3KJHA

Zn-bound state of cooc1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
b'MKLAVAGKGGVGKTTVAAGLIKIMASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLGSVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDLGIKKVRYVINKVRNIKEEKLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQSTNPAFVNLHDIYQKLRLEVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CO dehydrogenase/acetyl-CoA synthase complex, accessory prot
publication title Crystal Structure of the ATP-Dependent Maturation Factor of Ni,Fe-Containing Carbon Monoxide Dehydrogenases
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Hydrolase, metal binding protein
total genus 76
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kjhA00
1NMYA 2PX0A 4IDNA 1QVRA 4RVCA 1RC8A 1EXMA 1FNNA 5H70A 4LPKA 5D3MA 3D8BA 4C7OA 3U3OA 1T9HA 1ZM7A 3A1TA 3MJHA 3O47A 1ZM4A 2FV8A 2OCBA 4E22A 3V4FA 4FINA 2NO7A 1T6NA 3N70A 1OH6A 2PCLA 1L7VC 4G01B 3QY0A 2FSHA 2H16A 5LB2A 1FMJA 2NIPA 2VPPA 1OIXA 3FMIA 3T34A 2NPFA 1KY2A 2FPKA 2WJVA 1TTTA 2OCYC 4DIDA 2JJ2A 3MD0A 3A1WA 3AUYA 5H68A 1BMFD 1JALA 3IPYA 2QGNA 3WP1B 1Q3HA 1ZCBA 1G8GA 4Z8XA 1XPUA 2OM2A 3EZ2A 4UJ5A 4CEHA 3L8ZA 4TL7A 1TMKA 4OI2A 4X8HA 5CIWA 1MRSA 3QPWA 3X1WA 4ZO4A 1XTQA 3W8RA 3QJYA 3RS3A 5JWOA 5AUOB 6Q21A 2QRZA 4HZUA 2REOA 1XD2A 2W2TA 4TYYA 3LBHA 2PEZA 2QGZA 3MWKA 4TMKA 4PQFA 1NMXA 3WMFA 3A37A 2GJ8A 3W3AA 5DI9A 3LQQA 4MGIR 4D26A 2IF0A 3Q72A 5DE3A 3THWB 5J4LA 4LHXA 1OIVA 1WBDA 2J9RA 2FSIA 3AVOA 3WBJA 2CNWA 1HA3A 3RVBA 1UJ2A 4P4SA 1SVIA 1Q1QA 5HTKA 1Z3IX 2YJTD 2QTHA 4BUJA 2LKCA 3DZ8A 2QBYB 3SEAA 2G0TA 4KVAA 1A2BA 4RCYA 1E1RA 4D2IA 4JLMA 3AGPA 3UG6A 4LJYA 5FTNA 2W83A 4QC2A 1JR3E 4N0DA 1OXXK 1ZUNB 2P6UA 2QQEA 3L82B 2J0SA 2VP0A 4EPTA 3I92A 3FVQA 3TQCA 2WWXA 1BS1A 1ZNZA 1T8UA 1E2FA 1NVVR 2C9CA 2R6DA 3N2IA 4XSHA 1OE0A 2JJ1A 2GETA 2Q3MA 2ZROA 5JCZA 1DAGA 4F4CA 2J7KA 1YR9A 1OFIA 4DLZA 1YJ5A 2YWGA 3KX2A 1JB1A 2B8WA 3DMDA 3QF4B 1CXZA 3AP1A 3RAPR 4DZZA 1DVRA 4KHZA 4B3BA 3BBPA 3CH5A 5LB4A 1FOEB 3L2OB 5KSZA 1I2DA 5HE9A 2OAQ1 3EAQA 4M1TA 3SE0A 4RD1A 2F3TA 1E2GA 5FOWA 5LPNA 4QHSA 4Q1AA 5EXPA 3LX5A 4AD8A 1JBKA 3Q7QA 3UATA 1G4AE 3WMGA 4NCNA 2HYDA 2QPOA 3LLMA 3KTAA 4BWYA 2O0JA 4RZ2A 3ADKA 2AXPA 5JWRA 2CEAA 1AQYA 4QBHA 1DADA 1E0AA 4HDCA 4PAOA 4NYIR 4DVGA 3QE0A 5FUXA 1J90A 2JDIA 5DYGA 3GD7A 1VCOA 4AYXA 1MABA 2KE5A 4FIDA 4JKYA 3NIBA 4KVGA 3VQTA 2BBSA 4A15A 2WKPA 3B78A 3K9HA 3CKLA 4BASA 1UAAA 2QRNA 2WWHA 4QFMA 3CX7A 5BQ5A 4IFBA 1M6NA 4US0R 1FP6A 1E2JA 4R2IA 1E99A 1KSJA 4MKFA 4BQSA 2Y8EA 1S1MA 1EG7A 4Q21A 4PC3A 4K46A 1G291 4BFWA 1JR3A 4HDOB 1G5RA 1UBCA 2GTPA 4XTCS 2HEIA 3TIFA 1R2QA 2QM8A 2A5JA 1FFHA 4LZZA 2EWVA 4Z1MD 2ZRJA 3KJGA 4HEJA 1OXUA 3HP1A 4ZCLA 3AVWA 2J3EA 2RGDA 1DS6A 4HYYA 5K8UA 2I1VB 1P73A 2V7QD 5JWHA 5JEEA 4LJ6A 3HPRA 2CLSA 5LD2B 5JJLA 4DDUA 3I3SR 5EE0A 3ZLJA 4CYMA 4A0GA 1N0WA 5CM9C 5FOTA 3FKSD 3TUJC 5JHHB 1WB9A 2PT5A 4MGYR 4B32A 1VDZA 4A2QA 4PPNA 2R9VA 3U60B 4C30A 3SC3A 4EUNA 4LJ4A 4EPVA 4Q47A 2GJ9A 1GIAA 2OE2A 1XPOA 4DLTA 2ZJ8A 3KL4A 1YR8A 1OLOA 3IUYA 4IEEA 3B9PA 1AA9A 2R62A 2W58A 3QI2A 5HZKA 2FWRA 1NIPA 2J87A 3OIUA 1LB1B 2HCBA 1F48A 4B48A 2VF8A 1EX7A 4GOJA 5FOVA 1OXSC 2GF9A 4A2PA 4A1FA 2Z4RA 3EXAA 4V0NA 3IHWA 4NYJR 2VHCA 4EJSB 5G3ZA 4KBFA 1ZM3A 3LD9A 4GBMA 2H7VA 1X8KA 3A8TA 4PPGA 3GJXC 5FPTA 3DZDA 3K53A 1M2OB 3SDZA 1VYUA 2JASA 1E9DA 3KB2A 1TQDA 4LOAA 4H9GA 4V0OA 1GKYA 2H92A 3CNNA 5SZKB 1GNPA 5FBWB 1AN0A 3GLFE 5IK2D 5BYJA 1KI8A 1TAGA 2YWFA 1Z0IA 4NE2A 2J0VA 1KKMA 1IOZA 3U4QB 3IQXA 5AJXA 2ZJ2A 3R7WB 2YWHA 4PSAA 3TNFA 1NVVQ 2G1KA 3A58B 3M6AA 5KSPA 2FOLA 4XWOA 4Q1EA 3T06B 3BH6A 2XB4A 4B2LA 1AZSC 1VIAA 2OBNA 4B35A 1VYTA 3OESA 2BEKA 4JLNA 2JLVA 3OIVA 1MO3A 4HAVA 4D0NA 4DT1A 1UBGA 4I1SA 4LY6A 2OBMA 4BZPA 2ZITA 3AKYA 2FFAA 3FMPB 2AX4A 2J7PA 1NY6A 2AKAB 4PC2A 2F55A 5A5GA 3RC8A 5HPYB 1HURA 2ZSBA 2I1QA 5EZ5A 1Q0UA 2OAP1 3QIAA 4LHYA 4QJ4A 3WNBA 5KYKA 3OHMA 1DAEA 4HLUA 3CX8A 1DAKA 3WP0A 4CEIA 1Y3AA 3EC2A 4RCZA 4G5OA 1H65A 4KLNA 2YINC 4HSEA 3TMKA 1YZTA 1M1YE 3LH5A 2IXFA 4Q9KA 1KY3A 3IHLA 1SKQA 3N2EA 3SI7A 1T5LA 1NBME 2RGAA 2XITA 4NYIQ 3PIRA 4Q48A 4MITA 2ZUBA 3K70D 3L8YA 2QAGB 4DCNA 4F93B 1M7GA 1BYIA 1X3SA 2IEYA 1TX4B 1XEXB 4DSUA 4A9AA 3UMFA 3R8CA 1GFIA 3TRFA 1DAIA 3RRMA 3TUZC 4XD7A 2ZRNA 3THWA 2IBMA 1XD9A 2D3WA 4OI0A 3W90A 1SVWA 2A9KA 3B8HA 3GLFA 2DYKA 2O8CA 3C41J 1NI3A 3WHKA 3FOZA 1T0HB 3CZQA 1W0KA 2AK3A 3X1DA 4LJAA 1KAGA 4QHTA 3L0IB 2QBYA 2GCPA 3B1VA 2ZYVX 5EE3A 5AR1A 3EX7C 4LYFA 1PLLA 5IRCD 5FPKA 4FMCB 3CZPA 3PUZA 1YKSA 4Q4JA 2FFHA 3K0AA 5DSZA 3CLVA 1YZKA 4LUCA 3ZIAA 4GFDA 3DM9B 3B2EA 1P60A 3OAAD 3A4LA 3FYHA 2Z0MA 1KDOA 4KCGA 2CVFA 3X1ZA 1OH5A 3EIEA 1P7CA 2IF2A 1NLFA 4YXWA 3CWQA 4D80A 2ZM5A 4X8LA 4WZBE 4RD2A 2DWPA 3ZVRA 5FL3A 4CIDA 1GZSA 4UKDA 4F92B 2WMOB 2WAYA 2HDNB 5CLQA 4M21A 3G0HA 2O8FB 4ZDKA 4IFEA 2UKDA 2DWOA 1W5SA 5FOSA 3BJIC 3X1YA 3IIKA 1RVDA 2G6BA 1TQ4A 1G8FA 3QEOA 4PQYA 3BWDD 2RGCA 1CU1A 1NBMA 4MKGA 1BO6A 2W6JD 5FL7D 2Q3HA 3CBQA 5TY0A 3S1AB 1IN6A 2DFLA 4KFUA 1S1CA 1U90A 2F1HA 4R2HA 2ZIAA 5JJIA 4NYJQ 1N0VC 4HUTA 1SGWA 4P33A 3PXGA 3RWMB 1G16A 1Q1ZA 3K1JA 2QPTA 