4TLAA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
233
structure length
216
Chain Sequence
QAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTTGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEDLSALIERINYAIQKYRARRVSIDSASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Circadian rhythms. Atomic-scale origins of slowness in the cyanobacterial circadian clock.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
total genus 78
structure length 216
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tlaA00
2Q9CA 1ZD1A 1G3UA 4M9SA 4PHGA 1P2TA 3KJIA 5FOUA 4Q4HB 5FI0B 4ITRC 3QEOA 3QPWA 1WRBA 5UKDA 1CXZA 4RFSA 5EUMA 3M6AA 2W6JA 3W6PA 2WBLC 1UKVY 3PCRB 3CONA 3GQBA 1J2JA 3L8ZA 4I1OA 4GSYA 3GMTA 4ESHA 2IYYA 3KKQA 1IAQA 3BFXA 1O87A 1Q0UA 4DB4A 4LYJA 1XCGB 1H8ED 2CBZA 2DPXA 1A1VA 3IPXA 2AHOA 1K8RA 1YU9A 2DR3A 1KNQA 5KSOA 1HY3A 1RPZA 1G18A 1KDTA 4Q7JB 4P32A 3LH5A 4F7WA 4FWTA 2ZANA 3KXIA 2IHYA 3TH5A 2AKAB 3K1JA 3CM0A 5TB5A 5AUPB 2IF0A 2V6JA 1OFUX 3GJ5A 4URYR 2NMVA 2OT3B 1G21E 1VHTA 4L9WA 3FVQA 4M1SA 4GNKA 5F9HA 5CB8A 4DLTA 3FKSA 1HQCA 1TF2A 1E0KA 4IEEA 1HTWA 5J5CA 4A0HA 3VX4A 4TMKA 1ZNZA 4FMBB 2YOFA 1G3MA 1JAHA 3WMEA 3K70C 1R5OA 2ZRIA 4JLPA 1S3GA 4XSGA 3BXZA 4FMDB 4OQLA 2RHDA 5FUWA 1DS6A 1CJKC 3AEZA 1FOEB 1E79D 2ZUCA 4HYYA 2XNDA 1R8SA 2J9RA 3GFPA 4A0GA 4PQRA 1AQYA 4CGZA 3AVTA 1CIPA 1MT0A 4TYPA 2AK3A 3EXAA 3PQCA 4EFLA 1N2CE 3C8UA 2CK3A 4N1AA 1DVRA 4RCZA 4C0JA 1XD2B 3OFNA 4IDHA 3JVUA 2B7CA 1Z0IA 1P3JA 1W4RA 4P4UA 2DWQA 1XMSA 2ERYA 3CR8A 3B8HA 3K0SA 2O8EA 2G83A 2JJ1D 2CE7A 3CBQA 3B82A 3LVQE 2OO7A 3LQRA 1CU1A 3DPUA 3L43A 4F4JA 4QXAA 1WBDA 1ANKA 3B6EA 4IOLA 4TQ9A 4ARZA 1UKZA 4KI0A 4KSCA 3RLFA 2RGXA 2ZITA 1CR0A 1GL9B 1N6KA 1AS2A 3LX8A 3K0CA 4MITA 2IWHA 2C04A 1XTJA 1ZW6A 1UEJA 5F2EA 1NKSA 1P73A 4QFMA 3SNHA 1SVOA 1SQ5A 1UADA 2ZJAA 3D3QA 4URUR 2XXAB 2CHVA 5EXSA 1I4LD 3B13B 5KNDA 3TQCA 4D4JA 1IXSB 2JDIA 3U3JA 4RFVA 4AYTA 1JXOA 3KDSE 2XZOA 1MABB 1NJFA 3TUIC 4EIWA 3L82B 5FTKA 5EUQB 2OILA 4ZV4A 5FUVA 3FHCB 5K8TA 2JJ2A 3TBKA 3F5FA 5E95A 1JJ7A 1I4DD 1JQJC 2BHRA 3H1TA 5GVSA 3K9LA 3CKLA 2YWGA 2V9PA 1G41A 3REFA 4M21A 1UKEA 1OXUA 2QTFA 2IEZA 5DO9A 4IVPA 3BERA 1OIXA 1JECA 2NO9A 4M9QA 4BRWA 4ARZB 1OHHD 3CNLA 4LV8B 1WCV1 4ZDWA 2QNRA 2V8OA 2ONKA 4OQNA 4AY2A 1BYIA 1EFUA 1XD9A 3QKSA 1TU3A 4D81A 3CB4A 4FXPA 4O2LA 2ONJA 2FEOA 1LTQA 1OYYA 4KITB 3KQLA 1E99A 2QN6A 2Z83A 4AKHA 4WVFA 1OH6A 2YJTD 3LXRA 3MG9A 3GLFA 1IN7A 2IXEA 2QP3A 3CWZA 4GFDA 5AJVB 5FBRB 1XJ0A 1VYTA 3QG1A 5HZKA 1Z0JA 2IW3A 3U3RA 1R4AA 1KI2A 2GF0A 4Q4AA 4Q47A 3QVUA 5J4HA 1G8PA 1RZ3A 2OZEA 2J0VA 2QPAA 1RYHA 1CJMA 3C14C 1FPMA 4IOMA 1CLUA 1RRCA 5J4VA 4ZIRA 4OJKA 3ZVMA 5FOVA 2VHTA 2FV8A 1M1YE 1M74A 5CM9C 3N5CA 5LD2B 4D26A 2GJ9A 2YNMA 3GJ6A 1LS6A 2WSSD 4TLBA 2VF8A 3LRPA 4H1UA 3D8BA 3SJZA 2YC4C 3ZLJA 3AVPA 4X8HA 4AYWA 1KJZA 4OHZA 2G3YA 1KO8A 5DI3A 1NVUQ 3EASA 2ASEA 2REXB 3U5ZB 4Z51A 2DHRA 1KOFA 1BKDR 4NU0A 5L3SA 3HR8A 3PITA 4GMDA 2QTVB 3WMFA 5JFGA 1II9A 4DHEA 2ZVPX 1P60A 3GJ4A 1VG9B 3F0TA 2OEPA 1Z0AA 2X2FA 3TRFA 2OAQ1 4XH9B 3C7KA 3EZ6A 3F3YA 4JZKA 4KYUA 4M4SA 4P4TA 3UANA 4URXR 3UIEA 3OIWA 1XEWX 1QG2A 3QBVA 4HAZA 1Z6GA 5JI3E 4V0LA 5DGXA 5TDHA 2RAPA 1FNNA 4HDOB 4LHZA 5BW8A 2G88A 3AQ4A 5DHFA 4A6PA 1DE0A 1QZXA 2EWWA 3W9YA 2BMDA 3G0HA 1TAGA 5TV2A 4AIIA 3BFKA 1F2TA 2FGJA 3QEJA 4LC0A 4QC2A 3SJCA 3WY9A 4IKEA 5ELXA 2PJRA 2GCNA 4HDCA 4CF7A 1G4AE 2ODEA 3KX2A 2XOKD 1FQKA 3N70A 4A82A 4ZKDA 2W00A 2FSIA 1E9DA 2Z43A 3BB3A 4LYFA 3FPAA 3K0AB 4XTCS 4KFSA 3G5UA 5E7IA 1NNEA 4ILEA 1KI6B 1HV8A 3NWJA 2VHQA 4JBWA 3B7GA 1Z2AA 4LJ5A 4QGHA 4QOSA 3BIFA 1Q20A 3RC3A 1YZTA 3ASYA 2GXUA 3MMPA 2RGBA 5CB6A 2H8KA 2JLVA 3BH0A 4DB2A 2JEOA 2UVQA 1C1YA 3I62A 1YZGA 4HLQB 4PHTA 2QENA 1CKEA 2VA8A 5C4GB 2V1UA 2HLDA 1UM8A 2OBMA 1H8EA 4OK5A 4LSGA 3VU9A 2FJUA 3CX6A 1YZNA 4LV5B 4OHYA 4URZR 3QXSA 2GCPA 2MSEB 1GIAA 1E9FA 1FNMA 5LB4A 2NO6A 2QORA 4WA7A 3SS8A 4XVRA 4TQUS 4BLPA 3E1SA 1W36D 1NLYA 3VR1A 4R71A 2ZUBA 3LLUA 4UNSA 3IQXA 3MFYA 1RJ9B 2FN4A 4NCJA 4DSUA 3VKHA 1MH1A 3K8YA 2X1VA 2CCGA 2BDTA 2XZLA 4RJLA 2WJVA 2ZETA 3WRXC 3AF4A 5FL7D 5KSPA 2WJYA 3Q7QA 2BJWA 1SVWA 1N6LA 1VMAA 2WWGA 4QHSA 4DXAA 2P6NA 4NH0A 1TF7A 2IF2A 2Q21A 3TUZC 1XD2A 1NBMA 1HURA 2JLSA 3NTUA 1ZP6A 3T1OA 3QSYA 3X1ZA 3IQWA 3IUYA 1YZLA 1GVNB 1T4GA 3A37A 4LJ6A 2IUSA 2D4HA 1AS0A 2C9YA 5EE1A 4DLYA 5DLQC 2HJGA 4EPYA 3MWJA 3LO5A 4Q48A 2V55B 1AKEA 1NBME 4CT5A 4IDQA 4MYTA 3IBGA 2R44A 1XZPA 4BEBA 2GCOA 4OI4A 1XDBA 5K8IA 5DISB 2GESA 2VIIA 2FZLA 1U90A 1OW3B 4BZQA 4C7OB 4AKGA 2HXSA 4F92B 3DHWC 1FTSA 2YINC 1XXHB 2AKYA 3PFIA 1KI8A 3AVOA 1Q22A 1MABA 1C4OA 3EIEA 2ZSFA 5JCZA 2O8FB 4P4SB 1U0JA 1JEEA 1OT3A 3Q85A 5DE3A 1E3MA 4AK9A 2QL6A 2ZE5A 1KKMA 5FOTA 5A5GA 4FMDF 2AN9A 4KVAA 1CR2A 2JGNA 3KJHA 4TSFA 1EG7A 4GOXA 1TU4A 4OQXA 3A1WA 3IHLA 3ZVLA 3PEWA 4XTRA 3PV0A 2WPDA 1OYWA 2ZRJA 4B2IA 2ZROA 3B9QA 1E69A 4PC1A 1Q44A 4PC2A 2IS1A 4PAQA 3REGA 3G82C 3O47A 1Z63A 1KYIA 4PZYA 2J0SA 4F93B 4Q66C 4Z54A 3T61A 2VH5R 4R9UC 4RKFA 4RSGA 4F91B 3GLGA 4NCHA 4DUGD 2RGGA 2P67A 3BJIC 4DDTA 1NN5A 2FNAA 2RH5A 2J7KA 3L0OA 