3KJHA

Zn-bound state of cooc1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
MKLAVAGKGGVGKTTVAAGLIKIMASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLGSVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDLGIKKVRYVINKVRNIKEEKLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQSTNPAFVNLHDIYQKLRLEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, metal binding protein
molecule keywords CO dehydrogenase/acetyl-CoA synthase complex, accessory prot
publication title Crystal Structure of the ATP-Dependent Maturation Factor of Ni,Fe-Containing Carbon Monoxide Dehydrogenases
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
total genus 76
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kjhA00
2DFNA 2WPDD 4TTRA 3W3ZB 4CYMA 3GJ5A 1US8A 2ZI4A 2AWNA 1P4SA 2IS2A 2R9VA 1Q1BA 3CUEF 3N5CA 2WJHA 4MRPA 4B2PA 4AKEA 1G18A 3M6AA 1E9FA 2ZJZA 4JBWA 4ABYA 2ZU6A 4KXFB 4B48A 1UFQA 3AKYA 1E1QD 4S35A 821PA 3SE0A 1XPUA 1Z2CA 3GLGE 1H8HA 2R44A 4A1FA 2WV9A 5EE0A 5SZJA 3OEHA 5KSZA 2I4IA 1GFIA 1KK0A 1XEXB 3CPEA 1I4LD 2QMUA 3SBEA 1G5TA 2YC2C 2F43B 1XEXA 2D7DA 1IN4A 3VQTA 3CPJB 4KBFA 1LVGA 1R0XA 4KVGA 3FHTA 2QMHA 3GQBA 1T91A 1E9CA 4HAYA 4MGZR 5BN4A 3P20A 1JXOA 2D3WA 4PANA 1FOEB 1T5IA 2OUKA 4GDFA 1XZPA 4QL3A 1KYIA 1AZTA 2UKDA 4AYWA 3RS5A 3FWYA 3WNBA 4KFUA 3MAAC 2QBYB 1OV4A 4DVGA 2VLIA 5EZ6B 3VX4A 4DJTA 4HAVA 1IXRC 3BB3A 4FI3C 5E7MA 2QBYA 3K0FB 3LNCA 4PSKA 3R7WB 5BYJA 3THWB 1ZIOA 4LYAA 2GK7A 4XVRA 3R7WA 4B3GA 5C4GB 5JSZA 1EWQA 3SYLA 3FMIA 2ZRCA 3IILA 1E2IA 2H18A 3F0TA 3L0OA 2CCGA 2IYRA 3L8YA 3FTQA 3D8BA 2AK2A 3K0CA 1VMAA 3PV0A 4GFDA 4QGHA 2Q9BA 4G0NA 4ARZB 4PPQA 4RKFA 4X8MA 5FL7D 3EPLA 4LOAA 1DS6A 1EGAA 3DOEA 1NBME 1W47A 3OESA 2QE7D 4XTRA 4JLKA 2QP9X 1X8KA 4TLAA 2IUTA 3RWOA 1TNDA 2XJ9A 4YMVA 3OE7D 2IX3A 5JS7A 2X19A 2QA5A 2O8FB 1N2CE 2XITA 4G3XA 2VP2A 4TT3D 4PC3A 4BUJA 4KITB 2O8FA 4QBFA 3GJ6A 1GIAA 1KY3A 3Q72A 1NN0A 2REXB 2WWGA 4Q4HB 4C9BA 3CNLA 4GPTA 5BXQC 3TR0A 3CX8A 4NP6A 4TYQA 4Q4HA 4QBIA 4DLVA 2XJ4A 5B58C 2QUZA 2V6JA 1AKYA 2GJ9A 2PBRA 2WSSD 3TUJC 3T1TA 2ZE5A 2PCJA 4POAA 2AX4A 3RRZA 2VSXA 2VQSA 3HWSA 2G0TA 3TUZC 2WWXA 3JVUA 3MGCA 2QPTA 4MKIA 1TQ4A 4UXJA 4B75A 3IHLA 4JSYA 2CL0X 2F1RA 1BKDR 5IT5A 5K8LA 2IC5A 4JLBA 3T12A 3PENA 2YWGA 4P4UA 3EC2A 2EFCB 5L3QA 1FQKA 4E22A 2GWHA 2NIPA 4OJQA 1TF7A 4BFWA 2WMNB 1CTQA 1P72A 1W44A 4GMDA 5DI3A 3TR5A 4OBEA 3D7MA 5GJVC 1XEWX 4RD1A 3WMEA 3CNOA 3G5UA 1Z0IA 4TYPA 3RS2A 3Q9LA 3CB4A 3C8UA 2ZYVX 1TTTA 1A7JA 2DFTA 2ZIAA 1LF5A 2YWHA 2G9NA 4TLEA 1YR6A 2WMOB 2IYLD 1SGWA 3BIFA 2GCPA 2ZUCA 3W6NA 3O8BA 2V1XA 1ESNA 1QVRA 4JS0A 2D2EA 3EXAA 2GXAA 5A4JA 2WHXA 3IBYA 2MMCA 1Z29A 2WZQA 5FUWA 3OEEA 4A4DA 1KO4A 3B78A 3X1DA 1OIXA 1U8AA 3K70C 1M74A 3CF6R 4BFVA 2CLSA 5FR2A 2ZTSA 2ZS8A 2RGAA 1O3YA 3QUSA 2ZSBA 2BBTA 4M1YA 4JZKA 3CLVA 3LXRA 5KHOC 4LZZA 1NLYA 4B2LA 2O0JA 3Q3JB 4OQNA 4U00A 4EPRA 3PFIA 1A1VA 3CRVA 3TLXA 3ADKA 3CH4B 4CEHB 2XTNA 2ZUDA 1UKYA 3DHWC 2XTZA 4CEHA 5FOXA 4ZKEA 1D2EA 1GRRA 4XTCS 4LUCA 5E7JA 4D4JA 1NMXA 1P2TA 4ASUA 4BRUA 2PX0A 4C0BA 1HY3A 2OBNA 1N25A 5CB8A 2ATXA 2G88A 3B5JA 2CL6X 1J90A 2FFBA 2W6JD 1JPNA 4JMPA 3RYTC 3FVQA 5LPNA 5EJEA 2WIBA 2YINC 1OLOA 4LHWA 3BH6A 4PO1A 3K70D 4TTPA 1W48A 3ZIAA 1SXJD 2IUSA 4PTLA 5KDOA 5G41A 2NZ8A 2ZSEA 2QY9A 3ND8A 5KUTA 3KTAA 4PAQA 4BWYA 2C9OA 2DWQA 5JCZA 3GJ3A 4TYWA 1PLJA 3THOA 2D2FA 1II9A 1IN7A 2BMFA 3I73A 4BZXA 5E95A 1C4OA 4XOIA 1QBKC 2QGZA 4OKSA 4AK9A 2YZ2A 1GNPA 1G4AE 3SQWA 2PJRA 4B32A 3EWAA 1V43A 3QKRA 1Z22A 3C16C 2FSGA 3ZVNA 1SVWA 2Z4RA 1WF3A 4JLOA 5EE1A 2P6RA 1ZAKA 1P7CA 4AKHA 2IYQA 2FEMA 4NBSA 3GLFA 2BMJA 2ZRLA 2OCAA 1OF1A 3PVSA 1SVLA 4WZBE 3LX8A 1G21E 2ZS7A 4KJZA 1KK2A 1D8TA 1XMJA 2ZRFA 4UNNA 4PPGA 3ZZ0A 3E1SA 1CKEA 1G6HA 1E4VA 2QROA 2GEUA 2ZYTX 4Q18A 1WCV1 4IOMA 1YZLA 3DMNA 4D4KA 2VP9A 1IJEA 4RD2A 4B34A 3P27A 4ZKDA 2EVWX 1FMLA 2CLCX 2QM7A 1Q12A 2ZRJA 5FBRB 3QXHA 4G5RA 3AF4A 2ZYUX 4Q7MB 1JECA 1IHUA 1TF5A 1ODFA 1M8PA 4HLCA 4RZ3A 3OEHD 5CK5A 3SR0A 2REBA 1U0JA 4LBYA 3VFDA 1XXHB 3R8FA 2C95A 2P3SA 4KBGA 3THYB 3CR7A 4QBHA 3B9PA 1KMHA 4OHVA 4W9MC 1QDEA 4Q4AA 3TK1A 3THYA 2QORA 4EIWA 3CRMA 1J8MF 4M21A 2J59A 4PC7A 5F9FA 5C18A 5HR5A 3GD7A 4HLUA 3BJIC 1P3JA 1R5OA 2H1LA 4LHVA 1TQ6A 2BJWA 2ZJBA 3U7EB 2GTPA 3AVQA 1TMKA 3WXMA 1EFTA 2JLXA 2HUPA 2OEPA 3LBIA 4EDHA 2OZEA 4IXNA 4I1VA 3W5JA 5B2ZA 4LHYA 5HZHA 3B13B 3H0KA 1OB5A 1U9IA 1HTWA 2ZRGA 4HATA 2H17A 1GDDA 4A0RA 3B82A 1F60A 1GM5A 5DHFA 4KYIB 3K0CC 5FL3A 4F91B 1YU9A 4D0GA 3T35A 1YVDA 4I99A 1E9RA 1E9SA 4V02A 4BFTA 2CDNA 2WWYA 3UKDA 3N2IA 3NTUA 2O8CA 3QG1A 3GPLA 4IJMA 3BFXA 1Q57A 3DZDA 4KI0A 2WICA 4BZPA 2G0NA 1CU1A 4M1OA 5AUNB 5HPYB 4LYHA 3SJBA 3W8RA 4EPTA 1U0HC 2RB4A 2R6FA 1VG0B 2RGXA 1RJ9B 1ZIPA 1HURA 3QEOA 3MD0A 3QXJA 2X8AA 2F3TA 1LNZA 4CEJA 1Q1EA 3IDQA 3QF7A 2JLRA 3AUYA 2J46A 2GEVA 1NVVQ 2O8DB 2GF9A 4FMDB 3PJRA 1TU4A 4LC1A 4TMZA 1KI1A 1M7HA 3SDZA 3GLHA 5FI0B 2O8DA 2GZDA 3FB4A 3K09C 3P32A 4BLRA 1LB1B 2A9KA 1KDOA 1EESA 4HUQB 2C78A 1YQTA 1VPLA 3KKNA 1NVUQ 5TMPA 4YONB 3GLFE 2YC4C 2A5GA 3NXSA 4JL8A 1QVAA 1W0KA 3EZ2A 4LV5B 4PO8A 4RY2A 1ZCBA 1H65A 3K0AB 3CW2A 