4DLRA 5KNDA 3IILA 4PR0A 4NHOA 1AQUA 3IEUA 4XIGS 5HKKA 2ZS9A 3OEEA 3AVYA 1US8A 3K0SA 1EESA 1T91A 5TARA 1FX0B 4OJQA 2WPDA 1AK2A 1YR7A 4DUGA 1YZLA 2AWOA 4O2LA 4DC9A 1PV4A 3EW9A 5J4HA 2CLDX 3KQKA 1EGAA 4JL5A 4LGMA 1OIWA 1JPNA 4JLKA 2A5DA 2HXYA 4GL2A 1SKYE 3KXLA 1WRBA 4TYPA 3B7GA 4I1VA 4PFSA 5B64A 4PZYA 3IIMA 1EFRA 4Y0VA 1W36B 2QP3A 1OFTA 5K8LA 2GRJA 3GJ0A 4M0LA 3NKVA 3GFPA 4BLQA 5C46F 4RJLA 4HB2A 1GM5A 5FOXA 4BZQA 3RYTC 1L2TA 1M34E 1XB2A 5SZIA 3MWJA 5FBLB 2VHJA 4DCSA 1NRJB 1OKKD 1IY0A 5DHFA 3PUXA 1VCNA 3QKTA 5JRZA 4L9SA 2ZUCA 4JLVA 2ZE5A 4QNRA 2CJWB 2ZI4A 5GVRA 2P67A 1QRAA 4QXAA 2H8KA 2NQ2C 1ODFA 4DWJA 2P5SA 4QRHA 2EYUA 2RGXA 1NN0A 2Z4SA 4KODA 1P62B 2YYZA 4QGAA 3NH9A 4NBSA 3E2IA 4DLXA 4KSCA 1COWA 2IHYA 2VEDA 3CH4B 1Z2CA 2IYXA 3B9QA 3MUFA 4FW9A 3SYLA 2JLXA 5FI1B 4Q4LA 1XTKA 1G5TA 3K0CA 4NL4H 1U0LA 1KI9A 1S0UA 4EQ6A 1ZM2A 2GCOB 3CW2A 1FZQA 3GJ4A 3ASZA 3A1VA 3DPUA 2WJGA 2FSFA 3GJ6A 3VAAA 2BWJA 2WICA 1MV5A 2V6JA 2VLIA 4NZYA 2IYVA 3EPKA 3QG1A 3R9XA 1E94E 4QGFA 2REBA 2UZIR 4TT3A 4EJSA 5J4YA 2BC9A 5CLLA 2Z83A 1KHTA 1P72A 2BBOA 2GEVA 2W6ID 2PEYA 3U44A 4R9UC 1PJRA 3PEVA 3C4JA 1UDXA 3Q8XB 4POAA 2FA9A 4ASUA 5AJZA 4BRUA 4TMWA 3T35A 2H57A 4LYHA 1KSHA 1RFLA 2XZPA 2Z6VA 1ZW6A 1R6BX 2GDJA 2N42A 4TLCA 1DO2A 5CDFE 3DVLA 5LDDC 2NOAA 1II9A 5F9HA 4FCVA 1XCMA 3K9LA 4PC6A 3QOFA 3H0KA 4AKIA 1OPXA 2X1VA 3CNLA 3Q9LA 2OLKA 5HE8A 2YZ2A 4Q4HA 2IS6A 4IDQA 1XXHB 2EVWX 1ZVQA 4UXIA 2ZQ5A 4DDTA 4FMBB 1Z6AA 2MSDB 3EWSA 2TMKA 1KI6A 3CRRA 4PC7A 1XZPA 2RGEA 3A6PC 2ODBA 3HYTA 4Q1DA 3WRYC 5F9FA 621PA 4TMVA 4V0ME 1EX6A 1IONA 2C03A 4V03A 4KV9A 4DIEA 4B73A 2BV3A 2IHBA 1I2MA 2GXSA 3UMRA 4BPBA 4G0NA 1KMHB 4Q5IA 4DSOA 1RKBA 2F1JA 2VQSA 3EG5A 3IGFA 2C96A 3EIHA 2CHVA 2ZSFA 3TAUA 1NLYA 4LRWA 1KDRA 3GEEA 5AJWA 3UIEA 3NDPA 3RHFA 3GJ7A 1O3YA 3RS5A 4QJ5A 3W6OA 3AV0B 4QKQA 1E9FA 5G41A 5TDHA 4US2R 1KJYA 2F7SA 4TLBA 3SZRA 1FTSA 1QBKC 2QTFA 3THOA 2V54A 4B2IA 2QL6A 5KU1A 3AVVA 2FNAA 1N6LA 4KJZA 1ZJ6A 4Q00A 3WBKA 3B82A 4GZLA 1E2KA 4OQFA 2JJ2D 5EZ6B 2ZXUA 5L3QB 3AKEA 4B76A 5EP1A 2D2EA 2BCJQ 2YWEA 1U99A 3T5GA 3RNLA 2G0NA 3RDPA 2GXUA 1VG8A 2AD5A 2DFNA 4PPQA 1HYQA 2ZE6A 2FG5A 2JLSA 1M7BA 3GFOA 4TSFA 3LXXA 2ANBA 2MMCA 5CDFA 1HQCA 2BM0A 1E2DA 2RHMA 3VHLB 3X1XA 1Q1BA 5TMPA 2OFWA 4AY2A 4ACBA 1HE1C 5FTLA 2IUUA 2D4HA 2OCAA 4Q03A 4PSKA 1FTNA 4BLOA 4CW7A 1M7HA 3C16C 4ITRC 1GILA 4H1UA 1CR1A 2RGNA 2IK8A 3TH5A 1AS3A 4DLSA 2JEOA 3AVTA 1S3SA 3ZD6A 1E2QA 5EXTA 2BMJA 1HT1E 2ZI3A 1R0XA 4KU4A 4V0MA 5F2EA 2CNWD 1VPLA 2B7BA 3JZAA 2GF0A 3THXB 5DGXA 3QPVA 4US1R 4JSYA 3KB1A 2P65A 3KQNA 4ZI3A 1KOFA 2PLFA 3BFXA 1GG2A 5AUQA 3A36A 1E1RD 4HDQB 1H8EA 4Q7LA 4A0RA 5J4VA 2AD1A 3HYRA 2ZI7A 1R0YA 1SVLA 1P2TA 2EFGA 4EFLA 2IWHA 3SOPA 1R4AA 1FPMA 3E1SA 2YVUA 1JECA 5H1YA 2JLWA 1E9CA 1KZGB 3TUIC 1E2IA 4F7WA 2A5YB 4MRNA 3TR0A 1RW4A 4IVRA 1ETUA 4IDOA 4JLAA 3S1AA 2JAQA 1GL7A 2ZSAA 2NTYC 4ZKDA 1A1VA 3IKJA 5E3HA 3U3RA 2NO0A 2JJ1D 2JLUA 2O0HA 2VHQA 1ZUHA 4E07A 2J0QA 4FXPA 2VL7A 3NEYA 3WYAA 4WXPA 4DDVA 1LW7A 3VR2A 3GLIB 1RE0A 1SZPA 1FUUA 1NVXQ 2ZAMA 5P21A 2ASEA 4HUQA 2GZAA 1FX0A 2HUPA 1AS2A 5J5CA 2FPLA 2E9SA 5EE5B 4JT2A 2VH5R 2NO9A 4AK9A 1KGDA 3PEUA 4M4SA 4DCTA 1D6JA 4DLVA 2IS4A 1D2EA 1UEIA 1T5IA 1TF2A 3I72A 4YMVA 5B58C 3NBZC 1SHKA 2R44A 4XSGA 1PZNA 3DHWC 3OZXA 1XU4A 3ADBA 1OFHA 3H86A 3B1WA 4ESVA 3LO5A 1SXJE 1SQ5A 4URWR 1N6NA 4Q4AA 3CF6R 2GEUA 2YHSA 3LA6A 5GJBA 4Q19A 2R65A 2X77A 4FD2A 4MYHA 1SXJC 4C0BA 1TL7C 4TQ9A 1RPZA 1KSGA 1A2KC 1UKZA 1HUQA 2JDID 3FWYA 4QBIA 3FFAA 5JCPA 4A0FA 3QXSA 2PZEA 2LKDA 1IBRA 3CPJB 1W4AA 3LBIA 4TN1A 1HV8A 2GVDC 3HDTA 4RFSB 2EYQA 4MA4A 1VG1A 3BOSA 3V00A 3R8FA 1GVNB 1KO8A 1MRNA 2JLQA 3FPAA 3PG5A 2R6FA 3B1XA 3QG5A 4JL8A 2XEXA 1JQLB 1KI1A 3CO5A 1JR3D 4Q7KA 121PA 2CL7X 4FCTA 2XXAB 1IXRC 5CJPA 3I4LA 3SNHA 1ZIPA 2DPXA 4HAZA 4ARZB 4IHQA 3RC3A 1MR3F 2RGBA 1M74A 2IYTA 4Q1BA 1Z0JA 1ZC4A 2QTVB 3I62A 4GI7A 4A0HA 1X1RA 4ACAA 1GKUB 3U2QA 4BLPA 4EFMA 4JLJA 5CYPA 4Q1CA 1E69A 1VTKA 4KI0A 5TV2A 3AP2A 3HU2A 4PAQA 5G40A 3ZS8A 4AKEA 4URZR 4QBFA 1PUIA 1VG0B 5AWFC 2HF8A 5KNBA 3WY9A 1P9WA 3H4MA 1Z0KA 2ZS8A 3ND9A 4LBZA 3RS7A 3SBDA 1JR6A 3JVUA 3KKMA 521PA 3G82C 3MAAC 1ZD9A 4TTPA 4WVFA 5C4GB 1Z5ZA 2IL1A 4BFZA 1OB5A 1OFUX 1XTSA 2ZR9A 1ELOA 1T4GA 3GCGA 4DKXA 1SXJA 4RD3A 2WSSA 3SYNA 5L3SA 4OQLA 1CULC 1DAFA 4LBWA 4PHHA 2D2FA 3MGCA 1KDPA 2GJSA 5HR5A 3QKSA 4I1UA 4F91B 5E7MA 1W0JA 1P2SA 2F1IA 2PJZA 1J99A 1E4YA 1U2RA 4MYCA 5KSYA 5GJCA 721PA 1CR0A 1YHNA 2DCUA 3AB3A 3O8RA 3AF1A 1BOFA 4FMDB 5TB5A 2BOVA 1V43A 2BEJA 3H84A 4L8GA 1TQ2A 2UVQA 4MKHA 4URVR 4B3GA 3NDBB 3QXJA 1E0KA 2OZEA 1E2PA 3GEHA 2A5GA 3P27A 4M9ZA 5EXXA 3UWKA 1R5NA 2J0UA 3CPHA 4ZDIA 2CXXA 1GRRA 1IJEA 5J47A 1XEFA 1F2UB 2FZ4A 3IO3A 1D2MA 2V8OA 1KSFX 2O8BA 4PZLA 4P4TA 1KK2A 5GVSA 1KMHA 4IXMA 1DAMA 1NN3A 5KDLA 1SVOA 4PX9A 1VMAA 3DL0A 1ZU5A 4GZMA 4QGGA 4JYCA 1G7SA 3SHFA 4V0KA 1OT3A 3MLEA 3W6PA 1E79A 4BLTA 3TVDA 3BFVA 1E9RA 2ONJA 5L3RA 2W2VA 2ZJ5A 3TLXA 3AVPA 1JEEA 3UPUA 1YRAA 2J7PD 3ZDQA 3KUDA 3T1TA 3RANA 2JIZA 1HT2E 2FEMA 1Z06A 4Q18A 3W8NA 1BYUA 3C5HA 1KJWA 4W5WA 4B47A 2ORIA 2XTZA 4CDGA 5DO9A 1ZC3A 2I3BA 1GRQA 1LV7A 