3KJHA

Zn-bound state of cooc1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
MKLAVAGKGGVGKTTVAAGLIKIMASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLGSVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDLGIKKVRYVINKVRNIKEEKLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQSTNPAFVNLHDIYQKLRLEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the ATP-Dependent Maturation Factor of Ni,Fe-Containing Carbon Monoxide Dehydrogenases
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Hydrolase, metal binding protein
molecule keywords CO dehydrogenase/acetyl-CoA synthase complex, accessory prot
total genus 76
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kjhA00
3GJ7A 4G5RA 3EG5A 4BEJA 3AVXA 1L4UA 4A1FA 4W9MC 2OSBA 1DVRA 3TW4A 5DYIA 3DOEA 4H1UA 4DLUA 3PCRB 2OBNA 1GRQA 3O8DA 1PUJA 4XTCS 3MWJA 1YRBA 4KFUA 2FN4A 4DT1B 1EG7A 3UPUA 2D62A 2VP6A 1KI6A 3DO6A 4A0HA 2WIBA 3FE2A 2IUUA 4QXAA 2WSMA 4U5XA 1IN4A 4YXWD 2ZRGA 1XTRA 4A15A 2BV3A 4D4LA 4D6PA 4Q7MB 5B2ZA 4D4MA 4QJ3A 3GEIA 5HKKA 1MKYA 1D8TA 3BB3A 5P21A 4MUAA 1DBSA 2IF2A 2ZAMA 1CJMA 3C7KA 5EXXA 1N6HA 1OJLA 3AGPA 1S4QA 4JMPA 4LK2A 1MOZA 3NWJA 3B6EA 5HE8A 1C4OA 3VR4A 1AQUA 3CH5A 3T06B 4LBZA 4V0NA 1E0JA 1GNQA 2Z6VA 5EE0A 5CJPA 1QHGA 5DH9A 1ZNWA 1Z07A 3C41J 2GF0A 3IIKA 4KLNA 2F1JA 4BLSA 4FXPA 1JAIA 2IWHA 2GNOA 2NOAA 3GLFA 1T5LA 4HAXA 1PZNA 4L9SA 4U7DA 4QM7A 1S3SA 2GCOB 4OHVA 1P6XA 1NVVQ 2XITA 1YZNA 5DHFA 4AYTA 5JBQA 3DEFA 3DKPA 1X8KA 2G1JA 4L8GA 5M04A 2OM2A 2XJ9A 2FSFA 1WF3A 3E70C 3RRNA 4FN5A 3AP3A 2H5EA 2V1XA 2A5FA 4PTLA 4HLDA 4QBGB 5EP4A 3AF4A 3Q8XB 4ZKDA 3ZVMA 2QTHA 1P5ZB 3HR7A 3FPAA 3QF4B 3GP8A 1COWD 3H4MA 4TYNA 1NNEA 3X1WA 1U99A 4QNRA 2OG2A 2ZYWX 1AS2A 3GQBA 4D0GA 2ZS7A 4IJMA 3PENA 1NSFA 2B8TA 5L3QA 1ZCAA 2ZS9A 5G40A 5F9FA 4TQ9A 4BFSA 4MDEA 2HUPA 3T61A 4JL8A 5BW8A 4Q4JA 1Z0DA 4NYMR 3AVOA 2CNWD 2YV5A 3O8BA 3BIFA 2JLSA 1JQLB 2ZE7A 3I3SR 4KU4A 2J46A 1X6VA 3FHCB 2BWJA 4P4UA 2C96A 1ZM4A 3K8YA 4A4DA 1Z6XA 4IOLA 5BYJA 2F1IA 4XSHA 3BWDD 3LBNA 1G20E 2GZHA 3OE7A 4PPNA 1KI8A 3TRFA 5H8WA 2IXEA 2NO1A 3DHWC 1KK3A 4MKIA 4BGDA 3I5XA 1RC8A 2AN9A 3THXA 1G8YA 1KY2A 1OF1A 3RHFA 1LS6A 1IQPA 1EGAA 4V0LA 1J7KA 1KTVA 4RVCA 4TT3D 1I4LD 1NVWQ 2ZROA 2UKDA 1E94E 2XTMA 3K09C 3SJZA 5K8IA 3G5UA 4I1SA 2O8FA 4AK9A 3EIHA 2G3YA 2P5TB 1ZM7A 2F9LA 3L0PA 1TEXA 1KOFA 2QN6A 2VRWA 3Q3JB 1TX4B 4IDPA 2GXSA 1R7RA 1SZPA 4B2LA 4RZ3A 4G5SA 4C2UA 2WWIA 3GLHB 3ZIAD 2WOJA 4M0LA 1JJVA 3BD9A 4C0HA 1R0WA 2AHOA 4MRVA 2QT1A 4B73A 1E0KA 3LV8A 4EPXA 3QQ5A 4QFMA 4QNMA 2GVDC 2WJVA 2RCNA 2RGAA 3GJ8A 2RB4A 3O47A 1RJ9A 3ASZA 2HEIA 2PZFA 4MITA 1KDTA 3T1VA 5JRZA 2ZJZA 3DOFA 3H1TA 5JSZA 1XCPA 4B6FA 2WAXA 3I8XA 1MRNA 1YZGA 2G0NA 3QVVA 4EPVA 4ESVA 1E9AA 2QENA 1II8B 2AWNA 1LF0A 2J0VA 1OPXA 2ZR7A 1NIPA 2VLIA 4RCYA 1ZC3A 1P2SA 5FR1A 5FTNA 5HTKA 3B78A 5BYKA 3TKLA 3KQNA 2ZPTX 1SVKA 1K8RA 3T34A 3AF1A 4KITB 1OB2A 3K0AA 3NBXX 1IY0A 4HUQB 3A58B 2ZJ2A 1LTQA 2ZXUA 4UXIA 2ZI9A 5D3QA 3HYTA 1G5RA 4RJLA 1PLLA 4D82A 2DWPA 4OQLA 1FUUA 1XU4A 2BM1A 3SBEA 1MO6A 4NZYA 4M1SA 2WSSA 4CYMA 4LV5B 1VKJA 1FTSA 1VIYA 4XWAA 2OE2A 2VP9A 2FPKA 5C4MA 2X2EA 3N5CA 2FFHA 1G8GA 1Y3AA 4OK3A 4J0QA 1WMSA 3CRRA 3A6PC 3M6AA 4JVSB 1KI7A 4URWR 2ZRAA 2DWQA 1KMHB 2QI9C 5B58C 1DEKA 3N2EA 3I4LA 4MQBA 3AKYA 2GETA 5A0FA 1AK2A 1D6JA 5HE9A 2CL7X 3HYRA 5F3WB 2KBEA 3QI2A 1SVIA 4YMTA 1GP2A 4QBIA 1DOAA 3TVDA 3WYAA 4PQRA 2ORVA 1D2MA 2FSHA 5FPYA 4N1AA 5FTJA 3VU9B 3KKQA 4XH9B 1DE0A 3RANA 4R71A 2EFGA 2PX3A 3TSOA 4PO9A 5JEDA 1E9FA 1ZUIA 4V0MA 221PA 2D3WA 2YJTD 4MYTA 5LB2A 1ZAKA 4CEIA 3DKVA 4XD7D 4DC9A 1ZD9A 3G0HA 2ZI3A 1M7HA 1Q21A 1W36C 3DL0A 3LH5A 2ZRKA 5FOSA 3K70B 3LX8A 2H16A 4Q4LA 2OILA 2XJ4A 1D2NA 3TUJC 2VF8A 5GJBA 2C95A 4JLDA 5DYGA 3VAAA 4PX9A 4LWZA 3A1TA 2Q21A 4V0KA 4HDQB 1XZPA 3UIEA 1Z63A 1WB9A 1R0XA 3MD0A 4DJTA 4AURA 4EQ6A 4XSGA 5B64A 5FOUA 4F92B 3CR7A 2BJVA 4F7WA 4PC1A 4DDWA 2HJVA 5TDHA 4MYHA 5FI1B 5JECA 2WIAA 1U0JA 4G01B 1FOEB 2QM8A 3BH0A 5J4VA 3CX6A 4JLVA 2VP2A 3U7GA 2TMKA 2ZJOA 5JWHA 1Q12A 1GKYA 3K70D 2O0HA 4RFSB 1T9HA 3ZZUA 1J90A 2XNDA 4JKIA 4NTZA 3U5ZB 1H65A 3L82B 4PXAA 3QEOA 4MRPA 2VPPA 2J0UB 2VEDA 4DVGA 5JJIA 4I99A 3AV0B 2ZRCA 2XB2A 1OFIA 3PVSA 4MA4A 2XNSA 4RY2A 1GUAA 4QJ4A 4DEYA 1CR4A 4CEIB 1CXZA 1I2DA 2BC9A 3OEHD 1R2QA 4B3DA 1NBME 3QXJA 2IHBA 4PPGA 4AYXA 2KSQA 2ZITA 3R8FA 2BBTA 4C0AC 3T1TA 5FPHA 4IW3B 3AEZA 1P9WA 2WM9B 4KCGA 2GEVA 2IYLD 2Q9CA 4JLKA 4US2R 3EPKA 2F1RA 4C0LA 1ODFA 2R6CA 5GJCA 1QVAA 4WXRA 4OYHA 4ACBA 4EPRA 3LQQA 4CEJB 1OKKA 2J3EA 3B82A 3NEJA 1F6BA 3JVVA 3ND8A 4ERNA 2W0SA 1KHTA 3LBHA 2QEQA 4D4JA 5AUQA 3BB4A 2I1QA 4Q4JB 3TH5A 4KXFB 3OESA 3ZGXA 2VIIA 5AJZA 2IF0A 4RZUA 4HLUA 5JWRA 4OQMA 4B32A 5E4FA 1RYFA 5EXSA 5JRJA 5AUNB 1H8HA 3JZAA 1Z6AA 3H0KA 4IDHA 4C3ZA 3D6TB 1WBBA 4Z1MD 1NN5A 4NYIR 4JT2A 1KJWA 3ASYA 4GOJA 4I1UA 1DAMA 4AG6A 1YZKA 1UBCA 1P2TA 4RD3A 1G1MA 1M7BA 1XXHA 2IHYA 4ZPXA 1JALA 1G3IA 2DFNA 3EZ6A 4HUQA 4II7A 1NSTA 3FKQA 1T4GA 2QE7A 4LDJA 1M8PA 1N5LA 1Q0UA 4B48A 5AJWA 4LHZA 3NKVA 2H18A 3LD9A 4Q4AA 1E2DA 3SZRA 1IONA 1E1QA 2P6NA 1XMSA 3KKOA 2HYDA 1VHTA 3GFPA 4N3NA 4M1MA 1F60A 