3KJHA

Zn-bound state of cooc1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
MKLAVAGKGGVGKTTVAAGLIKIMASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLGSVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDLGIKKVRYVINKVRNIKEEKLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQSTNPAFVNLHDIYQKLRLEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the ATP-Dependent Maturation Factor of Ni,Fe-Containing Carbon Monoxide Dehydrogenases
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Hydrolase, metal binding protein
molecule keywords CO dehydrogenase/acetyl-CoA synthase complex, accessory prot
total genus 76
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kjhA00
2ZS7A 4B35A 2PL3A 2GA8A 2ZRAA 2F1RA 3SJBA 3U3OA 2ZXUA 3KKMA 3T35A 3NVAA 3BIFA 4DT1A 4KVGA 4EAQA 4QHYA 1W47A 1OT3A 1U0JA 3FMFA 2W6JD 3EW9A 4B3BA 2GHIA 2G3YA 1I2MA 3QF4A 1XBTA 4DB4A 2DCUA 3SHWA 4PZZA 1XEWX 2QN6A 2W6IA 2FOLA 3Q3JB 1I4DD 4MYTA 1XD2A 3IHWA 2H92A 2QP9X 4L5BA 1XTQA 3GCGA 2ERXA 3BGWA 5FI1B 3CH4B 5DNYB 1IOZA 3OFND 4BFZA 1Z0JA 4M8NE 5CDFE 1DO2A 1G64A 1D5CA 3I8SA 1Z63A 3TW8B 1AZTA 4AYXA 5J4HA 2Z4SA 2PEYA 2W6ID 2WSSA 2ZVPX 4YMWA 1OW3B 1CULC 4L8GA 3T1OA 5ELXA 4Q7JB 4E07A 5L3QA 4FWTA 1NVVQ 1U8YA 3Q8XB 1TQ6A 2WVJA 5TV2A 3TIFA 1GL6A 3REFA 1ZM3A 5AJYA 3L0PA 3X1XA 3AP3A 4TYPA 2K5UA 1KO1A 3WNBA 4DLYA 1QHNA 4KBGA 3C16C 1K5GA 1T8TA 1Z0AA 2ODWA 5H1YA 4NHOA 1N3BA 1WB9A 1M74A 1BMFA 1R7RA 2NO7A 2P65A 4NPHA 2QAJA 4BZPA 3UG6A 4DBLC 4O2RA 1MO5A 4I1SA 1R6BX 3BS4A 2P5TB 2CE7A 3WBJA 3AVYA 4AY2A 1KK0A 1KOFA 5G3ZA 4C0BA 3LW7A 3DM5A 2J0QA 3I61A 3QY0A 1TADA 3SYKA 2PJRA 1KHTA 3NC0C 1FMLA 2D4HA 4FIDA 3VU9A 4D4JA 121PA 2NO1A 3X1YA 3UWKA 5M04A 4O25A 1P6XA 3B1YA 4POAA 5CLQA 3VR4A 3TR5A 3HPRA 1KK3A 1UBEA 4XWAA 3IBGA 5IK2A 1A7JA 4LBYA 5FTMA 4UKDA 5LBIA 3RNLA 2CL7X 1XD9A 3R9WA 2ZS8A 3BE4A 4IFBA 4JLJA 1OFUX 4D25A 4DLVA 1GIAA 1E98A 4LJ9A 1W44A 3THXB 5FTLA 2YHSA 4MA4A 4P3YA 4LDJA 1XCMA 1NY6A 2F6RA 3QKTA 3MGCA 1OH5A 5GJBA 1KK1A 1F2TB 1KDTA 2BKUA 2G77B 3GJ8A 3RS3A 1GRQA 5EE3A 1DAFA 2ZTSA 3PEUA 4IOKA 1BIFA 2SHKA 3B5JA 3FKSA 2W2VA 4JLBA 1JXMA 1PLJA 2AKYA 2R2AA 2WJIA 5F9HA 1EWQA 3G82C 4BQSA 3DEFA 1US8B 3O8RA 3CM0A 4NCKA 4TLAA 1TAGA 1SXJA 1GILA 1KI6A 2A5DA 3CLVA 3ZZUA 3GEHA 3RSOA 5C1BA 3U44B 3EASA 1KYIA 5KNBA 4DLSA 2BBSA 3QXXA 1NMZA 2KE5A 2ATXA 1W36C 4KHZA 4IJMA 4OI1A 3F5FA 3ECCA 3THYA 1KI9A 2YWEA 1UKVY 4DC9A 4PFSA 4JLNA 4DZZA 3K70D 1RYHA 4Z1MD 1NN1A 5CB6A 3L2OB 4PZLA 4PHGA 3KKPA 1JBKA 1OF1A 5CM8B 2O8FA 2JJ1D 2ZRNA 3FMIA 4R7ZA 3RAPR 2GBLC 4FMDB 2ZRPA 2Z43A 4HSEA 2IUUA 1U99A 2PX3A 1P5ZB 3IEUA 2W2TA 2JJ8A 4FI3C 4YONB 1VCOA 4AK9A 3HR7A 4R9UC 4OL0A 3EPKA 1J70A 2D62A 1NSTA 4IXNA 1UKYA 1GKIA 3MRSA 1JJVA 2FFBA 4Z1MA 2F9LA 4Y0AA 1NBMA 2JGNA 3EARA 2JLWA 2ZRBA 2FA9A 3C8UA 3HR8A 3BH7A 2BHRA 2IHYA 1Y63A 4PSKA 2AFHE 4KYIB 3UG7A 4Q1BA 4W5JA 1LS1A 3SZRA 3K0AA 1MV5A 4BEJA 3EPJA 2IBMA 1G41A 2PZFA 3LBIA 1RRGA 3EA5A 3ZVLA 1NI3A 1SXJD 3NBYC 4YMUA 1YR8A 1KAGA 5JI3E 4YC7A 5H8WA 3NHAA 2V4ZA 4E09A 1NBMD 5SZJA 4C3ZA 5AUPB 1EFCA 4U7DA 1XTRA 1SKQA 1G3MA 1CR4A 3M1IA 2XX3A 1TEVA 1EFRD 1IN4A 1Z6GA 3LFUA 1OYYA 3TR0A 4D4KA 3FMOB 3A1UA 4NTZA 3UK6A 2VP6A 1PVOA 4HAZA 2DFLA 2CCKA 3AVXA 2ZYUX 4US0R 1W5TA 3W9YA 3BH0A 1KZGB 4ASUA 1KI8A 2ORWA 4HI0E 1IQPA 4N1AA 3VX3A 2BM0A 4ERNA 4RFSA 2XOKD 1ZNXA 4H1VA 1JAIA 4GRAA 1S9DA 2IUTA 2PH1A 3T15A 1JQLB 3U3JA 1M7HA 4PZYA 5FUVA 5G40A 4P31A 2ZRJA 1C4OA 5FFMA 1OH8A 1I4LD 2WJJA 1N0VC 2BBTA 5EE5B 3U4QB 2KJQA 1DO0A 2YKGA 1YZNA 2VHQA 5B58C 4UXHA 2ODEA 3RSLA 1JEEA 2C99A 3W6OA 3LNCA 2WAYA 1JECA 1N6HA 1R8QA 2QM7A 4IDHA 4Q47A 1NN3A 1ZW6A 2BV3A 1Q1ZA 3BWDD 3CB4A 4F38A 4BECA 2ZYWX 1E2JA 4BFXA 5AUNB 2HXSA 1KKMA 1D2MA 4TT3D 4XSHA 5JFGA 2IL1A 4LWZA 4HZUB 5P21A 5FOXA 2GVDC 1II8B 4PPQA 1HE1C 5F2EA 2NTYC 5FUXA 2BJVA 5JS8A 2VH5R 3ZVRA 3K53A 3EZ7A 5AWFC 1A82A 5C46F 2QQ0A 3K9LA 4KO8A 2DFKB 2ZRHA 4FN5A 2FEMA 1DARA 4JZKA 1L4UA 5A4JA 1XTKA 3LH5A 4DSNA 2CVFA 3LX5A 1NKTA 4Q1EA 3GJ7A 4B3DA 2F3RA 2WWFA 4JLDA 3WMGA 4BFVA 2HJGA 2EFHB 1MRNA 3W8NA 1E99A 3IDQA 2CNWA 1Z0FA 3GD7A 2QM8A 1E2DA 2C2HA 3PQCA 3A58B 2W58A 2IS4A 3TK1A 2WKPA 4OI4A 2CK3D 3JZMA 2OFOA 3QJYA 3RANA 4A8JA 2ZAOA 1ZNZA 4TQUS 2RMKA 3F0TA 4RD6A 2ZRIA 4V0MA 2ZI5A 3OF5A 4RKEA 1KI1A 3NXSA 1IN5A 4A2PA 4B75A 3FOZA 3LLMA 4Q9LA 2Q3FA 1I2DA 1UPTA 4MUBA 4CDGA 4CT4B 1GITA 3TUZC 1KJZA 3AF3A 1NG9A 5JEDA 4J0QA 5JJLA 1HE8B 4RD3A 1CRQA 4WA7A 5AK0A 2J9RA 5DYGA 3TH5A 4I4LA 2HT1A 3LBNA 1G16A 1D2NA 3AV0B 1ZINA 4N3NA 5HE8A 1CF4A 2ORIA 1KY3A 1KNQA 1E4VA 2WTUA 1TPZA 5AJZA 2QGNA 4JYCA 1E79A 1XEXA 4CEIB 1VCIA 4EFNA 1ZC4A 1Z2AA 3M4YA 1P2UA 2GJ8A 3NDPA 2ZITA 1I4TD 4LCBA 5CLLA 2QE7A 2J7PA 4XD7D 1AA9A 3LV8A 1FNNA 1DAHA 5G53C 2NGRA 1M6NA 3JVUA 4EPYA 5TVKA 4ZV4A 3B8HA 4OI2A 3W3AA 2D3WA 4AD8A 2N42A 1NVUQ 4EIWA 4MGIR 3IO5A 3VR2A 1ZNYA 2GAOA 3SDZA 1R2QA 4QHSA 5C4GB 2J7PD 2GK6A 2VSXA 3RS4A 3CNLA 3PCRB 5SZHB 1PLKA 5AUQA 3ND8A 4LJYA 2D2EA 3KFXA 3OEHA 4ZDWA 2MMGA 1P9RA 4TSFA 5LD2B 5F3WB 1XD8A 3Q72A 4PHTA 2AXNA 4WZBE 1A2KC 2ANCA 2QAGB 4XH9B 2HUPA 1VIAA 5JS7A 3WYFA 2Z6VA 3A36A 1UKEA 3W6NA 1KDRA 3CX7A 3RVBA 3SN6A 