4TLAA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
233
structure length
216
Chain Sequence
QAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTTGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEDLSALIERINYAIQKYRARRVSIDSASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kinase KaiC
publication title Circadian rhythms. Atomic-scale origins of slowness in the cyanobacterial circadian clock.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
total genus 78
structure length 216
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tlaA00
1US8B 3WMFA 5EXXA 3TRFA 4BLOA 4PO8A 3W6NA 1Y63A 3BH6A 4IJMA 1R5BA 3LNCA 2Q9CA 1W0JA 1TU3A 1CRPA 3KX2A 4A2QA 5FPKA 2QORA 4UNPA 3SYLA 3KXLA 1XEFA 4LC0A 3EIEA 2IS6A 1XD2B 4B2LA 2OE2A 2GNOA 1MT0A 2ZJOA 3EXAA 4CVNA 4TTQA 3SJCA 4Q19A 4RD0A 4DWJA 4NYIQ 4KYIB 5KNBA 2D2EA 3NXSA 2IS4A 2WWWA 3B78A 1KDTA 1XZPA 3IPYA 3LO5A 2CNWD 3CNOA 1JALA 3GJ6A 3AF2A 4B74A 2WWFA 2XNSA 2ZVPX 2CHGA 1S96A 2FMXA 2BMEA 1QHYA 2PT7A 4HAWA 1U8AA 1OKKD 4Q7JB 3PUYA 2H92A 1N6LA 4PANA 2IWRA 4TZ6A 2PX0A 3T1QA 2FA9A 1KK1A 3VR6A 5E7JA 5GVRA 4QM7A 1KNQA 1XXHB 1S3GA 1MV5A 3BD9A 3ZZTA 4LOAA 5DLQC 2GK7A 1B0UA 2ZUCA 2AD5A 2P0EA 2VQSA 2JLRA 1CF4A 2GF9A 1AN0A 1G4UR 1XEXA 1T0JB 4Q4JA 4JBYA 5K8IA 1E4YA 1TF2A 2QGZA 1JQJC 1N6PA 1KMHA 1W2GA 1E0JA 1KJYA 1XMVA 2A30A 4NYIR 4ZCIA 1KK0A 1P2VA 5AJVB 1NG9A 1Z0KA 3K0FA 1DEKA 1UBGA 4PSAA 3QQ5A 3SHWA 3K8YA 4PHFA 1E2EA 4M1TA 2WJHA 3ZYCA 4RSGA 4LCBA 1KKMA 4ZCMA 4QL3A 5DI3B 3ONWA 3NKVA 5CM9C 3A37A 4FI3C 2QBYB 4JVMA 3DKPA 4HZUA 3P27A 1IN7A 2DWQA 4JZKA 5CB6A 5EE3A 4HB0A 3DDCA 3TSZA 4ZIRB 3LRPA 1G291 1QG4A 4Y0AA 2EFGA 2GZHA 4IOMA 1E2MA 4UXJA 1DE0A 1TQ4A 1XTQA 2Z4SA 2PJZA 4E09A 4ZO4A 5CYOA 2EYUA 4DLZA 1GOTA 4ZKEA 1JR3D 2FOLA 2Q3HA 4AI6A 3TLXA 4OKSA 1JR3E 4OK6A 5LB2A 2VTKA 1ELOA 2HF9A 3UMFA 4NH0A 4Q03A 1Z0FA 2W00A 5BWMA 3SJAA 5UKDA 1IN5A 1MO5A 4QC2A 5KSOA 3GLFE 3HPQA 2P2LA 4S35A 2QA5A 5EP1A 2YOHA 3THYA 4OHXA 3IKJA 4PQRA 1RIFA 1G7SA 1UEJA 3F8TA 3NH6A 2XAUA 4NONA 4TT3A 4IXMA 3FE2A 3K0CC 4Q1BA 4GZMA 1T3SA 1ZVQA 4BFTA 4MQBA 4N0EA 2BDTA 3I1FA 2X2EA 3C8UA 4TN1A 2ZI5A 1SZPA 2QAGB 3O8DA 1ZC3A 3GEEA 5IT5A 3KJEA 1E1RD 2QMHA 2O8DA 2ZVQX 1F3OA 1ZU4A 2Z83A 2QM8A 3WRYC 4UNRA 1Z2AA 1RVDA 2IS1A 1NMXA 4B33A 2RGXA 1EFRA 1TQ6A 3SU8A 1VG9B 3X2SA 4CEIA 4D82A 3U3OA 1XFAA 5KSYA 1DG3A 2OG2A 3SHFA 3G82C 3EIQA 3AEZA 1X86B 2GXUA 1KI3A 3AH8A 3RRMA 1OLOA 1Q57A 1WXQA 3E1SA 2KBFA 4R9UC 4ABYA 3HYTA 4AKIA 1QHHB 2QROA 4JLPA 1KYIA 1TMKA 1WB9A 1BH2A 1OXSC 5AJYA 4QXAA 1Y3AA 4V0KA 2EYQA 1KO5A 1ZM3A 2I3BA 2AK3A 3Q9LA 5CIWA 1WMSA 5BQ5A 4HB2A 3V4RA 4B71A 2CCGA 5C4GB 1GKUB 1DO2A 2N1BA 4PC6A 5JCPA 3A8TA 3I61A 4C2TA 2JLQA 3FPAA 1GILA 1N6OA 4BQSA 1SVOA 1BMFD 3K0EA 2OCYC 1YZGA 5FTKA 3UK6A 4URWR 3CPHA 4E03A 3PEYA 5JWHA 2A5JA 2QTVB 5JRJA 3PIRA 4LV6A 3GFOA 1G9XA 4NYJQ 5FL7D 3VNVA 1SVLA 4EJSA 1II8B 2ZUBA 4Z54A 1O87A 1FQKA 4QGHA 5KPJA 3W5IA 3BE4A 4QNMA 4L4UA 2Z6VA 3RVBA 1LF5A 5JMTA 2XZLA 5EE0A 1DOAA 1YU9A 2VH5R 2C96A 2GCNA 4IHQA 5GJVC 4O3MA 1OH8A 2BCJQ 1E2FA 1E9DA 4QOSA 1N0UA 2GJAA 1H65A 1YZKA 3X1WA 5BN4A 3BXZA 3Q5DA 5LBIA 2KI5A 1F48A 4NHOA 1SVMA 1D9ZA 2OO7A 3NBFA 2IEYA 4W5JA 4D0NA 2O0JA 2R9VA 1R7RA 3REGA 1IY0A 3U7EB 3OAAA 4JVNA 2QTFA 1E4VA 4ILEA 4ERNA 3OESA 3T5GA 1NKTA 3GJ5A 2XB4A 1IOZA 1GSIA 4NYJR 1NRJB 3HDTA 2GTPA 1IXZA 2EWVA 2ZYUX 2O8CA 1K5GA 1P9RA 3EARA 4EPWA 1OV4A 3MLEA 4JKYA 4O2RA 3LW7A 4GOJA 3CX6A 1IQPA 4UXHA 2CL0X 3THWA 1TU4A 1HTWA 2YC2C 3LW8A 2GETA 4QJ3A 4DDUA 2YYZA 4EPRA 2G6BA 4EQ6A 1W36C 2H18A 3CNNA 4B2IA 4TLDA 5DO9A 2ZS9A 4DB4A 5IRCD 1OB5A 1RRPA 4LV5B 2JASA 1UDXA 5F3WB 1NN3A 3N70A 2R44A 4KITB 3GJXC 3R9XA 5H1YA 4Z8XA 4JLKA 4BECA 5FFMA 2ATXA 2VLIA 2QL6A 3QPUA 3RS2A 1KK2A 3CLVA 5JS8A 3Q3JB 3GLFB 4JBXA 3SC3A 2Z0MA 3ETLA 1M8PA 1Q1BA 4QHYA 4PHHA 4BFXA 4HLUA 4LYHA 1E9FA 2ZE5A 5LB4A 2JDIA 2FFHA 2WM9B 3QNUA 4JT2A 4D4MA 4Q01A 4TYQA 1E0SA 1R5NA 1D2MA 4J0QA 1ZU5A 1XB2A 1G18A 4M1SA 2F43A 3SFZA 4B6EA 1GUAA 1TX4B 4FWIB 3TMKA 2GVDC 1TF5A 3F3YA 1DVRA 1VPLA 3VR5A 1N5KA 4MUAA 3PXGA 2CE2X 6Q21A 5EE9A 1S1CA 2GVZC 1VDZA 2QRNA 2ZR0A 1OIVA 1CR2A 4LI0A 3A4LA 4ESVA 2XXAB 5CDFA 4CDGA 3EC2A 1VG8A 3CR7A 2C2HA 1OIXA 5JS7A 1R6BX 1F6BA 2WWHA 1CR4A 4AURA 5BN3A 2A9KA 1G5RA 4I1UA 2YWFA 3FHTA 1XZQA 3TR5A 4LYFA 2GA8A 5LD2B 1N5IA 2KBEA 3B1XA 4FD2A 1T0HB 2CL7X 2KE5A 3NBYC 2DCUA 2RHMA 4F4CA 4A1FA 2C8VA 1ZCBA 3PQCA 3GLHA 4P4UA 3WMGA 4ESHA 5C2JB 1G8YA 1W47A 2PLFA 2LCFA 4EPTA 1NIPA 2ATVA 2ZANA 4FCVA 4GMDA 4GMXA 5K8TA 4OHYA 1E9AA 2I1VB 3TUJC 2BV3A 1RE0A 2GJKA 3LBNA 4UQOA 4YDSA 3R9IA 2P6UA 1IHUA 4LHWA 3P32A 4Q47A 1X8KA 2F9MA 1MRNA 2R2AA 4XD7A 4BLTA 2NO6A 1P7CA 3T34A 4D6PA 1EXMA 2IX3A 4NCIA 4AWXA 2X19A 2HV8A 3OEED 1DAIA 3CIOA 4ACBA 1T8TA 3CZQA 5AUOB 4B3DA 4B3CA 3ZD7A 3E70C 2H17A 4M0LA 4A82A 4LBVA 5B64A 4KAXA 1Z6AA 1FX0A 3VX3A 4HEJA 2WWGA 2RHDA 1CR1A 4ZCLA 1KTVA 3ND8A 3TKLA 4POAA 2NZJA 4PPFA 5ELXA 3THXA 2PJRA 5SZHB 2HCBA 2VP9A 3QENA 3PR1A 1XF9A 2O8FA 2P65A 2B8WA 1EFHA 3Q5EA 3BOSA 4TTRA 2MMCA 4ARZA 2CVFA 4A2PA 3HWSA 3RRYA 4ITRC 1AQUA 1J2JA 2YJTD 4OHVA 4C0BA 5GADl 1JR6A 2XZOA 2J0QA 2O0KA 