1W0KA 2W2VA 4NL4H 4LJYA 5C2JB 4LK2A 3W6NA 4POAA 1Z22A 2O0JA 2AXPA 3PEVA 3H2YA 4DLUA 4F38A 2HYIC 2F3TA 4MUBA 1X86B 3THWB 4D0LB 1Z07A 2C95A 5HZHA 1TTTA 4C30A 2ZRBA 3PIRA 2FPMA 4B3DA 5FR2A 2ZYVX 3BB1A 2OCBA 2Q3MA 3CPHA 4F4IA 3QXJA 5HE9A 3DM5A 2REBA 3TNFA 4YMUA 1EWRA 5KDOA 4Q03A 4QBGB 4MRRA 1ZM2A 1SZPA 1CRQA 1QHGA 4HUQA 4H9GA 2BV3A 4ASUD 5L3VA 2EQBA 1RKBA 2ZAOA 221PA 2OLJA 4G5SA 2QY9A 4KBFA 1R2QA 4B32A 1IN5A 1OXSC 5JWRA 1U8YA 3VNUA 2A78A 2C8VA 4Q7LA 2XTMA 5J40A 1NVWQ 2XSZD 2VHUA 3QKRA 2YWFA 3ZDQA 4E09A 2G77B 2DCUA 1ZMXA 2O8BB 4Q1EA 1G8GA 2PZFA 4ZI3A 1JR3E 2IHBA 1D2MA 3IDQA 4HAWA 4I99A 1LFDB 4I1SA 1PLJA 2A2ZA 2CNWD 3RHFA 3TMKA 4C0QC 3THWA 3P26A 1E0JA 1ZU5A 4TYNA 5KU1A 3EG5A 1G20E 2Z6VA 4EPVA 2O8DA 2E87A 4DEXA 1HT2E 3AGQA 1GWNA 4P31A 4W5HA 4EPRA 1T3LA 4TSFD 1JR3A 1TMKA 1IM2A 3UK6A 1LY1A 2RGCA 2V54A 1M6NA 1N6OA 2V6IA 1VPLA 2PX3A 3AH8A 4PQYA 5H1YA 5JHHB 1WDTA 1C9KA 4IOKA 1CR1A 3K0FA 1RIFA 4EQ6B 4WOPA 4PQFA 4NYMR 2IT1A 2NZJA 4I4LA 3EA5A 3FFAA 2GJKA 2LKCA 2VLIA 3QE0A 4KFTA 4PPFA 5JBQA 4URWR 4BLTA 1VIAA 1P7CA 1KI3A 2KSQA 4OYHA 3SYNA 1KKLA 3CO5A 5A0FA 3LW8A 1U0LA 3NIBA 4NPHA 3DKPA 1XMVA 2IXGA 3FKQA 3NBYC 4PPNA 2QBYB 3Q7PA 2IS2A 4Z1MA 3NC1C 5KSYA 1NJGA 1G3RA 3GLIE 2GZHA 2O8DB 4NYIR 3U7EB 1D2NA 3E70C 1OB5A 3IGFA 4BFXA 2WAYA 2F7SA 4XVUA 1TNDA 2W0MA 1AJEA 2YWEA 3A1VA 4A2WA 2QMUA 5FBQB 4MGYR 3SU8A 4Z8XA 3U7GA 2VP5A 3I72A 1G7SA 2D62A 4IVRA 1GOTA 2MMCA 4TTRA 3PUWA 4FINA 4MGZR 1FX0A 4EPXA 2VP2A 5B30A 1N6IA 1LV7A 4KU4A 1N5LA 4PSVA 3SYKA 4B44A 2IYTA 3TLXA 2QP4A 5JJIA 2XTZA 2PL3A 1V43A 3LWNA 4PPGA 1S0UA 5KHOC 1E4YA 1Q1ZA 1HH4A 3KZ1E 4PO9A 3UWOA 2K5UA 1QHYA 2W2TA 2R9VA 3CW2A 3L8YA 2IYWA 3KQHA 2YYZA 3H0KA 2ZE7A 3QG5A 1AM4D 1U8AA 1EFRD 2BBTA 3HU1A 3EWSA 2QROA 3VR4A 4JL8A 4A4DA 1WE2A 3QY0A 4Q21A 3RRYA 1PLLA 4PPQA 3EAQA 2BKUA 1P62B 3EPJA 4NDZA 5EZ6B 2CJWA 3GJ3A 4JVMA 5IK2A 3KKMA 4GP7A 4CEHB 1ZC3A 1GM5A 2GXQA 2EFGA 2ODWA 3QF4A 5KUTA 5EP1A 1Z0FA 3QF7A 4V0ME 1EFHA 3SQWA 2P5TB 4B35A 5BXQC 2C9OA 1E79A 1Q21A 3B5JA 3T06B 4LPSA 1GRQA 1XBTA 3TSWA 3KXKA 3LY5A 3KKNA 2KI5A 2P65A 2QMHA 1DEKA 2ATXA 3QUSA 1GFIA 1ZNWA 3AF0A 2ZE8A 1SHKA 3SFZA 2PCLA 4MRVA 4XWOA 4HAUA 4DUGA 1KO7A 1JJVA 1G6HA 4Q19A 1IY1A 3LAWA 1P9NA 4WXRA 1NLFA 1Z6TA 2CDNA 1G19A 2JLZA 1S1MA 1T0JB 4TTPA 3CR7A 4U00A 4BASA 3MUFA 1CF4A 2HUPA 3WBJA 1N6PA 3K0EA 1Q1BA 4A9AA 4N3NA 5KDLA 1T8TA 3SC3A 4GZMA 1RRGA 3FHOA 4K81B 2V3CC 3N2EA 3ZIAA 4Q1CA 3ZD7A 2BCJQ 2IYLD 4Y0AA 1OPXA 4DLSA 1YRAA 3U60B 3AP2A 2R6AA 2WJGA 2ZJOA 2H92A 4WBSA 5JS8A 3LD9A 3ZJYA 3WP1B 4ZI2A 2IX3A 3MRSA 3VR6A 5IT5A 3X1YA 3AUXA 1A2BA 1TX4B 1H8HA 3OEEA 4LV6A 5FBLB 2E9SA 3HP1A 4QBIA 3RANA 4LC1A 1G7TA 1SKQA 3QQ5A 4EFMA 2LWIA 4L8GA 5LB2A 2WZQA 5FBWB 3W90A 2VP9A 2FSGA 3NKVA 1RC8A 2IYRA 3TAUA 1XEWY 1I4TD 2ZEJA 1VYUA 3U7FB 1YR6A 2QQEA 1ETUA 2ZJBA 4G1UC 4KV9A 1X3SA 5J4YA 2ATVA 3IHWA 1XX6A 4RZXA 1IXZA 5FUXA 4ZDKA 1N3BA 4R7ZA 2ZJ8A 3QKSB 1KDPA 3PUXA 5EE9A 3Q8XB 1AZSC 5BYKA 1NRJB 3SHFA 1D6JA 1OKKD 1W0JD 3IEVA 1Z47A 2EYUA 2FZ4A 4TYQA 3I92A 3K70D 5FTMA 4GMXA 4LHYA 1T6NA 3LQQA 4BLSA 4CT4B 2HXYA 5C1BA 1IXRC 1T5IA 2C96A 2ZI6A 3SZRA 5FPSA 5CDFA 5BYJA 4DLRA 4AKIA 1SXJD 2JLRA 4WZBE 5AWFC 3I8XA 1GAJA 2CHGA 4EPWA 5AJXA 3BFVA 1GNRA 4UXJA 4N0DA 3TSZA 4JSYA 1ZNYA 2VP0A 3IIKA 3ADCA 1NVVQ 3OEHA 1XTSA 2GJAA 2IEYA 4DSOA 4M1WA 1Z08A 4JLVA 3OZXA 3C15C 1Z06A 2PH1A 4M2LA 4IXMA 1X8KA 4CEJB 1JPJA 4AWXA 4D4MA 2F1IA 3BK7A 3L0PA 1N0WA 4JIMA 3T35A 3C5CA 2PZEA 2X77A 2QM7A 1UF9A 3LBIA 4PX9A 5KPJA 5L3SB 4BZPA 1F48A 1G17A 5EQTA 5HKKD 1KMQA 2WSSA 5K8UA 4Q9HA 5E7JA 5FOSA 3KQKA 4DLXA 4G5QA 1GRRA 1ZU4A 2J0QA 5L3RA 4LBZA 2SHKA 1VCMA 5D3MB 4M1TA 1H65A 1I2DA 2QBYA 5CDFE 2H7VA 4BQSA 1SXJA 2NTYC 4B3XA 2R6CA 1TQDA 2BC9A 5KTYA 4PAMA 3CRQA 2F1JA 3C16C 3R8FA 1NSFA 4JVLA 4LJ7A 2F43B 3AB3A 1DAIA 5TVKA 5L3QA 4DLVA 2J0UA 1GNQA 1QHHA 4Q5IA 4RZ2A 3B1YA 4WAUA 4ZKEA 3PEUA 1JBKA 2WKQA 4QM7A 1Z2CA 2FF7A 1RW4A 4G0NA 1JALA 4PTLA 1E0AA 5EP4A 1SHZA 2OXCA 1HT1E 1VG0B 4OQFA 1E1RD 2OESA 4GL2A 1K5GA 2FFQA 4PZZA 3KXLA 3OAAD 3RRMA 3I5YA 4KAXA 1R5NA 3UXMA 2HCJB 2H18A 2EW1A 2AXNA 3RS2A 4JJKA 3EZFA 2YKGA 3E2IA 1U9IA 8OHMA 3QVVA 2CCKA 2H57A 2HF8A 2ZE6A 2H16A 4EUNA 2C5LA 1UAAA 2FSHA 1T91A 1E2HA 2J3EA 3UMFA 4DJTA 1E9SA 4OI1A 4MKIA 4LWZA 1YHNA 4O3MA 2GAOA 2VBCA 3GLGE 1QHHB 5LBIA 5AUOB 1RE0A 2FFAA 5EXTA 3CPEA 3GD7A 3CF6R 1T5LA 1TUEA 2QMOA 3I3SR 4JKYA 5E3HA 4UNRA 1J7KA 3RS7A 3BE4A 4KFRA 3ADKA 2F3RA 3U44A 3AKEA 2XXAA 2QU8A 2PEZA 5CIWA 2AL7A 2XZPA 1VYVA 2ZS7A 2EYQA 2O5VA 2BVNA 4C0HA 3A8TA 3D31A 1EK0A 1DG1G 1DO2A 4TL7A 1BO6A 1F3OA 5CITA 2Z0MA 2X19A 4KHZA 4RVCA 1IY2A 2CE2X 2ODNA 2C03A 2DFTA 4TMVA 1GITA 1LS1A 1OF1A 1Z3IX 2IXFA 3B78A 4BFWA 5FPKA 4L9SA 2BM1A 2GILA 3CNOA 1E1QA 2JASA 4TLCA 2D2EA 5SZJA 3HPQA 3F8TA 3BRWD 4NONA 1Z8FA 4RFSB 5FTJA 4OQMA 1WA5A 2A3RA 1DAMA 3OFND 3EIQA 3RVBA 5JECA 4MDFA 4BZXA 3O8BA 2GCOB 5EP3A 2A30A 3AV0B 1FL9A 1OJLA 3R20A 2NPFA 4DCUA 1BYUA 3CWQA 1Z0DA 4WXPA 5GJVC 2XNSA 4CVNA 1GKUB 1XZQA 3DKVA 4ZCIA 2BMJA 2Q9AA 1Q57A 4NBSA 1X1RA 2RGNA 5M04A 3QKTA 1OV4A 3FB4A 4DT1B 4JT2A 2GA8A 4KJZA 1RYFA 1CULC 5JLJA 5JSZB 4Q4JB 