1U0LA 1VPLA 5H68A 1WBBA 2XTZA 4M2LA 4A8JC 2VBCA 2VL7A 2RGXA 4LYAA 1MR3F 2NO0A 3U7FB 1GWNA 4PO9A 2ZANA 2A7QA 2F1IA 2J7KA 1KO5A 1FTSA 2G0TA 4G01B 4DCUA 4TSFD 2QRZA 3GJ4A 2GK7A 1ZD8A 3K0FB 2VP2A 3PXGA 1N6LA 1CR2A 1UBFA 3I73A 1AGRA 3CF0A 2O8DA 2VHTA 3RRYA 3AF2A 3GLGB 2YOFA 2BEJA 2F7SA 421PA 3TJZA 2ZEJA 1M1YE 4HYYA 4HZUA 1H8HA 3DZ8A 3AKEA 4QOSA 1G7RA 1DG1G 1X8LA 4FCVA 1XZQA 4QM7A 2R6DA 3CH5A 3V4FA 1PZNA 2F1JA 4HUQB 1RFLA 3I72A 4IVRA 2C03A 2WPDA 3DOFA 3W6PA 1ZNWA 2ZI7A 2O52A 2OCBA 1UADA 3WXMA 3ZZTA 3P1JA 5JEEA 3MG9A 2EFEB 3OHMA 4OYHA 1XFAA 5FOTA 3C5CA 2JIZD 3WNDA 2ZU6A 1NVWQ 2GXQA 2Q6TA 2OESA 2PT7A 4YDSA 3KXIA 2BMEA 3BRWD 3IILA 4JVNA 2IX3A 3ZD6A 1KNXA 4NONA 2PJZA 4HAXA 5E95A 1W4AA 4LC0A 2ONJA 2GZDA 1O87A 3CKLA 4EFLA 2AHOA 1EFHA 4IOMA 4WXPA 1XTSA 1G8HA 4PO1A 2NZ8A 1CLUA 1HT1E 2E87A 1IN8A 1HQYE 1PLLA 1Q1EA 2BCGY 3GJ6A 1US8A 1DPFA 3CZQA 1RRPA 4BLQA 5TB5A 2CK3A 2XJ9A 1DAMA 4PC3A 3TRFA 5FH9A 4TMWA 2QE7D 1MABA 2QG6A 4LX0A 1UKZA 4IW3B 2G9NA 4ZCLA 4NMMA 2R62A 4OJQA 4PPNA 3VFDA 3F8TA 1FW6A 5L3SA 5JSZA 1CEEA 3ADDA 3A1WA 2RKOA 5EJEA 1E9FA 2E9SA 5HKKD 2DWQA 2H5EA 5KDOA 4BFTA 4WW0A 2WJVA 1ZMXA 4B3CA 3QKUA 4OQFA 1KY2A 4HB0A 4NU0A 4Q9JA 3ZGXA 3ZLJA 3T61A 3OEEA 1MO4A 4M1OA 3WYGA 2CCGA 1JR3A 5FPYA 4MKIA 1UBCA 2YV5A 2JLVA 4LUCA 1HQCA 2GJAA 3PEVA 5FOVA 1ZUHA 4D81A 1SZPA 1EESA 2H8KA 2Y8EA 5FUWA 4FCWA 4ILEA 1GNRA 4Q66C 4B2PA 1ZU4A 1GNQA 2EYQA 3SYNA 4V0KA 1QHIA 2IC5A 1XX6A 5KUTA 1GZSA 1E32A 2W0MA 2ZSEA 4JLKA 4TL9A 1T5LA 1ZM7A 2P67A 3AQ4A 3P20A 1A1VA 2YNMA 2ZE5A 5E4FA 1ODFA 4HLCA 4Q02A 5FBRB 5FPKA 2YZ2A 3TUIC 4OHXA 2FE4A 3GJ5A 2FPMA 3FFAA 2EWVA 2PMDA 3IIMA 2J0SA 2PX0A 2IYYA 2ZJAA 4LJ6A 1HYQA 3AVVA 2QAGA 3TAHA 1M2OB 3W34A 2FGJA 4RD0A 1V5WA 4BRUA 4M21A 4TQAA 5FL7A 2C9YA 4HEJA 3MJRA 4URWR 1HURA 2XAUA 2WBLC 3QXCA 4ZIRA 2GRJA 1KSGA 4ASUD 1BMFD 1RPZA 2RHMA 4XVUA 1E1RD 2JASA 3Q5DA 2JJ1A 2W2XA 2WMNB 5TXGA 2I1QA 3PENA 3GP8A 4I99A 1IXRC 2YC4C 1VHLA 2OUKA 4RSGA 3EWAA 2ECKA 4CEJA 1S8FA 1XD2B 4M1YA 2TMKA 4TQ9A 1KKLA 1G8FA 2GESA 3CX8A 521PA 1FNMA 3ZD7A 1ZM4A 3LA6A 3LXRA 2NQ2C 4TMKA 2XXAA 1G7SA 1XU4A 5E7IA 2JLRA 1U94A 2O5VA 3A4MA 1N5IA 3QSYA 1G5TA 2FGKA 1W4RA 1AQYA 2ZE7A 4PAQA 2R6FA 1E2PA 1HA3A 1WA5A 5HKKA 4XJXA 4PPGA 2REXB 2RCNA 2QU8A 3OIVA 1F2UB 1ZC3A 1LNZA 4MRVA 1HT2E 3PR1A 4V03A 2YVUA 3QNUA 4L15A 2IYQA 1QVAA 2ZVQX 3LY5A 4LJ5A 3HYRA 1J2JA 4RCZA 3U44A 4LV5B 2WOOA 4DB2A 1E1QA 5HCIA 2WZQA 3K9HA 4HZIA 3AVOA 2QEQA 4TTPA 1P2SA 4LY6A 3FTQA 4LZZA 4JBYA 1G5RA 3CRRA 2YJTD 1LV7A 4UXIA 3TSOA 4A0GA 2LKDA 5IK2D 3W8RA 1Z29A 1NBME 5GADl 4XVQA 1SVLA 1XPRA 1EFRA 2ZI4A 1VYTA 2WWGA 3N5CA 3L82B 4WBSA 4ZDKA 4FINA 3K70B 4LJ4A 1DVRA 5DN6A 3QPWA 1G3QA 4MKHA 4QFMA 3SE0A 4RVCA 2IYWA 1V43A 1WXQA 1ZYUA 5J40A 3QE0A 2ZJ8A 1OXXK 1N6KA 4RFSB 1VYUA 5DISB 2RGBA 3NWJA 621PA 3TQCA 3OE7D 4EJSC 2DR3A 4LHXA 2CHGA 4YMTA 2Z0MA 4XOIA 4B43A 1Q12A 4DLZA 1VMAA 2BMDA 1VG9B 2PLRA 4QGHA 3MJHA 1UF9A 2AX4A 4Q4JA 1NKSA 5K8UA 3R20A 1T6NA 4C7OA 1NRJB 4IHQA 4P4UA 3IIJA 3LX8A 4AYTA 2ZSDA 3E1SA 4RZXA 1HY3A 1W48A 4DVGA 3I4LA 1KO8A 1AS3A 1HH4A 1SULA 4A0FA 4XTCS 4JLMA 2WM9B 3EZ9A 4OQMA 3QBTA 5IT5A 2VTKA 3KXKA 5CJ2A 3T06B 2WWYA 4N0EA 4M1KA 4D4LA 4DSTA 1KJYA 4IDOA 3QIAA 2ODNA 1TU4A 3QKSB 4UJ3A 2B21A 2J87A 3U60B 3TW4A 1WP9A 3H84A 3UMSA 3X2SA 2GF9A 4C0LA 4F93B 2CBZA 4MRRA 2B7BA 1T3HA 5E7MA 3ZS8A 4IDPA 3TLXA 4DCSA 4A92A 2GCOB 4TZ6A 1BS1A 3NBFA 3SFVA 2KBFA 1CR1A 4Q1DA 3AVQA 4CZ2A 3KQHA 2W6JA 2OAP1 2GILA 1JPJA 2ZJOA 2FMXA 4A8JB 1J8YF 4MDEA 5FTKA 2OZEA 1NN5A 2RHDA 1YZLA 2REBA 4Q9IA 5UKDA 4YLGA 2ZIAA 1FP6A 3C14C 3T34A 4LI0A 4FW9A 2ZI6A 4GOXA 3MFYA 4ARZB 5D3MB 5CK5A 4CYMA 3CPJB 3FFBA 3F3YA 1Z6YA 4B3FX 3GLHB 1CP2A 5KO2A 2B92A 5CYPA 1N6IA 3NG1A 3UXMA 4Z54A 1AIPA 5DHAA 5H70A 2JIZA 3DZDA 1KI6B 2C77A 3I5XA 4JSYA 1P3JA 4AYWA 3D8BA 3K0CC 2VIIA 1ONBA 5FOWA 2ZAMA 2P6RA 2CMKA 4QBIA 1F48A 5D3MA 3ZVNA 2WHXA 1G5PA 1XMVA 3T1TA 2NIPA 1II8A 3IPXA 4AKIA 2JATA 2IWHA 4AIIA 4NCIA 1GP2A 2YOGA 3BERA 4ESHA 3U7HB 4LYJA 1GDDA 2R65A 1MOZA 3IUYA 2O8CA 2JLQA 1H8HD 1U9IA 2R6GA 4Q1CA 4B32A 3E2IA 4WZAE 4EPTA 2ZJ2A 2DFTA 3QPVA 3U7GA 3HWSA 1XXHA 3DMNA 2AK2A 1XPUA 2CJWA 2R8RA 3REGA 3N2IA 2IYXA 5CK4A 1TQ4A 3UMFA 2WV9A 2FZLA 4Q21A 3BFKA 1XJ0A 1Q3TA 1AS0A 1GVNB 5AR1A 1ZAKA 2XSZA 3LD9A 5L3SB 4LGMA 1OFIA 1S2MA 4ZIRB 1VTKA 5E7JA 3SOPA 2FH5B 2EVWX 2GBLA 3Q7QA 1ZUIA 4URUR 1W7AA 1N5LA 2IYTA 2OM2A 1IM2A 1XPOA 2QBYB 1W46A 4LC1A 1N6PA 3IGFA 4HATA 1BYIA 4GSYA 5CIWA 1FL9A 1W0JD 2OCYC 2P6UA 1KMHA 1OXUA 4R2HA 2OCPA 3TBKA 3DKVA 1YR7A 4GMDA 4DHEA 5BYKA 4KBFA 5CIQA 5EZ6B 4ON9A 4D0LB 2EYUA 2VP0A 3X1ZA 1KSFX 1P7CA 3PEYA 3QG5A 4OQLA 4KVAA 1FPMA 2ERYA 2Z5FA 4DDUA 1IY0A 2BMFA 2AR7A 4QBGB 1U90A 4P4SA 1VYVA 2O8EB 3C41J 1KSJA 1B0UA 4DIDA 1T4GA 4KLZA 1LF0A 3LDAA 4DDVA 3OAAD 5EE0A 1UDWA 1T0HB 2FFHA 3AH8A 1WBDA 2DFNA 4QRHA 4W5HA 1AKYA 2ZROA 4C0QC 4U02A 1G18A 1CBUA 1N0UA 1W0KD 1E2NA 2CXXA 2ZUCA 4ZO4A 2LKCA 5BWMA 4A9AA 4HAYA 3QQ5A 4HB2A 5L3RA 1NL3A 3CX6A 1LVGA 3KZ1E 4OQNA 5K8IA 2QSYA 3KKOA 1E94E 1JXOA 2P3SA 4NYJR 3KUCA 3Q5EA 3DHWC 4OHYA 4DCNA 1WF3A 1GNPA 3TVTA 2C04A 3K70C 2WAXA 1KZ7B 1W0JA 3U3RA 3PITA 4TL6A 1Z83A 4HLDA 