2QT0A 1HQCA 3I32A 2QP3A 1LS6A 4HLQB 5LD2B 2MSDB 3DEFA 3EG5A 5IK2A 2ODWA 2OILA 3AVVA 3H4MA 4CGZA 1NL3A 2JLSA 3WP0A 2RGBA 1F6BA 2J87A 4HI0E 3QJYA 2H7VA 2WVJA 4ZCIA 4ESVA 1R4AA 4GP6A 1YHNA 1NVVR 1A5TA 1HUQA 2Q3FA 1DVRA 1NMYA 4FINA 3IGFA 3BERA 4EQ6B 2AD5A 3RANA 4YMTA 1JPJA 1W5SA 2IYVA 1Y3AA 1KJZA 4RD4A 4MRNA 1P6XA 1BH2A 3QXSA 2PEYA 4MRSA 4QJ5A 3FOZA 2DHRA 1AKEA 3KJGA 3QF4B 4NYJR 2CLDX 1II8A 3IIJA 3KXLA 2ZRIA 2PH1A 3QF4A 4TQAA 3MCAA 4M53A 4YC7A 1T0JB 1SZPA 1Q3TA 4EPXA 2FPKA 1JNYA 1PVOA 1KAGA 5J4KA 5F9HA 3BE4A 1E2KA 4HYYA 4DLSA 5KNBA 1DO0A 2GRJA 4GRAA 1U90A 1S9DA 5FL7A 1IM2A 4A2QA 1BOFA 4YMUA 4KLNA 1IXSB 1P2UA 3ADCA 2QE7A 1ETUA 1OYWA 4NCHA 3PITA 1PLKA 3I62A 3HYRA 3NIBA 1FL9A 5L8VA 3CF2A 3ZZTA 4RJLA 4TZ6A 3BFKA 4AKIA 4KSCA 1MOZA 4PZZA 1D6JA 4M9SA 1FFHA 5DYIA 1P9NA 1G7CA 1NG1A 1WP9A 2FMXA 1E2DA 3VNUA 1X8LA 2IYXA 4J0QA 3EASA 4A6XA 4DSUA 1R5BA 4FWIB 4LBVA 3KB2A 1YR8A 4UNQA 2H8KA 1E2HA 1PLLA 2AWOA 4LI0A 3A1SA 5B64A 1ZINA 4DEXA 4BFZA 2HCBA 2J0QA 2WSSA 1YZTA 2G6BA 3UMRA 3M1IA 5FBVB 4S2EA 1A2KC 3BB4A 2OBMA 3IPXA 4KYUA 5J4LA 1ZMXA 3I5YA 3EPHA 1OH5A 3FGNA 1OJLA 1LS1A 2IHYA 4BFUA 2LKDA 5TB5A 4P32A 3NEYA 4Q48A 4ASUD 3RC3A 3RS4A 4NMMA 3QQ5A 1UF9A 1EFCA 2I1QA 4PZLA 2C9CA 1R8QA 1DG1G 3U6KA 4JVNA 4Q9HA 4RZUA 1DAKA 4IOKA 1XD9A 2CCKA 4ON9A 1GUAA 1XCPA 4M2LA 4QFMA 3U61B 4HEJA 1W0JA 5IF9A 2A7QA 1IONA 2I3BA 4Q1EA 3IIMA 3Q5EA 3ZIAD 1DAMA 1OH6A 5UKDA 2O8EB 3GJXC 2WJGA 3C5HA 2AK3A 1JJVA 1Z6YA 4ILEA 2WSMA 2QZ4A 3HDTA 4EPYA 2O8EA 3FDIA 5HE8A 5FTLA 1T8UA 2GCOA 3TJZA 2G1KA 3ZQJA 5IDVA 3UWKA 1R7RA 2Q6TA 2A5DA 3AVPA 4W7SA 2GESA 1P62B 3GLGB 4JVLA 1E94E 1EFRD 4BECA 5FI1B 3GLGA 4PC6A 5KDDA 2UZIR 5FTKA 4OHYA 4Z54A 2QAJA 3QXCA 4DDWA 2ZE8A 3G82C 3A1VA 4CVNA 2FU5C 1UEJA 3LQQA 4Q00A 3BS4A 4DT1A 1IBRA 2CVFA 5FUXA 1E9AA 1KJWA 4DZZA 5DH9A 5FPSA 1XBTA 3WNDA 4FCVA 3E2IA 5FOSA 3TSZA 1Q21A 3GEEA 2GAAA 3LRPA 2DR3A 3B1WA 4AYTA 1BO6A 1QHGA 5HKKA 1CR2A 3KQLA 4MA4A 2OHFA 4HDOB 2OCYC 2GKSA 3AH8A 4Q1CA 5CYPA 2QAGA 2BM0A 3WYGA 2HJGA 4H1VA 3LLMA 3R9XA 3WRXC 4X8LA 1E9EA 2R62A 5CIQA 3EIEA 2YV5A 1NLZA 2C98A 5JI2E 3VKWA 4FMBB 3BORA 3CF0A 4HZUA 4PHFA 5CLLA 5GJWC 4ZI2A 1AGRA 3HR8A 4HLDA 2V55B 3W3AA 4U02A 2IXFA 2XSZD 2ZITA 1OHHA 4HLUC 4IXMA 1TPZA 4OK5A 1Z6TA 4URXR 1XEFA 3K70B 2NO7A 4G5SA 1VKJA 1SXJB 4E07A 4YMWA 5DISB 1G8GA 1LY1A 2W2TA 4LJAA 2O8BA 2PMKA 2Q3MA 4KLZA 4TMKA 5CIWA 2XB2A 1GRNA 1BMFD 4BLQA 1PJRA 2OFWA 3QENA 2JASA 1NNEA 3X1YA 1XNJA 3AF0A 4B3XA 2VO1A 5FTMA 4IKEA 1NKSA 4O0MA 3P1JA 3LLUA 5HE9A 1KI4A 1NBMA 1NSFA 3FMPB 1G3RA 2F9MA 3C5CA 3QIAA 4PFSA 4BEJA 2OLJA 5KU1A 4MDFA 2X77A 5EXSA 4BPBA 4EJSA 2BCJQ 4ZI3A 2ZE7A 4I4LA 2QTVB 3U3OA 1CBUA 2GJSA 2HLDD 4MDEA 1MO5A 3REGA 2E87A 1MT0A 2WOOA 5LB2A 2CNWA 2C9YA 4UNSA 1G5PA 2CJWB 2HEIA 3H86A 3SEAA 3GFTA 2C8VA 2IBMA 1KGDA 1TL7C 2P2LA 3LW7A 4L5BA 1G9XA 5KDLA 5JMTA 2NGRA 4BLSA 5JCPA 1XFAA 2R6GA 3RLFA 2J1LA 1YKSA 4U7DA 1ESMA 1E9DA 1ZUIA 2H16A 3LH5A 1L4YA 1NLFA 1FZQA 1XDBA 4XWKA 1G4UR 1OB2A 1NJFA 4HDQB 3DPUA 1Z63A 1SVSA 3ETLA 3K53A 4RFVA 1KZGB 1OT3A 3AEZA 4TMTA 2YWFA 1VECA 4V03A 2BDTA 5AUQA 2GZAA 3O8CA 2OM2A 3A37A 2PLFA 4GI7A 1W2HA 2F1JA 4PAMA 2Z6VA 4P4TA 5LD2C 1G8FA 3VX3A 2VHUA 1OPXA 521PA 3PIRA 5DYGA 2OG2A 1NMZA 1CR0A 2QTFA 1W0KD 3T5GA 3T61A 1KIMA 1IY2A 1OE0A 4CIDA 2ZM5A 1J2JA 2VP5A 3MWKA 1IAQA 4DIDA 4WBSA 4XWOA 3DKVA 5IK2D 1W2GA 3VR6A 2W0MA 2HCJB 4GNKA 3T5DA 3CPHA 3QSYA 2YNMA 1KDRA 3WHLA 4EAQA 3LWNA 4I1SA 3AB3A 1TF2A 4XWAA 2ODBA 1DE0A 1T0HB 3THXA 3SQXA 1VHLA 5AUPB 1TEVA 2OCPA 4JLVA 1I2MA 1VIAA 5JECA 4YLGA 4Q7JB 2ZI9A 3I4LA 2DB3A 2IA5A 4E5UA 2ZRAA 1M2OB 3N70A 3AP2A 3PUXA 1N5LA 4JJKA 4EUNA 5JSZB 2DPXA 2JLWA 2WM9B 1ZCAA 4MUAA 5FPKA 5KSOA 3NBFA 3CR8A 4G1UC 3CM0A 1ZNZA 4WIAA 1RFLA 4TMXA 2AKAB 2QGNA 1JEDA 1AQYA 1EK0A 2GVZC 4GOKA 2GETA 2AKYA 1M7BA 2ZJ8A 3NC1C 3VKGA 1L4UA 1KNXA 5D3MA 5J47A 3AVOA 2VHQA 4LJ6A 1FX0A 1ZU4A 3P26A 3FHOA 4NZYA 2O0HA 2HV8A 1KAOA 3AF2A 1T3SA 5B30A 3KDSE 4KFRA 3QKUA 3KXKA 4RD0A 3U3RA 5KSPA 3WP1B 3LW8A 4II7A 1II0A 4I1UA 4US0R 2NO9A 5C2JB 1U0LA 2E9SA 2BKUA 2C03A 5AJWA 1DO2A 3B1YA 5EXPA 1H8EA 1L2TA 4KO8A 2FGJA 5H70A 3UIEA 4QKQA 3KFXA 4Q02A 1E0JA 1MABA 1WA5A 3K9HA 3NHBA 3VHXA 4PPNA 3JVVA 1DAHA 3D3QA 1VCOA 2SHKA 2J45A 4JIMA 3S1AA 2KBEA 2GXSA 2OFXA 2FOLA 2YJTD 4WZAE 1NN1A 3DM9B 3ZS9A 4URWR 1KOFA 1SHKA 5EUQB 2FF7A 3PUWA 1NY5A 2FH5B 2V6IA 2GBLA 1W1WA 3HU1A 1KNQA 1S0UA 4US2R 1CJTC 1W4CA 3OIWA 4XH9B 2IW3A 2JA1A 1SKQA 5TVKA 5L3QB 3KZ1E 1Q44A 3TRFA 3KQUA 4BLOA 5GJCA 1MRSA 4HB3A 5DI3B 3EIHA 1ZRHA 1ELOA 1D2MA 3CRW1 3NKVA 3P4YA 2WAYA 4JSTA 5EE9A 1W36D 1W0JD 3A36A 4AWXA 2W0SA 3D31A 2JAQA 4BASA 5KOYA 4PPFA 4BLPA 3AQ4A 2B7CA 3TSOA 5HCIA 2ONKA 1AS0A 4B6EA 1XX6A 3ZD6A 5SZHB 3UPUA 4D26A 3B85A 2J5XA 2ZI6A 1EX6A 1ZD1A 5H8WA 4PO9A 2YWEA 2ZE6A 3BAFA 1ZU5A 4NTZA 2PT5A 5CB6A 3AV0B 1CF4A 3UG7A 4JLNA 4TL8A 2IYWA 1X6VA 4MRVA 1ZW6A 5H68A 3T1OA 4LJ7A 2Z43A 1COWA 3RS3A 2BBSA 2XTMA 2VA8A 4F4IA 1JAIA 4TZ0A 4BLTA 3CKLA 3TNFA 1C1YA 2DY1A 5DIFA 1Z5ZA 4C2UA 2QG6A 4Q03A 3GEHA 1DEKA 3C41J 2IYYA 1AGPA 1D9XA 1F3OA 3J81k 5KPJA 2DYKA 1TAGA 2WOJA 1RRPA 1ZC3A 1KMQA 5EUMA 2BEKA 4BFSA 4AG5A 4M1WA 2GHIA 5HKKD 