K9NA 1G8JA 1M5UA 2HA3A 2YASA 4P58A 3QH4A 3KOXA 1XFAA 1A95A 3FROA 1N75A 2A92A 1P29A 4EA8A 2DR0A 2BFNA 4E2XA 4CMJA 1SA0A 2LXNA 4OUDA 2EJBA 1EJ2A 1F38A 2BGIA 3RARA 2Q5QA 4RQUA 4ENUA 3ZEAA 2PKEA 4G4IA 4QGHA 1JLHA 2V7BA 1WWKA 1NUPA 3JD0A 1X2EA 3KKLA 3Q98A 3I2FA 3QF7A 4EEXA 5JDIA 2W71A 4JC0A 4ESVA 2H92A 1SQFA 1HDEA 2ERXA 2HRQA 3AF4A 4TN5A 1IVYA 2F3UA 3HCPA 1RAHA 3M5CA 2DFKB 3M9XA 4N1AA 2VPYA 1IZ7A 2WB2A 1CF9A 1F8FA 1UDBA 2MR6A 4GZLA 2GN9A 4CFSA 3K9QO 3CVUA 1CUWA 4M49A 2JJ8A 4JVSB 4NJEB 2WTUA 1Z0AA 3K9CA 4MW7A 2OO3A 5DXFA 4DMGA 3KALA 5D5PA 1J23A 5CYOA 2GFQA 1TM3E 4CMGA 1XJQA 2ZVJA 4CKWB 4X94A 1U2ZA 3Q3JB 3O4HA 1FP1D 5DNCA 2BH2A 3CFYA 1K0FA 1JIJA 1QK3A 3P4YA 5EIOA 1YDEA 3SIPA 4D45A 2VAVA 1E66A 4BN4A 2GZHA 2OGTA 2QAGA 1JR3D 4TYWA 5JYBA 1DDIA 3W5IA 4CDGA 1T9CA 4RS3A 2I2FA 4Y6GB 4AKGA 1QF6A 2CHGA 1E9EA 1L5OA 4TUYB 3IUEA 2O05A 2OCKA 4X65B 2J6HA 4J2TA 1W581 1F17A 3CG0A 3HVJA 5J2UA 2CL5A 2WWVD 3OBIA 3E7WA 1BGVA 2PRJA 4MV1A 5EE5B 3RDPA 3DMHA 5JCJD 1FJHA 4F5EA 3O95A 1C9MA 3A05A 1M1YA 2PKQP 2XYQA 4J6FA 4OQQA 1X86B 1E1KA 4MVJH 2D2FA 3NWPA 3AJ9A 5D5QA 3TLGA 1RP7A 2C4KA 2BBWA 4I5GA 4EHIA 1SCJA 4EB6A 3JQAA 1CR1A 5AJTA 5B2ZA 2WW8A 3AEUB 1RHQA 3I1JA 3LECA 1OXTA 2WDPA 1UT6A 4IIBA 4TUYA 4XGKA 3GK3A 5EWLA 1Z4JA 1P62B 4J1SA 4MAFA 3E8MA 3JQDA 2R7KA 3UIEA 1GG5A 1SVWA 3CU5A 3EMBA 3MT9A 4BKOA 1OF1A 3N8IA 5K01A 3RR2A 4L6IA 4XKJA 2DBQA 1SC3A 3GHHA 1ZD2P 3FDFA 3GIDA 3DBHA 3TNDA 1IQRA 1ZR2A 5BWBA 4FFRA 3SDBA 3LBNA 1LDNA 3USZA 3AWDA 2OV2A 3EEYA 1PVDA 3FYTA 2VDRB 1NUSA 3NATA 3QUQA 4Z9XA 4YWJA 4E13A 4BO5A 2VCHA 1L4HA 1JEAA 1P5FA 3M3HA 3D4IA 1JQ5A 1TCCA 3Q6NA 3QW4B 4O33A 3O4JA 4M1EA 3E7PA 3L6CA 4Y9RA 4ZEWA 1X9HA 1QG4A 4MKGA 4OMUA 