3OZXA 2GESA 3THOA 3A37A 3REGA 1HUQA 4AYWA 2N42A 2QNRA 4P0TA 5L8VA 2ATVA 2NIPA 2JLYA 4UJ5A 1HT1E 3K1JA 4O2RA 1E0SA 1ZCBA 1C1YA 1OHHD 2X19A 2Q9AA 1JR3A 1ZVQA 1PLKA 4UNPA 3IQXA 1OXVA 2CK3D 4V03A 3SFZA 1VYTA 3HU1A 4PHTA 4A36A 1IXZA 3JZMA 2ZTSA 1KJZA 4P4TA 2GRJA 2CLDX 1O87A 1X8JA 2Q3MA 2QA5A 5SZHB 3NC1C 4JYBA 2RGBA 4GBMA 3ETLA 5KUTA 1ZJ6A 2QMEA 4ABYA 1TQ6A 3AP2A 1AZTA 4HB3A 1SXJA 4CEHB 1PJRA 3OIVA 1IM2A 4URUR 2QU8A 2J7KA 5CJ2A 4A8JA 4TZ0A 2BMEA 2ZIAA 3OEEA 2LCFA 4KVAA 4JSTA 2FNAA 2G83A 4ZIRB 3FFBA 2FOLA 2HCJB 3BFVA 2EWVA 1BKDR 4BRUA 3AUXA 3PUWA 1UBFA 4MGKR 4TTPA 5EE3A 3W34A 4HB4A 3BXZA 1LW7A 4Q4HA 2DFKB 3DZ8A 1Q1EA 1EX6A 3MUFA 2A2ZA 3ZZTA 2ZRMA 1AKEA 2HT6A 3TVTA 3DDCA 3UANA 3LRPA 4H9GA 2XZPA 4P31A 3ZD6A 3K0EA 1U2RA 2H92A 3IPYA 4ZV4A 3Q72A 5DN6A 1CR0A 4TYPA 2V3CC 3LXXA 2QORA 1OH8A 1N5KA 4QHSA 1KZGB 3B2EA 1NKTA 2YINC 1KZ7B 2PMDA 2VHUA 1E2HA 1Z0FA 4LRWA 5CB8A 5DI9A 3BGWA 1Z8FA 3T5DA 4HZUB 1A1VA 2ZUCA 3K9LA 5FUVA 1VCIA 1VG0B 2ZE8A 3VR3A 4Q47A 721PA 5KNCA 3BFKA 3NBFA 1XXHB 2ZSEA 3QPVA 4ZKEA 1NI3A 1X8LA 1PLJA 2O8CA 2X77A 5EE5B 4QGHA 1CRQA 1YQTA 3SNHA 1GL6A 1Z0AA 3TGPA 2PEZA 4EUNA 3LW7A 4ZO4A 4QHTA 2QM7A 1E2LA 2HDNB 3QOFA 1KSFX 3CZQA 3FMFA 1CR1A 3GLFB 2JIZA 1WA5A 3VNUA 2JGNA 2JDID 1TNDA 2DR3A 2RMKA 2NZ8A 4TMKA 1JPNA 3PUXA 2G0TA 1OH5A 4EPYA 1D9ZA 4LHXA 2OBLA 3AVQA 3I72A 5JI3E 1E6CA 2JLQA 4CEJA 4Q1EA 2YVUA 1E9BA 1N6PA 3IHLA 4AKEA 4G3XA 3CPJB 1BOFA 5GJVC 1SKQA 1E2JA 2XSZA 1NP6A 2ONKA 3KUDA 2BDTA 1XEWY 4NYMQ 2OXRA 4M4SA 5L3QB 1KK1A 2VF7A 2V54A 1KKMA 1ZM9A 2R2AA 2EYQA 4Q02A 4BFUA 1E69A 1H8EA 1CJTC 3EIQA 3F8TA 4Q01A 3RSOA 2C99A 2OLJA 3AM1A 1TMKA 3RC3A 2QPTA 5EJEA 3ADDA 1ZC4A 4TZ6A 1NN0A 4Q03A 4TQUS 2GEUA 1F3OA 2RKOA 5GJWC 3VR1A 3A4NA 3K0CA 4EPTA 1BYIA 2NMVA 5CITA 3UG6A 1QHHA 3CNNA 2QSZA 2A5YB 1VG1A 5FOWA 3UMFA 2RGDA 4DSNA 4GDFA 2IYZA 2F3TA 2QAJA 2QTFA 2Q0HA 3LX5A 1ZD1A 1HEIA 3QPWA 2PH1A 1IN7A 3I92A 2QGZA 1W0KA 3FGNA 3IBYA 3EC1A 3NBZC 2WWHA 2BCJQ 4GSYA 1GIAA 5CIQA 4LBVA 2IK8A 4Q7LA 2FA9A 5B30A 2JLWA 2WJHA 2C2HA 4Q9JA 2GJ9A 4B3FX 2F55A 2L0XA 3E5HA 3QVUA 4G5OA 1MV5A 1JEDA 4UQOA 2GILA 5K8LA 1FW6A 4AY2A 3X2SA 2XXAA 1VG8A 2YWFA 4EQ6B 3CBQA 4DT1A 2A5DA 1BIFA 1M6NA 5LDDC 1YZLA 3SYKA 3MAAC 4NPHA 4BLTA 2UVQA 1EFCA 2CHQA 1NLZA 3K0SA 2W58A 1GL9B 2ZU0C 4W5HA 1LNZA 2WJIA 2I1VB 4M1WA 4NYIQ 3W5JA 4JVMA 2IW3A 4F4JA 2VH5R 4HAVA 1ZNZA 1E9DA 5KDLA 4PPQA 1E1QD 2OHFA 1QRAA 1XXHE 1DAKA 4PO8A 2RGEA 3U3KA 3THYA 4JBWA 1PVOA 1X1RA 3AF0A 2JJ1A 1KSGA 1YR7A 2WWWA 4NCNA 4DLVA 2RHMA 3LVRE 2AK3A 4FCWA 3W9YA 1G64A 4JKYA 4US0R 1XD9A 3TQCA 4EKDA 2IYXA 4NL4H 5KYKA 4U00A 2N46A 1NLFA 3K70C 1RPZA 4XOIA 3ZS8A 3QUSA 1G4AE 1JECA 2RGNA 4DLTA 2CCJA 2QP3A 4PQFA 2OBMA 3W6NA 5TXGA 2VA8A 5D3MB 3GLIA 2DWOA 1FMJA 1T3HA 3CNOA 1Q1ZA 2SHKA 1SGWA 3WRYC 4LJ8A 3HPQA 5B57C 4TLCA 1G4UR 2IC5A 2ZYTX 1R8QA 5EXTA 2YOHA 5FBQB 4D80A 3OHMA 3QF4A 2NQ2C 4Q66C 2ZE5A 1OIVA 3EC2A 5K8TA 1KDOA 2QAGA 3UATA 2NO9A 3LVQE 4QGFA 4QM6A 1UDXA 4UJ3A 4ILEA 2CBZA 4KO8A 1HE8B 3MLEA 1WE2A 4IVRA 1AS3A 2IYUA 1TU4A 3S1AB 4C0QC 4TMWA 1KNXA 1IY2A 2B92A 2IBMA 2GZDA 2QROA 4OI1A 1XTSA 3SJAA 5IDVA 1CF4A 3M1IA 2B8WA 2IUSA 4LJ9A 4Q5IA 4MGIR 2ZQ5A 2IA5A 4B2PA 3CRW1 1UFQA 1AIPA 4M21A 2Z4RA 2P67A 1Z83A 1SXJC 4RZXA 5DI3A 4JLPA 1XTQA 1X3SA 4EPWA 5KNBA 2WTUA 1N5IA 2AKYA 2MSEB 3IPXA 4BE7B 1TF7A 5JHHB 5EZ5A 2ANCA 2DFLA 2BBOA 3M4YA 1U0HC 1T91A 2QP9X 4PAMA 5FUXA 2EW1A 4JYCA 1EXMA 3U7FB 2XOKD 3GMTA 5SZIA 3ICQB 2CNWA 4IOKA 1AS0A 1L8QA 3GFTA 1TQDA 2WKRA 3MRSA 2WZQA 1IHUA 3Q7PA 1KI4A 1XCMA 4A9AA 1ZIOA 3HJNA 4HLQB 4C0JA 3LO5A 2C9YA 3DZDA 2ZUDA 1P60A 1QDEA 1W5SA 5IK2A 4DLSA 4RKEA 4AC9A 1GNPA 1XTKA 4KFRA 2F43A 1Z6TA 4Q1CA 3ZS9A 4G5GA 2QBYB 1ZBDA 4LI0A 4TTRA 3L0OA 3RAPR 2Z5FA 4D4KA 3PQCA 1P9NA 2IYWA 4BFTA 5JSZB 1W4RA 1N0UA 3EASA 4NH0A 4O3MA 2C5LA 4QBHA 4TSFA 4M1YA 1JXOA 5FBLB 3KXLA 3PJRA 4F93B 3OFND 3SQXA 2OAQ1 2X8AA 1ZM3A 4TN1A 1XEFA 1XJ0A 6Q21A 1HURA 3GCGA 3ICEA 1W0JD 2P6UA 1G18A 5E7MA 1CULC 3A4MA 2WICA 3MCAA 3KQUA 1J2JA 1OW3B 4LC0A 3WP0A 2Z43A 4C9BA 3GJ4A 1CKEA 1G8HA 4YC7A 1G7CA 4RD0A 2IS2A 1YVDA 2N1BA 3FFAA 1U9IA 1TUEA 2A9KA 2W83A 4TL6A 4W5JA 4FMCB 3EZFA 1K6MA 2ZAOA 4B33A 2BCGY 3U3OA 4DB2A 4HAUA 3PUYA 4XVUA 1A4RA 4PHFA 5HCIA 2J7PD 1B0UA 5LBIA 4DBLC 1G5TA 4A0RA 4LBYA 2ODEA 3Q85A 5LD2B 1JJ7A 4ASUA 1EESA 2F43B 2HF9A 3U44B 3KZ1E 3BB1A 1CP2A 1U8AA 1Z6YA 2AXPA 3GLGB 3NDBB 1KMHA 1OSNA 2OEPA 2ZSBA 4TWZA 1EWRA 3ONWA 2LKCA 1AZSC 3VX3A 4B3XA 3O8RA 4XTRA 4X8HA 2KWIA 3HPRA 5EP2A 4DCUA 1Q22A 4HB0A 3CX8A 2Q6TA 5IT5A 2OFOA 4UNQA 2YC4C 4JVLA 1G3RA 2GJSA 1U0LA 2DFTA 3RDPA 3EA5A 4OQFA 2YYZA 3RSLA 1NJFA 1KO4A 1ELOA 1RJ9B 3AF2A 4W7SA 5A5GA 1GKUB 4Q19A 1N6NA 1R0ZA 2PEYA 2H7VA 1UEIA 4D0NA 2ZRFA 4BLOA 3AUYA 3KL4A 5FOVA 521PA 4MGYR 1EFTA 1TQ2A 2QQ0A 4LYHA 4KSBA 3U61B 1G6HA 5HR5A 5F98A 3ZIAA 1P75A 2C77A 2CXXA 2ZYUX 2JJ1D 2WMOB 1GKIA 1OE0A 2V6JA 1DTSA 2WAYA 3AB3A 3BK7A 2YZ2A 4GFDA 3NIBA 4M9XA 1N6LA 1NY6A 3OF5A 2REBA 4WW0A 1Z0KA 3VNVA 2OAP1 4BFVA 2JATA 2QAGB 4MGZR 4NBSA 1OH6A 1UBGA 4DKXA 5ANRB 2AX4A 1Q3TA 3X1ZA 2IS6A 3RS3A 3FHTA 3TSZA 1TQ4A 3VHXA 1KJYA 1UAAA 5DLQC 5FL7A 4O0MA 1CBUA 2R8RA 1G7SA 1IXSB 