5FR1A 3SYNA 3IKJA 1IY1A 4UQOA 4CRWB 2D62A 1UPTA 3WBJA 1DELA 1HT1E 1KHTA 2PZFA 3NVAA 4FD2A 4IVRA 1KI2A 2N42A 2V7QA 4F92B 1SXJC 1Z0AA 4PC1A 5FOUA 4JKIA 1RPZA 5EXXA 4M4SA 1VCNA 2ZR9A 4NH0A 1TU3A 4GOXA 1VCMA 1VG8A 2VHTA 1XWIA 4NCIA 2RGCA 4NHOA 2XAUA 3AVTA 3U7GA 3CWZA 1OHHD 1S96A 5DE3A 5EP3A 3WMGA 1M1YE 1TQ2A 4NONA 2OAQ1 2IYTA 5DGXA 4DC9A 1B23P 3H84A 4Q21A 2QU8A 2V54A 3KTAB 3HPQA 5C46F 4F7WA 4B3CA 2BMEA 4HSEA 2ZYWX 3VTKA 5DHAA 4GBMA 2Q0HA 1NBMD 5E4FA 3U2QA 3I1FA 4R71A 5E3HA 1EFRA 1OFUX 2MSEB 2O5VA 2QQ0A 3QKRB 3DO6A 2FPLA 1OW3B 2VYFA 3FPAA 1RZ3A 3K0SA 4JLAA 4BE7B 2B6HA 2BIFA 2J0UB 4R2IA 1RIFA 4BRWA 5JWOA 3GLFB 5BN3A 2R2AA 2HT1A 1GL7A 2J0UA 1QHXA 1E2FA 2CNWD 3PEUA 5JLJA 1LV7A 1YR9A 2P65A 2FWRA 5G40A 2ORWA 2JLVA 2P6UA 4O25A 1KK1A 3W9YA 4WW0A 3AVUA 4TYNA 3WHKA 5FBWB 1OIWA 2TMKA 4ITRC 1WQ1R 1G6OA 1RRGA 1OIVA 3HPRA 4FMDF 3AUXA 4NL4H 2VL7A 4YMSA 3BWDD 1CJKC 2Z5FA 3SHWA 3OHMA 3ZH9B 1N5JA 2EFGA 5C4MA 1YR7A 4D0NA 1AN0A 1T5LA 2KI5A 4NCJA 5EP4A 2X2FA 4JLPA 3Q8XB 4Z51A 2Q3HA 1ZM2A 2XSZA 4QHSA 4MKHA 4O2RA 3KB1A 4MYCA 1XRJA 1CR4A 3GJ7A 3VAAA 1CP2A 4V0MA 3T34A 4L4UA 2G83A 1KMHB 1P9RA 4KCGA 4QRHA 4Q4AB 1DTSA 2HYIC 2KB0A 1BMFA 1GKUB 3NDPA 1T9HA 1ZM3A 2WJIA 1NF3A 1UBCA 3NBZC 1E96A 1KI3A 1S2MA 3BOSA 1NKTA 3O8DA 4B3DA 4C4PA 3WNCA 3PCRB 3MSXA 2W00A 2ZPTX 4DHEA 3KQNA 3LQRA 4TLDA 2CMKA 2R6AA 1CRPA 2ZRHA 5K8IA 5J4YA 4B6FA 2OE2A 1W4AA 3DKPA 3L8ZA 1PUIA 2IYSA 2HLDA 3F3YA 2FFQA 3RSOA 1E79A 4XSGA 1GAJA 1P2SA 3PQCA 2FSFA 4KVAA 1GTVA 4C0QC 1ZUHA 1IQPA 3GFOA 6Q21A 3OIVA 4Q47A 2O8CB 1N6KA 1E2EA 4MYUA 3SJCA 2REOA 2V8OA 1W7AA 5DSZA 4B43A 2ZJ2A 5BYKA 4HB4A 2ZREA 3RDPA 2AL7A 1FP7A 4BQSA 4NPHA 1UJ2A 1Z47A 3MWYW 2EU8A 1CJVC 3ZJYA 2C99A 3MLEA 3A4NA 4YDSA 2F1HA 4CEJB 3I8XA 1KY2A 4AYXA 1NN5A 4EKDA 4A0FA 2VPPA 4KV9A 2LWIA 2XOKA 3QPUA 4BZQA 3GLHB 1HT2E 3IQWA 3NC0C 1ZNYA 1R0WA 3EZ6A 2VTKA 1OKKD 1G16A 1RYHA 2RGNA 1OH7A 2XEXA 1YRAA 2WJYA 3U3JA 5JBQA 4LJ5A 3E5HA 1R5NA 1ANKA 3QG5A 4IFBA 2R65A 2ZI5A 1E2LA 2PEZA 4IDNA 4TLBA 4B3BA 4C0AC 2EYUA 4LJ8A 2Z83A 4NYJQ 4QM6A 1ZJ6A 3EPJA 1ZM7A 1GRQA 1UBGA 2GBLC 2RHMA 4PQYA 2BCGY 1DPFA 4DLUA 3TKLA 4TSFA 4NDZA 4LSGA 2XXAB 1V5WA 1H8ED 4MITA 5FTNA 3W6OA 1M34E 1Q20A 4RFSA 2XXAA 3LAWA 4ZO4A 2FA9A 4HAXA 1XJQA 2FG5A 4M9XA 1UKVY 3TQCA 3VR2A 4RCZA 1HEIA 1T3LA 3C14C 4TQUS 3GP8A 421PA 1VTKA 4M9ZA 8OHMA 2VF7A 1TADA 4XD7D 4D4MA 2ZRKA 5TARA 5BW8A 1Z2AA 3B1XA 1E32A 3SJZA 4DLRA 4C7OA 4B35A 3UXMA 1JAHA 4E03A 3MWJA 3Q85A 2CVHA 4CDGA 3DOFA 2IS6A 1MV5A 3C15C 1RRCA 4UNRA 1NIPA 4DLWA 1II8B 2D06A 2QRNA 1Z0DA 4HB2A 2IHBA 2QP4A 2NMVA 2BOVA 1AIPA 4N1AA 4B2IA 4V0ME 3DM5A 1KO7A 4UXIA 2ODEA 4KAXA 2VP0A 3PEVA 3T1VA 4LV8B 5J4VA 2EWWA 1HQYE 4NE2A 4Q01A 3CX7A 4URZR 2YHSA 1FNMA 2WBLC 4KHZA 4DB4A 3PEYA 1SQ5A 3CIOA 1J7KA 5FOWA 1FUUA 2ZS9A 2Q9AA 2MMGA 3HU2A 1JJ7A 2IWRA 1AQUA 2J9RA 5EP1A 4DSNA 4AIIA 3X1XA 3U3KA 4KODA 3A1UA 2JLQA 1COWD 5FPHA 5CDFA 3FMFA 2JJ8A 4D81A 1QG2A 1G17A 2ANCA 3FKQA 1FW6A 2PZGA 3NWJA 1ZD9A 2PL3A 1PZNA 5E7IA 2QL6A 3M0EA 4V0OA 2FX3A 2QMOA 2D4HA 2BC9A 2YOFA 3OIUA 5HZKA 3EAQA 4DXAA 4JVSB 3AF3A 3W34A 1NY6A 4FIDA 4ZCLA 2ZSFA 5C1BA 2PMDA 2IEZA 1QHYA 1G8HA 1A4RA 1XD8A 3LDAA 2JJ1A 4OQLA 2FJUA 4WAUA 1NG9A 1W46A 3PXGA 3AVYA 2A5FA 2GJKA 2GZHA 4LRWA 2F7SA 1F2TB 2AR7A 2J7PD 2QENA 2V7QD 2X2EA 2RH5A 4C30A 4F38A 3R20A 1F2TA 3BFVA 3Q7QA 3GLIA 4TYYA 1K5DA 1TUEA 3MRSA 4P31A 4Z8YA 2BBOA 3C4JA 1BYIA 1R10A 5CLQA 1OFIA 1Z6AA 1KI8A 1VCIA 1KKMA 4LHZA 4V0KA 5G3ZA 4DDUA 1F2UA 1W36B 3TW4A 1XTJA 3LY5A 5DN6A 4JLJA 1SVIA 3RHFA 1Z8FA 3ONWA 1E1RD 3NHAA 4US1R 1GZSA 4LY6A 3IPYA 1HA3A 3K9NA 1E2QA 3U7HB 1E2JA 4RZ2A 2WTUA 1LW7A 2LKCA 1QHIA 2EFDB 2GCOB 3NH9A 3PG5A 1CJUC 4XIGS 1XTRA 1S3GA 2XNSA 3FE2A 1VHTA 3EC1A 1WXQA 5G53C 2VIIA 1DADA 1OXXK 2AXPA 3DMDA 2ZUBA 4JJZA 1BS1A 1G1MA 4JT4A 5EXTA 5D3QA 1KSFX 4CEIB 2FE4A 2F3RA 1VYUA 4WZ6A 3GEIA 3U3MA 3EPKA 3KKOA 4B73A 4CEIA 4C3ZA 3LVQE 2RGDA 4DT1B 4DDVA 4LK2A 4MRRA 4OI1A 1LFDB 1Q22A 2LCFA 3BH7A 3VKHA 4IOJA 4Y0AA 1W49A 4NCKA 4IFEA 4Q4LA 2ATVA 1N0VC 3CZQA 4ZDWA 2JATA 4FWTA 2VF8A 1OXTA 3BB1A 1KSHA 5CM8B 4EPVA 2ORIA 3QBTA 3CO5A 2XZPA 4A9AA 4Q4JA 2V1UA 2C5LA 2QAGB 2F55A 1AJEA 2OLKA 2HDNB 1HYQA 3L0PA 3PEWA 4GL2A 1XU4A 2GXUA 3UMFA 5TV2A 2JLZA 5TY0A 3SN6A 3TVDA 4G01B 1GKYA 3I61A 5FBQB 4GT1A 4OI0A 2P6NA 1G64A 5FH9A 3K8YA 2HXYA 2BV3A 4HZUB 4HAWA 1HE1C 1Z6XA 2W2VA 3A8TA 2NPFA 1KZ7B 2QPAA 4ZIRA 1JBKA 1Z3IX 4JBYA 1DARA 1GG2A 5CDFE 3MG9A 4DBLC 1YZKA 3B6EA 1KSGA 1WBBA 4K81B 2KWIA 1NVXQ 2O8BB 1GL9B 3AP3A 2WJVA 1SVKA 2DCUA 4QXAA 4AI6A 4UKDA 5FFMA 5SZIA 2JIZA 1U9IC 3LV8A 3NG1A 2CK3A 1M6NA 1MO4A 4OL0A 3T06B 5JZVA 1XMSA 4W5WA 1G7SA 3HR7A 5GADl 4L9WA 4Q66C 3SU8A 3KQHA 3QNUA 1YJ5A 4P4SA 4EJSB 4DB2A 2PJZA 1XD2A 4N3NA 5BWMA 3B9QA 4IVPA 4OHZA 5KTYA 4L9SA 1O87A 5FOTA 4HB0A 1UDWA 3GLIE 1E79D 1XTKA 1UKZA 3JZMA 5CK4A 2EFHB 3RWMB 3B7GA 2VEDA 2OCBA 2PCLA 1AM4D 3NH6A 1G8PA 2H92A 2IYZA 2NZJA 4B74A 4OI2A 1GNQA 2ZRMA 2FFHA 2WWFA 4RVCA 4CT5A 1S3SA 5B57C 4C0SA 4X8OA 1NSTA 4ACBA 3W90A 1ZD8A 1J99A 3WYFA 5DI9A 4BGDA 4C0HA 2WKQA 3HU3A 3LD9A 5JHHB 4EFMA 5JWRA 1IOZA 4UXHA 1XTIA 4ZV4A 4G5GA 3I72A 1ZNXA 3QI2A 2ZI3A 3NBXX 2J0VA 