3KJHA

Zn-bound state of cooc1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
MKLAVAGKGGVGKTTVAAGLIKIMASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLGSVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDLGIKKVRYVINKVRNIKEEKLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQSTNPAFVNLHDIYQKLRLEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CO dehydrogenase/acetyl-CoA synthase complex, accessory prot
publication title Crystal Structure of the ATP-Dependent Maturation Factor of Ni,Fe-Containing Carbon Monoxide Dehydrogenases
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Hydrolase, metal binding protein
total genus 76
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kjhA00
4UQOA 4P4TA 4Z54A 1Z08A 2WJVA 4BRWA 1IN7A 3LY5A 4II7A 1GG2A 2WV9A 2PBRA 3CH5A 3DKPA 2ZIAA 1H65A 3QVVA 1R5OA 1DADA 2FFBA 2WWFA 4B2PA 5BYJA 1JR6A 1ZINA 4OI2A 2XOKD 4KU4A 2QUZA 3HYTA 1XFAA 5IHPA 4DLTA 1XU4A 1OH6A 3AKEA 1S9HA 1ZUHA 4WA7A 4DCTA 1OF1A 4DJTA 2IC5A 5B57C 4LJ4A 2GEUA 1UF9A 3P26A 2NZ8A 2Q9CA 5GJCA 5EXPA 2AD5A 3VX3A 2P5TB 4B3BA 4I1UA 4D2IA 5EXXA 1II8A 5L3VA 1TQ6A 2WJYA 3EASA 2XTNA 1X1SA 3MWJA 3FKSA 4UNRA 4PSVA 2AHOA 1ZAKA 4D80A 2OCAA 1D2NA 1P9RA 2BJVA 3LXRA 4C0LA 2IEYA 3Q3JB 2QT0A 4AYXA 2NZJA 2JCSA 5JSZB 3MWLA 2IS4A 4HLCA 1XNJA 3WNDA 2ANCA 5JCPA 4RSGA 1FNNA 2G1JA 3DOFA 1HA3A 1E79D 2EFHB 4KLZA 2PEYA 1GP2A 1VPLA 1ZYUA 3U4QA 1R8QA 1QHYA 4ITRC 1T3HA 1DELA 4M4SA 5FOSA 4US2R 1OKKD 3GLIE 4MGIR 4H1UA 4CDGA 3GFOA 5TXGA 3PUWA 4TMZA 4Q1AA 3VU9B 1TPZA 2OUKA 1IONA 4BLPA 1SKQA 1F48A 1S96A 1W2HA 3IKJA 3JZAA 3PQCA 3AF4A 1E2PA 1E9CA 1OHHD 2QMEA 3K0FB 4PHGA 3MAAC 1WP9A 4PZZA 4RCZA 1EWQA 2QBYB 1OV4A 4LK2A 5AJZA 3SFVA 3TW8B 1IN5A 4B74A 3QBVA 5JEEA 3QKRB 4DLYA 1YZLA 5KDLA 5IDVA 3I62A 4BEBA 5DYIA 1LF0A 2WZQA 5FR1A 2V1UA 1G4UR 4I81A 3RSOA 2KJQA 1XPRA 4FW9A 3AB3A 3M4YA 4Z51A 3VKGA 1NMZA 1ODFA 1K6MA 1KI7A 1GNRA 2J59A 2TMKA 2P0EA 2VP9A 3HWSA 1R5BA 1Z29A 3REFA 1U98A 1VDZA 1SKYB 2HF8A 2ZAOA 3D31A 1OJLA 3I32A 2P2LA 2XNDD 2ONJA 1KK1A 2WPDD 3IIMA 3EPLA 2XGJA 2VHUA 3W6NA 5CK5A 3FWYA 5FUWA 4V02A 2CCJA 3GLHA 4FXPA 3TSOA 3CKLA 2ZJ5A 3K09A 1W44A 4BASA 1N6PA 3R9XA 2ZE6A 3WMEA 5JLJA 1GZSA 3T12A 1CJUC 2L0XA 5DSZA 1RC8A 2WWIA 4HUQA 3RHFA 1U0LA 2A3RA 2R6FA 3GLGB 4OQFA 2QL6A 4B2IA 2C99A 2GESA 1YU9A 1I4TD 4YXWA 2H8KA 4IFEA 3RS4A 3K8YA 4L4UA 1KSJA 4ZKDA 1UAAA 4IEIA 1M74A 2J41A 3LQQA 3V4FA 3T34A 1XP8A 2BMEA 2JATA 2CL0X 2C96A 1GILA 5DE3A 3B1YA 4UXJA 2XXAA 3FOZA 2ZR9A 3ZS8A 5KSOA 3X1YA 2Q3FA 1XCMA 4DUGD 5EJEA 1E0SA 2ZR7A 5CYOA 4C0BA 1QHSA 2A5GA 4HUTA 3CPHA 5FUXA 3FHTA 3U3MA 3QF4A 4TQ9A 4X8OA 2V7QA 1NRJB 4K81B 2ZRPA 1G5RA 3FTQA 3VNVA 2P6NA 3U7GA 3NHBA 2OFXA 2AK2A 2BC9A 4F92B 2NO0A 3ETLA 1E2LA 1ZRHA 2QROA 2XJ4A 4KVGA 4EPTA 4O2RA 3RWOA 3T1OA 2J0UB 4NCHA 1RVDA 1YRAA 3MCAA 1ESNA 1OXXK 3GJ8A 1CRQA 2EWWA 1N0VC 3AP2A 1F2TA 5FBVB 5IK2D 2VO1A 2O8EA 3KQLA 2LWIA 1K5GA 4IEEA 3DPUA 5EP3A 3GJ0A 1A7JA 4A6XA 2IYZA 1OH8A 4TL8A 5J47A 3SYKA 1BMFD 4OJKA 3IDQA 5CB6A 5E4FA 3PUVA 5BN5A 1O3YA 3VAAA 2XX3A 1G8PA 2A30A 1FP6A 1V43A 1CR0A 4DSOA 4MYUA 1CTQA 3L82B 3L2OB 1OLOA 1P9WA 2B7CA 2E87A 2DFTA 2V6JA 4JLKA 1CEEA 2V55B 3KXKA 1Q22A 1XEWY 5TY0A 1XJQA 1SVMA 1P3JA 5TVKA 2JJ1A 2IYUA 4P4SB 1KTVA 2FMXA 1JR3A 3TUIC 1S3GA 1KY2A 4PQRA 4NONA 4M9ZA 4Q7JB 2XTZA 4OHWA 4GBMA 1KI6A 5CM9C 2QGZA 3GLFB 2R44A 4LPKA 3K0AB 2KWIA 4CEIB 5KDOA 1GKYA 3TH5A 3N2IA 5FR2A 3Q5EA 4JYCA 1NN3A 5IRCD 4D6PA 3AVUA 4TLAA 5GJBA 3RANA 1YKSA 1DAIA 1PV4A 4HATA 4GZLA 4DZZA 1M7BA 5K8LA 3PFIA 2PH1A 3KDSE 3QSYA 2QMHA 2WAXA 2FJUA 3SYLA 3VR4A 3WMGA 1M34E 1I4DD 3ZD6A 2VHQA 1GITA 1N3BA 3HR7A 2VA8A 2FH5B 1VG9B 4Q1CA 2QU8A 2VPPA 3W34A 3CRVA 4RY2A 4HAZA 1KMHA 3GJ5A 3D8BA 2WWWA 1J2JA 3TR5A 3P1JA 4R2HA 1R8SA 2HJVA 3P4YA 3EIHA 3EA5A 1NP6A 3QF7A 4RD2A 5BWMA 4HAYA 4DCVA 4Q4AA 1E9AA 4OK5A 1VYUA 4EUNA 3PUYA 2BEJA 4V0LA 2NO6A 4BWYA 1T3LA 1IOZA 4CVNA 2VP2A 3IUYA 2NOAA 1TMKA 1II8B 1W0KA 4ESHA 1HE8B 3H2YA 1P75A 2HT1A 2X2EA 1G3UA 3MJHA 1IJEA 2CL6X 2XOKA 3IGFA 4Q5IA 1CRPA 4RJLA 3QG5A 4GL2A 3PG5A 3TR0A 4NHOA 2GRJA 5FUVA 5G40A 3DM9B 2WOJA 4OL0A 1E0JA 1E3MA 1TF5A 3H86A 4JSYA 4WOPA 2ZRAA 3KKMA 3LD9A 4OQXA 4Q9IA 4DRZA 3GLIA 2PJRA 2IS1A 1J8MF 4TWZA 1QRAA 3AEZA 4A8JA 4TT3A 2BCJQ 2ZRDA 2GDJA 1ELOA 3HPRA 2IWRA 3D6TB 4ZCMA 4OQLA 1US8A 2W2XA 2W6JD 2ZSDA 4F93B 5JBQA 1XF9A 2IXEA 3UPUA 3RRMA 2GJKA 4Y0VA 4WW0A 1G7SA 2EVWX 5EXSA 1YHNA 2QPOA 3VKWA 3U4QB 4S35A 2BBWA 3SU8A 2MSEB 2G6BA 1Z07A 3FVQA 4PC6A 4Q9JA 1R4AA 4NL4H 2BOVA 2N46A 4JL8A 4B76A 2NG1A 4DSTA 4EFLA 3ADCA 4DKXA 5SZJA 5J4YA 5BYKA 4FD2A 3GMTA 4Q4JB 5CITA 4URXR 2QORA 1UKZA 2BDTA 3V00A 1ZMXA 1AQUA 1E79A 5AUPB 4LJAA 3JVUA 3NBXX 4XVUA 1W7AA 3T35A 3BORA 4C0AC 1VG0B 3VNUA 2AXPA 1N2CE 2IUUA 4YMTA 3RS7A 2H18A 3K53A 3SR0A 1OKKA 3I5YA 1NY5A 1FPMA 4URWR 1HH4A 4M1WA 3G0HA 2PLFA 1Z0FA 3BB4A 2AD1A 3BJIC 2E9SA 1BYIA 2CNWA 1RFLA 4H1VA 4NCKA 2ZU0C 2OCBA 2Z83A 1G3IA 2R6DA 5EUMA 4NCJA 4AD8A 1OHHA 1J7KA 2N1BA 4XD7D 3CRW1 4XJXA 5KSPA 4B33A 5C2JB 4BFSA 3DKVA 1KGDA 3NC1C 2VP5A 1G5PA 1XMJA 2VSFA 1ZUIA 4D81A 2ZPTX 1OXUA 3A4LA 5FOTA 1YZTA 2GAOA 1OB5A 2OFOA 2DCUA 