1QGUB 1V5GA 1KSGA 3UW3A 2NUAB 2GZMA 3WXBA 5CITA 1PZEA 4TMFA 5G0UA 3UB3A 3VPGA 2W90A 4UU0A 2XQIA 1G8FA 3NHBA 4FMCF 1TE2A 1UZLA 3AUKA 4DSUA 5ALRA 4MUYA 4DQLA 1J5PA 2F1HA 3X2SA 4GG1A 3RWOA 3SQOA 4YO7A 5B1SA 2FNAA 3UK1A 4C08A 4ERNA 5L51A 4XX0A 3DD5A 1C7JA 2COKA 1BMFD 2A9VA 1Q21A 1L3CA 1U2DC 2IE0A 1KMCA 2VKQA 4QXPA 4S1TA 4EBFA 2C5BA 3FSGD 2G1PA 4GOOD 1RRKA 3ER8A 2EERA 2YHBA 3DMTC 4DLWA 5CCBA 1Z8FA 4OQYA 3MCWA 4K9KA 2B2XA 3UKJA 3WMWA 5CT4A 4OI1A 4BQEA 4MI3A 2Q3HA 2R48A 3QU4A 5DX8A 4OGLA 1UBTS 3FE2A 2ERCA 2HF9A 2VTKA 3NHZA 4I2NA 2CLCX 3MM4A 3RC9A 4GZ6A 4EFMA 1C9YA 1KAEA 4G1BA 3W9SA 2RGDA 3BILA 3QHAA 2OMKA 5JHHB 4BX8A 2VNIA 1FQOA 2J3HA 2H4FA 4Q3CA 5EMHA 3UAXA 1U2EA 2YW2A 3QVUA 4KN9S 4LOKA 1KVTA 5JISA 3KXPA 4Z4FA 2P41A 4YHHB 3IIEA 4S04A 2PFKA 3R6GA 5KJ1A 3M7IA 4OPMA 1CIPA 4FYYA 4OXYA 1U8CB 3LUAA 1SBIA 2HA2A 3V1UA 1W4ZA 3VR6A 3JQ9C 1RQ2A 3LQFA 4CEIA 3EMKA 2NN3C 3HC7A 2JJ1D 5E1MA 5FOQA 3WJ2A 1HI9A 3N2GA 1V2HE 4PC7A 4Y2UA 4D9NA 3NYRA 5C1OA 3U5ZB 4R2JA 4YUWA 2WJHA 4KOAA 3V8RA 3ZE6A 2P9TA 2VSFA 1Y89A 2W6QA 1GNPA 3FUUA 3DJFA 2PH3A 2CMGA 3IKMB 5B1DA 4BMCA 2FF5A 2CHFA 4AXBA 2C20A 3PUIA 2MWMA 4CMEA 4ALJA 2ZUSA 2Q21A 4JP1A 4LXTA 1SHUX 1T0JB 2WU3A 2Q5HA 1DC5A 2WJAA 4DIKA 2QMHA 4ZVSA 3UK0A 1J07A 4MLPA 2C92A 1EAYA 4URHA 1WPRA 2C1XA 2QQFA 2ZYIA 1V6AA 3FB4A 4RPKA 3VR2A 4OHYA 3I42A 1VPWA 5IDXA 3AUSA 3DULA 2YS6A 4IDAA 1I2BA 1OH6A 3SQLA 1CLUA 1E98A 1S3IA 3GB9A 3LZCA 1YB4A 4UHCA 1B1AA 5J59A 4BBJA 1F51E 1R5JA 3OTWA 1V16B 2H1LA 3QVGB 3VR4H 4CIBA 4ZHQA 3ZS8A 1JS1X 4M54A 1HNNA 3KWFA 4MKIA 3AGPA 1GCIA 2VZ0A 5AKJA 1GAXA 1DZ3A 1O6ZA 5CTJA 1KJ8A 1NA5A 1VJCA 3MOGA 1Z4QA 4OHFA 3H9EO 2AOUA 1VG0B 2CUKA 4Q3EA 1LA2A 4IY1A 4PQEA 3M4YA 5CVJA 