1GITA 1YRBA 3Q85A 2QEQA 1RJ9B 3FMOB 5K8TA 1CJVC 3GLIE 4PQRA 4DEXA 5L3QA 1W4BA 1UEJA 4LHZA 1CJMA 1H8HA 3ZZ0A 1C9KA 2WM9B 4M1KA 4AYTA 1II8A 3R9IA 2CL6X 1MT0A 3BK7A 1Z08A 5JS8A 3ZVLA 4Q9JA 4OHWA 1N6PA 3OIYA 4C0QC 2WWGA 3BC1A 1NLZA 4IXNA 2PT7A 3FFBA 8OHMA 2DHRA 1UBEA 1R5OA 2DFKB 2NZJA 1E32A 4CF7A 4JZKA 4HLUC 3IBGA 3THYA 4C2UA 3CF2A 1KIMA 1ZYUA 2WWYA 1F6BA 1OW3B 2QP9X 2V1XA 4PPFA 1JXMA 4OHXA 4UNNA 5JJKA 4XD7D 2FX3A 5BXQC 1DE0A 4IOKA 4JBYA 1DO0A 2CL0X 4FMCF 4L9WA 3RSLA 4A6PA 1CS4C 4WA7A 5E95A 3O8DA 4URXR 3SQWA 4G5QA 3KZ1E 4II7A 1XMJA 5DNYB 3UKDA 5SZJA 1KZ7B 3FE2A 1G8YA 1W0KD 3LFUA 3I8XA 2ZRHA 4OI4A 4B2PA 4OQMA 5KOYA 2CCKA 2ZI5A 3SU8A 5D3QA 4D0GA 4MRSA 2RH5A 3RSOA 1U81A 1N6HA 1YU9A 4M9XA 3BFKA 2Q3FA 2WWWA 2RHDA 3CONA 3W3ZB 4IDPA 3ZIAD 4DLWA 2CE7A 2WIBA 4D4MA 4OK3A 1P4SA 4TMXA 4TYQA 4AI6A 1G7CA 1DARA 3L0OA 5JSZB 4XWAA 1CJTC 2V3CC 2FF7A 2ZRFA 4YXWD 3BIFA 4GP7A 1Z0DA 1DELA 1YQTA 4OHZA 2G88A 3KFVA 2YKGA 4LJ8A 1X8LA 1YZGA 1Z83A 4O2RA 4NH0A 1G41A 1N6IA 1X86B 3K0FB 1TEXA 1IY1A 3PR1A 3TSOA 3UK6A 1ZNWA 4Q66C 4RSGA 2NPIA 1R0WA 3VR6A 5DHAA 3GLIA 2J45A 1ZRHA 4EIWA 5DI3B 2P6RA 1S2MA 5IDVA 3UANA 4ZIRB 2BMEA 5CK4A 3KQLA 4IOJA 1KAOA 1OJLA 1TNDA 3LVRE 5FI0B 3ZVMA 1SVKA 2V55B 2VTKA 3LDAA 4PZZA 4R7ZA 4CEJB 4AURA 1F2TB 1NBMD 4IVPA 5JS7A 2FDCA 1AGPA 1YE8A 4QM6A 4AYWA 2QM7A 2ZYTX 5FPYA 1DEKA 1K6MA 3IQWA 1OXVA 2ZJYA 2IYZA 3T1QA 1XJQA 1G3IA 2QE7A 2E1RA 1E2EA 3HU3A 2EFDB 2VSFA 5K8IA 1A7JA 1NVUQ 2V1UA 3U7GA 4V0LA 3PCRB 3VX4A 2CMKA 5HKKD 3IPXA 3ECCA 3MWYW 1WP9A 2Q9CA 2ZSDA 4JYBA 2Q21A 3OEED 4WXRA 2GZDA 2O0KA 5L3VA 4RZ3A 1IY2A 4KYIB 1ZMXA 2ZANA 2WPDD 2ZJZA 4DUGD 4QNMA 3K70B 4NCJA 1HTWA 3A4MA 4W9MC 5A4JA 1GNQA 4TL6A 4WZAE 5JLJA 4ZPXA 2WOOA 1LVGA 3X2SA 2WBLC 3MSXA 5CB6A 3KDSE 2CE2X 4NU0A 3V4RA 1EFRD 1WMSA 5KUTA 3FKQA 5EP4A 3VR4A 5JMTA 1KKLA 3CR8A 4X8MA 1KO7A 4Y0AA 2BMDA 3QKRB 2MSEB 4A92A 4OQNA 1KO4A 1OYYA 4ARZA 4JLOA 3U61B 1KK0A 3NVAA 3QXCA 1E1QA 2RAPA 4UNQA 2FGJA 5EP3A 1KO5A 3U7FB 3GLGB 4TQUS 2FH5B 3AH8A 4MGKR 3AKDA 1Z0AA 1GRNA 4EKDA 2IW3A 4TLAA 1O87A 1G3MA 4BEJA 5C4MA 5DN6A 3ADCA 4AKGA 3CM0A 1XCGB 4LSGA 1CJKC 3SFZA 4A4DA 5CK5A 4B3DA 1ZCAA 4GSYA 4KFRA 3ZH9B 2Z5FA 1UFQA 4OJKA 5DH9A 1QHHB 3KQHA 3SJCA 2ZI6A 3TSZA 1G9XA 3JVVA 2GBLA 3C14C 1N6KA 2GXQA 1COWD 1GTVA 4J0QA 1WXQA 3EC1A 3QF4A 3OEHA 1A82A 4MGZR 4BFVA 1LFDB 4XVRA 1XMVA 4P3YA 1S3GA 2G1JA 5KTYA 4OYHA 3CIOA 3P32A 4OHVA 3CRQA 4JJZA 5E4FA 4HI0E 4E03A 4Q1FA 2HJGA 1UADA 5L8VA 5KPDA 1U98A 1W1WA 2VP9A 2PMKA 3ZZTA 1NP6A 2ZPTX 1YVDA 3W6NA 1HQYE 4D81A 1Z28A 3ZQ6A 3VKGA 4HB0A 3IDQA 5JEDA 4TT3D 2F3RA 2J5XA 1Q21A 4RZUA 1C4OA 3K0CC 1MO5A 2XNDA 2P2LA 4OBEA 1W44A 4TZ6A 2V9PA 3NC0C 4DLUA 4ASUD 4TZ0A 1AJEA 4JKIA 2ORVA 3BB3A 5FFMA 2DR3A 2EU8A 2OILA 2BCGY 1KTVA 3I32A 3LW7A 1CTQA 2GJKA 4PANA 4B74A 3U6BA 3PFIA 5EE9A 4P0TA 2WHXA 3EARA 3HJNA 1F2UA 2OG2A 4UQOA 1G6OA 2IX3A 1RRFA 3AVQA 4GMDA 4EJSC 3TW8B 2D7DA 4URUR 2CCGA 4B71A 5D3MB 2G83A 4C7OB 1XRJA 1P6XA 2I4IA 3RRNA 4FWIB 3ZGXA 2KJQA 3PUVA 1NJGA 3W5IA 3EPJA 2KBEA 2ZU6A 1QHSA 3KJIA 1KNQA 1G21E 3OFNA 4D4KA 1V5WA 1Q20A 4JIMA 3CF0A 3NBXX 1U8AA 2F43B 2J41A 5ELXA 4M1MA 2YC2C 2FN4A 5E7JA 1WCV1 2ZJAA 1JEDA 1NSTA 4LV6A 1N5KA 3CRW1 1II0A 5IT5A 2WWFA 1RJ9A 1ZP6A 1NNEA 3W9YA 2XX3A 2J46A 3K09A 1G4UR 2RGGA 1AGRA 3B85A 1E0SA 3TKLA 4MUBA 3OE7A 4CEHB 2ZRCA 1JXOA 3I5YA 2GWHA 1Z6GA 1E9SA 4JMPA 3EZ7A 5CM8B 1XJCA 2GA8A 1G18A 1ZBDA 2HJVA 3VR5A 1GOTA 1E98A 1KK3A 2YOGA 2IT1A 1MOZA 1GAJA 1OH8A 5CYOA 3B6EA 5JFGA 3CRMA 4IOMA 2B7CA 1LY1A 1N6OA 2LCFA 3UMSA 4JVNA 1DBSA 4CT4B 1Z6YA 3K8YA 1HE8B 1GWNA 3PJRA 4QBGB 2XSZA 4ZCIA 2BIFA 4F4IA 4A8JB 5DIFA 2WOJA 1J7KA 4P4SB 3TR5A 4B75A 1E3MA 3HU1A 3I1FA 3LWNA 3BERA 4S2EA 1FNMA 1VYVA 2QAGC 1L4UA 2QSZA 4BGDA 4NTZA 4TSFD 3MG9A 2D06A 4LBVA 4YQFA 4C3ZA 1NKTA 1DPFA 4RKEA 3IBYA 4C0HA 3P4YA 1FUKA 1LF5A 5FR2A 3ZYCA 4WIAA 2W2XA 2ODNA 4EPXA 1UPTA 2AN9A 3BH0A 2OHFA 1EWRA 3ADDA 2VP5A 3QUSA 4KITB 5BYKA 1G8HA 4JBWA 3U4QA 4DRZA 1SVMA 3KFXA 4FWTA 2OV2A 3R7WA 3ASYA 4UNSA 3MJRA 4MKIA 4HB4A 2E87A 2JATA 4BEBA 4GNKA 2A78A 2PZGA 2PMDA 2ZVQX 1KI7A 1W2HA 3LV8A 2VF7A 1G20E 1CLUA 1HEIA 3D7MA 3KQUA 4PC1A 2ZE7A 2ZE8A 4OL0A 5FBQB 1J2JA 1PUJA 3RWOA 1YR6A 1JAHA 2Z43A 1H8ED 4TMZA 3VR3A 3AVUA 1SVSA 2RGNC 2VYFA 2ZYUX 2SHKA 3LNCA 1E6CA 3B1ZA 1JQJC 4LX0A 4CEJA 1ZIOA 5AJVB 4IJMA 1XX6A 4HZIA 2ZVPX 3D3QA 2KSQA 4DB2A 2X19A 4D6PA 1U94A 2EQBA 5GADl 1W47A 2CVHA 2O52A 4DSTA 2FSGA 2EW1A 2QMEA 3KJHA 5FUWA 4UNRA 2ZRDA 3D31A 3GP8A 1MABB 1BH2A 5FBRB 4URYR 2QAGA 1UF9A 3QVUA 5JI2E 3EPLA 3T1VA 1IM2A 1J8YF 1G3QA 1NKSA 1XEXA 3KKPA 1RRCA 1CBUA 1P9RA 2ZRAA 1JPJA 2K5UA 5M04A 4B6FA 1AKYA 1ANKA 4RD0A 3P4XA 1ONBA 3QXHA 2PX3A 3QVVA 5EUMA 1NMZA 3AEZA 3M4YA 3UG7A 3WNDA 1N6RA 2FGKA 1U0JA 2GAOA 1QG4A 2R6CA 1XNJA 2J1LA 4KLZA 4DSNA 2KI5A 2ZRBA 3KUCA 4LYAA 3WYGA 3LLUA 3GEIA 1B0UA 2XJ9A 3K9NA 4DJTA 3HR8A 3WNCA 4PSVA 1QHGA 1D8TA 1EK0A 1XWIA 1FP7A 1BIFA 2QN6A 3QF7A 2ANCA 1NL3A 3H1TA 1IN7A 4TYNA 2BHRA 2FZLA 1KI4A 3T61A 4KO8A 1G3UA 2CK3A 4IVQA 2XTMA 1MH1A 4LC1A 1N5JA 3BE4A 4HAWA 4B3CA 3ZS9A 2HCJB 1E4VA 5JHGB 1CKEA 1J8MF 5B57C 1LS6A 3VFDA 4C0JA 2OEPA 3KKNA 5JZVA 4IDHA 2VSXA 