4LJ7A 3VR5A 5DN6D 4Q7LA 4OBEA 4DLWA 4C4PA 4D6PA 3CW2A 4Q1AA 4I1VA 1AM4D 221PA 2A2ZA 4NKRA 3S1AA 1NLZA 3L8YA 3KUDA 1SVOA 2QZ4A 3IQWA 4M22A 1YU9A 5EE1A 5IHPA 3THYB 4GFDA 4QL3A 4M9ZA 4C9BA 2XXAB 4D0NA 4GDFA 3NKVA 4QGAA 1U9IC 4M1TA 4IOJA 3B1ZA 5GJCA 5KSOA 1WQ1R 5KDDA 2HLDA 2HJVA 1CR0A 1WE2A 3DOEA 2HXYA 2OG2A 4EJSA 4DKXA 3EG5A 2W00A 1NP6A 1XCPA 4G5OA 4JVSB 2IYRA 3SEAA 5GJVC 1Q0UA 1XMIA 5FPTA 3SR0A 1SHKA 4OK6A 1GRRA 2QPOA 2VSFA 2FNAA 1E2IA 3RS2A 1AGPA 3CR8A 3BORA 3QENA 4Q1FA 4BLRA 4A0HA 2OE2A 1G7CA 1W5SA 1X1RA 2GXUA 1LFDB 3AGPA 3W90A 1G7TA 1P61B 2ZUBA 4URVR 4W7SA 4C2UA 2W0SA 3Q7PA 3GFPA 4ITRC 3NIBA 3NTUA 3K9GA 4D4MA 1CIPA 2QY9A 2J1LA 1TX4B 3K9NA 3MCAA 3QKSA 5BXQC 1C1YA 1QHSA 3BB1A 4G1UC 2CLDX 5JJKA 1TMKA 3ICEA 1DAGA 4A4DA 2C78A 1GAJA 3FB4A 2PZGA 2CLCX 1X8JA 4HAVA 1KIMA 3T1QA 3VNUA 3R7WA 3MWJA 4GMXA 4OKSA 4WIAA 3BAFA 3SQWA 2RGCA 1WCV1 1OKKA 3QF7A 3QEJA 5FL7D 3GJ0A 3HYTA 3EPLA 2ATVA 1RVDA 1YJ5A 3BC1A 4PC7A 4XVRA 3M0EA 5DE3A 4DJTA 1FMJA 2OEPA 1FP7A 3H86A 3LXXA 2OCAA 4ZKDA 1F3OA 1IN6A 1R5BA 3WNCA 1QDEA 3NC1C 4QBHA 2VA8A 3KJHA 1Z6AA 3N70A 2BIFA 4Q4HB 1E2FA 3TGPA 1NVVR 2IYVA 5FR1A 4E5UA 1HUQA 2BVNA 4FCTA 4D2IA 4ZDJA 3ADCA 1P75A 3C15C 3I1FA 1R0WA 1QHGA 3FHOA 2D06A 1DELA 3R9XA 2VPPA 3Q9LA 3SJCA 1JR3E 3A1TA 3EXAA 4B34A 4Q19A 2OV2A 1Z6TA 5DO9A 2ZSAA 3UWOA 4PX9A 1UFQA 1YHNA 4A2WA 4X8MA 1XJCA 1L2TA 3CO5A 2YYZA 2LWIA 2O0KA 4A6XA 5JCPA 3EA0A 4RZ2A 5GVRA 2ZE8A 4NCJA 2EWWA 2IYZA 3TE6A 4KFUA 1BO6A 4IEIA 4QM6A 1QRAA 2A30A 1E1RA 2ANBA 4KJZA 2NOAA 1U8AA 3CONA 3DPUA 4NYIR 5JLJA 4IOLA 4L4UA 3CRW1 2N46A 4CT5A 5B64A 4G5QA 4JT2A 1HTWA 3QBVA 2J0UB 1MT0A 1YZGA 1XCGB 2UKDA 3AKCA 4BFUA 1SXJB 3W5JA 1Z06A 1F2UA 5KSPA 2B7CA 3CR7A 1IY2A 2GJSA 3CRVA 1KI7A 5BYJA 1XJQA 1UEIA 5F9FA 3TVDA 3WYAA 1YKSA 1ZUNB 4YXWA 2QORA 4KYUA 1QBKC 3O8DA 4BLTA 1X86B 8OHMA 5DI3A 1DOAA 1AK2A 1DS6A 3HU1A 1OKKD 5EP4A 3EZ6A 4H1UA 1GL7A 1XEWY 3UANA 4AURA 3AB3A 4PHHA 1K6MA 3AP2A 4UNPA 3BXZA 5TDHA 2BCJQ 3H4MA 2ZPTX 3AKDA 5FBWB 4NP6A 2RGEA 4RZUA 3ZH9B 3FKQA 1TEXA 4LK2A 1OYWA 3RHFA 3P32A 4DCTA 4Z51A 5HE9A 3PUVA 2DBYA 2AWNA 2W83A 4P4SB 5K8TA 3CF6R 1JR3D 1IHUA 1GSIA 4PANA 1GUAA 1IN7A 2ZJBA 3AF1A 3I3SR 1NMYA 2WSSD 1G9XA 2CCJA 2XNSA 3NHBA 1R4AA 4B6EA 4EJSB 2QSZA 5EXPA 1BH2A 1OPXA 1P9WA 3WRYC 2Q3MA 1NLFA 2V55B 4MGZR 1R10A 1AJEA 2JLSA 4AG6A 4URZR 3ZIAA 1U2RA 1VECA 2A9KA 4JLOA 4RZ3A 3KTAB 3VNVA 1CKEA 4NCHA 2OHFA 4RD1A 5HZHA 3EC2A 2QTVB 1G8YA 5CYOA 1ZM2A 1KJWA 1RJ9A 4HLUC 1GRNA 2Z83A 2HYIC 3L43A 5A0FA 1M8PA 3KQKA 1A2BA 2RGNC 2PMKA 4TLDA 1TL7C 1GKYA 1TUEA 2VQSA 3CZPA 4KITB 2WMOB 1DAEA 2OXRA 2XNDA 5KOYA 2XB2A 3SI7A 1T91A 5J4LA 4UQOA 4ARZA 4II7A 1TUIA 2YWHA 1D8TA 1U8ZA 3CBQA 4R71A 4KI0A 4JYBA 4PPFA 4TWZA 1X6VA 1W1WA 3CNOA 3GJXC 2QTHA 3KL4A 5JHGB 3BH6A 2AK3A 2IS6A 1E9BA 3KKNA 4JJKA 1UM8A 5HZKA 5JWHA 5KYKA 2BWJA 1UAAA 3GJ3A 1SQ5A 3HDTA 2V3CC 1W2HA 1Z47A 2P6NA 4TYYA 1VG1A 4TMTA 3U61B 2VHJA 2QTFA 2OLJA 2O8CB 5FPSA 3M6AA 4EPRA 3H1TA 4V0ME 4TYQA 1NMXA 1YZUA 2OAQ1 2FEOA 1FFHA 3B6EA 4F4IA 1TQ2A 1OXVA 4PO8A 1NY5A 2DY1A 1FX0A 3T1VA 3BB4A 3AF0A 1NLYA 1NG1A 2AD5A 3BFXA 2QUZA 3OIWA 4L16A 5EP3A 3R8CA 3VMFA 3OAAA 1OXTA 4BASA 4BWYA 3GLGE 4OK5A 1R0YA 2AD1A 4RD4A 2QPAA 4CEHA 5CB8A 5JWOA 2EFDB 2VSOA 4QXAA 2WJYA 2ZETA 1E9DA 1FOEB 2VRWA 3RWMB 1ANKA 2ZYTX 4S2EA 5KPDA 4OI0A 5FPHA 1J90A 2QQEA 1K5DA 2H17A 4PC1A 1BYUA 2WWXA 4IDQA 4KODA 4GOJA 4KSBA 5FBVB 3FMPB 4FMCB 3B60A 4A0RA 3N2EA 4QHTA 4XIGS 4GZLA 5CDFA 2X2FA 4PAOA 3W3ZB 1N2CE 3FGNA 4TMZA 3K09A 3ZDQA 4JKIA 5JCZA 1K8RA 4C30A 2O0JA 2QGZA 3V00A 3Q85A 4TZ0A 3IKJA 2WOJA 4AKHA 2XJ4A 2CE2X 3BK7A 4MUAA 4QKQA 2WICA 1NVXQ 4OHVA 4EFMA 4I1OA 3U7EB 1Q20A 2EFCB 3AKYA 2LCFA 1YR6A 2QT1A 3MMPA 3ONWA 3FWYA 4RJLA 1E3MA 5G41A 3B1XA 1E9RA 3RABA 5BN4A 4LSGA 2FFQA 1XNJA 1SKYE 1BOFA 4Q7KA 2MMCA 4B47A 3EAQA 4K46A 1E2GA 2VP4A 2G83A 1Q1QA 2O0HA 3AF4A 4QC2A 4BFWA 4F4JA 1VG0B 4ACBA 4BGDA 5JRZA 3U5ZB 5JECA 4TYNA 3NBXX 2DWOA 3RC3A 4C7OB 3JZAA 3VKGA 5AJWA 3HP1A 4BE7B 2FX3A 1Z07A 4IEEA 1N0WA 3AVWA 2C9OA 1L8QA 2F9MA 4HDOB 4ZPXA 4U00A 4KCGA 3CUEF 3T12A 1OV4A 3PUWA 1TU3A 2D74A 3KQUA 3QKRA 3MWKA 2GTPA 4L9SA 3EX7C 4MYCA 4JT4A 1JPNA 4JVLA 4G5SA 2DPXA 2IS1A 1S1CA 3RLFA 5JSZB 3B1VA 1SGWA 5F98A 2QMHA 1G6HA 4LV6A 3O47A 1GKUB 2KB0A 3SU8A 3IEVA 4HAWA 3KJGA 4HLQB 4G0NA 3LLUA 4A82A 2BKEA 4AKGA 2QAGC 4F7WA 1TNDA 3FYHA 4IVPA 2VHUA 3VR1A 5DI3B 2GJ9A 4LHZA 3RS5A 1PJRA 2B8TA 1B23P 1CS4C 2OXCA 1ZP6A 3P26A 1W49A 1WRBA 2FF7A 3DO6A 4ZI2A 1CJUC 1VDZA 1QF9A 3LWNA 2BM1A 5FTJA 4E03A 1VKJA 4B2IA 4OQXA 3WP0A 4KAXA 4HDCA 2IUSA 3HU3A 3QXHA 5DLQC 1Q1BA 3CRMA 1Y3AA 3A1SA 3QI2A 5JJIA 1OB2A 1AN0A 3RRNA 2HCJB 3X1WA 2CL0X 1QHHA 721PA 2Q9AA 1R5NA 2HV8A 5J4VA 2AN9A 3THWB 1G3UA 1OIXA 2C9CA 1OFHA 1T0JB 2PLFA 3B78A 2XNDD 1XTIA 2F1HA 4B74A 4W9MC 2ZR7A 1L7VC 3GLIB 2REOA 1J8MF 3QPUA 3VX4A 4NYIQ 1Z5ZA 4NYMQ 5K8LA 4B48A 1UEJA 5DGXA 3D6TB 4LBVA 3ZQJA 1MKYA 3K0EA 1H65A 2ORVA 4V0NA 5EXXA 3MWYW 3PIRA 4JS0A 1CTQA 2JLZA 2OBMA 5JHHB 4LHYA 3NH9A 3ZIAD 4LRWA 5JWRA 1RRCA 1P9NA 4M1SA 5C4MA 1GL9B 2Q0HA 4A36A 3GLIE 1SXJC 1FQKA 4EUNA 3RDPA 1D9XA 4IVQA 4Q4AB 1Z28A 2ONKA 2C95A 3IIKA 1DG3A 2F55A 