5FUYA 3ZIAA 3KKMA 3ADCA 5B30A 5C1BA 3M4YA 2R65A 3ZJYA 1OB2A 2MMGA 2ZSFA 2QPAA 3GLIE 4JMPA 1E79D 4WZ6A 4W9MC 2FPMA 2J0VA 4JYCA 4M1KA 4YLGA 1E2JA 2AHOA 2DFLA 2N42A 1WQ1R 4PAMA 4URYR 4XTRA 5M04A 1GKYA 4B6FA 5DYIA 3WBJA 5FH9A 521PA 1S3SA 4RJLA 1XPRA 3A1VA 4MKGA 1UEIA 4JLAA 3EZ7A 4M1OA 121PA 2G83A 5FOXA 4IOLA 1X1SA 2GESA 4EJSC 1FUKA 2ODBA 3WMEA 3PEUA 4A8JC 1FNNA 1S0UA 5D3QA 1FL9A 4OI4A 3KXKA 3SOPA 2NZ8A 1XEXB 2PMDA 3O8RA 2BVNA 4Q4JB 2W6JD 1VHLA 4PQYA 3AVQA 1SKQA 2IK8A 3OAAD 4UJ5A 4DZZA 1EFTA 2IA5A 2OFXA 3K0FB 4KO8A 3S1AA 1WDTA 2W0MA 4C2UA 2ZSBA 2XSZA 2ORIA 2ZS8A 3AVWA 1UF9A 1UKEA 3GLGE 3HR8A 2ZR7A 4M9SA 2J7KA 5KDOA 1RRFA 4TMWA 2ZRLA 1XJQA 2C04A 4I1SA 3R20A 1NLFA 3R7WA 1WRBA 2V3CC 4B76A 3GMTA 1KDRA 3U4QA 1NY5A 4FMBB 4L15A 3HPRA 2DPXA 4MGZR 1Q44A 1D6JA 4U02A 3AVXA 2WVJA 3OFNA 2ZS7A 2VP4A 2VYFA 4CT5A 2RCNA 3FGNA 5H8WA 4C0LA 1FMLA 1Z6GA 2AX4A 1CXZA 4FCTA 1J8MF 4NCJA 1LB1B 1OFTA 3KJGA 4Q48A 2BEJA 4OHWA 3CWZA 4NCNA 1E0KA 2J0UA 3IO3A 2G0NA 1ANKA 5GJWC 3NEYA 4BRWA 1SXJA 2XEXA 2CHVA 3NC1C 3AGPA 4Z8YA 3Q72A 4OI2A 3HP1A 4HLQB 5DYGA 2YV5A 1XEWX 3B82A 4MYHA 1E2NA 1XJCA 3CRVA 1KSJA 1ODFA 3QPVA 2FV8A 1ZNXA 3LD9A 1AS0A 2CMKA 3WHKA 3IILA 1A2BA 1ZD9A 4BLQA 3LAWA 3LQQA 1TEVA 1X8LA 1G19A 3SEAA 1NF3A 4XVUA 2GJSA 1M7BA 4II7A 5AJXA 1CEEA 4AKGA 3W5JA 5TV2A 1SQ5A 1FTSA 2DB3A 2GK6A 2H16A 4B3GA 4IDOA 1EX6A 4OYHA 1KO1A 1XBTA 2FN4A 4IDNA 3CH5A 4NE2A 1AGPA 2OFWA 5G40A 2Q21A 1JPJA 1YZUA 3QXCA 4BRUA 1P73A 3AVTA 1E2LA 4Q4AA 2N46A 3RNLA 2HDNB 4X8OA 1SVIA 1Z0AA 2CVHA 3AGQA 1KY3A 2CJWA 3EAQA 3FWYA 1IXRC 4DLRA 3MCAA 4PAQA 2CXXA 1N6IA 2ZUDA 1KSGA 3DPUA 3K09A 3QEJA 5HKKA 2JAQA 4C7OA 3PITA 1KO4A 1NJFA 3A1SA 4LPKA 5TVKA 3IEVA 1CIPA 1YZNA 2Q9AA 3KDSE 1J7KA 1N6HA 1XTSA 1H8HD 1XXHE 2ZRDA 2V1UA 4AYWA 3NBXX 2C99A 3CF2A 4RFVA 3D8BA 4TSFD 1RYFA 1PLLA 4UNNA 3CWQA 3U3RA 2EQBA 3TUIC 5JEDA 3GLIB 1U81A 2OAP1 2D06A 2ZRFA 3QOFA 3CPJB 2JCSA 3H2YA 4WAUA 4M21A 2ZI9A 4MRRA 2FE4A 1G3MA 4EJSB 2AR7A 2X1VA 1COWD 5J4KA 4PC7A 4XVQA 421PA 2G77B 4FMDF 4I99A 4LC1A 4EPXA 5C4MA 4M4SA 3A58B 3FTQA 5JSZA 4TLCA 4C0AC 4GP6A 1R0ZA 3WBKA 4JLMA 3RHFA 3IQWA 2P3SA 2HYIC 1YQTA 4MUBA 3OF5A 1JJVA 1FP7A 4JIMA 4NMMA 1X6VA 2B7CA 2I4IA 1HE1C 3QIAA 3EA5A 2CHQA 4CEJA 1UADA 3FDIA 2JLZA 2WSSA 1NLZA 3TAUA 4V0NA 1E2QA 4KJZA 3UMRA 3EZ6A 2YVUA 3SJZA 3DEFA 2GXSA 3E2IA 3FB4A 4HUTA 1L7VC 4PX9A 5KDLA 2O8CB 1XTKA 2HEIA 4N1AA 4L16A 2A78A 3RANA 2IT1A 2KB0A 3H0KA 4A0RA 1PLKA 3ZVRA 1TQ2A 3QY0A 3B8HA 3H86A 4O2LA 1PVOA 4FN5A 4FIDA 3VTKA 1E2GA 3WYAA 1KAOA 4S2EA 4AIIA 5HZKA 2IWHA 1V43A 1WF3A 3QF7A 4MRPA 2BM1A 4QBFA 2VHJA 4HYYA 3H84A 1G21E 3LXRA 3QXJA 2MSDB 4DRZA 3AM1A 3QKRB 3J81k 2J3EA 4TMZA 1GNPA 3ZH9B 2NGRA 2VL7A 1QHXA 2NTYC 4KBFA 5FTMA 4DKXA 4MA4A 2F1IA 2G9NA 2K5UA 1KK3A 2QRZA 5BN5A 2SHKA 3X1YA 3C4JA 5GJCA 3RSLA 5DHAA 4MKFA 1E9EA 4EAQA 3U7GA 1KI9A 3EW9A 1VYTA 2ZEJA 5CJ2A 2W0SA 4B35A 3NIBA 4Q1CA 1NVWQ 3ADDA 2VF7A 4RFSA 3VKWA 3LVRE 2ANCA 4PO9A 2R6GA 3EG5A 4M53A 2VHTA 3SDZA 4Q66C 4P4SA 2HYDA 4JLBA 4KLNA 2YINC 4D0LB 3CUEF 3KQUA 2CDNA 2FSHA 3TQFA 1KKLA 4Q1DA 2V6IA 4BZPA 4TL8A 4H1VA 2OUKA 1A82A 2WMNB 3TGPA 3UG6A 3ZD6A 5JBQA 3ZQ6A 5KO2A 5DISB 1W49A 1VG0B 1PZNA 2ZJZA 1NBMD 3V4FA 1NBME 1NP6A 1CJVC 2ZRCA 4DCVA 1LVGA 1FZQA 1J70A 1MOZA 3M0EA 3GJ7A 4NPHA 1N0VC 3C14C 4G5GA 2HCJB 3GLHB 2CK3A 1E9CA 2QSZA 4P3YA 2JATA 3T1VA 2J46A 1XCPA 3PFIA 1G20E 1Z6YA 3I72A 1SXJC 1L8QA 3BH0A 4MYTA 1S9HA 1Q3TA 4KSBA 5A5GA 1KI7A 4WXRA 2GF0A 5FBWB 2F3TA 4MGYR 4JL5A 4JVLA 1II0A 2A7QA 1HA3A 1Z0IA 5EQTA 2C9OA 2VHCA 1AQYA 3GJ3A 4RZ2A 4HDQB 1P3JA 3VR1A 1KMQA 4QBHA 2ZJAA 2LWIA 2F9LA 2O8BA 2IYQA 1DADA 1QVRA 4PR0A 3K9NA 5BYKA 2FSIA 2VA8A 5DGXA 5DH9A 3RRZA 4IDQA 2BJWA 3RS4A 2O8FB 2ZJ2A 1HUQA 4B75A 2BJVA 3KTAB 3LX5A 3JVVA 4XWKA 5FBRB 4ARZB 1NVUQ 1OYWA 2GAAA 1N5LA 2CE7A 2WHXA 2XNDA 1Z6TA 3OEHA 1NKSA 1QBKC 4H9GA 2IBMA 2QM7A 1W2HA 3I3SR 3AB3A 4DLTA 3KQLA 4F91B 4DEXA 4TMVA 3GD7A 3GEHA 5JWOA 2ZITA 3K09C 1WCV1 3BJIC 4M1MA 5J5CA 2QQEA 4C4PA 1WA5A 2PMKA 2XTZA 3DO6A 1I4DD 2ODNA 2FJUA 4QHTA 4B32A 1M6NA 1XWIA 1RJ9A 2DYKA 4NBSA 2DWPA 2ZYTX 4FINA 4LYAA 1E98A 5EUMA 5G3ZA 2UKDA 4I4LA 2VP5A 4CZ2A 4D2IA 5J4HA 2EW1A 4C30A 4BGDA 3AVUA 2W6IA 1TL7C 4IKEA 3TSWA 4UJ3A 5TY0A 1CJMA 4Q4HB 1CULC 1T91A 2EFHB 4KFTA 4DIDA 1YZQA 3CW2A 2DFKB 3TVTA 4F4JA 2P6RA 3B1ZA 4BASA 2B8TA 3O8BA 3RDPA 1VG1A 1NG1A 4Q1AA 2QGNA 3ICQB 1E6CA 3ZVLA 4QGAA 5TDHA 1EWRA 3PG5A 2EFDB 4PZYA 2X77A 4PAOA 4A2WA 1NLYA 1E2HA 5E7IA 3IHLA 3TH5A 2WSSD 4X8LA 3S1AB 1J8YF 4G5SA 4D25A 5E4FA 4KU4A 1I4LD 2LKDA 5KTYA 2ZRGA 2ZROA 2VP0A 1DAGA 1W4CA 2GWHA 3QUSA 5EUQB 5SZIA 4E5UA 4KYUA 1D8TA 2FPKA 5KOYA 2IL1A 3GJ0A 2X8AA 2NO7A 5JRZA 1Q12A 4BEBA 1TUIA 4W5HA 2WJIA 3A1TA 3DM5A 3R7WB 3Q8XB 2DBYA 4QBIA 4IEIA 4OBEA 1WP9A 1YR6A 1G5TA 4PSVA 3T15A 2Z4RA 4N3NA 1BYUA 3QBTA 1LS1A 4QRHA 3K1JA 2OBLA 4X8MA 1HURA 1XTJA 3KUDA 4DUGD 1JEDA 1KI6A 2IYXA 4R98A 1XMIA 1DAKA 2J0UB 1Z0DA 3EPHA 2GDJA 4QKQA 2CLSA 2JLVA 3AKEA 1SXJB 2ZE7A 1W5TA 5EXTA 3KKQA 4V0MA 4Q1EA 4NYMQ 3IBYA 5DIFA 5JJKA 1CRQA 4A8JA 3T5DA 5JCZA 4W7SA 2W2TA 3B6EA 5HPYB 3IEUA 1OXXK 2VEDA 2QTHA 4L9WA 3ZZ0A 3G5UA 1U9IC 