1V41E

Crystal structure of human pnp complexed with 8-azaguanine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Structure of human PNP complexed with ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v41E00
1YQUA 3E0QA 5B7PA 4U2KA 3LA8A 1Y1TA 4BMYA 5CCDA 4M1EA 4LZWA 1TGVA 1PR5A 1Z5OA 1SD1A 2HRDA 4KN5A 3NM5A 4PR3A 1Z5PA 1QE5A 2HSWA 4L6IA 1ECPA 1VHWA 4QAQA 1U1EA 4R2XA 1PBNA 1XE3A 2B94A 4TS3A 1A9RA 1K9SA 1RXUA 1ODLA 1JDVA 3EUEA 2OXFA 3KU4A 1A9OA 4TXJA 2A0WA 1Z38A 1OU4A 4DABA 2Q7OE 3LBAA 4NS1A 2ON6A 4JWTA 4D8XA 5B7GA 2OECA 4P54A 1A9PA 1PR4A 4F3KA 2AI2A 4F3CA 4F2WA 1V45E 3OOHA 2H8GA 4L5CA 1TCVA 1ODKA 4F1WA 5B7NA 3UAWA 4R31A 1SJ9A 1JYSA 1NC3A 2A8YA 1RCTE 4GLJA 2HWUA 3D1VA 5EFOA 5F78A 1TGYA 3BSFA 3BJEA 4R2WA 4LDNA 1I80A 1Y6RA 3U40A 4TTJA 5F7ZA 4TTAA 4DANA 4JOSA 4GKAA 3MMSA 4MARA 5F76A 4BMZA 1RXCA 1U1CA 1A69A 1ULBA 2RJ3A 1T0UA 4G41A 1Z37A 3BL6A 1NW4A 4DA0A 1Z36A 1RFGE 3IEXA 4L5YA 1JDZA 1OUMA 5JPCA 3ENZA 1K27A 3FOWA 1Z33A 3FNQA 4QEZA 1V3QE 3O6VA 1JDUA 1Z39A 4MCIA 4F2PA 1JDSA 4OGKA 3NBQA 1JPVA 1YR3A 5FAKA 4TS9A 1Y1RA 1TD1A 4YJKA 3C74A 1SD2A 2OC4A 4OEHA 3K8QA 4WKBA 3UAZA 3LGSA 4M7WA 2A0YA 3DF9A 4BMXA 1A9QA 4X24A 4L5AA 3MB8A 3TL6A 1JE1A 5CYFA 2HN9A 4WKNA 2AC7A 1PWYE 3KVVA 1ULAA 3EMVA 2QDKA 4LNHA 4D8YA 3ODGA 2ISCA 1A9TA 1CB0A 3FWPA 3PHCA 1PR0A 5EUBA 1V2HE 1JP7A 4D8VA 2PGAA 4DAOA 5CCEA 5F7JA 4OY3A 5IU6A 1PR1A 4FFSA 4GMHA 1PK9A 4K6OA 1N3IA 3INYA 3FUCA 1Y1SA 1TCUA 3GGSA 3UAVA 4GLFA 1T8RA 4DA7A 3E9ZA 4M3NA 3PNPA 1PR6A 1YQQA 3DPSA 3FB1A 4QARA 3O4VA 2AI3A 3T94A 5F77A 1V48A 3PHBE 5F73A 3EUFA 1RT9A 4EB8A 3FAZA 1CG6A 4DA8A 1OTXA 1YRYE 3KVRA 4YNBA 3DP9A 2QTGA 2QPLA 5C80A 2QSUA 4WKCA 5I3CA 4E1VA 4LNAA 1B8OA 1M73E 4TTIA 1Z35A 5EPUA 1JDTA 4JP5A 1RXYA 1RYZA 4G89A 2QTTA 1SQ6A 2GUWA 3EEIA 1B8NA 2I4TA 2AI1A 3OZBA 4YMLA 5CXSA 3GB9A 4LKRA 5B7QA 1A9SA 1V41E 4BN0A 1PK7A 3NM4A 4ECEA 5K1ZA 1C3XA 1OVGA 4MCHA 4DA6A 1V4NA 1VFNA 4EARA 4TXNA 3OCCA 1RXSA 4TXHA 4NY1A 4OF4A 4WKPA 4YO8A 4DAEA 3OZCA 1LVUA 3P0EA 3P0FA 1Y6QA 3UAXA 5DK6A 3DDOA 3BGSA 4IP0A 1G2OA 5CYGA 4I2VA 4RJ2A 1OTYA 2P4SA 1LV8A 3NM6B 1K3FA 1VMKA 4QFBA 2A0XA 1T8SA 1Q1GA 1WTAA 3KHSA 1PKEA 1U1GA 1PF7E 3E9RA 1U1DA 2BSXA 1LX7A 4H1TA 4G8JA 4QASA 1VHJA 4NSNA 4QATA 3OZDA 4DARA 4D9HA 4WKOA 3ONVA 3UT6A 3KVYA 3PNSA 2XRFA 3K8OE 4TXLA 5ETJA 1ODJA 4UC0A 1Z5NA 4PNPA 1ZL2A 3OZEA 3OF3A 3SCZA 4TXMA 1RSZA 3UAYA 1Z34A 5IFKA 1Y1QA 5KB3A 3F8WA 2IQ5A 1YBFA 4D98A 3QPBA 4OJTA 4TYMA 1T8YA 5CXQA 3DJFA 3OPVA 2OC9A 5F7XA 1JE0A 1OV6A 1PW7A 3KUKA 3OOEA 1ODIA 1T8WA 1ZOSA 3IOMA 1FXUA 1RR6A 1NC1A 1U1FA 1PR2A 4OGLA 2I8AA 5F7OA 4L0MA
chains in the Genus database with same CATH superfamily
5B6PA 3DS8A 1IQPA 3FCOA 3G2LA 4M8NE 1NY5A 1ZH2A 4IIGA 4O3FA 2WKWA 1UK7A 1AT1A 2Z6UA 2IXFA 5JH7A 2XVAA 3K9HA 4RKQA 5TEVA 4AIIA 3OY2A 2D0IA 3LA8A 3A0RB 2SCUB 1U7XA 1YOVA 1JQKA 5CCDA 4A3SA 2QXUA 1DEOA 2J32A 2V7QA 1P1BA 3IGFA 1XU7A 4JR2A 3URKA 3TEMA 1DWOA 4LZWA 2H9AA 4NOKA 3G8DA 1JBQA 1GQYA 1K97A 1NUSA 4HXYA 3OJXA 5J58A 1WXQA 3HXTA 2FN7A 2H5LA 1MO5A 1EVQA 1F38A 2W6NA 3K9LA 4X8OA 4RTNA 3KETA 4YB8A 4KE8A 1EA7A 3HPRA 2W2QA 3WNBA 2Y77A 4NKRA 2VNAA 1XLWA 2ZYIA 4JITA 3WZMA 3U3DA 2XX3A 3N6XA 3ZE7A 3DF7A 2TSYB 5A9TA 3ESAA 3AIKA 4RKRA 2R6AA 5CFZA 4GNRA 1A96A 2B4YA 3M70A 2QNBA 4Q4JB 5ICFA 3WGJA 3ER8A 2QP3A 3NR2A 2J48A 3N0TA 4K9MA 5DRTA 4EYEA 1BJRE 3GLIB 1Z82A 4XQEA 1X1AA 1H8ED 1JX6A 3EEYA 3FYDA 3ZWDA 2FMIA 4H1HA 2QS9A 4DLNA 2J3MA 2CXHA 1QONA 2B94A 4AG6A 4S1OA 2AN5A 2L18A 4D81A 4AO8A 4PSKA 1WCXA 4R0VA 4AURA 4XWYA 2VDWA 5LWQA 2VAWA 3GUHA 3NB0A 2HNKA 4IDNA 4ZK2A 3CX8A 2VL7A 2V6FA 1TK9A 3PTLA 1C5KA 1NVBA 2ZIWB 3VRHA 3BZBA 5HR5A 3JQGB 3L4BC 2UKDA 4OIMA 5HJ2A 3I61A 5DYTA 2IS4A 1EVIA 4ZCTA 1RWXA 1TIBA 2PS3A 2PGNA 7GPBA 1YACA 1XSEA 4NS1A 4RF2A 4EF4A 1KORA 4Q3EA 5L40A 4IZHA 3KQHA 3QX3A 3HUDA 4F71A 1GU7A 4WZ6A 4B6RA 2YS7A 5FADA 1ESZA 2C92A 5G1NA 2M32A 2QV0A 5H02A 1GAXA 2F8TA 3FGOA 5EOVA 5C9ZA 2UZ1B 4YAGA 4TT3D 1O9HA 1Q83A 1YZNA 