4L5BA 4EFNA 5C1BA 2J87A 4HAWA 3B7GA 1G3MA 1XTIA 2CVHA 4GZMA 1N0WA 2O8EB 2X2FA 1G6OA 3ZVRA 2R6AA 3T1OA 3RYTC 2OUKA 2VHQA 2NZJA 2ZJAA 2R6FA 5KDDA 3FMPB 4TMTA 1GAJA 1GDDA 3K9HA 4URZR 2V9PA 3QG1A 1E79D 2A30A 3NVAA 5EUMA 1Z3IX 3ZD7A 2J45A 4GP6A 1BMFD 1KO1A 3CRQA 3ZYCA 5FL3A 3I32A 1KI3A 1W2HA 2OO7A 4GZLA 1IJEA 4M22A 3QKUA 5CK4A 2ECKA 3IBGA 4ACAA 4PFSA 1BO6A 1ESNA 2GZAA 3KTAB 4EAQA 3CF6R 2QMHA 2BBWA 3PXGA 4DCVA 1JR6A 3R9XA 1FNMA 1E98A 2HLDA 1R5NA 1YZUA 3U7HB 2A7QA 3I73A 1RW4A 3EXAA 1U94A 1UBEA 5KSPA 4A2WA 3WRXC 1KO7A 3FKSA 4OQNA 1DS6A 5C46F 1E32A 4LX0A 2FZLA 2P6RA 5J5CA 4NYJR 1EFRA 3MWYW 4ON9A 3LWNA 4HAZA 2G9NA 3KQKA 2KB0A 2AL7A 3IIJA 4PPFA 1W48A 3REFA 3PEWA 2C9CA 4HATA 5E95A 1AA9A 1J8MF 1XMIA 1LY1A 4XD7A 1FX0B 1MABA 1Z6GA 1ZUHA 3WMFA 3NEYA 3C14C 2ZJYA 1UPTA 2IS1A 3SE0A 1QHYA 4BFWA 1KIMA 1OXUA 2ZRNA 5JJKA 2HXSA 4LZZA 3L2OB 3OAAA 1TEVA 1EX7A 3SU8A 2QTVB 3LDAA 1MR3F 1W47A 4MRSA 3OFNA 1E9RA 1KGDA 2IL1A 3GD7A 4UXHA 5C4GB 3SEAA 1F48A 1SULA 4Y0VA 4IKEA 5F9HA 3R9WA 3L0SA 2NO7A 3DVLA 1XPRA 2V7QA 3NG1A 1E4VA 5FOXA 1SQ5A 1MT0A 3M0EA 1GL7A 2LKDA 2H1LA 3AH8A 3NBYC 1XRJA 1NVXQ 3FMOB 3KJEA 4LOAA 2D06A 2HV8A 1A7JA 2NO6A 5DSZA 1T5IA 2ERXA 3CRMA 4FI3C 2CE2X 3BBPA 3KQHA 1TU3A 1XBTA 1TL7C 3VR6A 3OIWA 3RS7A 2H8KA 3F3YA 1ESMA 4NKRA 4E09A 2GBLC 2J7PA 1T6NA 1E2KA 1JEEA 2QT0A 5BXQC 3AQ4A 4WZAE 4D81A 4YXWA 2GXQA 1UKEA 1VG9B 4JSYA 3QENA 2IXFA 4JLMA 5L3VA 4YMSA 1Q44A 1S8FA 1OB5A 3SJBA 4F38A 5EP1A 4G1UC 2ZR0A 1S96A 1ZRHA 2NPFA 1O3YA 2XXAB 1WQ1R 2YC2C 4OK6A 5FR2A 3THWA 1P61B 3SR0A 3KJIA 2GCOA 3B9PA 4ESHA 1D5CA 2BVNA 1RFLA 3NDPA 3B1VA 3A1WA 3IEUA 4DLZA 1P9RA 2FV8A 4NYJQ 4PSVA 3TE6A 2BKUA 1GOTA 2NTYC 2HCBA 2QMUA 3B13B 1EK0A 2IYSA 3BJIC 3FHOA 4FINA 4QC2A 3SBDA 3W8NA 8OHMA 3T12A 4DIEA 3U3MA 1E2GA 5CLQA 621PA 2AK2A 1HV8A 1KMQA 1DPFA 3GPLA 4B75A 4TMVA 2WOOA 1V43A 2NO0A 1W4AA 2VQSA 3Q5DA 3LFUA 2IX3A 1GTVA 3Q5EA 1G8PA 1S9DA 2NGRA 4B35A 2G77B 3B1YA 5CM9C 1JI0A 2VP5A 4ZDIA 1ZP6A 4NCJA 5CYOA 1HQYE 1AGPA 1E2QA 3SDZA 1XF9A 1DG3A 4JLNA 2WPDD 4GRAA 2C9OA 5GADl 4QGAA 4JVNA 1UKYA 3VR2A 5AUPB 2J41A 4R98A 3AKEA 3SOPA 3D8BA 3GJ0A 5D3MA 2OCPA 3B1WA 2RGNC 3W5IA 4QG7A 3E2IA 3VMFA 1SXJE 3CZPA 2CMKA 4IVPA 4MKFA 2WMNB 1T0JB 2ZI7A 2ZVPX 1T8UA 4PC6A 5G53C 4ZCMA 3FOZA 3R7WA 4DHEA 821PA 5HKKD 2FPMA 3DPUA 2YOFA 2YOGA 1UEJA 4POAA 1RKBA 2ZJBA 1XD2A 1L7VC 3QBVA 4ZCIA 2FMXA 1ZUNB 3SI7A 1QHXA 2PZEA 3V4FA 1XJCA 3EWSA 3TR5A 4PSKA 3U44A 1II9A 1EFHA 4TL7A 3PFIA 1N6OA 2CE7A 3NH9A 3GLHA 5AJYA 1WP9A 2D74A 2D2EA 3WYGA 1I4TD 3CLVA 1LF5A 1NG1A 4Z51A 3B1XA 4JLOA 5JMTA 3CIOA 4LY6A 3UWOA 3KB2A 1R5BA 5DGXA 2EFHB 4PAQA 3QKSB 4LUCA 2W00A 5EQTA 2RGXA 1XNJA 4QHYA 4WZBE 5HCNA 2KI5A 3SN6A 3UG7A 4B2IA 2F1HA 4RFVA 2CEAA 2GCPA 1ZMXA 1DAEA 2R62A 1TADA 3PG5A 4ARZA 3V4RA 5J47A 1P72A 1KY3A 4IEIA 4Z8YA 1SXJB 4CEHA 1UKVY 2FSIA 2X1VA 1JB1A 4IDOA 4BFXA 1EFUA 1E3MA 3W8RA 3A1SA 3WP1B 2PMKA 4XWKA 3D31A 4OQXA 1CJVC 1XEXA 2KBFA 3TIFA 3WNCA 1G19A 4MKHA 3TQFA 4EJSB 5KU1A 5DE3A 3GFOA 2AFHE 1ZU4A 4URVR 5JS7A 2OFWA 4A2PA 4MH0R 2W2VA 2VP0A 3AVWA 2FWRA 4E07A 3X1YA 3MJHA 2QSYA 5EE1A 1SKYE 2REOA 5CLLA 1G41A 1G3UA 1N5JA 1ONBA 1QG4A 3OE7D 2GXAA 5FUWA 4PC2A 4CW7A 3W6PA 2A5JA 4IVQA 4B71A 1CJUC 4FMCF 4BFZA 3OIYA 1XMVA 1FZQA 2C03A 4NP6A 4DDTA 3EZ9A 1JPJA 1TUIA 4P4SB 4M1OA 2IUTA 1SVWA 3F0TA 3LBIA 3MJRA 5DISB 1XWIA 3K0FB 4AKHA 4RFSA 2FFBA 2ZI5A 3K0FA 2O0JA 5HZHA 2QL6A 1FNNA 1U9IC 1B23P 1G21E 3ND9A 2WWXA 3MFYA 3BOSA 1XCGB 4A0GA 4FMBB 4IXMA 4L16A 4JJKA 2JLUA 1FUKA 1E9CA 3ZVNA 2CDNA 4LJ5A 3QKRB 2MSCB 3Q7QA 1A5TA 1QHIA 1W7AA 2IYQA 2XSZD 4DUGA 1T0HB 2EQBA 2UZ3A 3IIMA 1S3GA 4CZ2A 1IY1A 2P0EA 3GJ5A 5FPSA 4RZ2A 1N6IA 1H8ED 3TUZC 2ZSFA 4N0EA 4KI0A 1KSHA 4I4LA 3ZJYA 4JLAA 5L3RA 3VHLB 2EU8A 5SZKB 3U3RA 3W6OA 3RRMA 5FFMA 2QRZA 1YKSA 2XAUA 2G6BA 5J4LA 4LV8B 1KSJA 1NVVR 1FTNA 2WJJA 3KJHA 4OHZA 4NCIA 2QP4A 4XVRA 4AWXA 5JWOA 5LPNA 1R10A 3T15A 2CCGA 4JBYA 3PUVA 4YONB 2R9VA 5J40A 3W3ZB 1SVOA 3U60B 1J70A 1WRBA 1W0KD 3BRWD 3GJ3A 4C0BA 1P62B 1DARA 4AG5A 4GI7A 4Y0AA 2J0QA 2BMDA 3WBKA 5KNDA 4DSOA 2J5XA 2PBRA 2ORIA 2Z83A 3KJGA 2G1KA 3J81k 2R44A 4YMWA 3RRZA 3N2IA 3DM9B 3H84A 5BN4A 4OHXA 4A6XA 4OK5A 3HDTA 2BHRA 1HYQA 1Q1QA 1NRJB 2Q3FA 3TK1A 5JI2E 1KDRA 1AM4D 4QL3A 3RLFA 3LAWA 3W3AA 4TQAA 1IXRC 4EJSA 3SQWA 3HWSA 3SYNA 4CT4B 3CR8A 4JBXA 3CWZA 1R0YA 4OJQA 3RABA 4A6PA 1F2UB 2B7CA 2AD5A 3KUCA 2R6GA 2ZETA 4OBEA 1XJQA 4YLGA 4FW9A 3LLMA 3RWMB 2FFAA 4ZDJA 1OIWA 4NE2A 1GILA 3FB4A 3TJZA 1II0A 2ZR9A 4Q9KA 1XD8A 4HDCA 1OIXA 1TF5A 4LYAA 2EVWX 4PC7A 3P4YA 4Q9HA 5TV2A 1GFIA 3OEHA 1G5PA 1G3QA 1KAOA 4WA7A 3A8TA 4KAXA 4PZYA 4JS0A 3SYLA 4JZKA 4ZDKA 3NTUA 1S1MA 1PV4A 4IDNA 2OFXA 1UM8A 1SHZA 1GRRA 3B60A 2YWEA 2HJGA 3KDSE 2O8BB 3GEHA 4IRUB 2W6JA 1CU1A 4EFMA 2OCYC 4A8JB 2W2XA 4U02A 3WY9A 3UKDA 1DAHA 1P2UA 5FPKA 2Z0MA 3O8CA 5JEEA 2GA8A 2XTZA 1SVSA 4TYQA 5H70A 4Q00A 2REXB 5AWFC 4KYUA 2J0UA 3A1VA 2BEJA 3PR1A 5EP3A 3K0AB 1W2GA 4MRRA 1U90A 4V0OA 2HF8A 3RS4A 1VIAA 1UJ2A 3UMSA 5TVKA 4ARZB 4RD4A 1H8HD 5FBRB 2PT7A 4GMXA 2GK7A 3GLGE 3GLGA 2JJ2A 3CB4A 4XWOA 5J4KA 2BMJA 2B21A 3S1AA 4ZI3A 2PCLA 2F7SA 3JVUA 1L2TA 4DZZA 1HE1C 2XX3A 