1RRGA 3CKLA 3OIVA 2EU8A 2IYZA 2ZRJA 1W0JD 3SBDA 3GCGA 4DLXA 1KIMA 3TIFA 1DPFA 3DMNA 2F7SA 1GFIA 1UDWA 4PPGA 4QGGA 4TLEA 4F92B 1W4BA 5HR5A 2HXYA 4TL9A 1W1WA 2WMOB 1G6HA 5JZVA 2XZPA 3PEVA 3K70C 3LX8A 4LBZA 3BERA 3TW4A 3ZVNA 5JJLA 721PA 4QFMA 4Q4AB 4NYMR 4NP6A 1W36D 3TSOA 3AKCA 3L82B 2CJWB 2ZE6A 2IYLD 1NVVQ 5P21A 3LY5A 5G53C 1W4RA 4HAXA 4B34A 3AQ4A 4L5BA 3EZFA 4C7OB 4GFDA 2JJ1A 1SGWA 3KB2A 2NOAA 3VR4A 2GJ8A 4OQMA 4PPNA 3SI7A 5FR2A 1YE8A 4M9QA 2DFTA 2ZI7A 3VFDA 4F7WA 2FX3A 2VHUA 3FKQA 3NDPA 3X1ZA 2GCOA 3NHBA 4BZQA 3VMFA 4JJZA 3WNCA 2IF2A 3FMIA 1TAGA 1N6NA 1E1QA 2ZU6A 4URVR 2YOGA 2PCLA 4BZXA 4OQFA 2ONJA 4LHYA 1TPZA 2J5XA 1EFUA 2IYYA 4B73A 5JWRA 1KGDA 2AK2A 3GQBA 2BBOA 3LA6A 5JFGA 4FWTA 2WAXA 5FOVA 2IHYA 5C46F 5J4LA 1Q1QA 1U98A 2DFNA 1VHTA 4JKIA 2GZAA 3EPKA 1W44A 1G1MA 3KKPA 4YMSA 5AUNB 2IYSA 1TF7A 4DDWA 1OH7A 2XNDD 4L8GA 2OLJA 3MJHA 1AKYA 1T3LA 2REOA 4XVRA 3L43A 4CT4B 2QMOA 4WIAA 4CEJB 3I4LA 4ZKDA 2L0XA 3BGWA 3NBZC 1R0YA 4HDCA 1EK0A 2ZRBA 3AP1A 1CLUA 3EASA 4HLCA 4KI0A 5CK4A 3RS7A 2A5DA 2GBLA 5AK0A 3QXHA 2IYRA 2IHBA 1KJZA 4JSYA 3EPLA 2ZRKA 2W2VA 4G5RA 2QY9A 3SQWA 2QSYA 3QG5A 3NDBB 3SYKA 3KKNA 4Z1MA 1HT1E 4CIDA 3T1OA 3W9YA 3LBHA 1DAFA 1N2CE 4V03A 4QBGB 5A0FA 4ZDKA 5EJEA 4TT3D 5BW8A 4LJ8A 1LY1A 2NO9A 4X8HA 1RC8A 1OHHA 3V9PA 3BAFA 2FG5A 1LNZA 4XWOA 2MSCB 5EE5B 2WTUA 4TL7A 1R8SA 1JAHA 5B2ZA 2VRWA 1G64A 2BEKA 4I1VA 4D0GA 3OE7A 2ZU0C 2AXPA 1PJRA 4WZAE 2DY1A 1JPNA 2P5TB 1A5TA 1EFRD 2ZREA 4IFBA 3RSOA 1Z3IX 4WA7A 1Z47A 2OESA 2ANBA 1RKBA 4DLUA 3VQTA 3RWMB 2QG6A 1UJ2A 2PH1A 5L3SA 2XJ9A 2AWOA 4Q9KA 4RFSB 4KCGA 4TL6A 1ZD8A 4IOKA 1KO8A 3QKTA 4KBGA 1HH4A 2IW3A 3P20A 1KZGB 1W0KA 4KV9A 4B3BA 4D26A 3CO5A 1KOFA 4P4SB 3U7FB 1HYQA 3K70B 5FL3A 1Z28A 3VNUA 4EPYA 4B48A 2VSFA 4TZ0A 4HAYA 3FVQA 2BKEA 2OHFA 4LBYA 4Z51A 5HCNA 4C9BA 1G8HA 3PUVA 4RD2A 2HUPA 1Q1ZA 2J0SA 2VSOA 2O8EA 4MITA 3SFVA 4BWYA 1ZMXA 1NVXQ 3MWLA 2W2XA 4DCNA 2D4HA 1UPTA 5DI3A 4Q02A 1E2PA 1KAGA 4LV8B 4YC7A 2TMKA 2PLRA 4DHEA 1TTTA 2QBYA 1S9DA 3AKDA 1AJEA 1IJEA 1FMJA 2IF0A 2ZJYA 2JGNA 4XIGS 1W36B 1P2TA 2IXEA 3W90A 3LQRA 2PL3A 4PC3A 2J59A 5E7MA 1Q1EA 5EXSA 3B7GA 1Z0JA 1SULA 4YMVA 5FPYA 4UNQA 4DXAA 1E94E 2ZRMA 3NTUA 3ASZA 1NY6A 4H1UA 3BIFA 4CYMA 2OILA 4LY6A 3WP1B 1G6OA 4EIWA 4PO1A 3E5HA 2ZSEA 1U90A 2J41A 5IF9A 4ASUA 4IVPA 3H4MA 1NN5A 2E87A 1Z83A 3MWJA 2WJJA 2Q3FA 5J4VA 1KNXA 1DTSA 1G7TA 4DSOA 2AWNA 1AZSC 1KMHB 3BB1A 3P26A 2QE7A 3OIUA 1B23P 2YWGA 1E9SA 5FTLA 4K81B 2O8BB 3MRSA 5DSZA 4GOKA 4GOXA 5CYPA 2D62A 4FMCB 1UBEA 2GRJA 5CM8B 4A0HA 1W5SA 4HZUB 2H57A 4M9ZA 4AK9A 3G0HA 3FKSA 3DVLA 4IW3B 4A0FA 2HT6A 4QGFA 4US0R 3IUYA 2VP2A 3CRQA 3B1VA 1M1YE 3CB4A 2JJ1D 2HLDA 1Q22A 5K8LA 3QI2A 1AS3A 1BO6A 4RD6A 3QVUA 5JI2E 5JI3E 5F9HA 4RD1A 4A0GA 3GPLA 5AJZA 1AIPA 1LTQA 3MFYA 3BWDD 2RGNA 1OH6A 3HJNA 1FUUA 2BWJA 3GFPA 1VIYA 3BH7A 1E9BA 1RJ9B 2JIZA 4I81A 2BC9A 2HF8A 3IHWA 3UWKA 4DCUA 1EG7A 1ZM9A 3GFTA 2AD1A 2YKGA 2B7BA 3THYB 2GEUA 3MSXA 3U44A 1CS4C 5KSZA 2B21A 2PX3A 1HE8B 4Q21A 1RYHA 2JDID 1FPMA 3RLFA 2ZAOA 2C9YA 2J9RA 3ZS8A 3D6TB 5JJIA 4YMUA 1ZP6A 2QNRA 2FFQA 4U5XA 2IYWA 4DB2A 2Q3MA 2WIAA 5AR1A 1G3RA 3A1WA 2GKSA 2QQ0A 4D81A 1KJWA 2UZ3A 1ETUA 4Q1FA 3ECCA 3KUCA 3VU9A 2O8DB 3A6PC 1P4SA 3AP3A 1F5NA 2J1LA 4TQ9A 4WXPA 1V5WA 1II8A 1OXVA 5CDFE 5L3QA 3MD0A 3I8XA 3U7HB 4CEIB 3OZXA 3REFA 5CIQA 2WJVA 2PT5A 3CNLA 4LJ7A 4K46A 1F2UA 3DKVA 3PJRA 3ND9A 5KNDA 1KSFX 1CBUA 3PUZA 1JEEA 1X1RA 2OBMA 4NTZA 3MUFA 4LJ5A 5FPHA 1L2TA 3GLHE 3W6PA 2GBLC 2J87A 1OXTA 3I5XA 1G7CA 5HCIA 3AF0A 2FWRA 1FNMA 4BFUA 1S1MA 3ZGXA 1IM2A 3VR3A 4AG6A 4XD7D 2XGJA 2H5EA 2ODWA 2G88A 4UKDA 3K0SA 4HZIA 1Z08A 3B5JA 1R2QA 1A4RA 3KL4A 2NIPA 3OE7D 3KB1A 2W83A 1JXMA 1ZM4A 1BIFA 1TEXA 1DAMA 2QEQA 3A36A 3B85A 4RD4A 4U00A 3LV8A 2EFCB 4NDZA 1GL6A 1MH1A 3FMFA 3B60A 4ACAA 3KQKA 2H7VA 2QMUA 2OAQ1 1GRQA 1R0WA 2WKRA 3EWSA 4A8JB 1ZUHA 5KHOC 2VIIA 1Q20A 3B9PA 4MH0R 2IXGA 4DT1A 3EC1A 3P4YA 1GL7A 3WXMA 1AGRA 1IBRA 2FGJA 3T61A 3U6KA 1W0KD 1D5CA 3LDAA 4BFVA 2A5GA 3CRRA 1JR3A 4RZUA 5H68A 4EKDA 2KSQA 4LHVA 3VAAA 2WPDA 4DSTA 2R6FA 1G17A 3B1WA 3D31A 4Q00A 3FYHA 3BFXA 1EGAA 3GLFA 4TLBA 2UZIR 3RAPR 1AA9A 1QHGA 3N2EA 5FOWA 3ZIAD 2IYTA 2QENA 1N0WA 3IPXA 5G41A 4C0JA 2XITA 2AN9A 3MWYW 4D4JA 3PEWA 4US2R 3MJRA 2OCBA 3T06B 3RC3A 2BM0A 5EP4A 3EPJA 1XCMA 2OXRA 821PA 3CR8A 5DE3A 4NZYA 1I2MA 1DELA 3UG7A 3RRNA 2A5YB 3I73A 3WRXC 2REBA 4R7ZA 4Q9IA 3K9LA 5D3MA 1G8PA 3EZ9A 3SN6A 3V00A 3THWB 2KWIA 5EZ5A 2V6JA 2ZYWX 4Q7MB 3TBKA 5F9FA 3JZAA 3U60B 2ZRIA 3LFUA 4M2LA 2ZE8A 3AUXA 3VHXA 4A9AA 3HYRA 4EQ6B 4ZI3A 2OCPA 1VIAA 3W8RA 3MWKA 3L8YA 2PCJA 4G0NA 1LW7A 4NL4H 4LDJA 1RW4A 4GP7A 4O0MA 4WZBE 2JJ2A 4MYUA 3TAHA 3DMDA 2QE7D 1XMSA 3LBIA 1ZUNB 1NI3A 1U9IA 4MKIA 4CRWB 4URXR 2XSZD 1K6MA 1TADA 2D2FA 1AS2A 3L0PA 4M1YA 3EWAA 5KU1A 4AC9A 4D4LA 3FMOB 4DSUA 3FKSD 4C0QC 2BBSA 1WBBA 5EP3A 4BEJA 4MDFA 3LVQE 5IDVA 4U7DA 5DN6A 4G01B 3U3MA 1ZAKA 2WWIA 2F43B 3UATA 1IY2A 4PXAA 1BMFA 1DBSA 4WVFA 4GRAA 1GAJA 1XNJA 4ZV4A 2DWOA 1Z22A 1NJGA 1QDEA 1P9NA 3OFND 2QPOA 3LXXA 2G3YA 5FL7A 4RY2A 3D3QA 2ZJ8A 5FUVA 5E3HA 1X8JA 2FH5B 4QHSA 4RCYA 4LGMA 