1UJ2A 1PR9A 4W4TA 3RVQA 3B6EA 2QUBA 5AVVA 1VXOA 4FFMA 1TGYA 2VJQA 3LOQA 1MO6A 3ZHTA 2MINB 4QFMA 5KBYA 4QUBA 1EFRD 3O21A 3MAAC 1T4BA 1Z88A 1BDIA 2Q3DA 3CNNA 1R0KA 2VH5R 2O6LA 1G1AA 4XDGA 5E3HA 1D7AA 3ZK9A 2ZRGA 2WT4A 3WNBA 4O1HA 3M4NA 1P77A 2YVAA 1OXKB 4TN1A 2A5JA 3IO5A 3HYTA 3PYXA 1KKMA 3P9NA 3G2HA 4FNAA 5FQNA 5E38A 4UUMA 4OTZA 1SVUA 3A4VA 3LOUA 5E95A 1TI7A 3X3HA 4RADA 3DQQA 1QV6A 1RPJA 4B5LA 4ETIA 1CZRA 3LPCA 4HB0A 4YK7A 2JC3A 1W19A 3HRHA 1JJVA 4YWHA 2C2OA 2AG5A 4UHHA 4D02A 3KT8A 5JJCA 2ZJOA 4KE7A 5ALYA 4BNJA 2AFIE 3GCWA 3DE1X 1DO8A 2ZTHA 4N39A 4RD2A 4E2WA 2O5CA 3MJTA 4MUGA 5IS2A 1CHNA 3ZVNA 5DASA 2ZAGA 4DZRA 3OE5A 2P2CA 5CA1B 4BB9A 3SX4A 4B3HA 4CM1A 4URVR 2C4WA 3SSNA 5JY1A 3OIVA 4D42A 4QVIA 4DRYA 1PL6A 4RVHA 5FUMA 4UCQA 1AKRA 3ELDA 3HPRA 3MGBA 4KQGA 5CLLA 1ITZA 1P7ZA 3K94A 3SCZA 3KX2A 4MS3B 3T41A 1LRLA 1CUGA 3U31A 1COZA 2P3QA 3RI3A 3RTBA 1H2FA 4B8YA 2JCVA 2ZI7A 2P8JA 3ADPA 4IOMA 4CIAA 2DXIA 2J59A 1ND6A 4Q66C 4CTJA 4EGQA 3HCWA 4EJ0A 4JUAA 3TUZC 4LJ6A 1QGED 3K9BA 4Z9BA 2BFOA 2CDCA 1S8FA 3L1VA 1O1YA 1DV2A 1IHXA 1SQ6A 2NXNA 3LCMA 3LFTA 1F20A 5CK5A 5TGZA 2OBXA 4Q4JB 4BLTA 2FSUA 4HXGA 4MPPA 5AKYA 5FL7A 5IAKA 3AKZA 2RH9B 3B20A 3U7RA 4PNZA 4CLXA 1KMHA 2IY8A 3TZBA 1NYQA 3RC7A 2HC9A 1KRXA 2FN3A 1IN6A 3JTMA 3DO8A 3IQHX 2DWUA 1JKXA 1RAAA 4LQCA 5T6BA 3HK2A 1C1YA 3WWOA 4D8YA 3KWLA 2C3YA 2H1WA 2QLFA 4KXMA 3TE6A 1YU6A 3FTNA 3W2IA 5KWEA 4I3GA 5ALHA 2XNDA 1IG0A 3WFZA 1EK6A 3W1EA 4HX2A 4BNXA 1M6WA 2X15A 1TL7C 4FEAA 4D3DA 3VR1A 5A4KA 2BV3A 3P9CA 1DIOB 2KLBA 4M2LA 2VDJA 3SC3A 4C4YA 1O5OA 1PZHA 1II9A 2GKOA 3KS9A 1QONA 3VZRA 4LCEA 3M34A 1CE8A 1CJVC 2HCTA 2LV8A 5A0TA 1UC4B 2OAEA 4RZIA 3KFLA 1G2IA 3WHLA 2PWAA 3W5HA 