1W4CA 4LJYA 4BRWA 1RRGA 1V5WA 2ODWA 2OCBA 2GEDA 1QF9A 3CNLA 3LA6A 3SFVA 1IN5A 4FCVA 1TF2A 2LWIA 3B9QA 4OJKA 2XNDD 1VMAA 3BFXA 4S35A 5SZJA 1E9SA 4BPBA 4LHYA 2F3RA 2K5UA 1YHNA 3MGCA 4F91B 1ETUA 4JT4A 4LV6A 1LFDB 2UZIR 3L8ZA 4LYFA 4DCTA 2FJUA 2OCAA 1QHSA 3ZH9B 1M74A 2C8VA 2V55B 1W36B 3VTKA 4B3GA 3NC0C 4YMVA 2XOKA 1NL3A 4M9SA 4WOPA 4Q9IA 1A82A 3IHWA 5JHGB 5ELXA 1E2IA 1P7CA 1FFHA 3K9GA 2ZM5A 1W5TA 4BUJA 3CO5A 1EWQA 2GJAA 4ITRC 1W4BA 1R5OA 3KKMA 3T5GA 3VU9A 3U4QA 3PIRA 1S0UA 1P3JA 2ODBA 1XPUA 1AGRA 4LC1A 5A4JA 1P73A 2I4IA 3SHWA 5C2JB 2W2TA 3IQWA 1CRPA 2DYKA 2EYUA 5L3SB 1XD2B 1OKKD 3SJCA 5KSZA 5FTLA 2CCKA 2ZSDA 2O8DA 3R20A 3MSXA 3RS2A 1UKZA 5FPTA 2ZYVX 5KO2A 4NCKA 3QNUA 5BQ5A 4CVNA 1E96A 3IKJA 1W36D 4DB4A 5BN3A 2ORWA 3TW8B 1E2NA 5J4HA 2VP4A 3N70A 3WBJA 3QXHA 4BLRA 2CL6X 2PLFA 1SXJD 4AKIA 3QPUA 3QIAA 5EE9A 2C78A 5H68A 1DAGA 2IYRA 4V0ME 3RS5A 5IHPA 4CT5A 1AKYA 2YHSA 2VYFA 3IEVA 4KODA 1NKSA 1OXTA 2G88A 1OH7A 1W49A 3WNBA 5AUOB 4L15A 1UDWA 2ERYA 2WVJA 3IO3A 2R6DA 3EX7C 2E87A 2RHDA 4CRWB 4TL9A 1NLYA 3VQTA 3ADBA 2O8BA 1S9HA 2A78A 1XP8A 3C8UA 1CLUA 1XPOA 4JL5A 3L8YA 2WV9A 1HQCA 3F5FA 1COWA 2CJWA 2F9MA 2GVZC 2ZE6A 4L9WA 4TMZA 3EPLA 1Y63A 1NIJA 1XX6A 2CJWB 4OI0A 2BEKA 2CVFA 3GLFE 2GK6A 5C18A 1SVMA 1XEXB 5DN6D 2D2FA 4HAYA 3P26A 3ZZ0A 4BFYA 2ZRJA 2VL7A 4B76A 2FE4A 4HB2A 2PCJA 1FP6A 3I1FA 2A3RA 4URXR 1GRNA 2IYTA 3BERA 3FMIA 4M1TA 2PLRA 4X8MA 1Z08A 2GBLA 1JR3D 5CB6A 1VYUA 2OLKA 5KPDA 2CK3A 1CR2A 2MMGA 3FWYA 2ZUBA 4MDFA 2B6HA 2OESA 2QRNA 4P32A 2YNMA 3QXSA 1FQJA 4IEEA 3AF3A 1ZNXA 2FPLA 2DPXA 4HSEA 1KI9A 1NBMA 4ZI2A 5G3ZA 2O8FB 2CL0X 2O0KA 3K09A 3PEUA 3U6BA 4OI4A 2EWWA 3AGQA 5KSYA 2DBYA 5E7IA 4LJAA 3D3QA 4Q1FA 4TMXA 3CWQA 2J0SA 1SHKA 1K5GA 3GLIE 1VTKA 2P65A 4Q9LA 4FIDA 3TNFA 3TUIC 2O8CB 3CRVA 4URYR 2RGGA 3R8CA 1AJEA 4O2LA 3QY0A 1M2OB 1U8YA 3QKSA 3P4XA 1KK0A 2ZEJA 3BH7A 1KO5A 1Z5ZA 4XVQA 3ADCA 2DHRA 4JL6A 3X1XA 3GEEA 1RE0A 1N3BA 1Z47A 1YR9A 4PC3A 3EIEA 1KNQA 4NDZA 4WXPA 3CF0A 4UNSA 4Z8XA 1NG9A 2J9RA 3QSYA 4PO1A 3EPHA 1E0AA 1G7TA 2QPAA 1T3LA 2GWHA 2OV2A 1NMXA 5LB4A 1FQKA 3UMRA 2ATXA 3UWKA 3Q9LA 1DELA 4IOMA 2ZI4A 4D2IA 3I61A 3SC3A 4NU0A 2WKQA 4RD1A 1I4DD 2KE5A 4R2HA 4PAOA 4WBSA 2ONJA 3RNLA 4YMUA 1KDPA 5EUQB 1RYHA 1QG2A 4C7OB 2AWOA 1GZSA 3EW9A 1QZXA 1YZTA 1E1RD 4M1KA 1W1WA 1US8B 4Q1BA 2J1LA 4WZ6A 3K9NA 4PHHA 1KYIA 4GOXA 1US8A 4WAUA 1IJFA 4Q7JB 4DIDA 5CDFE 1CEEA 4R7ZA 1T3SA 2AR7A 2NPIA 4TT3A 3KFXA 2WSSD 4G5QA 3HU3A 1XFAA 1Q3HA 2IYVA 2JIZD 5E7JA 1N6RA 1HT2E 2JDIA 3CM0A 1D9XA 2V1UA 1MRSA 1VCNA 3FYHA 4IXNA 1ZINA 3NXSA 2HLDD 3MWLA 2QAGC 1A2KC 1Z29A 3TAHA 5J4YA 3THXB 1UADA 4DWJA 4FWIB 1YU9A 2V8OA 4DCSA 2XGJA 1JR3E 1UF9A 2CLSA 2Q9BA 4NCHA 4H1VA 4LGMA 4TYYA 2D7CA 4LJ7A 1ZU5A 4KHZA 1II8A 4OHYA 2YKGA 1EFRD 3AVPA 2C98A 4BECA 4ZIRA 1Q20A 1E2EA 1KAGA 1MO3A 1Q1BA 2VSOA 4KBGA 2QMOA 3C15C 4TLEA 4DSTA 4A0FA 4KFTA 3AVUA 4EFLA 1MO4A 1NMYA 2B7BA 2JLXA 4D0LB 5CM8B 2GCNA 2BJWA 2PX0A 3H2YA 4A2QA 3KXKA 4CDGA 1G8FA 2Q3HA 4NMMA 3EARA 4OHWA 1JXMA 3QE0A 1N2CE 4LHVA 2CLCX 2EFDB 3V00A 4B6EA 1M7GA 4EIWA 1CIPA 3X1DA 1TTTA 5FUYA 1KI6B 1LV7A 1F2TB 1G17A 1WCV1 4LYJA 4HUTA 4HZUA 1N0VC 3I5YA 2A5GA 5DNYB 4PZZA 5CDFA 3WXMA 1LS1A 3BS4A 2P2LA 2F6RA 3QJYA 4Q48A 1C9KA 3CUEF 5FH9A 1XMJA 2FH5B 3CPEA 4NHOA 4FMDB 4RSGA 3RVBA 4B3CA 4EJSC 1Q57A 1GITA 2GAOA 1M34E 3KB1A 4LBWA 4TLDA 1HY3A 1YZQA 2VO1A 2WWFA 1DAIA 3GJXC 4IHQA 2W6ID 3SS8A 4KV9A 1IAQA 2WPDA 3PITA 4NONA 2VHJA 4K81B 2FX3A 1NMZA 4OL0A 4XJXA 4ZCLA 4C0KA 5AJXA 4MYCA 3K0CC 4A92A 1SVLA 1Z2CA 3P27A 1RVDA 5BN5A 1I2MA 1GNRA 1P2VA 3QXXA 4Q21A 3ZVLA 2ZRLA 4YDSA 3A1UA 1RRCA 3QKTA 3K53A 3TR0A 3WMEA 1X86B 4QGGA 4LCBA 3IUYA 5GVSA 5KSOA 1JNYA 2GJ8A 4F4IA 4K46A 5JCZA 2IEYA 2QGNA 4LPKA 4C7OA 4R2IA 3EPJA 3AKCA 3WNDA 1GVNB 3DMDA 3RWOA 2RGCA 4D26A 2DY1A 3LY5A 4BEBA 2ASEA 3U2QA 2WBLC 4CIDA 2JLRA 1JQJC 5UKDA 4I1OA 1JBKA 2KJQA 1OYWA 2ZRIA 3UK6A 3C16C 5IK2D 4Z54A 4R9UC 1HH4A 4LJ4A 4HYYA 4X8OA 1QHHB 2QY9A 4UXJA 5DI3B 2WWYA 3VKHA 2EFEB 1FX0A 1MABB 1WXQA 1W44A 3LNCA 4GNKA 1YR8A 2JEOA 1DO2A 1NBMD 3L43A 4Q1DA 3U3JA 1E4YA 5AR1A 1JAHA 3ZQJA 3AVTA 4LJ6A 2MMCA 1ZNYA 4O25A 4Q7KA 4GT1A 1VDZA 3NH6A 4BZXA 2JLVA 1QHNA 3IGFA 3VKGA 2R65A 2VBCA 2PZGA 2FGJA 2GXUA 1W0JA 5HPYB 4G0NA 1KKLA 4JJZA 2BKEA 3TLXA 4GMDA 5CIWA 5JCPA 3GLHE 4P3YA 4C4PA 2WHXA 5JJLA 1IN6A 4DLYA 5TMPA 3P32A 2D7DA 4DDUA 1FP7A 3EZ2A 2WKPA 5H1YA 2ODNA 2AD1A 1S1CA 2PL3A 2FF7A 2NG1A 3QG5A 5FTMA 1XDBA 3I62A 4KVGA 2QE7D 5K8UA 2PJRA 1TPZA 2AKAB 3DMNA 1F2TA 2P3SA 4DDVA 4D25A 4HZIA 1Z06A 4RD6A 3THYB 2VHCA 3QBTA 5FTKA 4HI0E 4BZQA 1OFTA 2VHTA 3I8SA 5TB5A 421PA 1MH1A 2JAQA 1IBRA 2FG5A 1DAFA 2VSXA 4A82A 3KX2A 3FVQA 1IN8A 4RCZA 2YWHA 3C4JA 3B5JA 4B47A 1N6KA 1P4SA 1DG1G 1FPMA 1U81A 3KTAA 3ZLJA 1E2MA 1E1RA 1Z0IA 2D4HA 4AI6A 4Q1AA 1OHHA 3C5HA 4BASA 4GOKA 2BIFA 1MO5A 1Z22A 4C2TA 3EAQA 1E2FA 4LSGA 2IYYA 3U6KA 3W90A 1YR6A 1XTJA 3FTQA 3VFDA 3PEVA 4IFEA 3GLIB 5DIFA 5E3HA 2FFQA 1KO8A 3IILA 4TSFD 5IF9A 2ZU6A 4B43A 1L4YA 4AIIA 1R4AA 1Z2AA 5CYPA 2WJGA 2XB4A 1D2EA 3CONA 4B74A 1R8SA 4P4SA 4KLZA 4TLBA 2PJZA 5IRCD 3TBKA 4Z1MA 2HXYA 2ZRHA 3NHBA 4M9QA 4Q4AB 1AN0A 1T8TA 2JCSA 