2AFHE 3F8TA 4UJ5A 1RE0A 2AXNA 2W6ID 4LCBA 5G3YA 2BMDA 3KJEA 4TN1A 3VR5A 2O0KA 1KI6B 4BFYA 2VRWA 2XOKD 3HP1A 3KXIA 3LBNA 3MMPA 5AJXA 3U6BA 3MJRA 1UEIA 2GDJA 2EQBA 2IYUA 1KI6A 2ZJAA 2ZAMA 1CXZA 4ACAA 4PHGA 4ERNA 2FEOA 4C0JA 4ZCMA 4V0NA 2GVDC 1E2GA 4BEBA 3BRWD 3TAUA 3CWQA 4KU4A 4LC0A 4PXAA 5F98A 2A78A 1Z0FA 3EARA 1CRQA 3T1QA 4A8JB 5FPTA 5TXGA 4AG6A 3O8RA 4TSFD 3QVUA 4A8JA 1LF0A 2QI9C 1QRAA 3IEVA 4AY2A 2QRZA 3PUZA 3IQXA 4PQFA 5EE5B 2BHRA 3TUIC 2FV8A 3ZDQA 2NTYC 4M1KA 2JJ2D 3V9PA 2P5TB 4DSOA 1E98A 2OBLA 4R7ZA 1JEEA 1CEEA 3THXB 4TMVA 1FUKA 4XJXA 1EXMA 2GCNA 3B2EA 4QOSA 3BK7A 3EZ9A 3QY0A 4A0GA 4DCNA 1J8YF 2GEDA 2GAOA 2WKPA 3AP1A 2F43A 1OXVA 3I8SA 3PUYA 4NYMQ 3VU9B 4ZDIA 5JRZA 4WXPA 4JL6A 3FKSA 5L3VA 1KJYA 3VU9A 2J3EA 2IS1A 4FN5A 5GJBA 4DRZA 2GJ8A 2ZJOA 4NCNA 3GJ4A 2VH5R 3VR3A 4O3MA 4XVUA 4JL5A 4URYR 4D2IA 4M1SA 3BGWA 1YZNA 2QSZA 4FMCB 1E9BA 5FUYA 3WRYC 5JEDA 4TWZA 2ZR7A 4AURA 4LX0A 2MSCB 1X3SA 4LBZA 3W8NA 2FDCA 1KTVA 4MUBA 4CW7A 5JJLA 5K8TA 5CM9C 4MKFA 1QF9A 5J5CA 1P9WA 2C96A 5D3MB 3RC8A 3ZVRA 1ZUNB 1JXMA 4MGYR 2UVQA 3K0FA 1FX0B 2B8TA 1XF9A 1OKKA 4Q9JA 1DAGA 3KQKA 3THWA 4LJ4A 2V4ZA 2VSOA 4NYMR 2V3CC 3V4FA 3WY9A 1ZNWA 1SXJE 2FFAA 4QG7A 2B21A 2ZRNA 4AC9A 1Z0JA 5F3WB 2OT3B 2XB4A 1MABB 3K1JA 3L82B 3QPVA 4GMXA 4KFTA 4GSYA 2C77A 3S1AB 1N0UA 1WE2A 4ARZA 1K8RA 2WKRA 5EZ5A 2NOAA 3NDBB 2JJ1D 5DO9A 1KI9A 1W36C 4GP7A 2R6CA 2WIAA 4MGIR 4XD7A 3OFNA 4Q7LA 2OAP1 4YXWA 2QMEA 1CR1A 1JR3E 2NPIA 3ZZUA 3QE0A 1E2MA 4DSTA 2K5UA 2IL1A 3HJNA 2PLRA 3KKMA 2RAPA 4Q19A 4L15A 4ZPXA 1CJMA 2VBCA 2FSIA 1JB1A 4L16A 3X2SA 3SBDA 4RCYA 3P4XA 5DN6D 4PHTA 4MH0R 4Q1FA 1GILA 3K09A 2Q9CA 2JDID 1ZYUA 1S8FA 3SC3A 1N6NA 1SKYE 3ICEA 4Q1DA 2CEAA 2ZQ5A 1GL6A 1SULA 4URUR 3W5IA 3TE6A 1XPRA 5K8UA 2FPMA 4OK6A 3A58B 1MO6A 1S9HA 3KL4A 1N6OA 1N5KA 1G3UA 1QHHB 3EWSA 1NIJA 2HYDA 2VSFA 1WBDA 3DDCA 5A0FA 1Z0KA 2G3YA 1IY0A 1QHHA 3W6PA 4QJ3A 2GA8A 1SVOA 3UATA 5EE3A 1GWNA 1GITA 1R0YA 4C2TA 2EYQA 221PA 1QZXA 1RYFA 3B60A 4IW3B 2OESA 3EX7C 3KUDA 1VYVA 1G3QA 3RRMA 4B3FX 1CIPA 1E99A 1XP8A 4DEYA 4M1MA 2J41A 2QAGC 4D4LA 4OQXA 1DG3A 1X8JA 2WJJA 3QBVA 4MYTA 1N6LA 1PUJA 4QHYA 1KK3A 2OSBA 1G3MA 1QHNA 2FSHA 4OJKA 4DCVA 1U98A 2BKEA 4PQRA 5LB4A 4DUGA 3WBKA 4DIEA 1E4YA 4DDTA 2JEOA 1ONBA 2O52A 3B8HA 2RGEA 4D80A 3KJIA 1XTSA 3OZXA 1XMVA 4A82A 5HTKA 2VHJA 3L0IB 4QGAA 2C2HA 4RKEA 4P0TA 2PZEA 4LPSA 4IOLA 3HYTA 2RKOA 2ASEA 3RABA 2QEQA 4PSAA 1EFUA 1T6NA 2R8RA 4URVR 2A3RA 2J7PA 1WMSA 3B1VA 3X1WA 1LTQA 1N3BA 1TEXA 1IJFA 1W5TA 5FBLB 4GZLA 3TIFA 4QNMA 2DWPA 1ZBDA 4F4JA 1X86B 4MQBA 4D82A 2Q21A 5JI3E 1K5GA 5H1YA 2BJVA 3OAAA 1N5IA 2DFKB 2OO7A 3EZFA 1DAFA 3QKTA 2AN9A 4UNPA 4QNRA 2ZAOA 1E1RA 1KO5A 1U2RA 2R6DA 2I1VB 2Z0MA 5JWHA 4AKGA 4DLXA 1P2VA 1AA9A 4LV6A 2G77B 3AGPA 4EJSC 1GVNB 1VDZA 4O2LA 3EW9A 2ANBA 2JIZD 2N46A 4A2WA 2HT6A 4HUTA 2CK3D 4FCTA 4M0LA 3MFYA 5DNYB 1BIFA 1R2QA 4HAZA 3IUYA 4B76A 4QGFA 1Z6GA 3MJHA 4YQFA 3N2EA 4Q1BA 1I4DD 1CLUA 3CONA 4C0LA 2XZOA 2AFIE 3FHCB 2A30A 1KSJA 4MKGA 5FUVA 3SFVA 4JKYA 1XCGB 3IO5A 2VP6A 3K0EA 2ZSAA 1VIYA 4CF7A 1T8TA 2IF2A 1E69A 3GFPA 1YZGA 4LWZA 4F4CA 1G5RA 5ANRB 2BM1A 1EWRA 1TUIA 4G5QA 3SHFA 4OQFA 3VR4A 4K8OA 3Q5DA 1VG1A 5CYOA 4B33A 3EA5A 1IN5A 3BBPA 2OXCA 3L2OB 1AS2A 3A6PC 2B92A 3CRQA 3E70C 1R6BX 5JS8A 2IK8A 4U5XA 1RVDA 4RD3A 2ZI7A 3LBHA 1FTSA 1MKYA 4M9QA 4FW9A 4OHWA 5KYKA 4IRUB 4ZDJA 1U94A 3M4YA 4DKXA 1IXZA 1ZP6A 5BN5A 3EA0A 3C7KA 2OV2A 2J0SA 2YOGA 4IDOA 3H2YA 1N6IA 3LVRE 4LYFA 4LYJA 3UMSA 3I5XA 1G7TA 1JR3D 2OXRA 4PHHA 4Z1MD 1R8SA 1HH4A 1T4GA 4WVFA 1GOTA 3TW8B 1UBEA 2EW1A 2CE2X 3GCGA 3LA6A 4E09A 4TMWA 721PA 2QQEA 4A8JC 3CX6A 4CZ2A 2YOHA 1E2PA 3GJ0A 1JR6A 1TQDA 3R9IA 4ZDKA 3U60B 1E3MA 3UG6A 4TL9A 3A4LA 1E0KA 5DLQC 2JLUA 4N0EA 2ZU0C 1ZM4A 4NU0A 3CRRA 1X1RA 3ZS8A 2JCSA 5FPYA 3MUFA 4OYHA 2WAXA 2CE7A 2QT1A 2V9PA 1VYTA 2CCJA 4M1TA 1RW4A 2F1IA 4PX9A 4JYBA 4DLZA 3ZQ6A 121PA 3H1TA 3QVVA 1C9KA 2A5YB 1P5ZB 2CBZA 3WYAA 1FP6A 3IEUA 3RVBA 4OQMA 3UANA 4W5JA 3K9GA 1H8HD 2YVUA 1DAIA 1NRJB 2FZ4A 2CHGA 4WXRA 1NI3A 3NEJA 1OSNA 2CXXA 1BYUA 2ECKA 3LFUA 1KKLA 4NKRA 4GOJA 1M7GA 5JEEA 5JJIA 3A1WA 5AWFC 4B71A 1I2DA 4H1UA 4EFNA 1XXHA 5GVRA 5CITA 1G8YA 2F9LA 4I81A 3AGQA 4FCWA 3FMOB 3CZPA 2W58A 5KO2A 1YZUA 3FKSD 3ASZA 1G20E 1XPOA 4A0HA 4OHXA 2ZXUA 3AM1A 2GXQA 1P73A 2QM8A 3NBYC 4A6PA 4AD8A 1FMJA 4NYIQ 3FYHA 2EWVA 2QSYA 4IHQA 5AJZA 2ZROA 1G7RA 4LGMA 5AJYA 1P75A 2W6IA 1KI7A 2XNDA 3RNLA 2P67A 4D25A 1FTNA 5FTJA 1AS3A 1L7VC 2B7BA 3SFZA 3A4MA 2D74A 4PSVA 3ADDA 1SHZA 1T3HA 4DLTA 5GVSA 3ZLJA 4LPKA 1VG9B 1G3IA 2EFEB 2WPDA 4DCUA 5IHPA 4IDQA 3TGPA 5L3RA 1SVMA 3B1ZA 5JHGB 4QM7A 2VHCA 4N0DA 3RS0A 3U7FB 4Q5IA 1OH8A 4QBGB 1RJ9A 4RFSB 3VHLB 4A15A 1XCMA 5CJ2A 2UZ3A 2VP4A 4HDCA 2CHVA 1Z83A 2NO6A 1U8ZA 4NYIR 1HE8B 1E1QA 1FPMA 2XGJA 1YE8A 3AKDA 2IEYA 2JJ2A 4QGGA 1Q1ZA 4MGKR 2FN4A 2W2XA 1G19A 1MRNA 3OFND 4LHXA 3RSLA 621PA 3T15A 1S4QA 4C7OB 4YXWD 3WMFA 1P61B 4IVQA 3TH5A 4HUQA 2ZETA 4EPWA 5AUOB 4K46A 3UWOA 3L43A 3DZ8A 1QHSA 2FZLA 2KBFA 2ZRBA 5JJKA 3ZVLA 2P5SA 3QPWA 1NJGA 3UK6A 3SYKA 1XMIA 2DFLA 3TMKA 4Q9KA 3IO3A 4M22A 3K0AA 3TSWA 1GNRA 3BD9A 3ZVMA 4DWJA 1ZC4A 4JT2A 