4IOJA 4Q9IA 1W46A 4G01B 1DAHA 1E2LA 2CLSA 2YZ2A 3HR7A 4C0AC 5HPYB 3S1AA 1I2MA 2W6ID 4Z8YA 2Q0HA 3W8NA 4HLUA 3UATA 2J1LA 3PUZA 3SFVA 2XB2A 2W0SA 1US8A 1KAOA 2OSBA 3EWAA 2ZSEA 3ECCA 3T12A 3TR0A 2WWXA 1UPTA 1S3SA 1EWQA 4DRZA 3NG1A 3EARA 4HB3A 5DH9A 1YE8A 1T9HA 3I1FA 3PUYA 4Y0VA 3BAFA 4AG6A 4D6PA 4B71A 5JCPA 1Q1EA 1N5IA 1VECA 2AK2A 5FTLA 3THYA 4V02A 5EE5B 1W48A 2D7CA 2ZS8A 1E96A 2GDJA 1VIYA 2OM2A 4JBXA 1GSIA 3GJ7A 2X8AA 5CJPA 2FX3A 3WBKA 4JLNA 3B1XA 1YZKA 1U94A 1E2GA 1HE8B 1KTVA 3OF5A 5A4JA 2BM0A 4YXWA 2PT7A 1W2HA 1TPZA 2I4IA 3P27A 3AF1A 2ZRCA 4DC9A 2ODBA 2REOA 3C41J 3GLHA 3OESA 1XEXB 4JLBA 4TLAA 3T5GA 4E03A 3ETLA 1KJYA 4LX0A 2J7PD 1ZC4A 1T3HA 2NZ8A 5HE8A 4HLUC 2OCPA 3SDZA 4BE7B 4KFUA 4KLNA 4LI0A 4OL0A 2V1XA 3NH9A 2JLWA 1NG9A 2R8RA 3BGWA 4YC7A 5DN6A 3GLGB 3ADDA 1E4VA 4IDNA 1KI6A 2ZRPA 3LBHA 1G291 3MJRA 2GJ8A 3WXMA 3RS5A 2QQ0A 3A4NA 5TXGA 1UDWA 1G8FA 3ND8A 3D7MA 5DSZA 1NVXQ 2IC5A 1ZD9A 1GL6A 1WQ1R 4A0FA 4L15A 4JLJA 2RHMA 1KHTA 3CIOA 5CIQA 1M7BA 2B7BA 1W5TA 5BQ5A 1SVLA 2ZAMA 3W8RA 4TMTA 1ELOA 1ZJ6A 2YWHA 5G3YA 3U2QA 3THXB 4HB0A 1II0A 5DHAA 3FDIA 4BFSA 4HDQB 3VR2A 4DCVA 4JSTA 1LNZA 1W49A 1XTIA 2W6IA 4LHWA 2ZJ2A 4RZ3A 2FPKA 3U6BA 3BBPA 1S96A 1XMIA 3WYGA 4A92A 2AFHE 2XOKA 5JEDA 1R6BX 4GPTA 4US1R 4DCSA 3ICQB 4LBWA 1CRPA 4IDPA 1RFLA 1RJ9A 1W4BA 4HAYA 3PENA 4YDHB 2QAGB 3EA0A 3MWYW 4BEJA 4DDVA 3O8DA 2IYQA 2Z5FA 1XMJA 2H1LA 4OI0A 2VYFA 2YOHA 2ZI5A 1NN0A 1AN0A 4Q1BA 3MWLA 5FPYA 4QGAA 3NVAA 4QHYA 3WYAA 1ZM7A 4RD4A 5KDDA 1AS3A 2VSXA 1NSTA 1KAGA 2JIZD 1N6NA 3EC2A 4JLKA 5CLLA 1JR6A 1FMLA 4UJ3A 3T1TA 5B64A 3TIFA 1QRAA 4AYXA 1A5TA 2WJJA 4QBFA 1S9HA 3Q5DA 1EX7A 1A4RA 3QJYA 5AUNB 2GJSA 1E2NA 1KSFX 2EVWX 1VKJA 2RGNC 3GLIA 1FP6A 2JDID 3EIHA 4BLRA 1CP2A 3DMNA 5B2ZA 3UMRA 4A15A 2Q9BA 4LOAA 4AG5A 4DDWA 3K9GA 3WYFA 2GBLA 1U8ZA 1KI1A 3BS4A 1QG4A 3EPHA 1W7AA 2HCBA 2WIAA 4YLGA 4BFVA 4HATA 2C9CA 4B6FA 5KSZA 1QDEA 3DVLA 1A2KC 5CLQA 2EU8A 5IRCD 5GADl 2I1QA 4B47A 4C2TA 2AD5A 5GJCA 4RD0A 1EGAA 2NGRA 2ZRMA 4FD2A 4MKFA 2GEDA 3RWMB 5HTKA 2IL1A 2O8CA 5JI2E 4A1FA 1XRJA 2VQSA 3MCAA 4XSHA 4HLCA 2GWHA 3CX7A 2FSFA 2GZDA 3NBFA 2D2FA 3K9NA 2XITA 4CZ2A 2CK3D 3B9PA 2UZ3A 2F9LA 3P4YA 1ONBA 3RSOA 3A1UA 2GXSA 3A36A 4BWYA 1YQTA 4IRUB 1JR3D 5FI1B 5G41A 4MRSA 1OSNA 2RGAA 3T1VA 4S35A 3SJBA 5JJLA 2WSMA 1SXJC 1HA3A 2WWFA 3CZPA 4MA4A 3H4MA 4CYMA 1P2SA 2ZUDA 1EXMA 4UJ5A 2AFIE 4LYHA 4EJSB 2BBSA 2KBFA 1E0SA 5BN4A 2QEQA 4JLDA 1P9WA 2A5JA 2WJHA 1J70A 2P6RA 1Z6YA 2CEAA 1TUIA 4TMWA 3RNLA 3EPKA 5IF9A 2WHXA 3HJNA 3SJAA 3RDPA 4E22A 4DT1A 2GXAA 4NMMA 4Q9KA 4BFTA 2G0NA 5IHPA 2QP9X 2GAAA 4RY2A 3FMPB 3ZH9B 1PLKA 3KB1A 3VMFA 1ZM3A 2GK7A 4Q4JA 4QKQA 1VG1A 3CZQA 2RB4A 1YR7A 4UNPA 1G16A 4ABYA 2DB3A 1E32A 3ONWA 2F1HA 4A2PA 2QA5A 1GTVA 4HAXA 5B57C 4LJ4A 3AKDA 3NBXX 1QBKC 1UJ2A 1XFAA 721PA 4OK6A 1JPNA 1KY2A 3ZIAD 1ZCAA 3FOZA 1ZBDA 2B92A 1E9CA 3GEIA 5E7MA 3QENA 3AVXA 1SVSA 1XJQA 1EFCA 3V00A 5FFMA 3AKCA 2BCGY 5FH9A 2IYZA 1X1SA 3VR5A 2OCAA 1E9RA 4TYWA 1JI0A 2D7DA 3B1WA 1FW6A 1GILA 3AVQA 2VHJA 2O8BA 2OV2A 1XP8A 4RD6A 3THYB 2YVUA 4LBYA 4YMVA 1BOFA 1W0KD 2C99A 5KYKA 1E9BA 3OE7A 2ZI9A 5KNCA 4L5BA 1F2UB 1W1WA 1W0JA 1NN3A 3RAPR 3OHMA 1OXVA 1O3YA 3CF2A 5CYOA 2RMKA 3CNNA 3EZ7A 3OIYA 5CK4A 1G8YA 3DO6A 4ZDJA 3A6PC 2D74A 5HR5A 1G64A 4FCTA 2QSZA 2IYSA 3IO5A 5CK5A 4X8OA 4NZYA 1J90A 1G8HA 2BEKA 2J46A 4MKHA 3TW4A 1L7VC 4E5UA 4TMZA 1IY0A 4D80A 3TW8B 1X8LA 2DYKA 2ZYWX 1BMFA 2JLUA 3Q5EA 4B2PA 4KVGA 2G0TA 4PANA 1DADA 4HEJA 1G9XA 4QJ3A 4IEIA 4H1VA 1E9AA 1Q12A 5FPHA 2QMEA 2IK8A 2H17A 3QKRB 3QPUA 4MQBA 3ZQ6A 3J81k 3ZYCA 1U9IC 4YMSA 2IWRA 2OBLA 3WHLA 2H5EA 2JCSA 4LUCA 4FIDA 4LDJA 1MO3A 3I8SA 1XCMA 1KO4A 2O0KA 2VSOA 3UKDA 2AWNA 3W5IA 3KQUA 5BN3A 1T3SA 4ZCMA 2QE7A 3THXA 1FZQA 1G4UR 5JWHA 4TWZA 2HT6A 1G5RA 3SN6A 3DZDA 1Z28A 3UWKA 3SR0A 4B34A 4CRWB 3H86A 2BJVA 2B8WA 1FX0B 2JJ8A 4AURA 3U4QA 4EAQA 4DCTA 5H68A 3ZVNA 3B60A 4PSKA 4ZO4A 3HDTA 2WWIA 4TQAA 5DI3B 5C46F 4QJ4A 1E2MA 3KL4A 2QRZA 4L4UA 1Z6AA 2WVJA 2F55A 2XEXA 3CPJB 2DBYA 4OBEA 4BFZA 3RABA 3QNUA 1DG3A 1XXHE 4HZUB 4TMXA 3KKOA 2IUUA 2IYVA 2ZI7A 3O8RA 3H84A 4LY6A 1MOZA 1QHXA 4JL5A 1IHUA 4NKRA 1Z29A 1D9XA 3I4LA 4PC6A 2ZM5A 5FTNA 4FMCB 3L2OB 3ZVRA 4M0LA 1MRSA 4Q4LA 1ZM9A 2F43A 1HEIA 1ZUIA 4M22A 2OHFA 2RGEA 1QHSA 2PLRA 2ZYUX 3GCGA 3RWOA 2B8TA 4JS0A 2I1VB 1N6HA 3MLEA 3QXXA 3I32A 3U3KA 3QKUA 1II8B 3MGCA 4FN5A 2PLFA 5J4LA 1AA9A 3EZ2A 4OJQA 4Z1MD 2BMEA 3A1TA 3LNCA 1YVDA 4HB4A 1FQJA 1OE0A 3W3ZB 3OAAA 1NG1A 2HJVA 2ANBA 1D8TA 1L2TA 1D9ZA 2CL0X 4TLDA 5GJWC 2O0HA 3KFVA 2R6DA 4B2LA 2A7QA 1L8QA 1W4AA 1ZIPA 2MSCB 5EP2A 3DMDA 2Y8EA 1KK3A 2DFNA 2B6HA 4BLOA 5DI9A 4Q4HA 3DZ8A 2DY1A 1PJRA 3WNCA 2IUTA 2QRNA 4JLAA 4I1UA 4A8JC 2QT0A 2BMFA 1ZUHA 1KK1A 1KJWA 6Q21A 2BOVA 2I3BA 4PO1A 1NP6A 4A36A 1DBSA 1E2JA 4FMCF 4GT1A 1JQLB 2C2HA 2WAXA 4LHVA 3DM9B 3QF4B 1Q3TA 3KQNA 3WHKA 4JVSB 1S4QA 4GP6A 3TVDA 4LCBA 1QVRA 4JVNA 5CJ2A 4EDHA 5KPDA 5EXXA 2CXXA 3O8CA 2P3SA 3K9HA 4G3XA 2KBEA 2IS6A 4C2UA 2GF9A 3GLHE 3TAHA 4YONB 2V7QA 2JA1A 2PX0A 4GDFA 1BH2A 2WMNB 3ICEA 1G5TA 3B1VA 5SZKB 4XWKA 4MGIR 4O0MA 3GJXC 1K6MA 5G53C 4MYCA 4ESVA 