2GDJA 3V9PA 4GL2A 4HDOB 5KPJA 2FU5C 4LPSA 3AVVA 3DM5A 2IS4A 3NHAA 3B1ZA 2JASA 3PV0A 1WDTA 1S2MA 4QOSA 1CJKC 2ANBA 3TMKA 5DO9A 2OZEA 2ZJ8A 4WIAA 4E22A 4YQFA 4FCTA 5JLJA 2OT3B 4IFBA 2FDCA 1OXSC 5GVRA 4MKGA 3E1SA 2PT5A 4TYWA 4AD8A 1G16A 3A4LA 3T1QA 5F2EA 3ZDQA 1QVRA 1RZ3A 1DO0A 3CW2A 4QRHA 3VR5A 4JLJA 4ZDWA 3WMGA 1W46A 4ASUD 3BH6A 4C0SA 1CTQA 2FEOA 2H57A 2BBSA 1G291 2FEMA 3LLUA 3A36A 3TSWA 2YWGA 3U4QB 3B85A 2AXNA 1G9XA 2XTNA 3QF7A 2XZLA 3ZQ6A 4BLQA 3EA0A 2ZSAA 2GHIA 3R7WB 4HLCA 4JIMA 2HYIC 4RKFA 2E9SA 4M8NE 1X1SA 3BAFA 3BE4A 3CH4B 1YJ5A 1BMFA 3L0IB 2FZ4A 1E2PA 1GG2A 4B3BA 1OYYA 1E99A 2CHGA 2GJKA 3IDQA 4K8OA 2I3BA 3HP1A 2ZS8A 4DSUA 5DHAA 3CPHA 2AFIE 1VCOA 3QEJA 4FD2A 4M2LA 4OKSA 1ZYUA 4E03A 2W6IA 5JS8A 4FMDF 2MSDB 1Z28A 4TLAA 1NF3A 4OI2A 4PQYA 2IEZA 5KHOC 4XIGS 3CX7A 121PA 3VKWA 2O8EA 3HU2A 4QBFA 2GF9A 1FL9A 1GSIA 3OEED 2QBYA 5FBWB 4DUGD 2V6IA 1IOZA 4BWYA 1ZM2A 1OFUX 5FOTA 2CHVA 1YE8A 2BM0A 3FKSD 2EFCB 3T35A 3CKLA 2QG6A 5KOYA 2BOVA 2WWGA 2O52A 5FI0B 1BYUA 1HA3A 4KBFA 1VYVA 1F5NA 5G41A 3B8HA 1ZD8A 1ANKA 2IXGA 2ZI6A 4IOJA 3KKNA 5CK5A 3RRYA 1GWNA 1NVUQ 4M9ZA 1KK2A 1CS4C 4Q4HB 2QZ4A 4HLUC 4PANA 5FL7D 1OFHA 1N25A 2W0MA 2QUZA 3KQLA 2O8DB 5G3YA 3KXIA 2Z4SA 1QBKC 3HR8A 3THWB 1LVGA 4HEJA 2HT1A 2ZJ5A 2QPOA 2XEXA 3AKDA 4DCNA 3WYFA 4UKDA 5EZ6B 3C5CA 4C30A 1NY5A 4RD2A 1U8ZA 4WVFA 4PR0A 1BS1A 3MG9A 4S2EA 1ZW6A 5BWMA 3WHKA 1KI1A 1R6BX 1E79A 2H17A 2JLZA 3ECCA 1XB2A 4AKGA 2IT1A 2V7QD 4UNNA 1OV4A 3P20A 2JJ2D 1Z0JA 4DLXA 2O5VA 4UNRA 3G82C 3WHLA 1KI2A 3PUZA 2JA1A 2WJYA 4I81A 4DLWA 1VECA 2QQEA 3R9IA 1NN1A 3AVYA 1XEWX 5JZVA 2VSFA 4N0DA 3UXMA 3VX4A 1DADA 2ZRPA 1WBDA 4PHGA 2RH5A 1F2UA 3LXRA 1XZQA 2V4ZA 4I1VA 5KDOA 4QJ5A 1PUIA 4B44A 4FWTA 2GTPA 5TARA 4MRNA 3EWAA 3KKPA 1OXXK 4MUBA 4YDHB 1NJGA 1VCMA 5KTYA 1YRAA 4Q18A 3PEYA 4MYUA 4F4CA 3H86A 2FGKA 3QKRA 1ZIPA 5EXPA 4E5UA 3ADKA 5FBVB 4GPTA 1J99A 4KJZA 2JJ8A 1TAGA 2GAAA 3FDIA 3MMPA 4KFSA 1G7RA 2ZREA 1HTWA 4PZLA 4KSCA 2ZRDA 4TL8A 2DB3A 4DEXA 1BH2A 1LB1B 3LW8A 1OT3A 2ZVQX 3OIUA 1GM5A 4L4UA 4TTQA 4CF7A 2W6JD 4US1R 3RC8A 4PSAA 4DRZA 2J59A 5AK0A 1NN3A 3LQRA 4JLBA 2P5SA 1AQYA 1K5DA 2FSGA 3IO5A 4A8JC 5HZKA 1RRFA 3TAUA 1RIFA 1VHLA 2C04A 4W5WA 3KFVA 1M1YE 2Y8EA 3U7EB 4X8LA 5AJVB 3QXCA 3RS0A 3OAAD 1U98A 3SHFA 4BZPA 4IDQA 4M53A 3D7MA 4BQSA 4GP7A 1RRPA 5JFGA 2DCUA 4KYIB 4DXAA 3CF2A 5TY0A 5L3SA 1FMLA 2OXCA 2VTKA 3AP1A 1J8YF 3MWKA 2XZOA 1A2BA 1SKYB 4QKQA 5LD2C 1OLOA 3BC1A 4B34A 3P1JA 4DLRA 3GJ6A 2RAPA 2BMFA 2IWRA 3EZ7A 1E9EA 2GKSA 4V02A 2ZRBA 3BORA 4EDHA 2E1RA 1VPLA 2ZANA 4BLPA 4P33A 4CGZA 4LHWA
chains in the Genus database with same CATH superfamily
4G5RA 3AJRA 4JB8A 4F3KA 3SJ7A 3AVXA 1L4UA 3BG5A 1GO2A 3O1HB 4A1FA 2FUG6 3M6VA 3OC0A 4RH0A 5CFPA 3HJUA 1EFPB 2PR7A 3PCRB 4M6WA 4MJXA 1GRQA 3ABOB 5BWCA 1VSVA 5DGIA 3SZMA 3PXXA 5C51B 1YRBA 2BM8A 4OGWA 4A0HA 5AMXA 4EI2A 1NX6A 1U7WA 5DXAA 3R7SA 1KVUA 3FR8A 1W581 4IP0A 1QYVA 4J4BA 1IN4A 1U2DA 1S2DA 4U5XA 2V1UA 3AMVA 1SKUA 4NE7A 4LHEA 4WLNA 2IU0A 3AM5A 4DNQA 3IXLA 3PPYA 2DPYA 4HQKA 2RBEA 4QJ3A 4OGLA 1BSVA 5DWDA 5DT2A 4DSAA 4N3BA 3BB3A 1A1SA 3PD7A 1DBSA 4AY3A 3NEAA 1CJMA 1W85B 2P0AA 1NOIA 2XUKA 2HSJA 1S4QA 1TI7A 3AGPA 3C7KA 4LK2A 1YONA 1O6ZA 3CINA 4UVGA 3SJUA 5HE8A 2O23A 5E6SA 3TD6A 2A92A 4OXQA 5IARA 2ZJ3A 3ZY2A 4PNEA 1GTRA 2VOEA 3TRHA 2E4YA 1VPWA 1FRQA 1IPEA 3ESCA 4MV4A 1Z68A 3HY6A 3I6BA 4V0NA 4ZJYA 3B3JA 4DG5A 2FP4A 4LOJA 2JRCA 3L93A 1WNTA 1QHGA 5DH9A 2CVPA 1Z07A 3DVQX 4RO0A 3QH4A 2ZWPA 3G7SA 3AZQA 1MFPA 1R9JA 5IC5A 3WNVA 2ENWA 4KLNA 5AI9A 2NAPA 5BY2A 4TKUB 3OU2A 4ZOEA 1NVAA 2GM5A 4XYGA 4Z9YA 4BLSA 1CNMA 1FVOA 1WHTA 3FPSA 3M2TA 1K8QA 5C5CA 2J9YB 1JHXA 4DJEC 3OZVA 3CFYA 3GLFA 4DMFA 2CXRA 2NX2A 2HRCA 3OTOB 2YR0A 3AR3A 2XITA 1H6CA 2E18A 4BVAA 1U9CA 3CLUC 2ZSHA 3OQ1A 1MDBA 3COSA 1X8KA 5M04A 4KR3A 3THSA 1HF3A 2XJ9A 2CLLB 3I58A 3V2HA 2DLCX 3RRNA 3FCSB 1OYVA 5KYNA 4KQEA 1JEAA 1FSSA 3U3XA 2A5FA 2OOSA 3ETGA 3WAJA 3HXTA 4PTLA 3FTCA 4HLDA 3ZHBA 2VJAA 4HJXA 5FDFA 3KAQA 3C5EA 1UPFA 4IAOA 4C7XA 1M5TA 3AF4A 1GV0A 1J6UA 2QYSA 1MRZA 3I4CA 4LC9A 1LLCA 2FMUA 3X1WA 4QNRA 1XAJA 4EX6A 4D9HA 2ZYWX 5DP1A 3O93A 5I7AA 3WIOA 4H35A 4IJMA 1UANA 1NNI1 5DYNA 3BRQA 3C1TA 2IIQA 3T61A 5KKAA 5BW8A 2ZAYA 1Z0DA 2UZ4A 4L0MA 1CUEA 1JQLB 1QQ5A 2ZE7A 3K2BA 5LKRA 3HCAA 1O9GA 1SWVA 1X6VA 3R0QA 4L8YA 1SG9A 3SC2A 3EUAA 1UK6A 3K8YA 4UEWA 4IOLA 1BRMA 5LQDA 2Z6QA 4EB6A 1WR8A 4W9NA 4JEHA 1GQSA 2GZHA 1KI8A 2IXEA 4IKOA 2NM0A 5ER6A 4BGDA 3I5XA 1YQEA 1P19A 2AN9A 3THXA 3KSBC 1KY2A 3RHFA 1IQPA 3ZXUB 4MUMA 2PSDA 2CXUA 3ANLA 4Y2UA 4HUJA 4TT3D 5L40A 2BUBA 1TEZA 1ZIDA 5DJ5A 1I4LD 1I1OA 3MF4A 3MQ4A 1FDOA 3PHCA 2UKDA 1PE0A 1QQ6A 5HBGA 1AK9A 3FN4A 1CDDA 1CVRA 1E94E 2XTMA 4W7HA 2NUTA 3WK8A 2QMYA 1VHDA 2D8AA 5K8IA 4I1SA 1Q92A 4R0VA 4AK9A 2JLBA 4LY9A 3PNBA 4WOKA 1W94A 3RYFA 4C5BA 2GRUA 3L0PA 2QN6A 1KOFA 3PLAE 4HH0A 5JD3A 1YKGA 3O1IC 4G5SA 4QXMA 1VJRA 4FFLA 2WWIA 1JYEA 1FLDA 1L8LA 1CQJB 4M0FA 4RMHA 1JJVA 5ALVA 1K86A 4MRVA 2QT1A 2E37A 4B73A 1HPLA 4KXUA 4J1NA 5AJTA 4OYYA 2GVDC 4QNMA 5BORA 4J1TC 4L2IB 2Y2UA 3BREA 2J6IA 3BHMA 4GX0A 4NH4A 5F2NA 5HM6A 2I99A 1VIVA 3E3AA 3P96A 