1T5HX 3RSSA 2G83A 3K94A 2EHJA 2C3YA 2XXJA 2Q9UA 2ZSUA 1KBOA 1LF5A 2GLUA 2OL4A 3C1AA 2B92A 2MJLA 5DDIP 7ADHA 1TCVA 4MHSA 2XT6A 4CL8A 5DVZA 4JYAB 4I50A 3KKOA 1P2TA 3WI7A 2ONJA 2MTBA 2O7SA 2YV4A 4D44A 5IAKA 2OXTA 2C8LA 2WJPA 1SBHA 5EJFA 1TIPA 2R2GA 2OYRA 1CUGA 3TQSA 1DFIA 3R3WA 1OAKA 2P9HA 4R1LA 4YVFA 4YRPA 4ZVMA 5IBRA 3RBZA 3EQZA 3RIEA 2WI8A 4XGQA 3H3FA 1L8XA 4C0KA 4ENTA 1NYLA 2WG2A 3GAZA 2C95A 4HNTA 1M8FA 2P9BA 3D81A 3SD7A 2B8TA 2PGOA 1W0KA 3WJ7A 3Q7SA 1EINA 3ZIUA 2K87A 2PGLA 1CJTC 2Y0CA 2YV5A 4X66B 2GMWA 6NULA 1BXKA 3ELBA 5GTDA 4K9KA 4QELA 4ODIA 3EQ2A 2X19A 1M76A 2M2IA 4NATA 3P7MA 1LNQA 3FSEA 1ODSA 4C76A 3THWB 2L42A 5D5PA 4QBKA 4U9HS 4F04A 5FOVA 5G4KB 3H7AA 4D8WA 4RJTA 4YJ3A 3VYRB 1U2DA 4W4TA 5CXXA 5ELLA 4MIEA 4EIWA 3OKCA 3AHCA 3BTSA 1T34A 3NOOA 4L3WA 1Z06A 3GCWA 4INZA 1U8UA 2HSDA 3VYSB 3NDBB 4X54A 3N9IA 5AJZA 3D3KA 4UUOA 3VSBA 2GHIA 1ZL0A 1VSUA 2IXDA 4HQKA 4WQMA 4FB5A 1E5LA 5ENVA 3BMOB 3VC3A 1MOSA 2XE7A 4CFSA 1E9DA 4NULA 4GP7A 4QULA 2H17A 1V6AA 2QMYA 4H59A 3SZMA 3IP1A 3RS8A 2B8EA 4C4OA 4EYKA 1NKTA 1GZDA 3KE9A 3UA3A 4DCVA 1UEIA 1N2ZA 1TZJA 4GE3A 4DR6B 3A4YA 4DIKA 4XIJA 5EHGA 1DQYA 1LDBA 1E3WA 4MCIA 1N0IA 2B35A 2IYLD 3B7WA 2B7LA 1U2SA 1E9RA 2HPVA 2J09A 2HA5A 3O2NA 4G8BA 4UUMA 1SXGA 1FRZA 4QVGA 3LFTA 1AKTA 5FPSA 1V8FA 1PL7A 5JSKA 4CHTA 4EB6A 1MGPA 3JV7A 5IP5A 4I1RA 4E5KA 4F96A 2NZ2A 1AMOA 1X15A 2PFKA 5CLIA 4MICA 2LW7A 4RXMA 1SCIA 1ZC3A 3E9NA 1U7UA 4W7IA 3V80A 3GXBA 5C1PA 4ER5A 4P3XA 1U8FO 2CLFB 2ZU6A 1V11A 1VE5A 4N3GA 1VB3A 3PE4A 4QPZA 3TMYA 1UJBA 2JLZA 4EH1A 3C3WA 1R9JA 1SXJD 3B13B 1TLLA 4R3NA 4RPKA 3UMRA 3PPVA 3NUGA 4JYCA 1M75A 2P4UA 5BQ5A 4FFOA 4BMXA 3ZD7A 1ZBQA 3P20A 1NBIA 1JFTA 2D74A 3SSOA 1JIJA 1L8LA 4YT2A 1Z0AA 3NFRA 2H2FA 3ZR4B 4Q12A 1W36D 3BYZA 4A6DA 1USWA 2ISSD 1X3SA 5IAAA 3A2LA 2CHQA 2XQKA 2FZLA 4P4SB 2AFRA 2BHLA 4LV5B 4MX8A 3PQFA 2JH9A 4H31A 3KVVA 1S2NA 4CN9A 3FN4A 5IABA 2EV9A 3ROQA 4JBYA 5HQTA 4YFYA 2E87A 3WLLA 4YAKA 3Q1KA 4YT8A 2JIZD 1OH8A 1WMDA 4A16A 3A28A 3ZDDA 1G63A 1G6HA 3SKVA 2HO4A 4R16A 3TOVA 4B2PA 4UUQA 2C7RA 1FFBA 3I5XA 1NZJA 1Z17A 3CX6A 4X3OA 2X0KA 1ODFA 1XQYA 3OOSA 2RHJA 1OA0A 1CB0A 3WHKA 2X3YA 5EZYB 3VR3A 2PS0A 3HY4A 2ICAA 4FYKA 3MWJA 1NMSA 2I66A 2KYRA 4N9QA 1AA9A 2BGTA 3BRSA 7YASA 5I5GA 1JP7A 1XQ6A 5K09A 2NM0A 421PA 1ONPA 4FNMA 2GBIA 1ZOPA 1NN0A 1Z4MA 2VSQA 4QUDA 3QYJA 2FE4A 4JVOA 1MJ5A 5F7JA 1V4BA 3H1TA 3TZQA 4MV5A 3QBVA 3NH6A 3K1TA 4K6OA 3D3EA 3L1JA 5DBGA 1CZKA 2JPDA 1IY9A 1CUAA 3AETA 3GZNA 2OMKA 4PLTA 3UH0A 4ETWA 1RC1A 1YJXA 2D8AA 2G70A 1DAGA 4NAHA 1RRKA 4YRGA 1E1QD 1T1IA 1QIMA 3GVCA 1GGKA 1PDOA 1CJVC 2JJ1A 1G21A 4J0JA 4QYSA 3SZUA 3K09C 1PO7A 4MJ3A 3AP3A 2C8JA 3SBEA 1OXMA 3ZWXA 5JAHA 4BU0A 2NSHA 1Z6YA 2Y1WA 3OZUA 1PJCA 3JR3A 3U4IA 3B7PA 2F67A 4RHEA 4S05A 5ERXA 1T0IA 4D97A 1C30A 2G3YA 4GI3A 3SE0A 2OFPA 5EXTA 2VPYA 4PCLA 3U3XA 5HS4A 1ULTA 5JNWA 5DM0A 4LUCA 3DLHA 3UJ9A 1CQJA 4ATNA 3R7WA 3WWEA 5K4HA 3DTNA 3ZY6A 2JEOA 1U5BB 4KFUA 1E6CA 1N9GA 1L5NA 4QKQA 5KDDA 2X2EA 4ZOLA 5HJ7A 4R1OA 1CNEA 2W42A 4PRZA 1VLHA 2IKQA 3JARB 2OGSA 1ZY2A 3DEZA 3UPDA 1QOPB 4CF4A 2PKQP 1CR4A 3RUFA 1ABBA 3KVRA 1IOWA 2QZPA 2FN9A 1BA3A 3I53A 5ALNA 1WEKA 3LUFA 1VB5A 3AERB 3VU3A 3NXSA 4C9BA 621PA 1HE4A 2ZQYA 3DOCA 5EHNA 3W34A 5DM60 1FDIA 2D2FA 1MB3A 1D7AA 1DI0A 3B2EA 3DDWA 1FNCA 3CONA 3QKRB 2I71A 2PX5A 3DB2A 2OKCA 1IWOA 2OSBA 3BE5A 3DEAA 3JQ6A 3NTOA 4LXXA 1QCCA 4D3ZA 5A0TA 2D0PB 1HFWA 3KZCA 2K2WA 3NYIA 2C97A 2QM0A 1UM9A 1IY0A 2QZ4A 3GJ0A 1IB0A 1THTA 2EJTA 3R3VA 5FLYA 3ZHTA 4C08A 4LWPA 4UE6A 1Y8RB 2J5QA 2PA0A 1M73E 3DZJA 2QBYB 1M1UA 2D5BA 4HP8A 2J33A 3FCYA 5DEOA 1U9CA 3FWKA 5B57C 5E7IA 1K8XB 1XRQA 1IXKA 5H3CA 4E70A 1GPJA 4OXXA 1T5SA 4CKEB 4HFJA 1NUTA 4M8LA 3UKJA 3DVSX 1AV7A 4MW4A 4NE2A 5TARA 3ZHUA 1HTBA 5L3SA 4Q9LA 2YWHA 3SOZA 3WYGA 2K7FA 3MWEB 5IAGA 3ZI4A 2YQZA 4OXRA 5JARA 2CDRA 4GBED 1G3UA 2R96A 2YHUA 2QMEA 3N74A 2CWDA 1XR3A 4ZQEA 4AWBA 2E2WA 1S3IA 3RFFA 1T5LA 4LYGA 3E15A 3HM2A 2ZB3A 1EVZA 2D4HA 