2DR3A 1P2SA 1VTKA 2OFOA 1NSTA 3LLUA 4URUR 4F93B 1LFDB 3BB4A 3L2OB 1SHZA 2P5SA 2O5VA 3QKSA 3ZS9A 4ZDWA 2VP6A 4O25A 1SXJD 1SXJE 2RGNC 1QZXA 1JXOA 1W46A 2BMFA 2ERYA 1GTVA 1MKYA 2RGCA 1G8FA 4PC2A 3C15C 3GJ4A 4HAVA 4M8NE 3TNFA 4PZLA 4JVSB 3EA0A 4E07A 2ZQ5A 1TNDA 1ZD1A 2ZAMA 4PSKA 5GJBA 5DI9A 1OH5A 2F55A 3JZMA 1GM5A 3K0AA 2BHRA 4KVAA 2D3WA 3PUWA 1FOEB 4DCSA 2JLWA 2V9PA 1JI0A 3UKDA 1FX0B 1O3YA 4BLRA 4DLWA 4DIEA 1EESA 2D7CA 4N0DA 2ZR9A 3BB3A 3CBQA 1ZC4A 1KY2A 5FTNA 5L3SB 3THXB 4TYWA 1JQLB 5AUPB 3FHOA 3CRMA 4KFRA 1E0AA 5ANRB 3W6OA 4LSGA 4YXWA 4MRVA 2V8OA 1D9XA 1YZTA 4W5WA 4TQUS 5HKKD 4Q9LA 5CLLA 3KJIA 3NEJA 1GRRA 4BFZA 1R8QA 2NMVA 3QE0A 1CR0A 4I1OA 2OXCA 2HJVA 5FUXA 3B13B 4MGIR 1KI4A 3BFKA 2WOOA 1KO7A 1P9WA 1XJ0A 4IEEA 4JLVA 3RWOA 3ZDQA 2BOVA 1VCIA 2Y8EA 4IDHA 3RYTC 1GP2A 1CJUC 1FFHA 5CK5A 2PEYA 1SVSA 1G7RA 1YJ5A 3N5CA 1XPUA 4XSHA 1ZM2A 3H1TA 2Z43A 3WYFA 2AL7A 2C9CA 4KODA 3A1UA 1N6KA 1NIJA 1Z5ZA 1LF0A 4OI1A 1IONA 2YWEA 2FZLA 1J90A 1P2UA 1JECA 4LJ6A 3TW8B 1G16A 4C0KA 1S2MA 1YR8A 3GP8A 1NN0A 5C18A 5EE1A 2VSXA 4QJ4A 1GL9B 4OL0A 4PFSA 1HEIA 3U61B 2WPDD 1PV4A 4Q9JA 4HUQA 1F60A 2CCKA 1AKEA 2QN6A 5FPTA 4JBWA 2X2FA 5JHGB 5SZKB 3UIEA 1AK2A 3A4MA 4DDTA 3F0TA 4M1WA 2FDCA 2ZRAA 4P31A 2IC5A 2J7PA 1PUJA 4QJ5A 5JLJA 2D7DA 2GCPA 5L3VA 4AYXA 3LWNA 4JSTA 4R71A 3QF4A 2AFIE 1Q21A 2WZQA 3WNBA 3HU2A 2A5FA 2OCAA 1IY1A 3ZVMA 4AG5A 3LH5A 5FI0B 4P4TA 1YR7A 2NPIA 2OM2A 2IS2A 4GDFA 1C1YA 1OYYA 3CM0A 3W3ZB 1MABA 3U4QB 1A1VA 3OEEA 4NCHA 4B43A 3IGFA 5BXQC 4JYBA 1VCNA 4URZR 3PUXA 3SR0A 2OLKA 1YRAA 3T12A 4D80A 1RRCA 2V4ZA 1T9HA 2FEMA 3JVUA 3K53A 1YZLA 1BOFA 2JJ2D 1GG2A 1R4AA 2QI9C 2F1JA 2ZRPA 4JLNA 4LK2A 3SBEA 5KYKA 2IUTA 2OEPA 2GEDA 4Q9HA 3ICEA 2WAYA 3QEOA 1OT3A 2OSBA 4K8OA 3CRW1 4PQFA 5CJPA 4BFYA 4A36A 4GL2A 1KDPA 2QZ4A 5LPNA 3OIYA 3RS5A 5AWFC 3U44B 5FUWA 4JJKA 1Z06A 2RMKA 2YWHA 4OQNA 4ZI2A 5LD2C 1RPZA 3ZZUA 1OSNA 4IOJA 4Q5IA 3TE6A 1UBFA 4PZZA 3WHLA 3R8CA 2WBLC 2BMJA 5FOUA 3RABA 1JBKA 3U3JA 5DN6D 2AKYA 1E3MA 4GBMA 1P75A 3K70D 2ECKA 1Z6XA 5CLQA 1OE0A 4A6XA 1CP2A 1ZNYA 2RAPA 2G1JA 2WJYA 3PVSA 3GLIA 3VHLB 3VU9B 2ZSAA 4XTCS 4IVRA 2PZEA 1E79A 1IN6A 2EVWX 1UAAA 2P67A 2QP9X 2RB4A 5L3QB 1ZUIA 3UMSA 3QXSA 1XP8A 2CL6X 5CITA 4KLZA 3C7KA 4IVQA 3QSYA 1KZ7B 2VPPA 1AZTA 1ZJ6A 2VO1A 2QAJA 2XB2A 4PHGA 4CEHA 1F2UB 3I8SA 2Q0HA 2ZI6A 2H1LA 4CGZA 2FFBA 3KFXA 1XTRA 4JLOA 2EWWA 1CJKC 5EP2A 5F2EA 4DSNA 4ON9A 3F5FA 3W34A 4HLDA 1T5IA 2YNMA 2CK3D 3OIWA 4B2PA 1E99A 4P0TA 3AF1A 3GEIA 3MAAC 2W6JA 3L0SA 1F2TA 1SHKA 2DHRA 2ZRNA 5FPSA 1P62B 2RGBA 4Y0VA 1XD9A 3VR2A 4EDHA 4LHZA 3BS4A 1VMAA 4EFNA 3BC1A 2XTMA 4RZ3A 1EWQA 4MRNA 1GIAA 4JT4A 1KHTA 2FZ4A 1ZW6A 4L9SA 4LYJA 4G5QA 4CF7A 3GLGA 1ZIPA 1G3QA 1UKVY 4LPSA 5HE8A 1DS6A 3TR0A 3R8FA 4M9XA 1OFUX 1CKEA 1YR9A 5SZJA 1U94A 2HXSA 2ZSDA 4WBSA 3WNDA 3NC0C 4V0LA 1E2DA 3CF6R 4NU0A 1Z63A 1KI8A 3AVVA 2KJQA 1TQDA 1WE2A 2I1QA 3KXIA 1C4OA 4TMTA 1AM4D 5FTJA 4DBLC 4PHTA 2CBZA 4DT1B 5EZ6B 4F38A 3I5YA 5L8VA 1GDDA 1NVVR 1ONBA 1XCGB 1HQYE 3ZQJA 5K8UA 4IFEA 4YXWD 5JSZB 5JECA 4OK5A 4LJAA 1J99A 2EFEB 2HT1A 1M7HA 2ZJBA 1U0HC 4M22A 1QHIA 2F6RA 5E95A 2FPLA 4NCKA 1JNYA 1OF1A 4YMWA 2BCGY 2ERXA 2QUZA 2YC4C 4AY2A 3UWOA 3OEHD 2B92A 3QKRA 4CW7A 4A6PA 4B44A 4PPQA 1U0LA 3BK7A 4AD8A 1Q0UA 1MO3A 2IUSA 1EX7A 3CF0A 5GVSA 3SQXA 4LUCA 3DOFA 1R0XA 3DOEA 5G3YA 2QMEA 2QP3A 4OK3A 1II9A 2BIFA 4TQAA 3SS8A 2CEAA 3TK1A 1VKJA 2XJ4A 3TUZC 1G3IA 2FSGA 1MO6A 2AXNA 2BKUA 2XX3A 4D4KA 4NKRA 1US8A 1UKYA 5FBQB 3T35A 2BMDA 5HE9A 1CJTC 5D3MB 5F98A 3U3KA 3FHCB 2W6ID 3UANA 1G41A 1T6NA 3X1XA 2XTNA 3CX8A 3M6AA 1N3BA 1P5ZB 3L0IB 4JL6A 4MYCA 1XD2A 3FFBA 3SE0A 1NMYA 4LWZA 1XX6A 2V54A 1L4YA 1D2NA 3NHAA 1R10A 2C03A 5TARA 3QVVA 3VKGA 4AYTA 1VECA 3U5ZB 3HU1A 4KXFB 4P33A 3AVOA 4LJ9A 4Q7LA 1MO4A 5KUTA 1P72A 3FFAA 1VYUA 3QG1A 4BPBA 2PZFA 4G3XA 4RVCA 1XMJA 2WOJA 2C98A 2J7PD 3KZ1E 4YQFA 1XEWY 2YZ2A 2ZXUA 3BRWD 1G3UA 4RD3A 2P6NA 1I2DA 2WJGA 5TB5A 2PBRA 4YMTA 2RH5A 3ADKA 4UNSA 5H70A 1P6XA 1QG2A 4US1R 3W3AA 4Q18A 1T5LA 1R5OA 1FTNA 5J4YA 1IAQA 1N5JA 2FNAA 3P1JA 1XXHA 2ZIAA 1RFLA 4FMCF 1H8HA 3NWJA 1XU4A 2ZM5A 4BUJA 2JLYA 1IJFA 3DL0A 4ZDIA 5JHHB 2MSEB 4TSFA 4A4DA 3ASYA 1HQCA 3IIKA 3KJHA 3QKUA 1H8EA 5AUQA 2RGAA 3TVDA 3PENA 4EUNA 4XOIA 4DLYA 1SVWA 3EX7C 3CH4B 2BBTA 1CU1A 1COWA 2ZETA 4TMXA 1UBCA 3U6BA 2FEOA 3K9GA 3O8CA 3RS0A 5FI1B 3WY9A 3D7MA 4HI0E 1PLJA 621PA 4HSEA 4DLSA 4GSYA 1GVNB 1IXSB 2ASEA 3QKSB 4TTPA 3W8NA 1GRNA 4LBWA 4RCZA 2FU5C 2F1RA 1XDBA 3KTAA 1ZCAA 4TYPA 4OQXA 4V0ME 1UFQA 1ZRHA 2JA1A 4LJ4A 3I92A 1RZ3A 5J40A 5L3RA 3CONA 4KSCA 4ZIRA 4R2IA 4QM6A 5B58C 2GXQA 5TMPA 4BE7B 4KHZA 2ZI4A 1M2OB 1NSFA 2BBWA 2IXFA 4FW9A 3IIMA 3ADBA 4V0OA 4MDEA 1GKIA 1WBDA 2J45A 3AF4A 1M74A 2FGKA 4EPVA 1QHSA 3K0AB 3C16C 1S4QA 2QU8A 4RZXA 1ZIOA 4LHXA 2O52A 2ZTSA 4LX0A 1KI2A 1G8GA 4HAZA 4KFUA 1YRBA 4IDPA 1KI1A 4GT1A 2RGEA 2V1XA 4A15A 3AVPA 1DARA 2PZGA 1LS6A 4C3ZA 4MGKR 1X3SA 2V7QA 3U2QA 3B9QA 4IXNA 1ZNWA 1ESNA 5FBVB 3IO5A 2GHIA 2C78A 2G1KA 2C5LA 2NO0A 4Q4HA 1IN8A 3DHWC 4P32A 4EFLA 1PUIA 1XTIA 1XRJA 3FMPB 5IK2A 2CCJA 3QPWA 1W48A 1BYIA 4HDOB 3A4NA 2QAGA 3L0OA 