5JEEA 4ASUA 1TQ4A 2WKPA 2NQ2C 4PFSA 1OXTA 2FDCA 2ZJYA 3D6TB 4EFNA 1ESMA 4QGFA 2QG6A 4OK3A 1KDOA 2ZJ5A 2PMDA 2WOOA 1R10A 1WMSA 2NIPA 2R2AA 4URVR 2E1RA 1OIWA 1GP2A 2ZRKA 3V4RA 4MH0R 621PA 1OXXK 2VHCA 3KKPA 1UDXA 3TUJC 3MSXA 4HZIA 1DPFA 3ZD6A 2DFKB 4XVQA 4QNMA 1XD8A 2G6BA 4O25A 3T15A 4C7OA 1B23P 3LFUA 5LPNA 1UKYA 2X2EA 2EFEB 3HYTA 4M53A 4RD3A 5BN5A 4RCYA 1E2FA 3UG6A 5LDDC 1TL7C 3R7WB 1XXHA 1F60A 3HYRA 3A1SA 2OE2A 3KJGA 3W3AA 3PXGA 2J41A 4EKDA 4ZDIA 3M0EA 2PMKA 2JJ2D 2KWIA 4TL9A 4Q4AB 4JLOA 3S1AB 1ESNA 1GKYA 1TADA 2CLDX 3EZ9A 1TEXA 1E2KA 1IOZA 1KSGA 1Q1QA 3R9XA 3PR1A 4EPTA 1OH5A 1BIFA 3AVWA 3SEAA 1AGRA 1DO0A 1ZINA 2ZPTX 4Q1FA 5HCNA 3WMGA 1PUJA 4JYBA 4C9BA 1SVKA 4XJXA 3M4YA 3NHAA 4QG7A 4NYMQ 4YXWD 2NPIA 2KJQA 4U5XA 4FCWA 4DVGA 3X2SA 3B85A 3X1XA 4XD7A 1E94E 4M9ZA 4R2HA 4FI3C 5D3QA 4QGGA 2Q6TA 1WBBA 1N25A 2JJ1A 5G3ZA 3TE6A 3HPRA 3R7WA 4B3BA 4QNRA 3U6KA 1NMYA 5KNBA 1K5DA 3FKSD 1S2MA 1KZGB 3EC1A 3KUCA 1HYQA 3CH5A 3W5JA 4JYCA 4TTQA 3LV8A 1XU4A 4I81A 4LJ9A 1CEEA 1GUAA 2D06A 2DWPA 2ZI4A 1IJEA 1SVMA 1PZNA 1MO5A 3GLHB 4J0QA 5EZ5A 3BB4A 3NXSA 3U61B 2PBRA 2LCFA 4KBGA 4A0RA 2ZSBA 4HUQB 4FW9A 2PZGA 3I73A 1DARA 3KUDA 3CRMA 3ZGXA 4HAVA 4G5RA 3RSLA 3V9PA 1KIMA 2RCNA 3PUVA 4B74A 4JKIA 3K70B 2HV8A 2R6FA 1GRNA 4PR0A 1UBCA 5AUQA 3K0AA 2ZSAA 2YHSA 1N0UA 1J8YF 1AK2A 4B33A 2CMKA 4XD7D 4TL6A 3VQTA 4MDEA 2FE4A 1OIVA 1VTKA 1G7RA 1FUUA 3LLMA 2J87A 3DL0A 1P2VA 2V4ZA 4UXIA 1TF5A 2FFBA 1EESA 2ECKA 1E2QA 1XTQA 3VHLB 1UEIA 2C98A 3IO3A 2G1JA 3IILA 5HCIA 1KMHA 1XEXA 4AI6A 3AUYA 1Y63A 3R9IA 2N46A 1U98A 1CR4A 2QM8A 2OBNA 1XTRA 2BEJA 3MAAC 4DIDA 4TZ0A 1JAIA 3L0IB 4C0BA 4TZ6A 1IN4A 1Z0KA 2HEIA 5L3QB 4RKEA 3RC8A 1YJ5A 3SOPA 3VR3A 3DDCA 2AWOA 3FYHA 521PA 4QM6A 3NC0C 4PHFA 4QL3A 1R8QA 1P5ZB 4U7DA 2IS4A 3Q9LA 1S9DA 4Q7MB 2ORWA 1NF3A 1Z6XA 4GZLA 3GLFB 3WRYC 3L0SA 1P2UA 1ODFA 1PUIA 4GRAA 4KYIB 4V0OA 1QVAA 4Q00A 3EX7C 2RKOA 3FMOB 1NL3A 4C0LA 3THOA 3TVTA 2VEDA 1R7RA 1NVVR 3K09C 2ZR7A 4YDSA 5JHGB 2Q3HA 4BPBA 1KMHB 1FUKA 4KO8A 3FTQA 3EW9A 1XEFA 2XAUA 4JBYA 4FCVA 4ZIRB 3QBTA 4ZCLA 2QAGC 4M9XA 4KSBA 5C18A 5IK2D 3FWYA 4ZPXA 1R0XA 3QPVA 2XJ4A 4LBVA 3ZQJA 4Q9JA 2R6GA 4BFUA 3I5XA 1TQ2A 4W5WA 3N2IA 4RD2A 2WV9A 3LBNA 1ZUNB 3ZS9A 2ZIAA 4YQFA 4DZZA 1ZIOA 1XTKA 3K09A 1EFRA 1SKYB 2NO1A 5J4KA 2WM9B 5B58C 1NIJA 4JT4A 5FL7A 1OHHA 3FMFA 2WTUA 1NMZA 3OIVA 3U44B 2YC2C 2CCJA 4BRUA 3QXCA 3OIUA 1E1RA 4PC3A 4NYJR 1OB2A 3VX3A 3LW7A 4JL6A 3RYTC 1XPUA 4Q02A 2O8FA 1JNYA 1M7GA 4QRHA 2O8CB 2XX3A 5CM8B 2PT5A 2JLYA 5G40A 4D25A 3NBZC 3KTAA 3SHWA 1XJCA 1XNJA 4DCNA 3RRNA 2P5SA 2XTNA 2FMXA 4E07A 4CEIB 1MO6A 5TMPA 2O8EB 3IIMA 1E6CA 3WP0A 4HUTA 2J59A 4CEHA 4UNNA 1JB1A 1X6VA 4ACAA 1ZCBA 1W44A 4EJSC 3AF2A 3NDBB 1P61B 1AKYA 1N6RA 1WB9A 1XPOA 1J99A 3P1JA 2ZI3A 1M34E 2ZU6A 2IBMA 1JXMA 2OUKA 4LHXA 2KB0A 2ZXUA 1ZYUA 2W2XA 2GVZC 4NHOA 2NOAA 3PG5A 3DOFA 4PSAA 2ZVQX 4WZAE 2WIBA 4X8LA 3C4JA 1CBUA 1SGWA 2XSZA 3KFXA 3SYLA 2LKDA 1MV5A 2OCYC 4JMPA 1M7HA 3EPLA 5AK0A 2RGDA 1E2PA 1E1QD 3PEYA 4G5GA 4IHQA 2ZRFA 4Q18A 1T8UA 3VU9B 4CEIA 4R98A 4KODA 2F1RA 4NP6A 2FG5A 4P3YA 1OFIA 3AGPA 1KGDA 1COWD 1SVIA 1AQUA 2DFLA 3SBEA 2GVDC 3T34A 2HF9A 2JAQA 2QUZA 3ZS8A 3VKGA 2ZR0A 5JS7A 1N5KA 3DEFA 1KSJA 2A9KA 1HUQA 1W36B 2P2LA 1GL7A 4EJSA 1DTSA 1COWA 2ZREA 2W58A 1A7JA 1XF9A 2R65A 5E4FA 2VTKA 3VKWA 1LB1B 5DYGA 1JEDA 3AP1A 4UNQA 3SI7A 5FR1A 1F6BA 4KLZA 4JLMA 4C3ZA 1V5WA 2CL7X 2ZR9A 3KB2A 4NCKA 2ZRDA 3NEJA 2IYUA 4V0NA 4XOIA 2B21A 3TR5A 3X1WA 1G7CA 1U99A 4D0NA 4M1KA 4TLEA 4LPKA 4IFEA 3GP8A 5FPTA 1G5PA 2OG2A 2ORIA 1W4CA 4GOJA 1ZD8A 3W6OA 1KO1A 1N0VC 4DLZA 2ZRLA 1YZQA 2YV5A 1OFHA 2WPDD 1X8JA 4Q9LA 1UBEA 5AR1A 4RD1A 2WWYA 2BWJA 3PVSA 4D4KA 2QGZA 3R8CA 4P33A 1ZNXA 1NIPA 2Z4RA 3I61A 3BC1A 1TQ6A 2ZRNA 1OH7A 2WWWA 3GLFE 5DYIA 2NO0A 5FOXA 1E98A 4PC7A 2MMGA 4PAOA 3Q72A 3FMIA 2EFHB 1XPRA 4A8JB 2EWVA 1Y3AA 4C0SA 3AVVA 4O2RA 3MWKA 1NBMD 1VG8A 2QT1A 2C77A 1L4YA 2PCJA 4TN1A 4P4SA 1AZTA 1KK2A 1A82A 4A2QA 4CIDA 4LGMA 5JSZA 1EX6A 2JIZA 2F6RA 3P32A 5JMTA 3AVYA 1BS1A 4UKDA 4WIAA 4Q1DA 4US2R 2QTHA 1Z5ZA 2JATA 2GETA 3LVRE 4NCNA 3K0CC 3FGNA 4P0TA 3U3OA 2BBWA 2JLQA 5AJWA 2ZSDA 4BUJA 2FOLA 5DNYB 4OHVA 5EXPA 1US8B 1W47A 2A5GA 4X8MA 2QAJA 2UKDA 3GEHA 2Z4SA 3FE2A 3CX8A 3QOFA 3VAAA 5HKKA 3U4QB 2WOJA 2GK6A 4WZ6A 3SQXA 1DAGA 1F2TB 4XWAA 3ADBA 1P4SA 1VDZA 1YRBA 2FGKA 4CEJA 1OFTA 3BD9A 3KJEA 5AJZA 2QPTA 3T1QA 4BFYA 1GG2A 4IFBA 1XCPA 3PJRA 5IDVA 4CW7A 4HB2A 4NE2A 2N1BA 1KK0A 5DN6D 1OKKA 1AIPA 3BWDD 4B3CA 4IXNA 2ZRHA 4UXHA 4B43A 4BLQA 3CF0A 2FEMA 3UG7A 1P9RA 3A4MA 3CRW1 3VFDA 5H70A 2HT1A 4B75A 1NY5A 2VP6A 1SXJB 2GHIA 4YMTA 1M2OB 1R0YA 5K8LA 2CL6X 3T5DA 1AGPA 2HDNB 3B2EA 2FPLA 3AP3A 3GPLA 1KI9A 2QGNA 5FOWA 3VNVA 4US0R 1VHLA 2GZAA 1CJVC 3RS3A 3AVUA 3M1IA 1WXQA 2G9NA 3OE7D 1MO4A 1G1MA 2QZ4A 2J0UB 2ZTSA 3CUEF 2J45A 2W6JD 2IYXA 1II8A 1HE1C 3ZZUA 4MRNA 4DEYA 5AJYA 2WKRA 3K0FB 3R9WA 5EE0A 1R0ZA 2HLDD 1UBGA 3ASZA 4S2EA 2OFWA 4KXFB 1LF5A 2OLKA 2XB4A 1BMFD 5CYPA 3A4LA 1NKTA 3BH6A 1WF3A 2CLCX 3NEYA 2FA9A 3SBDA 3AF3A 3TK1A 3WNDA 2VP4A 4LJ8A 4HSEA 3VHXA 4HI0E 4UQOA 4GBMA 1KI7A 2VO1A 2ZU0C 1IN6A 