1W49A 4GOXA 5JJLA 3KTAA 3OIUA 1GNQA 3GLHB 3THOA 5TDHA 2P67A 4O25A 3DEFA 5D3MB 1M1YE 1GL9B 4HUQB 5LB2A 4P31A 3ZZ0A 4QBFA 5AJXA 4US0R 1P6XA 2NGRA 4DLWA 3RRNA 1YVDA 1RW4A 3PCRB 1Y3AA 3CWZA 3BH6A 3K0CC 4GP7A 2V54A 3TIFA 4B3FX 1AGPA 2WPDA 4W7SA 2WHXA 1Z06A 2YJTD 3ZYCA 2XXAB 1KAOA 4NMMA 2FSHA 1UM8A 1DG1G 2QSYA 5G3YA 4A0GA 5JSZA 2BIFA 2QTFA 1ZP6A 2A5FA 1OYWA 2XJ9A 1IXRC 2PZFA 2IYQA 3GFTA 3SJBA 2WIBA 3MSXA 2CXXA 4HDCA 1LW7A 3LH5A 5E7MA 421PA 1FUUA 5K8UA 3QF4B 4TMTA 4A15A 3N5CA 1ZU4A 1YE8A 5LD2B 4E22A 3K70C 1S8FA 4QBIA 4QHTA 3F8TA 3T06B 4ON9A 4U5XA 2I1VB 3QBTA 5HPYB 4ZCLA 2A5JA 1XCPA 3BBPA 4MITA 1DARA 2R62A 4LBWA 2ZVPX 4C0HA 4KI0A 3ASZA 1E2QA 4PAMA 3LDAA 1F2TB 2O8BA 2ZI6A 4AG5A 2ZRLA 4D4LA 1PLKA 2GZHA 4QGAA 4HDQB 3THXA 3DM5A 2ZRFA 3TNFA 3P20A 3OF5A 2GK7A 2ZRHA 2G77B 4IOMA 4PFSA 5FBRB 3CRRA 4E03A 4FCWA 4JLNA 1LFDB 2B8WA 3ZVNA 4KAXA 4AIIA 2WWYA 1WXQA 1ZJ6A 4M1YA 2UVQA 1VKJA 2C5LA 5GJWC 1E9SA 2ZRGA 3FMOB 3OEHA 4K8OA 1XCGB 4A36A 2ZS7A 1TF7A 3FB4A 4A92A 5HZHA 2ZI3A 3P32A 1Q3TA 2BJWA 5CJ2A 1EGAA 3CH4B 3QIAA 4FMCF 5DI9A 1E0KA 2FN4A 4BUJA 2UZ3A 3OHMA 4YONB 4B35A 1WF3A 4MQBA 2R6AA 1E9RA 1KI6B 2C9OA 2Q21A 1E2HA 3F3YA 3AF0A 2KBFA 1W4BA 1Q20A 3EPKA 4YXWD 1KK0A 2QRZA 5JHHB 1UEIA 3M0EA 5EP1A 5K8IA 4DB2A 5HZKA 3DZ8A 3W6PA 1GWNA 2KSQA 5JFGA 1X8LA 1GOTA 4LJ9A 1CR2A 3TAUA 2H57A 1KK3A 1H8ED 1CR1A 2ZJYA 2J3EA 4V0NA 5AUQA 2P6RA 1YR7A 1JBKA 3UWOA 3UMRA 3AF2A 3LVQE 1LY1A 1AIPA 3CR8A 4KLNA 5UKDA 4KFTA 5ELXA 1GSIA 3P27A 4Q03A 1R2QA 4DHEA 4YMUA 1KMHB 3IHWA 5F9HA 2AWNA 2OBLA 1X6VA 1OFHA 4LC1A 2UZIR 3KJGA 1YR6A 2VTKA 1UKVY 3KXIA 5KYKA 3THYA 2NIPA 1FTSA 2JIZA 3ADBA 1CJVC 4Q1FA 1TL7C 821PA 4W9MC 2AKAB 3LRPA 4M22A 4Q4AB 3ND9A 3A1VA 4KFSA 3PJRA 2FEMA 2GXQA 3EC2A 1CJMA 4OJQA 3RAPR 3CWQA 5EP4A 4ASUD 4BE7B 4XH9B 1PVOA 4G5RA 2FPMA 4G1UC 2WTUA 2NPIA 4XOIA 2YHSA 3A1UA 3D7MA 3WP0A 2IYWA 3C14C 3NKVA 3BE4A 2ZSAA 4A2WA 4B43A 4JS0A 4NPHA 1XBTA 4JKIA 3QKTA 1C9KA 1E94E 3T1VA 1TNDA 2REBA 1KHTA 2J5XA 4TL6A 1W36C 4YQFA 1BOFA 2IYTA 4IHQA 3GLIB 2C03A 1LF5A 3OIYA 4A8JB 3EG5A 1T3SA 5DN6A 4JL6A 3VKHA 2JLZA 1US8B 1MRSA 1VHLA 3SOPA 1JJ7A 2ZETA 3WHKA 1JALA 3K9HA 1QVAA 2QA5A 3BB3A 1X86B 5E95A 2QMUA 1W0JD 2A9KA 4MRSA 5H8WA 2F1HA 3NEYA 2AL7A 4NYJQ 3IPXA 2OCPA 1Z47A 1KDRA 1YZQA 4BLTA 1UDXA 1BYUA 3B60A 2W6JA 3QG1A 2YOHA 4FMDB 3BIFA 3OEED 2O8CA 3REGA 3LLUA 5K8TA 4LHYA 4D82A 1GNPA 1G1MA 2FFAA 3IO3A 2ZSEA 4TYYA 1Y63A 3IHLA 1MR3F 1E2NA 5C46F 1TQ2A 3DZDA 4IOLA 1D9XA 2ZJ8A 2DWPA 2ZANA 1ETUA 5JEDA 3SJCA 2ECKA 2D06A 3Q85A 1KI2A 2ZUDA 1EWRA 1UEJA 2ZS9A 3NBYC 5CDFE 2I1QA 1IXSB 1G21E 1AZTA 1CBUA 5GVSA 2VEDA 2YC2C 1T0JB 2IUTA 4ZIRA 1Z2AA 2GCNA 1VG8A 1AS2A 2Q9BA 3SHWA 2VP6A 3LWNA 1JQJC 2XITA 4LYFA 3W5IA 2JLQA 3K9NA 1ZC3A 1NBME 3L0IB 2BBTA 1W0KD 3TAHA 3B82A 1JECA 2IXGA 2ZXUA 2WJJA 3VR3A 3PEWA 4Q01A 4AC9A 3WBKA 1NSFA 1KZGB 3KTAB 1MH1A 4HLUA 4TZ0A 3FMFA 5AR1A 3BH7A 4ZI3A 4LOAA 4Q02A 3R9IA 1KI1A 1G5TA 2EU8A 2NTYC 2Q3HA 2R65A 4XD7A 1NN1A 2AK3A 4D4KA 1RRPA 4TT3D 1Z6GA 1E2JA 1UFQA 4Q1EA 2O8DA 4HYYA 2YV5A 2GCOA 3BRWD 4GRAA 4DIDA 1MO5A 4KYIB 4HEJA 4URZR 4URUR 4C3ZA 5BW8A 3V4RA 2QM8A 3CUEF 3KQKA 1FTNA 4ZO4A 2JLYA 5JWHA 1NVVR 4Q4HA 4TLBA 2A2ZA 1G18A 2IYRA 4MKHA 3B1VA 4Q00A 4A0RA 3N70A 2K5UA 3O8BA 3EIEA 2AN9A 4BECA 4NYMR 5G3ZA 4MGZR 1RJ9A 1GFIA 3AGPA 2OT3B 3WYGA 4QHSA 4MYHA 5KDDA 3HU2A 2ZROA 4UXHA 4B3XA 1Z0DA 2SHKA 1VYVA 4LHVA 3VQTA 2ZI4A 2OLKA 1NG1A 4BFWA 3SQWA 3I61A 3VTKA 4JLBA 1ZM7A 3KKOA 1NG9A 4I1VA 2DFLA 2F9LA 3BAFA 4KVAA 2BMJA 3AVYA 2O8BB 5FTMA 2BMFA 2BWJA 4Q4JA 1KI3A 4MRNA 2CNWD 3THXB 2QEQA 2FSIA 4B32A 5LB4A 3EZ9A 3NXSA 4YMWA 4KV9A 3C15C 3I5XA 2QGNA 3ZD7A 4KFRA 4JJKA 5BXQC 3T15A 5IF9A 4TYQA 4QGGA 4Q9KA 4LJ6A 4OQNA 4TYWA 4URYR 1IN6A 4O0MA 3X1ZA 3OE7D 4TYPA 1NVUQ 3X2SA 1VCNA 2VSOA 4D0NA 1S4QA 1OIVA 1E69A 1HTWA 2WBLC 4FMDF 5KU1A 3E70C 4MH0R 3U44B 2PL3A 2F1RA 1Z6AA 4GZMA 5C18A 2YWFA 2F3TA 3PV0A 1KKLA 1NMXA 2DWQA 4GT1A 3W8RA 1PUJA 1R0XA 1GRNA 2QZ4A 2BVNA 4NH0A 1GUAA 2OHFA 3RSLA 3QEOA 4F4JA 3GP8A 4Q48A 3FE2A 1J90A 2ZI5A 4W5WA 1XEXA 3ICQB 1QHXA 1ZNYA 2HLDD 2I4IA 1P2VA 2PZEA 3JVVA 3SI7A 5JS8A 5J4HA 3AVVA 5JZVA 4LY6A 3QEJA 2P6UA 4NE2A 1MO6A 4AY2A 3AF1A 4LC0A 2H16A 5LBIA 1UBFA 2ZSBA 5G53C 3U61B 1M7GA 1AKEA 4HAWA 2ANBA 5EE0A 3TW4A 3NBZC 3B8HA 3I1FA 4PQYA 1NF3A 1AQYA 3FMIA 5D3MA 5AJWA 2CLCX 5EXTA 4P33A 4PC3A 3G5UA 2VF7A 1L2TA 1XTJA 3SHFA 2QTHA 4JZKA 1XD8A 4TMXA 4JBWA 1E0AA 4L15A 1N5IA 1IBRA 2OM2A 4UKDA 4QM7A 4P4UA 4N1AA 3K1JA 1AN0A 1FL9A 4TL9A 2RGEA 2RGCA 1L7VC 3EAQA 4LHZA 4QNRA 1DAGA 2YWHA 4GPTA 1JPNA 3WBJA 4DEXA 4DB4A 1Q1EA 2JLWA 3PEUA 1H8EA 3THYB 5EE1A 2GXUA 4P0TA 1GVNB 1X8KA 1FX0A 1ZM3A 1U90A 4JVLA 4V0OA 1KI4A 3I4LA 521PA 5JRZA 3WNCA 1F6BA 2VHTA 4G01B 2C2HA 4DDUA 3CF6R 3MUFA 1ZIOA 2ZAMA 2IF2A 4OK6A 1U9IC 1Q12A 3LBHA 3E5HA 4HDOB 4JVNA 3LVRE 4KHZA 4AG6A 4UXIA 1N25A 1YRBA 3QVUA 1T9HA 1UJ2A 1SXJE 1X8JA 3HU1A 4BFZA 1QHNA 4BGDA 4DLUA 5BQ5A 1TUIA 3OEHD 4I99A 3WNBA 2XNSA 1T8TA 3UANA 2REXB 2NPFA 2VHCA 2EYUA 3O47A 4F4IA 1G8GA 4ASUA 2QP9X 5DI3A 3M1IA 2WJIA 3AVQA 5JRJA 2QAGC 1KO4A 2WICA 2C77A 2ZRBA 3NH6A 4HAVA 3CX7A 3IBGA 3G82C 4LBYA 3NIBA 4DWJA 4AKIA 3ICEA 