1XPOA 5TXGA 2XOKA 3RC8A 2WIBA 1SKYE 2HJGA 3NVAA 4V02A 1ZINA 1DO0A 1QVAA 1YVDA 3KQNA 3C5CA 3ZLJA 1BS1A 1E96A 1EFCA 1W7AA 4QNRA 4RKEA 4UXIA 4B3FX 3C5HA 4FXPA 4A92A 1U8YA 2NPFA 1OPXA 2PEZA 4XWAA 1KDOA 3B2EA 4XH9B 5EXPA 1Z8FA 5AJWA 1E1QD 2NO1A 1QHHA 4OQLA 3EZ2A 4LJYA 4TWZA 4OI0A 3MMPA 4OJQA 1T4GA 2ONKA 1HT2E 2OV2A 4TMKA 3WP0A 4PTLA 3X1DA 5CB8A 4DEYA 2G0TA 3KQHA 3AVYA 4BFWA 1N25A 1E2IA 1OIWA 4HUQB 2V55B 1NBMA 4DLVA 3K9HA 1QRAA 2CNWA 4JLJA 4YONB 2Z5FA 2GEVA 3DZDA 2D74A 5KPDA 3NH9A 4WOPA 1G5PA 2GJ9A 3Q7PA 1OW3B 3BBPA 1OKKA 1MR3F 3QJYA 3QF4B 1UM8A 4C0SA 5A4JA 4DVGA 1GNQA 2RGGA 2AFHE 1GZSA 2RKOA 3BFVA 3VX4A 4GZLA 4HB4A 2ZPTX 5KNCA 3T1TA 4DDVA 3M1IA 5HZHA 4Z1MD 3N2IA 3KKOA 4EFMA 4HLUC 1MABB 2H8KA 3AP2A 1K5DA 3AV0B 2R62A 3R9WA 3SNHA 3IBGA 2Q6TA 2WSMA 3GJ8A 1FP6A 1OFIA 3IQXA 4F4IA 2ZYVX 4RKFA 2AKAB 4JL8A 3MGCA 1OHHD 2WICA 3OHMA 5J47A 3I62A 1Q3HA 1M7GA 1KI6B 1M34E 1S8FA 5IHPA 4HB3A 3THOA 4MKHA 2R8RA 1NN1A 1NL3A 221PA 2Q9BA 3I32A 4HAUA 2OBNA 2IEZA 4WW0A 4BLPA 4FCWA 3KFVA 3HU3A 1A7JA 1L4UA 2WWYA 1T8UA 2NQ2C 5FOSA 4IRUB 1P61B 1DG1G 1OXUA 1OJLA 1ZM7A 2E9SA 4YDHB 4XJXA 4BFSA 2O8EB 5B57C 2B6HA 1ZBDA 3CX7A 2YHSA 3HR7A 3PV0A 3Q85A 3VKHA 1ESMA 1OFHA 2WV9A 1QHNA 4DCTA 2IYVA 1HV8A 4QG7A 2OZEA 2ZRHA 2YOFA 3BORA 5JEEA 1E9RA 1QF9A 2GILA 2A2ZA 1JJ7A 2E1RA 2VBCA 3UXMA 1H8ED 1TUEA 1W4AA 4JLDA 3L8ZA 4G1UC 2LKCA 2ORWA 2JEOA 3LLMA 4DC9A 3NG1A 1Z2CA 2ORVA 2C95A 1I4TD 3B1YA 1GITA 4MRSA 3K0CA 5FR1A 3RS3A 1JAIA 2FFAA 1HY3A 2CLCX 2JLXA 4CEHB 3DZ8A 4OHZA 2NG1A 1VCMA 4GI7A 4AKHA 4AKEA 2VHQA 1ZNZA 3AKYA 4OJKA 1YKSA 2R6AA 2JLSA 1MRSA 2UVQA 3CZPA 1LV7A 2FF7A 1BKDR 1XD8A 2A3RA 2C77A 2R6CA 1T3HA 2F1HA 4LZZA 1U8ZA 1F2TB 4BLSA 4TLAA 2QPTA 3TQCA 4LRWA 1FQJA 1E1RA 5LDDC 1SKYB 1SVKA 3UPUA 5KSPA 2JLUA 2XXAA 4R2HA 2QT0A 2R6DA 3PCRB 4ZDJA 4G5OA 4ASUD 2VF8A 1KSHA 1NMZA 3FOZA 2F3RA 2GXAA 4B3XA 5FOTA 3GLGB 2GCOB 3DM9B 1JB1A 2CLDX 2WKQA 1U0JA 3O47A 1E32A 1DAEA 3CPEA 2IUUA 1GWNA 2V7QD 3SYNA 3EIHA 4HATA 1Z07A 4KVGA 2QP4A 3TJZA 2IYUA 3P4XA 3QXXA 3QBVA 4TYYA 3Q7QA 5FBLB 1D2EA 5IK2D 1E69A 4Q7KA 1UKZA 3IDQA 4ZPXA 2GZDA 4JS0A 2WKPA 4XSGA 1ZYUA 1GNRA 1N6RA 1A2KC 3SZRA 2O0HA 4DUGA 4E22A 2WWXA 1Z29A 1U2RA 1C9KA 2XOKD 2HLDD 1G4AE 3IIJA 4KFSA 1NNEA 1VYVA 2ZJ5A 3MG9A 1VCOA 5DHFA 2OT3B 4B47A 1K8RA 3WYGA 2GAOA 2FSFA 3SJBA 1P60A 2JJ8A 5HTKA 4DJTA 1IN4A 2QAGC 1DAHA 1YHNA 2RGDA 4FMDB 4C0HA 2REXB 5DNYB 1CTQA 4TYNA 1FW6A 3AUYA 2W58A 1E2KA 5KDDA 2JIZD 2ZI3A 4Q4LA 2ODEA 8OHMA 3AF3A 4GNKA 5BYJA 1U99A 3C41J 4GPTA 2QT1A 4PC1A
chains in the Genus database with same CATH superfamily
5BPFA 2PZBA 4KPUB 3W6NA 1BWQA 1Z4MA 1JFRA 3HCCA 5K0BA 1KE2A 4CPDA 1NFFA 3R41A 3T5CA 3ZDZB 2WR8A 4A2QA 2QORA 3JD0A 4UNPA 3FMGA 4LMRA 1L9KA 5CNMA 4LC0A 1D1PA 3WLOA 2G04A 1XD2B 3HYLA 3WB2A 1SOUA 3W7VA 2O54A 5BP7A 2B8JA 2GNOA 3E3LA 3OP4A 3WK9A 4CUJA 3CBGA 5D5QA 2WA2A 1DJNA 2ZJOA 1RYNA 2VYCA 3K35A 5E3IA 1DIBA 4RD0A 1GPYA 1KIAA 4NYIQ 2OWDA 4AMUA 5JNWA 4B9AA 2IS4A 3UB4A 4DIMA 3HVJA 3LO5A 1HYBA 2CNWD 1GA1A 3A6EA 3CNOA 3GUZA 4HD8A 4I55A 4QOIA 3UJ7A 4YP5A 3ZY2A 5KTMA 1TCUA 1VL2A 2DUMA 2W6QA 2VCEA 2CHGA 1ONPA 1JG2A 1PG0A 3JQEA 4G85A 5AKHA 1U8AA 1OKKD 3PUYA 2H92A 3QW2A 2IWRA 1XMPA 1MC1A 3BCHA 4DBZA 5B3LA 4YMLA 2XB6A 1Y1KE 3LCMA 2P6OA 3EGDA 2ZB8A 4TZ6A 2YHIB 3UUWA 4QPCA 5GVRA 1GT6A 3FI9A 4X44A 3ZZTA 4W6ZA 5DLQC 3GOHA 1PWXA 1B0UA 1L0BA 2AD5A 2VQSA 3CJRA 3ETNA 3KJXA 1N2BA 1X1EA 4R9SA 2EF0A 2B61A 1UBLS 3EUFA 4RZIA 1T0JB 1PFWA 4JBYA 3AIIA 3QX7A 2RGUA 3PQ2A 4FR5A 4BV8A 1D4OA 1GZDA 1MB4A 4MS4A 1KJYA 2A30A 4NYIR 3NKFA 1Z0KA 4UOZA 1RQPA 4PSAA 1X77A 1FYEA 2XLBA 3N86A 2OENG 4M1TA 3M34A 4ZQCB 3KL2A 4RSGA 3RT9A 4LCBA 3UJHA 1NU8A 3PNLA 3GPIA 3LPDA 1XN4A 4ONEA 4JVMA 1Y9DA 4HZUA 4KSYA 1UOPA 3VYRB 2AZXA 5AXDA 2WDPA 3ZQKA 1IZZA 3O7MA 4AMYA 3V8MA 1ADCA 3P27A 5CB6A 1TFUA 2NXNA 4ROTA 4TWJA 4IZ6A 4F2HA 4O59O 4R3WA 3BWYA 1G291 1H2EA 2R7NA 1RAIA 2Z2IA 4WADA 3PS9A 2EFGA 3FWHA 5KS2A 1CUZA 1DE0A 1DEHA 2R8PA 3MJEA 4CM8B 1A8HA 5KNDH 4JEHA 5IVKA 3PFWO 2EAUA 1YRLA 2J31A 4ZKEA 1CNFA 2FOLA 3SQDA 1BMTA 2YRWA 3KVNA 4P93A 1JR3E 2VTKA 1NJ5A 1FNCA 2XWBF 2QVCA 1CPYA 3I6YA 3UMFA 2X7JA 1VL6A 1XZKA 3D0OA 2OBYA 4J6EA 2JFUA 5JADA 2BUBA 4B3JA 1K4KA 3E9MA 1SWWA 1C41A 1Z13A 3FYUC 5KSOA 4BKOA 5L9AA 5LZ9A 3GLFE 2ZZNA 3ZWVA 1CG6A 1K9SA 3JYQA 5AVJA 1U28C 3AY7A 5HJ5A 4PQRA 4IR7A 3U7QB 3VKVA 1J9EA 1NZJA 1SK9A 1UEJA 2IZ5A 4GECA 2Q1SA 4MP3A 4DCGA 1R6TA 1RLTA 3FN4A 5THKA 1QLHA 3FE2A 4OYYA 3H11B 4Q1BA 4UM5A 1V5IA 1CUGA 4FFBB 4N0EA 3C8UA 1X74A 3DB1A 4TN1A 3QBEA 4U9HS 5FEUA 1Y8CA 1HL3A 1ZC3A 2BFBA 5HIMA 1DKMA 2GARA 3OU6A 1F3OA 4TT8A 4WZAA 2PGAA 1M73E 3WRYC 3HADA 3GDWA 3ZXYA 4MUYA 1RVDA 5B6PA 1DHRA 1A5ZA 1NMXA 4A5OA 2RGXA 3OM9A 1EFRA 1GPLA 4CEIA 2PSDA 4OA5A 5CX1B 5BSMA 3TB6A 4D82A 4UAVA 4P3KA 3N6VA 5KYVA 1BEZA 2PNJA 1U1DA 4FPXA 4D9CA 3AH8A 1OLOA 3E1SA 3PX3A 2AJLI 3HXTA 1PL8A 1FQWA 3IJRA 3SY8A 1KPHA 1KZ1A 2EJTA 3BXPA 4OY3A 3KZCA 4YCCA 1G38A 3F9RA 2I2XB 3BSYA 3GUVA 1WB9A 1NF8A 1QF7A 5DRYA 1MX3A 3EMVA 5AQEA 4J29A 1EUDB 4E94A 2Z09A 3C48A 4C7XA 1SM4A 2I1WA 1Y3AA 4AO6A 2EYQA 2L19A 1KO5A 1P7WA 2I3BA 2AK3A 2X4IA 