3JVVA 2FU5C 4W7SA 1DAKA 4DSNA 1RRFA 1T0HB 2CVFA 4II7A 1SKYE 3KTAB 5DIFA 2BBOA 5TARA 4DIEA 4MUAA 3IPYA 4Q1AA 4D4LA 1KSHA 2A5FA 5FL3A 1DOAA 1NMXA 2ZRGA 4C0KA 2ZJZA 3SE0A 4C4PA 4ERNA 3TQFA 2KE5A 1IQPA 1FFHA 3ND9A 4LYAA 3B1ZA 2FFHA 5SZIA 1S8FA 1E2IA 4EQ6A 1F5NA 4KCGA 1ZM4A 2XGJA 4TT3A 2O52A 4NTZA 4PZLA 4V0MA 4PXAA 4N0EA 1HQYE 3P4XA 3U7HB 1IBRA 1GDDA 1GNPA 5C4MA 5H8WA 2IA5A 1FP7A 1KDRA 4QJ5A 4LRWA 4Q01A 4CDGA 3GEEA 3RS0A 2NO7A 4A6XA 1CS4C 5EJEA 2QPOA 2GEUA 4DWJA 5KOYA 2WJIA 3E5HA 4AKEA 1D5CA 1R0WA 4JJZA 4XIGS 4ACBA 1F2UA 5F98A 2G1KA 1Z83A 5JRJA 4TL8A 1U0HC 1KNXA 5JWOA 4YMWA 2HYDA 3WNBA 2N42A 4M1YA 4NYIQ 2OXRA 4B3FX 2CJWB 2Q3FA 3LDAA 4DLWA 4ON9A 3IEUA 3GLIB 3FFBA 3QI2A 1TEVA 1RRPA 1GZSA 1U2RA 1G3IA 2OFOA 4B3GA 2VL7A 2ZQ5A 3BH7A 5LD2C 4AC9A 1SXJE 5FUYA 5L8VA 5TY0A 1J8MF 4D2IA 2CVHA 2OFXA 4MYHA 4GOKA 1E9EA 4PHHA 3C5HA 4OKSA 4K46A 4WW0A 2W83A 2VF7A 1NY6A 2TMKA 4LJAA 3CRVA 2JLXA 2GEVA 1OLOA 1VCNA 4IJMA 2VPPA 1WP9A 4MKGA 2V7QD 1W36C 4I1VA 3MD0A 2GRJA 1B0UA 2PEYA 1RVDA 2AX4A 3GFOA 4IDOA 3CLVA 4B6EA 3GFTA 3HU2A 4M1OA 1G3QA 4OI2A 1LF0A 5JZVA 4QHTA 2XJ9A 4U02A 4IVQA 2AD1A 3TSOA 4LZZA 4NYJQ 5GJBA 3TGPA 4MYUA 5SZHB 3TJZA 1E2DA 821PA 2WMOB 3AKYA 2GTPA 4DSTA 1P6XA 1QF9A 1QHIA 3P20A 3CRRA 4G5OA 2BKEA 1PV4A 3HWSA 4W5JA 1PVOA 1KZ7B 1YKSA 4HLDA 1QHNA 3QXHA 1R5BA 4R2IA 5J47A 3AM1A 2A5DA 4NCIA 3Q3JB 4IW3B 5F3WB 3ZZ0A 4D0GA 2VRWA 1OH8A 2ERXA 1YZUA 2ZS9A 2ORVA 4A8JA 3CH4B 4M8NE 3IKJA 3TKLA 4W9MC 1S1CA 3A58B 4RZUA 3VTKA 3BOSA 1GKIA 1DAFA 1VCOA 3GJ8A 4OHWA 4AD8A 5JJKA 2FWRA 3W34A 4DKXA 2P6UA 4FWIB 1UBFA 5D3MA 5BWMA 1ZVQA 2ZYTX 4L16A 1M8PA 2QE7D 1ZAKA 2VSFA 4GI7A 2QSYA 3LA6A 2R62A 2C78A 1DELA 2MSDB 5FBVB 4DBLC 2D3WA 2GNOA 421PA 1CJUC 4V03A 3X1DA 3HU3A 4MGKR 1L4UA 2F9MA 2CNWA 2J5XA 2QI9C 4V0KA 2GBLC 1CJTC 3NH6A 1KO5A 1LVGA 4B48A 4B76A 3MJHA 2WWHA 2BIFA 2EFDB 1W5SA 1YR8A 3LXXA 3GJ0A 2L0XA 1P72A 4DDUA 1KI4A 3BORA 1NN1A 2NG1A 2DWOA 2P0EA 1XB2A 1FTNA 3V4FA 2J7PA 1NI3A 4HZUA 3RS4A 3IBYA 3LX5A 2XNDD 1SULA 3JZMA 2GKSA 2CHQA 4K8OA 2AR7A 4QBHA 1IN8A 3ZZTA 4M1MA 4TYYA 2OAP1 5GVRA 5KO2A 2FH5B 1MKYA 2UZIR 3IIJA 2PJZA 3K53A 1XWIA 3JZAA 3UPUA 2YOGA 3UMSA 4D82A 1N5JA 2A5YB 1LW7A 1NLZA 3NHBA 1G6OA 4F4CA 121PA 1H8HD 3OEED 4BECA 1VCIA 5F9FA 1DAEA 5P21A 1Q3HA 5EE3A 5JRZA 1UFQA 3U3MA 1D2EA 1U81A 2WICA 4BGDA 1KY3A 1IONA 2QAGA 4Q7KA 1MRNA 1EFTA 2ANCA 1P75A 3NDPA 4MRPA 4PO8A 4OHXA 1CTQA 3DOEA 2EFCB 1IJFA 4B73A 3OEHD 3QIAA 1W2GA 3RRZA 5ANRB 1YR9A 3FHTA 1ZRHA 1FMJA 2ZRAA 1E2EA 4TT3D 1MR3F
chains in the Genus database with same CATH superfamily
1DQNA 1JP7A 1OX4B 1JIUA 2CDRA 2EIHA 4K9SA 3RUEA 1G3UA 4M9SA 3HDYA 3I01M 1P2TA 5FTWA 5HKOA 3HJRA 5FI0B 4ITRC 1DINA 1UDCA 5AW3A 4KI7A 4AZWA 2R5WA 4RFSA 1T15A 4PIMA 3UPTA 1HNXB 1N34B 2WBLC 1UKVY 3PCRB 2YJ3A 1WW8A 3CONA 4ED9A 1LDYA 2Q49A 3DBVO 2HKIA 1TDJA 3FNRA 2GS9A 3GMTA 4GSYA 4N5LA 2PO5A 2VTBA 1FB5A 1E89A 1QIFA 3BFXA 3GRFA 3KKQA 5ISMA 3G13A 1NVKA 1XCGB 1BRMA 2CBZA 3AEQA 3R6DA 1T13A 4KOAA 4F04A 1K8RA 4I08A 3SEQA 1KNQA 3F1KA 3KEQA 1G8JA 1HY3A 4HWKA 4RM3A 1OGYA 1CB7A 1L4FA 1SC4A 4Q7JB 2ONZA 3DZJA 5DV9A 3BTUA 2NSHA 1YUMA 2IHYA 5A71A 3WLMA 5F23A 2AKAB 2PL9A 3DCIA 2Z08A 3WLKX 3D4PA 3EGEA 2JZNA 4CL8A 1Y8CA 2CDCA 1OFUX 2V6JA 2QQGA 3ORSA 2A58A 4BAGA 1VHTA 5CMLA 5EJ2A 3RIGA 4HVLA 3G5LA 3D7KA 1E3SA 3GW8A 3SHVA 1HKHA 1L4BA 1TKAA 2AKEA 1HZZC 2ZJ0A 5CB8A 1ZMTA 4BBPA 5F9HA 3EVFA 4KE6A 3FKSA 4DLTA 1HQCA 1TF2A 5J5CA 4C4RA 1HTWA 4JYAB 4WWHA 2O3RA 4CF6A 1EYZA 1P7YA 1XTPA 3PNOA 5KQRA 4DQVA 1JAHA 3AUKA 4EG4A 1J00A 2O2GA 4KN5A 1A50B 1N92A 4JLPA 2FLKA 3M4XA 3ICPA 4C14A 4YRSA 2HU8A 3AEQB 3QVGB 5C51B 1BDHA 3D4NA 4G5HA 1YL7A 3ZDCA 1V7PC 2PS3A 5EHIA 4AP6A 1RPTA 3G8DA 2G7MC 5FUWA 4CQJA 2KM1A 1T4CA 4H4DA 6AT1A 1L5YA 2PO7A 3R7NA 1E79D 4YPVA 4HYYA 2P4UA 3F90A 5IXJA 3AZQA 2ZCJA 4DTCA 1TCCA 2HREA 2NUPB 1O4VA 1LI7A 3RT7A 3GLRA 3A9VA 1H6DA 4BMYA 2Q28A 4YRKA 1V45E 2G63A 2QLTA 1PNVA 1Z2EA 2VJQA 3E15A 4LG1A 4N1AA 1DVRA 3EAFA 3N53A 1XD2B 2BCEA 2PXHA 3SQLA 3L0YA 2EXXA 4X44A 4B6GA 4LI3X 2B7CA 4LY9A 5LLDA 4UVEA 1JQKA 5G4LA 2DWQA 1IBLB 1TO6A 1T9CA 2X7JA 3B8HA 3GNLA 3K0SA 2G83A 2JJ1D 3FZEA 4K5QA 2QJTA 2IP4A 3LCUA 5EZSA 2YNMD 1CHNA 2Q29A 2FUG6 2GUWA 1CU1A 4UHCA 1H9CA 3GAFA 4F4JA 1GGNA 3CUYA 3NYIA 4IKOA 2JD0A 1H22A 4S1VA 4XGKA 2QN7A 5AK3A 3ENZA 2I8AA 5AH0A 3KYDB 4OM8A 4X7RA 2X0FA 3EISA 4RDCA 3AFNA 1AS2A 2HCFA 3FYSA 4U39A 4ZU3A 1IHXA 5F2EA 4MQEA 1UEJA 3SNHA 2J31A 5GMOA 2BN4A 1SQ5A 4P7BA 4DMKA 1VPDA 4WN9B 2AI1A 3B13B 3ZZNA 2JEZA 3TQCA 3SBXA 4RZQA 4A73A 5AVTA 1DHTA 2JDIA 4NESA 5B37A 4AYTA 2HM7A 3KSRA 1MIHA 4KIUA 4E5MA 1ECFA 2F67A 4EIWA 2C5HA 3JQRA 5FTKA 5EUQB 4ZYUA 3HSYA 5FUVA 1OWMA 4W8GA 1JEQB 3R3YA 2QTGA 3ZHXA 2Z2JA 5E1BA 3H1TA 5GVSA 1NYLA 2NUTB 3D8RA 3K9LA 3LTEA 1BXRA 4HAOA 5SY6A 1G41A 4M7RA 4NE9A 2WUVA 4OYYA 4AU1A 1T29A 1OXUA 1SC1A 1K7YA 2E4AA 4NCBA 4F56A 1MZPA 1M6VB 2IEZA 2W5UA 2YHUA 3F67A 5KZMB 2AUNA 2VS1A 1I5OA 3UEOA 4TZTA 2C2YA 4O4HB 1F7VA 2JFUA 1J4AA 2NO9A 2O7SA 4MQLA 5HDQA 1RHRA 3HXOA 1LD3A 1SURA 1ZSYA 3CNLA 3I58A 3S6JA 3MWEB 3UV6A 3VVLA 4ZDWA 2QNRA 2ONKA 4OQNA 3RARA 3RUIA 1RP1A 