3JRNA 4EUKA 2IUYA 2C58A 4BJ6A 3QLVA 2F3PA 1DG1G 3T6KA 3VNAA 2VF2A 3L5KA 2PXXA 1ZUNA 5AVSA 5KTOA 3C45A 1KDPA 5K0CA 4U7FA 3CW9A 3DC7A 3UGTA 4OQ4A 3RV3A 5BSFA 5BYKA 4TTIA 1TCAA 2IV7A 7REQB 4OHKA 1K68A 4RDHA 2OP1A 2WZCA 3MHPA 4B7AA 4RSRA 2EP7A 2WG0A 3IAAA 3K0BA 3N2IA 3SXUB 4IG9A 4EJSB 5IPFA 2PUFA 1CUVA 1U4NA 1I32A 2IYOA 4OJMX 3VR5A 5JNUA 2Z5GA 1P2GA 2H11A 3V4LA 5DM60 1T2AA 3GWGA 2QMYA 3LY7A 1M2FA 3GOHA 4WRRA 3QELA 4ACBA 2K87A 3NORA 3OM9A 3V55A 5AW8A 1N7GA 4Q03A 2JI6A 1W35A 3CZQA 1KQGA 4PG4A 1YJXA 4A36A 4MWSA 2JARA 2WAAA 4N6NA 3VHXA 4IBOA 4Y1RA 1Z36A 3KOWA 4TS9A 4MA4A 1S8OA 1DCFA 3DF7A 2XSZA 5AM5A 1J99A 3GLHA 3KL2A 1BZYA 1MMFB 2IK8A 2J07A 3X1KA 3B1XA 1GEEA 2YCLA 3ZXIA 1OE0A 3NOOA 4H7IA 3TL6A 4MEJA 4OGWA 3GJ5A 1VHTA 2CE2X 4FS3A 4P4NA 4TKUB 3WHIA 1TGVA 2PS1A 5GZ1A 1T2VA 3RVLA 1Z5OA 3ADCA 4HATA 3QFSA 4BN5A 4E1VA 2D5AA 2VQSA 4YONB 5KTKA 2ZYSA 2FDRA 2CVZA 3LQKA 3GN1A 4NNOA 1U7ZA 3V3KA 5JJBA 4K9LA 1UK9A 3L1KA 6YASA 1MXFA 1JHAA 3NUQA 1Y3DE 1E7QA 5AYVA 1QWOA 1QZZA 3SYNA 1K4YA 3VKWA 1PR0A 3JU3A 3OQHA 1V8FA 2J6CA 3I5UA 5BN3B 5BRAA 1N78A 1I2ZA 5E9JA 4MWBA 4UNRA 1XIVA 1HYBA 1VZ3A 4MVJI 4FFSA 3BB4A 4GX2A 2I29A 4A73A 3IVRA 3WGQA 1UOEA 1H0HA 2BUCA 2C88A 4PG7A 3RNLA 3HFRA 5K8TA 3AF5A 1RYMA 1OAKA 3PXUA 1U0NA 2IPLA 1U02A 1JFFB 2K6GA 2R6ZA 2RBEA 3D6HA 4QEZA 1I4LD 2Z57A 4HZIA 4B6OA 5CFNA 4N3BA 1G8SA 2ZIXB 3RFTA 3D31A 3TX2A 2ZUEA 1NM5A 3U16A 1XZBA 3A6GA 3P0IA 3NAGA 3SKXA 4Z53A 2AN1A 5CFQA 1WDWB 4P1ZA 4V2UA 3E9ZA 3ADBA 3B6IA 1T5DX 3NTOA 1E60A 4K81B 3X1ZA 3JQGB 1WXDA 3KZKA 4M1WA 4AYWA 5CYPA 1NBAA 1IQUA 5FX2A 1LFDB 3HCEA 5JU6A 3E3NA 1CF2O 2VCEA 3KOUA 4WACA 5EZ5A 4D9IA 3HYSA 1LK0A 2FFBA 2A3NA 1EQUA 2PYZA 4ZAGA 1NU6A 4ARBA 