2DY1A 4LYHA 1K5DA 2GF9A 2ZTSA 1WB9A 3HP1A 4C30A 4PC7A 4Z8YA 1MO4A 2BEKA 1D5CA 4KODA 1XEFA 1E1QD 4HI0E 2ZI7A 1KSHA 4JLDA 1SXJC 3WRXC 3TMKA 2GJ9A 1Z0JA 2FDCA 2YOGA 3NBFA 4A0FA 1E96A 4C0JA 3BD9A 2QP3A 1QHGA 4JLMA 5CDFA 2IWHA 4D4MA 2D62A 2O8CB 1Z3IX 1R0YA 1NKSA 4DDWA 3EZ2A 2FEOA 4PXAA 1SHZA 1N6OA 1EXMA 1W0JA 4JVMA 1VIAA 3E2IA 4RD4A 1Q21A 4CEHA 1E99A 2QSZA 1FFHA 4FN5A 1Q1ZA 1NBMA 3T61A 3FFAA 1Z83A 2CCGA 2J7KA 1GM5A 4D26A 4Q9HA 5DIFA 2DFNA 5CLLA 1E1RA 4B34A 1BKDR 3IBYA 1Z0IA 3I72A 4CYMA 2JIZD 1KK2A 1RRGA 2YOFA 4G5OA 1DE0A 3Q9LA 3WYFA 3OEEA 2C98A 4B73A 4ZDIA 2ZVQX 1WMSA 4ZIRB 4BZXA 4MGYR 3QOFA 3K70B 5FL3A 3AVPA 2QPTA 2OV2A 2D2FA 4E5UA 3U6KA 3EWAA 3UWKA 6Q21A 4HLDA 4GI7A 4BEJA 2Z4RA 4BLRA 2CJWA 1CF4A 3AKCA 2V1XA 4PX9A 3NHAA 4RD6A 4C4PA 2CMKA 1Z63A 4RVCA 1RPZA 1A2KC 2F3RA 3GEEA 3KQUA 4IOKA 1OB2A 2CEAA 1LS1A 1SZPA 4B44A 1EFCA 1U94A 1UBGA 1CKEA 2IHYA 1VECA 2XAUA 3CR7A 4NKRA 4NYIQ 4QBHA 5JWRA 2VHJA 1DBSA 4AWXA 1CJKC 3CW2A 4G0NA 4LWZA 1YR8A 2JDIA 2O8DB 5DN6D 4MRRA 121PA 1TX4B 3A1SA 3O8CA 1ZM2A 2GCOB 2V4ZA 3OZXA 1B23P 5B64A 2ZS8A 1W1WA 2OE2A 2ZYUX 3HYRA 4QOSA 2GBLC 1S3SA 4JLAA 5DO9A 2IA5A 3I3SR 5FTNA 3MG9A 3OIWA 1XD2A 5L3QB 4Q4HB 4F38A 2OILA 1NJFA 4IXMA 4M2LA 5A5GA 3S1AA 5AUOB 1WDTA 2WVJA 2WWXA 1ONBA 5CIQA 1SVSA 1XMSA 3QXCA 5H1YA 2GILA 1UKYA 4DLSA 3RYTC 5J4VA 2PCJA 3EA0A 4XWKA 1OXTA 1RJ9B 1OXSC 3VR1A 3Q5DA 5F9FA 4EPWA 2DFKB 2J9RA 3TJZA 1II9A 2JEOA 2H5EA 4UNNA 2OLJA 4EPRA 1W2GA 1T8UA 2A78A 2F1IA 4HAUA 2KB0A 5TV2A 1Q1BA 2GJSA 2WSSD 3VR6A 1R10A 1ZNZA 1D2EA 4IVPA 5HKKD 1KJWA 5FPSA 2O0KA 3IQWA 4A9AA 2O0HA 1TEXA 1G8FA 2RGNC 1OXVA 2IYVA 2C95A 1LB1B 2ORIA 4LJ7A 1SULA 2XSZD 3R20A 1ZM9A 3R9WA 2J1LA 3QKSB 2RH5A 4WZ6A 2V3CC 3PITA 2AWOA 2IX3A 3CLVA 4C7OA 4PZYA 3K70D 4IW3B 4FMCB 3GEIA 4C2TA 3VHXA 3FKQA 1HUQA 1TADA 2IXFA 5SZHB 4F7WA 1XTIA 8OHMA 4KYUA 4MGKR 4Q18A 4M1MA 4DBLC 2GJAA 1PUIA 1S1MA 3IEVA 3TLXA 5KUTA 1CP2A 2ZREA 4A1FA 5FPYA 4M8NE 1S2MA 2HDNB 2ZU6A 4EFNA 4MYTA 4PO1A 3GPLA 2YKGA 3QXHA 4B3CA 2ZE7A 4X8LA 1K8RA 1XEXB 1U9IA 3FFBA 4A2QA 1XPOA 4DEYA 1P7CA 3U2QA 4Q19A 3OE7A 4HAXA 5SZKB 1AM4D 1E2KA 4X8HA 4DCSA 1P61B 4KJZA 4RZ2A 4KFUA 4MKGA 3MWKA 4YMSA 3C41J 1U81A 4AI6A 2GCPA 3GJXC 2YWGA 1WBBA 1W36B 1ZD8A 5FOXA 3AVOA 2X19A 3H1TA 2H92A 4R9UC 3CNOA 3GEHA 4URVR 4D25A 3NTUA 2HLDA 2FGKA 2NO9A 2QAGA 3RNLA 4CT4B 3RRYA 2PJZA 4C2UA 4TSFA 1QF9A 5KSZA 1KSFX 3CX6A 1QVRA 1I2DA 3PXGA 1LVGA 4PO9A 4LX0A 3V9PA 4GMDA 4RKFA 4EQ6A 3KQHA 2B7BA 1JXMA 4IJMA 3CZPA 1MO3A 2GF0A 3LFUA 1FX0B 4LBZA 1OPXA 1Q3HA 3H84A 5AK0A 2R6CA 4EPVA 1DPFA 1KO7A 2AX4A 4DDTA 3WY9A 2GXAA 2GETA 4AKEA 3CPJB 1II0A 2VF8A 2EWVA 4B47A 1N6RA 3EPHA 2HV8A 3AGQA 3FGNA 1P4SA 2BBOA 4PC2A 5GVRA 4KITB 2REOA 1U8ZA 2ZUBA 1WE2A 2D7CA 3QI2A 1OH5A 1VIYA 2FOLA 5KPJA 2FNAA 3ADKA 3IQXA 4WIAA 4XTRA 1IN8A 4ARZA 3A58B 4EAQA 4D0LB 2FSGA 3J81k 1XX6A 3GJ3A 2CL7X 1IAQA 3MD0A 5DNYB 2W6IA 3D3QA 5P21A 4N3NA 1JQLB 2BM0A 2ZJOA 5BN3A 5FOVA 2HF9A 5DI3B 4IDPA 3W3ZB 4M1KA 1JPJA 4D0GA 2ORVA 4PSAA 2ONKA 4QJ4A 4B2LA 1E4YA 2CVHA 1KNXA 4G3XA 4A4DA 4ACAA 5HE8A 3TSZA 1A5TA 4R2IA 1N6NA 3IIKA 1ZNXA 5HCNA 4XWAA 4TTQA 4POAA 1N6HA 3U44A 4US1R 2R2AA 3R8FA 2AFIE 3B7GA 3PEYA 3LW7A 1Z6XA 2XEXA 4HZIA 4JMPA 2E1RA 3PIRA 4LPSA 4CRWB 1VCIA 1OT3A 3NVAA 4LBVA 1TTTA 4BQSA 2VP4A 1MABB 3L0PA 4NU0A 1W36D 1Z6YA 2FG5A 1GRQA 2C78A 4Z8XA 3AKDA 2A7QA 4XWOA 1NIPA 3MFYA 5JI3E 4CZ2A 2IL1A 1MRNA 1F2UA 3HR8A 3IILA 4L16A 1ZW6A 1E4VA 5EZ5A 1LNZA 1E1QA 4CEHB 4O2LA 1NVXQ 2W2TA 3KL4A 3B85A 3QNUA 3W9YA 1NVWQ 2GBLA 2MSCB 4QGHA 2Z0MA 3KB2A 2J0QA 4PPNA 4PANA 4BFXA 2FPKA 1KO8A 3NG1A 2QP4A 3ZVRA 1RRCA 3KKPA 2ODBA 4NDZA 1T0HB 1MKYA 1XPUA 4JIMA 4B3DA 2GKSA 1FNMA 2QM7A 5CLQA 3AKYA 1DTSA 2ZYWX 4B71A 2FA9A 1DO2A 1X1RA 2V9PA 3BERA 5CIWA 4IXNA 1L4YA 4FWIB 4FCTA 5JJIA 3RS2A 5CK4A 4LHXA 1FW6A 2CJWB 4KCGA 5AWFC 3VR5A 3AUYA 3HDTA 1P5ZB 4FINA 1QBKC 3B1ZA 4ZKEA 4DCUA 1OIWA 4IVQA 3SBDA 1KDOA 1PJRA 1UBEA 4DIEA 2JLVA 3W90A 2P5SA 2PEZA 4A2PA 1W47A 2Q9AA 1D9ZA 4WBSA 1DAFA 2F7SA 2JLRA 2ODEA 2ZE5A 1COWA 3KKQA 3W8NA 4ACBA 3SNHA 1JXOA 1G17A 4TTRA 1G19A 2FZ4A 1L4UA 4N0DA 1TF2A 4R7ZA 1RKBA 5JWOA 3B13B 4KBFA 3OFNA 4GSYA 3RC3A 1XD2B 1JI0A 3AF3A 4Z1MA 5BN4A 2JLXA 1Z2CA 3S1AB 1T91A 1Z22A 3TQFA 1G41A 3ZQJA 2W2VA 3TUJC 4L8GA 5B30A 2Z43A 2D3WA 4QKQA 1WBDA 5GJVC 2GAAA 2GTPA 2YZ2A 3MLEA 4JLJA 2IF0A 4QL3A 1E2FA 2C8VA 1CJTC 1M8PA 2OAP1 5FUYA 1DAKA 1GDDA 4LRWA 1DO0A 1NKTA 5FOUA 3EX7C 1H8HA 2W0MA 1G7RA 2YWEA 3T5GA 1L8QA 1Q0UA 1GRRA 3QJYA 1XXHE 3BFKA 4NP6A 3CIOA 5EE3A 4IKEA 1KDTA 2PX3A 1G7CA 5FBQB 1N0WA 3K09C 3R7WA 3CRQA 3WP1B 1NBMD 2HEIA 4EFMA 5C4MA 3UMFA 1HYQA 2GEDA 3NWJA 2HCJB 2UKDA 3ZS9A 1E1RD 3WRYC 1ANKA 2BBSA 4XVRA 1CLUA 3ZVLA 3GJ7A 2KI5A 4Q21A 3THWA 3TVDA 2B92A 2EYQA 4ILEA 4GNKA 2J0SA 4HSEA 1TU4A 3ZQ6A 1S1CA 3RS0A 4C7OB 4KSCA 1KJZA 2PX0A 1FUKA 1NI3A 1EFRA 3KB1A 3K0CA 1VCMA 2C9YA 2WSSA 2WM9B 2VQSA 4EIWA 4JT2A 5M04A 1X3SA 2QENA 1T5LA 4TQAA 1MOZA 5HKKA 2AR7A 2H1LA 1E9FA 3HU3A 3LA6A 3OIVA 2IYXA 4RFVA 1DAHA 1G8HA 4UNSA 4BFVA 3O8RA 3RRZA 1KDPA 3ZVMA 3DMNA 3HJNA 4HB4A 3KUDA 4TMKA 4PHTA 2MMCA 2XSZA 3N2EA 3C5CA 3L0SA 4OI0A 3U3KA 1UKEA 3PENA 4A82A 1U8AA 