4B76A 3SBEA 3SFZA 4MH0R 2EFGA 4UJ5A 1IXSB 1EFUA 2WSMA 4MYHA 2XZPA 4C0HA 3WRXC 3VAAA 1VHTA 2D2FA 5J5CA 3AVTA 1KTVA 2BMJA 4QNRA 5EUMA 4Q03A 2JLUA 5B2ZA 3UPUA 4GT1A 1LW7A 1S1MA 5EXSA 2QBYA 1E1QD 1TQDA 3AVPA 3LBHA 3GFOA 4QJ5A 3DMDA 2DWPA 1LY1A 1CU1A 4NCNA 5KNCA 3PG5A 2A5YB 4Z8XA 821PA 1R0XA 3P27A 1KDOA 1OHHA 3ICQB 1T5IA 1COWD 2G1JA 4TN1A 3THXA 4QJ3A 1RKBA 3GLFE 4B3GA 3V9PA 5CJPA 5J4YA 2JEOA 5BN3A 4US1R 4IRUB 3SYLA 1G1MA 4WZ6A 3B2EA 2BJWA 4KXFB 1OJLA 3LO5A 4Q9HA 3QUSA 1CJKC 2XEXA 1M34E 3K0CA 4QG7A 4US2R 1SVIA 4TLBA 4MRSA 4IXMA 2R6CA 2X1VA 3OZXA 1G4AE 1N6RA 5LDDC 4ABYA 5HCNA 4KFRA 2RB4A 1FTNA 4BUJA 4K81B 1FZQA 2UZIR 4TL7A 4HUTA 3C4JA 2H18A 4BPBA 2DB3A 2JLYA 1EX7A 2VF7A 2G6BA 3T5DA 4DEYA 1XMSA 4R2IA 4WVFA 1JEDA 3ND9A 2JLXA 1Z0IA 2D7CA 2GZAA 1RYFA 4TT3A 2HT6A 4Q4JB 1E2QA 4B3XA 3DM9B 3HU2A 1CRPA 1E9AA 3KKQA 4DLRA 1OB5A 1DBSA 2FFAA 5TY0A 4IDNA 1CJVC 3DDCA 3TSWA 2OFWA 2Q3HA 2Q9BA 4XTRA 4PQRA 4TMVA 2GXAA 3BB3A 4QBFA 2QI9C 1HV8A 3EIEA 4XWOA 5SZKB 1ELOA 4MQBA 5LPNA 1ZM9A 1CJTC 4Q4AA 4PC6A 4I81A 4ZI3A 4LYHA 5FBQB 4AI6A 4O3MA 2Q21A 5B57C 1KDPA 2KSQA 2XOKA 2F43B 4IKEA 1A5TA 1DTSA 5L8VA 3U4QA 2C96A 3QXSA 5EP2A 1YZTA 2J41A 3HPQA 1JQJC 4GBMA 2VO1A 2ZJZA 4Q9KA 4B73A 5KNDA 3VKWA 2X77A 2HF8A 1QHHB 3LQRA 1TTTA 3PUYA 4P0TA 1QG2A 2G0NA 1Z0DA 5CITA 2QT0A 5KU1A 2WKQA 4QNMA 3WMFA 5LB2A 2V6JA 2R44A 3UATA 3GLFB 5KTYA 1AQUA 4DT1B 1NN0A 1W4BA 2R6AA 2A78A 4WOPA 3VTKA 4CEIA 5TARA 2NPIA 3ZZ0A 2ZRMA 4LJ8A 4JL6A 4M53A 4WXRA 4FWIB 3LAWA 5DSZA 5EUQB 1U81A 4P32A 1NSFA 3TKLA 4E22A 1GFIA 2ZM5A 4B71A 3T5GA 2QMOA 4GOKA 4V0LA 3WP1B 4A1FA 4TLEA 4RCYA 3CPEA 1S3SA 4AKEA 4DSOA 3KQLA 4GI7A 1CXZA 2XTMA 3FDIA 2NZJA 5FR2A 2FSFA 2QMEA 3I92A 5IDVA 1QZXA 4HLUA 1QVRA 4X8LA 3R9IA 3AEZA 1ZIOA 3MUFA 1VIYA 1NF3A 4W5WA 3ASZA 3EZ2A 5C18A 2GVZC 3BOSA 2IXEA 3AP1A 2PEZA 2UVQA 2GF0A 3A6PC 3ZYCA 2V8OA 4CRWB 2MSEB 2QPTA 2ZREA 4M9XA 1C9KA 4BZQA 1XB2A 2V7QA 5C2JB 2ZRCA 5DYIA 2IA5A 1W4CA 1YR9A 4CIDA 1OIVA 1JI0A 2ZUDA 4JL8A 1TF5A 4JSTA 1XTJA 4FMDF 1KI4A 2WJGA 4O0MA 2J45A 3GLHE 1Q57A 1NNEA 1TF2A 4LPSA 4Q01A 1KI2A 2XB4A 4JL5A 4UNRA 5IF9A 3C7KA 3QOFA 2GEDA 1ESNA 2QRNA 4UNQA 4NYJQ 2BBOA 5JBQA 1YRAA 1OHHD 1MH1A 2BC9A 2QMUA 2IYUA 2R9VA 4MKGA 2VHCA 4DLTA 4B6FA 2EU8A 3TMKA 1DAIA 1WDTA 2FPLA 4KLNA 2AKAB 4EKDA 2ZRDA 4MGYR 5EZ5A 2VYFA 2I1VB 4JLPA 1Z3IX 3SC3A 1OH7A 4LOAA 4YMVA 4I1UA 1NIPA 2FPKA 1M7BA 2GWHA 4KU4A 4QJ4A 3I62A 1Z08A 2GEVA 2NO9A 4C0AC 3WBKA 3V4RA 1AZSC 3UKDA 4EPXA 1W36B 3K8YA 4LPKA 2X2EA 2QP3A 2XTNA 5HR5A 1Z22A 4EPVA 2H1LA 2PZEA 4HUQA 2IS2A 1X1SA 2JJ2D 2O8EA 2WIAA 2ZE6A 1F60A 4TTQA 4Q4HA 4JLVA 2IHBA 1XRJA 4PHFA 1JR6A 2KWIA 2FSGA 5IRCD 2FV8A 4O2LA 5LD2C 1IJEA 4TTRA 2ZR0A 2FDCA 1YZKA 3OEHD 1OXSC 2FN4A 4BLOA 4DEXA 1GTVA 1AS2A 5A5GA 1E2MA 4NDZA 2EQBA 2FU5C 1NIJA 1P72A 1G8GA 2MSCB 4PQYA 4BEBA 2VEDA 3TSZA 1N6NA 5AUOB 3I32A 3TAUA 4FXPA 2VF8A 3VR3A 2IXFA 4H9GA 1LTQA 4F92B 4QGGA 4DXAA 1XEXB 4ACAA 1BKDR 2ZRKA 4RY2A 1ESMA 2A3RA 1W36D 1Q3HA 3KTAA 4U5XA 2GCPA 4OHZA 5FTNA 3PJRA 3CIOA 4K8OA 1PUIA 2VLIA 3CF2A 3K1JA 5GVSA 3LW8A 2GNOA 1XZPA 2CEAA 2RGGA 1ZU5A 1DEKA 1KSHA 1N5JA 3EZFA 1Z8FA 4NYMR 1X3SA 1XEFA 3KDSE 2XGJA 3NBZC 3VQTA 1EG7A 4C2TA 5EE9A 2L0XA 1RE0A 1JAHA 5J4KA 2V9PA 2P2LA 5AJVB 3GPLA 1J99A 1SVMA 2J5XA 4LBWA 1J7KA 2YWFA 2JA1A 5KSZA 2ZRFA 4JIMA 4PQFA 5D3QA 1E0AA 1KGDA 2XZOA 4HB3A 1E4YA 4EQ6A 2YC2C 4DUGA 5JRJA 4GNKA 2KI5A 1S96A 1EK0A 2J46A 2WJHA 2G1KA 3QXJA 4F91B 5KSYA 1KAOA 4G5GA 4X8OA 3R8FA 2CNWD 1JNYA 5ANRB 5KDLA 1S4QA 1NJFA 3GQBA 3SQXA 4XD7A 3KJIA 5TMPA 1D6JA 1E9SA 5L3VA 3C5HA 3RS0A 2CLSA 5FOUA 2X19A 2C5LA 4D82A 3EWSA 2RGNA 4G5RA 1NJGA 1YE8A 2IYSA 3WHLA 2WPDD 1EXMA 2FG5A 4KV9A 4NH0A 4F4CA 4PSAA 3SHFA 1P2VA 2ZJ5A 1OSNA 4Y0VA 3LRPA 3U2QA 2YWGA 2CL6X 3DL0A 1IXZA 2BDTA 1EGAA 4P4TA 2OSBA 3KJEA 3LQQA 2ZSFA 3BFVA 2MSDB 4RFVA 2IF0A 4TYWA 1GG2A 3CWQA 3WMEA 2B6HA 1RC8A 1H8ED 2NO6A 1ZCAA 4MGKR 3H2YA 3L0OA 2ZJYA 1IONA 1HEIA 3QKRB 1UDXA 1KO7A 3UIEA 3QF4B 4KSCA 1FQJA 4FMBB 3AM1A 2AFIE 2P5SA 4M0LA 1ZD9A 4V0OA 4S35A 5FOSA 2H16A 4X8HA 4JBXA 4TMXA 1UJ2A 1G20E 2YOHA 1ZD1A 1ZBDA 3P4YA 5FBLB 4KFSA 4M9SA 1SVWA 2N1BA 4ESVA 4PR0A 3U3KA 4FD2A 1IY1A 1SXJE 5AJXA 5LB4A 2V7QD 4BZXA 1N25A 2OO7A 4NBSA 2JDID 3PVSA 4C0KA 3EPHA 1II9A 1ZVQA 4N0DA 2E1RA 1O3YA 2H7VA 2PCLA 4UNNA 1ZCBA 3THOA 3A8TA 2OFXA 2HEIA 1F6BA 3ADBA 3CWZA 1OH6A 1Q44A 2DHRA 5KPJA 1OE0A 1G19A 2NG1A 4DLUA 5G3YA 2AL7A 3EIQA 4URYR 4D80A 4AWXA 3KQNA 4HDQB 2QP4A 4JJZA 2AWOA 3D3QA 2IWRA 4YQFA 1F2TA 1KI3A 4MYUA 1N5KA 3ADKA 4Z8YA 2ZR9A 1D9ZA 2ZI3A 1FUKA 1M7GA 3AGQA 4YDHB 3EIHA 3B85A 3NEJA 4HB4A 4DLXA 1G3RA 4XWKA 2IEZA 4M9QA 3OE7A 1P73A 1E2KA 2J0VA 1JALA 1YRBA 1E79D 3PV0A 4L9WA 2QNRA 4DDTA 2ZRLA 4B2LA 3JVVA 3IHLA 4EPWA 2JAQA 5FI0B 2QL6A 1LS6A 2G88A 3FKSD 2HCBA 4EDHA 4WAUA 2YINC 3IO3A 3ETLA 4AC9A 2PCJA 2FWRA 5B30A 3TUJC 3H0KA 1PV4A 3QEOA 4CEHB 4URXR 4OK3A 1KO4A 1OFTA 3FE2A 1U98A 4MDFA 1T3SA 2BOVA 2HDNB 4M1WA 3FHCB 4D0GA 2JCSA 2O8BB 3SS8A 3GMTA 4GPTA 3RS7A 3QVVA 5JZVA 1E2LA 3PEWA 3B9QA 3B7GA 2FJUA 3A4LA 3VHXA 1II0A 1JB1A 1W2GA 3SBDA 3K0AB 3FVQA 5L3QB 2V1UA 2FZ4A 1P62B 1YZQA 3FPAA 3L0SA 3AVUA 2OLKA 2RGAA 1DADA 