3CF0A 3GB9A 1FF9A 2R8YA 4GWLA 2DEUA 2VCEA 1OCEA 2NU6A 2NXCA 4RD4A 3RYFA 2HQ1A 3P2IA 3ONEA 2PSEA 2IE0A 2NN3C 3QNMA 4Q3BA 3A32A 1NNEA 3RVDA 5B7QA 3WISA 3W8FA 4BV9A 2J6CA 1Y9ZA 2NXJA 2P67A 4FONA 3H4MA 1HE2A 5CHYA 2FY8A 4MRRA 4HNAA 4I3HA 2GSWA 1YE3A 4C06A 2IYQA 1QTRA 3TAUA 4G3XA 3BA6A 1TM1E 2PTHA 4D45A 3DLTA 3MPUA 4ZYVA 3RS3A 1THZA 1AMNA 3JVDA 3T3DA 2B5OA 2G9ZA 2ZIGA 1JR3D 2HSEA 2GKGA 2JA2A 2W98A 4RD6A 2VG8A 2AD5A 3E35A 4MEAA 4B7AA 4ZU1X 1GU0A 1F9AA 2AFHB 2BUAA 4ZZ2A 5K1ZA 1AKYA 1WCV1 4EP1A 3NHRA 5JAPA 2R8ZA 5FBWB 1UJCA 2JFZA 4A23A 1ZW1A 1V4NA 1NJFA 4JEUA 2OZKA 4MWEA 4A4DA 1FDSA 4EARA 1I3KA 2W70A 1XO1A 1GSAA 1I5OA 4X63A 1YULA 5BSTA 2P77A 1IU9A 3WRWA 1XTZA 1A82A 1H3EA 4BNHA 4F4HA 3WX0A 5AHRA 3OZCA 2YC4C 4WIAA 3CCFA 3MCAA 5IEJA 2DKFA 1WULS 2R79A 1KOLA 3DVRX 4NMXB 2IQIA 2YMLA 1YAJA 1H1LB 3AT1A 1UM8A 3E9CA 2CNBA 3W8RA 2ZYSA 1JIXA 4HQRA 4NJMB 1WF6A 4MVJF 5EMMA 1M2EA 2WMDA 5JSYA 2JAXA 3PX2A 3UVEA 4XDHA 4RAQA 2A4KA 2IEGA 5CVTA 2YZ7A 3ORSA 2DUMA 4UVIA 5AK0A 4FHFA 3NANA 4F3RA 4FE7A 2P68A 2QF7A 1LNSA 5C2JB 4GGPA 4EAQA 3O75A 4F8YA 2GAFA 2LPMA 4KWIA 2DLNA 4GRIA 3U4GA 3BGWA 3UW1A 1YTUA 3MGCA 1W4BA 2B21A 1KI9A 1K3FA 4PC2A 4QUAA 3RKSA 1VMKA 1XVTA 3MBKA 4AW9A 2IYFA 3IPLA 3HABA 1PFYA 3PXCX 3RVKA 2OLKA 4A03A 3FRIA 4LW8A 1V71A 2O23A 5D7NA 4FI3C 1ZK1A 4EPVA 2ZIXB 4OSPA 1QAQA 4M7RA 4YALA 5ITZB 4NBTA 3GRUA 1G21E 2B6HA 2GRJA 4MW0A 1ZSYA 3I64A 3NBXX 3K0CC 3R9IA 3RVQA 1W94A 3KWJA 1H22A 3OD5A 3OZSA 1QUFA 2GEVA 4R84A 1PGOA 2CHGA 2HHHB 4DRXB 1JYEA 1XQWA 4GOXA 3SXUA 3BWYA 1XLTC 3L0IB 3C5WP 5FPYA 3BRWD 2XT0A 2GFIA 4XD2A 4RTSA 1ZI6A 4FWIB 4RD2A 4H4EA 1LPOA 2TECE 1BVYF 1XTRA 4PHCA 4Q6WA 5AKYA 3K8OE 3LDFA 1AHHA 3QIVA 2HA3A 3AYZB 4PPQA 4L2IA 2ECQA 2GDJA 4R69A 3DVQX 4RJLA 3UJ6A 2C7QA 1AY0A 1UMDA 2ZJ3A 1FSFA 2VN8A 3VDQA 3ZZUA 1HZZA 5CUQA 4ZCIA 2PMBA 4JLSA 4WA7A 3O8OA 3IDOA 3PQEA 3PFGA 3H17A 1IZYA 1Y1QA 4UQOA 2CEKA 2C8KA 3FI9A 3GC6A 3O8DA 3SX0A 3FHTA 1VL6A 2YW9A 3GYGA 4NDZA 3B51X 4LC9A 4WCFA 4MWOA 3DMDA 3AM1A 4QDXA 3UCEA 4BBAA 4FCTA 1R74A 4FMCB 2WIAA 4JXZA 1TKAA 3UOWA 2R00A 1NE2A 2J3EA 4QVIA 3IAUA 3T4XA 5AKKA 3SLRA 2ADMA 1LI4A 3CNBA 3TIFA 3CVOA 4AWXA 4AZ3B 2HFKA 3DJYA 3WB2A 1L7DA 5F7XA 3RVNA 3I5MA 5JXGA 1UBCA 3WK8A 2QI9F 2X0JA 1FBTA 1V2GA 2QN6A 5GY7A 4RPGA 3NIFB 3KSUA 2ZJOA 1HM5A 3ZI7A 5TY0A 5K0GA 1P1RA 4FMDF 2PKQO 4X92A 1SC4A 5L8VA 5A0VA 3OQHA 3FNEA 1MEOA 4OFWA 3HB5X 3E84A 1BAPA 4A73A 5DT2A 1CZLA 3IILA 5IYZA 3WB1A 5C8VA 2FGJA 3UA4A 4LMPA 2VP4A 4RELA 5HKBA 3ZE8A 2OK7A 4NCJA 1NMQA 1CF2O 3LQ2A 1XMIA 3FNGA 4QC2A 4ZA2A 5GGXA 2F3UA 4V24A 2ERYA 2CKDA 2ZBEA 1GNRA 2IYPA 1JQ5A 1Y6FA 2I6SA 3IUNA 1JEDA 1MNAA 4I4TF 3CRNA 4XX0B 4E88A 3S2ZA 2V4UA 2ERCA 1NW9B 2AZTA 1CY8A 4PIPA 5D1NA 4TT8A 2WP8J 2W93A 2IRWA 3LW7A 4LSGA 2WTEA 4DIEA 3K96A 4QVKA 2KQUA 3A1NA 1M2JA 2IHTA 3BKWA 4NRDA 1OREA 3L8HA 4QODA 3IEKA 3CW2A 1UDBA 2VAVA 5AVRA 5DBFA 1Q3TA 2BGMA 1LLCA 1I01A 1G4HA 3JPWA 1VJRA 3L8MA 5G02A 1VI6A 4DQKA 1C3VA 1EWYA 1HOTA 3FGPA 3L93A 4PIMA 4Z6KA 1QLWA 4KR7A 3QX8A 1DIRA 1W2HA 4FR5A 1YK1A 3HDYA 4D4IA 2Y8EA 5M34A 4Q9AA 4MQ5A 4CMEA 1YTLA 4X7MA 5ARCA 1WEHA 1C1XB 1WQ4A 4GI5A 5EYPA 1XKLA 2BGKA 3MC1A 2G9VA 1U1EA 1A7KA 2AWOA 2CHUA 1Q0RA 4TTVA 4LDPA 3R3ZA 5DTJA 3VTZA 1V9LA 4WBNA 4M37A 4TS3A 3HYCA 1CF9A 1T2VA 2GZRA 2QJWA 2RG7A 3KSBC 4A0SA 4P36A 4REQA 4ZVNA 4B3GA 2B1IA 2ODQA 4FKBA 5A4AA 2CJXA 1JSLA 4KGXA 2ZJ0A 3R5FA 4FHZA 5ALHA 4FYIA 1A7UA 3AZOA 4ARBA 3WGQA 2NSDA 3ORYA 5IFLA 4EHNA 1XKTA 1ZGAA 5AMXA 4O4HF 1YAHA 3D4LA 1FDRA 5LBIA 5KTSA 4ZMRA 2AC2A 2A0FA 3QBEA 4D8XA 5AKHA 4DLLA 1U80A 1EDBA 1U2RA 1X7XB 3QWIA 1V8ZA 5B1DA 2I7TA 4KOEC 5B7GA 1PWHA 5FUWA 1KO8A 1SBTA 2VPQA 4IZIA 3Q3IA 4FTWA 1U5AA 2LDBA 3T41A 2JASA 1I1QB 2GCOB 4MR7B 4O4IB 1EE9A 1YB7A 4JVLA 3VHXB 4BKMA 4QRHA 3C3JA 2BW0A 1D6NA 1HWYA 1KEZA 4F2WA 4WOCA 3X1WA 2XCIA 4YXFA 1RMQA 4R6WA 4ZVKA 3UG7A 3UT0A 1VKNA 2C78A 2FP3A 2NUAB 5DLDA 1KI6A 1CQIA 2PGJA 4ND8B 5FD8A 5K8JB 4RANA 2NTYC 1G8YA 2VLBA 4DG5A 1MOQA 3U13A 2GXUA 