2EFDB 2ASEA 2W0SA 4KSBA 5FOWA 4IDOA 2JDID 1A82A 2FFQA 3KFVA 1XTQA 4U00A 1A1VA 2RGXA 2WOOA 1WA5A 5L8VA 3U7FB 4PHHA 2IS2A 3ADDA 1GIAA 3BXZA 3VMFA 5F2EA 4AK9A 2VP0A 1LS6A 5FTJA 3SN6A 1PZNA 3MRSA 1CR4A 2ZEJA 1E2EA 1HE1C 1G16A 3PR1A 4JLPA 4ZPXA 2HYIC 3AQ4A 1G20E 2IK8A 2IT1A 1AJEA 2ORWA 2GJ8A 3QUSA 3TSWA 4ESVA 2QAGB 2RKOA 3EPJA 5CB8A 1OE0A 5EUQB 2C9CA 1PLLA 3WXMA 3U5ZB 2QTVB 4M9SA 4TMVA 4QG7A 2CVFA 3K0EA 4WXPA 2IEZA 1IJFA 1OSNA 2DYKA 4G5SA 1JAHA 4UNPA 5J40A 4EQ6B 5L3QA 2OXCA 2D2EA 2FU5C 2ZYVX 3EW9A 4AKHA 1GL6A 1SXJB 3LBNA 4V0ME 1NN0A 4EKDA 1N5LA 4BFUA 3OAAA 4XSHA 4QM6A 2WKQA 3LX8A 1G4AE 4LV6A 2OG2A 4NTZA 2OCYC 4PPFA 1U0JA 2F43A 2ZYTX 3UIEA 1KAGA 1WQ1R 2PZGA 4I1OA 4PC1A 3FHCB 3QKUA 3ZDQA 4DVGA 1R7RA 3RWMB 2H17A 3F5FA 3TRFA 1RRFA 2JLSA 2RB4A 2OSBA 1G6OA 1QZXA 1G7TA 3UG7A 3WMFA 4ARZB 2G9NA 5H68A 3L8ZA 3QY0A 2MSDB 3EZ7A 2GWHA 2OEPA 3CB4A 2VSXA 3A1WA 1D2MA 4KO8A 4B6FA 2P3SA 3QKSA 4M21A 2A5DA 2ZM5A 1J8YF 2Q0HA 3FHOA 3ASYA 2QAJA 1T4GA 1DAEA 3GJ6A 4BRUA 2WIAA 5FFMA 1A2BA 2B8TA 2XB4A 4ZCIA 3B5JA 1T5IA 2IUSA 4TYNA 1AS0A 5FTLA 1XRJA 4TL7A 1N6LA 2JGNA 2DPXA 2ZRKA 1YR9A 3LBIA 3QXXA 2D74A 4OBEA 3BFVA 3K9GA 1AA9A 3Q7QA 1SGWA 2FGJA 3SJAA 5A4JA 1IHUA 1ZD9A 1DOAA 1F2UB 3ZZUA 4DT1A 3W6OA 4TSFD 5FL7D 5ANRB 1RE0A 1Q1QA 5HE9A 2JJ2A 5FBLB 4NYJR 1XZQA 1FP7A 1HT1E 1OIXA 1EFUA 4NCIA 4WZBE 3U60B 3UK6A 1N5JA 4M1OA 4A8JC 3GJ4A 1TQDA 2CBZA 3LX5A 1P73A 4ZDKA 1SXJD 1F60A 5KNCA 4OK3A 4DCNA 4P3YA 1M2OB 2WJGA 4DXAA 2O5VA 2OXRA 2RGBA 1BIFA 1ZBDA 3BS4A 3LV8A 4RZXA 1IY2A 1UPTA 4IRUB 2J7PD 2LCFA 5DHFA 1NLYA 4RFSA 3MJRA 4WVFA 2WKRA 4EJSC 4LUCA 5EE5B 1EG7A 3TQCA 1NLZA 1SHKA 2CE2X 3DOEA 1LV7A 2GZDA 4IDHA 2VYFA 3A4MA 4JSTA 1XJ0A 5HTKA 3DO6A 4LGMA 5E3HA 1FMLA 2OZEA 1OFUX 3RC8A 4W5HA 5AJVB 1ZUNB 3OESA 1G64A 5FPTA 4E07A 3AVWA 1G8YA 1N5KA 2FF7A 4WZAE 1EFTA 4QXAA 4PAOA 1PLJA 1IY0A 2PCLA 3C8UA 2W6ID 4JLVA 3QPUA 2AXNA 3C16C 4PPGA 5DHAA 4LJ5A 5FH9A 3W5JA 4YC7A 1NL3A 1SVOA 1TU3A 3LO5A 4U7DA 1G291 4BZPA 4QJ5A 1KI9A 1VG1A 3SDZA 1BS1A 2J45A 1NIJA 5SZIA 2CLSA 1XXHA 3ZH9B 4M9QA 1Z8FA 5JMTA 3CRMA 3SC3A 4CGZA 2QPAA 4UNQA 1VCOA 2G1KA 3RS5A 4LCBA 4QHYA 1KO1A 4R71A 2OESA 4NCNA 3ZIAA 2HJGA 3R8CA 2IS6A 5JS7A 2GZAA 1C1YA 1TUEA 5TB5A 2WAYA 5JHGB 2QMOA 5DISB 1AGRA 3B6EA 4LZZA 2WWHA 5J4KA 2V8OA 3CX8A 1P2TA 3QENA 1EESA 4OYHA 4GOKA 4HB0A 2PMDA 3IEUA 4RCYA 5LDDC 3R7WB 4FMBB 4IFBA 3U3RA 1I4LD 1S9DA 2OBNA 3NH9A 5FI0B 5TARA 4S2EA 5EQTA 1XTRA 3B9QA 4U02A 3U7EB 1ZIPA 1ZD1A 2NO1A 3KFXA 1ZCAA 1MABA 2X1VA 5EE9A 4BLOA 4MRPA 4YDSA 1UDWA 2ZITA 3THWB 2BKEA 1J70A 2QE7A 4L9WA 4OKSA 4L9SA 3AV0B 3CBQA 4BPBA 2CK3D 1W46A 3PUXA 4IVRA 1E6CA 5HCIA 3RS3A 4ERNA 3ZLJA 2YNMA 2O8FA 4XVQA 4MUBA 4DLRA 1SVLA 4DLVA 2PMKA 4ZI2A 2OBMA 3A6PC 4JKYA 5J4LA 2D7DA 4DSNA 3M6AA 2ERXA 4EPYA 1DS6A 2ODNA 2Z4SA 2BMDA 4B75A 4QJ3A 5JI2E 1GKUB 2PT5A 5DYGA 5L3SA 3BH0A 1Q57A 1JJVA 3NEJA 1NY6A 4XSGA 3KJEA 5AJYA 1COWD 2DR3A 4ZDWA 4RD1A 4CW7A 2HXSA 1V5WA 1SVIA 1UBCA 1F5NA 1OFIA 4M1TA 4MRVA 3FDIA 1JEEA 5JJKA 1YQTA 5L3RA 2BKUA 4E09A 2DHRA 2B6HA 1XD9A 3BOSA 1GL7A 1KIMA 3JZMA 1G6HA 3OFND 4RKEA 3SYNA 2NQ2C 4H9GA 1E98A 2EW1A 4RZ3A 4Z1MD 221PA 2JASA 2ZJZA 1O87A 3BGWA 3K0SA 1KJYA 3DHWC 2WJHA 1ZCBA 2OO7A 1E2MA 3EARA 1JAIA 1U0HC 2CDNA 1R5NA 4V0MA 1SKYE 5LPNA 3QXJA 5IT5A 4N0EA 3H0KA 2ZI9A 3UATA 1G3QA 4C0SA 1TQ4A 2W00A 1P72A 2RCNA 5KSYA 1XDBA 1IM2A 1HEIA 3PUZA 1CXZA 1KKMA 2R8RA 2G0TA 1H8HD 4QGFA 1KY3A 3RLFA 1IY1A 1TAGA 3ZZTA 4Q7MB 4I4LA 2QRNA 1SVWA 1AK2A 1G3MA 4GOJA 3A37A 2MMGA 2QT1A 4I1SA 4TQUS 3GLGE 3B9PA 3A8TA 3Q8XB 4FI3C 1VMAA 4B48A 1E9BA 1KO5A 1SVKA 3LNCA 4RZUA 4TLCA 2DWOA 5DH9A 3MMPA 4JVSB 3VR2A 1QDEA 2I3BA 3TKLA 2BV3A 2F43B 1E9EA 4DLXA 1UADA 1EFHA 4Q9LA 3I92A 1M6NA 1XWIA 1ZC4A 3VX4A 3CPEA 5TMPA 5HR5A 1EFRD 3L43A 2FFHA 4C0QC 4PR0A 2N42A 2RMKA 1NJGA 1P62B 1TEVA 2RGDA 2P65A 1YZUA 3LQRA 2ZRNA 4HZUA 5FBWB 1XTSA 2D4HA 3TGPA 2G3YA 4OHZA 2QY9A 2VBCA 4HLQB 1BO6A 3U6BA 2GEVA 1CU1A 1W5TA 4TMWA 4PAQA 4BFYA 4IDQA 4LYAA 4CEJA 5AUNB 1Z0AA 3FPAA 621PA 3CNNA 4WAUA 3AM1A 2XB2A 1CULC 5KO2A 1P2SA 4LSGA 2YC4C 4EJSA 2NO7A 1E32A 1ESMA 4NZYA 1XZPA 4PPQA 5KPDA 1C4OA 4A0HA 3DVLA 2PLRA 3BC1A 3KKNA 1B0UA 3I8SA 4M9XA 3TE6A 3ONWA 1D8TA 3PVSA 1XB2A 3IPYA 5F3WB 1HQCA 3K9LA 1D6JA 2CLDX 4OHXA 2R6GA 4ABYA 3QE0A 1G9XA 1MT0A 3KZ1E 4LYJA 1CIPA 1Z0KA 2F9MA 2IHBA 3KQNA 3B2EA 4PO8A 3U7HB 4OI4A 1U8YA 1Z5ZA 1QG4A 1QHIA 3CO5A 1RIFA 3C4JA 4DT1B 2ZJBA 4B3GA 4YMVA 5FI1B 4TZ6A 2NMVA 5J5CA 4WXRA 3QQ5A 1R0ZA 1QHHA 3UMSA 2EFCB 2X2FA 3O8DA 4FCVA 4OI1A 4BZQA 3QPWA 4M0LA 1XMIA 4LJYA 1N6IA 3GLFE 2IBMA 1RZ3A 3UKDA 2FSFA 2Z5FA 4AYWA 4DC9A 3KJHA 3SS8A 3OAAD 4CIDA 4F4CA 4FWTA 4GMXA 3SQXA 1BH2A 4OHVA 4EPXA 4LJ8A 2IYLD 3KX2A 1HY3A 4TTPA 1U99A 3ECCA 3GCGA 4AURA 1XMVA 1IQPA 2X77A 3DMDA 4RFSB 4UJ5A 5FL7A 3B1WA 4QRHA 4GFDA 3T1TA 3SE0A 1HURA 2RGAA 3Q72A 3FKSD 1R0WA 3W3AA 3BFXA 5CM8B 2DB3A 3U3JA 2QG6A 1ZM4A 3A1TA 1ZU5A 3AH8A 3BWDD 2WSMA 1SXJA 4NBSA 1AKYA 2ZQ5A 2Y8EA 2GXSA 3A4NA 4M1SA 5C4GB 2J7PA 2ZRMA 3C5HA 1KZ7B 2XNDA 3VHLB 2BCGY 2F55A 2G0NA 4GDFA 2EQBA 2ZSFA 2J0VA 2ATXA 4JLOA 4F91B 2LKDA 4RD3A 5D3QA 3MGCA 1DVRA 3AUXA 2FPLA 2WMNB 1OFTA 3A36A 3CZQA 