3JWGA 3Q9LA 1KJ9A 3OWHA 4HB2A 4XGRA 4RQBA 2VXBA 4ZC1A 1DO2A 2N1BA 4PC6A 5JCPA 3KPWA 1B6GA 3GYGA 1EK2A 1ZDMA 3DFKA 4AP9A 1N6OA 1DKOA 1SVOA 3KG2A 4H6XA 3PHJA 4BQSA 5B36A 1G2IA 5HM8A 4NFHA 3PEYA 2I4NA 4EHDA 3KVOA 5JROA 3H65A 2W6NA 2Z8YA 2IPNA 2QVGA 2ZUBA 4EI7A 4L0DA 5AKJA 2ECFA 1O87A 2A94A 4DVJA 2HBQA 4RFLA 1EDOA 2AQKA 3CXRA 3GAZA 4PINA 4QGHA 5KPJA 3KYCB 2WJ3A 3KHKA 1A8QA 3QVSA 1YAJA 1OTYA 1V1JA 2X4DA 1VDMA 2MYUA 3WYEA 3H5OA 3SZMA 2VH5R 3PVZA 2GCNA 3JQ6A 3WWCA 1FFDA 3EXG2 2UV8A 3T7JA 1D3AA 2O3JA 5ALRA 4EF5A 2QDXA 3LBYA 1GZ5A 1T9DA 1EFKA 1LI7A 5BN4A 5SY4A 3EEFA 4JEUA 1Z7BA 2EG9A 5AM1A 3PQ5A 1Q3KA 1TYZA 5I7SA 4LZAA 2Q5IA 2PA0A 2QN2A 4W5JA 3ZE8A 2O0JA 3KR1A 4D0NA 2QI9F 3G0CA 1C7FA 1HNNA 4O2BF 3WLTA 5IUKC 3I30X 5I7RA 2D1QA 1BCRA 1HL7A 3VVLA 2FP4B 5KNBD 4UZSA 4ERNA 2PXXA 1RHJA 4S1NA 2HKIA 3H18A 1HR0B 2HQ1A 4QSMA 2E49A 1C7ZA 1O9GA 1GV0A 1P9RA 3EARA 3UHPA 2F59A 1NHGA 4V24A 2Z5GA 4XIIA 3VYTB 4EJ6A 4ZZ1A 3BF7A 4O2RA 5ERYA 1EK5A 1CY2A 4U0JA 3S7TA 4DANA 3CEHA 3RAFC 1IQPA 4AQDA 4F4HA 1GUFA 5K4HA 3VAYA 3THWA 1TU4A 1JIKA 2XVZA 3DLCA 2PSJA 1JHAA 2BTQA 3R7DA 3OF3A 4GKJB 1XU7A 4EPRA 2G6BA 2VHXA 1Q7RA 3MCZA 3INYA 4TLDA 1U3WA 4HQNA 4D9BA 4DB4A 4JJ8A 2PX6A 2EJWA 2A0KA 3B52X 4ESEA 5LA6B 1PV1A 1N78A 3JX9A 4RTQA 4MKXA 3R0XA 1Z6PA 1QGOA 3R5XA 1M1XB 2VLIA 2Y1LA 1H2ZA 2YHBA 2WUWE 4OJNA 4J2TA 4INAA 4ZHQB 4CTMA 1PBTA 1ZK2A 2PANA 2VP3A 3ESZA 3PGA1 1PNTA 1KJNA 3AETA 4RF2A 5I7UA 4GBGA 1M8PA 1ULAA 5ITZB 4N3BA 5M29A 1DQYA 4GIBA 3QNWA 2IGTA 2O7SA 1AUVA 4PHHA 1LD3A 1Y34E 4RETA 3L7OA 3L4JA 2ZE5A 4K86A 5LB4A 3DHYA 3HCRA 2FFHA 2LV8A 4LHEA 2CDAA 3QNUA 4JT2A 4MUGA 4Y2PA 4D4MA 2NYRA 3T38A 1R5NA 1ZONA 4GGPA 5KVSA 4Q3CA 4R7TA 3S2GA 1D2MA 5IN4A 4J0QA 4HBZA 3CJQA 4M1SA 1YACA 4RHYA 4WFIA 1PBNA 5I7WA 5KC9A 4FWIB 1TF5A 5L7WA 1DVRA 2JW5A 4W5TA 1XZCA 2NT4A 2Y4NA 3R5HA 4WFKA 3DMGA 4F4UA 5AMXA 2QRNA 2GVZC 1UM9A 4ALMA 4LI0A 4MWDA 4CFYA 3NHZA 4CDGA 3EC2A 2BHLA 2E6KA 3MS7A 4MWGA 3G1WA 1R6BX 3BUSA 5KYGA 2X0JA 4UBIA 3GAAA 4AG3A 2DLCX 3E4CA 4QUGA 1G5RA 1U9JA 4R51A 2O07A 5TT0A 2A67A 2DR0A 1ML4A 3TR5A 4GI1A 1N5IA 3FKJA 2DUNA 3KM0A 3EPPA 1AU9A 3OKAA 3BYZA 3B1XA 3MJ4A 1K7CA 2RHMA 3S55A 4A1FA 1YULA 2QW8A 4P4UA 1FDOA 3AHIA 2LCFA 4JH0A 2Q7OE 10MHA 1YD7A 4GMDA 2J5QA 4YJ2B 4F72A 5JBNA 1YQGA 2PXCA 1E9AA 2BV3A 5ER9A 1RE0A 2GJKA 3RU7A 2RHOA 1M6WA 4JBLA 5DEIA 3GRFA 3C1TA 4FHCA 4XD7A 3G13A 4ZAZA 4D6PA 4BTLA 3OFSA 5C3MA 3JZDA 2GBIA 4DDHA 4ZAFA 3BQ9A 3CZQA 3M8KA 3PPXA 3AEKB 4EWLA 4B3DA 1T6YA 1EFDN 2CUZA 5TPWB 3ZD7A 4R40A 2H17A 2WF9A 1HZJA 3KTOA 4P36A 3ZEAA 1TUBA 1RWKA 5B64A 2HW8A 1A77A 1OD6A 1FX0A 1PE0A 3T3GA 4NZMA 4TUYF 3EF3A 3NAGA 2NUTB 4ZCLA 2OQVA 4GSKA 4PONA 2HHHB 4AS1A 4P2BA 3T3MB 2NZJA 3F6SA 3R5JA 1KAMA 2JI7A 2I9KA 2EIHA 5SZHB 1GPAA 3JPWA 4XIFA 1OAOC 1XF9A 4EUEA 1YOVA 4DQKA 5TMBA 1JMKC 3NIGB 3ZWXA 4I5FA 3UXYA 1J25A 4B3RB 3UAZA 3OCWA 1GAWA 4UAJA 2DPGA 4TTRA 3EY4A 2MMCA 3MT7A 5E4YA 3CF4A 1TECE 3HWSA 1MOSA 3GARA 3GVHA 4OQZA 4D4GA 2UUBB 3I45A 2CXRA 2Z6AA 1RXSA 3NTOA 1J2JA 2YJTD 2XV1A 4BC0A 3IUJA 4Q3KA 2FWAA 1CVRA 4GMHA 2D8AA 1JF8A 3TBFA 3NDJA 3PC4A 1JKMA 1OB2A 1BE8A 2DBQA 2QPAA 4MJLA 4CKEA 3E5RA 3GLIE 1PGPA 1W88B 5LOVA 2B69A 2P9HA 4JC5A 1T1GA 2FPMA 2IX9A 4JYCA 4LWOA 4WZ6A 4BMDA 5JFOA 2DFLA 2WNIA 4TPKA 4U2CA 1WQ1R 4URYR 4XTRA 3D3NA 3SX4A 3GA5A 4KO1S 5FH9A 4KR9A 3HNOA 1OBCA 3HP7A 4AJHA 3IT3A 121PA 1AKWA 1X9IA 4Y6SA 1X1SA 2GESA 3OKCA 4EJSC 1WEHA 3QE9Y 3TDKA 3OOYA 3MK31 1FL9A 2BMAA 4FBGA 3PK0A 3PFCA 4DPLA 3C3XA 5CIYA 4NS4A 4RVNA 4JI6B 1IWBB 2V4UA 3HM9A 2PO7A 1XF1A 2BVNA 2FMIA 1UP7A 1JIVA 1NATA 5GZ1A 1UDRA 1T36B 3QWAA 4C07A 4B6GA 2QVYX 3FLEA 2O6HA 3GX1A 3TOVA 2WINI 1L4KA 3OAAD 4DZZA 4N8EA 5G2OA 5ES3A 4G65A 3ZY6A 2IA5A 2X5OA 3B12A 3M82A 3K0FB 4V1CB 1XROA 3J7AC 4AMVA 1WDTA 2Q8PA 2W0MA 4UQPA 3T9BA 2XSZA 3N74A 1HE3A 1DC7A 3LSTA 2Z9CA 1R18A 3OZSA 4P3XA 1L4BA 3LUPA 2EQ5A 1CRZA 4MJXA 4Y1RA 1QR6A 2P9YA 1XL0A 3KJZA 1X0XA 1EX1A 2C04A 4I1SA 4JI7B 2O4UX 3R20A 4GLFA 4G86A 4QT0A 3HHPA 2WTXA 3U4QA 4L15A 5LM3A 1GPH1 4WXHA 4XQ0A 1FFEA 3T4UA 1DQPA 3WWYA 1AF7A 4WECA 5ECWA 2WVJA 3AVXA 4NG4A 1R8JA 3MC1A 4QPJC 3ADPA 5JARA 2YY5A 4C0LA 2AB0A 1V48A 5G0VA 4NCJA 1WSAA 4LXUA 4Q48A 4YV7A 1B0PA 3VBCA 2XCSB 4WWHA 4MR7B 2IV2X 4N18A 1H4SA 2QVXX 5B1HA 2PKYX 3TSAA 3IO3A 1HXHA 1J0BA 1ANKA 2G0NA 3HB1A 3OM1A 4K03A 4BRWA 1SXJA 2C9ZA 5LXTF 3RBVA 2CHVA 2NVOA 4HX5A 3AGPA 4KZPA 3Q72A 4AJEA 3HKCA 4E13A 5I8WA 1B73A 4HLQB 4U2DA 1PG2A 2NW6A 2PMBA 1QLJA 2YV5A 3EXIA 4LVOA 1E2NA 1WBJB 5DTQA 2OO5A 4B45A 4DHWA 1KSJA 3RAJA 4REMA 1ODFA 1KORA 1RD4A 3NHRA 3ZN2A 1Y3FE 3ISTA 1VLJA 1XLWA 2VI5A 2CMKA 3GNTA 4G2TA 3WHKA 4F8YA 3CVYA 1QYXA 2HK6A 3UOGA 4QU5A 3FZQA 5DXAA 4BLQA 2YJ3A 3ETEA 1E1KA 1TEVA 2GQ0A 3BMCB 4XVUA 3G2MA 2GJSA 3E9CA 1KETA 2VKQA 4B4UA 1NW4A 5I7FA 1M7BA 1CEEA 3HCFA 4BLVA 5ABPA 2PUHA 3W5JA 1E20A 3DVSX 2LIPA 1FTSA 5KKCA 4G81A 4DFDA 4B3GA 4V2IA 2GD6A 2I2BA 4BP9A 2BHTA 3F6PA 2V98A 1XBTA 5TC4A 3JVEA 2NVUB 1AGPA 2OFWA 1FJGB 2L2QA 1K66A 2Q21A 1JPJA 3CCCA 3FM9A 3QXCA 2EZTA 4BRUA 1H2YA 1R5JA 1RDFA 2VRCA 4M0MA 2K87A 4QTZA 5MHTA 3AVTA 3ZI0A 5C5CA 4G9GA 2D13A 5IZCC 