4NL4H 4PTLA 3MAAC 3RYTC 4A6PA 3I5YA 3HJNA 2GKSA 2J59A 3U6KA 2CHVA 1LF5A 1E2HA 2C8VA 3BBPA 4AG5A 4PSVA 4M4SA 3MD0A 3IQXA 3GEIA 2FSHA 4RD2A 4G3XA 3A37A 1E2EA 2CDNA 1AKEA 4BFSA 2WWIA 2HF9A 3KB2A 2O8BA 3A1VA 2O8FB 3NH6A 4Q7MB 4JBWA 1FUUA 1E69A 3DKPA 1F5NA 1P2TA 2CHQA 3SJZA 3W5IA 5BW8A 1EX6A 3I8XA 2QA5A 4JLAA 4DDWA 4OHWA 1Z2CA 1GM5A 1G291 1E9EA 1XDBA 1QG4A 4LBZA 3QVUA 3GLFA 1T8UA 3D7MA 4Q5IA 2O8DB 1YQTA 2BBWA 3GLHA 1E0JA 3R7WB 4ZKEA 4PAMA 3O8CA 2X8AA 1VG8A 3OEED 4QGFA 1RZ3A 4Q48A 1S9HA 4YXWD 2F3TA 2I4IA 5SZIA 3OIUA 3X1DA 3KB1A 2JDIA 1IBRA 1TF7A 1XF9A 1XP8A 4UNSA 4JVMA 2A5GA 1YVDA 3E70C 3RWOA 2IEYA 3VR6A 1COWA 3AUYA 3CNNA 3PFIA 4GZMA 2QENA 2GETA 3ZJYA 6Q21A 5E3HA 3RRZA 2ASEA 4CGZA 3PUXA 4C0JA 1QHXA 2GCOA 1SKYB 3WHKA 4ZCIA 4CEJB 1XMJA 1MRSA 3WY9A 1QHYA 3K09C 1S0UA 1MO6A 3VKHA 3DVLA 4BLPA 3NDBB 2WWWA 2OT3B 3RRMA 3FHTA 1IJFA 3THWA 2WKRA 5DIFA 4YMSA 3L0IB 2XZLA 2F43A 1EWRA 2Z4RA 2BEKA 1Q21A 2P0EA 3B13B 1H8EA 2CVHA 2J3EA 4A2QA 1KK2A 3TQFA 4CW7A 4PC2A 3SJAA 2ZQ5A 4M1MA 5KHOC 2B8WA 4BFYA 3VU9B 4HAUA 4C0SA 1MABB 5BQ5A 2ZYVX 4BRWA 3GEEA 3P4XA 1KMHB 3BJIC 3MSXA 2HYDA 2WWHA 5DH9A 1U0HC 3S1AB 2ODBA 4FMCF 4GP7A 4GL2A 2RGDA 2ZSBA 2J0UA 1E9CA 1G8PA 3KXLA 2DYKA 4DRZA 4LHWA 1E0SA 2V54A 2OBNA 4NE2A 1ETUA 4LYFA 4ZCMA 1RW4A 2IYLD 4DSUA 4JKYA 4LV8B 4JMPA 3MLEA 5EXTA 3TNFA 1D2EA 1LB1B 2A5JA 5DHFA 4B33A 5JMTA 1G3IA 4A15A 2VP9A 3IBYA 4OJKA 4TLCA 1GOTA 2VP5A 3KFVA 5HTKA 2GEUA 2D7DA 2V1XA 2GCNA 5CM9C 4DUGD 4Q00A 2NMVA 3UMRA 1OIWA 3G5UA 2KBEA 1SVSA 1Z0KA 3B82A 2ZRGA 3AUXA 4KFTA 4V02A 1XXHB 2GAAA 5J47A 3GLIA 3G0HA 3RC8A 2RAPA 2C98A 3GFTA 4XSGA 2NPFA 4MITA 4Q4LA 2GXSA 1S3GA 3VHLB 5BN5A 1ZIPA 3EC1A 1IAQA 1VCMA 3ASYA 1VCNA 1T9HA 1N6OA 2IXGA 1RIFA 4PXAA 3ZS9A 2JJ2A 3SNHA 1T3LA 1R0ZA 1EFTA 1PUJA 3OIYA 1KMQA 3IPYA 3K0FA 1OLOA 2V6IA 4DCVA 2OBLA 5HPYB 2H57A 2IT1A 3L8ZA 3OFNA 4P33A 1DAKA 1E6CA 1UBGA 2A5FA 2QROA 1R5OA 2XSZD 3QG1A 4MRNA 2PBRA 1FX0B 2IK8A 1DE0A 3LVQE 1G6OA 1P60A 1P4SA 2AXPA 4NZYA 1RJ9B 1SHZA 1X8KA 2FSIA 4LHVA 1XWIA 1Z6XA 3NEYA 3U3MA 2HLDD 5FUYA 3ZQ6A 2GZHA 5FL3A 5GJWC 3BD9A 3E5HA 1R8SA 3CPHA 4CVNA 4EQ6B 5EP1A 1JJ7A 4LJAA 5JI2E 3D31A 3CRQA 4Q18A 4RKFA 3U6BA 2WIBA 4R98A 2ZS9A 3K0SA 1A4RA 1L4YA 1SVKA 1WMSA 4DIEA 4DWJA 3ZVMA 2CJWB 3MWLA 3B9PA 2I3BA 2RH5A 4D26A 1ZRHA 4TL8A 4MKFA 2IW3A 4IFEA 2OILA 3KX2A 2EW1A 2GJKA 1ZJ6A 3PUZA 4GP6A 1E0KA 1Q22A 1E96A 1XXHE 4BLSA 4B44A 2UZ3A 2Q9CA 1MO3A 2ZU0C 2ZI9A 4UXJA 5EQTA 3OESA 2IF2A 1G21E 3A4NA 3J81k 2XITA 3O8BA 4ZDIA 1RRFA 4MRPA 2PT5A 1G17A 3B1WA 5DI9A 3GLGA 1W0KA 2GDJA 3LVRE 1G4UR 1CJMA 4CF7A
chains in the Genus database with same CATH superfamily
4W99A 3JYNA 1XU9A 4XIJA 3ACBA 1N8NA 3CB2A 2GPJA 4E30A 4N5DA 3RT1A 2ZRAA 2XUFA 1E7MA 2ZXUA 1TO6A 2FOXA 3PFFA 1TAHA 3D64A 1RBMA 2X5NA 3PNOA 4QHYA 1W47A 5DNWA 3ZI7A 1ZGCA 3FMFA 4RK0A 4B8WA 4YJ2F 3EW9A 5T3YA 2G3YA 1I2MA 1UANA 3HUUA 1XBTA 2GHQA 4KWCA 4YAUA 1SD2A 1XN4A 2WINI 2AW3A 3ZHVA 2QN6A 5CHYA 2OYSA 2FKNA 2FOLA 1F4VA 3UV3A 4AO8A 1D5WA 5CDUA 4EGCB 2WNHA 2NV0A 5TLSA 3IHWA 2IZ6A 3VSBA 2QP9X 3W05A 3CEJA 3UAWA 1IOZA 2XYRA 5EIBC 4BFZA 3PVCA 4H27A 5CDFE 1MQ9A 1FXWA 2AE1A 3DCNA 5CB4F 2I22A 3UY4A 3EMDA 4GGMX 2R7AA 2CLOB 3CE9A 3DXYA 4R0VA 1WLYA 2VWQA 1U0TA 2Z4SA 3TDMA 3HCAA 3MELA 5DX0A 2FUNB 1WPGA 4L8GA 3WAJA 2P4UA 1COZA 5KKNB 2HRZA 3EVCA 1BZYA 2WVJA 4ARBA 3TQTA 1IHYA 3BWXA 3IR7A 1I30A 3L0PA 4NJOA 1K0UA 4PGMA 1GGEA 1KFCB 2NXEA 2K5UA 3H4IA 4YPFA 3WWCA 3WNBA 1MEJA 4DLYA 2B94A 1B76A 1Z17A 4LHEA 3TZKA 1CUGA 4AXBA 1N3BA 4B8YA 5AVTA 1M74A 5JAZA 1WB9A 1CC1S 3FIUA 3U56A 2RJ3A 2NO7A 3DTVB 2P65A 2FLWA 2QAJA 4RFLA 4EVQA 4I1SA 1JHXA 1R6BX 2Z3VA 4AY2A 1A9TA 3MTBA 4KIJA 1Q1NA 1KK0A 3E58A 3EFBA 3SWWA 1N92A 2BSAA 3AX6A 4XCVA 4B82A 4RLFA 2J0QA 2JCYA 4X3PA 1G1AA 3UB2A 4DRXB 4HEA1 2YJNA 5M5BA 4I46A 5IUNC 1RYEA 3E7DA 4RHFA 1YBVA 5TC4A 3ZDAA 4FMPA 1AK9A 5C37A 5IEJA 1I0ZA 2NZ2A 2NO1A 4UU8A 3X1YA 4D4JA 2OECA 4O25A 5IAJA 5I45A 5KMGB 3B1YA 4G67A 3O95A 5LLDA 3V7NA 1JG7A 3VR4A 2DULA 3TR5A 3PICA 1EVLA 1JGTA 1JG6A 1KK3A 4HDRB 3C3XA 4L4ZA 4R2JA 4UAVA 3PPYA 4G1VA 1YUBA 1O97C 1XZLA 4LBYA 3CS3A 2HX1A 1JDNA 3K6JA 1XMXA 5FTMA 1Y6FA 4MR8B 3R9WA 2Z57A 4TRNA 3MTIA 1EG2A 2JRLA 2JI7A 3USZA 4S04A 1OFUX 5F9HA 4D25A 5A2QA 3KPYA 1Y4ZA 1L3BA 1W44A 3THXB 1T0BA 2W4MA 3F6SA 2RI6A 5A6SA 4JUFA 1RXWA 5E6UB 1FU7A 4ZYUA 1OH5A 5AHKA 3QUCA 2OZLA 3BEOA 3BMCB 1HZJA 1QORA 2RBKA 3P9SA 4MVYA 4IOKA 1ENYA 2PMCA 2ZTSA 3PEUA 3FKSA 5EE3A 1ZZGA 4N8DA 2L42A 1P4GA 2Y3IA 3QVKA 4JLBA 3S55A 1OWPA 4REMA 1Z45A 2GCIA 1PW7A 2VXCA 1BCRB 2YXBA 3KOMA 5AI5A 2AZMA 4Y2PA 5KWEA 2BH9A 3JAMA 3DEFA 3EGWA 1US8B 3KLNA 2XDYA 4YYEA 3LO8A 4V0RA 1SXJA 3HBFA 1XDUA 1CY7A 4RPJA 4TSRA 3QMWA 3AJ8A 4DQ0A 3GEHA 3A1NA 2Q5LA 3RSOA 4F2WA 4QUEA 2V03A 1RRMA 4XUEA 1YDWA 3NOXA 2KE5A 1U0RA 5FYQA 3TQHA 4EJ0A 1JEAA 1ATIA 4KHZA 4QG3A 2CL5A 3ECCA 1UH5A 1TDJA 1KI9A 3F5FA 2HF7A 3HFGA 3OHPA 1U8CB 2ZG6A 2FTKE 1QFSA 3FJOA 4Z1MD 4Y0NA 3SDSA 3ZLTA 5CB6A 4BNXA 3FPEA 3NKFA 1L5KA 3EVEA 1OF1A 3UO8B 1G9TA 1GPDG 3D7NA 3X44A 2EF0A 4BLUA 4G5HA 3ICWA 2ZJ7A 1G38A 3IKMB 2J9FB 2MU1A 2GBLC 3L4SO 3UMBA 2XT0A 2ZWVA 5AJHA 2Z43A 3H99A 3BGOS 