2H1LA 5CB8A 4G3XA 2O8FA 1G1MA 4PAMA 4HAXA 5IHPA 4NYMR 4TLEA 4DHEA 4O3MA 2QT1A 3NBFA 2N46A 2CDNA 2NO6A 4RKFA 1OHHA 2WIAA 4RD4A 4I1OA 3GMTA 1CF4A 1E2HA 1IQPA 1W48A 4R98A 2FPMA 2NGRA 3K9GA 1G17A 4BFUA 2BDTA 4TTRA 5HCIA 3ZVNA 2ATXA 2QQ0A 3TVTA 1VECA 1RRPA 3TJZA 2R6GA 4BLSA 1TQ6A 1D9ZA 4D4LA 4M9QA 2GHIA 2H18A 4L15A 1XJ0A 2HYIC 3L0SA 2OCPA 3SS8A 2IS2A 4B34A 2ZRKA 4YDSA 4N0EA 4JJKA 2P6NA 3SHWA 3M0EA 5FPSA 1EWQA 4M1OA 2PZFA 4FMDF 3SJZA 4QG7A 5EJEA 4CZ2A 1SXJD 2WSSD 4GOKA 2IYLD 1A5TA 2QG6A 1E9AA 2C77A 1NF3A 2NG1A 3D6TB 3FGNA 1W0JD 2GJAA 3BD9A 4BFTA 2G77B 1KNXA 2UZ3A 2VBCA 1S9HA 2ZU0C 2C5LA 5KSOA 3K0EA 3QSYA 3GQBA 3R9WA 4PTLA 2VIIA 4DT1B 2IUTA 2F1RA 4DB4A 4O0MA 4TMTA 3PEWA 4XOIA 3AF4A 1XTRA 1FL9A 4AWXA 1GL9B 2FFBA 4KSBA 1QVAA 3U7EB 2F43A 3LVQE 2CHQA 1TF5A 1XP8A 4UXJA 1NVWQ 4EPWA 4CEIB 2PL3A 4C0KA 3DEFA 2GESA 2AFIE 1D5CA 2KB0A 1Z47A 3PVSA 4RD6A 2G3YA 1CR2A 3EZFA 5JBQA 2CJWA 2ZR0A 3F0TA 1XXHE 2ZEJA 1DG1G 1CR4A 1KI3A 4R71A 1K5DA 3QEJA 4S35A 3VTKA 3A1UA 4TYWA 3GLHB 3CRVA 5J4KA 2WSMA 4C0LA 3PENA 3UWOA 4M8NE 1RYHA 1E79D 2GKSA 1G7TA 2HLDA 2ZETA 1NY5A 3DDCA 4CRWB 2ERXA 3H2YA 3ZJYA 3RABA 2RB4A 2OFXA 1P2UA 5CJ2A 1U9IA 1XCPA 2JIZD 2W00A 2O5VA 1IAQA 1R0ZA 2GCOA 2J59A 3MMPA 3EIQA 4B6EA 3W34A 1OB2A 3CX6A 4CVNA 2OO7A 5BN4A 3NC1C 1Z07A 4B33A 5GJWC 5F98A 4KAXA 3TSWA 3GLFB 5AUPB 3BB1A 1KMQA 4XJXA 3UXMA 1ESNA 4U7DA 2QMUA 5JECA 2O8CB 2GXAA 1H8HD 1R8QA 3QNUA 4YONB 1XEWY 4A8JA 1MKYA 2F9LA 4F4JA 3B13B 1DAHA 3KXKA 1E2LA 4MYTA 4RFVA 1NN5A 2FE4A 3L43A 2OLJA 2ZRMA 1WF3A 4JT4A 1FQKA 4U00A 4Q4JB 4ZI2A 2HT1A 3K0AB 2P5TB 2DFTA 3WMEA 1P5ZB 1UM8A 4JLPA 4BFSA 3F5FA 2ZRPA 1NIJA 1Q22A 2BM1A 3ZZUA 3IO5A 1W7AA 1TU4A 2D74A 2WKQA 1OF1A 2PCJA 3PEYA 1N5IA 3DKVA 2NO1A 2ZTSA 4U5XA 4DDWA 3DOFA 4GT1A 4OKSA 4C0SA 4JVSB 1E2NA 3NEJA 1XD8A 1E96A 2JGNA 3AKCA 3I61A 2EFHB 1XTJA 2YOFA 4AIIA 2AWNA 2OUKA 2QROA 2X2EA 1U0HC 2KBFA 3WHLA 3N5CA 1QHYA 1KYIA 4ZV4A 1VIYA 1Z22A 1XXHA 1BKDR 4NYMQ 4RY2A 4W5JA 2FEOA 2ZREA 1UKEA 1KO1A 3NWJA 2D62A 1LTQA 1T3SA 1R7RA 5UKDA 3JZMA 2G9NA 2XNSA 2VHUA 3CNOA 2AHOA 1XFAA 4M1WA 2RMKA 1T8TA 4YMWA 1R10A 1BMFA 3A1SA 4DCVA 2HXSA 1VCIA 3V9PA 3FDIA 2GCNA 3VKWA 4XWKA 2ZS7A 3BH7A 5J40A 3NBYC 4Q9IA 1P61B 2AK2A 1Q3TA 3BXZA 3HWSA 3B5JA 3REFA 1L8QA 1US8B 1ZU4A 4NCHA 1CP2A 4MYUA 2C9YA 1U8ZA 1RRGA 2RCNA 2WKRA 2X2FA 2DWQA 1Z2AA 2FMXA 2R6AA 2GK6A 4L16A 1LF0A 3TK1A 1GNRA 3SYKA 3RS2A 3C5CA 3T12A 2GNOA 4XH9B 1L4YA 1N0UA 3VR1A 5CIQA 1WBBA 4LHWA 2A5FA 3AVXA 2F9MA 3SQXA 4EFNA 3Q5DA 1T3HA 1X8JA 2XTNA 2R2AA 3T15A 4C2TA 2QE7D 3E5HA 1XPRA 3R20A 2WVJA 4P31A 5KHOC 5CITA 1ZUIA 2QENA 5FPHA 4D4JA 1AIPA 4CT5A 5EXSA 2QT0A 1WQ1R 3RS0A 1Q44A 1CJUC 2OESA 3MCAA 3M1IA 4YC7A 2YC4C 4DCUA 2VP4A 4DXAA 4YDHB 4ZCMA 1K8RA 1OYWA 3FB4A 4GPTA 2QU8A 2EWWA 4Q7MB 2IWRA 4LI0A 4KBGA 2GK7A 4HAUA 4D82A 2DY1A 2XJ4A 4LCBA 2HF9A 1DG3A 2N1BA 3WYFA 3GJ5A 4JLDA 4IW3B 3U7HB 1Z29A 5EQTA 3THXA 1W5TA 3NG1A 1NG1A 4XVQA 4NCIA 3NHBA 4G5SA 4HB3A 3VNVA 4EQ6B 4I81A 4JLBA 1RYFA 4NP6A 4ZDWA 1E1QD 2C2HA 1Q12A 1ZNXA 3GLHE 4D25A 2NZ8A 4BE7B 4EPRA 5E7IA 1B23P 3BRWD 5DN6D 2WJIA 3PUWA 5IF9A 5HCNA 2WWIA 5BWMA 2IYSA 4GDFA 4PHTA 2YV5A 1XF9A 1SHZA 2OXRA 3PV0A 3U44B 4XVUA 1RIFA 5LBIA 1WA5A 2WAXA 5FR1A 4QHYA 2PBRA 1SKYB 2JA1A 2ZYWX 2RKOA 4JVMA 1UBFA 4PHFA 1E0JA 1Y63A 4P4UA 421PA 3OEHD 2IA5A 4GP6A 4EDHA 3PQCA 4JVLA 4B44A 3I8SA 4LV8B 3AM1A 2HV8A 1G5PA 4AG6A 4K81B 3TGPA 5FTMA 2JJ8A 1QHIA 2ZRGA 3ICEA 4M2LA 4MRVA 2A30A 4I4LA 2P3SA 1EFCA 3EWAA 2GBLC 4MRRA 4NONA 2VA8A 1I4LD 4TLDA 1N3BA 3RS4A 4Q4HB 4ON9A 4DBLC 2O8EB 3SR0A 2A2ZA 2V4ZA 1P3JA 3DMNA 2XGJA 4OK6A 4Q01A 4Q7JB 4Z1MA 2C98A 1KI6B 2XNDD 4W7SA 3Q3JB 1AM4D 2QAJA 3LAWA 2V7QA 2KWIA 3EASA 4CGZA 4LDJA 2F6RA 2Q0HA 2C78A 3Q5EA 4B3XA 3LXRA 2FU5C 5EUQB 3FKSA 1SULA 2WJYA 1N25A 4RFSA 4IKEA 4N3NA 1PLKA 3W5JA 3QPUA 1Q57A 2V6IA 2XB2A 4PXAA 4LV5B 1S8FA 1TEVA 2MMGA 4A6XA 4IRUB 3SJAA 2ZR7A 3GLHA 4GOXA 3AGQA 4LWZA 4NDZA 4B43A 2O8DB 2XXAA 2ZAOA 4MRPA 4BECA 4KYUA 4LJ5A 1CEEA 2QY9A 4M1YA 3OFND 3RLFA 3O8CA 2AR7A 5FTJA 4IOLA 4A2WA 3C15C 3AF2A 5A0FA 1TU3A 2PJRA 4LJ9A 3T1OA 4OI1A 1FW6A 2BBWA 2XOKD 1QG2A 2GILA 5FH9A 2P0EA 3MRSA 1QZXA 1VHLA 2IXGA 1HY3A 1IXZA 3LQRA 2R8RA 2YNMA 3HR7A 2JLRA 1G8PA 3WXMA 2REXB 2WTUA 3OE7D 4HLDA 2C8VA 2JCSA 3NXSA 3FTQA 4FI3C 3HPQA 3ZQJA 4DLYA 3ICQB 2XZOA 1T0JB 2NMVA 4QM7A 3I73A 3EA5A 1U8YA 1W4RA 1OH7A 1M8PA 1YZQA 5DISB 3DOEA 5IK2A 5LD2C 1D2NA 2B6HA 3SBEA 2Q9AA 3IEVA 1XZQA 3VU9B 4N1AA 1UKYA 3VNUA 3K09C 3NTUA 4ERNA 2FJUA 4NMMA 1OV4A 4Q9LA 4G5GA 2XSZD 4BLRA 2QMHA 1GDDA 5TXGA 5C2JB 2C95A 1XBTA 2A7QA 2XAUA 4HATA 2ECKA 2WZQA 3EZ9A 3U3MA 3A4NA 3U3JA 4KXFB 3FHOA 2EFEB 3LW8A 3L0PA 1JI0A 1DOAA 1OXTA 1NG9A 4YMUA 1G3RA 1C1YA 3DM5A 2OBLA 1N5LA 5BW8A 4ABYA 4E5UA 3GJ3A 3TW4A 4L5BA 1CIPA 4MQBA 4OQXA 3LBNA 4LJ7A 4WZ6A 5KO2A 2GEDA 2IC5A 1IHUA 3LRPA 1T3LA 3TQFA 2BKEA 1QHXA 1E2MA 3SJBA 3TE6A 2WJJA 3Q7PA 1TF7A 4WOPA 1NJFA 3RRZA 2BJWA 3J81k 1TUIA 3FHCB 2B92A 1OSNA 4TWZA 4LBYA 4L4UA 4BRWA 1Z0FA 2QPAA 4M22A 1TPZA 4HUQB 1D9XA 4QL3A 5EE1A 4PO8A 1CRPA 2AL7A 4PO9A 3VMFA 1TUEA 1UKVY 3T5DA 1W49A 2C04A 4B3FX 1ZD8A 2XOKA 2FFQA 3AP3A 1A4RA 1IJFA 3ZD7A 1ZNYA 