4X8OA 1SVIA 3T0GA 1E3TA 1L5SA 1KY3A 2W37A 3FWYA 4P4LA 3PE6A 4YI5A 6NULA 2ZUDA 1N6IA 9LDTA 1LRLA 1LCIA 2VBIA 2X58A 2NU8A 3K09A 3QEJA 4AU1A 2JAQA 4UPDA 1KJQA 2C00A 5DNEA 3ONEA 1ZG3A 1NJFA 3RTAA 3K05A 3Q15C 2C7QA 3EQ6A 5K0GA 5ALDA 4C76A 3QX3A 4J16A 2V1UA 4LZJA 3LGAA 5JS2A 3Q3EA 1NXTA 4YGXB 3OIFA 3VU1A 1JIXA 1PT6A 3D8BA 1DUSA 1CEXA 1RYFA 3ANNA 3L04A 3GLKA 3NO4A 4BX8A 4YAKA 3CHYA 3EFEA 2EQBA 4RTRA 1SXHA 1U81A 4O4IA 4OEHA 3L7IA 3PF8A 4QYIA 4UEJA 4Z7QB 4M1EA 4MRRA 1OX4B 2DECA 3L18A 2QYOA 4EJSB 1J09A 6REQA 1COWD 3PC8A 4R8KA 4XEUA 4YCLA 1U8XX 4P9NA 3GFFA 4XQGA 4A0SA 4E1VA 2SCUB 1YB7A 4LC1A 1T25A 2E5WA 1XRPA 3AXSA 1DDIA 1BA3A 3N6XA 1PTKA 4BL5A 4DGSA 3C7AA 1ILWA 3DLAA 4C4SA 4I19A 2YIVX 1SU7A 3LT0A 4GP6A 4C0AC 4B85A 2Z8YM 3GRRA 4UUNA 3Q1LA 4BNDB 4DMFA 1PJ3A 2YIDA 1A8SA 2A9QA 2C1EA 1TYCA 2C83A 2HEGA 1RZUA 1J1UA 1X6VA 1ZEMA 4DC0A 1TM7E 3UMGA 3ROZA 2B7CA 4JC0A 2C7PA 1LK0A 1I2CA 1Q15A 3QIAA 4RAQA 1USKA 2WWRA 2JGAA 4NCXA 1L4EA 3ZU3A 1TB4A 4CEJA 5CH8A 4YMHA 1NLZA 3TAUA 2BGRA 3WTCA 3DAOA 1EU1A 1B76A 5CTAA 2GXSA 3E2IA 4GVXA 3AYXB 2XR1A 2Q6KA 1R0RE 1YJXA 4L8VA 2A78A 5AQ1A 4YDQA 4HDSB 1N3IA 2KB0A 2VQFB 1E18A 2CLEB 5EN4A 3H5IA 3J81A 3TE7A 3ZVRA 3F7NA 2RBEA 5EESA 3N0XA 3QY0A 2ID4A 4OIFA 1FUEA 4I4TF 4L4RA 4K40A 3QH4A 2XODA 3CMCO 1HORA 1HWYA 1D2RA 4IDAA 4KQEA 3VTKA 1UPUA 1E2GA 4S2EA 3TGWA 4AIIA 4BMOB 1QAOA 2PL5A 1DCTA 2Q28A 3SHVA 1V43A 5HZKA 3PYMA 3B1KA 3DXZA 2AOXA 4O63O 3RHSA 7REQA 3V2UA 2BY4A 1TLLA 2BM1A 4QBFA 5FV7A 1E64A 3ZNQA 2NXJA 4CMEA 2VHJA 4HYYA 5JTTA 1H2HA 2I4LA 2XI4A 2ROQA 3LXRA 1NQTA 4FW8A 4EA7A 3WQSB 1XZGA 2MSDB 3EYAA 2RONA 4URFA 5AKIA 3E05A 1KVQA 1BE6A 2Z3ZA 2LDXA 3BIJA 5CFRA 5IUJC 5KOHB 3J81k 1R6AA 2J3EA 3HTXA 3Q9SA 1QC5A 1ZL0A 4KBFA 4RKRA 4TXLA 4O2AF 1G6Q1 1KK3A 3LLVA 2H2HA 5BN5A 2JNWA 1MX9A 3X1YA 3DZBA 3RSLA 4AUEA 4GXRA 3A4VA 4PYIA 1QAQA 2A9OA 2VJQA 1KC3A 2XDAA 3ASVA 3EY9A 4MKFA 1VYTA 5F35A 5U4XA 2EC5A 1GZ4A 4H27A 4UHBA 1T2EA 1NVWQ 1TKCA 3CLKA 2VF7A 3VKWA 1JT9A 3LVRE 5DTEA 3VDNB 3GT7A 3EG5A 4PYJA 2EJUA 4BCBA 1SU8A 2ISQA 4NAHA 3U48A 4BV3A 2WP0A 4P4SA 4DMUB 1MIOB 2HYDA 4F2DA 1A9OA 2DVMA 4WVLA 3DV0A 4OA8A 5EINA 4KLNA 3QFSA 5CDHA 1YFJA 4XB2A 2FSHA 3KQUA 3LPCA 4WMLA 1P1FA 2PUAA 1KBOA 1ZI6A 2IHUA 4BZPA 2QNIA 2O2ZA 4H1VA 5BMVB 2BI4A 4R5HA 3PNQA 3WL5A 2H1WA 2FWJA 1KE1A 4PXSA 3ZQ6A 1W49A 2GHTA 3D64A 2HSDA 2PH3A 1BEUB 4XRRA 4NWIA 4O02B 1NP6A 3UJ8A 1CJVC 3UB2A 3IIIA 1J70A 3A2LA 2HU2A 3R23A 5A05A 2HU7A 1O97D 1DWQA 3SFTA 1CB7A 1ZK1A 1TK3A 2AZMA 3DL4A 4LEIA 1SKAA 1KR5A 1WZNA 2HCJB 3HRKA 4RTOA 3DP9A 1OV6A 2EATA 3G5MA 3AUJB 3UWMA 4D9IA 5JQGF 2J46A 2PD3A 2X4LA 1J2RA 3DMFA 1FSFA 1ES9A 3D5QA 3EGIA 3PE4A 2A88A 3MF4A 4MARA 2H11A 1A71A 3REQA 1D4FA 1QIHA 5JH7F 5LP6F 3BJMA 1Q3TA 1ODSA 2XECA 3I28A 2HMYB 4KSBA 1KI7A 4MUEA 5CW1A 2OXIA 4UMDA 2ACKA 5K6AC 4RKWA 4UAGA 1U7HA 4NRDA 4OJYA 3N75A 1II0A 1ZXBA 4PG6A 4C3UA 3PU6A 1HA3A 4WK6A 5EUBA 3RAEC 4X90A 2BKXA 5ELLA 3T4XA 3HRHA 4R3NA 5B7NA 4Z2AA 1ND6A 2KX7A 5CB4B 3VO9A 5INTA 1KMQA 3R74A 3L5OA 1EGVB 4QBHA 5CH5A 4O08A 2JFVA 1F4VA 4WBNA 3V42A 4BATA 1VSQA 2E89A 3P45A 5BYKA 2V0CA 3GG9A 1WL8A 4IDQA 4M0DA 5DH9A 3ZNPA 2ZJ2A 2D2VA 1P4AA 2R87A 3IH5A 4JI0B 3B3AA 2BJVA 1YMUA 2R66A 3LX5A 1QFXA 4NABA 1IFXA 4E6EA 1GUZA 4U4AA 3GVCA 1N5LA 2CE7A 3F9IA 2WHXA 5GONF 4ARAA 3CC8A 3MS2A 1QBKC 1WUHS 3U37A 3I3SR 4NOMA 1UJ4A 5KNCH 3ACDA 4GC5A 5CCDA 3ZBTA 4GVLA 4TMVA 3M1YA 3KUKA 3BXEA 3HBAA 1PS8A 1JG4A 1I3CA 1MGOA 3F47A 1NXSA 3Q3HA 4L3WA 1WA5A 4W8OA 3VU8A 2EGHA 1NUHA 2ZSKA 3HC7A 4L8WB 4N39A 4TRRA 4E6PA 5BQFA 1DIGA 5A4KA 4S1OA 4NBSA 3OSZA 3RH0A 2QTLA 3OJFA 4FINA 1E98A 1VJCA 3HY6A 4HO1X 4ZT3A 3S3TA 1PU2A 1LKZA 2UKDA 4GNRA 2VP5A 1CT9A 5E9JA 3NWBA 5GM1A 1ICIA 3ODPA 4D2IA 2VHEA 5ADUS 2B1QA 3HLYA 3QTBA 4TXHA 4X6LA 5ALXA 3FGPA 4BGDA 4M6WB 4BB9A 1TL7C 4KN6A 1DQSA 3Q6IA 4IKEA 2Z6UA 3HKDB 4IGKA 1RZRA 2LUOA 2P90A 1T91A 3Q0TA 3UMBA 1BD4A 5CT8A 2DFKB 4F4JA 1QB7A 3GEMA 2W2NA 4XB6B 4YT8A 2P6RA 4GR5A 2G70A 1MC5A 3AY3A 2O48X 3CZ4A 1NBEA 1YJAA 4HN4B 1QQ7A 3PG5A 1FC0A 4QDJA 3DLHA 1VBKA 4PAOA 4A2WA 1JJAA 1E2HA 3SQNA 4C2BA 1GA6A 1UJMA 4GGMX 4J0DA 3MEQA 1NC1A 1B6TA 1SFRA 2DM6A 2Q6OA 4MP6A 5FAXA 1OOEA 3QX9A 1PDVA 3L6RA 1FNDA 1DAGA 1SN7A 2GWHA 2IYAA 3K16A 3QUSA 4GF5A 5FD8A 5IAAA 1F6WA 1P5RA 1HTBA 3QTLA 4GI2A 2FK8A 2IL1A 4LDRA 5JRZA 3R0QA 5HEKA 4W5HA 1L1EA 4ZD6A 3B5EA 3DM5A 4E2ZA 3R7WB 5ALJA 5DNAA 4Q9NA 4EEKA 3AO0B 3H4IA 4QBIA 1NRXA 3K7EA 2VZEA 4OBEA 3RYIB 4I4NA 1PO7A 4XVCA 4GO1A 2OZPA 3KVYA 4KRGA 4OHKA 1BYUA 2E0IA 3HGMA 2BFOA 4FYMA 4RKYA 3R75A 4K9QA 5DYTA 3QBTA 2IIPA 4QRHA 1N7IA 3HL4A 4AN4A 3WMRA 1P1JA 4HDMB 4ZRNA 1DI0A 3SE7A 4WA8A 1PHPA 1HURA 1SQSA 2ZUWA 1JEDA 1T0PA 3HDGA 4K6OA 4D9KA 1U0GA 5KNLA 1ZR2A 1UK9A 1ZA1A 5D5HA 3U1TA 1Y6ZA 4IZIA 1OVMA 4PRZA 1Z0DA 1T4CB 1I3KA 2H51A 3C3WA 3WRWA 4D97A 3EPHA 2CEKA 2O2GA 3GA7A 3L0YA 2ZE7A 1X92A 4H3KB 1PNOA 2XXJA 3KKQA 3WICA 4NYMQ 5FBZA 2W22A 3IBYA 5JJKA 1NAHA 2J9XB 5JAZA 1QZTA 3I12A 3O1LA 1YBMA 4EY3A 1OLSB 3OLWA 2JGDB 1N2OA 1XCOA 2IE8A 4PE5B 3O26A 4I2VA 2ETVA 5HQ3B 3OC6A 5TQJA 1QTNA 1UP6A 1OI4A 2ZIVB 2ZAYA 1PL0A 4LDZA 4PVCA 1NF9A 3ECAA 