3G0HA 1OXSC 3L0SA 4W5HA 1A2BA 1MO3A 4L8GA 1I4TD 1NVWQ 4TTQA 4V0LA 2ERXA 2KJQA 2ZRDA 2OFOA 4X8HA 2G1JA 1D2NA 2AHOA 4IDPA 1MH1A 1YZQA 4RSGA 3BC1A 5J40A 2N1BA 3TBKA 1UKEA 2GILA 2JLYA 4TL6A 1GKIA 2DWOA 2NO0A 3VR1A 4Q9LA 2DBYA 2HJVA 4PAOA 3CNNA 3RAPR 3VNVA 2WWHA 3ASYA 3IHWA 2HXSA 3Q7PA 4EQ6A 1JALA 4D6PA 2HF9A 4PC2A 1UDXA 3LX5A 5M04A 4KFSA 1AK2A 4WOPA 2P0EA 4H9GA 1E0SA 4R9UC 3KKPA 1D9ZA 3AVXA 2WWWA 3RRNA 4A2PA 2AD1A 1F48A 1U8YA 2A2ZA 1RC8A 1RKBA 1XXHE 1DOAA 1AZSC 4HAUA 4Q9IA 3CH5A 2RGGA 2KSQA 4F93B 1S1CA 4DUGD 2IXEA 2FNAA 2ORVA 2QTHA 3SZRA 3ZGXA 2XZLA 3VMFA 4M8NE 2E1RA 2CHQA 1L8QA 2RCNA 5SZKB 2XX3A 2YYZA 3R8CA 1KDTA 4UJ3A 1CULC 1IN6A 2ZJYA 3V4RA 2IXGA 4IEIA 1RRFA 2ZVQX 2CL7X 4JBXA 2BBWA 1E2NA 1N6PA 5P21A 3OEED 1TX4B 4TQ9A 3OE7A 1GSIA 1EX7A 2ZRPA 1WB9A 3GLIB 3QKSB 1OXUA 3U4QB 1KDPA 2X1VA 1EFHA 5J4HA 3SJAA 4PZYA 2Y8EA 3PR1A 3QKSA 4TT3A 5F2EA 2YKGA 3U4QA 4JYCA 4JLMA 2D7CA 1F2UB 3FFBA 3OAAD 3R9WA 1CS4C 3QOFA 1R0ZA 5EP2A 2PX3A 1JQJC 4LJYA 4P33A 3FFAA 1JI0A 2JDIA 3GJ8A 4QJ4A 4YDHB 1XJ0A 2H5EA 1A82A 3JZAA 1QG4A 4DLYA 1NP6A 3QXXA 3F5FA 3DL0A 4FXPA 1XEWY 5JFGA 3ADBA 3IBGA 4OK3A 2ZEJA 3O47A 3ZD7A 3OIYA 1Z07A 2BWJA 3MWLA 1F5NA 3AVWA 1B0UA 1NN3A 4QC2A 3GLHE 1ZVQA 5AJVB 3SS8A 1JQLB 4I1OA 3SOPA 1G291 4B44A 3D6TB 1Z28A 1MR3F 2KE5A 3OF5A 4A92A 5HCNA 5FOVA 1UADA 1WRBA 3DVLA 1OFTA 1GP2A 3KFVA 4R98A 2ZJ5A 1FNNA 1S1MA 2BEJA 2J7KA 4JLDA 1XTQA 1N6RA 3KX2A 2IT1A 3SI7A 1Q3HA 4WA7A 1DBSA 4B47A 5EQTA 2ONJA 1UM8A 2Z4SA 3AKCA 4Q4JB 2RHDA 1K6MA 1U99A 1E6CA 4JVMA 3QEJA 3IIKA 4P3YA 1N0WA 2F6RA 4A36A 1FQJA 4Z8XA 2IS4A 1J70A 1ZM9A 3TVTA 1WDTA 2H57A 3V00A 4C0KA 4HZIA 4RD6A 2L0XA 2NQ2C 3I92A 4MYHA 2QNRA 4ZIRB 5ELXA 1KO1A 1N6HA 2NO1A 3TQFA 2ODNA 4KSBA 3TAHA 3LXXA 1P60A 3LO5A 2B8WA 4R2HA 3ICQB 3U44B 2QN6A 4TLCA 4OI4A 1Q0UA 3U44A 4Q1AA 5KSYA 5A5GA 5AR1A 1D5CA 2ZANA 3PUVA 2C04A 4Y0VA 2GK6A 3BXZA 3ZYCA 1HV8A 2QPOA 4ESHA 2GNOA 3KKQA 1W4BA 3BH0A 4P4SB 1XD2B 1XZQA 2HF8A 4EFLA 2W6JA 2GF0A 3SNHA 3EIQA 3ND9A 1OYYA 3AKEA 1YRBA 3I3SR 2ZVPX 3U5ZB 4QHTA 2FGKA 5TDHA 1SXJA 1IN8A 3AF1A 1UBFA 1W4RA 3X1ZA 1PV4A 4GZMA 4XVQA 2W83A 2IUUA 3REFA 2ZR0A 5BQ5A 4DCSA 5JRJA 1G41A 4FMCF 4Q7KA 5KNCA 5KPDA 1EG7A 3KJHA 2JGNA 5IRCD 4D0LB 4BFXA 2GJAA 5KNDA 5LBIA 2RGNC 5AK0A 2WWIA 4LJ9A 1XB2A 4IDHA 1Z08A 4TL7A 2IWHA 5LDDC 1Q1QA 2PT7A 3A1TA 1JR3A 2NG1A 4Z1MA 2ERYA 1U81A 3KUCA 3K9LA 4PR0A 3EZ7A 4DCTA 2XNDD 1Z06A 2IF0A 1XJCA 4LDJA 2BVNA 4LBWA 3CBQA 1Y63A 4RZXA 4CT4B 2CJWA 1E0AA 5L3SB 3GMTA 4IEEA 4XSHA 1DAEA 1UAAA 2A5JA 5L3SA 2ZSDA 4G5OA 1SKYB 3RS7A 2RMKA 1KO8A 1X1SA 3ECCA 1OFHA 1US8B 3RRYA 5CJPA
chains in the Genus database with same CATH superfamily
2WPDD 4MVYA 1GQ2A 2I55A 2I66A 4BRSA 1AKQA 1US8A 4CMEC 4GPAA 4CI9A 2AWNA 4HKTA 3PZRA 5E9AA 3C6XA 3C3KA 1G18A 1SUIA 3KSMA 4N0MA 4NH4A 2BSAA 2ZU6A 3UV6A 1QBGA 2IKSA 4NJMB 3P2EA 4BJHB 3ZDEA 2GPSA 3DEHA 3FWPA 1Z2CA 4NJMA 2G5PA 2ECOA 4MYDA 1H8HA 4BQOA 2R44A 4A1FA 5J43A 5EE0A 1WSAA 4M6WB 1SZDA 5KSZA 1XTUA 3DOCA 4AJEA 1U3GA 2A9OA 1CNEA 3K9FC 4UM9B 3N0XA 2HK7A 1G5TA 3SBEA 1ZN8A 2F43B 3L92A 1EAYA 1KQGA 5EXEA 1VPWA 4OUDA 5FLYA 3DXFA 2BSQA 4HK4A 3ANYB 3VQTA 1DQYA 3B3FA 3CPJB 2EGHA 1R0XA 4KVGA 4GLFA 5GIOE 3FHTA 1H2HA 3I5MA 4R2WA 1U7DA 1T5SA 2I4NA 4NZMA 4KACA 4RHEA 4AS3A 4TUYF 1Z88A 4RHUA 5BN4A 3P20A 5D6NA 1FOEB 3PDJA 3PGXA 3LUJA 1XZPA 3UAVA 1KYIA 3ITNA 2AMVA 1Y8QA 2AQKA 2RG1A 3G13A 4QYIB 2PNJA 2VDOB 5KTTA 2QG9A 2WRZA 1RHQA 2DQKA 2RHJA 1GJRA 1GXSA 3FWYA 3ID6C 4QYIA 4EELA 3BDAA 5EZ6B 5SY6A 4GKBA 4TMYA 3BB3A 3COZA 4S1OA 2P2YA 1P18A 3WIVA 3PLNA 1H3FA 2Q8QA 3FVWA 1ISRA 3VC7A 1ZIOA 1SD5A 1NZJA 1UP4A 1KAMA 1VIMA 3HG7A 2XVXA 3HZOA 4I3HA 2ZRCA 4I8XA 1VBNA 1E2IA 4DLAA 2WU1A 3DMGA 5EJ6A 2EFYA 5AVXA 2QTTA 3L0OA 2CCGA 2B25A 1HSZA 2QL7A 3U3DA 3KZCA 1MOQA 4TWRA 1TC2A 2Q4DA 4A91A 3ACDA 5H02A 4XWGA 3DKIA 4QGHA 1DDIA 2QN7A 3FOWA 4ARZB 1ZCFA 5EWLB 4ZT3A 3V8MA 1PS9A 3VRHA 3RSZA 2AFIB 1NBME 1W47A 5EWLA 2QE7D 2FPWA 2IPNA 1JEQA 4XTRA 2JGMA 2QP9X 5SYNA 3HSYA 3D6NB 4TLAA 2IUTA 3SF8B 3PT9A 2XJ9A 1QFZA 5BURA 3W5AA 1N2HA 2R3SA 4EG7A 1L4LA 4ZTBA 1RE1A 3PNOA 1N2CE 3LQ2A 4Z4FA 3A2LA 4KR6A 1UKAA 4BUJA 1F3LA 2JBAA 3IULA 4QBFA 1K1EA 5CGZA 4CMAA 4X0EA 2REXB 2WWGA 4ZALA 2O50A 2GKOA 3TR0A 3M34A 4BYMA 5B3KA 4NP6A 3RUAA 4CNBA 3DVRX 1GZ4A 3VSDA 4CF5A 1WY5A 2INGX 5B58C 3HM9A 4IFTA 1NUSA 2V6JA 3FWKA 3KPJA 2ALJA 3IURA 4UPVA 1N3LA 1WF6A 2PWBA 2ZE5A 3FM9A 2HA0A 3OE1A 1MAVA 3FPHA 3QUAA 4OLHA 4POAA 2AX4A 5DTQA 5JW6A 3RRZA 3KR2A 3MS7A 1NKVA 1N8NA 4V2UA 4MUNA 4L75A 3GJRA 5A3SA 1EUCB 1TZMA 2WWXA 1ID1A 2QLNA 1ENZA 3EIXA 4MKIA 4B75A 3PHJA 2HHAA 1IDOA 4IDDA 2F1RA 1SK8A 1EUCA 4X85A 5K8LA 2I22A 3IPCA 4AUMA 2IC5A 3T12A 2W6NA 2FRDC 2WA2A 4FQ7A 3PENA 5KWVA 2EFCB 2MT9A 4FMPA 4M76B 4RPCA 2NIPA 4DNXA 1EE9A 4IIGA 4RSRA 3TLAA 3I1YA 4G86A 4GMDA 1M8FA 4EI7A 4X7RA 3CJQA 3DUFA 1CG6A 1F9EA 3H3FA 1JL3A 5TJ9A 3TR5A 5JXWA 3CNOA 1KFJB 4TYPA 3RS2A 1O4VA 3I9V6 1N0HA 4NHEA 3UJ7A 3Q9LA 4N9QA 3K9QO 5IT0A 2EIHA 2O6HA 1RYYA 2SNIE 4BVKA 1TXGA 5HFJA 4C3VA 1SY7A 3C1TA 3Q9UA 2ZIAA 4CLDA 3RBXA 4U2EA 3RV3A 3OCUA 2WMOB 3KOYA 2IYLD 1TMGE 1WEKA 4NENB 4HVAA 1PL0A 5E4YA 2CLIB 1C3LA 5IHXA 