1I3CA 4TYYA 3FB4A 3KR1A 5K0CA 5U4XA 4G25A 1Y4UA 5JCZA 1KFKB 1KIAA 1POXA 4LISA 4PFSA 2XADA 4HH3C 4UNSA 3R7DA 4YV0A 1H94A 5MGNA 2ZRHA 2ATCA 4JOBA 4Y6SA 1ZITA 4CR7A 3AR3A 2EL9A 1MH1A 5HDBB 1XIVA 2C2MA 4TTJA 1CUCA 4YEDA 5A9RA 3QX9A 4LE0A 4OX9Y 3ZBUA 3RVSA 3ICCA 4QXMA 4UQPA 1Y3CE 1E5QA 5LZ7A 4ALNA 4QM7A 4Y9RA 3TLZA 3ENKA 4TSFD 1V47A 3JXEA 4II3A 4YUAA 1UFRA 3VHQA 1YQTA 3PCRB 1D0SA 4JL8A 4HDSA 4MQMA 1JDBC 2AJLI 4NCKA 3VAAA 2FMFA 1UMBB 4IR7A 2OO5A 2UUCB 4GM1A 1GSOA 1OWPA 1YQXA 1MVNA 3A1FA 3GT0A 3N2IA 2ZJFA 1NLMA 1E8DA 2ABWA 2AS0A 2C31A 1HTWA 2QZ9A 3GGOA 1MRSA 1A0OA 3B3QA 5B3JC 2VBGA 2VTBB 3C1UA 2PUVA 3LOQA 1OHHD 4XLTA 1Z36A 1T0PA 2PM8A 1ODTC 1Y5NA 3DCNA 3DQPA 3H5TA 4L5YA 4O4JB 1VP9A 1HG1A 3OPNA 3QF4A 4NWIA 4QUKA 1X8LA 1K27A 1XWWA 2FWNA 3H2YA 1ENZA 2NWQA 3N1UA 3TW6A 2OUIA 3V4SA 1I2CA 3WRXC 5JHHB 1X87A 1VPTA 1DQPA 4BFVA 5A4FS 2EKPA 1L4YA 3IT2A 3H2SA 3LUDA 4HPWA 3LF2A 1P6XA 2HQBA 4EMBA 3LVFO 2ZE6A 3QBTA 4LDQA 4B3JA 3P2OA 4F2PA 5DBIA 1ZCFA 2X0IA 4NJOA 4OGKA 1RD4A 4KPGA 3NBQA 4ZODA 4YONB 4DRZA 4YP0A 1PD1A 1JJBA 4IOKA 1P31A 1KHTA 2Q5LA 3RT9A 3VC1A 5A3JA 1P7VA 5FWYB 5IUKC 3UJDA 4X6UA 4EY5A 4KXMA 5SZHB 3WWCA 4BO5A 1QB7A 1LFAA 2YXPX 2FEXA 2OPBA 3PUKA 5K3DA 1YCDA 2OC4A 1VHTA 2BFBB 2DJ5A 1QRSA 4F8EA 1F0PA 5L3RA 3U1VA 3RYHA 3CINA 4LHEA 1VHQA 2EX1A 3TXXA 1DKPA 2IXAA 2FDCA 3AL0C 3SY8A 2P65A 2IXBA 5CX1A 5C5DA 4CEIB 1X1RA 1P0PA 2Q3HA 4LJSA 3U1TA 4DG9A 2Q3BA 3SG0A 4YMWA 2B1GA 3BK7A 1EDOA 4WXRA 2FSSA 1R1DA 1Q92A 5K0LA 2AHRA 1J8FA 3CN9A 1VYTA 1NOIA 2RGGA 2EZ9A 4IICA 1OPRA 4RA6A 3RD5A 1I30A 3H8WA 1U7TA 2FQWA 3EZ7A 1V3TA 4D0NA 1NXQA 1NIPA 2HJGA 2OP0A 4S12A 5FEMA 2ZEJA 4P0PB 3OQBA 4IINA 3EMVA 3RS0A 1VQ1A 4FILA 1YVRA 3OKFA 5TQ0A 1Q12A 2WU4A 1GNSA 1F4LA 4JBNA 3E6AA 3WNZA 4CGYA 2FX3A 3GGDA 4E2WA 5JNLA 4UJ3A 3UB3A 4B8WA 2ISCA 2CBZA 4LFBB 1FMJA 3M9WA 2PQ2A 3ND6A 3OCZA 4J94A 1PKXA 1G5QA 4QXRA 3RUAA 1USIA 3DAYA 1IMJA 3IV7A 3N2EA 1V2HE 2Y1OA 4M1QA 1GUYA 2M9MA 1JF8A 1D2NA 2VHXA 4U3JA 2FN4A 3IMFA 1SB8A 1Y9JA 1EVLA 1AH2A 2NVUA 5DMHA 3D8UA 3HRIA 4B2YA 2I8LA 4Q37A 4AJKA 2XMSA 3SNKA 3Q9NA 1NPDA 5EZSA 5CFRA 3PNLA 3TZEA 2GUGA 4KNVA 1LF0A 2I4MA 4PQRA 5ERYA 5CG2A 2DPMA 2BH9A 4CI9A 1T4BA 4FHDA 5KQGA 2BM0A 3QOXA 4LIPD 2LR0A 2WPNA 2PDAA 3GFQA 4TMVA 1YR6A 2R1UA 1TJ3A 4ISCA 1RLMA 1VLLA 3K9WA 3B8HA 1DARA 4MW1A 2XUKA 4NBUA 2NT4A 3A05A 3D6AA 3H65A 1NBEA 4OBXA 5F12A 3T54A 3ZUGA 8GPBA 4M3NA 3PNPA 3JQ9A 4N5LA 5BMOA 3K0SA 3VZRA 2WOOA 1DPFA 3BS4A 1XDGA 9ATCA 1PZMA 2FMKA 3SQMA 3UKDA 1QQ6A 3ED1A 2WUEA 2FW8A 4QOSA 3EWSA 4H7PA 3T94A 2JRCA 3L5KA 1MIHA 4JCOA 2XUAA 1R15A 3ADOA 1O94C 4UTOA 4X8HA 4Y1EA 3QPCA 4WERA 3DMTA 4AP9A 4RDXA 5ES4B 2I91A 5AOVA 1M72A 1VJ1A 3S5JA 1XD2B 3AI2A 5JNTA 1IHXA 2GNOA 3GJ5A 1JN0A 1MX9A 4MQUA 5DHAA 3RTBA 4F6RB 1SUDA 3FAZA 4KWHA 1EP1B 4LRWA 3TPZA 1XYYA 4V2IA 5DIZA 3FLMA 3TTXA 2BZ1A 4KH0A 4HGRA 4QHYA 4D0SA 3WLRA 1FU7A 1KY3A 3LM8A 4RV4A 3ZTTA 2I7DA 1D4OA 4FUQA 3ZHCA 3H1BA 2X5OA 2XJ9A 5I7SA 1P9RA 3I73A 4GX5A 5T3YA 2FFBA 2IYNA 3CTPA 7REQA 3NC0C 1VE1A 1WXEA 5T6MA 1CFJA 1NY6A 2BTEA 2H65A 1Y3BE 3MQFA 4HFRA 5BQFA 4B4DA 3WLSA 3AY0A 2HLPA 4OXIA 4RVUA 3BE6A 3RB8A 3SS7X 4ARUA 2HRQA 1EQ2A 1WMSA 3IJEB 2ODPA 4C4SA 2QLLA 2VRNA 1SEVA 3T3NA 3RC2A 2E21A 3MJ4A 3ILYA 3SS9X 3BFVA 2PUAA 2DB3A 3T5BA 3IAAA 1N33B 3MRXA 4KXVA 2OCIA 3FPBA 1NONA 2YJZA 5AI4A 2ZSIA 3ETGA 2GUWA 1N1DA 2QGZA 2VHZA 1VLVA 1JLKA 3F4LA 5SY4A 2XF8A 1YS6A 3L0YA 1VDMA 3BXXA 1PG2A 2CJPA 3D8RA 1OI3A 3DFKA 1QZUA 3H11B 5DP1A 5F2OA 3WFJA 1L6IA 4YQFA 1EHCA 2W37A 3GLHE 1SOWA 4N5MA 3O8NA 1DTWA 2OV6A 4GL2A 1RYDA 3H3XA 4MMYB 4HS9A 5KYKA 3K9FC 1VSBA 6ABPA 1PZNA 1D09A 2DH5A 1LRKA 1WXFA 1FOEB 4XJTA 5JANA 2EATA 2RAPA 4G0VA 4PG7A 5HBRA 1DCMA 2B1JA 1UWVA 4L8YA 2DHDA 1XBTA 4I14A 2Z5GA 3KVOA 3IX7A 1ULUA 5JWOA 4AO7A 2B69A 3TRFA 3ELDA 4DBLC 4O2BB 3ZXYA 4BMDA 1D2HA 3W5BA 5DOVA 4R3UC 4KQMA 4JOQA 1YUBA 1NU8A 2CKMA 4KITB 3EC2A 3OP4A 5L6MB 3KFLA 3C3EA 3E2MA 4QBIA 2PMFA 1TJYA 3FPJA 4YN3A 5DW3A 4B33A 4YMHA 