4HSEA 2IUUA 2Y9MB 3UAYA 1AGXA 2PX3A 2WRZA 2W2TA 4O02B 1ZJJA 2FSVA 2D8MA 3E9YA 2BD0A 1Q84A 2ZGVA 3HR7A 3KEMA 5BSGA 5KTOA 1J70A 1UWVA 3BWVA 1PDVA 3DE2X 2JCVA 4RTLA 6LDHA 1GKIA 3MRSA 2Y1XA 1NBMA 2JGNA 4IEFB 2JLWA 4X91A 1RFGE 1J9ZA 2P2CA 3CZAA 3I04M 4BNNA 2IHYA 2A1IA 4PSKA 1C7ZA 2NZYA 1LJ8A 1NI4B 1Y8RB 4OAPA 4OH1A 4W5JA 3RFCA 5FEUA 1F0YA 5DBOA 5EXEA 3RKRA 3URKA 3EPJA 1IXYA 3LBIA 4MUIA 4JLSA 3SCZA 3R0XA 1TT7A 5LQJA 2QZ9A 3TDKA 4ZGGA 4R05A 3DYBA 3FNBA 5E3JA 4KQHA 3W2HA 3GA0A 3KQYA 3I2IA 4NFSA 2V4ZA 3VPBA 4E09A 1QB7A 1GQFA 2QG4A 3BXXA 4XPZA 1EFCA 1M2JA 4KPEC 3F1KA 4G8DA 2JCGA 3DEKA 3NGXA 1MX5A 2WI8A 5GPBA 2DHEA 3M1IA 5H3CA 1O0SA 1TEVA 1ODCA 4O4JF 1EFRD 1IN4A 3OEYA 3PFKA 3VOTA 1WU8A 2IITA 2O2CA 4PAGA 4EG3A 2YZMA 1IE3A 3N6RA 4TRJA 2ACWA 2NN3C 1JKMA 2BEVB 3QBEA 3CURA 1V0JA 5ALOA 3D6AA 4CCWA 2XODA 2NT3A 4NE9A 2CCKA 3C6XA 3AVXA 3HJRA 4US0R 1EM8B 1RAIA 1KZGB 3WWEA 1ZN8A 1A9ZA 3IUQA 3KOXA 3HB0A 1QH1A 4ODIA 4E51A 1URPA 4MYRA 5C5CA 3UJ6A 1NVGA 2XOKD 3NGMA 3BE8A 1OLXB 3K9WA 1O8BA 2FE1A 1X1BA 3KLMX 2H4YA 7MHTA 2RONA 4DZRA 2Z2KA 4KK3A 3T15A 2P9GA 3SKYA 3O3MB 1I9CA 2HSJA 4J91A 2BGNA 1I80A 1HDXA 2HI0A 5IKMA 3K0KA 5A7GA 5IARA 2WFLA 3H5IA 4AF7A 1I4LD 2GS9A 1ZL0A 2BBTA 2X0NA 3M6VA 2KJQA 2HSEA 2VHQA 1KYXA 2YWDA 1J9GA 3UUWA 4GLJA 3RSLA 2BLNA 2A59A 1TKRA 3AUSA 1KJQA 3E0QA 4IDHA 1EUDB 3VPCA 1ARZA 1Q1ZA 3EH1A 3IUEA 1BQEA 3SLRA 3QUAA 1HETA 1KBOA 4AO7A 3RADC 4C05A 2XT9A 2QYOA 3T94A 4BECA 2PTGA 3LP8A 5D7BA 3UOAB 4BFXA 4EUHA 5LVAA 2KYRA 1D2MA 1FUYB 4GNRA 5JFGA 5IM4A 2WK1A 1GVHA 3I2GA 3K1ZA 1I94B 5F2EA 1PGJA 3OCXA 4CCYB 2NUTB 1J8QA 1C14A 2PAFA 4EB6A 5ITVA 5JS8A 3U9SA 3ZVRA 3EZ7A 3EUFA 1A82A 3TLZA 1F9EA 4BO5A 2WSYB 3N8HA 5SY4A 5DM70 5KJ6A 1D4FA 1T9KA 3JYOA 2Y4OA 3A6FA 3DVAA 3KTDA 4KLRA 1JKJB 3V1YA 1L4UA 5C0OE 1NXQA 1D04A 1YSCA 2GZ3A 3NUQA 1E62A 3LX5A 3TRIA 2JBAB 3V1KA 4EARA 2HHLA 4Q1EA 4XI9A 2LVBA 1MHPA 3FI0A 3FJ1A 3KRTA 4JNKA 4P8RA 5A3SA 4HWPA 4Z5XA 1SVUA 1N2HA 1XCOA 1MRNA 5CA0B 4J43A 1TMGE 4LQLA 1KC3A 2VJLA 3ZHUA 4ZV7A 4P5PA 1M2KA 4A23A 5CBPA 5IJXA 5IKPA 3IDQA 2CNWA 3GD7A 4Y9TA 4LRQA 3WK5A 3JWIA 2KQUA 2GI4A 1H1LA 4LTDA 1GG8A 3MTEA 4JT8A 5K0EA 4HNGA 3TK1A 2IS4A 3HLTA 2UUBB 3ELUA 3TTSA 2FJPA 2WKPA 2CK3D 5GZ3A 1P17A 1HDCA 3F0TA 3FPKA 4BX2A 1QO0D 2RGUA 2DUWA 3DOHA 4V0MA 4RKEA 3GGGA 4C7MA 3AEQB 4B75A 1HZZC 1T1IA 3HZOA 4IV0A 1I2DA 4P54A 4Q9LA 3FZGA 4MUBA 3FOZA 3SBXA 2PRKA 1KRXA 2JEZA 1Z25A 2R4QA 2XWSA 2RAFA 2A88A 3QUBA 3NR2A 1VCHA 5JJLA 3ER9A 2VAMA 5K5EA 1A9PA 1FU4A 2J9RA 1NNI1 3WVNA 1EFAA 5DYYA 2VXOA 3SVTA 5CFMA 2WF9A 1EFPA 1E3EA 2DR0A 2X8LA 4I4LA 4B83A 1P18A 3ZWVA 4K1LA 3TE7A 1U7DA 5HFJA 3ROXA 3BXEA 3AV0B 2JA2A 4W4TA 1CF4A 1KY3A 1KNQA 4YT8A 2QXUA 4JK3A 2G8NA 4MJXA 3PQ3A 5AJZA 1GZ4A 4JYCA 1E79A 4F5WA 5JXIA 3B6MA 4TS9A 1HQKA 2HBZA 2GAFA 5IN4A 1I1QB 3RVRA 5B12A 1IVYA 1GGVA 3PGJA 1JFLA 4EFNA 5MFZA 1RI2A 2FR8C 1Z2AA 4IMIB 1POXA 3U31A 3VH4A 2OD2A 4ZMRA 5EJ7A 1VE5A 2GJ8A 2RHJA 1V5EA 3FTCA 2QW0X 2ZITA 4ZYXA 2IEBA 4LCBA 2J7PA 4X6XA 4H35A 1FNNA 4LF5B 1RQ2A 1SPBS 3ZR4B 2FMHA 2NGRA 2PLWA 3ADOA 3IP7A 1GPKA 4C7BA 2QMYA 1BAPA 5KX5F 4ZV4A 3SJ7A 3B8HA 5EQJB 1QYDA 3EEFA 4PHCA 4C08A 3T3IA 4QUGA 1DV2A 3FN4A 5A9TA 2N42A 1AC5A 4AD8A 1T9ZA 3IO5A 5CT8A 1ZNYA 1MC4A 1JE0A 2JS7A 4MWZA 1PT7A 3WLHA 1R2QA 3AI1A 4C6TB 4QA9A 2GK6A 3AJRA 4GKJB 3FOBA 1PQPA 4R3UC 2CGEA 5HM6A 3KSRA 3M6FA 3ND8A 2BP7A 4GE3A 1FDTA 3RAJA 4ZDWA 3T8YA 1ISGA 1P9RA 4XPIA 3KYIB 4E4TA 4EF5A 1OAOA 2P0AA 1ODLA 1ZISA 4NJEA 3MTJA 4WZBE 4XH9B 5JVDF 4CLEA 5JS7A 1IULA 3WYFA 1E58A 2GEBA 1U6KA 4DNPA 5E2IA 1ORDA 2XUIA 4F9GA 4FB4A 1AH2A 2C4NA 2XW6A 2D5CA 3H1AA 3HM2A 4GBED 3WGOA 2HGZA 4M2LA 4ARUA 1H2WA 1V1MA 3KOYA 4DQKA 3GLTA 2RGXA 2J07A 4MVCA 1SXIA 1X7WB 1GWNA 3I01A 4RAQA 3B51X 4O4LB 3K9QO 4YQZA 2IOFA 1FCJA 1SUIA 2B7LA 2WABA 4OXRA 5HS6A 4BNFA 4DCUA 3GJ4A 4YFVA 3ZHRA 4Q37A 5D6NA 3DLTA 1FPQA 3HRHA 3KT0A 4C01A 3R7SA 3MBIA 2R79A 3F4BA 3K6SA 1VRVA 3FZNA 3PXAA 1N6LA 2VRBA 2G76A 1Z12A 3MWEB 3D2BA 3PFGA 4OHFA 5LIRA 3B9BA 1OXKB 5BW5A 4DIMA 3UOWA 2LIVA 2WSIA 3AF2A 1H1TA 3B1FA 1V1MB 1JFTA 1DB3A 1K5PA 3PKIA 1YUNA 2F7SA 4REOA 1DC5A 1IVNA 2ZEJA 3EFOB 2QZSA 4YCDA 3Q1KA 1EWYA 5TGTA 4ZGWA 4H4EA 4FR0A 3R24A 3SC4A 2EXXA 4C03A 3VA7A 4JCOA 3HXQA 2HO5A 4WKNA 3RUAA 5LU9A 1LBEA 5FWNA 1GTRA 1RSZA 2R6DA 2EKPA 5HUHA 2QDXA 2H4HA 4DV1B 1A98A 1Z4QA 2ATCA 4MX8A 3DOFA 4HV4A 5AKHA 3GLQA 1AKUA 1H94A 3P1JA 2AFIA 3WWOA 1S4MA 4QQKA 4EGAA 1A8PA 4OYHA 1L9XA 5KB3A 3C5CA 3RUEA 1OILA 1E4EA 1OWMA 4DLKA 1XJWA 4KMOA 5AIBA 1J5EB 2ZOSA 4FNMA 4LXGA 2CFIA 4R5HA 4RK4A 3W5CA 4DEVA 5KC8A 2OESA 2PT7A 3TB6A 3DBRA 2P35A 1OWNA 1CNEA 3R5FA 4JVNA 3A32A 1E2UA 1LBHA 2IX3A 5JU6A 3U7QA 2XE7A 2PJZA 5JBIA 3EPPA 5E95A 3GJZA 2FSVC 1O87A 3JATB 3Q2OA 2AHOA 1EFHA 4IOMA 4KPFC 1UXIA 4PO1A 3ZNQA 2BT4A 4BMSA 2QE6A 3OTOB 3D4LA 3LIPA 4QUJA 5IFLA 5F2NA 1UXKA 1X7GA 4J94A 5JSYA 2XIQA 3CSDA 5H80A 5KYYB 1OPRA 2BHLA 3CZQA 1U04A 1RRPA 1FJHA 1XHLA 4HQ0A 2YVQA 5TB5A 4AN1A 5KTSA 1DAMA 3EFEA 4FOTA 4HCJA 3PXCX 4ER6A 1JP7A 2QG6A 1ZN9A 1BJKA 4UUOA 3UMMA 4IW3B 4JLWA 4LVUA 5FP0A 4ENWA 4UE3S 3VFDA 1QRRA 5KTPA 3VRHA 5L3SA 3CQ9A 3HV2A 3F6RA 4GR9A 