2DXIA 1PHRA 1A8HA 2RH8A 4N3BA 4R1LA 2IOYA 4BO2A 2G7ZA 1PDOA 2ZWMA 1J22A 1UZLA 5AM3A 4E33A 5A4JA 4C6RA 5EYPB 1EXDA 4FN4A 4NOKA 5LBTA 2WHXA 1O08A 1D0VA 1PEYA 3IBYA 3HCWA 2ZDQA 4HAOA 1W59A 4XASA 4M1ZA 5FUWA 4A4DA 2V5AA 1KO4A 3C1AA 3B78A 4HNAA 3MT7A 5DV9A 2G17A 1ZN7A 3RC1A 5C32A 1EDBA 1L7RA 4MUKA 5KYYB 5DTIA 4J1TC 2CLSA 1PO7A 4YMHA 5KYYA 1RZRA 3A3YA 2R5NA 1SN7A 1O3YA 3HEMA 3JVEA 1IUNA 4YEDA 1NJ2A 1G20A 5ALRA 1H93A 3ME5A 4JZKA 3K8OE 3CLVA 2J9FA 3LXRA 3SJUA 3TOXA 3ZCXA 4TRMA 5KHOC 5KKNB 1DBQA 4GL4A 4B2LA 3FNEA 3E0QA 4ZCPA 1A1VA 2NTVA 1R8JA 4P86A 3JARA 4ZU1X 5U4QA 4MRMB 4D8XA 4WDRA 5A7GA 2XTNA 4ZJPA 1B8PA 1PQPA 1YOBA 2OD7A 4ZYUA 1FFSA 1B4DA 4LKRA 1RKXA 2XTZA 4PPYA 1XA4A 3U0BA 3A0UA 4D4JA 3QLVA 4LUCA 1RFGE 1ZGCA 2UZ0A 3KXPA 3OT1A 4C0BA 2OBNA 4C43A 1N25A 2IOQA 2RHRA 1Z34A 2VHXA 2GD0A 3ZD9A 4AY4A 5CB8A 3QX3A 2CFIA 2J3IA 2W6JD 1QTRA 5BMVB 2WIDA 3MB8A 5D1NA 3IR5A 1ZH8A 5BMVA 4LHWA 3DBHB 1A9ZA 2WIKA 2XCQA 3F7NA 3GW8A 3IMEA 3QLEA 4J0HA 4TYMA 1YWGO 3TLEA 4PTLA 4ITUA 5KDOA 1DDGA 2ECFA 4K87A 2DQSA 2ZSEA 3ND8A 1MC8A 5KUTA 3KTAA 4WBNB 3OZBA 1ZGAA 4PAQA 1KMNA 3TL2A 3SLRA 2J9XB 3FXAA 3KYIB 2D2FA 3JQRA 3THOA 5KNCD 3AJDA 1PNQA 2FW8A 1SVNA 2BMFA 4L4XA 2QX7A 4AMGA 5E38A 4E7PA 1C4OA 1VM6A 3C7AA 1QBKC 4OKSA 1GZVA 1A9RA 1ZISA 2UUBB 2RE8A 2A9RA 1HL3A 3A6EA 1YBAA 3UJ6A 3C5VA 3EWAA 4HL6A 1V43A 3QKRA 3CG4A 2J0EA 3IAM1 4R0MA 2FSGA 1BJTA 3D4OA 1SVWA 2ZBGA 3ONFA 5C53B 4P7FA 1C4XA 3QYPA 4NBSA 5FWXB 3UKOA 3GLFA 2I54A 3ZI4A 3OU7A 4IKPA 2OCAA 4CIBA 1EVYA 4TXJA 1ZK3A 3HJAA 5BW6B 4WZBE 3LX8A 3IP7A 5G0WA 4D56A 2BONA 3RUIA 1NQUA 5H5JA 2DY0A 2WABA 1XMJA 3PQ5A 3G7UA 4O4LF 3B3GA 1L6RA 2ARKA 4HFJA 2UAGA 4YALA 4PLHA 3W5CA 2ZRFA 4OX9B 5AK6A 4CG3A 2HKIA 4G0WA 3AY7A 5T4EA 2QROA 2ZYTX 3L8MA 3FUVA 2PUEA 5HFNA 1VA5A 3I83A 3SKVA 4KIUA 1SOVA 3M4NA 4WBXC 1PFWA 4RD2A 5AVRA 1WQ4A 3P27A 2O4UX 1JHRA 4ZVOA 1G8JA 5DT9A 1HQDA 1MJNA 5IAEA 1ONSA 2CLCX 2QM7A 1GCOA 2ZRJA 4X65B 3ISVA 2B78A 3L1KA 2ETXA 3HWRA 3K6JA 3AF4A 2I71A 3OLQA 4ZU3A 4IQGA 4N49A 1OASA 3OY2A 1SXQA 1EXWA 4RK7A 3VU8A 3D0QA 3M4JA 3VOBA 1ABEA 4XSVA 2IIQA 2X6TA 5A4AA 1DQPA 5JYEA 1VPVA 3DLBA 4FFVA 2E18A 2QXUA 4DLKA 2C95A 3PQEA 2P3SA 4KBGA 1L5NA 4G1CA 2IE8A 3CR7A 4KIGA 2CHFA 1KAHA 4QBHA 3B9PA 4W9MC 1UJBA 3TK1A 2JGEA 1M8KA 3LUBA 2QORA 2ZB3A 1V8BA 5KNLA 3ZCRA 1JAYA 3CRMA 5FWDA 3E61A 5EEGA 1IDN1 3LDFA 4AMYA 1GPLA 5HR5A 1LLFA 1FVHA 1P3JA 2YJNA 4LHVA 4CT0A 2H2HA 5A7HA 2BJWA 4MKRA 4YMIA 4Y2UA 1TMKA 5DFAA 3LUPA 3AXSA 3IJEB 4PYNA 7ADHA 2LCQA 3U5TA 2C7QA 2P5UA 4EDHA 4IDCA 1T43A 3C48A 5B2ZA 3DB1A 4EKEA 1F7UA 4LHYA 2WUFA 1ZVJA 3K31A 5HZHA 3BD7A 5BSWA 2UXBB 1R6XA 2ZRGA 1EIZA 1GTJ1 3EVBA 1CUZA 3NGMA 1JBQA 1GDDA 1GM5A 4ENPA 4MMYB 2GBIA 4OVKA 4WDQA 1GR1A 1EJ6A 4C05A 2RHCA 1AVTA 3R6WA 1EINA 1B3BA 1OC4A 3T35A 5IZCC 3WR5A 1OAOC 3DZKA 4KO4S 5CLFA 4N7BA 4MGEA 3ZLTA 4V02A 5G0TA 2WWYA 2Y1GA 1K27A 3CPHA 3NTUA 3W7AA 3ORRA 2AR9A 5F2NA 3QG1A 2W2KA 4JSRA 3VYRB 1KORA 5E4TA 4KLRA 5F23A 4IHKA 3RTDA 1F8GA 3DZDA 4KI0A 5K3SA 5BY2A 5ICSA 1CU1A 4M1OA 1FSPA 1TM5E 2JKVA 1TYBE 2RB4A 1PK9A 3TNYA 4RKQA 5LOVF 1H66A 3AI3A 1FLVA 1HURA 2Q1YA 2FZCA 4KWEA 3MTGA 4C29A 1P5FA 5AQEA 3IDQA 2PZ8A 5TRTA 1UBRS 2BE9A 3OMWA 2QR2A 3KZVA 3AUYA 3FGZA 2GEVA 5DOVA 4TMZA 1A97A 1KI1A 1ZUWA 4AUKA 5FI0B 3E9MA 3FF1A 2Y71A 3IBFA 1GZUA 5LYJF 3IUPA 1LB1B 1TLLA 3AUAA 4CLHA 2COKA 1IQRA 2QL5A 4A23A 1EESA 2C78A 3ABRB 1VPLA 5ERGB 5TMPA 4YONB 1P44A 1AQNA 1XJWA 2AG6A 1QQ5A 1PT6A 2FFJA 3GLUA 3JZIA 3R0VA 1QK4A 3ROZA 2P3OA 2C61A 2Q2WA 4C1NA 4I50B 1DKQA 4MV5A 2BE7A 2QT0A 3R5HA 3TZHA 4TT8A 2JFVA 4OB7A 1ISPA 3AVVA 5ESDA 2ZBUA 2JS7A 1CJCA 5F5LA 2PUGA 3NUQA 1ZVVA 3WG9A 3U37A 5IDQA 2CVPA 4QWWA 1TJ5A 2WVJA 4IGIA 3S2GA 4ZCIA 5JZOA 4FJ2A 4QFDA 4YAFA 4PAWA 1ORDA 1YHNA 2ZIEA 1J5PA 5SY4A 1FYXA 1YDHA 1ZRSA 3IUJA 2EG5A 3H1BA 1HE4A 1TB4A 3A7EA 4EQ6B 3PPWA 3QHPA 1B0ZA 4QVGA 3KLNA 2HI0A 3FCUB 4IJ6A 1A04A 1JPJA 1CUCA 3NKFA 4AJKA 3CVXA 3U81A 2GLTA 3OJ0A 3HI4A 3ILSA 3L7MA 3GN2A 3T4PA 2G36A 2CLDX 4S1PA 4X1KA 4ZQFA 4BMNA 3MJCA 4I1IA 1II8A 2WTEA 3DOOA 1Z15A 2PH1A 4KQGA 3EFOA 4QEZA 1A4UA 1H0HA 1HBJA 2AYZA 2L18A 5AYVA 2BMVA 1Z2OX 1RCFA 5COAA 3IYLW 1SZPA 1ACJA 2FX2A 3K0KA 1FYDA 4RAOA 5H81A 4EDFA 3UMYA 1XA3A 1Q3TA 2XD9A 3P0JA 4RHTA 1I8TA 1PVOA 3NHKA 3SYRA 3ZY4A 5J4KA 1A2OA 1HL7A 1A5BB 3BE4A 1NHGA 3VDMA 4DLSA 3ZVKA 4GRAA 4RADA 1XTVA 3QVKA 1GYRA 1S9DA 5JVDF 1NFQA 3KJQA 4A2QA 5B6JA 2WQZA 1TTQB 5DSTA 5BV1A 1ETUA 3B6ZA 3V4VB 3E81A 4R68A 1SM4A 5IJZA 2DPLA 1T9AA 3I62A 4C4RA 1IHDA 1JI3A 1NONA 2HK6A 1RLTA 3NIBA 4C01A 4JLWA 3WSVA 3BFKA 4KSCA 3Q7EA 1MOZA 1SUWA 1SCIA 1U2DC 2BGTA 1FFHA 2PL5A 3PNQA 4M9SA 5E1BA 4WLNA 3RT1A 4ZN6A 2P1RA 5EMKA 2VUIB 3Q9NA 4FLFA 4KE7A 1X9IA 2P9TA 1U1IA 3EISA 3NWPA 1O95D 3KSRA 3WGZA 1BU5A 3DQZA 3QZUA 5TQ2A 2VSNA 4F8EA 1YR8A 3WLSA 4X7MA 1Z2NX 1SQSA 4MR9A 3UB2A 1I0ZA 5B64A 4I5DA 4LHEA 3RIYA 2HSDA 3BZUA 3M1IA 4WCVA 3ONEA 2EZUA 4JH0A 3RHSA 3UMRA 2E3JA 2VQFB 2W6PA 1CQXA 3L6RA 5J4LA 1E59A 3BHMA 4HRYA 4PTYA 3ZC3A 5E1MA 1OJLA 2RI1A 2B1JA 4FUTA 5REQA 3TWOA 1H1LA 2UZ4A 3LG2A 4P32A 4X1OA 4Q48A 1HTBA 3SYMA 1W5FA 1IRIA 1GGEA 3RC3A 2NT4A 2KPOA 3RS4A 1Y3BE 4F2WA 