4GRAA 1WCIA 1B0AA 3FSRA 3W9SA 4QAJA 4YV1A 3W7AA 3ZYZA 1UJMA 2HDNB 4IGKA 3U5ZB 1QH8A 5MGBA 1ABFA 1EFDN 1CQPA 1QZTA 2XYHA 1W93A 2BMDA 1PN3A 5DHFA 2X6TA 1O89A 1VBKA 3CLSD 1XHFA 1S9HA 3FCXA 1U7ZA 4LVNA 4LF5B 3G17A 3KD2A 2FZ4A 4P4UA 3GD7A 5LP6B 3D59A 4Z9AA 1RKXA 1X9HA 1YJAA 3KUXA 4NF2A 4Y7DA 4JYMA 1NN3A 7MHTA 1RRVA 1ZAKA 4FDAA 2C4UA 4TXHA 4I6EA 1M67A 1E0KA 1I5EA 3SSMA 3N7AA 4DAEA 4H7HA 1ZOLA 3Q85A 1JH8A 2VYCA 4EJSC 1TJ4A 1J8DA 2IUTA 1GYPA 1O7JA 4WHMA 4U5XA 1QSGA 1NBWB 1JXQA 3D9QX 2HA6A 5TQVA 2O3UA 3MOSA 1W4ZA 1X6VA 2XMDA 4XCXA 2X5JO 1JSRA 5AO9A 1X70A 3OE5A 1ORHA 1EFPA 2FCAA 4KDCA 3R9KA 1KAMA 1KQFA 5CEJA 2O05A 3ZDQA 4FFPA 4V3CA 5KYNA 1YRQA 3OQJA 4N5NA 3U39A 2IUUA 3DHYA 4E4TA 3EG5A 3BK1A 4BX8A 4IDDA 1Q3HA 2P91A 5CR9A 5D3MB 1WU7A 2NU9B 5EJ9A 5F5LA 5TGDA 1SWVA 1OT3A 1CRWG 4F9GA 3W3AA 1BEUB 1U02A 1C7RA 4NENB 2XNDD 3SR3A 3FMVA 1LV8A 5BR8B 5L3QB 4DSNA 1KEEA 2R1TB 1JFFA 1RBYA 1NAIA 2JI9A 3LLVA 1Z25A 4X7RA 2P7HA 3EVNA 4JJFA 1UXOA 3REFA 2P11A 1PAUA 3KT3A 3T1QA 3OLWA 4HQFA 2VZLA 3CX3A 2ZBFA 3UJNA 4ZYTA 1BMDA 3Q8KA 1PQ4A 1PV2A 4JP3A 5M5BA 3N07A 3T9FA 2DQYA 2DSNA 3LY9A 4FYPA 3VH3A 3K71B 3UNXA 3PFWO 3RS9A 3O7MA 1E61A 1EK1A 1BJKA 3OQVA 3THYB 5LQKA 1Z4PX 4QUHA 2QLNA 3Q2OA 4PN7A 3JQAB 4NSNA 4QATA 4NABA 1GZSA 1SCQA 1ZRNA 2BFFA 2WTMA 4W1PA 1GQRA 3TNDA 1BIFA 3KDSE 4K0KB 2HTEA 3W5VA 2AFVA 4C6HA 1JJIA 2KSQA 2YN4A 1HT1E 1SNYA 4FOSA 1DQSA 4Q01A 3HKCB 4YR7A 4EQZA 1Z88A 4K9PA 2PLRA 1PL0A 3QX7A 5IUJC 2C2WA 1YMVA 3E3MA 1N8TA 2VBIA 3MS2A 2V4MA 2ZR8A 2BDUA 2H7XA 4KFRA 3RCBA 4NAVA 2PZ8A 3SF0A 4GZMA 2QN8A 2EZUA 4GUAA 4OAOA 3E7WA 3LS2A 3CA8A 2IHYA 3WK4A 1NMYA 2PUEA 1LJUA 1NV9A 1TVMA 3ZLBA 1YCGA 4OOEA 1NUQA 3Q2KA 3ROEA 4Q4HB 3OOJA 3L6BA 4UM7A 4MVJH 1HPLA 1BW9B 5FOTA 3EIFA 2O2JA 1N6IA 3JW8A 3RSCA 2JZNA 5GM1A 2ZVJA 5BT9A 1V8OA 2BMFA 1JHAA 4KXNA 5AH0A 3T7JA 5ADWA 1AF4A 4CMBA 3MWDB 4OB8A 1DKNA 1T8YA 1J8QA 1O97D 2XQFA 1W49A 3BTVA 3MJEA 3AFOA 4YDRA 3HU1A 4NDNE 3T99A 3TLAA 5F23A 3QZUA 3FZGA 5CLGA 3ICOA 1QH1A 2A58A 2CLMB 4YCJA 2WFAA 4BB5A 1VJDA 3AW8A 4M1TA 3GEGA 3DAFA 3BGOS 5AQ1A 3C1TA 1K63A 3SLKA 4KRXA 2Y05A 4E33A 2QVGA 1CUZA 4EGSA 5LR6A 3BD6A 1IJFA 2XQIA 4KU4A 2JHGA 1A97A 4EJ2A 1GOTA 3OTQA 4I1IA 4MWDA 5K6RA 4B73A 4NEGA 4ZI5A 3E0QA 5IN5A 4NU8X 3BXFA 4XCVA 4FB4A 3QHAA 2JI4A 1J0CA 2IPOA 4O1HA 3UMCA 3QRWA 4J43A 3AONB 3BH0A 3EFHA 2EIXA 2BKAA 1SC9A 3DFZA 5KDLA 3CJRA 4S35A 1KDVA 1P91A 3W77A 3SZRA 5I7OA 1EB9A 5HIKA 3PD7A 2ID9A 1U98A 4F3NA 1GZ3A 4JI5B 4X85A 1WCYA 3RBXA 2ZRLA 4GMFA 4AF7A 3RWOA 3ABZA 3V1YA 1RACA 4ZGBA 3RU7A 1ZFNA 4IKOA 3KXLA 5GVSA 4LDZA 3ZIAD 3RVPA 2V3VA 4EF6A 2J0UA 2XUIA 3LDHA 2GJSA 2IS1A 1E79D 1ZWLA 4TWZA 2H7YA 4I3FA 2J45A 2J4CA 5DHRA 2BI8A 4K2AA 5FOSA 4IYJA 5E3HA 4C6TA 5CLJA 2XNHA 1G55A 4LRTB 2R6GA 1XUOA 2JGKA 4QAQA 3T3OA 5ADVA 3TQTA 4R2XA 2HTFA 5K03A 3CSDA 1JTEA 1S96A 1V6SA 2Q4EA 4L51A 3DMGA 1OYYA 2VYVD 1X7DA 3L7DA 2YXLA 4V0KA 4FUTA 2B30A 1ELOA 4HYYA 4GRDA 5F64A 3TRHA 1WSWA 2YIDA 3Q8XB 1MUUA 3OCWA 2ZYVX 3DCYA 4KRYA 3P19A 3HWX1 1U7HA 4MYSA 5F1OA 5CFNA 1KDOA 4HDMB 5IBCA 1QAMA 3G9TA 3LWNA 2Y1GA 1GM5A 1OU4A 3FHLA 4K0RA 3AILA 3DGFC 2FEAA 2DFKB 2YMPA 3MLBA 1GPUA 1G0OA 4B6GA 2AXPA 2X15A 1SKBA 3GV0A 3IXQA 3KWMA 4HYQA 4MR8B 4TMZA 5FR1A 2XVMA 3DZDA 9GPBA 3PG5A 5CDSA 1KEVA 1GKUB 5KBYA 1E1CB 2I03A 3ZZ0A 4B84A 4PZPA 1ZZEA 5LXTF 3SYKA 2WPDD 3E9YA 1QMPA 3P27A 4LXYA 3I04M 2W2MA 3L7JA 4D4KA 1W9MA 4WDRA 2QLBA 2E18A 2J6HA 4ZHQB 1E3LA 1OT5A 3E23A 2JFOA 2ZSBA 2Z8YA 2Z83A 5AICA 1KI7A 3AUAA 1GQQA 2EQAA 4TWAA 3JU3A 1E0JA 3ZDCA 1FDTA 2NZJA 1UINA 1W73A 3GVIA 2UVPB 2GO1A 4ENWA 1QBKC 3G79A 3VV2A 4URXR 1QG2A 1X0XA 2AT1A 1GDDA 3FFBA 3L8EA 1YS7A 3ZGVA 3B6IA 3D0OA 2QXTA 4BVJA 5CFMA 2NU7B 2IU3A 3NKVA 4BBZA 1J0BA 1SJ9A 1ZN7A 2FMHA 2IHKA 2PCLA 2NNLD 2WM8A 2OYCA 3CEHA 1UDXA 1C7JA 3AUKA 3E61A 3JYQA 3QWHA 5EFOA 4E5YA 2I4RA 3V9AA 3R9XB 2Y0PA 4DCJA 3TTSA 4EG0A 3DHNA 5CW1A 3KOYA 1YL6A 3BJEA 1L3IA 2H1SA 2B8JA 3HEAA 2C2OA 1Y6RA 2XOKD 2GXSA 3D3WA 4R9SA 1P1IA 4DXDA 