3P4XA 3VFDA 1WRBA 1KMQA 2J87A 3IIJA 5EZ6B 3SJZA 5FTKA 4JBYA 1XXHB 1JNYA 5FPHA 3SZRA 1QG2A 5FPKA 4D4JA 3AP3A 4NYIR 3RABA 1NMYA 4PTLA 4EDHA 1YZKA 2G83A 3LLMA 3EXAA 5EP2A 2J46A 5GADl 1FOEB 1T6NA 2FX3A 3CONA 2XZOA 1HT2E 2CCKA 4O3MA 2LKCA 3IO5A 2OAQ1 2WWGA 1W4CA 3Q7PA 2IYYA 2ZJAA 2YINC 3CF2A 3LW8A 4G5QA 4BLQA 5B2ZA 3B1XA 5B58C 1NN5A 2OFWA 4V03A 2FE4A 3T5DA 1FMJA 3RDPA 3NDPA 4G5GA 3GQBA 4DUGA 4HLUC 2JJ2D 4L5BA 2GA8A 4YDHB 2O8EB 3L8YA 1FQKA 3AP1A 1DG3A 4QC2A 5G41A 5KTYA 3VU9A 2IW3A 4JT4A 2QNRA 4PSKA 4HB2A 4DDVA 1XJCA 2C04A 1KSGA 2YYZA 2IYSA 2F1JA 4C0KA 2CHGA 3H4MA 3X1XA 1VYTA 2H7VA 1MV5A 2JJ8A 3K0FA 4MA4A 4IDNA 3GFPA 2WKPA 1EK0A 2VIIA 3X1DA 1DAMA 2VLIA 2JLUA 2QBYA 2O8FB 4JL5A 4ZDJA 1Z28A 3QKRA 3FMPB 5IK2A 3GD7A 1SQ5A 2JA1A 1HQYE 1P2UA 4QNMA 5CYPA 2O0JA 3X1WA 1R6BX 2VRWA 5C1BA 1DEKA 2HUPA 3KUCA 3LAWA 5H70A 3U3OA 4CF7A 2GVDC 1BMFA 1VTKA 4TLEA 4LV5B 2BM1A 4PZLA 2XZPA 4RD0A 5L3SB 5KHOC 2ZJ2A 4MKFA 1NNEA 2ZRJA 4KBGA 2CK3A 4Y0AA 2ODWA 4P32A 2BHRA 3EC1A 4Q7KA 1FQJA 3DDCA 1A4RA 3UG6A 4XIGS 3SFZA 1ZNWA 2KBEA 1E2GA 2XTMA 3C7KA 3ND8A 4JJZA 5KNBA 2QN6A 3F0TA 1Z6TA 4TN1A 1OH7A 3TVTA 1NSTA 1IXZA 3LXXA 4J0QA 2GHIA 4MDFA 1NVVQ 1W4RA 2HXYA 1AZSC 1GKIA 2X8AA 2RGGA 4X8MA 2KE5A 3KXLA 4R98A 3GLGA 3QPVA 1YJ5A 4Q66C 2RGNA 3T1QA 3WHLA 4NYMQ 1KNQA 5A0FA 2V7QD 3ZIAD 1OYYA 1KOFA 2HT6A 2EFEB 4A6PA 3FYHA 1EX7A 2B21A 1EX6A 5KOYA 3MWYW 2ZE8A 3GLHE 4OQMA 4IOJA 2EFGA 1W5SA 1RYFA 3HPQA 4W5JA 2XZLA 1E2DA 1KYIA 3WYAA 4FIDA 4MKIA 2RHDA 4Q47A 4HB3A 2FZLA 2O52A 3KJIA 2ZR0A 1E9DA 1GTVA 4LV8B 4GP6A 4Q7LA 4K46A 3TBKA 1P9NA 2Q3MA 2Z6VA 3BK7A 2CE7A 1XEWX 4MDEA 3QXSA 3ZGXA 3I73A 1AS3A 2DBYA 4OHYA 2ERYA 2QE7D 4PQFA 5E7JA 1F3OA 3EIQA 1NLFA 2W83A 4JYBA 1G3RA 2RAPA 3I8XA 1VHTA 4V0KA 2J0UA 2CHQA 2GVZC 4Q4LA 4UJ3A 3L0OA 4MUAA 4Q1DA 3SEAA 2CHVA 2HYDA 2JAQA 2WMOB 4LHWA 4DSUA 2V6IA 4QBGB 5E7IA 2JJ1D 1M7HA 4HZUB 3AVXA 4PHFA 3ZJYA 2F6RA 2QI9C 1JR3D 1OW3B 1YZNA 2W58A 2ZUCA 3DL0A 2VL7A 3TK1A 4Q1BA 2YVUA 1CS4C 2ATVA 4M53A 2ZRCA 1I2MA 5JECA 1YZGA 4CEJB 5CJPA 3NDBB 5DLQC 2GK6A 1WCV1 2AKYA 2ZRIA 4AKGA 1U2RA 4DLZA 2RHMA 4EJSB 4YLGA 3CNLA 4CT5A 721PA 4LI0A 1JEDA 4P4SA 1HV8A 4KXFB 3NC0C 4C9BA 5KNDA 1ZVQA 3AVTA 4XTCS 4AYTA 2FWRA 5LD2C 2QQEA 1W48A 3EZFA 1W4AA 3E1SA 4MYCA 1IN4A 3B78A 1N0UA 2PT7A 3GLFA 3EZ6A 2GNOA 2Q6TA 3CM0A 3K0AA 4CEIA 5F98A 4TLDA 1FZQA 4BLSA 2G88A 3EWSA 4BFTA 1Q44A 1RYHA 5JCZA 1E2IA 1JB1A 3CF0A 2R9VA 1JR3E 2A5YB 1XTKA 4LDJA 3SBEA 2QQ0A 3BB1A 5DGXA 1J99A 1P60A 2AFHE 1QHHB 2FV8A 2HCBA 2VH5R 3TUZC 4QFMA 3UXMA 4B6EA 1KI8A 1N6KA 3RVBA 1GAJA 1LTQA 4JBXA 1S0UA 3PEVA 4ZV4A
chains in the Genus database with same CATH superfamily
2Q41A 4P7GA 1KR5A 3FWHA 3NUQA 3ZWOA 3EXIA 4Z54A 1OVMA 1Z08A 3UJAA 3AEKA 4LGYA 2ONYA 4BRWA 1IN7A 3VSBA 1T2UA 4MPPA 2PBRA 5FD8A 1N4AA 3HZHA 3NANA 5FA8A 2RHTA 2ZIAA 1M6WA 3D7RA 3SVTA 4I14A 3IE0A 1E7MA 5CNJA 2HSEA 4OI2A 1PJLA 2WLTA 4GX0A 4KU4A 4CV3A 2JGMA 3MTQA 4DLTA 1BDIA 4BJHB 4L50A 4EMTA 4MWBA 2EC5A 1QGED 2QZSA 1IZZA 4ITVA 5JCJD 3K7EA 1LH0A 1O6ZA 1PJCA 3OIFA 4K1LA 2E4AA 3PQEA 4TZKA 5ILOA 4S24A 4BFCA 2IC5A 3MB5A 2Q9CA 4KFCA 5KWEA 2P5TB 1K98A 1CYDA 1PR6A 4D2IA 2FWMX 1Q11A 1GZVA 3IE2A 5ES3A 4EUKA 1V6SA 5JROA 1WW2A 1UJ4A 3EASA 3LOPA 2AN1A 1X1SA 2FUG6 3ZU2A 1C7RA 5E6SB 1ZY2A 3FKSA 4UTZA 1OXBB 2RHJA 4PSVA 2AHOA 4UNRA 3O90A 3JVEA 1GTRA 4ZMBA 1V71A 1XELA 1I2AA 3KSUA 2FVXA 2ATCA 1TOAA 2QT0A 3WYDA 1R6AA 2GM9A 2DC1A 3IP1A 2GPTA 1DXHA 2JCSA 3NC4A 4ODIA 1J33A 3W79A 2I6FA 1BGWA 3K71B 3NONA 2PM8A 4GG1A 1YQ9A 4QXMA 4AZVA 1L6IA 3LUFA 1NC3A 2G82A 8AT1A 4YAEA 5FBHA 4MJLA 5BUSA 3DOFA 4WBNA 4FGUA 4OM7A 3O8QB 4QDXA 3B5IA 4MGEA 4O63O 3SKVA 2OD9A 4IUYA 5E4TA 4KLZA 3OJOA 1FVHA 1CUUA 2CV0A 4RM3A 1FVFA 1TTQB 4ITRC 1RD4A 3VU0A 4E88A 1LW6E 2IIBA 3N2GB 3IB3A 2D5BA 5JCXA 3GLIE 4EHDA 1NBHA 2C3MA 3IUEA 2XNKA 4MW2A 4A26A 2ABWA 1J0XO 4Q1AA 3VU9B 1AQLA 1P2DA 2OUKA 4EHBA 3A6JA 1H1TA 4F3NA 1CUFA 3AWIA 3VYVA 1F48A 3V5NA 2NVWA 1REQA 3PQCA 1T3GA 2ZQZA 3C4QA 1TLFA 4IRXA 1PTJA 4MIYA 4JI4B 1ZH4A 2XHZA 4BP1A 1ISJA 4HK4A 1Y1KE 3SXPA 3I1JA 2YJ3A 5DWQA 4YMLA 4KQEA 1U9YA 1OV4A 3SFVA 4WJZA 1UQRA 2NNWB 2C7QA 1PWXA 4DLYA 5EJ5A 1Z82A 4P34A 4LAFA 2NX2A 4BEBA 4L76A 4LXIA 5DYIA 3GXOA 1RRVA 5DCUA 2XRMA 5EKUA 3W3AD 5HA5A 5H9WA 1BROA 3MWGA 1OWMA 3UTDA 3WA7A 3WLQA 1A9ZA 1DKNA 1MAWA 1R0LA 1R8XA 2IU4A 2X0JA 1H0RA 4I81A 4UUOA 1NM5C 3UV6A 4M8IA 1CQXA 2B5VA 4MRAA 3LHSA 3WFJA 4BS9A 5JQWA 3C7AA 3QVWA 1QGDA 1K6MA 3AI3A 3FR7A 3P9NA 4QXQA 1GNRA 3KHSA 4AY5A 1LSJA 3JQQA 1CB0A 2VP9A 3REFA 4EYSA 1Y89A 4U2BA 1KTIA 4RTPA 2BSAA 1Y9EA 1UL1X 1CY8A 3D31A 2REQA 3I32A 2WE7A 2XNDD 4WY5A 5DGHA 4ZAYA 2FZVA 3H4TA 3N6RA 4FS8A 5CK5A 2B35A 5DDIP 5DW0A 5EFOA 3GLHA 3SICE 3TSOA 2JBHA 1W44A 1ZN2A 2OORC 2WT4A 3K09A 3S5JA 2CV1A 2O2JA 5DVZA 2PIDA 4HRYA 2UZ4A 5EFZA 4XB2A 1INLA 3IDSA 3RHFA 1RC8A 1QHFA 1U0LA 1P5RA 2R6FA 1UP7A 4HGPA 4OQFA 4B2IA 2VWHA 5KHAA 3P9XA 2VZLA 1YU9A 1MTOA 2ODTX 4YXWA 4IFEA 3RLIA 3K8YA 1Y1PA 2YFYA 3DFMA 3PUJA 3RS4A 5K7SA 4LY9A 3W8EA 2J41A 3ORRA 4FGKA 1B73A 2FZEA 2JATA 3PZBA 4KIFA 4OQ4A 5EHZA 5DE3A 2RD2A 2QTNA 4UXJA 4GOLD 1N8NA 1WAMA 2ZR9A 2BGMA 3BXEA 3H75A 5AVYA 