1KEEB 1RJ9A 4HEQA 3A3NA 4PZPA 1RWOA 3NWPA 2OCDA 3TOCA 3VC1A 3ZLTA 2PUGA 5JRZA 1PJ2A 3SDBA 4LQDA 1AV6A 3BD7A 1LJ8A 1KFEB 2X4IA 3ED1A 4KWCA 2WAXA 2RH4A 3I8XA 8AT1A 3CQ9A 1NF9A 4S1VA 1P1BA 2PQ6A 3ER9A 4BNFA 1PQWA 1WKBA 3W4JA 4H6VA 3KSAC 4ND6A 4IV0A 1KS2A 2J9FA 1VBKA 2VYVA 2XPCA 4M0KA 4WOCA 1OTXA 1QH8A 2IPNA 3AI2A 4QU5A 4L50A 3B78A 3F8SA 3NTLA 3P9SA 4UHFA 1M2EA 2ZPTX 4IJ5A 4FBGA 4PGGA 4KITB 4H17A 5BW4A 1SQ6A 4DV1B 3HZOA 3FYUC 2ZJ2A 4HMPA 1C0PA 1B2LA 3D4NA 4HDNB 1TAHA 1RJEA 4J0HA 3T54A 3DWGA 4Z53A 4OKIA 1YVRA 2Q2VA 3LUCA 4RJLA 1PLLA 2WB2A 5PGMA 3H1BA 2UXDB 5HXAA 3S2UA 5J23A 4LZOA 4OQLA 2BM1A 4B7XA 4BMCA 1I7LA 3SBEA 1U1EA 2PPLA 1KBZA 2HQRA 2CHEA 3L0DA 4LV5B 1VKJA 4AMGA 1JKXA 3NV7A 5LLDA 1CCWA 1DWPA 1VMEA 2D5AA 2LUOA 2OE2A 3EF3A 2FPKA 4JUAA 4AN4A 1GEGA 2X2EA 5CFRA 2NSLA 3DUWA 3OBIA 1CZRA 1SU7A 3USCS 1T2VA 1BCRA 4IIUA 3QOYA 3J80A 1XLUA 1G8GA 2R1ZA 4D74A 2QD2A 4H6XA 4W1RA 3RVJA 4FWBA 1G8KA 3CRRA 4JVSB 4MAMA 2WUEA 1C3OA 3DFFA 3CLSC 2G5TA 3DE3X 3T7IA 5B58C 2ZKLA 4XDHA 4YJFB 1E63A 3F98A 3C3WA 1RXUA 2WTNA 9LDBA 1YBVA 4CF3A 4I36A 2FW7A 2F48A 2GN2A 4ZZ3A 1U3GA 1GP2A 2AG6A 1B6RA 3WGZA 2FSHA 3H6KA 3I37X 3OKPA 5HIJA 4JNKA 4YUXA 3GC6A 1D2HA 3LPAA 1LI7A 2QTVA 4S1TA 4UDNA 2PXAA 1O4WA 3HU5A 4FZ3A 1Z7YA 2PFSA 1C7IA 4OGFA 1E9FA 4QT0A 1SAYA 4CL8A 4MYTA 2UZ0A 2VNKA 4MUGA 5LB2A 5IYZA 1YQWA 2VCEA 3EWNA 2W5UA 1DC5A 3DKVA 4XD7D 2GFQA 5AHKA 5AVWA 4BU1A 3KZVA 1F51E 4BXOB 2DBVO 4C7BA 3DL0A 3E7FA 3LH5A 1U1CA 1RC1A 3KKLA 3K70B 3Q8KA 1RTKA 2CNOA 2H16A 4RVHA 5F78A 5FWXA 2VF8A 2XY4A 2ECOA 3PC7A 5JH7B 2JCBA 3DJYA 1RDFA 4QYMA 4ENRA 2X1LA 3VAAA 1UXGA 1VJ5A 4LWZA 4PX9A 2AB0A 4CCYB 1P1IA 2YL2A 1VLQA 3CVXA 1LC3A 4HDQB 4OXKA 5REQA 4BGEA 4D96A 3WGNA 1N77A 3D9QX 3R41A 1WB9A 3FGOA 4D9EA 4ENPA 2ILTA 1Z35A 4RTJA 4GLFA 2IRWA 4EQ6A 3W9UA 2R4QA 2QZPA 1QGZA 3UAZA 4F7WA 1VL1A 3N2NA 2GVNA 2HJVA 4DDWA 3UWPA 1TVMA 5TDHA 4LF6B 1BGVA 4YP1A 3GG9A 2AW3A 4RJIA 3DTVA 4G01B 4RKWA 4J2OA 5J4VA 2V0CA 3CX6A 3K9QO 2X3UA 2BFAA 4KZPA 2WAMA 1ATIA 1KIAA 1Q12A 1B2RA 2O0HA 3ZZUA 2JPDA 5ALJA 1N36B 1J90A 4FYPA 1Z5PA 3CG4A 4JKIA 3U5ZB 1OGYA 3IELA 3F2VA 3VR6D 3RIXA 1QDUA 3OPNA 3I2HA 2HQSA 5IAKA 1G21B 1OC4A 5LOVA 2MU1A 4DVGA 4BNLA 1FC0A 2AVNA 1W88B 2BR3A 2XB8A 3AV0B 5A1JA 3PVSA 3PL5A 4MA4A 3G8BA 3UBMA 1GUAA 4F12A 4QJ4A 5EIFA 1YC5A 2I6QA 1CR4A 4OQPA 2VVTA 2FUEA 4CEIB 5FBKA 2CMFA 3OEHD 2QXYA 1KS9A 4AZ0A 5BUSA 1CZHA 2Y27A 1ZN7A 5E0KB 5J2TA 4HDMA 2HU7A 1Y1RA 3G0GA 4GNRA 1UPXA 1Y80A 5FPHA 4IW3B 1T5TA 2LD4A 5CYFA 2JI9A 4JJIA 3OMWA 4MQFB 4LDZA 4YR9A 3EY9A 1V8OA 5KINB 2P9QA 3ROQA 2R6CA 3OC6A 3OE4A 4WXRA 3RQSA 2QN1A 4AO7A 2J3EA 2IH5A 3NEJA 3H1AA 2PUJA 3JVVA 1V16B 3D59A 4NY1A 1H4VB 1WCWA 1AO3A 4UE2A 4ERNA 5JCOC 3HSKA 4EMUA 1KHTA 3OTIA 3WGTA 3QBEA 2DH6A 3BCSA 1ODJA 2CJYA 4L3OA 3BB4A 5AUQA 3GLKA 4IHJF 4D4JA 5L4NA 4Q4JB 3TO5A 2ACWA 3R3UA 2HPVA 2X8JB 4ETWA 1BJTA 4JDUA 5AJZA 2PKQO 3ABQB 4HLUA 1U6IA 4PBRA 1ESZA 1ZQ9A 3Q3HA 4K6GA 2PA0A 4I9GA 4WN3A 1RYFA 3VO2A 1GCGA 4B32A 1C1HA 3U4MA 1YBFA 1Z6AA 2V9CA 1EVZA 1TO6A 3CUKA 2H2HA 5IDXA 1HDGO 5DLEA 3GYGA 4CTKA 4NYIR 5KYTA 4JT2A 1KJWA 1ZR2A 4GOJA 1Y33E 3E9YA 3W5VA 2Q5FA 3KLPX 3EVTA 1T8RA 4KDEA 1G20B 4TT8A 1JQBA 5G0UA 1G1MA 1XZDA 2X9NA 3DZHA 1IZ0A 4C6RA 5JNSA 1JALA 1G3IA 4DLAA 1YTLA 4BBPA 3A26A 1W25A 4Q4DA 2C9MA 3FKQA 4JWKA 1T4GA 2C3OA 4H16A 1TLFA 4H7DA 1RABA 1M8KA 1HTBA 4LHZA 1N9GB 2H18A 2OO3A 1W35A 2RJ3A 1IONA 1V37A 2Z8YA 1EFVA 2GEFA 4K9QA 3HBMA 4A6DA 3KKOA 1L5NA 2HYDA 4DRXB 2PVCA 1AC5A 3HXLA 5AM3A 1DU4A 1F60A 1RP1A 4QVGA 3ETCA 1SQ0A 3SG0A 1MC1A 1MZVA 4R81A 1JA0A 1WB6A 1GD1O 2EG5A 2Q4BA 2YWXA 4F9FA 4R1UA 1BNCA 3MC1A 1U2SA 3ONEA 2N42A 3M1YA 4P0TA 2BF7A 1KVQA 5FWXB 1E9VA 2FUG1 1Y3BE 2Z5VA 2I4LA 2C8LA 4H60A 4Z4QA 4P0QB 1NV8A 1ZCBA 1C1YA 2X19A 4F4FA 1QAMA 2VJKA 4V03A 3GHYA 3V7UA 5D6NA 4QQNA 1SVNA 3IJRA 2OHGA 4M1ZA 2WG1A 1HG0A 1UKBA 4P4TA 4QASA 3I12A 4EMTA 3SR3A 1RXEA 1O87A 5K0ZA 1X8JA 1WM1A 3NYIA 4IDGA 3NC1C 1V6CA 2RGBA 1N4AA 2EZ4A 3I2GA 1YDMA 4F2GA 2QMEA 2ZT6A 1E8MA 3AETB 5GGXA 4ABYA 1P4RA 2R5FA 4MVXA 2ZQZA 3NS7A 4CEHB 2PX8A 3VZDA 2I2FA 4Q3DA 3FYUA 4QULA 1HWYA 1IM2A 3A6FA 1QGDA 2QU8A 2J7KA 4X24A 4YJ2F 3RNOA 4KR6A 4TZ0A 3KQSA 4AM8A 1RPNA 4NXNB 1IBMB 1P8AA 4JSTA 4X20B 4PXYA 5IKPA 4ZQFA 1Z5OA 4LG1A 3MCVA 3I5MA 5EWMB 5CDGA 2YHIB 2DHEA 2HMUA 3EVBA 5LP6B 4CKWB 5B1SA 2PBLA 1NP3A 4TTPA 1KY5A 1YIAA 3HBNA 3KWMA 2C5BA 2J0EA 3BXZA 5I9BA 5THKA 1N2CB 2NNWB 2HCFA 2B5OA 4YCNA 4LVCA 2JGDA 1HZZC 1TTQB 3DZ8A 3OWHA 2IV3A 1EX6A 3QYJA 3KCNA 4NEGA 3IE0A 1M34B 3DS8A 4JKOA 5DBEX 5I7UA 1IC6A 1WUYA 4G36A 5E4JA 4JGGA 4H9GA 5CEEA 1UC4B 4P31A 3D2CA 2IP2A 4EHAA 2OO5A 2XLBA 2XYVA 1ZPDA 4LOIA 1YZYA 1X13A 5DN6A 5HF9A 5BYBA 3REQB 5MGBA 4RAQA 4YAOA 4K87A 3H1PA 4EYEA 1OH8A 4MLZA 4LRWA 1X7ZB 3B2EA 1KIFA 2YINC 3SX0A 3TGWA 1E2HA 4EZEA 7YASA 1KOGA 3K92A 2WF7A 4A3SA 1Z8FA 4HZUB 2I2DA 1PWHA 3RBAA 2O2HA 1VG0B 1K7XB 2ZE8A 3VR3A 5IW8A 4D9CA 4CLDA 5C1DA 721PA 3WDSA 2BGGA 1HNWB 3OCVA 1SG6A 1DKLA 4G9GA 2XUFA 3NJ8A 4R31A 5DU2A 3ZHCA 3DKIA 2PLAA 1M2OA 3IS3A 4NIMA 3RO7A 4F21A 1PIWA 1OZAA 1NQWA 1X8LA 2PL5A 4HNVA 4M0EA 1ULZA 3H2HA 3O2QB 4OLHA 3S2FA 3SNHA 