1Y6GA 2DFTA 4B3FX 5KX5A 1FUEA 5FUXA 3M2PA 3LL4A 3TE6A 1TMYA 4TLAA 5EUCA 2J8ZA 2R84A 1T4GA 2P5SA 3GLTA 3WJ2A 5A03A 3ON5A 4FSHA 4EEXA 2AJDA 2FZKA 3QPAA 1BQ4A 4WASA 4DPMA 4RKYA 4JR0A 3BMQB 4WVLA 3BRCA 1P72A 3MN1A 1WVGA 2FJUA 3QXSA 2ZM5A 5CDHA 1JB1A 4PYIA 5HZHA 4G41A 1X7GA 3HP1A 5JT1A 1W4LA 2R86A 1ACLA 3ZVKA 3RTAA 6REQA 2ZWAA 2XDYA 4B3MB 4OL0A 2QU8A 3K6RA 5ILOA 3LT2A 1RFGE 4IDAA 3H5NA 5HP4A 1M34B 2I54A 3H1AA 1TOAA 4OK5A 3R3UA 2FUG1 2WIDA 1NP7A 1LH0A 1OF1A 2RSLA 4KXLA 3WHIA 5DX1A 1OLSA 1N9ZA 1RFLA 1RLIA 2WYWA 4MRAA 2X0NA 2XUQA 3GPDG 1CUBA 1XVLA 4BO2A 2PZEA 4WNIA 1BX3A 1U6KA 4HWPA 4M4SA 4RW0A 2OOKA 3HXQA 2RB4A 4KWEA 1ZEMA 2AMFA 4IHJF 2VP0A 1KKUA 4HBGA 3T95A 4JBHA 1U9IA 3OIVA 1GKKA 1UADA 3OFND 1C9JA 3G49A 2EVWX 4P81A 3UEOA 1F9EA 1ZIPA 4KPUB 4K40A 2PMDA 3ZPXA 1ZR4A 3V33A 2I6UA 3ML1A 4U0KA 1WP9A 2D3WA 4UULA 3SU8A 1CEQA 1Y9EA 3KTAA 3AJ9A 4S1PA 2G72A 2IHVA 4RGQA 2WA2A 5T57A 2Z1DA 3K1YA 3SQOA 5JRDS 2E6KA 2E4AA 3DULA 2OCYC 3DBVO 1X92A 3HXPA 4CCYB 3KQUA 4JLKA 1PIWA 3PEVA 4DMRA 2IYEA 3PQ7A 2Q3JA 4X1OA 4EI2A 2B83A 4KO8A 3DF9A 5AM3A 3FIJA 1R4MB 1ZS9A 3DYBA 2XQJA 3FPSA 3PFFA 3ULKA 3DL4A 3OZGA 4UVGA 2OESA 1R8YA 1RYMA 1K5GA 4G0ZA 3U31A 4MW2A 1VJTA 2GD6A 3QPDA 2AXQA 1BMFA 1Y5LA 4NYIR 3RFVA 4ZRDA 5D5HA 3MWGA 3UXYA 3DE5X 3UMVA 1UZNA 4KQ6A 3P26A 2BUCA 3PXAA 4P7GA 4RLHA 2GJ4A 4CLOA 1QYRA 3WGHA 3N59A 1I7SB 1N2XA 1C0PA 4UU0A 1CY2A 3DVAA 3K3PA 2PX6A 1W59A 1SFRA 1XAHA 3L7NA 5C1IA 4D8YA 2HK8A 1ZONA 3I6BA 3IQWA 3W9UA 3WV4A 4LF6B 1M5UA 2OXCA 3UGQA 1AK1A 2WJIA 3X43A 1EGHA 2DWCA 3ESZA 3CEPB 4O4HA 3HMKA 1E2FA 4HGYA 2AR7A 4YCCA 3DLBA 1GR0A 2CHFA 3TKYA 3FMPB 1U2PA 1IPFA 1UBHS 5KJEA 4ICIA 4PCVA 4FSDA 2JD0A 1FSSA 3QU2A 4DYHA 2O2SA 4GHWA 4AJ9A 2F00A 3AF2A 2Z2JA 2Q2VA 2ZSFA 1Q0PA 3HADA 4OY3A 1QBGA 3U09A 2AC4A 1LGYA 1RRPA 4CTNA 4OHZA 1A98A 3IIKA 2P75A 1KMCA 4FT2A 4IGAA 1G7CA 5KU7A 4Q47A 2C2XA 4GD3Q 1RRFA 3ROZA 5BMVA 3T9CA 3KZMA 2JEZA 2XVXA 4TMTA 3WWZA 1S7CA 1SU6A 1XQ1A 2P9FA 2R8EA 2WIKA 3PP8A 1JT9A 4HYEA 4LC0A 4YS6A 4ESVA 4NHOA 1QPZA 4DMFA 1PNVA 2PWBA 3BREA 1QRRA 1TO1E 3BL8A 2G1JA 3Q87B 3OG9A 2WKQA 2FDXA 2QHXA 4BCDA 1TLFA 3IEPA 4K6FA 4EELA 1DBQA 3NLLA 2BEKA 2X5NA 1B7GO 3ICPA 5E9WA 2YRXA 3I0NA 5CCBA 1QTNA 3VUFA 1YQQA 1MGOA 4A91A 5A05A 5TX7A 4NQRA 1AQYA 3V8MA 3CIFA 4E21A 4RF5A 3CH6A 5AXAA 1FUIA 3S28A 5AW1A 3KQWA 5I7RA 2HADA 4J3NA 3BC1A 4JJZA 4MDYA 2J0SA 3AVOA 1ENPA 3WKEA 1K6EA 4EO9A 5TQJA 16PKA 3ZOZA 4WXPA 3OT5A 4PC1A 4Y2GA 5FBKA 1U90A 2XUPA 2JKZA 4EVIA 2VPIA 3D2LA 5IH7A 4W5TA 1L5YA 2QQGA 2Q1TA 3VYWA 2LRHA 1DKQA 3KYCA 2CXOA 5BN3B 4OP1A 1TW3A 1Z8NA 4RM3A 1H2HA 4N8DA 4OH1A 1EWQA 1V1MB 2GM3A 3N3BC 4EI7A 2ECOA 4YQZA 2J4FA 1QC5A 4IFEA 1EXVA 1PJSA 4GYYA 1SCAA 5KUTA 1YKFA 4LSZA 1G3MA 1YB6A 1XQXA 1AD2A 1E1RD 2FR8C 2NAFA 2Q1SA 1Z3IX 4WMLA 4M1ZA 1JWAB 1TM3E 2WJJA 4XIIA 3ZNNA 1ISPA 2FA9A 3MCWA 4IH4A 4DLZA 1I32A 2GWRA 1J23A 3I4LA 1D6JA 4Q9JA 3VPHA 2W6QA 2O59A 3TH5A 3GT7A 1MG5A 4K81B 3OPXA 4AF6A 2YMMA 3DEKA 2C29D 5EEGA 1P9LA 2J07A 1JHXA 4TMXA 3ZV3A 1JG7A 3U0BA 3SZGA 2P2NA 3WL8A 3R3SA 4EPRA 2IZ5A 5BSRA 1RPJA 3E8XA 4BWYA 2WUGA 1AU9A 2IY8A 4J16A 3OO1A 2IYUA 1EFRA 5TQ2A 4CQMB 3PIIA 5FRDA 3RBVA 4GU5A 2PG3A 3NIGB 1TUBA 2Y1CA 3SX2A 5BR7A 2YIJA 2LD4A 5CA0B 3W5HA 3MBIA 2QY6A 3OQPA 1DEKA 4M0KA 3VJLA 4PFKA 1GL9B 3D6JA 5KSYA 4MA5A 1K8QA 5C0OE 3WG9A 4QYIB 4A2QA 3KQOA 4PLGA 4PPFA 4QHTA 3DOIA 2VPZA 3LZ6A 3S0JA 1FJGB 1P2FA 2UVQA 2VJAA 3GRKA 4ZMSA 5JEEA 5IK2A 2C2ZA 2QG9A 3MXOA 1F5SA 2HNBA 4CKXA 1AKMA 3RRNA 1JU3A 1OZHA 3O1LA 4NYIQ 3I28A 4H6PA 2VHUA 1G66A 5EA2A 3JX9A 1YDMA 2RK4A 3OQNA 2OD7A 4IIVA 3A6GA 1VXOA 4MPPA 3RU3A 3A1EA 2L82A 1FP6A 1EX9A 1Z4QA 3D2BA 4F60A 4UTRA 1OX5A 5JPIA 1T3GA 1T9AA 2AB0A 2WYOA 3RJ9A 1VFNA 1ZMOA 3DTVB 2PSSA 4IJQA 4BGIA 5L3VA 4GOND 3ZGNA 2RCNA 1FP4B 2ZBPA 3OE1A 1B43A 1DDOA 3PXDA 1COZA 4P35A 1BJTA 3W8NA 4IIXA 5A2GA 4MS3B 2O2GA 4E5DA 3DZCA 2FLVA 4N4AA 3ZWOA 1ISSA 3S7ZA 4DLYA 1UXKA 1ZD3A 3KLMX 2C4NA 5HGJA 4Z2YA 4KPFC 4AQDA 4D9IA 4MVJG 5BNFA 