4B3RB 4PLCA 1B00A 1UJNA 1XCMA 2LCIA 3RRFA 5ITVA 4DUGD 1E0SA 2EF0A 2ZR7A 3LM8A 3L7OA 5FWDA 4D3SA 3GFBA 3JTMA 3VOSA 2VDWA 2YDXA 3WKCA 4C0BA 5LL6P 2CUZA 4CM9A 2PKQO 1NLUA 2QQ5A 1V47A 5DULA 1MC5A 3U7JA 1W1UA 2V7QA 3UHFA 1F7UA 1FB5A 4NBUA 3VNVA 3FTQA 2V74B 3ZK9A 3AW8A 2RARA 5DTJA 1EUCB 2BC9A 3ANLA 1I3OA 1QFSA 3H6KA 3NKFA 4BN4A 2DBVO 4KNWA 4KVGA 2ECQA 3RWOA 1Q0TA 4QGSA 5B2EA 1IRXA 4Y8VA 1YXMA 4W9RA 3IQZA 2V58A 3MCAA 1OXXK 1CRQA 2EWWA 4UREA 3QI7A 3QZUA 1PJQA 2WM2A 4IUCS 4R3UC 3Q6NA 1CLEA 1V4BA 3WLPA 1VB3A 4TUYA 3DE7X 1TCVA 3NHJA 5K3BA 4S0ZA 4L4ZA 3GZNB 2CNKA 3X2FA 3DAOA 3AR6A 4OJKA 3OD5A 4RS4A 3FWNA 5CB6A 1ATIA 1RPAA 2AE1A 2BISA 1I7SB 1O3YA 2WINI 1AVTA 3U7QA 1JHRA 1G8PA 1ZI6A 4IIXA 1BSVA 3WK6A 4MYUA 3TRDA 5KNCA 2FLVA 3DF7A 1CEQA 3L82B 5EWLB 4OHCA 3L2OB 2PLWA 2V6JA 2AIRA 2V55B 2WF9A 1LGYA 4HO1X 3BWCA 1P3JA 2AH5A 4GKKB 1NUTA 3CN9A 2EXXA 1YA8A 1FJHA 5TC4A 4P4SB 4X62B 4BXOB 3T3DA 1KTVA 4E70A 3TUIC 2WNSA 3IA2A 3OO0A 5T6MA 4FLMA 3AY6A 3VVLA 3GDWA 1GU1A 1P0CA 1A27A 2WD7B 1LC3A 4LZLA 3LRXA 3DBLB 3UFXA 3V33A 5JU6A 4L3OA 1UODA 5CM9C 2IUFA 4URFA 2R44A 3K0AB 4QVIA 4DN6A 4CEIB 1QPBA 3LT0A 1GKYA 1NZDA 4UTXA 3LWDA 1NP7A 3GP3A 3Q5EA 1I9CA 1MVNA 5LLSA 3O1HB 2BSXA 3PLAE 3C45A 4PX3A 1O94D 3IQGX 1T6BY 1DAIA 1NXTA 4HYQA 3W2FA 3FN4A 1OQAA 3S99A 1L7BA 2LIPA 1E7WA 2PDAA 2PH1A 3ED1A 3NDIA 3MS2A 2QVLA 4XFDA 4NY1A 2QMHA 3DEAA 3VR4A 3KEOA 2QN2A 3EVNA 3O4HA 1X74A 4X5OA 1GITA 1H66A 2PMBA 5M5BA 1LX6A 5T4FA 1VG9B 4Q1CA 5BNTA 2MINB 4PZDA 2VPPA 2FSVC 4CMIA 3I9JA 1SFRA 2RCYA 2OCDA 4MQMA 3UN1A 2EQAA 4EVSA 5IDQA 1JHUA 1T9KA 1I0IA 2ECOA 4GBED 3P4YA 2ACWA 4ZHQF 2BDEA 1L5LA 5A9SA 2CB9A 1VKZA 1YC2A 4D8WA 1B3RA 4B2YA 2IIVA 5KQPA 5FFFA 5BWMA 5BNFA 4CLRA 2PUGA 3W3AH 2B6NA 1F6WA 3D6UA 4OK5A 2JB9A 2I3DA 2IPLA 5JSUA 1P39A 4DRXB 1GD1O 4CVNA 4YCNA 3ILHA 2VP2A 4J1QA 4WXMA 1UIRA 3KQSA 4CODB 1IVNA 1R74A 3CV3A 4L4XA 1P44A 3WJ7A 3DSRA 2YHBA 3G0BA 5C8YB 3NHWA 2F48A 2X2EA 3DKKA 2CNDA 3U9SA 2P2NA 2CL6X 3IXLA 2XOKA 1EFDN 4Q16A 5IDXA 3JR7A 4NZOA 3JQGB 4DM4A 1HORA 5H4GA 4MARA 3PG5A 3TR0A 4GL2A 1AKNA 1VPEA 2J5BA 4IHJF 2PKYX 3A3YA 3ILSA 4HFNA 4N5DA 4B6QA 4BQRA 3LY8A 4WHMA 5IAAA 1JHQA 2FPWA 3GYGA 1TF5A 3P0RA 4DQKA 1E3MA 3GLIA 5DWVA 4D74A 1J8MF 3PJDA 1LLDA 3AEZA 4TT3A 3BMNB 4KXWA 5AT1A 3UJPA 2XNHA 2PVCA 3OCWA 4QA9A 5A4AA 1WHSA 1ODKA 2Z9DA 3G89A 1CF2O 3BRWA 3WKAA 3CPSA 2GMWA 4IH4A 3RRMA 3JQFA 4WADA 2OAGA 1QP4A 4KLRA 2CDRA 3U4QB 3KT0A 3PNBA 3OLYA 3QUTA 4WNAB 3I9NA 2NU9A 2I4NA 2BBWA 5J43A 1L8XA 1MCZA 2YYAA 3U7RA 4CIBA 2W4QA 3LC7O 4ZANA 3B3QA 1P74A 4JL8A 1R4MA 2ASVA 2NG1A 3CLHA 4BO9A 2XBMA 5E6UB 3DE3X 4Q4JB 3WK7A 3V7WA 1YTLA 1U5AA 3HDQA 4RW0A 2QORA 5HIAA 1OGIA 4YJHA 1K7SN 4W1RA 3VYWA 1HQDA 1WXEA 3TJRA 3ZEIA 1AQUA 1E79A 1Q1GA 2XWPA 1SG6A 3GHYA 1XGKA 2WF6A 4DLLA 2Y1FA 5DP2A 3B3JA 2I7CA 3STTA 4V1CI 3WLLA 1L1QA 4U2DA 4MUXA 3R09A 3TB6A 1CJBA 1PGJA 1WMEA 2AXPA 2JFZA 3P19A 4WQMA 2E4XA 2IUUA 1PCXA 1C9DB 4NV1A 4ZC8A 2H18A 1FEZA 1DL5A 3D5QA 1OKKA 5A1TA 4URWR 5EXDA 4M1WA 3Q0IA 2G28A 1TMOA 3BJIC 2PMEA 3O3CA 5IU6A 2HHJA 1JF8A 1KH2A 4I55B 1DIGA 3UAWA 5CHYA 2ATEA 5T5QA 3QLTA 5CAEA 4P38A 4JBLA 3UOAB 1E5XA 3U4HA 1CDZA 2Z83A 5EUMA 2NU6B 5KYXA 4S04A 5JXIA 1YL5A 2G09A 2X9VA 3JQBC 4DLAA 2PWYA 1O4VA 4ADSG 2H5LA 1OHHA 3G49A 2N1BA 1RS0A 1VPVA 3NHKA 3NWPA 3CRW1 1PL7A 4RHCA 3P2IA 2WF7A 3IC5A 5FEMA 3RQSA 3DKVA 4QQKA 1KGDA 4WEOA 4RDIA 5FYDA 1RAEA 2CVZA 3ULKA 1Q0LA 2D2VA 3NAQA 5DGCA 3TLCA 1OXUA 3A4LA 4OU4A 5FOTA 3SKYA 1YZTA 4IHKA 3T6KA 2GAOA 3ME5A 1QRSA 2OFOA 1FQOA 4AJNA 3EGWA 3VUFA 1OUMA 2JGKA 1KRXA 3KTAA 1QZUA 3OIUA 3R7FA 1Z7EA 3RIHA 5HZGA 1T2NA 2G7ZA 1AKVA 3EGIA 5TDHA 5B1YA 3Q11A 6NULA 1DIHA 3T3PB 1P33A 4EHFA 5D3MB 3IBCA 3P5BA 2X5NA 3GLRA 3P0HA 5KYUA 1GL9B 2WR8A 3NYRA 3NHMA 5EG5A 1YVPA 3JY6A 1TO1E 1YS4A 4AJ4A 4US0R 1AN9A 4FE3A 1Y0BA 1TIPA 2HHAA 2RIRA 4JP5A 1YVDA 1MEEA 3TQIA 1V48A 3A1DA 1G2IA 3PDIB 4ZAFA 3KJXA 3TIFA 3WBBA 4B3FX 4N5MA 2WPDA 2XT0A 3CJQA 3G59A 3RVDA 1Z06A 1BN6A 1NQOA 2P6PA 2YJTD 1D2AA 2ZDHA 3HRIA 3HWX1 4P7FA 2DU8A 2FSHA 5I4IA 1K8QA 3MBIA 1R4NA 2W6CX 1UM8A 2FJ0A 1CUDA 2V5AA 1E77A 6AT1A 1DG1G 1AKMA 2HPZA 2IE8A 5G3YA 5AOVA 1H94A 2BIFA 5IXYA 1ZP6A 1Z8HA 3DAHA 4OSEA 4PVCA 3SJBA 2IYQA 2AUTA 1KH3A 3OCVA 4R3WA 4ZPJA 1Z17A 4HDCA 5KYWA 2J5KA 3LH5A 4UHKA 3SSMA 4M6WB 3L6EA 1E89A 2BW0A 1PG5A 421PA 1DLJA 4A0QA 5BP7A 4A15A 1W581 2QNBA 3A32A 3K16A 3O8QA 1WDLA 3L06A 1AE1A 3F8TA 2XUQA 5JYEA 1P4RA 2JFWA 2FPGA 2Y71A 3T06B 3GCXA 2DF8A 2XI4A 3HN7A 1U8UA 3RFFA 2K7FA 1EZ4A 2I1VB 2N47A 3LC0A 1Y3FE 1SOVA 3QBTA 4N9QA 4QSMA 1KDZA 5HPYB 1XZGA 2PKEA 4INJA 5FQOA 5CLGA 3ZBTA 3ENZA 2ZYGA 1L5OA 2R62A 2XQVA 2ZVPX 2NLOA 3HP7A 3DV2A 1DTEA 4KI0A 4PAMA 3WLJA 1F2TB 1O9BA 2O8BA 2ZI6A 3DG9A 3RVSA 4HNTA 5FIUA 4PM4A 3UJ6A 4ZO6A 3GVPA 4XEUA 4IOMA 1I80A 2HA5A 3D3WA 5FBRB 2EBHX 3IUBA 3V55A 3CRRA 5C32A 4JLNA 5CP8A 5EPOA 4ZU1X 3DYVA 3CVOA 4KAXA 2WWYA 1VL2A 1U9ZA 2GFIA 1ZJ6A 1XKLA 1PNVA 1YFKA 1U7XA 2P7IA 3GB9A 4XEHA 4LDAA 3R7LA 2Q99A 1J2EA 1NPYA 4AJEA 4QEDA 1TM3E 1E9SA 3MWDB 2ZRGA 1Y1SA 2PSHA 4S1NA 4UUNA 4L51A 1NUUA 3RHSA 5LZ8A 1TF7A 1U8TA 1WF6A 4QT0A 2R4QA 3RTAA 3Q0EA 2ZI3A 3LF2A 4RIEA 