1KVRA 1ZGJA 1YB6A 2VP3A 3OCVA 5KQRA 4KHZA 4G0ZA 3OICA 3U7EB 4BMDA 5F2EA 4LDPA 2JLQA 1ORVA 3P71T 5I7SA 2Q27A 1D2RA 3HI4A 2PN1A 3I8XA 1AUXA 3H4IA 1ODLA 3HNOA 4IRMA 1WQ1R 4F06A 2MSKA 2XNCA 3COPA 5JSHA 3HDQA 4QFDA 1TTTA 2XGMA 2VNSA 1E89A 4EO7A 5CB8A 3U4CA 4DJDC 1A8IA 1A8HA 2FA9A 3KQWA 4W8HA 2FN8A 4WFQA 2Q9AA 2XUIA 1KERA 2IY9A 4C0JA 4QXMA 5LQNA 2NO9A 1ZI9A 1BFKA 4EB0A 3SG0A 5C46F 4WWHA 2IH2A 4DLLA 1U8FO 3C3YA 4FUTA 2BJHA 4D9MA 4F3CA 3ZDYB 1DE0A 2H07A 2Q5CA 5DTIA 1E6MA 4EUFA 3OKAA 1G5IA 1PYGA 4N4AA 3JAWA 3DE7X 1Q74A 3OCZA 1D2AA 4P7FA 3K70C 4M6WA 4WNYA 4E3WA 5BQPA 3A31A 4EPWA 1WMSA 3QIVA 1NRJB 4D79A 4AU1A 4EKYA 3TG2A 3KOYA 4RL6A 2ZYHA 3OX1A 2ZYAA 1TX4B 1TDJA 3DR3A 1PSDA 4OGGA 3U37A 3ZQJA 2CBZA 1HOXA 3GLIB 2PSEA 4RV5A 5EPOA 2D62A 1BG6A 4X6UA 2R7AA 2QP4A 4G5GA 5HCUA 1J70A 1XZEA 3WKEA 1TUEA 4BO1A 1KNQA 3DWFA 1NUHA 1T4GA 2CHEA 3WGIA 3G82C 3DFIA 4B8WA 4XA8A 2WD7B 2QVLA 2VNJA 3U4MA 3Q3GE 2B20A 1JXQA 4MIEA 4PHCA 4PE5B 1BJRE 1UODA 4RVOA 5G3ZA 3RTCA 3NAQA 1FFCA 3QPWA 3UMBA 3WLEA 5F3WB 3GF4A 5I7UA 5LLTA 1DB3A 3IAS1 1XWWA 2R5WA 3OE4A 3RVPA 4CL2A 4IIJA 2IZ0A 3ETCA 3C3MA 3DL4A 1FP7A 4L74A 4AUNA 5ICMA 2XBUA 5BPHA 2JK1A 3JTEA 4NMXB 4D80A 3GLVA 2HWYA 3ZGXA 1L6IA 4DBVO 1DAPA 1BMQA 2PG3A 4QU9A 5ARBA 2OFOA 5KSZA 2VYQA 5DI3A 2ZJ0A 3HCCA 3JVEA 2XKKA 4N5IX 1KJQA 2PA0A 3HP1A 3EEBA 1SK9A 4UQPA 5B1IA 4DQVA 2BY4A 1N6OA 3I04A 3AESA 3MELA 5FL3A 4ND8B 2I6FA 2IZ1A 4ARVA 4WV3A 5TPWB 2VQEB 2WHPA 3AR5A 4O4HF 4ERXA 1BVYF 3E4CA 3E15A 4DBLE 3EPPA 5FP0A 3EFOA 1FZTA 4D41A 5DM1A 2XUZA 3P94A 1AMUA 4UD2A 4FNGA 3FUXA 3KPVA 2GN6A 3C6BA 3H5AA 3EVNA 2W42A 4UVGA 4XW2A 1HQKA 4D82A 2QGFA 2WMDA 2XOEA 4QYMA 4BJHB 3K70D 1VMDA 3HQ4O 1Y6JA 1I33A 2I6QA 2GBFA 