3MFYA 4YLGA 3C7KA 4G5RA 2L0XA 4YMTA 4G1UC 2ZUDA 5HZHA 1F5NA 1XMSA 4Q4AB 2WMNB 5FOUA 5AJYA 5KPJA 3TAHA 2AFHE 2AXNA 2ERYA 3DO6A 1W46A 4Z54A 3AUXA 2IUSA 3KKQA 1XEWX 4HZUB 4TQAA 1LNZA 3AF3A 2WV9A 1XD2B 4Z51A 4ZDJA 4PO1A 4LHVA 1N2CE 3GPLA 4MUAA 1JAIA 3OAAA 4Q9HA 4M53A 4NPHA 4NKRA 5JI3E 1QDEA 1VHTA 2IYUA 2PH1A 2GZHA 1QHNA 2BBTA 2DBYA 5DLQC 4BZXA 5G3YA 3PUYA 4F38A 1X1SA 5KDDA 3B1YA 2VP6A 4KFTA 4TL9A 4ESHA 2EFCB 1G7RA 3C8UA 3U6KA 1YZUA 1ZINA 2VHTA 4TTQA 4UNPA 1G64A 1WDTA 2VO1A 3BS4A 1Z6XA 3FMFA 3MWLA 1E9EA 2ZJBA 4P32A 4D0LB 3E70C 4HAYA 1Z8FA 1NSFA 4LPSA 1GUAA 1CRQA 4HLQB 3KXIA 5FUVA 3QXXA 4UXHA 2QUZA 3K70C 3CR7A 1GSIA 3BORA 1FMLA 1R8SA 1VKJA 2ATVA 2IYQA 2DB3A 4HLCA 2CK3D 2W6JA 1GKIA 2Q6TA 5FL7A 5BN5A 5F3WB 4AG5A 4A36A 1PVOA 1JJ7A 4WAUA 3LY5A 4M1SA 1FQJA 1X6VA 4BFXA 3NHAA 2ZRLA 4FCWA 5JSZA 2BJVA 1KK1A 2WJHA 4OHYA 1IXSB 2OSBA 2QNRA 1AZTA 4U02A 5SZHB 3GLGE 2CCJA 1KDTA 2QA5A 1EFTA 2ONKA 3K0FA 4Q02A 5TVKA 3QQ5A 4C4PA 1I4TD 2QI9C 1PLJA 1UDWA 4JS0A 4QOSA 4AC9A 4OK5A 3G5UA 1SXJB 2QORA 5DI3A 5G53C 5H8WA 1EFHA 1QF9A 5L3SB 4KFSA 4ZIRA 4JSTA 5KDOA 2ODWA 2H17A 1OHHD 1P9NA 3BGWA 4A82A 3QKSB 2QP4A 2GAAA 1ZD1A 3LX8A 4DEYA 1F2TA 3SFVA 2OXCA 4H1VA 1Q1EA 1RZ3A 1TADA 4AKHA 3KTAB 1XMIA 2HT6A 2IYYA 2A3RA 1GL6A 2C9OA 4WW0A 3WRXC 2O8EA 2VP2A 2AKYA 3BB4A 2JLYA 3ETLA 5JRJA 4QJ3A 4LK2A 3B60A 1WE2A 4JBXA 1G19A 2J0UB 3F3YA 3KKOA 3EZ6A 1I4DD 1OKKA 2BKUA 3O8BA 4EAQA 3GFTA 4MDEA 4V02A 3KJEA 2ZRIA 4GRAA 2O8BB 3QKUA 1W4CA 1P75A 4BFYA 2CHGA 2ZJOA 3TBKA 4I99A 3P20A 2B21A 1ESMA 2Q9BA 4RZXA 821PA 2BMFA 1W2GA 1MO6A 2OT3B 1XTIA 4LC0A 1J70A 2IEZA 1G6HA 1KJZA 3OF5A 3EA0A 4ZKEA 3ONWA 2XZLA 4LYJA 1ZM9A 3P1JA 5B2ZA 5EP2A 3U5ZB 1W36D 4TL8A 2O8DA 4K8OA 1GP2A 3QKRA 1AS0A 1E9BA 2X8AA 3P26A 2CBZA 221PA 2CLCX 5ANRB 3AF0A 2W0SA 4FN5A 4W5HA 2VRWA 4O25A 3DKPA 1IN4A 2BVNA 1S96A 3GJ8A 3GLGA 3OIWA 4GMXA 4MH0R 1IN5A 1NN1A 4QGHA 3I5XA 3QBTA 4ILEA 4EPYA 2ORWA 1S9DA 1W36C 4MDFA 1XDBA 1II8B 4M9SA 3AQ4A 1DTSA 3CWZA 2IS1A 1HH4A 2IYWA 2W6IA 1JNYA 3F8TA 1QHHA 4C9BA 5FTKA 5KNCA 3PITA 2QZ4A 1Z6TA 5AK0A 4C0AC 2H5EA 5B30A 5FBVB 3VKHA 4WBSA 2JLZA 3THYB 2HLDD 1AKEA 3QBVA 1F3OA 2LWIA 4Z8YA 1YZNA 2W0MA 1P2VA 1JJVA 2VSOA 3RRYA 1F60A 3ND8A 3CPEA 3VU9A 3BAFA 2GVZC 4E09A 1ZAKA 4NCKA 2PLRA 2QMOA 2ZI9A 3IIJA 4YMSA 2QSYA 1VCMA 4X8OA 5C18A 5FUYA 3EPHA 3CUEF 5AUNB 3FHTA 2B8TA 2ODEA 2OFOA 3QENA 3SN6A 3REGA 4UJ3A 1IN8A 3U3KA 2C99A 3VHXA 1KI2A 3CB4A 1LS1A 1U9IC 4PHGA 5C1BA 1K5GA 5BN3A 2YOHA 4XTRA 1EFUA 2MSCB 4JL6A 1VG9B 1S4QA 1R5BA 2IXEA 3NH6A 5DYIA 1Z63A 2ZSEA 3VX3A 2D7CA 5GJVC 4IEIA 4A8JC 1MO4A 2IYRA
chains in the Genus database with same CATH superfamily
4KN9S 1Y37A 3SDSA 5KOJB 1QVRA 2PJDA 4YRGA 3IAUA 4FFLA 1T9HA 3PZBA 1SXGA 3GDFA 5C8DA 1VC2A 3C1OA 2HD4A 1MTZA 1RXCA 3O47A 3MCVA 4K6GA 2FEWB 5I8PA 4FINA 2FUG6 2XMPA 3BA6A 3O26A 1T5HX 2PCLA 2XWBF 1WZUA 4G01B 4I4TF 3W0LB 2FSHA 1FMJA 1OLXB 2NIPA 2JZOA 3H2HA 1DT5A 2VPPA 4JC8A 4S12A 2UZ1B 1X7YA 3K73O 5EXDA 1AZLA 2NPFA 3OQVA 3SMVA 3VOSA 3DV0B 2XKJE 1EEHA 3IDOA 1C14A 3A9TA 1LWOA 3VGPA 4DIDA 1K4KA 2CFIA 5AW7A 1PT7A 2VF5X 3WGUA 4KR9A 5H68A 3IAFA 1BMFD 3HH8A 4FGJA 3O7MA 4WNCA 3DP7A 4MLZA 5A7FA 1SCIA 1ZCBA 1UK6A 1NBEA 4L6IA 3GRYA 5FD8A 4DNXA 1JA9A 4PSCA 2Z9DA 2QTCA 1RJDA 1BMDA 3MMZA 1IVNA 2GM5A 5I9NA 4G0PA 4NATA 3ER8A 3PFHA 1JG1A 4J9VA 3WIDA 1EFKA 1XD2A 3ZJUA 3N1UA 1CDEA 2PEZA 1E1KA 4FD3A 5COBA 4ZO7A 3I6ZA 3WMFA 3JQEA 1Y5MA 2YMPA 4P82A 1OROA 2I8LA 5LBTA 1ZEMA 4C0XA 3U7HB 2YXNA 4WKOA 3ZZ0A 5CVCA 2NXEA 4ND1A 3NI2A 1CS0B 3TDNA 3L7DA 2H08A 1YKGA 4UREA 1NT4A 3Q72A 1HDEA 4NECA 3CLUD 3THWB 2H4ZA 1D6NA 1NXWA 2YFHA 3GEGA 3COSA 3HCWA 6REQB 2FR0A 1HYEA 4BN5A 5HSGA 1BVHA 4H7PA 4Y2VA 1VPTA 4OQZA 10MHA 5E0OA 2FR8A 3RVOA 2CNWA 2VK4A 3R6GA 4WCDA 2AKEA 2RGRA 4S04A 1ISMA 1SVIA 4QOHA 5HTKA 1FFGA 1QIFA 1ECCA 3VDQA 3WYBA 1WW2A 3DZ8A 4WACA 4KVAA 4IVNA 5LP6F 4AU1A 1XE3A 2O2DA 1A2BA 4RCYA 1YCDA 1DP4A 5BP7A 4K3UA 3S55A 2ZDQA 4QC2A 1B26A 3PC3A 1OXXK 3L82B 4ZGWA 3TTXA 3RRJA 3I92A 4QICA 3NGXA 1PTJC 1ZNZA 1T8UA 4IUCS 2Q3LA 5D5HA 2E6UX 3K5IA 3NRJA 2EGGA 4BU0A 3COJA 1BXRA 1KERA 3VH2A 3KAKA 1DRJA 2PD3A 2JJ1A 3ISVA 4YRTA 4D8XA 2PUAA 5JCZA 3NYRA 4F4CA 2NACA 1VE6A 1QGUA 1YR9A 2QW1A 3M7IA 3NM6B 4D6YA 3KQOA 4DLZA 3KB6A 3BMOB 3G2IA 4CQLB 1CXZA 3AP1A 2AMVA 3FRJA 3RAPR 4B3BA 4F3NA 3IDZA 4P1ZA 4L75A 4X1YB 3L2OB 5I4IA 4MSUA 1CJSA 2H1OA 1I2DA 2CHUA 3ODGA 4JKOA 3B51X 4M1TA 2XF8A 1LRJA 1RTKA 1LZKA 1FA9A 1WB5A 2TSYB 4RD1A 1VIMA 4YJKA 3MJTA 5EXPA 1JBKA 2EG5A 3Q7QA 1G4AE 2CGEA 1C1DA 3WMGA 2HYDA 3E53A 4KWEA 2WT9A 4QIHA 5AKZA 5ECDA 2K2WA 4BWYA 4EUEA 3ADKA 1YFLA 2BKAA 4G81A 3DBOB 5KYUA 6GPBA 5AW6A 2R4TA 5IJ0A 4ML3A 1PNVA 3F5SA 1U9JA 4NOKA 1FXUA 2PUGA 4CKYA 1BFUA 1F12A 4PAOA 4WZAB 2IY8A 4DVGA 4I9NA 2XKKA 4IHJF 4MI9A 5FUXA 5MGBA 5I48A 2C7PA 1GPDG 1D3AA 1J90A 5EJMA 1U8FO 2KYRA 3DOCA 4PN3A 5CA1A 3GVIA 3JARA 1Z4KA 4FIDA 4AJPA 4C43A 3NIBA 2FFJA 4KVGA 4WLUA 2QZ9A 2WKPA 3V1LA 3VQTA 4BASA 1X19A 2E21A 2QRNA 3D8NA 1FLVA 4KE8A 4MYRA 1IPEA 3CX7A 3F4LA 3G2KA 4ZAWA 3SKVA 1BRTA 3HI6A 1FFXB 1FP6A 1G60A 1KSJA 1NPTO 4KX5A 5K0TA 2Y8EA 3CV3A 4NK5A 3RF7A 4Q21A 2VNJA 4K46A 