3R0VA 4XGQA 4ZJPA 1PZHA 1Q3TA 2DPLA 4FMCF 5LXTF 2UXCB 3OQIA 4AMGA 4NJMA 5JMWA 1E0KA 3G02A 4Y6RA 4BUJA 1E7RA 4NQZA 2UZ3A 4RHTA 2X9NA 5EYPB 1WF3A 4FOTA 4MQBA 4YONB 5HF6A 5I5GA 4DNFA 1KI6B 4AROA 4A8PA 1URPA 2QTCA 1BFKA 3WTBA 2V3WA 5AIAA 1W4BA 2A33A 4OMDA 2CHUA 3RVNA 2NSLA 2EHDA 4XYBA 1V3TA 2ODPA 3NKLA 1DQRA 3SAJA 5K8IA 4B6JA 4EJ0A 2IHVA 4I5FA 1KJQA 4DB2A 3DZ8A 1SUDA 1WG8A 1X8LA 1JAYA 4J3JA 1QKIA 1UWCA 1AQJA 2J3DA 1PR1A 1U0BB 2FLWA 3PC6A 4XUDA 3QLUC 5JZBA 1JEQB 1N5DA 2DT5A 2I66A 1WMDA 3H9JA 4K05A 4MLZA 4BMNA 4KR3A 5AXAA 2ZJYA 2P6RA 3S2YA 1RIIA 1NW7A 3TL2A 2W43A 3G0IA 3R3VA 3HXOA 5M2QA 3AF2A 4HNRA 4U7JA 2XW6A 1P0MA 4KLNA 1YFLA 3IESA 4KFTA 5ELXA 4LYGA 1KMHB 4UDNA 3A9SA 2AWNA 4C7JA 4RJJA 4WN3A 5IXJA 4MVJP 1ORIA 3JWJA 1OLSA 5DTQA 3QVXA 1E6MA 1V1RB 1YR6A 2VTKA 5ALIA 2XUPA 4QBKA 5IM4F 1MA3A 3C8DA 3CGGA 3MCUA 3PD0A 4PYIA 5CG2A 1GZ5A 1CX9B 1YRYE 1CJVC 1Y6QA 821PA 3E3AA 3DTVA 3PJRA 3FOBA 1GUFA 5FLKA 5I9IA 1KWGA 1ZMBA 2XTAA 3RAPR 2D59A 2HREA 1GEEA 2ZZKA 4HWTA 4BE7B 2OC9A 4JX9A 2Q6OA 2ECPA 2ZIGA 3CLUD 4PSDA 4G1UC 4XH9B 2WTUA 2NPIA 1PVOA 4RAQA 5INTA 1HSZA 3IBTA 4W1PA 3VTAA 4H0NA 4M88A 1NQ5A 2C83A 4F60A 5BQ3A 4RK1A 4NZMA 4JB3A 1LWOA 1O5TA 2X9GA 1BE6A 4RXTA 2QX9A 1T3ZA 3O4JA 3SXUB 4JUFA 4A2CA 1BWSA 1KHTA 2J5XA 1EE2A 3E9QA 4QEKA 1NVFA 2H31A 2V97A 4YQFA 4C7XA 1B6SA 1EK2A 2FK8A 3N74A 4DANA 4Y2VA 4EQZA 4C7KA 2C03A 2VDJA 1N0IA 2EP7A 1UPCA 2VDKB 3EG5A 3GZNA 4ARCA 1KYXA 3SF0A 2VXCA 2B8NA 2GM4A 3IYLW 3P45A 2WM8A 5DN6A 3U0VA 3CB2A 5ARBA 2CXRA 2JLZA 1J09A 5CVCA 4IDFA 4ZTUB 1VHLA 2QIPA 1T1JA 4CF4A 1X86B 1W0JD 2IW1A 2P9QA 4I4TF 4MKZA 3JYNA 4NPAA 2X7HA 3ZQ4A 1AURA 2Q2QA 3NEYA 1UBRS 4MCJA 4R05A 5FWYB 4DDHA 5DASA 5TR9A 2HMUA 3V8QA 3WGQA 4TRMA 1KJ9A 3LPNA 3OZEA 2NU7B 4QATA 1DQNA 4D9KA 1CE8B 1G8SA 2O3QA 2VPXA 5CBPB 1UDXA 1BYUA 1PR4A 2W6JA 2BP7A 2P9CA 5FA5A 5AVQA 4GPZA 1MJHA 3BIFA 3C3AA 3KC2A 3R5SA 3AUSA 4FT2A 3TTWA 4YGXB 3DTYA 5CCXA 1W5EA 4GYWA 2HSZA 4AMUA 1GTG1 4K1XA 3CLSD 2ON6A 1Y63A 1OR8A 5C46F 4JXKA 2V7WA 5IKEA 1P1JA 3K8OE 4BO4A 5JE8A 1V25A 2ORYA 4AMBA 1D9XA 4PBRA 4D02A 2DWPA 4V0SA 5DT2A 5LBUA 3ESQA 2V98A 3PNOA 2ALJA 2D06A 3NBYC 2QTTA 2I1QA 5GIOE 1IXSB 4QICA 3JYQA 3GT3A 4D42A 4ZOAA 4YASA 3RBVA 4DCOA 5L4NA 4PLZA 1USUA 3RSSA 5GVSA 4RESA 3HVUA 1T0JB 5LP1A 4M7RA 1Z2AA 2GCNA 1T10A 1M76A 4X64B 1Q0SA 3SHWA 1ZIYA 3ORSA 3WJAA 5KC9A 3ZI4A 2JNWA 1W0KD 1G0OA 1NBIA 3WOVA 2EARA 4ZP1A 5BWOA 3L8DA 2V9CA 4MV7A 1W73A 4ZJYA 1F0YA 3L5KA 2ZXUA 4FKBA 3GNQA 4P4NA 4AC9A 3TKAA 3WBKA 5A6SA 1NSFA 3GVIA 1X92A 4HLUA 1GTL1 1FY2A 4G07A 4JP2A 5AOBA 2C82A 5G4LA 5LMNB 1OMOA 3V1MA 2IXDA 2Q0SA 1KI1A 3RJZA 2EU8A 2NTYC 2Q3HA 2AC2A 5ER6A 1YQEA 2IP4A 3LT4A 3ZCUA 5HOQA 1KFBB 1Z6GA 3UWDA 4EUFA 3CUYA 4Q1EA 4PX2A 3WR5A 1RQLA 4GS5A 4KWHA 4BVAA 2GCOA 3UUFA 5MN4A 5J1TB 5DHPA 4OP3A 1CQWA 4HEJA 4ZARA 3KCNA 1QIKA 4MDYA 1RI2A 2JLYA 3OTHA 4CLOA 3KOYA 1GCGA 3O73A 1WZIA 2UUAB 2ENUA 2FWAA 4Q4HA 4ZOEA 5K3DA 1N5OX 1TKBA 3B1VA 4R68A 1HNWB 1G66A 3PNPA 4LYYA 5ER9A 1VHQA 4MX8A 1R1DA 4XJTA 1T6ZA 2PMWB 4ETNA 1Z5UA 1EBFA 3LCRA 3EIEA 2AN9A 3IEKA 2V7VA 5G3ZA 2Y99A 3BMNA 1FE8A 2DH5A 2NW6A 4IILA 1DDGA 4MGZR 1QYXA 3AHEA 4P82A 1K2VN 5FKJA 3SF8B 5ITZB 4QHSA 1F7VA 3DT9A 4LJKA 5KDDA 1SB9A 4K2HA 3KOUA 2QG9A 3KLMX 2DKOA 3EN0A 3TDKA 1E8DA 3OY2A 5SYMA 5JAIA 1KIAA 4RJKA 3QX9A 2JEYA 3T7AA 4NNPA 5G0WA 4KXLA 3OO1A 1QLWA 3ANMA 4DY4A 4CFSA 1CUAA 3SQWA 3PYLA 2PY6A 3AEQA 3PCXA 1E60A 3VTKA 4IDEA 4F7DA 3PI6A 1O95D 3MIIA 4I1VA 1TA4A 3BAFA 4YJGB 3ZHQA 5MDHA 2JS7A 5DX8A 2PU7A 3I2JA 1IIRA 1ZEJA 2C3UA 2I2WA 2ADOA 4Q4JA 5NULA 3RG8A 3D0OA 3S8YA 5DRYA 1V3VA 3HFGA 1V8FA 4B32A 5LB4A 3R5XA 1SBHA 4X61A 3QUAA 3L1HA 4KV9A 4HNUA 2IZ6A 5JBIA 4GECA 2MHCA 3T15A 5ALEA 1RKVA 1D2HA 4TYQA 4GM0A 1TYZA 4MR8B 2OFFA 3BPSA 4URYR 4LMAA 3FHJA 3X1ZA 4TYPA 2XUGA 4LF7B 4D0NA 2A0YA 3RO7A 1S4QA 4CL8A 2WU3A 3N05A 1SCNE 2IH5A 3E70C 3AEUB 4U63A 4E6PA 2F1RA 1FJGB 1ZGGA 1CZNA 3CSSA 3G7UA 3V2GA 3LWZA 3ZTYA 1Q7GA 4MEBA 2BKAA 3B89A 1ZCJA 4GT1A 4QWMA 2PPLA 2DWQA 3V2IA 3W8RA 5TIIA 3HB1A 2MCFA 4PNPA 2AFVA 1GRNA 2Z3VA 3GYBA 4X20A 4RK5A 2IH2A 1RC0A 2TMYA 3N87A 2FX2A 4RGBA 1J90A 4WXEA 3D81A 4D56A 3CLKA 1TUGA 4ZVRA 1V96A 4HJXA 2I4IA 2GPBA 3ICQB 5JJ5A 4KN6A 4R0VA 3ZWAA 5DYTA 4C03A 1ZOSA 1BCRB 2P6UA 2QRVB 3QEJA 5AVUA 1IUNA 3OC0A 3ZDYB 4EA9A 5AICA 5HYVA 1IBLB 4AY2A 1QG6A 1PJ3A 5AKKA 2H16A 1ZMRA 3ZWMA 1UBFA 2ZSBA 2B94A 3RI3A 1M7GA 4MWEA 1LNSA 2YS6A 3B51X 2XKAA 3NBZC 1PRYA 3B8HA 4YACA 3ROQA 1BFDA 4P2GA 4EGCB 4U3JA 5JSHA 2C7OA 4CCSA 2Q4OA 3FMIA 3OUZA 5D3MA 1SY7A 3NS7A 3RFVA 5K0GA 3QBDA 1VE6A 4P33A 5F77A 1M5UA 1XTJA 1YJCA 2QTHA 1XD8A 3H9GA 2YR0A 4YR9A 4GPAA 1IBRA 2A14A 1XE3A 1YK1A 2OM2A 3Q8WA 5KKNB 3QUBA 2WSYB 5EPEA 1RWNA 1L3IA 1A8QA 1GPH1 1DFGA 3RVLA 4J1TA 3DDSA 4WCFC 3TZ6A 3FUXA 4CDRA 3HYLA 1CCWA 3IIEA 1ZVVA 2YH2A 1GPAA 1WEKA 2PQ2A 4ALJA 3QUQA 2C57A 3ZXYA 5IT4A 1I7QB 5HVNA 1RKQA 2EF1A 3DWIA 3THYB 4YGYA 5EE1A 2GXUA 3NT4A 4P0TA 4DV4B 3GOQA 4QUGA 2D0DA 4CTKA 3UK7A 1A2QA 4UVDA 3E0QA 4JVLA 3SIRA 4KX3A 1WUIS 2GBGA 1F6BA 3I1YA 4M6WA 5DM0A 4G26A 3CF6R 3MUFA 1KY5A 3OPYA 4O4LF 3WHIA 1QGUB 5EJ9A 5EWMA 2G4VA 4Y2TA 4KQJA 1C3OB 1Q12A 