3RUFA 3D8HA 2RKOA 2VLBA 5A62A 3S8EA 5JQGF 3PWTA 1IDN1 2C5EA 4N41A 2PRIA 3L6DA 3N0XA 5A7FA 1QYIA 3NETA 4LXIA 4WW0A 4N12A 4BQRA 1H3EA 3QKUA 3I6MA 4Z2YA 2Q8PA 4HB0A 4Q9JA 1N2CA 4CM1A 1FIUA 3ZLJA 3IMKA 1BFUA 3IALA 5K3FA 3PDWA 5KYUB 2ZBQA 1A7AA 1U2GA 1WZNA 1PD1A 5T6MA 4D96A 3WGLA 3DVQX 3IE2A 4BC0A 2I4MA 1R3UA 1JR3A 3NANA 5FPYA 1F5SA 4MKIA 1UBCA 2YV5A 1EDOA 2JAXA 3KSUA 4A03A 5KX5B 3K2BA 1HQCA 2ZBFA 3FGPA 1YT5A 1RQNA 1DKOA 1B8VA 1RHKA 4D81A 4CF6A 1EESA 2Y8EA 4KVZA 3C7DB 4FCWA 1PVDA 4P7GA 5FUWA 3HH8A 4Q66C 3RODA 1IOVA 4B2PA 1GNQA 2OHXA 2V45A 1XX6A 2BFFB 2RAVA 3BYZA 4HX5A 1ADCA 4D8XA 2W0MA 2QX6A 2HNKA 3H2IA 2ZSEA 2C7PA 1B2LA 4TL9A 5LZ7A 3H2KA 1A1VA 5E4FA 3C1OA 2XB9A 1A9RA 4YASA 1W35A 1SCUA 5EJGA 5FBRB 1O9HA 1T0PA 3ITDA 2QRPA 3PPWA 3TUIC 2ASVA 3GU3A 3N86A 5IXSA 1KL7A 2FPMA 3IVXA 1I2CA 2EWVA 3FFAA 3IIMA 4GC9A 4YRCA 5EJ2A 2IYYA 4Q3OA 3Q41A 2J0SA 4EHDA 4HGZA 4CODB 3AVVA 5G4KA 2P5UA 3MN1A 5JSHA 1A95A 3LBYA 3W34A 2FGJA 2Q3CA 3W1WA 4PNHA 1V5WA 2FW1A 4DF3A 4K6FA 1P9LA 2QWXA 2DPMA 2WYWA 4HEJA 4F3YA 5ALTA 1RABA 4J7UA 1SD5A 3PDHA 3IBCA 3FPHA 2GT1A 3FCEA 2XUDA 4CMGA 3GXBA 1G8JA 3SEQA 3ZWKA 5KHLB 4DQXA 3F6PA 2ALJA 1H3NA 2LBPA 3IQIX 2JASA 3FCYA 5DW0A 2RBGA 2WMNB 5TXGA 4CQLB 1WTCA 4IIEA 3HQ4O 1Y3HA 4IIFA 2OHVA 2XMCA 3FLAA 3BJEA 1IIRA 2R1VA 4K28A 1OY1A 2G07A 4OKIA 4QQFA 3N07A 5DCUA 1KKLA 3CX8A 4HZGA 1FNMA 4JEMA 3ZD7A 3LA6A 3IAAA 1J24A 4CTNA 3VNRA 2JARA 2NQ2C 4YJ2B 3B53X 3GZTB 1JFFA 3WA6A 1XU4A 5E7IA 5H9WA 4MUMA 5I9LA 3I9LA 1JU3A 5INTA 5BW6B 3C7TA 3IULA 5HWSA 5FRDA 2MYNA 1W4RA 4XQ0A 5BMVB 5BV2P 1QFJA 4GGPA 4UM7A 5HKKA 1KEZA 4QTYA 2W42A 1QP0A 5DTMA 5ISMA 4X20B 3PNBA 2RCNA 3OIVA 3U5TA 3DDWA 1K68A 1F2UB 2QTCA 3OF3A 5LP6B 3VYUB 3HKCA 1ZVVA 3G5LA 1MNQA 2YVUA 3NAQA 4OQEA 4UMDA 1WF6A 4FSHA 4KKXB 1MVLA 1U0EA 2ZVQX 3LY5A 2W22A 3LU1A 3R0QA 4Q0MA 3ZDEA 3VM6A 3U44A 5KAMA 3LL4A 3QSGA 2YH2A 1RP7A 2FPPA 2WOOA 4M8KA 1EZZA 1M34A 2YRWA 4JGBA 2WZQA 4HZIA 4ZAWA 4ADSG 4J9UE 3OC0A 1MJHA 5DTEA 2CDBA 3P8ZA 4LZZA 2A57A 3NHYA 3UENA 2YY6A 1MFZA 3D02A 3KZKA 5C80A 3E8SA 4UXIA 3OUUA 3IS3A 2N47A 4BUCA 5IK2D 4HNVA 1OXMA 1NE2A 1Z29A 1YOBA 3G1WA 1P91A 2JCBA 2QJRA 3D4BA 4PGFA 3QTTA 1XNHA 2ACKA 4YCAA 3T38A 4M0EA 3QPWA 3SE0A 2R97A 2VCYA 1R0KA 2C54A 1Q19A 4LWPA 3UXHA 1Y5RA 2RHLA 1ZYUA 3UK2A 2GZSA 2Q3BA 3EMVA 2ZJ8A 3N2YA 3QE0A 5D51S 3NWJA 2IU4A 3PPXA 2Q41A 3AINA 1Z2EA 4J16A 1D8AA 4M0MA 4RMIA 1W73A 4XOIA 3RI3A 4TTAA 4BB9A 4K5QA 3GG9A 4L4XA 3HNPA 3LUGA 4HEA6 4CFSA 1VG9B 3BIXA 4GXNA 4TV9A 1ZCZA 4GR5A 5AHXA 1LBQA 1NKSA 2XHZA 4I7EA 5F77A 5ALNA 3KV1A 4CQNA 1VHQA 2H29A 3QELA 3OQIA 4P4UA 4D4HA 4DPLA 3VISA 1FDRA 2GLUA 4I4IA 1ODJA 2GCEA 4KGZA 4ES6A 2W2QA 1AS3A 3KLBA 1SULA 4XARA 3O7MA 4A0FA 4EB6B 2WM9B 4O08A 2H1RA 3UGKA 1GU1A 1L7OA 3VSEA 5IT5A 2VTKA 3T06B 1JJFA 4V3CA 3ZTYA 2ETVA 4M1KA 5A4IS 1XQ6A 1BGXT 4GS5A 4PONA 5JTUA 4Q6WA 5DJ5A 1SHJA 4N47A 5HBGA 1SCBA 3L3BA 4GM1A 2HA2A 4M87A 5SY6A 1XALA 3RUIA 2I91A 5DM4A 3EVGA 1TVEA 3X2SA 2XQGA 4C0LA 3O75A 1I32A 4JBIA 3HTXA 5KZMB 5A0VA 4P98A 2B7BA 3CUKA 3D6MA 3KB8A 1CUHA 1KY4A 1N8TA 3MJEA 2GCOB 3BE6A 5BUZA 3ER8A 1L1EA 1GO2A 3C1AA 3SFVA 4XGIA 4PN7A 4Q1DA 3AVQA 3SD7A 3SKXA 2W6JA 2JI4A 2OAP1 4Y2SA 1JPJA 2YZNA 2J31A 2ZJOA 4AECA 2JGKA 1QIKA 5B4TA 2AZXA 2UAGA 3I0MA 2QRVA 2P8SA 2V7VA 4X1YA 4ZHQF 5HRAA 1KAMA 2RHDA 1QR2A 2REBA 4MW6A 1CG6A 4X0EA 3UT5A 3GV0A 4PCUA 3A6LA 1P44A 4FW9A 5K3SA 1H6DA 2GK4A 3AY0A 2O8NA 3BMQA 3QA9A 4EJFA 3CPJB 3FFBA 3F3YA 3EZGA 3JALB 5FHQA 2XLCA 2D1YA 2R8EA 4UTOA 1BXKA 1Z6YA 4N3GA 4QSHA 2HHHB 3GLHB 4RNCA 4KGXA 2D1TA 3RUPA 1SOVA 5KO2A 5REQA 1BX1A 2B92A 5CYPA 5KTTA 5FWXB 1JLLA 3SEZA 3PLNA 1XL0A 4ARIA 4DJDC 3WLIA 2R00C 3OJFA 3TOCA 5I7UA 1RLUA 1P3JA 1KYQA 4JSYA 1G5IA 4AYWA 3TOSA 3ONNA 3D2AA 5K8JB 3O8QB 4B6JA 1PAUA 1ONBA 2AXEA 2R00A 5FOWA 4P35A 3U0BA 4QBIA 1HPLA 1NVMB 4PFKA 3RREA 1QTRA 1VBNA 1YS9A 2FEAA 1I6KA 2WHXA 1RXIA 2XDQB 3UQYS 1MA3A 5CDSA 5CXSA 5GZ6A 1SN7A 1II8A 4PRYA 4CG1A 4IXTA 1PTJA 4EB8A 1E3LA 2BY4A 4F71A 3BERA 4WKOA 4ESHA 3CMCO 2CFOA 6REQA 2UYCA 2E4ZA 3ZXIA 3TSYA 3Q8WA 2O8CA 3NJRA 1E5QA 2JLQA 1UCFA 5CGZA 1Z73A 3B6IA 1SIWA 3MTQA 4FYWA 5DM1A 1W75A 2DFTA 3F6CA 3H5TA 3QPVA 3H8WA 1UZMA 3K7EA 4I9UA 3HWSA 1XQWA 2GAJA 3AFOA 1CUWA 3BIOA 1XXHA 3VC7A 3CEAA 1MU0A 2DPGA 1RRKA 3REGA 4MS4A 3N2IA 3P0HA 5EGNA 2OYRA 4OSOA 3SHOA 5CK4A 5LN1A 1TQ4A 1JS1X 2OB1A 1SCQA 3JPWA 3OSUA 2WV9A 3N3BC 5L6LB 3Q88A 1Q3TA 2YZGA 4H3HB 2VHXA 1T2DA 3KE8A 3QGMA 1ONPA 3DQQA 2PXCA 3O1JC 1YMUA 2I2XB 1DHTA 2FH5B 4PGGA 3WTCA 1IH8A 1Z7GA 3LJKA 2P40A 3HDGA 2E4UA 2MSLA 2OM2A 1W46A 4B5LA 3IEXA 4AFNA 1T10A 3KSBC 1W0JD 3LCJA 1RBYA 2P6UA 3LTEA 4PAWA 3EGIA 3TBKA 1YR7A 2QOEA 4NMXB 2RCYA 3VC2A 3A9VA 4JGIA 2QZZA 1PZXA 5CIQA 1L5YA 4RC9A 3HVKA 5EZ6B 4J3JA 5F7ZA 3RQSA 4B17A 5L45A 2Q46A 3I04A 1ACLA 5FLXA 3V97A 1BQ4A 1KSFX 3RWBA 5AW6A 3PEYA 1UZLA 1CUIA 1WMDA 1RBQA 2FN3A 2Z5FA 2BGRA 5AJUA 4AMUA 1AHHA 1IY0A 4MW2A 1PZGA 3LLVA 4QBGB 1U90A 2C4KA 4BX0A 4PBRA 5BUCA 5BOVA 3REOA 2Q4TA 3MUNA 1KSJA 4R0NA 3BIJA 2CNNA 3RYFA 4DMMA 3LDAA 4KSYA 4BNHA 1M2GA 4DSAA 4ZT4A 5EZSA 2WYIA 3ZC3A 2Y92A 1A9XB 1E6MA 1PFUA 4GXQA 1T0HB 3V2UA 4UQLA 5K8CA 