1TECE 4F7DA 2C9CA 3K6SA 1VMKA 3U6KA 5EVJA 4JVNA 3VYSB 3ZGVA 5ICMA 1DAKA 4IOKA 2CJXA 1XD9A 4ON9A 3W2EA 3GH3A 4AN4A 3EGEA 1XCPA 1QYRA 5ARDA 4I3GA 1H2RS 1T10A 1IONA 2I3BA 3ZIAD 4J9UE 1M2FA 1JHPA 1PYGA 1OH6A 1Z13A 4WOKA 4Q82A 1Z4IA 3C5HA 1GR0A 1L3BA 2WJPA 3AUKA 4ILEA 1KE1A 2GEKA 1U3DA 5E0OA 4NZOA 2NO5A 2ZSKA 2HPVA 3VVLA 4BO6A 5IDVA 4ZGWA 1MB9A 2GN2A 2Q6TA 4RMJA 3JQ8B 3MJDA 5I7RA 3E9RA 5I48A 4A5OA 5EIEA 4PR3A 1QZUA 2XCUA 3GLGB 3LKZA 1QORA 3B70A 1VP9A 4L3VA 4EY6A 3N86A 5FI1B 3GLGA 4PC6A 4AMZA 1NYQA 1X42A 1WETA 4OHYA 4FSDA 3QXCA 3RVQA 1ADCA 4PNPA 1V39A 5EOVA 1KARA 4H60A 1QV6A 2BKLA 5J2TF 1IWOA 1FP1D 5FUXA 4BQPA 1SKAA 4YV0A 4DJAA 1IY9A 1GG9A 1XBTA 5LC1A 3QUQA 2X42A 4FCVA 3HV2A 3V32A 2QK4A 5HW0A 1W8DA 3HCRA 3GEEA 1BRMA 4GXNA 1DRUA 2ES4A 4N7JA 2PUCA 1BO6A 2ST1A 5CXQA 4UPEA 5HM6A 4HDOB 5TF0A 2XWQA 3S55A 1N9GB 3AH8A 3LQKA 3D8TA 2QAGA 3ENWA 1YZ3A 3R75A 2HOQA 2H1HA 5EQDA 1NQWA 4X8LA 2BSXA 5CIQA 4P7GA 3VR6H 2YV5A 3OETA 1NLZA 4BNMA 5ITZA 2JC3A 4CN9A 4EG5A 2OV1A 1NU6A 5H9VA 2EL7A 3G2QA 5BQOA 2H48A 4HZUA 4E6EA 2IDMA 2ZATA 5GJWC 1AGRA 3BDIA 3HR8A 3SX0A 2V55B 4U02A 1AV7A 2I67A 2XSZD 1G5QA 2ZITA 2JGAA 4M9UA 1TPZA 3AEQA 1BDMA 3PJGA 4FC7A 4QTZA 3TSYA 4CMBA 3K70B 1XPJA 3H2SA 1TTHA 4L8WB 1JA9A 2C0CA 5K3DA 2O5EA 1ZOSA 2C2WA 1LY1A 1XNQB 1OVMA 1R18A 1Z2PX 2WAAA 2O8BA 2Q3MA 1MC1A 4BLQA 1E3JA 2BDUA 2Q6VA 3RR2A 5EJAA 3O3NB 2LBPA 1NNEA 6REQB 3CSSA 1YH3A 4B3XA 3AL3A 3V4LA 3QVLA 2P11A 2X7JA 5EJFA 5EZSA 1A9XB 5FTMA 3CYFA 5ALKA 4ZD6A 4NJEB 1JFLA 5CVVA 4PFSA 3QIAA 1TPYA 3WGIA 5GV8A 1Y9EA 4MAAA 4NG5A 4DC0A 2OCXA 1VJ0A 2GSDA 2VWGA 5DYNA 3TI7A 5JATA 1FLNA 4BPBA 2JJMA 2BCJQ 3DAFA 2YVAA 1E5QA 2ZE7A 4I4LA 2AE1A 4EJSA 4ZI3A 4CM8B 4KR2A 1R6TA 4WY2A 4RLHA 5LQNA 4HYEA 4MDEA 2HA6A 3Q7RA 1T2UA 1EE2A 5HP4A 3RFVA 4WI1A 3DVAB 2O2YA 2NXWA 2C9YA 3F98A 4JY7A 1WZUA 1HT0A 3H86A 1JQ5A 4CKWA 2QUBA 3GFTA 3N7AA 3GAAA 1C0LA 4G97A 5IAJA 3PDUA 4FLMA 1XZDA 3USES 4DS3A 1T8YA 1LTHR 2QSJA 3E9ZA 1G9XA 3LW7A 3P52A 4ENSA 1EZZA 2NGRA 4GZ5A 2ZIGA 2HSZA 2QY6A 3B5EA 1B41A 3G6WA 4RS4A 1KOGA 1JHDA 4Y2TA 1WVMA 2H2AA 2IUFA 1YKSA 3QLUC 3RLFA 1ESMA 1IU9A 1ZUIA 5K6TA 4U7DA 3D1JA 3F8WA 1IUOA 3AR5A 4TXNA 2VDVE 1KYYA 2BJHA 4FB5A 4B7XA 3A1DA 1FZQA 4KQ9A 4AZSA 4XWKA 5LN1A 3IUEA 2PSDA 1RXVA 2W6ZA 5LZ2A 1H2YA 1NX6A 3K53A 5DBEX 1OT3A 2TS1A 1T1JA 4GOND 4EL5A 3UO8B 4B40A 4D42A 2ZJ4A 4TMFA 4NAVA 3UAGA 3WTCA 3A37A 3IX7A 5EGNA 2D00A 2OQIA 3DDOA 3HB5X 4YRDA 3L93A 3GRYA 4GI7A 2YHIB 4JMLA 5DLYA 2QVGA 3HCAA 4XX0A 5JXHA 5LD2C 3ENQA 3SD7A 4V0QA 4G9EA 2Y27A 3HGMA 2VHUA 3LZCA 2ZTUA 4HPWA 1AB5A 1SFRA 2C88A 2YFYA 5DYGA 4ZYWA 1OLXB 2Q7XA 5CA0A 5K8VA 2JAUA 1W0KD 2GWRA 2PQ2A 1L7DA 2QTFA 2ZWVA 3TLGA 5JYCA 1B1AA 1KJNA 4B5KA 2ZM5A 2O48X 1XV5A 2VP5A 2C4NA 3QPBA 5FA8A 4TLLB 4DIDA 2PBLA 4L0DA 4RVDA 4XWOA 1E7WA 1SB9A 1XQWA 2HNKA 4CKBA 3DKVA 4JEIA 3VR6A 1UMCA 4GGPA 3SIXA 3T5DA 3QSYA 4FDAA 2H1VA 3L3BA 4MWOA 4ZGGA 5IDWA 1MEJA 2IEAA 2Z5VA 3OCCA 3GRRA 4KXVA 4Y3UA 4BCBA 3SC6A 5DXAA 1IWPB 2ZZKA 3COYA 4K9SA 4ND1A 2ABWA 1MQAA 4EJ2A 1YDMA 3MTBA 1RAAA 4R8KA 2OCPA 4NATA 4JLVA 1I2MA 1SO8A 5JECA 4Q7JB 1W9HA 3BHIA 2PRYA 3KALA 4KR0A 1F0YA 1VRWA 2IU4A 2NYRA 3I4LA 1Y3HA 2CXPA 2IA5A 3UV3A 1GT91 1Y7IA 3NHPA 4ZZ1A 1Z3CA 4ZHQA 3NGXA 3KIPA 1M2OB 1U3FA 3PUXA 2R25B 1EVJA 4JJKA 1BS9A 2G5TA 1CQJA 5D6OA 1H5QA 5CLJA 2RGYA 4U63A 1ZCAA 5HJ2A 4MUAA 4RTOA 3WL7A 1FXWF 5GAJA 3Q11A 4FHZA 2Q1UA 4R83A 5H80A 3WOHA 4EW1A 5FPKA 5KSOA 1THGA 3CR8A 3GGOA 3HB0A 4HQRA 4BAZA 4U7TB 1GQSA 1UANA 1WUYA 1UFVA 4PZAA 2AKAB 4FVTA 3SIPA 1JEDA 1UQTA 2ZSHA 1EK0A 3UK2A 3CEPB 1OA1A 2GETA 4FHGA 5KNBD 4HY3A 2AKYA 1NDQA 1CJBA 1LCIA 3ZGXA 3WXBA 4I19A 2PSSA 5D3MA 1R64A 3Q8LA 5DU2A 3NVMB 3AVOA 2YRWA 4AXBA 1BE6A 1LWNA 1J42A 2JVKA 5E4JA 3M6IA 2IY9A 2K7ZA 1DKPA 2O0HA 2JI9A 2QW0X 2MIIA 3LA8A 3M81A 4JJAA 2C97A 4Q24A 4BNVA 1C9YA 1VBMA 4KFRA 4W6ZA 3OZAA 5ITVA 3DR5A 2DMRA 3KXKA 4RD0A 1UOEA 5ALPA 4II7A 5F9MA 5LQMA 3SICE 4B9AA 2E9SA 3MVEA 5ALYA 3VHXB 1GVHA 4HDKB 1H8EA 1PNTA 3PXEA 3GG9A 4Q02A 1J07A 1MABA 3VHXA 4NQZA 4PPNA 3JVVA 2A0FA 1DAHA 1VCOA 2SHKA 3HJGA 4QDZA 3MHTA 1IXYA 3QEKA 4HNUA 2I6FA 4HDSA 4B7AA 2O05A 4ZZ3A 1FRNA 4F8JA 4GOMD 3IQEA 1SHKA 2PZMA 2FF7A 3LHDA 1R0BA 2ZDGA 3B36A 1CUEA 1IHYA 1W1WA 1XAGA 3J7AC 4AS1A 2C3UA 5BMVF 1QDLB 2AJLI 2JD0A 1LLQA 2O3SA 2JA1A 2HFKA 5C1DA 3D6MA 2VTBB 3TRFA 3NPAA 1RI3A 1ZIXA 1G21B 3OTGA 3ED1A 2JK0A 3MCVA 4XEHA 4BLOA 1K3FA 2RG7A 4OHKA 3TX6A 1CUYA 1GV1A 1E62A 4DR4B 2C82A 3V1TC 1JDVA 3L8CA 3H1FA 3DZFA 4IUCS 3IV9A 1D2MA 3CLUD 4MW5A 4JSTA 2VJLA 3MW8A 3SOZA 4X94A 1WIWA 4HRXA 1K5HA 1W0JD 3SEQA 3LPMA 1NJSA 1UT5A 2W0SA 1WU7A 3D31A 3R3SA 1F0PA 3ZWDA 2B7CA 3TSOA 2PS0A 2ONKA 5GTDA 1AS0A 3QVJA 4B6EA 1AF7A 3FJ1A 4MCHA 3NWEA 5SZHB 5BR7A 3ZD6A 2QVCA 2FUEA 3AW8A 4GSKA 3GDWA 3B85A 5I8WA 3THRA 2QV0A 2ZI6A 3P4UA 4QULA 1XQ9A 3WDSA 4EI8A 1ZVKA 5HOQA 1ZD1A 2X8JA 4MW1A 4C4ZA 5H8WA 2Y1EA 3IL2A 1P17A 3I30X 3KHSA 4RHFA 1QPGA 2ZE6A 4UUBA 4RH1A 2QRKA 1V6SA 2JRLA 1CF4A 2OC9A 4FW8A 4TL8A 1ZW6A 1CQIB 4JENA 2VQEB 2ZUWA 3VDXA 4JU9A 3W2GA 2O7NA 3UJ9A 2JCVA 3O4VA 1CQIA 2VA8A 3M89A 5U1PA 5EWJA 1V1MB 3CKLA 1AQJA 2V45A 1P1CA 1Q74A 4RIIA 1AHIA 