2QRPA 4ISCA 1EFUA 5LZ9A 1XD9A 3D1VA 3MQFA 4ZT5A 4YT4A 3BSSA 1RYYA 4K26A 5K0NA 1UUFA 2FR8A 3WMRA 2FEOA 4H17A 4KITB 2Q0QA 4F45A 3OQMA 1E99A 1UBJS 2NU9A 3FPGA 2IUFA 4ML3A 4MWGA 4P7KA 1RQRA 2EKQA 3WLQA 4QLBA 4IUYA 4WVFA 1R66A 4HDAA 2YJTD 3V7WA 3EGOA 4OHFA 1KC3A 2OGWA 2AV6A 4QX6A 1XJ0A 4BRSA 4DSZA 1AH2A 4HX5A 5HZKA 4F1JA 4N41A 1Z0JA 1X2EA 4ATNA 1R4AA 1VSTA 2XE8A 1C7JA 1P0FA 2QLMA 1PCXA 3FSEA 4EL0A 4GL4A 4Q47A 5F33A 1RZ3A 1SBYA 1YB4A 4QPCA 3C14C 1CJMA 3WDLA 4YR9A 3GN2A 5ESDA 4AZ3B 3PGMA 2X0EA 1FPMA 2IYPA 2VQDA 5A0VA 1UBNA 2HQSA 4YP6A 1ZD2P 3VZCA 2NXWA 2J3IA 2ONCA 1M74A 2ZIEA 5LD2B 4D26A 2GJ9A 3PHGA 4YJHA 4OG2A 4W82A 3ZU6A 1LS6A 1W2WB 1YT5A 5FLKA 3TQTA 4TLBA 3RBVA 4PZUA 3D8BA 2A9FA 2YC4C 1YKGA 2VDKB 3LLSA 1WX1A 3JQ7B 3ZLJA 1W8IA 4I6GA 4PIVA 5K4HA 4WASA 3VO2A 3ZWNA 3HA7A 4JQSA 3ZU4A 3PXCX 1TK9A 1Q95A 2VZEA 5TF4A 2PJUA 1JHMA 4Z51A 3NHLA 2DHRA 1KOFA 1BKDR 1MX1A 3CCCA 2R8ZA 1T34A 4FK8A 1NVEA 1O5TA 3HR8A 1K9VF 3PITA 4D8XA 2B9VA 5L6MB 5JQGB 1I32A 3IXMA 5JFGA 1VBMA 4YJFB 3JYOA 3MLAA 1K1EA 4DMFA 1VG9B 2GCIA 4P4TA 4AP9A 3UANA 2AIRA 4X61A 1LBQA 3R77A 3VSDA 1KDYA 1GGKA 1XEWX 3KQVA 1QG2A 3QBVA 4ZQIA 4CIVA 5THKA 4C7VA 4V0LA 3LKZA 3A4TA 3A6ZA 1EDBA 5CVEA 3U17A 5HMLA 4Z53A 4JENA 3WS7A 2BSQA 3I01A 1ZMBA 3AETA 2G88A 4A6PA 1J39A 4IIBA 1DE0A 2OM6A 3FBTA 4Y67A 3BFJA 2H6EA 5C53B 1F2TA 4LC0A 5LMZA 2AUMA 3WKBA 1TI7A 2VCYA 1YB7A 5JSQA 1KEVA 3ELYA 2HBZA 1LRJA 4HHEA 4QYIB 1XZCA 2XT6A 4HDCA 2QDKA 4CF7A 2ZFUA 1W19A 3DQZA 3FMGA 3EUFA 3UK0A 1E9DA 3DBLB 2Z43A 3T1YB 2J6BA 5JNVA 3K8ZA 3FPAA 3K0AB 4I4CA 3ZHOA 2CY0A 1N2HA 4CN9A 1C9JA 2I6QA 1FDIA 3NWJA 4JBWA 4MX8A 5TPWA 1Z2AA 2IOFA 3BIFA 3PGLA 2AH5A 4XI9A 5H4GA 4WV3A 2GXUA 3OZEA 4TSRA 4AO8A 3ONNA 3I9V6 3L9XA 1J0EA 1QR2A 2ZQYA 4YV0A 3QU9A 4PHTA 3AR5A 1JG7A 4ZD6A 4D43A 3N28A 4MR7B 1S2GA 3D8HA 4FOPA 3CX6A 4G6ZA 1JZSA 1YDFA 2GCPA 2AOTB 4NBUA 1EFAA 4NATA 1D7OA 1QIJA 1E9FA 1FNMA 3LVBA 3OQ1A 3BMOB 3OCXA 4YRTA 4ZVPA 5LB4A 4AWAA 4O2BF 3ZDXB 3WAJA 3BXOA 4XQEA 3LL4A 2LBPA 3KV1A 2QORA 3NDRA 4WA7A 3MGAA 3SS8A 3BJZA 4GG1A 4TQUS 5EIXA 2OL4A 4HWTA 1NLYA 3VR1A 1QRDA 1T5SA 2LR0A 4QTYA 4EITA 3G2QA 2Z8XA 1SFRA 1RJ9B 3I12A 3O03A 1EVLA 5T4FA 1EHCA 2GZRA 5LIRA 3MCUA 3RFVA 1RADA 4RJLA 1JG4A 3GVXA 1GZ7A 4FP9A 4KXVA 4MV6A 1FFYA 3QLUA 3WRXC 1CIJA 2NZVG 3AF4A 4ENSA 2WJYA 3JQCA 4KK4A 4GRIA 4C7MA 1XTBA 2BJWA 1SVWA 5HCUA 4P3PA 2O3TA 3G7NA 3HRKA 4QHSA 4KQGA 1FYFA 5IUJC 1ZI9A 5K2OA 4NH0A 3HLTA 3UJHA 1TF7A 2IF2A 1ZVJA 3CUVA 3MQ4A 3TUZC 3Q3GE 2JLSA 2XZTA 1XR3A 1ZICA 3NTUA 1ZP6A 2CFSA 5COBA 1M0TA 1MB3A 2QRMA 4G0YA 3X1ZA 3IUYA 4R3NA 2V98A 2IPLA 2F90A 4OHCA 4Z4CA 1IEWA 1LEHA 2D4HA 2F59A 2JPDA 4YMGA 4X85A 4DLYA 3HCRA 3URMA 2E4XA 2XA1A 3DDNA 1P0MA 4J7XA 1GSOA 4N03A 5FNVF 1OMOA 1H69A 1UWKA 4MYTA 5BOVA 3IBGA 4DFDA 3JAKA 1XZPA 1SB8A 1JEYA 3INNA 3HKEB 1BMQA 1ZZGA 4OP1A 1C0LA 1ODJA 3NFYA 5DISB 2GESA 1A9YA 1U90A 1C2YA 3CT4A 4C7OB 3QU5A 4K3VA 3C48A 4K1LA 3GC6A 3SXPA 4C0WA 1KEEB 1QH8B 2NPOA 3RC9A 3VGPA 1B2LA 1KI8A 1W0CA 3QMVA 3R3WA 4PE5B 4ZYYA 2J48A 5ABPA 2PMWB 4QARA 5SV2A 1C4OA 2C1EA 4Y1RA 2MHCA 1U0JA 4P4SB 1MPTA 1JEEA 5CLGA 1OT3A 4Z99A 2G17A 3L5OA 5I7VA 4CDMA 5LZ4A 5ICEA 4NBKA 2IHZA 1PZGA 4AK9A 1SU4A 1EBFA 2VOJA 2WK1A 3N2YA 4FMDF 5FBZA 1CR2A 5FEUA 2JGNA 4TSFA 5TIIA 1MRZA 1TU4A 3M9LA 3LGAA 4G25A 4O1MA 4G09A 5LC1A 1GV1A 3OZAA 4JOQA 5BSWA 2WPDA 1OYWA 2Q2NA 2ZRJA 3O4VA 3OPXA 1L7OA 2R97A 4XGRA 4RHXA 2F3UA 2VDNB 1IB0A 4PC1A 4MJLA 2ZSJA 3WFZA 2IS1A 2E4UA 4OTZA 1H4SA 3G82C 3ZYZA 3O47A 4E5VA 2GTIA 1OBOA 1Z63A 2B2XA 5LKAA 1YB6A 4DQUA 4F93B 2J0SA 4Q66C 3DGFC 1OY1A 4X5OA 3TNLA 2FJ0A 5K4AA 4RKFA 1J56A 5BSKA 1CF2O 2IJGX 5G0UA 4DDWA 2OBFA 4A1FA 2QUIA 3E05A 1EXVA 3ZZMA 1RLOA 3PNKA 4O2AB 1RBMA 2FZWA 3MS4A 2B3DA 4L6AA 5DMXA 3K4HA 1ZUD1 4NL4H 4ZC1A 4ENWA 4F6RB 1BDMA 1Z22A 1C0EA 3IL2A 2PV0A 3PEVA 10MHA 1P17A 1KEZA 2HYIC 1P33A 1X86B 3PWZA 4MOWA 2FPIB 4D0LB 5HZHA 2YXDA 3V7YA 3IAHA 1ZJWA 3DP9A 4C30A 2J85A 2TS1A 2POCA 4BCCA 2CFIA 2WLSA 2UV8A 2ZYVX 3PPVA 1E59A 1GGEA 3ISTA 4F4IA 2JARA 3KAQA 4F46A 4R2KA 2X0RA 5MF6A 4HFJA 2P9YA 2REBA 4WK6A 4TXJA 1JVBA 3JAMA 1T2DA 1EWRA 2DQYA 1E3JA 1EVJA 1C5KA 2O3UA 3OZFA 3QLVC 1RR6A 4MRRA 1O95D 2WINI 4YALA 4UZSA 2B4QA 3BICA 4HUQA 4CM3A 5AESA 5HGJA 5C52B 5EG5A 2BV3A 2PGLA 2PUHA 4HD8A 4W9RA 2EQBA 1YZVA 2HIHA 4YROA 1RKVA 2H7XA 221PA 2ZAOA 3MERA 1Z37A 4DA7A 2NZUG 1WSAA 4IICA 5BWNA 2ZT7A 3K6SA 4KBFA 1R2QA 1YVEI 4V3CA 3CU5A 3QW2A 3VNUA 2C8VA 2HJRA 5HFNA 1NVWQ 2FPXA 1FTGA 1KR5A 4Z7JA 3CEMA 1OAOA 1ZMXA 3DE3X 4IWXA 3EHEA 4LQ4A 4EI9A 3R3UA 4KYTA 2C2OA 4ZI3A 3WA6A 2X3UA 3A25A 2OD7A 1JR3E 3S4YA 1S89A 1XZHA 2R84A 3CKMA 3UTCA 3FOAA 2Q5CA 3INTA 5LZ8A 4M76B 1LFDB 4I1SA 2VPYA 3LUPA 1PLJA 4OREX 4TPKA 3TMKA 3ZBQA 3THWA 4PZCA 3P26A 1L7QA 2VYQA 1E0JA 4B0OA 3I9FA 3NHFA 2PM8A 2ZYAA 5ECGC 1JHZA 3ZTTA 2XLCA 1Z8DA 1S01A 1TFRA 2O8DA 3DE0X 4A5OA 2IELA 4XDYA 2E82A 3PCTA 5K8CA 4P31A 2J3KA 1Z75A 1T3LA 3N2GB 3UK6A 1JR3A 1TMKA 1IM2A 4QRIA 1LY1A 2RGCA 3IEXA 3VU0A 1IG3A 1O94D 1N6OA 1PQ4A 2BDUA 2PX3A 1Q0PA 2QVCA 5H81A 3SJUA 3DFMA 1K7FB 3UWPA 5CD1A 2ZAYA 3NTLA 3WISA 4CKWA 3REOA 1GN9A 4P80A 3MGKA 