1ULSA 3OY7A 4LN1A 1QQBA 2JARA 1S3IA 1ZD4A 2QM7A 4KKXB 3DTVD 4JGBA 3NTXA 3DW3X 3FMFA 4R3NA 4BCDA 4GLJA 4WKCA 1Z7GA 1L4NA 1NDUA 4MX8A 1EQ2A 3R7FA 3VNUA 2JDID 4LNUB 4I19A 1JPNA 3VOTA 3LCMA 2YZNA 4MB2A 1X1BA 1OH5A 1S02A 3F6PA 3JQAD 3PR3A 3AVQA 2YUTA 3TLJA 5JI3E 1E6CA 2JA2A 5JWRA 3A9TA 4J75A 3B1JA 1ZEJA 4MEAA 5E9QA 2OQVA 4YAIA 3CPJB 5CFQA 1KQGA 4KSYA 2C7QA 2IZ0A 3HUFA 2ONKA 4NYMQ 2O3JA 2BDTA 5CVVA 5FNVA 2WE8A 3EG9B 1CP3A 1L5GB 3GQBB 4M4SA 2VF7A 1ECCA 2V54A 4FOTA 1ORTA 3DQQA 3NKLA 3RFXA 3RSOA 3F8TA 5IAGA 2C99A 4GMFA 5D86A 1PTJA 3PD0A 4ZO6A 2VYQA 4TLDA 3RC3A 5EJEA 5ALLA 2QVLA 5FUMA 1NN0A 4F3NA 5GJWC 2RKOA 1QKIA 3A4NA 3C8ZA 3I9V1 1KYWA 4RMGA 1HDCA 1ADJA 3W4IA 3C39A 1BYIA 5CITA 1Q91A 5DF1A 1QHHA 4DSNA 6GPBA 2A5YB 2PRSA 1RZVA 4GDFA 3QITA 1LGYA 3PC6A 5DASA 1I0LA 2F3TA 3KQPA 2H9AA 3E7DA 3OTHA 3RIGA 5IZ4A 3VBCA 1CLEA 5FWAA 1SOMA 2ZKIA 3RI3A 3ZYZA 1I3LA 1MW9X 1ZMBA 3NBZC 4CMAA 1XCBA 2JIOA 3DBRB 1JDPA 4UARA 3ULKA 2Y9MB 5B30A 4BBZA 5JD6A 5IKXA 1FVXA 2Y6UA 2C2HA 1PGQA 2GJ9A 3RFTA 3VKUA 2F55A 1EH5A 2X8WA 3JATB 5KBYA 2XQJA 3QVUA 3V7YA 2IXDA 4HP8A 4ZICA 4K9OA 3QOXA 4QVIA 4CG0A 1GY8A 4N6OA 4G0UA 4WHMA 1FW6A 5TMEA 3FSJX 3A1NA 5U1PA 3SYRA 3X2SA 1VG8A 3WGVA 2GO7A 2HRZA 1C8BA 1ZEMA 4PLPA 4TWJA 3LTNC 1Z2OX 1H9BA 3QNMA 2Q62A 3IMKA 4NPHA 1U4OA 1ONOA 2BRUC 1EFCA 2MSLA 2XOEA 4XIFA 2CHQA 4GS5A 4DM7A 2W58A 3IV7A 5FRDA 2EERA 2AW5A 4OXRA 3K0SA 3SYTA 1PFGA 1ZOLA 1EDEA 2FPPB 1KP3A 4CCAA 2PTGA 4HAVA 4LMPA 4NOKA 1FU7A 4PPQA 3L7AA 5TE9A 2G70A 4GPZA 4PO8A 4TXNA 2RGEA 3D3EA 2GSDA 3IP7A 4KAAA 3I42A 4JBWA 3U3KA 1X1RA 2EEPA 5KIAA 1CD5A 1M1ZA 2JJ1A 1KSGA 3WLHA 1X1EA 2VTVA 4NCNA 2AEFA 2RHMA 3H1FA 4G85A 4ZVRA 2PIDA 1Q83A 2QLJA 2QX7A 3VDQA 1U4SA 1KQPA 4I2NA 4MYRA 4CIWA 3A05A 1VE7A 3BCHA 4MPPA 3W9YA 2PH7A 1G64A 4JKYA 2YY5A 1XD9A 3HJHA 4RHXA 1NLFA 5G1NA 3K70C 1RPZA 1G4AE 1JECA 1RBMA 2RGNA 4AAYA 2X2PA 5FLEX 4EA7A 4PQFA 4AP5A 2Y92A 5HGXA 4G81A 1L5OA 2OBMA 1NUUA 2VA8A 4NS1A 3IFSA 3ZWMA 4DABA 3GLIA 2DWOA 4HRAA 3HBAA 2SHKA 3WRYC 1SKBA 3UHPA 4LJ8A 2AMFA 2GBIA 1IDN1 1G4UR 1N8NA 1OAAA 2ZYTX 2P75A 3C85A 3HEAA 5EXTA 2V0GA 2YOHA 3ROTA 5GM2A 4D80A 1F5SA 3OHMA 3QF4A 2NQ2C 3HDJA 3WIEA 1F4LA 2PMWB 1YDHA 3BQ9A 2W71A 4KJZA 1H66A 4RGYA 2O59A 5K8TA 2QAGA 3ANSA 3RPEA 4GVPA 5EHIA 1WL8A 3V2GA 3UATA 3ROZA 3ZE2B 4Z3OA 4QGFA 4QM6A 4AJOA 2WJZB 3LL4A 3MLEA 5LZ9A 3ET5A 2CMHA 5FNVB 1EG2A 1BFDA 3BIOA 4TMWA 1KNXA 1IY2A 1JILA 2IBMA 1KPIA 3L4JA 3Q40A 4LY0A 3SJAA 4BCCA 4RA6A 4QYXA 5IDVA 3M3PA 3UT6A 4YT8A 3H99A 2IUSA 1FMFA 4BB9A 1JTVA 4UCQA 4DJAA 4N0PA 2K2QB 1UBUS 1JL3A 3C1AA 4MGIR 4RORA 4MO9A 5BQPA 1H5NA 5REQB 2PANA 5CR9A 3ZHXA 3ZBQA 2WM2A 3N7TA 2OVFA 1X14A 2W7TA 4BV3A 3CRW1 3R77A 2Z4RA 3KQVA 4L8LA 1Z83A 2JAOA 4RZXA 5KNBA 4JLPA 3RW9A 1QV6A 1X3SA 2ZJ7A 5TS3A 5K99A 2WTUA 2MSEB 3IPXA 4BE7B 4HVLA 1TF7A 1L1QA 2DX7A 1G0NA 5IUNC 2AOTB 3OTGA 5JHHB 1RM4A 1SU8A 2DFLA 5I51A 2BBOA 1Z0UA 1RYDA 4GXRA 5FUXA 4D97A 4YRZA 4LE0A 1EXMA 2UYGA 3A70A 3U7FB 4W63A 5SZIA 4CCYA 3S1SA 1AS0A 1QCDA 4H4EA 2GDZA 2O6HA 2WKRA 2FWAA 3DPIA 4AN1A 1W4LA 4LTNA 1OBHA 3SZGA 2VRCD 5K7SA 4J76A 4REQA 3T9DA 3RE1A 4BE9A 2NT4A 4OUDA 3LO5A 3UTCA 3VVBA 2C9YA 3DZDA 1QDEA 1W5SA 2B99A 5E1BA 1BN7A 4DLSA 6PFKA 4AKTA 3JQGA 4KO3S 4RKEA 4AC9A 2ZUUA 3C3XA 4YJHA 5HILA 5A6VA 3TZCA 1XTKA 4DHWA 5L7TA 3KV1A 1KH3A 5DEIA 2XIJA 4Q1CA 3VKFA 3ZS9A 2QBYB 5AXBA 1ZBDA 4LI0A 1A9YA 5BV1A 3RAPR 5JV5A 3VAZA 1X7HA 2J5KA 4E1AA 5JSZB 1GXSB 4NH0A 4EG1A 1WZNA 2A4KA 4F96A 4M1YA 2OQIA 3WL4A 1A7KA 1OROA 1YOBA 4REOA 1HDRA 4Q9NA 3SQXA 4KMMA 2X8AA 4D5EA 4LXYA 2F3UA 1UP6A 4BB0A 4I4IA 4F8EA 2E6KA 1DMSA 2WDZA 3OZUA 4DS3A 2OC9A 1XMQB 3GT3A 3HV2A 3MJVA 1MN6A 3ICEA 4IIVA 3BL8A 4G4SP 5ALQA 4P3XA 2P41A 1DC6A 5LP6F 3DDOA 1POXA 1J2JA 4W9RA 4GL4A 3G2LA 4HGZA 4MVJM 4PAGA 5KMGB 1JYFA 2C8JA 4F3TA 3GJ4A 1CKEA 1G8HA 1SXGA 3MCTA 2RD2A 1AGXA 1RKVA 3FFAA 4H4CA 1O9HA 2OHOA 1ZICA 1KMMA 5AW5A 3VDMA 1WEKA 1TUEA 1J9EA 4TL6A 3FG9A 2QPLA 3R6DA 3D0RA 4BKOA 2P1ZA 2M98A 3BMCB 1YQXA 3E9RA 4ITUA 4MS4B 2OORC 1MCZA 4UM8B 2VEOA 4X5OA 3JYNA 1TM7E 4FR0A 4JC8A 1KVTA 4PHFA 1B0UA 3OLXA 3OM8A 5HCIA 2KS6A 4BNWA 5I7RA 2ZUEA 4Y0NA 2Z9DA 3Q85A 4JR1A 5LD2B 5MHTA 1AO0A 1TMGE 4ZEWA 1Y98A 5IZCC 2FSPA 3EYAA 1M34A 4L85A 4M46A 4W5RA 2BEVA 1KMHA 2ZSBA 2OEPA 4QJIA 3VPFA 4TWZA 1EWRA 4YCMA 2BELA 1X7WA 4ZAXA 3UJHA 1LK0A 4IMJB 4CLOA 3IR5A 4FEAA 2WDPA 3EXG2 4MCIA 4OU4A 3U39A 1VKHA 4IGAA 2BH9A 1Q22A 3L4SO 4BLUA 3I39X 2OFOA 2C29D 2YC4C 4JVLA 5DHRA 3KDAA 3X0DA 2E4UA 3Q10A 4XX0A 5BR8B 1WETA 4ND1A 4RVSA 5MN4A 1ZOIA 2QJFA 3JV7A 4OQFA 3ZUPA 1E5QA 1RLMA 3EZLA 4XUGB 4ZOLF 1KO4A 1RJ9B 4ZCTA 4G4JA 3KELA 4D0NA 5GM1A 3DBLA 2ZRFA 4RHFA 4BLOA 4MIYA 1ZX1A 4FZJA 2FP3A 4JV5B 1EFTA 2I66A 4LDPA 2BLNA 2EBFX 2O2CA 3I01M 4JR0A 5C8XA 2ALJA 4M3NA 3MB8A 4DA9A 2HNAA 4KQCA 4D8TA 4KJXA 4BO8A 4KUHA 4LNAA 2JJ1D 3KYDB 2CUKA 2WMOB 4RYLA 2VK4A 2V6JA 3AB3A 3BK7A 3KQWA 1OC2A 4MJ7A 3VZQA 4GFDA 1KWGA 3B70A 3T9FA 1Y9AA 4M9XA 1JQKA 1VFPA 3OF5A 1QJ4A 4ZTBA 1EI9A 5ER9A 1R6AA 4WW0A 5A06A 4ARIA 1MVOA 3QW2A 5F21A 3GDOA 5DMXA 1L7AA 2PBZA 2JATA 2QAGB 4MGZR 5CXXA 5MN6A 1OH6A 1UBGA 3O84A 4DKXA 1A7UA 2Z2JA 2ZGVA 3LPMA 