2GN1A 4KPGA 2O3TA 4IDEA 3UJ7A 3W2HA 3H05A 5K0JA 3E23A 5K51A 3DEFA 2H85A 2NAPA 2C5LA 4DV7B 3UCFA 2PA3A 4XUDA 4FZVA 2IELA 3II6X 4KFRA 1NONA 4H7PA 2PFGA 2PEZA 4L6CA 2VZEA 1T1RA 4QC2A 3MXOA 3ANNA 1WCYA 2YWXA 2ZJZA 1NNUA 3PNBA 3RFUA 2GDZA 4K8OA 4CF5A 3OQBA 4G67A 4CN8A 1HE1C 5TPZD 1LW7A 3NV9A 2PS3A 4DR7B 3K5PA 2SHKA 2XITA 3N87A 4M1SA 3JWPA 1M72A 2WHQA 1VYVA 1KXJA 2Y1FA 3CKKA 1I0LA 3O8QB 3GFVA 1ILWA 3JVUA 1ULBA 3ZU3A 4FKBA 4NR0A 4B8ZA 5IC6A 4EBBA 4YFYA 3VTKA 2FFHA 1XU9A 2IP2A 4DXHA 4MDHA 3LYLA 4K26A 2IXTA 3KD2A 1Z6YA 1Z62A 2I6TA 2W70A 2G25A 4BKMA 1DQSA 1HDCA 1J90A 2DWCA 5IKMA 3TVTA 1DHRA 4Y2VA 3MMPA 3THWB 5LMCA 2FX5A 2Z5LA 4H7DA 4X1YA 3WIDA 1J2YA 1USGA 4NFLA 3I9KA 2CVOA 1NR1A 1OU0A 2MINA 4U6QA 3PNQA 1CBUA 1PL7A 1JIVA 2GHIA 4XM0A 8ABPA 2ZI9A 1LDEA 2CCJA 3SYTA 1EVYA 1XMVA 2B5WA 4R31A 1BXGB 1UDXA 1JBEA 5DGHA 4NVRA 7REQA 1YQDA 2VDVE 1SZCA 1QRTA 1TADA 2HDNB 4GR5A 2BFDA 2GPWA 3DZHA 2YS7A 4KPEC 3R9XA 1V1MA 1A8PA 1SPXA 1U0SY 4AZ3A 1CEQA 2HU7A 4X1OA 1CIVA 5IAOA 4RK1A 3WMRA 3VAAA 2XNDD 1S5PA 4R8SA 3LS2A 3WIVA 1WV1A 1DT5A 3I8SA 1Q92A 4J90A 2VWGA 4R3WA 4MV7A 1TA0A 4F9TA 1ACJA 1IRXA 4FWBA 4FCCA 3F74A 1H5UA 3T54A 3VRHA 3T5CA 1AT1A 5KNLA 2BW0A 5B3JA 4GO1A 1C8LA 3HN7A 1T10A 3QMMA 3ONDA 4DZZA 1WDLA 4UBOA 2BFFB 1WHSB 3RC1A 3GFGA 3B5EA 5J2TF 4PC2A 1KI1A 2JA2A 1C0KA 4EWLA 3NBKA 3BPSA 4N47A 1S9HA 2ZE5A 2BM8A 3BF7A 2NYRA 4IS2A 4IZOA 2PBFA 5HE9A 3RHSA 5AWFC 2W2TA 3DD1A 5JMWA 1GQSA 2VPIA 1LC0A 1SUDA 1XBTA 3BSSA 4CKWA 1CEYA 4YXWD 1N7IA 2QXUA 5BW6B 3DMYA 3VR0A 1XA4A 1K27A 3HRKA 2I33A 5DW0A 5JBQA 2G1UA 3MWFA 1P3DA 1WO8A 4IGKA 2DU8A 2YHSA 4Q48A 2IWHA 3PVCA 4TLBA 2C5FA 2GGSA 3LFUA 1MNQA 2R87A 3GFSA 1M6YA 4QPNA 4LJRA 3MJSA 1ZJ5A