1Z5ZA 4AIRA 4LOKA 2B20A 3C41J 1SNYA 4WFIA 5GV7A 2QTMA 4KXYA 4NAHA 4MHOA 3VSEA 1JLLA 3EMKA 3BTSA 4RANA 1TAGA 2WOJA 1ZC3A 5CVCA 1C0IA 1I6KA 4RXMA 1ZIDA 2QRMA 1SQFA 2QRVA 1U0OC 3AY6A 4NU8X 1R8YA 5F76A 4ZMBA 1V41E 2GHIA 3KC2A 4UTRA 4F97A 5HKKD 5KWEA 4W7IA 5LQUA 4L5IA 1TKCA 3CXRA 2D62A 1UPTA 4X5OA 1AHHA 1ZBQA 2V7QA 2R7MA 4N54A 1ZJYA 1QMGA 1W8IA 2G67A 4J2TA 4XFDA 5A6SB 3IEXA 5A9RA 3HCPA 5EXXA 4ARIA 2LZ0A 2ZR9A 1I7SB 3SJ7A 4B4OA 3DNMA 4TV9A 2JCXA 4OATA 1VCMA 1VG8A 3UAXA 1JNXX 1XWIA 2WF7A 4XOUA 2ZLBA 4NHOA 3W3AD 4UTVA 3UTCA 3U7GA 3QK7A 1W75A 1X13A 1I7LA 1GFWA 1S96A 5DE3A 2EOAA 1KF0A 2NADA 5EP3A 2BGJA 5TMEA 1MX3A 2X86A 3P2OA 1NASA 4OMUA 4WERA 1TQ2A 4DC9A 2OAQ1 2IYTA 5M3BA 1LQ2A 3HJUA 2MTBA 4Q21A 2WYOA 4EARA 1Z17A 4GS5A 4EX6A 3B1KA 1GL3A 3PSAA 5AVJA 2WT9A 3GFQA 4YI3A 1OAKA 1XDUA 4TTVA 3A9VA 4F7WA 1C9MA 5IXJA 5D84A 4PRZA 5KJ1A 3PFHA 4JR1A 4AVYA 4V38A 1NBWB 4K6MA 4N5MA 1JFRA 1X8XA 1AB6A 2Q0HA 1NBMD 3PU6A 4OUKX 5I6DA 3U2QA 2BM8A 3I1FA 4R71A 4UM5A 5E3HA 3IQGX 1OFUX 1ZXXA 2O5VA 4HX5A 1JFTA 1Z25A 2Q0XA 3R74A 4UQLA 3TTXA 4MRAA 3K0SA 5IT9A 2BKVA 4WUTA 1D6MA 4E4TA 4YAKA 1DBIA 1Z5OA 5LMNB 3GMDA 5JWOA 4BRWA 4TWJA 2R2AA 2QNBA 4IJKA 3QVSA 3V1UA 3OKPA 5CT6A 3PEUA 1UK6A 4BO8A 1P4GA 4A10A 1WD7A 1LV7A 1HLGA 1M34A 1RCTE 1NJ8A 4BRZA 2FWRA 1SCKA 1O58A 2WU4A 4PLTA 2VTVA 1VJRA 4Y2XA 5G40A 4GKVA 5T4BA 3T9FA 4AY3A 4RACA 3TW0A 2C7PA 4BY9E 2Q2NA 2P6UA 3F73A 1GFSA 5B58T 4Z9BA 3W9YA 4DOMA 2IHJA 2ERCA 4A0SA 3AVUA 4CFZA 3C7TA 2I3ZA 4JOCA 1OIWA 3ZTTA 5DHPA 5IMSA 2R66A 4JCCA 1G6OA 3Q7TA 3TFQA 3UMGA 1C8KA 3BQMB 1H2AS 4R05A 2VL7A 4I6GA 1E3WB 1YQDA 1YB2A 1E5LA 2GHRA 3GBVA 2V6GA 4LGYA 1OTXA 4YJFB 1CDEA 4ZARA 1YR7A 2X41A 4MCJA 5C4MA 3NM4A 1AN0A 3HWWA 1T5LA 1XFDA 4NCJA 3TPZA 4GM1A 2VJNA 4YJFA 4EVQA 1XIVA 2J3DA 2Y1CA 3Q8XB 4MLCA 2WTMA 1ZM2A 2LPMA 3UYLA 4G1FA 1F14A 1JS1X 1IH8A 3H0EA 1OXKB 2P7IA 2R84A 3KB1A 3LFTA 4HD8A 1UJNA 3B1JA 3V7NA 5EGSA 1D03A 1SD1A 2G83A 2Y76A 4L4UA 3TEJA 4I50F 4BKPA 1P9RA 3NNSA 5B3AA 4M0FA 5HIAA 1R9JA 3L7YA 1F17A 4XCQA 4Q3NA 1ZM3A 3E27A 4J4BA 2PSFA 3ODPA 4X6YA 2YWXA 1T2DA 3I2JA 3B8EA 2W00A 5JYBA 4EHBA 5B2EA 4PXYA 4I55B 3LQRA 1O96B 5I9SA 3NASA 4N9WA 4COOA 3CR3C 3PJFA 4B6FA 4I55A 1SAYA 1O96A 2OE2A 1V3TA 2GBGA 3FVVA 3DKPA 3L8ZA 3RIMA 1I36A 2CDCA 2HLDA 5TR9A 3U4IA 4ZO8A 5GZ3A 3T1YB 2ONCA 1E79A 1JLSA 3L9XA 1K9SA 1QUEA 3H05A 4GUDA 3G17A 4O1MA 2O3JA 4TRNA 3RC2A 3VC3A 1GSAA 1GTVA 2YW9A 3UGQA 2DETA 2YUIA 2JGDA 1IQPA 2EFJA 1BXKA 3OIVA 4XUDA 2J32A 6Q21A 2O8CB 4MYUA 2FLKA 4BXOB 5NULA 1W7AA 4B43A 2IYPA 1W25A 4Z2AA 4BXOA 4W1QA 1PGJA 4EHHA 3DCIA 2I2FA 4XD2A 4BLWA 4H18A 4NE7A 1IVYA 1VGRA 5BO5A 2FMUA 4CKCB 3GF4A 1SU6A 3MWYW 2CL5A 2A1IA 3HXTA 3PHGA 3MLEA 3A4NA 3UC5A 3ZJYA 5EINA 5J9FA 2F1HA 3I8XA 3RTGA 1KH3A 4G8JA 1NN5A 4KB5A 3PIIA 2R85A 2Z5GA 3BGDA 4G25A 1YCDA 1Z4NA 5CEJA 1WSWA 2LWIA 1TQ8A 4BZQA 1PR3A 3ZCTA 1HE2A 1W29A 1BCSB 1ZD2P 2VHYA 3BGSA 3DSRA 1RYHA 1G16A 2RGNA 2WJYA 3T3EA 4B6OA 1RP7A 3FNGA 3F9CA 1YKGA 3GLRA 1FSZA 1CEYA 2DR0A 1E2LA 3NHRA 2PEZA 3OKAA 3X2EA 4CR6A 1ZH2A 1RIIA 3OQ1A 4GSLA 2EYUA 4NYJQ 4NVRA 3ZOKA 4QM6A 1FRQA 1ZJ6A 1GRQA 2JNWA 4UC0A 4QTXA 1T0IA 2BCGY 1DPFA 1MG5A 3KD2A 3TKLA 5KJFA 2YZMA 2E6UX 2BP7B 2XXAB 4MITA 4M49A 1EEXB 1FYFA 1XAHA 3DMFA 1LPPA 3PQ7A 5DRYA 2XXAA 4ZO4A 3PTLA 5GMOA 2PR2A 2ATIA 4HAXA 1Z5WA 2I99A 2OQRA 2FG5A 2PX2A 1EP9A 2W2NA 2VT6A 4ABTA 4RCZA 2PKQO 4TQUS 4JD5A 3L5OA 2H7YA 5KOHB 3E4DA 1USKA 4D4MA 3ZNQA 3ECSA 3B1XA 1WDKA 2P35A 5AM5A 4ARSA 1IB0A 3AMVA 4DYVA 3NONA 1RC0A 1XVIA 2M98A 4M86A 2DUJA 4DLRA 1W34A 3Q0EA 5IM4F 2A57A 2YWJA 2JFZA 3G88A 2AH5A 2UZAA 3AFMA 2Q6OA 1MV5A 1NUHA 3C15C 4INPA 4R84A 4ALMA 1DOZA 2JFXA 1DV2A 4GLBA 4HNGA 3PGKA 2RC5A 1V37A 4B5LA 3G8YA 5NLLA 5HIJA 5EKUA 4DNPA 2OY0A 4ZT6A 2A84A 3UV7A 1XRLA 3BMCA 4DDHA 1A8QA 1U3WA 4ZYLA 1YQXA 2WHPB 1Y3IA 1Y5RA 2WD7A 1KO7A 1P6QA 4DM4A 1RQ7A 2IEBA 3PEVA 4MUEA 3V33A 2E48A 1YCGA 2EWWA 4XDYA 3TL3A 4NE2A 2V4MA 3CX7A 4URZR 2YHSA 2VZ8A 2FI1A 4O1IA 4DE5A 1Z38A 3FNQA 3KOUA 2P9HA 4RGVA 5EG5A 2WBLC 5FPPA 4HMPA 3CIOA 4P4GA 4U2DA 2ZS9A 3D2CA 4FTWA 3HU2A 4NICA 1JJ7A 1O95C 5TJHA 2IWRA 2PUVA 4AM8A 3PQ8A 4DSNA 1D2HA 3LK6A 2ET6A 3QW2A 1COWD 5IFLA 2C4VA 2P7HA 2XLCA 1QG2A 1Q7RA 2ANCA 4MAMA 4EYEA 1OA0A 3QWFA 5ALNA 2B0CA 2PZGA 1UDRA 5BORA 4AP9A 2F90A 3VBCA 3I5UA 1PZNA 2YJ3A 5BSTA 1U8EA 5BYBA 3W05A 1X80B 3MT0A 3P7MA 2BC9A 4E3ZA 5CUQA 2HK8A 3O3CA 4ZVPA 4CEIA 4DXAA 1LSJA 1X80A 3OJWA 2WB2A 2Y0BA 3AF3A 4P7JA 4J3NA 1T9GR 3DNFA 2PMDA 2YR0A 1SUDA 2CUZA 4KPUB 1A4RA 1NVTA 4ANFA 1LPOA 1FJ2A 4MMZB 2JJ1A 4OQLA 1D07A 4RGQA 3UA3A 4S3MA 3NIDB 1WULS 1A5ZA 1NJ5A 1GAWA 1L9KA 1LGYA 3KK0A 3TN7A 1C7EA 1F2TB 2X2EA 2YVQA 2W2OA 3PA6A 4QPPA 3ZLVA 2HRQA 4F38A 1DNPA 2P2NA 4PINA 3FYCA 1F2TA 2FKAA 1N2GA 4ARAA 5KOJB 1D6NA 4U2KA 4ZOQI 4K26A 4ZYVA 5KYUB 4MVJH 2UXCB 1LJ8A 1K5DA 2V6MA 1DAOA 4P31A 5KOJA 2GBFA 5IYZB 4X1IB 1KRXA 1R10A 5KYUA 1C8VB 1OFIA 1YJQA 4V0KA 1X7ZA 4TQGA 5TC4A 5IYZA 1W36B 2BUAA 3PYXA 4FLEA 2LP4Y 3BJZA 1XTJA 2F8MA 4KK4A 4COKA 1SVIA 1SXHA 5F4BA 4IUDS 5C51B 1E1RD 1KJ9A 2LD4A 3KHKA 2P9GA 1CUIA 3NHAA 4US1R 4X3PA 1UMDA 4R54A 5AK3A 1WHTA 1DLIA 4GX5A 1EYZA 2VJBA