1LFAA 1ORDA 2VPXA 4EYQA 1J9ZA 3HSKA 1BQEA 2AF3C 2GTPA 5IMSA 2HEIA 3FG9A 3S7TA 2QM8A 2A5JA 2OAEA 3H9QA 1POWA 4FZ5A 4LMAA 3I42A 4YP7A 2X5OA 1QOQB 3WDLA 1ZJJA 2R5WA 3AEQB 3OTGA 1KWKA 4O4IF 3UVEA 4ZCLA 3HP1A 4D9EA 1Z7GA 3OEYA 4BBZA 2EKPA 2UUOA 3KD3A 2RGDA 1DS6A 3ROZA 1ZXLA 4Z1OA 5K8UA 3UQZA 4Z4QA 4EI9A 3DE3X 3K1AB 4LJ6A 3L6UA 3TNDA 5JEEA 3OQMA 1K0FA 1BXKA 1Y9AA 3A6JA 5CM2Z 2BD0A 3QE2A 1P3DA 1YULA 5H7XA 3ZOKA 4A0GA 1OY1A 4UM8B 1F06A 5CM9C 1NBOA 1ULBA 2PGIA 4Y2SA 3FKSD 4GE0A 1AVTA 5JHHB 1WB9A 2DC1A 2PT5A 2ZWVA 2X15A 2QTNA 4J76A 1VDZA 4COOA 4GXRA 4BN4A 2R9VA 4NNPA 3U60B 2WPNA 2IKQA 4QASA 2QI9F 4UEOA 1QZUA 3G0GA 3SC3A 4RJIA 2LCIA 4Y98A 5KX5F 5L6LB 2H5JA 3ZY3A 1XPOA 2QVZX 3H19A 4HNVA 3WA7A 1JJFA 3H5RA 5DXFA 1OLOA 4IEEA 3DJFA 4NZ9A 1P1IA 3IOCA 3T5MA 5IXJA 2B1GA 1WXEA 1YIDA 4MI6A 3UAWA 1CUZA 1NFRA 3S6JA 3GEMA 1NIPA 2H3HA 3WWYA 2M6SA 3GR6A 1I4OA 4R0VA 5HX7A 3JU3A 4BV8A 3VPSA 2VF8A 5A05A 5M2QA 1OXSC 2GF9A 2BGRA 2X7HA 2MYTA 3UENA 1AKQA 4A1FA 4D74A 3EXAA 1QQ5A 2X8JB 4IQ0A 3T0GA 3UAVA 1SU8A 2X8BA 4ALJA 3TJMA 4EJSB 3O73A 4KBFA 4TS9A 5ULLA 3LD9A 5CDYA 3PX2A 4PPGA 3D5EA 3GJXC 4JWKA 2PWBA 4KPGA 4LTMA 5FPTA 3ZCUA 1IM5A 4J1QA 4J16C 1D4FA 1SCBA 2JASA 2O7RA 4AULA 2Q1WA 2X14A 5LCXA 3DNMA 5IYZA 4B3TB 3KR1A 4B82A 2H92A 3CNNA 5EMKA 2H9IA 4RANA 5SZKB 1GNPA 5A5VA 4NBLA 1UBUS 1V1RA 5IK2D 4RAQA 4JU8A 4FHZA 5BYJA 2VJKA 4KE7A 5GONA 1Y7PA 1YB7A 2YWFA 3PDJA 1BTOA 1IFXA 1C4KA 3N87A 4HYQA 1KKMA 4CKBB 3U4QB 4AY3A 3IQXA 2FK8A 5EHQA 4BNWA 2ZJ2A 4E31A 3DFUA 1DSSG 4PSAA 1NVVQ 1L5ZA 1NMQA 1E4EB 2G1KA 3A58B 3GEPA 3KSUA 4IF4A 2GA9A 3I9KA 2FQ1A 3TRJA 2FOLA 3EWNA 4UVDA 3TWOA 4E5VA 3T06B 2J32A 5T8KC 2YV3A 1VIAA 3RJTA 4XPIB 4I6GA 5NLLA 1VYTA 3OESA 5K0EA 3OX3A 4YBZA 1Y98A 4ZYVA 1MO3A 3IODA 4GI1A 5CVDA 1UBGA 2HMWA 4G23A 2HU5A 2J67A 2PX4A 4G8DA 2OBMA 1U2TA 2ZITA 3FMPB 4AZSA 3LHSA 4DM3A 2YW9A 1UXJA 2XUGA 1V8OA 1HYGA 1XVVA 2JFYA 2NPOA 2VSYA 3DE5X 1AGYA 3IESA 1XZKA 3T0IA 5HPYB 1UJ4A 4M55A 3DVQX 1GLGA 2OOSA 5KYKA 1U4NA 3UK0A 3IPAA 4R68A 4TUYF 4FB5A 4JC5A 5L40A 5MN5A 1ORWA 2WILA 4TVKA 1GZ6A 2PBLA 4JI0B 3EC2A 3SC2A 1P80A 3TMKA 2BRUA 2OV6A 1TCAA 2Q4OA 1YZTA 3NUZA 4IG4A 3LH5A 3BBLA 4CR6A 1JP7A 1Z3CA 5LL6P 3HCPA 3JQFC 5FKJA 3CUKA 2I91A 1ZRNA 1NBME 3QYAA 4BNIA 4W9RA 2FF5A 3PIRA 4Q48A 4MITA 1V4NA 1NRWA 3NHFA 3ZCVA 2ETXA 4FE7A 1L7BA 2EQAA 4RF5A 4I3HA 5EMMA 4ZCRA 4E11A 1BYIA 3FDJA 3AMVA 3N2ZB 3AK4A 1F8YA 2YHIA 1RYMA 3QEBZ 3PWKA 4JYAB 2P9EA 1V9SA 3PFNA 1DAIA 1XU7A 3EPRA 4FSXA 1GZHB 4YECA 1N1MA 3TUZC 3FNQA 2D8AA 4AKSA 5EA2A 4RMJA 5HRUA 2HRQA 4WXEA 4PLPA 5JDIC 1NQUA 4NG5A 4JJ8A 4AO8A 3MTJA 2HU8A 4G0YA 4KWIA 4X24A 4NEHB 1CQPA 2GGSA 3QWHA 3GVHA 3C41J 4KIGA 3C3XA 2K7FA 3WLJA 1HL3A 1SOUA 2IP4A 3WK7A 3ZWMA 1BDJA 4EDFA 4DR2B 4Y2QA 2NV0A 3HJUA 2QBYA 5EE3A 2ZYVX 3TX2A 5TNXA 5EIFA 3IT0A 3F4BA 2C3PA 3N76A 3NORA 4MW5A 4KYVA 3LUHA 2XBUA 3BCUA 3PUZA 4Q4JA 3K0AA 2B35A 4H0NA 5DBFA 5DSZA 1YZKA 4LUCA 1HQDA 2O3JA 3O94A 2AR9A 1XALA 1KDOA 3T7AA 3V8PA 3R0XA 3P71T 1KU0A 4KLRA 2VDMB 2O07A 2ZKLA 2FP4B 3IQHX 2R1VB 3CWQA 4D80A 2H7YA 2I87A 4WZBE 3NOOA 4U0JA 5B7QA 4HDNA 2DWPA 3R3UA 3ESBA 3HWWA 5COAA 3ITEA 5FL3A 5I9TA 3DH0A 3PGA1 5BNFA 4DCGA 4YAKA 2FSPA 4ALNA 3FNRA 4MZDA 1Z36A 4ZQFA 2H1RA 4F92B 2KPOA 4X60A 4ER5A 1WKVA 2HDNB 3OKAA 5CLQA 2O8FB 4H1HA 3JXEA 3D7SA 1M6YA 4HQ0A 4YMIA 2XYVA 2H00A 2UKDA 2DWOA 4LE0A 4PSUA 1P1CA 4EB6A 2DSTA 4NY1A 5FOSA 3BJIC 3IIKA 1P0MA 2G6BA 3FJOA 2C61A 5CA0F 1SC3A 1TOAA 3RJ5A 1EFPB 1A9SA 2V8BA 1H6AA 4KR7A 4A91A 2O19A 2AEJA 5LU9A 1NBMA 2FFRA 1L7XA 2GYVA 2QLFA 4RMGA 1IEVA 2IYNA 3H5AA 3IXQA 1W85A 2D1QA 5TY0A 3S1AB 3C39A 4ZZ0A 1U90A 2PGNA 4MRMB 3TZCA 2ZIAA 3AV3A 4MCAA 3PR2B 1H0KA 1X7WB 4HUTA 1DJOA 3C24A 2HH9A 4P33A 5A06A 2FMHA 3TSCA 5HS6A 4H15A 5LKRA 4DLRA 5KNDA 2PS3A 1EXVA 1GNSA 3NASA 4KXWA 4PR0A 4UC0A 1QFJA 3ZDAA 4XIGS 5HKKA 1B3RA 3ODPA 1DT3A 1NW7A 3OEEA 4DMMA 3K0SA 1EESA 1F20A 5TARA 1MB4A 2PWZA 1RWQA 3CTMA 3N28A 3OURA 4OJQA 1P1KA 2GF2A 1UPBA 2CLKB 1YR7A 5TEWA 3O9ZA 4O2LA 3OPVA 4YO8A 2CLDX 1DB3A 5J4HA 4BB9A 3A3NA 3GNSA 3O7WA 4AG3A 1W6UA 1OIWA 4LGMA 2I3AA 4L72A 4L27A 4Q15A 4YGYA 4JLKA 1MNQA 2C3MA 5CNKA 4G1CA 5TQ0A 4TYPA 3B7GA 1E77A 3OT5A 4I1VA 4PFSA 4C4SA 2A5LA 3IIMA 5GIPE 1EFRA 2G1PA 2YBDA 4U7PB 3ZLTA 5NULA 1UPFA 2DQYA 4HDRB 4DSAA 4L76A 4B46A 3HP7A 5HIAA 3NKVA 5E4TA 1IJBA 2REQB 3OZRA 4HB2A 4LDPA 5J1SB 3P9XA 1L1RA 1PFQA 4WZBA 2UYCA 1K6IA 4RA9A 5SZIA 1X94A 3MWJA 3J81k 1E1MA 4DQLA 3JYOA 1I13A 4GECA 4WE3A 5AI6A 5H59A 4KVFA 1X7XA 1NRJB 4DCSA 1IY0A 1CYDA 3IDAA 3LSYA 1LPOA 3FDFA 1SD2A 1VCNA 3PUXA 4PG7A 5CGQB 3PA6A 4C4TA 5JRZA 4JLVA 3IC5A 5LXTF 4AZ0A 2VWQA 1ZCFA 5CR9A 1SU4A 3OP1A 5GVRA 2AQIA 3GN1A 3TOSA 3K70D 1ODFA 3QU9A 1H2FA 4IJKA 5T4FA 2EYUA 4YRFA 1G66A 2Z4SA 1HZZA 4Y8VA 4AS2A 3KJFA 4MGEA 5LOVF 3RE1A 4KK4A 4O4JB 3NH9A 4EUHA 4NBSA 3E2IA 3IP1A 1WB6A 3RB8A 4RESA 3ZI7A 1N3LA 5T3YA 1COWA 4FW9A 3RVJA 1Z2CA 3MUFA 2ZYIA 2Q5OA 4R9NA 4F5ZA 2QW8A 3IHKA 1G5TA 2R79A 4NL4H 5DXAA 3WGJA 1U0LA 2Q2VA 3MMSA 3NTRA 2DR0A 5FLXA 3PDWA 1F4VA 4UEWA 4NR0A 5LQUA 4N3BA 4YVFA 3RYIA 4DWVA 3MJDA 3DGEC 5BN4B 2HWYA 1RHRA 2FSFA 1EVQA 2BWJA 2CF5A 4DADA 3OMLA 2WICA 