3WAKA 3T3IA 1KH1A 1SC1A 3DWIA 2HMSA 2FPLA 1ZM3A 3RHFA 3NPAA 2Q2OA 3C24A 5A4KA 1KC1A 1HKHA 2QRVB 2P90A 5FPQA 3TW8B 3ENNA 1AZLA 2G9RA 1WZUA 3K1AA 3ZW7A 3D8NA 4PZ9A 3TG8A 2DBRA 2VA8A 4BV2A 1M2VA 3RRJA 2VTVA 5LQDA 2FPSA 3FWHA 5AKEA 4BZXA 1L0BA 4DW8A 4JKYA 4WN9A 1MRNA 1VECA 3O8QB 4DSOA 4URWR 2GTHA 2VQSA 4U8GA 1AHNA 1QF9A 4JQYA 4CMIA 1PNOA 4DIUA 4GLBA 2A0XA 1TZMA 3KAPA 1LPMA 2CGEA 4HMOA 4HZIA 4I5FA 3TI9A 3TAXA 4F92B 1S01A 4W7SA 1TNDA 3B36A 4JJGA 4PZYA 1NV8A 2GPBA 1Q3KA 4RABA 3EPJA 4I8XA 4H3SA 3ZWPA 3R8XA 3NX4A 4M38A 2C94A 1C4XA 3VH1A 5GZ1A 4D7AA 4MI6A 4UBIA 1J4AA 4AULA 4HWKA 1WIWA 3D3NA 2YWDA 2SCUA 2GEBA 4QXAA 2AKYA 2YZKA 3NHYA 4QASA 4CCSA 3N2KB 5LA6B 5B3LA 4UAGA 2HD4A 5HQ3B 3U44B 4HEQA 4LJRA 3WRYC 4CIBA 2JLWA 4S2UA 2WOJA 1SUWA 4L75A 4R1TA 1ORVA 4Q7JB 1ZU5A 4MJ7A 2JIMA 3II6X 1EJBA 3EGDB 1IPHA 1IEWA 5BYJA 3VOBA 4WNCA 4BEVA 4KQEA 1OI4A 1P0FA 4RVDA 3SHOA 2QMOA 4EUEA 1L5FA 2R25B 3TJRA 4OHKA 1KJQA 2O8DB 3MIIA 4UTXA 3WB9A 5JPDA 3GFVA 1JXMA 2XVZA 3H1EA 4IUBS 1WUJS 4Q4JA 5DLPA 2H3EA 3CFYA 1CR1A 1ZH4A 2PMWB 4FYVA 5BWMA 3TDKA 3VR4A 2I8CA 3GLIA 1KU0A 3NT2A 1NXSA 2P35A 1WDTA 2AYXA 2FPOA 3H6GA 4IH9A 4LOJA 4CKBA 2XGSA 5LOVB 3LV8A 4BFZA 5IJ0A 2H1FA 4KQIA 3KAQA 3S8EA 3V8EA 4P3YA 4X65B 1D6MA 1NA5A 4RTQA 5LYJB 1NQOA 1NBMD 5DWDA 5ALUA 5EKTA 2ZUEA 3IELA 1GPYA 1XA0A 2GK3A 3MMNA 3ND5A 4JQOA 4WUVA 3RHTA 3S4YA 4AYTA 3ZVNA 2EXXA 4GZLA 3HY3A 3SLGA 5KYUB 3DZFA 2QAGC 4MV6A 1VE3A 3GJQA 4I55B 4YJHB 3HCRA 3TO5A 3QLTA 4KLNA 3VTAA 3CEAA 4L3VA 3JQGA 4AZSA 4FCWA 721PA 4KH1A 1QHIA 2F3PA 1XPJA 2EDAA 2WJWA 1KRXA 3RG8A 3AI3A 5B30A 1Z5VA 3J81k 1PT8A 1GQSA 2EBWA 3OE4A 3F0TA 4OI2A 1XQ9A 3G9QA 4P3PA 1LTQA 2V7EA 5E4JA 5T8KA 4HL6A 3UF0A 4CG2A 1E2NA 3H5RA 4LY6A 2UZ1A 2CL7X 3KYIB 1ONNA 2BR4A 1XRRA 3OJOA 5C8ZA 3IDFA 3LT5A 4RDIA 4EKIA 1O0CA 4Q9IA 4JLDA 1QIJA 2J5RA 1Z2DA 5ARBA 4N65A 2PFSA 4E12A 3UJPA 1A04A 3X1XA 4R2KA 2FMTA 3IMEA 4C4PA 1UAGA 2H57A 3PC8C 1B23P 2ZYHA 4QM6A 1G9SA 3QLJA 1KMHB 4PICA 1Q0UA 3ASUA 3EGWA 1PUIA 3ZLUA 1QO0D 5JNRA 3M89A 1E8NA 2NPFA 2W6CX 3V1UA 5I3CA 5IM4F 1QKJA 1J2RA 3KFXA 2OUKA 1T0HB 4WLFA 3BWCA 4BMPB 1NJGA 1NP6A 2C4HA 4XKJA 3TOZA 4M1EA 1QK3A 2P9TA 4OCZA 2R6JA 4HD8A 1UKEA 1GUDA 1YZFA 2D06A 3GO4A 4PWYA 3SKYA 5KYXA 1SD1A 3LLSA 2HF9A 2NPOA 1Z4NA 2OP1A 5E1BA 4BS9A 3IIIA 4UHKA 3RC9A 4V0SA 1GUFA 4ETIA 1GZ7A 5CVUA 3J81A 1AGXA 3AKCA 1ZD2P 5G4KA 3H5OA 3CLRD 1UT8A 2QAJA 5H7XA 1HL3A 1K7XB 3NP7A 4DUPA 2ZAOA 2X0DA 3O38A 4UAUA 3KWLA 3VYUB 5JOQA 4NPHA 4YJDA 2HEIA 3JQQA 1RIFA 2XCOA 3GN2A 1P60A 3FZQA 1DRJA 5TPZA 2IUFA 4RHFA 4C5AA 4F38A 4K5QA 1BS9A 3LI2A 4NPAA 1A9RA 1JI3A 1QGYA 1A4UA 1YDHA 2CNWD 3TSCA 3QXJA 3VPAA 3W06A 2BLNA 5SYNA 5IANA 2CVHA 4PGFA 1A95A 4WOKA 5G53C 4D82A 3BMOA 4E2FA 4YXWD 3KQNA 1SBIA 2QRZA 3CX4A 1PQWA 2VHYA 2EP7A 2C98A 4JLMA 4DG8A 1Q84A 3AFHA 5SY6A 1RYYA 3AL2A 3FWNA 3CW9A 1DINA 2W6MA 3S1LA 4GBJA 1N2GA 1OU0A 1ISHA 1YNSA 4BECA 1DBIA 2CY0A 2JZOA 3HBNA 7ABPA 3O90A 4YBZA 4ES6A 2BTQB 3P96A 4C01A 1FE8A 5TT1A 5HKAA 2CJYA 4G56A 2AUTA 2NO0A 3EA5A 3HVHA 4DIMA 2MINB 4NAUA 2RGBA 4UD2A 2F43A 2BDEA 5FL7A 4GZ3A 4HI0E 5JR3A 10MHA 1N6HA 4RL4A 3E05A 3IIMA 3HE3A 2XUFA 3OO0A 4RXUA 4F46A 4XQ9A 5CBPB 2FQ1A 3U4CA 1ODKA 3H6HA 4RK6A 4WFIA 3HYLA 4ARCA 1Z08A 2QI9C 2O54A 1WR8A 2HCTA 2KLBA 3C43A 3E1GA 1DJOA 3KKNA 4EHJA 4EG1A 2A14A 4ZRNA 4DXAA 2QTNA 3FY4A 1LQTA 1PYGA 4EX6A 1TTTA 4EHHA 3CB4A 1IUOA 1K9VF 1OX6A 3E27A 4JJKA 4OJYA 4IGFA 1BA2A 3HDQA 3RKUA 1QX4A 2JLXA 1E4EB 1VCMA 3FWYA 3IBSA 3TE7A 1UUFA 4CW7A 2Z9DA 4EUKA 3TQOA 2DLDA 1XMXA 1JG1A 1JG3A 1UPAA 2H4JA 4FOOA 2C4MA 3LRXA 3QI2A 4OU4A 4P4SA 4UEWA 5J59A 3VSAA 2GZSA 4GDFA 2WUVA 4TTAA 2OM6A 4BLSA 2RH5A 1HETA 2QPOA 3OT1B 5IS2A 4JFAA 2WD7B 2I7XA 2WRZA 5HK8A 4A8JC 1I2MA 2WF8A 3U3KA 4JJIA 4F5ZA 3GLKA 2IH2A 1HYEA 1H9AA 1A69A 3RQSA 3QELB 3LPLA 2PBFA 1UC4B 2FRDC 2XDQB 1SK9A 3AB3A 3KEOA 4FD2A 4KYIB 4YRJA 1LQUA 3AKYA 1QGOA 3W6UA 1QGUB 2BUBA 3GK3A 1FA9A 1WPRA 2BFMA 4UHBA 3RAGA 3RJZA 1NXTA 5EZYA 5K45A 5KWJA 4WCVA 