2GD6A 4MB6A 3Q1LA 4P83A 4F72A 1QWSA 2FDRA 3ZDRA 2PS0A 3UN1A 4FHFA 1O4VA 3FHTA 1X3LA 2DUNA 1TQ4A 3LKVA 1E6EA 2IXAA 3VHXA 1ORWA 4BB5A 2JFZA 3E1KA 1XALA 4O0MA 1SBZA 2Z98A 3UUEA 2I91A 1FEZA 1IXSB 4C29A 1JDBC 3AFOA 2EQ5A 3I9NA 4EB3A 1CZLA 5CAEB 4M0MA 4Y6GB 4CLRB 3AHIA 3ZVRA 4Z49A 3U7RA 3M81A 3NBAA 2VHQA 4JJGA 5LYJF 1M1XB 2IHTA 3H6GA 1OOEA 3CN7A 1QB7A 3UGKA 2DU8A 3TLGB 1C4XA 2AXEA 3WLAA 3NANA 4K7JA 1GAJA 3QRWA 5MFZA 4HHEA 4EG7A 5DXFA 4X3PA 5JAIA 4P81A 2V9PA 1T9BA 4DR7B 3QG1A 2A30A 1Z8NA 2KLBA 4ZZ2A 3L7NA 3UB2A 4NI5A 4BVKA 1TA9A 1Z3IX 4BXOA 1I7PA 1BMFD 2IPLA 4DXDA 1FJXA 1Q0ZA 3DV2A 3VGJA 2OO7A 1G21A 2POCA 4OMDA 4M22A 4KNVA 3JYPA 4C5CA 2HFKA 4EGJA 1VLHA 4ES6A 2ECKA 1DKOA 3JD0A 1TT7A 4RHUA 4EW6A 4NOLA 4UFOA 1NBHA 4AT1A 3BJRA 3OTWA 3R09A 2GHTA 4OX9B 5GZ1A 1OWMA 3JALA 3FTPA 3EJ6A 3EXG1 3BA6A 1IOLA 1GZ4A 3RBXA 3DYVA 1TVCA 1ECPA 1COZA 1M0WA 1YZUA 2XMGA 4CCWA 3CNBA 3C1UA 3R24A 5LZ4A 3U7HB 1OFUA 1SCIA 3DP9A 3OEWA 2QD5A 1UBEA 1YS1X 4TUYF 3H3XA 3NAGA 4OQNA 4C14A 4DYDA 1E32A 4LX0A 4NAVA 4YAJA 1A8IA 5AIAA 4UAGA 4ADSG 3MWYW 3V8BA 2BFOA 3CXRA 3CEHA 4HAZA 4N5IX 2G9NA 5ALZA 3LLCA 1W85A 2RSLA 3IIJA 4V1CA 3QVTA 4PPFA 3ZXIA 4B6GA 2QYOA 1CK4A 1IM8A 1IRIA 3FCOA 4IIEA 3UGJA 1P91A 2B1IA 1CB7A 4WDRA 4YYEA 4DJ5X 1X0VA 5EPUA 2NYAA 4XR9A 5HIIA 4RY0A 4E21A 4BQOA 1XMIA 1UFRA 4Q3AA 4F9GA 1FX0B 2ZM6B 1FK8A 1KY4A 2G71A 2JFXA 3DEKA 1PJQA 3C14C 3E3NA 4AJHA 2XDWA 1S2LA 2XCLA 2IS1A 2P2GA 1XROA 2VDWB 2JFOA 2YZ7A 4G5HA 4BEWA 1FQWA 4FE7A 2OA0A 3ROGA 3HJBA 2FMHA 3VO1A 1M76A 1QRSA 1OXUA 1MOSA 5JJKA 3L2OB 4DAEA 1OZGA 2IXBA 3KPJA 6LDHA 2WFLB 1YULA 2QTVB 4IO0A 4MRSA 3E3OA 3NBMA 5DHSA 1RYEA 1DKNA 4G1CA 1ILEA 5AFSA 4UXHA 3SEAA 2B4QA 1ZGBA 2XZDA 3R9WA 1DP4A 2RHWA 3AJ9A 4EFKA 1PJ8A 4FNGA 5CW2A 3AL2A 4UTZA 3DXXA 1QZTA 2YHUA 1OVMA 1VXOA 3H0CA 5FOXA 3SLKA 3GRRA 3JYHA 3FETA 3M0EA 2EKZA 4O4IF 5IVHA 3UT0A 2H1LA 1HRDA 4X1KA 1M54A 4J4TA 4IXWA 3FMOB 1NVXQ 5A4MS 5EJ8A 3IEMA 3RK4A 16PKA 2NO6A 3NJRA 5J58A 2W48A 5CH5A 2Q27A 3CRMA 4B3IA 2XHZA 2XCRB 1YQDA 4HWKA 2XEDA 4DIUA 1GDHA 1YI0A 3DQPA 1TL7C 2BSXA 5KYYA 3L79A 2VCYA 1PR6A 4BOYA 5DBGA 1YR1A 3F3YA 2WFZA 4ZGGA 1N2JA 5L51A 3K9CA 3A6KA 1A5ZA 4R54A 4Z9FA 4HV4A 3DT9A 2V74B 4KQFA 1YAHA 4LA4A 2INGX 4LZNA 4L7VA 3U4IA 2I4MA 4L22A 4JLMA 4AUMA 4ZYXA 5L3VA 4J94A 2BGIA 5SICE 4TX1A 4X7PA 2QOEA 4LYGA 3FM9A 4AF6A 1S96A 2WYIA 2NPFA 1RIIA 1ZOOA 2Q3DA 3H11B 5F77A 2PYZA 1YQUA 3RYIA 4BC0A 1WQ1R 4E1BA 1UXHA 2BFBA 4IHJA 4BEVA 3ACDA 2GCOA 3JYLA 1D5CA 1R6VA 3B1VA 4ND4A 4R1PA 4JQOA 5D00A 5EL0A 5AXDA 4DLZA 2FV8A 2HO4A 2Z1NA 4NYJQ 5JDCC 2GPJA 3GAMA 1GOTA 1I3KA 1T4DA 5KHAA 2IY8A 2HCBA 2QMUA 4Y8VA 3W8NA 1XO1A 4QC2A 3AO0B 3PNSA 3SBDA 3BL5A 4OHBA 4RK4A 5LIRA 3G6KA 2IU6A 4LW8A 1E5LA 3EDOA 5CLQA 4BX8A 4F45A 4CIYA 1N7JA 2QTTA 5TIIA 1HV8A 4D3ZA 5H16A 3CKYA 2WJ6A 3DDSA 1SRRA 3O4IA 1W6RA 3BX1A 2RHCA 2VQSA 3Q5DA 1O0CA 3IQDB 3GZ4A 5J2TF 2IX3A 2I3AA 3JVIA 2FJ0A 3Q5EA 4MPRA 1G8PA 2NGRA 4B35A 2G77B 1TAQA 3TAXA 1KYYA 1PDVA 3MWEA 4XYBA 2O2XA 2FX2A 3NOXA 4ZDIA 1CY7A 3HBLA 4P34A 1DG3A 4IF6A 1CE8A 2OY0A 2C9OA 3OOJA 4N65A 4U7JA 4YLEA 1XL0A 4JVNA 3ZV7A 3H5RA 1WPGA 3AKEA 2Q1YA 3LMKA 4L0QA 2OCPA 3A14A 3B1WA 2PVPA 1HE5A 1QH8B 4I8XA 2ONCA 4Q34A 2WUDA 4WRRA 3E2IA 4Y2QA 4AZ3B 4RMNA 4KYTA 2R1VA 4W8GA 3O0TA 3ILYA 4YASA 1EA5A 4U9UA 1OX6A 1ZISA 2ZVPX 4RZSA 1JHMA 1T8UA 4D41A 4ZAZA 1U28C 1XRQA 2PM8A 3HUDA 5JAQA 1TKAA 3ETHA 3Q6NA 1N57A 1Q3KA 1QYWA 4J2TA 3BMXA 4UNIA 2YOGA 3I28A 5CXSA 2B1RA 5GWXA 3K20A 3HP7A 3R5XA 5ECYA 4YWJA 3QBVA 4E5NA 2R85A 2C58A 2FMXA 1ZUNB 2A3NA 2PZEA 4FJ1A 3V4FA 4XFJA 4Z4IA 5H80A 1XJCA 3TR5A 2VDKB 1NQOA 2FN9A 2YXDA 1HGXA 1EXWA 1B43A 4NFHA 3G8YA 5TPZA 4IQ0A 2EEZA 5E1OA 4EMBA 2I1LA 1W4ZA 1WP9A 2D74A 2HBZA 4AN0A 5A6SB 4ZT6A 2D2EA 3DR3A 1I4TD 2UVDA 1LF5A 3TFWA 4Z51A 2IOFA 5IAAA 4ZT3A 1R4NB 3C3YA 1P0MA 3DBHA 2AHRA 4NSNA 3CIOA 3L8MA 1ZO8A 2BTEA 3M1LA 3V5NA 2GUGA 1FXSA 3ICVA 4LTDA 3N3AC 4F4HA 5EQTA 3F90A 2OECA 2RGXA 3INNA 4X1OA 2NSJA 2D1SA 4UUAA 1CJBA 4Y6LA 3OP1A 4CM5A 3LGSA 1S3FA 3LC0A 1IHDA 3EDRA 4IS3A 4BV2A 2F1HA 3DPSA 4EW3A 3WKAA 5DNUA 3UOWA 2Q0XA 2XUHA 1ZMXA 1CDZA 2YMPA 3HCNA 2WHPB 4GP9A 3STWA 5L6MB 1RAAA 4KQKA 3V4RA 3U48A 3VH2A 3HHPA 4Z8YA 3MUNA 2H2DA 1KAMA 2ABWA 2AQHA 4KQGA 4ZOQI 2X1VA 3DE2X 1JB1A 3EMBA 3TMAA 4CU2A 4DV4B 1JAYA 3IBFA 1FCJA 4IDOA 1NF8A 3C3JA 1EFUA 1PUXA 4NLLA 5YASA 3F6RA 3HCPA 2R5NA 2AIRA 1U8UA 2FEAA 2WSBA 5J3JA 4XWKA 3D31A 4OQXA 3ORFA 2MYTA 4YP5A 3TIFA 3WNCA 2HF7A 1MBZA 2P27A 1B3RA 2X42A 1CZOA 1EJ6A 1QFXA 1ZKMA 1DB3A 2ZIZA 4MI6A 3OICA 3OPYI 5EA2A 3DAOA 2CXPA 4XI9A 5TQ2B 3DZFA 2UU9B 2ZWVA 2VTEA 2OFWA 2JKYA 2JG3A 4MH0R 4CM4B 4MI3A 3MQ2A 3LC2O 1BMTA 2C4WA 1S8OA 3FBWA 2GHQA 3X1YA 1P31A 1X7DA 4ZD6A 3O2SB 1X80B 3PC8C 5I6DA 3P19A 4XPIB 4C0WA 3EH1A 3HSYA 4Z2AA 1YK1A 4F4UA 5ERGB 1XL1A 1A71A 2RJNA 1N5JA 1ONBA 1QG4A 1V9CA 3OE7D 4WBNF 3KWLA 4CW7A 5I4BA 3W6PA 1F7UA 3S2SA 1CJUC 4X60A 2XAAA 4BFZA 2PZ8A 4G0OA 1FZQA 1GU0A 2RK3A 2Z30A 4NP6A 3QU7A 4NABA 3WKBA 3CVOA 1BRTA 4LZJA 1YB4A 3NAQA 1SVWA 1TFUA 3F0TA 1UMDA 1F06A 2WWTA 4PYNA 2YV2A 2D2IA 2HPZA 3PWTA 1EVYA 3VSAA 1YA6A 4AKHA 4K26A 4AFNA 2OB2A 3K0FA 4EHNA 1CIJA