3ORSA 5ALLA 3D8UA 5A1TA 2NSJA 3QG1A 2DULA 1MVNA 3O21A 3JALB 2BC9A 1NT2A 1KHTA 2BBOA 2GLUA 2JFQA 2Y1WA 5DBGA 2O2EA 4BJ1A 5KQPA 5CW1A 4BEWA 1X38A 1M2OA 1GGFA 2PZMA 1AQIA 1JNXX 1B73A 1PWZA 2X5XA 3GRRA 5LIRA 3ICEA 3T35A 2HDWA 5DLEA 3B36A 1QGZA 5A3QA 2JZCA 3H1GA 1CVLA 2WJAA 2H57A 2VTVA 2ADOA 4LVOA 5JYCA 2AOTA 1R6BX 3B1KA 4AMVA 2D1YA 3LRTA 4N8DA 4QQFA 5CDFE 4MO2A 4PHCA 2BEWA 1II9A 3QMVA 4R1MA 1F38A 2IPLA 4P80A 5F9HA 3GAFA 1OMOA 5EAIA 4J7UA 3CNLA 1XQYA 1I80A 2E0IA 5GOTA 2XADA 2V03A 4U7FA 5CFOA 1H2YA 7MDHA 3ZV7A 2FPGB 2OGUA 2VPTA 3KQMA 3KT3A 1J2YA 4DHWA 1XXHB 2EVWX 4UXIA 1NXVA 4MPTA 1DCFA 1R4NB 1YZHA 2MSDB 2G5PA 5EWLB 2TMKA 1E3SA 2R8BA 2WIFA 3CRRA 4QGSA 4J0KA 2VTBA 4ARIA 4M0PA 1I10A 3WIEA 1IMJA 3WRYC 4FB4A 4YN3A 3VKUA 3OMWA 4TMVA 2ESRA 2X2OA 1IONA 4JJGA 5FAXA 3FFWA 3N3BC 4KV9A 3EDRA 5F5LA 5HKLA 4B73A 8AT1A 2BV3A 4NFHA 1VJGA 2JARA 4OP3A 1Q0HA 4ROSA 1CP3A 4Q5IA 3SZ3A 1UIRA 3GJQA 3SM9A 1ZZEA 1MB3A 2AMYA 4L2IB 1L5MA 4ZK6A 2PSDA 3RT9A 5CT8A 1NSYA 2ZSFA 1Q0QA 3D54D 4XIIA 4LRWA 1AN9A 2DY0A 3QJGA 3GEEA 5AJWA 5C8YB 2B3TA 3G7UA 5DSXA 3NDPA 1Y1KE 4TV9F 3RHFA 4J1SA 2XBLA 3W4JA 4QKQA 4JJFA 5TDHA 4L51A 1W52X 1MOPA 2F7SA 4US2R 2JHCA 1R9GA 2GZ2A 3QUAA 3SKYA 3LWZA 1JEJA 3W2IA 2YIDA 4U6NA 2V54A 3OICA 4N0QA 5D84A 2XH8A 5E9WA 2WTNA 3AVVA 4WNYA 4YRIA 1ZJ6A 4G6ZA 1K08A 3GT4A 3WBKA 2Z8ZA 4GZLA 4OQFA 2JJ2D 3UEOA 3EXG1 3AKEA 4DA8A 2JB9A 4Y6LA 4JY7A 5IVKA 2X40A 3AETB 1AY0A 3IP5A 2R7NA 1KDVA 4D56A 4E3ZA 2E4WA 1FDUA 4R3NA 1E0DA 1FDOA 1HYQA 4GX1A 1XQ9A 1SBIA 2ZE6A 3OOHA 5I45A 2FG5A 1M7BA 3GFOA 2QUHA 1OZHA 1FRFS 3PI6A 1OTYA 3NV9A 2EXXA 1U8CB 5CT6A 2VDKB 5CDFA 1VL5A 3SXPA 3UGKA 1GN9A 1E2DA 3VHLB 1EZ4A 2C4TA 4A2CA 5TMPA 3AR7A 1M6VA 2OFWA 4RZSA 4MUKA 5M3BA 3O0TA 5FTLA 4M0KA 3I0NA 3NIWA 2HCFA 4S1VA 1WHSA 4AX4A 2I9KA 2Z95A 3W3AD 4ZEVA 4PIPA 4YJFB 2J9XB 2C4VA 3EDYA 3L01A 1KFBB 4JUFA 1CR1A 3TH5A 4D5GA 1S2OA 3ZEIA 2PSEA 2Z2JA 3MGBA 5AFSA 5JAHA 1R0XA 3RUCA 4FOPA 3UCEA 1VPLA 5T5QA 5IHXA 2GF0A 1KOJA 2ZJ3A 3KNZA 4FDLA 5IKXA 1CIVA 1X8XA 1YRHA 3EVDA 1U2EA 3KB1A 3M6XA 3OFVA 4FHFA 1NJ6A 2R1TB 3P19A 3HYCA 2J6IA 2PLFA 2ID9A 1L7NA 1YS1X 3BFXA 3D1VA 3W5AA 3LKBA 1H8EA 3D1JA 4Q7LA 1WG8A 3OETA 2ZI7A 1SVLA 4EFLA 5ADVA 4P0PB 2YDYA 5FJJA 1FPMA 5H3LA 1UOOA 1JECA 1HQKA 3GLRA 5H1YA 1E9CA 1RWOA 4F7WA 5TPZD 3AHEA 4MRNA 1E58A 2F9FA 3C7AA 1OXMA 3DT6A 3I2YX 3I01A 3W5BA 3G0IA 4CM9A 1MX9A 4HQFA 4P3XA 5E3HA 5B1DA 3U3RA 3QTBA 3VJLA 5KS2A 2A59A 2DTEA 2H2HA 3BZWA 2J0QA 3H2JA 1RLUA 2ZJ4A 3WYAA 5FWYA 4WXPA 2FZGA 2WTBA 2QTAA 1SZPA 1D1TA 1EX9A 1WDWB 2GD0A 1LBSA 4NPCA 5TQ2A 1MQ9A 1AK9A 1H05A 1K98A 1M5UA 1JDBB 3JQPA 1GHTA 2FPLA 2IPMA 1WV1A 2E9SA 5G1PA 2ARKA 1X80B 3PEUA 1K06A 4M4SA 2D5BA 4DDKA 2UU9B 1XO1A 1M6HA 3NBZC 1SHKA 1CERA 1SRQA 3H9EO 4GZ3A 2APJA 3DWIA 3QOWA 4LSWA 3DHWC 4ZI5A 4EM6A 1XU4A 4OQDA 2LXNA 4DR6B 1C0PA 3P0JA 4J0GA 3U4MA 3H86A 4XDHA 4MQMA 2HFJA 4ESVA 4CU5A 4PYRA 3GVCA 2P4UA 3QVWA 2GEUA 2YHSA 3LA6A 2YMMA 4RGBA 2R65A 3G8YA 1Z5OA 4FD2A 4IX9A 4MYHA 5A9SB 1SXJC 1XP5A 2FDXA 5BMVA 4Q4DA 4YP6A 4RJTA 1YB6A 4YCBA 2H59A 5AT1A 3WGKA 5A4KA 1UM9B 1ZOSA 5AESA 3LX6A 1G8AA 4XJTA 1UKZA 3PXBA 2ISSD 3FWYA 1C4XA 5JCPA 4X90A 1FVHA 3E23A 2LKDA 2PX2A 1EP3B 3LIIA 5KKAA 5KNDH 5FNVB 1CJCA 1BXGB 2A1UA 4KQHA 1GA1A 1HDYA 1YS7A 1Z2DA 4M0EA 1VG1A 1KVSA 4MA4A 3V00A 1VCHA 5AIAA 1PV1A 1ZMRA 2Q5QA 3KQQA 4HGRA 5BW5A 3FAZA 5IU6A 4QWMA 3PG5A 4GR5A 1NYRA 3SIXA 4EKEA 1R18A 3K2EA 3KYCB 5ALJA 1A9TA 4BP8A 1I6WA 1B8UA 1BW9A 2QUAA 121PA 2IXAA 2V9CA 1RKUA 3E9YA 3JWJA 4D3DA 2ZIUB 3A4IA 2QUIA 1H42A 3KV1A 2YWJA 4N0MA 3RS9A 3UKOA 2IYTA 1Z0JA 3QEMA 1ZC4A 3TO5A 4R2WA 2DPHA 3ANYB 2PRJA 1FLAA 2GYWA 2QRUA 4KAFA 1Z4IA 1NM5C 1SCKA 2W2LA 1UBSB 3IAHA 5E7QA 4BLPA 5AVUA 3BWYA 3R41A 1D03A 3HADA 3WWEA 3QJ5A 4F9EA 1STOA 4HMOA 5CYPA 3SHOA 5TV2A 1TTPB 4WOCA 2WJ6A 3HU2A 4PAQA 4GQIA 3UMVA 3V2HA 4URZR 4QBFA 1Q3KA 1SCUB 4B4KA 5IKEA 1EQUA 1PBTA 2HF8A 3KZNA 5DVZA 1FC0A 2CUNA 4R3WA 4AWBA 1VL1A 3GNQA 1Z0KA 2RHJA 2JFHA 4CBVA 1ADJA 4AY6A 4NCAA 2BGUA 1JR6A 3JVUA 2CLFB 2QRQA 1GA4A 1RAEA 1OAOC 2IHJA 1KC3A 1ZD9A 3BL5A 3E3AA 3G82C 4S0XA 1NA5A 4TTPA 1JKIA 1OFUX 4BFZA 1OB5A 1XTSA 1EXWA 2EOAA 3IEXA 1NAIA 3LLVA 4KDCA 4DKXA 4RD3A 3SLGA 4XUDA 1EU1A 4R0NA 5HUQA 5L3SA 4OQLA 1VZ2A 4DFDA 5EJ5A 3I5AA 4UTZA 3EIUA 5BQOA 1GPKA 5DCLA 2I03A 4CETA 3G2LA 3LHFA 3LP6A 4HFNA 1SQSA 4I1UA 1Q19A 5ADWA 2N0SA 1J99A 4IIUA 1U2RA 3CKKA 1M0TA 1ZGGA 2X4LA 5GIOE 3AB3A 3O8RA 1BOFA 2DUWA 3EG9A 1LDNA 5TB5A 2FY8A 1MB9A 2BOVA 2BEJA 3LCMA 2UVQA 4WHMA 2AEFA 2UUAB 4N5IX 4B3GA 4EHFA 2ID8A 4PG5A 4ND8A 4ZOLB 4C29A 5L4SA 3FTEA 1R27A 2RI6A 3F5DA 1ETHA 4Z49A 1TW2A 1VMDA 2R7AA 1HYBA 3K2BA 4PNEA 2R86A 4XWTA 5KSWB 2J0UA 4ZDIA 2C7QA 3Q0EA 4D3YA 5K6AC 4R4JA 2GMWA 4Y9DA 2BFFB 1XQ6A 1R12A 1SKUA 2EX1A 3L8HA 4LMPA 4WN9A 4NFYA 4B3MB 5F1PA 2HREA 3OZBA 4KH0A 2YZNA 3RYCA 1DDGA 4MDFA 1R6XA 4P4TA 4NH4A 5GVSA 1KMHA 1NXTA 4E7OA 5HQ3A 1JH8A 2ABWA 1J09A 3B48A 5FOQA 4CUJA 4PX9A 3T7KA 2BHSA 1DZ3A 5ECYA 5FHQA 4QGGA 3CT6A 5T41A 3CZRA 1NBHA 3WMWA 2X9GA 3SHFA 4ZVOA 1JSRA 3EMVA 1OT3A 1YCFA 2BN4A 4BCCA 3UMMA 1G59A 3N8DA 4YJ2F 3IPCA 3SICE 1CZOA 2QR5A 5L3RA 2W2VA 5LC1A 3TLXA 