1CR1A 3OCCA 4YRPA 1WULS 2W48A 1XZBA 1RIFA 2NN3C 2ZTVA 4EQ6B 4F6LA 4PBRA 3SQOA 3WC4A 1WLSA 4H3VA 4NYMR 4I4LA 3EA5A 1USWA 2LKCA 1W87A 2V1UA 2B0CA 4XPIB 1AKTA 3PQ4A 3H1AA 5GIOE 3AIOA 1WF6A 4DPKA 2OQRA 4OYHA 1P3DA 3CO5A 5AQ1A 3FCEA 5AKKA 2IXDA 1U0LA 4NPHA 2AC4A 2CHEA 4E11A 3DAPA 3HFJA 1ZH0A 2VH1A 4J0GA 3Q7PA 4F0JA 2IS2A 1MLDA 4H7KA 3NP7A 2WHQA 4NYIR 3U7EB 3USZA 7AT1A 3IGFA 3AL2A 1EP9A 4FU0A 3UUEA 4CMIA 4KWCA 1AJEA 1Z15A 3TS1A 2PKCA 3L1KA 1SN7A 4LVUA 5C3MA 5FBQB 1MFPA 4MGYR 3SU8A 5JYEA 4BX9A 3VYUB 2D62A 3HGQA 4DCGA 4DQ0A 1GOTA 1AX9A 3CKKA 3PFWO 2I9PA 3PUWA 2PUVA 4M6WA 3VR6D 2GO7A 2BRUC 4KU4A 4AMUA 3LLCA 2PG3A 3WYNA 3C87A 1ND5A 3AJEA 4BV2A 3U5TA 5F2OA 1T1GA 2QP4A 2ADFA 2CYCA 2NU8A 1AC5A 1WUHS 2Y1GA 3EA4A 5EN4A 4MS3A 4B4VA 3O8NA 3ZBUA 4CV1A 3TLAA 4LTNA 2RB5A 4F1WA 3LWNA 3A2NA 2JH3A 3GELA 4PPGA 4GVPA 2C3PA 3CW8X 4W5NA 5NULA 2Q3EA 4F86A 4KLCA 3D0OA 1WY5A 1EK6A 1DEHA 1TIPA 2V97A 3L8YA 5AW6A 3MJDA 4H7HA 4QYMA 5TNXA 1N2BA 2ZE7A 3QG5A 1UFOA 1AM4D 3AHHA 1M2OA 1EFRD 1Q7TA 1ZWKA 3IV9A 3QV2A 4O33A 4F5DA 2QROA 2XTJA 1SCAA 2HMTA 3AR4A 3NIDB 3VR3D 3IUBA 4Y1FA 2JAOA 1U65A 1V8FA 2QN3A 4LTMA 2H11A 1QWSA 3FYDA 3K9CA 1PLLA 4O63O 2Q5JA 2NU7A 4PPQA 4EZEA 3C4VA 4F5EA 3VTFA 2BPOA 1QX3A 4P58A 2QX9A 2PZJA 4CXMA 2CJWA 2X9GA 4JVMA 4F06A 3KS9A 4GP7A 3VZDA 1GM5A 1RJWA 2LE0A 4QT4A 4Q39A 1S8NA 3KP1A 1YF3A 2R8OA 1YUNA 5CFLA 1H0RA 1VRVA 3IUJA 1DKQA 3I39X 5B3KA 3TGWA 2I29A 4ZV7A 1NJSA 1TZJA 1E79A 1DIRA 1EX9A 1RWOA 1Q21A 5DULA 3B5JA 4Z3OA 2EW2A 3L41A 1X9HA 3T06B 1F8YA 4XUEA 3TSWA 5CCDA 2IIVA 3DYVA 4AMZA 1A5ZA 3S2YA 2PPLA 3UQZA 1DKMA 4BP8A 1GTL1 2ERCA 2E7ZA 2I6SA 2YW2A 3DLPX 1GFIA 4KK3A 4KUHA 4C6SA 1XMOB 2VJLA 2ZE8A 3BILA 3SC2A 1MGOA 2PCLA 4XWOA 2OPBA 3H83A 3OLZA 4K05A 2WI8A 4EX6A 2XKKA 1F1BA 2A0YA 2LVBA 4Q19A 3LAWA 1R3UA 1VPTA 1DMRA 1M75A 1YJQA 3MZ0A 1Z6TA 2CDNA 4FMPA 3K1ZA 1SBQA 3UV7A 2JLZA 3P9KA 1KVRA 1ZK4A 1NQVA 3FPFA 3ZHZA 2WAAA 3F47A 4BP3A 3ZWDA 4F4UA 1CF4A 4Q9DA 2HUPA 3WBJA 4D46A 1SWWA 2JIMA 3C3MA 4M8LA 3PHJA 5KDLA 3HBAA 4GZMA 4K81B 3RYIB 4TUYF 3TLGA 1VIVA 3ZIAA 2FOIA 2YVLA 4HMQA 1OPXA 4BUCA 1YRAA 5A6VA 2B82A 2V4MA 5E1OA 4ZMRA 2WF8A 5ITVA 3Q7IA 4WBSA 5JS8A 2JKZA 2Y2UA 3K4QA 5FB3A 1RZRD 1GPMA 4N48A 5A06A 2PU7A 3M1AA 3WP1B 4Y2VA 1XWFA 3G2OA 3H9UA 4JXKA 5IT5A 2CXOA 1A2BA 2D1TA 3TD2A 1RYEA 1TX4B 1H8HA 4LV6A 3TZHA 4RCVA 3RANA 1XZGA 3CLHA 2PMFA 4TVOA 4YBZA 1GNVA 1E6WA 1YRHA 4L8GA 2ABWA 2PGAA 1P91A 3EFEA 4FD3A 2OYRA 4EY8A 3FPBA 3O0DA 4DKJA 1DIAA 3G9QA 3COSA 1QDLB 1JSCA 4OAPA 2WIKA 3OD1A 1E7YA 4XX0B 1C3VA 4MW0A 5FV4A 1VYUA 3KOYA 1YR6A 5DTJA 5KYTA 1XTTA 1R0RE 1ETUA 1R6AA 2GYWA 2YIDA 4KV9A 4YQEA 1CX9B 1WXWA 1Z25A 1NNLA 1H2XA 3CFYA 3VJRA 1N3BA 2IP1A 4AQDA 4BNLA 2ZJ8A 3BMXA 5ALUA 1TC1A 5EE9A 4J16C 3P9ZA 3SZUA 3ESCA 5HKLA 1BS2A 4HNAB 3RC1A 2D1FA 2NYVA 3DUFA 4LGCA 3SHFA 1QXSA 3VVMA 4FM9A 1CC1S 4IGKA 3Q9UA 2NYRA 4B2YA 4C7BA 2WA1A 4PSDA 4Y6RA 2KW5A 1JDPA 2QZSA 3V4LA 3MJCA 4OLFA 4DPLA 5EWJB 9GPBA 3LQQA 1IHPA 2Q4RA 1ABEA 4HGPA 4CT4B 1IXRC 2VPWA 3GJRA 2ZI6A 4ZI7B 4JB0A 1TB4A 4MRAA 4B4OA 4DLRA 2RJ3A 3D59A 2YJ6A 4WZBE 3Q11A 1GAJA 1EVZA 1M54A 4EPWA 5AJXA 3BFVA 4KPGA 1VSVA 2P78A 4XDZA 4UXJA 5D5QA 4LF6B 1GCOA 1KVQA 1G63A 5A4FS 1XTSA 4HGNA 1P5JA 5JRDS 1WETA 4M1WA 1KKUA 4XWGA 2FEAA 1FJHA 1FYXA 1UBMS 1ZS9A 3EXHB 1ZDMA 4M2LA 4QUHA 2J5KA 4IXMA 1X8KA 3UFBA 1T4MA 1KH1A 5JSFA 1V5IA 4AWXA 1DQSA 4GECA 1UMCB 3EMVA 2F1IA 2FRVA 1NM5A 3ZHBA 1T6XA 2P2CA 4TLMB 1ZGZA 3L8DA 4GQBA 3ESAA 3G0CA 3HBMA 3DFFA 2PZEA 1EUYA 4EG0A 3QX9A 1PNTA 5KPJA 4KQKA 5HG0A 1H05A 2EJBA 3DOCA 3EVAA 1W6RA 4ZO9A 5ALWA 4XA8A 4B4UA 4HFMA 4EJ2A 1OBCA 5K2MA 1P1BA 1U9JA 3D7SA 5A04A 1JQDA 5ALMA 5IYZA 1S8AA 3WKAA 1A9PA 2GVNA 3L40A 3OFSA 2BI8A 2YVAA 3AFHA 1RWWA 4G26A 4PRKA 4Q24A 5E7JA 5FOSA 5HXAA 2J0QA 1YQDA 3L0DA 3FOFC 3WGQA 2CUZA 2KX7A 5ED0A 2H7VA 2XF2A 1SXJA 3AEKA 3U3XA 1I7PA 3ZBTA 3FG9A 2R6CA 1J97A 1N8KA 1VYHA 2BC9A 5AM1A 2ZK7A 5REQA 3SX4A 5KTYA 1DX9A 2WF5A 1GNTA 3D4OA 3C16C 4QOHA 1WDMA 4YRJA 2R85A 3OCVA 1NBEA 2F43B 5LXTA 3LQYA 4IIYA 4PG7A 2ZYIA 4EG5A 3FX2A 2ID4A 1GNQA 1FJGB 4IUBS 4RZ2A 5EAIA 2AQIA 3OJ0A 1CUJA 2Y1CA 4IIJF 3PEUA 5CVJA 4YUAA 1D6SA 2IP2A 1C1XA 1U7XA 2C58A 3ELBA 1NDHA 3LUGA 4ZHQA 1EM8B 4ZCSA 1T4CB 2OXCA 4G97A 1SNYA 2E4ZA 1VG0B 2EQAA 3UMGA 4DV4B 2PVCA 1I8TA 4HK4A 4EHJA 1M9NA 1P4RA 1T9BA 4GL2A 1K5GA 2FFQA 4PZZA 5I51A 1YVRA 1DIOB 1ADJA 3KXLA 3OAAD 1UC5B 1YKFA 2AGVA 1NV8A 3ENKA 3UXMA 1HG0A 2GK4A 1YOBA 1UQUA 2ZKIA 1I5RA 4D6YA 1ECJA 1PGJA 2AXNA 1K5PA 4JJKA 3EZFA 5TF0A 4UQPA 3ZGOA 2COKA 1AK9A 4IV8A 5L45A 3PI7A 4IIEA 2H16A 3U7RA 2FSHA 1T91A 4P4NA 1MJFA 3BYZA 4DJTA 1E9SA 3UMJA 2BFAA 2HX1A 3K32A 4FFRA 4W1RA 1SD1A 5ENDA 3K1AB 4I46A 3V6MA 4O3MA 3DHEA 3AB8A 3RRBA 5LOVB 1C29B 3L1VA 1DTEA 1X1QA 3M6MD 3SQDA 4A91A 2VVTA 2NADA 4PTYA 5F7OA 1I3MA 2ID9A 1TUEA 2WFMA 1TLTA 2GHQA 3K15A 4UW9A 3A11A 2Q3JA 3NLLA 1VRCA 4JP1A 4R6XA 3RS7A 3WNZA 4NJEA 3L7JA 4N5DA 5DRYA 4D8YA 1MAAA 3U44A 2IX9A 5EEHA 1JFTA 1NF9A 2IZOA 2IZ7A 2QU8A 1GYPA 1A5BB 4LRYA 1O08A 2QYHA 4X24A 2W6MA 4X1IA 5CIWA 2IKQA 3O4HA 5DHRA 5JCOC 1ECBA 2EYQA 1ZD5A 2BVNA 2O5VA 2QRUA 3D31A 