1U9IC 2GLXA 3E5HA 3LOQA 4HDRB 1K7XB 1XC7A 5AJUA 1KZ6A 3LVRE 4KHZA 1TI7A 1K7CA 1N25A 2CXQA 2VQ3A 2C8KA 2FSPA 4LISA 4EFKA 3HHEA 4JZYA 3BDAA 1N2IA 4UAJA 3VZDA 2V7GA 4HNVA 4D3DA 1SXJE 4ZJUA 2PFKA 2P4HX 2V6MA 4EX6A 1Z35A 5LZ7A 4MLDA 1TUIA 3FJ1A 3OEHD 5EEHA 3ITKA 1VIVA 1RHRA 4LA4A 5LVAA 2VHCA 3QVSA 4E15A 5EIXA 2QP9X 2XVXA 3RSHA 5KTRA 3HJBA 4NATA 4BV2A 5JRJA 1E1CB 1Q7BA 2D8AA 1NI5A 2C77A 2WICA 3MLAA 3NH6A 3VPFA 2BZ0A 1IQ0A 3R7BA 3G82C 2YHUA 2OCIA 3VPDA 4DWJA 3EEBA 4JUDX 4POOA 3RAFC 4JI8B 3ICEA 1LBIA 4HS9A 2GF9A 4G8JA 3HP1A 1JH9A 1JSCA 1EWKA 4PC7A 3MUNA 4Z8YA 2BEKA 1SBNE 4KODA 1NUSA 4HI0E 4FR5A 2ZI7A 5IF3A 2HJWA 1KSHA 1WMBA 2VJAA 2XMRA 2HWUA 3MJFA 4IUDS 2X0DA 3C85A 1DV1A 2I4RA 4OD0A 4N0QA 4U6QA 1GZ7A 5H80A 5BSGA 3NBFA 1RLTA 4F2PA 3OLCX 2QP3A 4C7VA 4FQ7A 5REQB 4JLMA 5EYPA 2R1UA 3I9LA 1H9BA 2QHXA 3HKEB 3IP5A 3SDSA 3W5CA 3OT1A 5I01A 2D62A 1JTEA 2FPIA 3N6VA 5A06A 2DPYA 3N7AA 5EJ2A 1NKSA 2R8PA 8MHTA 1EVLA 3EZ2A 1SHZA 4TLMB 1F4PA 3FAKA 5ENDA 4P92A 2V7XA 5FA6A 2FP3A 4LIPD 4RD4A 4BNKA 5A3JA 5C9ZA 2OZLA 1E99A 1JL3A 4JQOA 2YYSA 1JMYA 2C7VA 1PKXA 4FN5A 5CH3A 2QPLA 3FFAA 1STOA 1ZVKA 4B3HA 1Z83A 2EFJA 4D26A 4WUVA 2OPHA 4ER6A 3VPSA 4RTJA 2JAOA 3QJGA 1E1RA 4B34A 1UZLA 1TVKA 2OHGA 2ZK7A 3I72A 2Y0DA 3BDIA 2JIZD 2AOUB 3LGSA 4JC5A 1DE0A 3L8CA 4IIUA 4X7BA 1NR5A 3RRJA 1EFLA 4P5EA 2LW7A 2BTQA 1QBGA 5IYZF 3KIPA 1WMSA 2RB5A 4YREA 1C9EA 3VO9A 2PFSA 1M1YB 3DCJA 2GHTA 3NEPX 1L3BA 3BAZA 1YACA 3BILA 3OFKA 4FEAA 4FHFA 4IV5A 5EUBA 3VTZA 3AVPA 5BSFA 3CLRC 2D2FA 4G56A 3U6KA 1T6XA 2IXBA 3UWKA 1TYDE 3M82A 4HLDA 4TV9B 4GI7A 2QSJA 4BLRA 2CJWA 2V1XA 2JIDA 1V1RA 4RD6A 1U2TA 2ZBFA 3IVCA 3M8KA 1TKCA 2VDRB 3GEEA 5HGXA 3S8EA 4YAKA 4DJAA 1X1DA 1OB2A 3DHNA 3M6XA 2GPJA 2NZUG 4UEOA 2OYCA 3IP9A 1SZPA 4B44A 1U94A 3DLTA 1ACLA 1M73E 4NYIQ 1RYYA 3BA1A 4ND3A 4KR7A 3S6JA 1I7NA 1QF6A 3WLMA 3PE6A 4LWZA 4U7GA 1EZZA 1L7PA 2JDIA 3KE9A 4BAZA 5A7FA 3VA7A 2O8DB 1J1IA 4OLJA 2QUKA 2IQ5A 4B5KA 3H42B 2V4ZA 3PYMA 3HZZA 1JHPA 1XYVA 3STVA 3PD1A 1GCAA 2AG8A 3KVOA 3UJCA 1W1WA 3NWBA 3HYRA 1Z4JA 2M6RA 4MAMA 2GBLC 1YHYA 5FTNA 1QUFA 3JATA 4NU8X 3GI1A 2GF2A 4XPIB 4AO8A 4Y2UA 5AUOB 1WDTA 4QU9A 1XMSA 1KZYC 1M2GA 2L42A 4EG5A 3RUIA 1DGQA 1SOAA 1UKYA 4Y9DA 3RC9A 1L7XA 1G42A 1PQYA 2NVOA 1LI7A 3RVRA 3WIOA 4BBZA 4F8YA 2PKXA 5J4VA 1FF9A 2PRKA 1T34A 1FFDA 1ZUWA 2A9OA 1OXSC 2QQGA 2HOQA 3Q5DA 1R5JA 4BCBA 1CG6A 4YAUA 2HMTA 1MDBA 4XIFA 4ZCQA 3MMZA 1QIEA 4EPWA 3PLRA 3E18A 1U3GA 3N9IA 1T8RA 4R1PA 3QU7A 4UOQA 4WASA 2O2CA 4N76A 2F1IA 1P6UA 3LUHA 1K68A 2C2WA 1M83A 1WV0A 4DBLE 1RNLA 5E9JA 2R11A 1ZNZA 5FWYA 1FFBA 3KALA 3R6GA 5DLYA 5ERYA 5EIBC 2WIFA 3AJRA 5HKKD 1J49A 2PUTA 1IUKA 4RK7A 1GA4A 3A1NA 4YT4A 3Q1KA 2OORA 2WT9A 2IYVA 2C95A 1I6KA 1LB1B 3I9MA 3BE6A 4OL9A 1ZM9A 1OAOC 3GR6A 1WEHA 2J1LA 3IXQA 1P8AA 2Q4RA 4EBFA 3H5NA 4YRDA 4LOIA 1UT5A 1NE2A 3N7TA 3TPCA 2ETVA 5D3KA 2GKOA 4IW3B 4BAUA 3GJZA 4KYTA 4LFBB 4AQ7A 3D8RA 4WWHA 3FCCA 4JXXA 4HGZA 5C1DA 1P9OA 1K0FA 1MA0A 3F74A 3FHLA 4MGKR 5CGQB 3SHTA 5DB4A 1M6HA 5CB4F 4IEFB 5CT8A 5E6RB 3MWEB 3Q88A 3TLXA 4EEKA 1CP2A 1RXIA 2QX4A 3CH7A 5FPYA 4A1FA 5HTOA 4JEMA 3Q5GA 4M89A 3INGA 5I7VA 2ZU6A 4GKVA 4EFNA 2WWVD 3GPLA 2OYSA 1C5KA 2OXTA 2GZSA 3DH0A 4RYLA 5A5FA 3E9NA 4XE5A 1K8RA 1N78A 1V8OA 4E3WA 2J9YB 1XEXB 1XPOA 3USES 3M89A 1B6TA 4HAXA 1J2TA 2CNOA 3CMMA 4HYTA 3VSAA 4DBZA 5G2OA 4KUHA 3WGNA 1UZUA 4KJZA 1XNRB 2PAFA 2E4YA 5KZMB 4IX1A 4J94A 1W9HA 1N1DA 3C41J 3MWKA 3NHPA 4YMSA 4F1WA 4MPJA 2QJWA 5MHTA 1GGEA 1U81A 3GJXC 4NBRA 1SUPA 3KT8A 1ZD8A 4EG7A 3BG5A 4E1VA 2R7AA 2CBGA 1WSAA 3H1TA 1CDEA 4ZA2A 4R9UC 4HEA1 5KVVA 3NTUA 2HLDA 2FGKA 4HDAA 1F06A 5BSMA 3K1TA 4KO2S 1QF9A 1JVSA 1Z45A 4QYMA 2C2XA 3A14A 4M0DA 2AOTB 3CX6A 3P2JA 3ROKA 5FO1A 3OTIA 2CLLB 5ECDA 4ZCPA 4Y6GB 3V9PA 3UWMA 5EMNA 5KI6A 3OZUA 3FPFA 3PGLA 1SRRA 3G6KA 4J43A 3RSQA 2DMRA 2W9XA 2FPXA 3L0YA 2VQ6A 3NWOA 4OX9Y 5JC1A 3PNQA 5EJAA 1DPFA 4RQBA 4LTDA 1GGHA 3WGTA 2O0MA 3EFBA 1JI3A 1JG1A 5EZQA 1II0A 3KT6A 1NNSA 2P62A 1N6RA 3DNPA 4EHKA 1LPSA 1IHYA 4FR0A 4E5VA 1WKBA 2FG7C 4Q3EA 2WJPA 4LI3X 4KITB 2YRFA 1O9HA 1U8ZA 2HNBA 2D7CA 3CLTC 3QI2A 4XDGA 4AZ3B 2EWMA 1GPKA 2PUWA 5KQSA 4EEZA 1KPGA 1M10A 2P3QA 3ZGVA 2KM1A 2DFPA 3ON5A 4TVBA 4CMGA 2ATIA 1UMDB 2D2XA 1TKAA 3O26A 2WTEA 3A58B 5JPDA 3N2YA 1A9TA 3N58A 4EAQA 3V3KA 4D0LB 5JDIC 4NCXA 2CL7X 4IBOA 3RVMA 3MF4A 4YV1A 3FZYA 1E5VA 1MH9A 2W6IA 3D3QA 4F45A 2BEWB 4TSKA 2BE9A 5E2IA 3D1LA 4N3NA 4OJTA 4W7IA 5P21A 4RLQA 1XFDA 3V34A 2X3FA 4E14A 5AVXA 1Y6GA 3E5MA 3PXAA 4Q3OA 2UVDA 4W4TA 3E23A 4FGSA 3AHGA 5K0FA 1Q6ZA 4L4RA 4B6PA 1EXWA 2X9QA 3OZRA 5C7IO 1QPZA 1PI3A 5DBGA 4G3XA 2YHAA 5HE8A 1NVKA 1UH5A 3AFIA 3G9XA 4WLOA 5CXXA 4EITA 2J9GA 3S5UA 4F3KA 3MQ4A 3OHPA 1F8UA 1P3Y1 4TTQA 3D7SA 1Z33A 1KY4A 1THGA 2H1WA 2YJ6A 4CMKA 1W5AA 1ZONA 1KP3A 2QW8A 3B7GA 3KS9A 3OJLA 1VGQA 1Z6XA 1K9SA 1BG6A 1VCIA 4LBVA 1L6RA 1RZUA 2VP4A 2WUGA 5F2KA 1BFUA 4NU0A 5T64A 4KOEC 1Z6YA 3MJTA 2P9EA 2A7QA 1OBVA 4J9UE 1Y4AE 2H5JA 2QRQA 4KQKA 1W94A 4DR5B 3IILA 3HQ4O 1ZW6A 5CBKA 1LNZA 4UASA 4CEHB 1BA2A 2XXAB 2JFGA 1C3VA 1RDFA 5AI5A 2B4QA 4CFYA 4TKUB 2QM0A 3QYAA 2ZAGA 4G65A 1IAVA 2RBKA 4DAOA 3KB2A