1JEEA 3UPUA 1YRAA 2J7PD 3EGVA 4K6OA 5E6SB 1GQ2A 6AT1A 3RANA 4I8DA 5AM3A 3RREA 1OU4A 3PRKE 1Z38A 2ZUTA 5TSDA 4W5WA 3ZY5A 3TXYA 4CDGA 2Y27A 2I3BA 1GRQA 1EWTA 1E3WA 1LSJA 1LV7A 2EW2A 3I6BA 4U8GA 4YALA 3S29A 5K8TA 4L08A 1YAHA 5L3QA 3HJRA 3DBRB 4DWOA 1V5IA 3Q2IA 1YDGA 3NVMB 1C9KA 1EUCA 4O2BA 5B1SA 1L4GA 1XZHA 2Q1XA 4M1KA 2RJ3A 2ZPUA 3OZUA 3R9IA 5ICEA 5BR1A 3E61A 1MT0A 4R1TA 3DNPA 2EBFX 1R3UA 1Z08A 2OV3A 5EKTA 1H4TA 4OHWA 1N6PA 1RM0A 3WTCA 2Y0BA 2BGTA 4EW3A 1VHQA 1MX5A 1Z6ZA 3DE1X 4MARA 4RVNA 2HA0A 2JGLA 1R5OA 3FVRA 2NZJA 4O2AF 1A76A 2NTEA 3OO0A 2HHAA 3DCYA 3CF2A 4QJIA 4JJIA 4G4SO 1RPTA 2CUZA 1CFJA 1JXMA 1AE1A 1X9GA 2GFHA 2ZWOA 4M87A 4OHXA 2QLBA 3KLNA 4XD7D 5HXAA 2G82A 4PSDA 4EB3A 5JIBA 3M6UA 4L22A 5FYDA 2QZSA 3FNFA 4DQDA 1UP4A 3USZA 3UGTA 4A6PA 2WD9A 1PX2A 3VNBA 1F7UA 4G26A 3T7SA 5TF0A 3PUHA 1RS0A 4URXR 4II7A 4JYZA 5DNYB 3UKDA 5SZJA 3AUJB 3ROQA 1KZ7B 4R1SA 3WGYA 2FWAA 1G8YA 1W0KD 3NWOA 1CG6A 4JASB 1UP7A 3NGMA 4U2BA 2CV2A 1UKBA 3SU8A 3W5VA 5D3QA 3TKAA 1HMPA 1XEAA 2R25B 1QGAA 3RSOA 3KKEA 3GELA 4JCOA 1TE2A 3EZLA 2R6R1 1OQAA 3BFKA 5CCEA 1BHJA 5CYGA 2H29A 3HO6A 3LP5A 3QY9A 3IH5A 4OK3A 4TMXA 4D4MA 4YCCA 3T3MB 5ALVA 2DUMA 1TC2A 1UBHS 1K9VF 4YT4A 4XWAA 2AN1A 5JSZB 4C2AA 2CXTA 2FSVC 1QP0A 4RTPA 2PSSA 1DELA 3UWSA 4ZJYA 1TLFA 3KFVA 4Z5XA 5KYTA 4BL5A 4W1QA 4C07A 2DF8A 4JHLA 4NH0A 1Z68A 4HQ6A 1JEYB 2PHZA 5IFKA 1N6IA 1X86B 4QVIA 2AG5A 1C80A 3DQPA 3HKBA 2CXSA 1L7AA 1RBZA 2AJLI 2W6MA 2NPIA 3HKDB 4HCJA 4GLLA 5DHAA 1QPGA 2FQYA 1X0VA 1S2MA 5IDVA 1VJDA 4ZIRB 5CK4A 1KYTA 4IOJA 1KAOA 1OJLA 1TNDA 3CNEA 3LVRE 4AJIA 3ZVMA 2TYSB 4TM7A 2VTKA 3N2KA 4G25A 4H60A 4YAEA 1VKZA 3ZWCA 4DXHA 5IBCA 4KGVA 4V0RA 2HLHA 3ZDBA 3IVCA 1JHXA 2ZBEA 2FW6A 2WDZA 1F2TB 3DTNA 5L7YA 2IV3A 3UAXA 3AG6A 5B4TA 3JQ7B 4G4GA 5KKNB 3MF4A 2FDCA 3ONFA 1XQ1A 1YE8A 4L74A 4CTKA 3M2TA 4LJLA 4JEMA 2O3TA 4MVXA 1XR3A 2ZYTX 1DEKA 3HJHA 3OQJA 1DTWA 4LZPA 1K6MA 3IQWA 3NGLA 4HOYA 1EVZA 2XT0A 4TWBA 1KWGA 2IYZA 4G1FA 4YCMA 3LFTA 1G2IA 3F4KA 1A7JA 2GPWA 5LA6F 1DC7A 1BE8A 3U7GA 2JHFA 1P2BA 3MIIA 2ZYDA 2P2CA 3CVVA 4D9NA 2CMKA 3UJHA 1MC5A 3ECCA 4TSKA 2BONA 1H2BA 2Q9CA 1D6MA 3QLVA 4JR1A 3UJNA 1RQXA 2QLTA 4RZ3A 1UMKA 4D43A 1Y1TA 2WPDD 1K66A 1QO0D 3F6SA 4L1KA 1R37A 3FNEA 3AI1A 3QYFA 2V7UA 4BO7A 3ELUA 3PNBA 3FN4A 1QH8A 4QE3A 5A4JA 4TL6A 2QRHA 4ZPXA 4MO9A 2VLBA 1Q0ZA 1U2GA 2WBLC 3TL6A 3TI9A 5G0TA 5CB6A 5EHNA 1GPUA 4NU0A 4OXRA 1IEXA 4GI2A 4BO6A 5M5BA 1FFCA 2UXDB 3BF7A 5KUTA 2C07A 1HWYA 1QC5A 4EWLA 3CR8A 4X8MA 1MP0A 3B52X 2BMDA 2VAVA 1SK9A 3ZNPA 3D43A 1V2HE 4X44A 4OQNA 1MAHA 4H27A 3CVUA 2IHNA 3QXCA 1EK6A 5DM2A 5EP3A 1FFWA 4GPBA 4TQUS 2VF2A 3AH8A 4Y9RA 5LQJA 2Y1OA 2GZ1A 3SG0A 2PGLA 5L95A 3SCZA 3V3TA 4ONEA 3VMMA 4M0MA 5AHOA 4Q37A 1I5RA 1A7UA 1ZRMA 2A9OA 3K6RA 1W19A 4LXIA 1XCGB 4M0FA 2AUMA 4XWGA 1B0PA 2QIPA 1Z5PA 1T2FA 3NTQA 3SFZA 4I2NA 5I9BA 4A4DA 4GSYA 1D04A 4B3DA 3NMUF 3JQ6A 1P1BA 2Z5FA 4LDRA 4OJKA 3ZH9B 4KKXB 3I4CA 3AEKB 4B84A 1D7OA 4ZJZA 3JVVA 4FP9A 3NIFB 4F8JA 3RSZA 5TT1A 4BO0A 4MW0A 1YU6A 3WAJA 3OPXA 5K2MA 1WDKA 4MGZR 4ZRDA 1IM8A 3DTTA 5B1EA 1LFDB 4EVIA 3NCHA 4P3YA 5LYYA 2E4VA 4IICA 3D2AA 1LLFA 1IIBA 2IOYA 1ODLA 5JZOA 2RG1A 3P32A 1KY4A 2PUEA 2BFEA 1P31A 2P0YA 4HI0E 3Q0IA 4KOEC 3PKIA 4E03A 4ZI7A 4ZJUA 5L8VA 1HNZB 1U98A 1DC8A 1W1WA 1OGIA 2OGSA 1L7OA 1QORA 4FJ0A 3ANTA 3W6NA 2I55A 5IT0A 3ZQ6A 1M1UA 2BJHA 4ZU6X 4TT3D 3RFUA 3A2NA 3VHXB 2JI8A 4DMKA 3RIGA 1YRWA 4QQKA 3PSAA 2HA4A 4BRZA 4Z3DA 2XNDA 2HRCA 1I6MA 2P2LA 4OBEA 4ZQGA 1W44A 4TZ6A 4S1TA 2QTRA 1PGQA 3MFQA 2HEGA 3S8EA 1QMGA 1I9GA 3RROA 1HC7A 5FFMA 4EMTA 2WU1A 3LW7A 1WSBA 4AECA 5EE9A 2IX9A 4P2BA 3G6WA 1QFMA 1Q77A 1RCTE 3EJWA 4UQOA 3ZVKA 1G6OA 4URFA 3AVQA 4Y0NA 4EJSC 3O8OA 3WX0A 4INZA 4MQEA 1P4RA 2OYRA 1NLMA 1UT6A 4RXMA 3DZCA 1N77A 2Q2QA 4WNIA 3RYHA 2D7DA 4BC0A 2RK4A 2O14A 4G0UA 3NTOA 1T34A 5JXIA 3N8HA 3EGOA 5DP1A 1E3JA 3P2JA 5HHTA 3IPLA 1AUVA 3D4IA 1UT5A 2BKXA 2ZU6A 3B53X 5CVJA 4ZOQI 1H3FA 1BMTA 1OZGA 1QHSA 3KJIA 1RYDA 1G21E 2R3SA 4UVEA 4KR6A 1V5WA 1Q20A 1WUTA 2IZOA 3CF0A 3NVDA 4JIMA 4PZUA 1HDIA 3NBXX 1AUXA 2VDJA 1FB5A 3DLAA 3R3WA 1T24A 2YC2C 4N7JA 1YI1A 4YJHA 5G4KA 1WCV1 2ZAYA 1RDFA 5AHWA 3JZIA 2JL1A 4DPLA 4LV6A 2Q3DA 3KOOA 3CRW1 3VVMA 1II0A 5DGCA 3EF1A 2WWFA 1PJCA 4NOMA 4WJLA 1EUQA 2XVYA 1G4UR 4MCJA 4CMAA 4R7TA 1E0SA 1JW9B 3E81A 1DIAA 5THQA 1E9SA 2BT4A 4RZIA 4EKGA 4LG1A 5CM8B 1XJCA 4B5KA 1ZBDA 1LPAB 1THGA 4D96A 2DUUA 1W76A 1KK3A 3DZIA 3RVKA 1AMUA 1U9CA 1GAJA 2NUPA 3LKVA 4UZSA 3UHJA 3UMBA 5CYOA 2H9YA 3B6EA 3L1UA 3CRMA 1Z4QA 1DUVG 4Y2JA 5JFGA 1D07A 4OFZA 2IDZA 3HM9A 1N6OA 2FWPA 2WSIA 1R66A 1DBSA 2PZLA 1JHZA 3K8YA 5H0IA 1J9GA 5EHZA 2JCXA 1YK0A 1GWNA 4XI9A 1KRWA 5KWEA 3K92A 2HGSA 4R8MA 4HWPA 1H6CA 2XSZA 3AHDA 5EZQA 3EWIA 3VC3A 4RSRA 3U49A 5KVCA 5ISMA 2JEYA 3FLEA 4G89A 1FRZA 1FXSA 2B4KA 5DIFA 1XHEA 4E5YA 2CMGA 3NEPX 1FNMA 5AYVA 4TSFD 3MG9A 3PA8A 4PVCA 1MF7A 4YPVA 4P86A 2PMFA 5EINA 5HF8A 1POXA 3EY4A 5U4QA 4IIYA 4R2XA 4UDOA 3S2FA 3I0ZA 3TLBA 2ZK7A 3W5HA 3B6IA 2FRDC 4Q3KA 1QB7A 4HNTA 1ZWKA 2QJOA 4C0HA 4X91A 1O94A 4WIAA 3TTVA 2W2XA 2ODNA 3OLCX 3NT2A 4YRQA 3VVLA 3IMFA 4MR9B 3WB1A 3MT8A 1WPRA 3QUSA