3WAKA 1WBDA 4YJ3A 1AKYA 4JP8A 1CBUA 1N0UA 4XLZA 2V7WA 2ZUCA 4OUDB 4ZO4A 3JQ8B 3UAOA 1PV1A 4HB2A 1IZ8A 1KARA 1RD4A 3CX6A 3I6QA 4FHGA 4OQNA 4KJXA 2V3WA 4AWBA 3LYUA 3I1JA 3GGDA 5DASA 3CUVA 3JVDA 1Z5PA 4GWGA 1GFZA 2AEJA 3IX7A 3K4QA 1YZHA 3DMTC 3NYQA 3HBMA 4EA8A 5JRDS 3AJAA 4MVJP 1U2SA 3WLQA 5LR6A 1EJ6A 2V7XA 2WJWA 3KS9A 3IQGX 3PITA 1M73E 1TXGA 2X9VA 5CLJA 5DN6D 3FNGA 4Q7LA 4OBEA 4DLWA 3CW2A 5GV7A 3J7AC 4K6KA 3DLCA 1AM4D 1LK7A 2A2ZA 3S4YA 5LQDA 3S1AA 1P3Y1 5C1DA 3TEJA 3GD5A 1NP7A 4L95C 4D7AA 3L8YA 5TF0A 4UCWA 1BVHA 3IQWA 1RZRA 2Q9UA 1JX6A 5EE1A 1D6SA 4QL3A 3ENNA 4M9ZA 4C9BA 2XXAB 1KIAA 4GDFA 4AS2A 3GFSA 4TV9B 1V3TA 3R3YA 5L7YA 3B1ZA 3HRIA 2GD0A 3GVXA 5KSOA 4RZIA 1Y81A 4TRMA 1AUVA 1CR0A 1WE2A 1FW8A 3HDVA 2AMVA 2BGGA 4DKXA 4BE9A 1NUUA 1ZK4A 3GOQA 4G1CA 2W00A 4IQ8A 3CZCA 1SCIA 1XCPA 3GXOA 1FVFA 4FFPA 3DCJA 4G5OA 3SEAA 5AW1A 5LZ4A 2HRRA 4DARA 1JUDA 3H11A 3SR0A 1SHKA 4FGUA 3GG2A 4OK6A 4P6VF 1V3QE 1I3MA 3VTZA 1Q74A 2FNAA 2EJVA 3IQHX 2PD3A 4OQZA 1LX7A 3FUXA 4MPTA 4Z3DA 1L4FA 4CUZA 4G9BA 1DBWA 1MIHA 3QENA 1PDWA 2O2HA 4I4CA 4Q1FA 3D0RA 1AZLA 1LFDB 1DLJA 5JTTA 3L9WA 4RS3A 4BCDA 3AEYA 3MRTA 1AB5A 4CM4A 4C2UA 4AP5A 4R8SA 5JSFA 3EG9A 5AYVA 2J30A 4HTFA 4ITRC 3Q1LA 4FJ1A 3NTUA 5IT4A 3VDMA 1Z2NX 3DW1X 3AKZA 1XZBA 3QKSA 2OMEA 2QUHA 4O4HA 5TE9A 1SC6A 5ITZB 3ICEA 2P6PA 3GMDA 2A1UA 1K88A 1EUQA 2WB4A 2YVLA 1GAJA 1M5UA 4CKEB 2C57A 9GPBA 3OO0A 3Q6MA 3VNUA 3T1QA 4G09A 3BAFA 3LXMA 2DJ5A 1WCIA 1FNDA 3EZLA 1MD9A 4LRXA 2Y1EA 2Q62A 5IX8A 1G6Q1 3L7KA 4YT4A 5THKA 1KERA 4DWOA 2OPBA 1PG2A 3O5AA 4D99A 2EOAA 1FP7A 3LXXA 2IODA 2RH8A 4XB1A 4CTJA 3CNEA 2Y66A 1BD3A 1G2IA 5LQAA 3GBPA 3I5UA 1QDEA 4KPUA 4PLPA 1SA0A 2VYVD 3NC1C 3OWOA 1N2EA 3RBVA 3R3HA 3QITA 3HS3A 1OZGA 2I7TA 1Z6AA 3N70A 5AK4A 2BIFA 4MAAA 4UHCA 1ILEA 3N8KA 1Y3FE 1NVVR 3ORHA 2OCXA 4EB0A 2AF3C 2BVNA 4D2IA 1P75A 4Y2QA 3I1FA 1R0WA 3FFWA 4FM9A 1T4BA 1YOVB 3A2NA 4D42A 1SZJG 4KRGA 1KH1A 4NF2A 4Q19A 5T6BA 3UWOA 2ZSAA 3KPJA 4I9FA 4Y6SA 2WUVA 1QV7A 1PEDA 1UFQA 2VH2A 2CKMA 3P9CA 5LYYA 3C87A 2IQIA 4POOA 4TV8F 3OT4A 4X8MA 1RMQA 1XJCA 2CF5A 2NX2A 5DXAA 4A6XA 1ZQ1A 1UFOA 1NU6A 4N49A 3EA0A 4RZ2A 5GVRA 4CQMD 1G59A 4ND3A 4HX9A 2IYZA 2ZDGA 3QVSA 1PSWA 3FI9A 2UUAB 4JYPA 1XK7A 1K8ZB 3BCSA 1QRAA 4QM6A 2VDOB 2WJPA 3F97A 1DOHA 3HN6A 4OU4A 3TD6A 4UMFA 1H3FA 3A31A 4ZAYA 1SXHA 2R3SA 2WJ3A 4UD6A 1CT9A 5JNWA 2QUKA 3IYLW 3CRW1 4RGYA 2N46A 1FSGA 2PKEA 4G4SP 2YN0A 1C9JA 1KWKA 2O5EA 1JPVA 2IPOA 3DZHA 3MUEA 4JT2A 3UA3A 1EA7A 1YZGA 4DNFA 3O31A 2BHSA 3MINB 5HA5A 3UFXA 3AYXB 3Q98A 4DGSA 4DLPA 4ZHSA 3AKCA 3X0DA 2PRSA 3A4IA 3IMGA 4I1PA 1RTKA 3B6JA 4IF6A 5KSPA 1F2UA 1Y5LA 5JCOC 1EEXB 2B7CA 2C9BA 1IY2A 3CRVA 3O4HA 4G4SO 4IQ4A 4QOIA 1WCYA 3W8DA 5JSQA 3HJCA 4Y7CA 4ZCPA 4M38A 1MZPA 4WOKA 1JG3A 3JATA 2BGJA 1TLTA 1CZOA 2AA3A 3COVA 4IGAA 2CFRA 5EIAA 2IIPA 5G0WA 4BMPB 4YCCA 1X86B 5AI0A 8OHMA 1KQOA 1Z74A 3FPFA 5DI3A 1AK2A 2J85A 3E27A 5EP4A 4I4TB 1KDZA 5E6RA 4XM2A 3HFSA 3PL1A 4W6QA 4AURA 4EF4A 4Q3KA 4YMLA 4XE5A 1TM7E 3GP5A 1PX0A 2G08A 1RQXA 1WO8A 4FIZA 4I55A 1QIIA 4JBNA 5E0KB 5FBWB 2RGEA 5EKSA 3D4OA 3KWMA 4LQCA 3ZH9B 4YA6A 3FKQA 4G81A 6AT1A 2V74B 1HNZB 2HLPA 3I09A 1K6EA 2WHEA 3PUVA 4LY0A 4XQCA 4P4SB 1DCFA 3GL9A 5AI6A 1GUAA 1IN7A 2Y68A 3DV9A 3LGXA 3I3SR 3HFJA 2YIJA 3LQ2A 5EJAA 1E5TA 2XNSA 5TF4A 2RHWA 3I58A 5EXPA 4BBPA 1AJEA 3NM5A 1BWQA 1NLFA 3C4VA 2QVXX 4IJUA 4MR9A 2JLSA 5M3BA 2M9MA 2P9TA 2X42A 4J7XA 1JLRA 1C30A 4Z49A 5LFAA 4OLBA 4MUFA 5FWYA 4JZYA 3VNVA 3NBQA 2MINA 3EWNA 2HU2A 1Y1SA 4DPMA 1X39A 1X7WA 2M6SA 1G8YA 1ZM2A 3IAUA 5KCMA 4FFLA 4P82A 5T4HA 4F56A 3ZWBA 1RJ9A 1UDCA 4P4LA 1RI5A 3ORRA 1Z37A 2YJ3A 2XKJE 5A0FA 1XVTA 1VIVA 1XJ5A 1H4SA 3D3JA 4TLDA 1Y6GA 2WT4A 1TUEA 3ABQB 4A8TA 4ZQHA 3RC9A 3CT4A 4NPAA 3W9BA 2WTAA 3WS7A 3VKFA 1EVQA 3NDJA 3SI7A 5J4LA 2AUTA 5CPFA 1MX9A 5BN4B 4UQOA 5CYFA 1CZKA 3EFHA 5AJTA 2DETA 3KQSA 1D8TA 3NDIA 4RK5A 2PZAA 2YBDA 4QVGA 1W93A 4C4OA 4JBGA 1X6VA 5DHRA 2JL1A 1HDYA 1W1WA 3CNOA 4GZ5A 3DPSA 3S8MA 2PFSA 2OBFA 3GJXC 2YXNA 3SLGA 3BH6A 3OX4A 1JDJA 1JSZA 1JHPA 4IUBS 4QXOA 4RE6A 2OV4A 5DT2A 2PQ0A 2GR9A 3EYWA 1Z47A 1O58A 4TYYA 2QTLA 1VG1A 1XZAA 3FVWA 2FPGB 1I01A 3L7LA 2OLJA 3LXUX 4TMTA 5JATA 2ECPA 3H1TA 4V0ME 5CT6A 2JVIA 3WGZA 4BX8A 4ZVKA 5K8VA 1GA6A 3ENZA 3U1VA 2FEOA 5BWBA 2NVUA 5FI5A 3OMXA 2C4WA 1EFKA 1OXVA 1TQ2A 3IQDB 4NK5A 3ZLBA 2H11A 2DY1A 1HR0B 3R3UA 2DFPA 1RKXA 3HSKA 4OB7A 3T1VA 1SC9A 2JI8A 1SY7A 5DP1A 1MTOA 4KXLA 2WA1A 1NG1A 4BASA 3OIWA 1VMEA 3QFCA 5EP3A 4IMPA 3A04A 2X13A 3A2KA 5EMHA 2AD1A 2YN4A 2QPAA 3HYLA 3IBFA 4RBNA 4AJEA 3GNLA 4IILA 5HS4A 3KEGA 5CW2A 4UBLA 2WJYA 1G2PA 1TIPA 2VBIA 1G8KA 1ILWA 5AM5A 4B80A 5IH7A 1E9DA 1KR2A 4OM8A 3TN7A 3WBBA 3X2EA 2GPNA 1ANKA 2WJ4A 4S2EA 2H1HA 1V4BA 3EUEA 1I1OA 2H17A 5K4HA 3FCCA 1BYUA 4ZT6A 1CETA 5MGBA 4V38A 4LMPA 1JHVA 1M72A 4MVJI 4GOJA 1TD9A 3B1KA 1MW8X 3G6WA 3MS7A 3OOJA 1DBQA 1WJGA 1W1UA 2BFEA 4B46A 1KMCA 1T8SA 3SF8B 4FMCB 1RXYA 3B60A 3NHRA 1NXVA 2X2OA 4A0RA 4C6TA 3VTFA 3OHSX 1GTG1 3UAZA 1GUBA 3RVMA 2A86A 3FGNA 3MXOA 1VB5A 3ZDQA 3K09A 4CDMA 2CV0A 5JCJD 4JKIA 4UQPA 3AHJA 1H4VB 1HZZA 3RSCA 4DAOA 2UVPA 2CDAA 2X9QA 5CLHA 4AKHA