3SBDA 1MORA 1B8PA 1V11B 2AJCA 2C92A 2I62A 4ENVA 3R3HA 3TIFA 3U5TA 3Q7RA 4LJKA 1NTOA 1USWA 4Z3KA 2AH5A 3T7DA 2GS9A 2XDQB 4GR4A 4PPGA 4QGGA 4QQKA 4DNQA 1W4BA 2R4TA 1DRVA 5BN3A 1Z56C 2ERCA 2OHOA 2XZPA 3PEVA 4L95C 4PFJA 4EY7A 3LX8A 5HGJA 1DT3A 2E4XA 3BERA 4BB5A 3CLRD 5JJLA 3AHJA 2MR6A 1FTGA 4DTIA 1X15A 2PQ6A 2ZBDA 3FR8A 4BCDA 5I45A 2J85A 2IU6A 4J0FA 4N5DA 1RYEA 4GPIB 2WQZA 4NYMR 4CCSA 4GRDA 4H7PA 1CETA 1NVVQ 1XTBA 2HLHA 2PUJA 3LY5A 5BNFA 3KOWA 1T8YA 4ZT4A 1N5DA 5G53C 1W4RA 3WZ2A 5AH0A 3KSBC 2CL5A 2D2XA 3AQ4A 3NHLA 3JSXA 4QOHA 3ZHYA 5ICGA 4C7OB 1RTTA 5C9ZA 3S4YA 5JJBA 3USZA 1S2GA 1SGWA 4O4JB 3WGLA 2F8LA 2I8CA 3KB2A 3H8SA 4PPNA 1T34A 1KIFA 3SI7A 1S2DA 2NO5A 4QRIA 2VWPA 4R3UC 2X9LA 3IP1A 3VFDA 2B37A 2FX3A 1V9LA 1R27A 5JO9A 1E66A 3EMDA 3NHBA 4BZQA 5LCXA 2GNAA 3G5AA 1XI2A 2NUAB 2F1OA 2WYIA 2IF2A 4CKBA 4X00A 3FMIA 4KNVA 3KEFA 4LGYA 5JSQA 2Q6LA 3F2IA 2M32A 1JVNA 2ZU6A 5IASA 1JIIA 4ZVSA 4M38A 1YNSA 4LHYA 2V0GA 4HFJA 1S3FA 1V5EA 2Y1FA 4NE9A 3OQPA 2B0JA 1OXKB 5DT9A 5JWRA 1KGDA 3RSHA 1DFGA 2AK2A 2A4MA 2PTHA 5ITSA 1L5WA 1ZH2A 5JXHA 2G82A 5DGIA 1TVKB 5DJ5A 5BPHA 2PRZA 4C21A 1EJ6A 1JL3A 1BE0A 3OZFA 4F6RA 3HXMA 4J4BA 1Z73A 2IYSA 5H80A 2XCUA 3NRJA 1U7UA 3BTOA 5GGYA 4EB8A 1DIRA 2XCIA 2XNDD 4KL8S 3A9CA 5IN5A 3MJHA 3V4LA 1A2QA 1MXFA 3ECSA 1MJNA 1L5HB 2WM8A 4RZSA 2QMOA 4HXYA 5H3CA 3W8FA 3I4LA 1WCIB 4ZKDA 1LK7A 2L0XA 2QTMA 1FA9A 2NWQA 4F0JA 4QG3A 3ZHUA 1R0YA 1WUYA 4F2GA 2R8ZA 2AFIB 5B7PA 2BSQA 4KI0A 3H2HA 2MSNA 1FRNA 2A5DA 1IOWA 3QELA 1WDKA 2IHBA 4DRYA 1Z7EA 3KKLA 2ESRA 3EPLA 4FDVA 2W2VA 4HGPA 5BUQA 1BQ3A 4LXXA 2V7WA 1SB8A 3IDOA 3P2EA 5D86A 1YC5A 2YS6A 4DQDA 1HT1E 3F8SA 1VIVA 1SZDA 3OQBA 5REQB 1N2CE 3AV3A 4YUZA 1KMIY 1L8LA 1XA0A 2COUA 3JRXA 4QVKA 4RORA 5BW8A 4GI3A 3B1JA 4R1MA 4YX9A 2X6TA 2NO9A 2BH2A 1LC3A 1DMSA 3V9PA 3OURA 4DUPA 2DXIA 3C8MA 2PS3A 1NJ6A 1WKBA 1L8OA 2VYNA 4TL7A 1DKUA 5FIUA 3K4PA 3OX4A 4N49A 1CUFA 1XG5A 2BEKA 2AXPA 4MUNA 5JCOC 1UBRS 4Y0NA 4FU0A 1U7XA 3LCCA 4ITVA 1GGJA 2P5TB 3ZK7A 3FFXA 4WA7A 2Y9PB 2OESA 2ANBA 1RKBA 3BGIA 4HHEA 3VQTA 2RK3A 1AKTA 1UJ2A 4C14A 3D6FA 5HZMA 4CQMA 2NP6A 2GO1A 4YAFA 3ASUA 3HSYA 4RFSB 2J5RA 2P11A 3B9RA 3QPCA 2IW3A 2ADOA 2OV4A 1W0KA 1Z33A 3PHLA 3GRAA 3SYRA 5CA1B 4YT5A 1HYQA 3U7FB 2FLKA 3LVFO 4OUDB 4B48A 2VSFA 4BO1A 4HTFB 1F0NA 1IVYA 1FP2A 4HNGA 2OCKA 2RGWA 2HBRA 4C9BA 3EIXA 3NGXA 3PUVA 4UEKA 5F9MA 2J0SA 2VSOA 3FJYA 5I5GA 3TI9A 4UVEA 4WN3A 2YFKA 4CNBA 3G79A 2I2CA 3I09A 4JKOA 3WMWA 3ZKAA 2NQ8A 4BWYA 4DARA 2EBHX 2FKAA 4WFJA 3WRXA 1P39A 4DSAA 4L5IA 4LQCA 1G0NA 1M54A 4BBJA 1UL1X 4LSWA 1M2EA 4YC7A 1M1ZA 2TMKA 4NK5A 4DHEA 3L1KA 3CGWA 1AJEA 1CQJB 1IJEA 1S2IA 5BY2A 1NP3A 4XIGS 2PD6A 3VVMA 1M1UA 3QEMA 2HUNA 2QR3A 3RFUA 3PQ4A 4X3CA 3UMYA 2FPXA 2GEFA 3F67A 4K7JA 5FB3A 5FYQA 3B7GA 3KIPA 4QBKA 3T4EA 4G67A 2ZZMA 3ZDRA 1VC2A 1N2XA 4CLOA 1GAEO 4XD2A 2WIFA 3RTBA 3DMTA 2ACEA 1MEJA 3JQPA 1EDEA 3DSRA 1W1IA 4ALNA 3H3XA 3TW8A 1EJ0A 3H2ZA 2PFSA 3ANXA 3PD7A 2QW0X 1DC4A 2Q1TA 5I9NA 2ZSEA 1NXPA 1U90A 4N40A 4CTJA 4IVPA 1IBMB 4FEYA 1RWQA 3H4MA 3P0JA 3WA6A 3MWJA 3TSCA 5AW8A 1KQOA 5J4VA 2AMYA 3ZU5A 3OPMA 1D1TA 4TS1A 5ADHA 4DSOA 5KTPA 4GE3A 5SY6A 3KHUA 3BB1A 3P26A 2QRLA 5JCXA 1B23P 4BJ3A 4E4TA 2HAEA 1A8UA 1MVNA 2B1IA 2VDMB 5KYUA 1V4VA 3ZY3A 1E9SA 1O95A 3U7QA 5A5DA 5BUZA 4X5OA 5KYYA 1U5AA 3MRSA 3UUGA 1RXVA 3EXHC 4E70A 2WA1A 4WNCA 1Y5LA 4H0NA 4KXWA 5LMNB 3H11A 2GRJA 4A0HA 1UPXA 3PDJA 4M9ZA 4FFBA 3OFKA 2WABA 1PQYA 1ISGA 4TWAA 4YJFA 5ECDA 2FPRA 4HNHA 1ZHOA 1YRHA 3G9UA 3B1VA 4E11A 4MQFB 1REQA 4ME6A 4NFYA 3PDHA 3EFHA 3VR4D 5LWQA 1AS3A 2AOUB 1L3IA 2K4MA 5HP4A 3ZE0B 4HG2A 4Z6KA 3K32A 2ZIGA 5KWSA 4RD1A 4U39A 3GRKA 2ZBEA 4GLJA 1LLDA 3OZDA 2Z1MA 1YASA 3MFYA 3BWDD 5CXSA 5ETJA 4NNPA 3HJNA 4CCYB 1M6VA 4C0WA 3H13A 3E53A 1UK6A 1FYVA 3UUFA 1CUYA 3GFPA 8LDHA 5IG2A 5MFPA 4V1CI 3EGVA 4HK4A 5JZSA 4MLDA 1AHPA 2HF8A 4DCUA 4D0RA 4NCBA 4KO2S 3SC2B 1EG7A 1WZCA 3VSBA 3EXFB 3HY3A 3KOOA 1GARA 4LXHA 3MSXA 5BQPA 2YXNA 3LMKA 1ZZGA 2B8NA 3SM9A 1EE9A 5TLSA 3UKOA 2HH9A 3RLFA 2H54A 2H4HA 4EO4A 4WCFB 2QN9A 4YRTA 4EGFA 3DO5A 3IVGA 3TRIA 2B1GA 5IKXA 1T8RA 4K9MA 4U5XA 1VRWA 2Q3MA 3DB2A 1PW5A 2WIAA 4XYMA 5AR1A 1G3RA 4FHDA 2DR2A 3OQJA 5F52A 2GKSA 4HBGA 1S2LA 3NHPA 3OOEA 1FDIA 1TM3E 4QXPA 4QOFA 3ECCA 5KAPA 1FFGA 1SC6A 3ZBPA 5FA6A 2O8DB 3A6PC 3HJCA 1F5NA 4O1IA 4UZFA 3OP1A 3E9DA 3H9BA 3FTCA 1X7ZA 3G0IA 3GJZA 3KFLA 2XYHA 1HEUA 5C31A 5KHAA 3KJFA 5C1PA 4G0PA 1VMIA 2YZGA 3REFA 4E5DA 1A9ZA 1F2UA 2AEMA 5EKSA 1OZ0A 1GA4A 3ND9A 2VTBA 3WLEA 3ZGZA 1KSFX 1JEEA 4NESA 1O0CA 3MUFA 4LJ5A 3WDLA 2ACVA 1HBJA 5KQLA 4ZQGA 2GPWA 4ENRA 1T5BA 2GBLC 5KU7A 1E5TA 1X0VA 3ZWOA 1PR9A 2GPBA 3T7RA 3N9IA 3BX1A 5HCIA 3AF0A 4R1TA 1IM2A 4PCAA 4XPIB 4M7PA 3JQFA 4EMSA 1XQYA 2XGJA 1C3XA 1X2EA 2ODWA 4UKDA 5ALSA 3B5JA 4Y8VA 3HNPA 2CHFA 2VJMA 2CV1A 4YAJA 4ND6A 4HNTA 2XGMA 2VZLA 3A25A 3OE7D 3KB1A 5E1BA 1MA3A 4M8LA 3U17A 3B85A 4INPA 2P5YA 3D7NA 4LOIA 4R2WA 4XM0A 1P4RA 1DQNA 2PVCA 5KVCA 1ISSA 3JWPA 4HXFB 2WQ7A 3QIVA 1MH1A 3FMFA 1HYEA 4AW9A 5KTKA 3B60A 2X4GA 4N82A 4D99A 2IZ6A 5BR7A 3KQKA 4LQDA 5G0TA 4DCCA 4K9KA 5AW3A 4H7HA 1ZUHA 2VTEA