3MTJA 3NBAA 4IHJB 5EC8A 3RBZA 5JC1A 2ZJ6A 4L78A 1S3FA 4WK2B 5H82A 1LVHA 3OU6A 4ND1A 4OXNA 3ZHVA 4EF5A 4GGOA 4KHZA 3IMFA 3TLJA 1IJKA 1QFYA 4IMPA 5JD3A 3B78A 1LS1A 5K01A 2G5GX 4WFJA 1E2BA 2BM1A 2ECOA 3KBOA 2ZAGA 4EVSA 5HS4A 2D2EA 4DUZB 1VI6A 5SZJA 3N07A 4LECA 4NONA 1N2SA 1Z8FA 4JA2A 3UH1A 4OQMA 1EZ1A 3JQGB 4KAFA 5GY7A 3RASA 1UK8A 5LOVA 2PKXA 3AG5A 5LMUB 5JECA 2BYTA 4BZXA 1DEXA 1HFWA 3ILYA 2GCOB 1B8UA 1GT6A 1Z6ZA 3AV0B 1UC9A 4P5DA 4D3DA 3E27A 3F2IA 1R15A 1Z0DA 4JEIA 6CHYA 3F6RA 2H51A 3HEBA 4GH5A 1KE1A 1CY0A 2XNSA 4CVNA 4E7OA 3TCXB 1BS9A 1ID8A 1IPEA 1DOZA 4R8MA 2FMKA 5F5XA 2BE9A 2Q9AA 2W6ZA 1MA0A 1X1RA 2O4UX 1MG5A 2QRQA 3QZUA 4OBBA 5KAPA 5M04A 2FYTA 2GA8A 4KJZA 4P93A 2CVQA 2P9CA 1Y1SA 2V74B 5AI6A 3EVDA 5E4TA 1CULC 5JSZB 3CEJA 4ZO7A 5AVKA 2XWPA 1N5MA 3FNHA 4G01B 2NAFA 2JF0A 4IX9A 1FNSA 2IV3A 3C6MA 1I2MA 2W6ID 4IP0A 4Z8YA 3W8NA 4YYEA 4ZT6A 2PRSA 3E9QA 1UZLA 3DF7A 2D13A 3DV9A 1SOWA 4DN6A 1M2EA 1CUVA 3JPYA 4ZFNA 2C7VA 4OU4A 2PGIA 1RWNA 3EWAA 4P34A 4PQEA 2IRWA 1LPSA 1YMVA 4TKLA 5E6UA 3NAQA 4H59A 3SSOA 1UPTA 3W2FA 1GQOA 1S3SA 3MB5A 4HWPA 5D7NA 2DB3A 5IBQA 5CHYA 4OB8A 4WLUA 2YZMA 3UAOA 1QOZA 1LWNA 3GX1A 4NJOA 2P8JA 4Y0VA 2UXCB 4Z0TA 4GPIB 1KOLA 1LQTA 4LDQA 3FOBA 1U0GA 1HZJA 2AK2A 4PLGA 3Q41A 4V02A 2YQ4A 3IDSA 2ZS8A 4QECA 1HDOA 3PQEA 3THYA 2RG7A 2AE2A 4R2LA 2Z5GA 3HYCA 2TYSB 3LUAA 4MUGA 5IJAA 3ERCA 5D84A 4H16A 4QFDA 5F1OA 1PJ2A 4JLNA 1NVGA 1UBRS 3B1XA 3N3AC 4IJ5A 4BBZA 1E2GA 3DZIA 4DNFA 3KJQA 2I2BA 3T7KA 5J2UA 4YH1A 1LDNA 4XDHA 4NZOA 4IKPA 3P2OA 1TIKA 3GH1A 1FRZA 2REOA 3OESA 4KEAA 3NEPX 3OIGA 4KX3A 4W6ZA 3SF8A 2I7VA 3HADA 3F8WA 1SO8A 2IY7A 2VYNA 3OJFA 3I42A 5IAOA 1ZC4A 1YFKA 3TW8A 3NI2A 2NAPA 1NUQA 2VBIA 3RI3A 3ZPXA 3ZZ1A 1Q7BA 5H0IA 4EHFA 4GVLA 1ZAYA 5A2QA 1PK7A 2ZUEA 4I19A 2Y0DA 1CCWA 3N2KB 2JLWA 3NH9A 2WAMA 3BGWA 2Y77A 3MTDA 4F6CA 1EUDA 2Y66A 1SVNA 1VHJA 5FUBA 3UAYA 2GRAA 4N0QA 3GLGB 3ADDA 2HBYA 3DR5A 1KI6A 2ZRPA 4D92A 1ZVMA 4S1NA 4PIPA 2IHNA 1YRWA 1ZOSA 1G291 3MJRA 2AMVA 2GJ8A 2YMQA 2P41A 4NENB 4HXFB 4KBYA 4Z1OA 4ZVMA 5I7UA 4DV5B 1UDWA 5I3CA 1Z4MA 2UU9B 3ND8A 1A0OA 1CQIA 1NVXQ 1X9GA 4FGWA 1M1ZA 3HXQA 4TKMA 2BR5A 4L15A 2D59A 4A0FA 4GPZA 1C7RA 4NV0A 3RAFC 2ECPA 2J3JA 4WOKA 4MR7A 4U7FA 1ZJ6A 3BF7A 2L19A 5G3YA 1II0A 1UC4B 3N2GA 3FDIA 5E2BA 4AN0A 2AEJA 5C7LO 5KVAA 1Y7LA 4TMFA 4J1NA 5DOZA 2HA7A 2HV9A 4KTTE 4GE3A 5EVCA 1W49A 4DCVA 1XTIA 4I5DA 4LHWA 4IQ4A 4J3JA 2HHHB 3NOOA 3TPFA 1DDGA 4GBED 5JEDA 4X20A 3BAZA 2ZJFA 4LBWA 4RMJA 3VDXA 1HNZB 2X4LA 2V96A 4IDPA 3ZXYA 1DHRA 1QIGA 4D3FA 3PENA 4FUQA 4NX2A 2OGUA 1WUTA 4U6QA 2DC1A 5IFLA 2NTNA 4KWEA 4FYWA 4K9KA 4PLFA 3NHJA 1R3DA 3SC6A 4M8SA 3GH3A 5KI6A 2K7ZA 1IM5A 2PBLA 2F8LA 1VKHA 2OZVA 3ZCRA 2SCUB 4L73A 2OQIA 5IKEA 1OLUA 4RLFA 1NN0A 1XYVA 1AN0A 1O54A 1TW2A 1SBCA 4Q1BA 4RS3A 5LFAA 4L4ZA 1DBPA 1KDZA 5FPYA 1XN4A 3M3HA 4ZJUA 2DVMA 4QHYA 1ZM7A 3CA8A 3N59A 3F1LA 3ULKA 4AZ3A 2VSXA 1R88A 5KDDA 1TD1A 3THSA 4V3BA 3DR3A 3CVUA 1FP4A 1YFJA 2C8LA 1XLTA 2MU1A 1B8VA 1XP5A 2NU6A 3Q5DA 2H65A 2CJFA 1ZXBA 1EX7A 2D3TA 3JARA 1G8SA 1A4RA 4R68A 3PC8A 5GGYA 1IXYA 2GJSA 1UKBA 1KEWA 1U3WA 1O97D 1FP6A 1K4MA 3IA7A 3PC7A 3ZI4A 4D9IA 3DMNA 2GBIA 2Q9BA 2XGGA 3FMVA 1BJKA 2H2GA 1UC8A 2RFLA 4INOA 4P98A 1ODLA 4QQFA 4YP1A 3HGMA 5DM2A 4TXHA 3VSCA 2ID8A 3SF0A 4BBAA 4AKHA 4RACA 4UEKA 2X9QA 2YRWA 5E0OA 4BFVA 1VP9A 4QEZA 1A2QA 3R5TA 3STWA 3EDMA 1HQDA 4LRUA 1SUAA 4B6FA 1RYNA 3MF4A 1C4KA 4QDXA 1HYEA 1B16A 1UJMA 3ZY4A 1CRZA 4TV9F 4YCDA 1ADGA 2EU8A 5EIAA 3SEZA 5CFMA 5HP4A 2W2PA 4BZWA 2H1VA 2P1DA 5AVXA 1M1NA 1O89A 1U3GA 4MKFA 1ISMA 2Q5FA 2YYSA 1FQOA 3RWMB 4EB8A 1D1SA 2ZIXB 2O8CA 4JSRA 5COQA 2LGJA 3OPQA 2LDBA 1HRKA 1E6KA 3KAPA 3FRIA 3PNPA 1B6RA 1A88A 2NZ2A 4ZTBA 3K9NA 2P91A 2EATA 3EBPA 2CK3D 2XQIA 4MCIA 1BVHA 3B9PA 1N2OA 4LOLA 3RSOA 3U0VA 1IU9A 1P5HA 3S1SA 4UVIA 1YQTA 1DBVO 1XAJA 3VPFA 1CNFA 1E7RA 1GGHA 1I6LA 1OSNA 1OTHA 3X2FA 3SJBA 1ZRSA 4YWHA 2NU8B 2WSMA 3Q88A 1NJ6A 5AJHA 1L5KA 1X7ZB 3WLFA 4FHEA 2ZTHA 1WSBA 2XDAA 3AEXA 3GBVA 4D8TA 2OR3A 5CA0A 3WWPA 1VJTA 2A0UA 3FROA 2G6TA 2O1EA 4J7AA 3IP3A 5EIHA 4C89A 4O3FA 3SSMA 2WJHA 2E85A 3GQVA 1J70A 1NVMB 3Q5GA 4N5HX 3G0GA 4M8KA 4XSVA 5J40A 2CEAA 3D4BA 5TEVA 3EPKA 3ET5A 4GX0A 2NTEA 2O3SA 1D03A 2CZGA 3GF4A 1SB9A 1KYTA 2QP9X 2P9TA 3ETGA 4GXRA 4J2HA 4RY2A 3E8SA 3RU9A 3ZH9B 3KB1A 3E5MA 1I1HA 4MK4A 2Y71A 4Q4JA 5F4ZA 1FZTA 5ILOA 2HMUA 2HK7A 2RB4A 1NFRA 1GEGA 4GYKA 4ABYA 2Q2VA 2JHFA 3ONWA 1A69A 1XV5A 4A2PA 2F00A 2B94A 4XGIA 3RH0A 4HAXA 4MHSA 3FDXA 2P9ZA 3NBXX 4K86A 4UEQA 3STXA 1QBKC 4D9JA 4UTVA 1QK4A 1RLMA 1H3EA 3M1YA 3I6MA 1RM0A 2B4KA 1ZBDA 3M89A 4GM4A 3QJ5A 3M1LA 3GEIA 3TTYA 4DAEA 4EAAA 1UBTS 1XJQA 1EFCA 2HPAA 3TQIA 3KYDA 1GLNA 3G9XA 4KWHA 2BCGY 1V8OA 4I55F 2PLNA 3P2JA 1OBHA 4L51A 1KGSA 4C07A 1J0AA 1V2GA 5LVAA 2PANA 3IMGA 3O8LA 5MGNA 1MOQA 3AVQA 2VG8A 3THYB 2XRMA 3EH2A 1YC5A 4J91A 5LJIA 2I7CA 4LMRA 4YMVA 2WC1A 3M5WA 1PWHA 2QV7A 1O0CA 3E2PA 3AWDA 4D42A 4RDHA 4BO5A 1EGQA 4UPEA 5K6RA 3U7HB 5FJIA 4DLAA 3CPSA 4JIGA 3RAPR 3AFMA 1OXVA 3OHMA 3UM9A 3ELDA 2CDBA 3E84A 1M6VA 3HKBB 4INPA 2CSXA 3DAYA 1H1LA 4NOLA 3CKYA 4HEQA 1Y7PA