3AHFA 2ZGVA 2Q5QA 4FGWA 3KBBA 1NVEA 4UM8B 2R8RA 2IP2A 2FX5A 3ONDA 1US8B 3HCBA 4L85A 3QITA 1O08A 5AK3A 2B61A 4BEBA 1FYVA 5LLDA 2NV6A 1G20B 2YXBA 2G04A 3NBUA 2HDHA 2ZVDA 4HSEA 5IJXA 2VRCA 2BKLA 3OWXA 1EJ0A 1G0NA 3TBFA 4AMZA 3BWDD 2XOXA 3EZ6A 5HXAA 1YQGA 4YUVA 4LZZA 4D9KA 4PLPA 3P0RA 4OHOA 3PENA 3L7AA 1XLVA 1GKIA 1OPXA 2YN2A 4NZYA 5CK5A 3G0HA 3GFBA 4C7OB 3ASYA 3LHDA 1BN6A 2Q49A 2XCLA 5JFOA 5IT0A 5JCOC 3GP5A 5CH3A 1Y5RA 3EJWA 3BG5A 3CVUA 1L4UA 1ES9A 1Y5IA 5AVUA 1A71A 4TV8F 2DG2A 2ONZA 1C7FA 4V3BA 5KINB 1UJ5A 2LGJA 1OW3B 2FX2A 2ZBGA 4Y98A 4MROA 4NE9A 2R6HA 3H9CA 4MS1B 2ZAGA 3CLHA 2FUCA 1DHTA 2V7TA 4OHPA 4PPGA 4PYMA 2IPXA 4KBYA 4X61A 5HMMA 3WGGA 3WK7A 1T8PA 1ULZA 5CVVA 4DBZA 3H9EO 4BX0A 4PCAA 4D57A 3ISTA 1SBNE 3ZJVA 3PLAE 2RGAA 2C59A 3JARA 4I8IA 5EJMA 4DV7B 2BDTA 3IP6A 4L5AA 3ZDAA 1J0EA 1UBEA 4WZAB 5EJAA 4XTCS 2XKBA 4IUCS 3E03A 1RTKA 5IEBA 1ZCBA 3AERA 3DAGA 3GLSA 4WKNA 3EPHA 3WGZA 2W8BB 2CNDA 3MNFA 3M5PA 3L0PA 4C05A 1GA6A 3QKRA 3GU3A 1DTEA 3TSOA 1EH5A 3GT3A 4RS4A 4EW3A 4L6CA 4PPYA 1Z0SA 2YOHA 5DCYA 5L4NA 3PDHA 4DLXA 3D0KA 4E6PA 1DELA 5BSKA 4EYGA 4OTZA 3X0DA 1RW4A 5JADA 5FLXA 3ODGA 1KJIA 1F3LA 1Y8RA 1TFUA 2A9OA 1J06A 3ROPA 1SM4A 5ALOA 5EWMB 1EP9A 2GK4A 3D7SA 4REMA 6YASA 5FTJA 1Z7BA 2C84A 4IKPA 3ZWCA 2KWIA 1Z8DA 3BMXA 3S1AA 4CMKA 3AFGA 4CKEA 3B9QA 1BOOA 1J1ZA 2KPOA 2RGNC 4OM7A 1I0ZA 3HM9A 3VKWA 3VO8A 4O1IA 2JFNA 1MZVA 1GRQA 3V2UA 5FTLA 3UV3A 1RKVA 3LCCA 3MWEA 4D6YA 2YNMA 2WP0A 4B1FA 3PCTA 4LS3A 1S2DA 3NRCA 3HCDA 1XHLA 3U7FB 1QFSA 3C5HA 2FZ5A 5FA8A 1LRLA 4KIJA 2P3LA 4NPCA 5ED4A 3FUCA 4QECA 5E1OA 4HBZA 2Z04A 4FS8A 1Z13A 2P2GA 1U8ZA 1OXSC 4DSZA 5JEDA 3B5EA 1SC3A 3JYHA 4OHMA 1TZCA 3T7IA 4JL5A 5EJEA 2IX3A 2YWXA 4ILEA 2A9JA 2F3TA 3A4IA 3CM0A 1WZIA 2CDAA 5CLHA 1EZ1A 4XFDA 3NTXA 4MV0A 3AVWA 1X2EA 2VEDA 4R5HA 4IDBA 4AJNA 3S81A 2O2CA 2AG0A 5AM2A 1UQUA 3DPSA 3GG2A 2O0KA 3FCAA 4ITRC 5JZOA 1N78A 3LDUA 3IBCA 4UZFA 4A6PA 4XVQA 2JZCA 1WB9A 4BMVA 1N9KA 1V48A 1VXRA 2EF0A 2PGXA 3DD5A 3EIUA 1AK2A 1D3AA 4HAYA 4D2IA 4E15A 1RXIA 4ZREA 4RVNA 1U8AA 2AFHA 5J4VA 3EYAA 4J16C 1P3JA 4U8HA 4YAJA 4H7JA 1N5RA 1LI5A 3PFHA 2HRCA 3RRZA 1ZDMA 5FPKA 4W5NA 1ZJ4A 1NBHA 1YRYE 1YBHA 4BVBA 2RI0A 3OZTA 4LDJA 3AWIA 3FLBA 4B32A 4BTEA 3OURA 3Q6MA 1QVRA 3RRFA 3D7KA 4J29A 4NECA 3BDIA 3G9XA 4KXUA 4LC1A 4KAFA 1J56A 3GJ6A 1MO4A 1NYQA 2NTJA 4LMBA 4MH0R 4CIWA 3ZJUA 2JDID 2X9NA 2VXYA 3RS7A 5MDHA 2F90A 1H1LA 3QXCA 4GSKA 5J5AA 1WO8A 2VWPA 3ENQA 1S8AA 1PQYA 4XUDA 5LWHA 4MUGA 1JVSA 4NJMA 4C5BA 4CJXA 4JKIA 4C0SA 1CZHA 1XCBA 3LWDA 5JLAA 3TN7A 4JP5A 4HXGA 4UUBA 4D5EA 5AHXA 2JK1A 1I0LA 4MV4A 4RQBA 3E3LA 4A27A 2BBOA 4MZDA 2IYYA 4MV7A 2PL1A 1PZXA 1KY4A 4IHJA 1QHHB 1SZPA 1KWGA 3A9TA 1OGIA 3N0WA 3A1CA 4Q15A 1C41A 5ALIA 1YR7A 3FDIA 4AJ1A 2YUTA 1P7CA 5BUQA 2W4MA 3FLEA 3QM1A 1E1DA 5GV7A 3MRTA 4YLGA 1W85A 4LZLA 4P4LA 5BV1A 4KE9A 2F8SA 1GILA 3BXOA 3L1IA 5FAXA 2WSSA 3LTEA 3AR7A 2VDUE 3HCWA 5BN4B 3H9QA 2ZIXA 2W6JA 2RJNA 1IH8A 3WSVA 1TK3A 3U48A 1KVUA 2O1SA 2V1XA 4AY4A 1KQ3A 4IV5A 4LHZA 4M49A 2WF9A 2GXAA 1AZSC 4HNSA 4IY1A 1BDBA 4ENSA 4ZHQF 2EU8A 2YWCA 3LG2A 3TQHA 2Z3ZA 4DRXA 2OV8A 1EXWA 1YL7A 3V6LA 3V4ZA 2V7XA 5C31A 4FE4A 3GEPA 3R5HA 2JGRA 1NSFA 1R2QA 2QD3A 2DYKA 3JYNA 1RYEA 5LZ9A 4B74A 1E7WA 4HHEA 1RLUA 1FTSA 2KB0A 2YV1A 4EPWA 2CZGA 3CJTA 4U0JA 3U26A 2H85A 4KXWA 4L8WB 4A1FA 1NTOA 2A0KA 3LFUA 2FWBA 3GCZA 1WXWA 2QRMA 4G4GA 2XV1A 4UEOA 2IOFA 3C3PA 5IBPA 2IHNA 1ADCA 2H92A 2VZEA 1TM4E 2WB4A 3O8CA 4JDUA 3WLHA 1N75A 4WZBA 1VIAA 2XVYA 4MCHA 2BHSA 4KG7A 3FA2A 5EJIA 4Y2VA 3AH8A 4C1NA 1VP3A 3HNPA 4PLCA 4DA6A 1L1EA 1FMTA 1YS9A 1HNNA 1WOMA 1YGYA 3KP1A 4WPGA 5J1TB 1EAYA 5H81A 3SFZA 4W99A 1IRIA 1CX9B 2HV9A 3AUSA 3OCCA 4Z2AA 1BXRB 5CDGA 2FLWA 2ODWA 1M1ZA 4UHCA 1J0DA 3T9EA 5B1EA 1YT5A 3UJ3X 2NQ8A 4OHBA 2XRZA 1TB4A 1BDHA 2ZRNA 3AOEC 2QVCA 1XMPA 5EAIA 4FLFA 3CRRA 2CVZA 3WL4A 4NFLA 1BX1A 1ZXXA 1Z9BA 1KJNA 2YZMA 3IQZA 4HSGA 2JJ2D 4AT1A 4E22A 4YUXA 3CKKA 3KPWA 1RVV1 1NQUA 4KQXA 2HGSA 1IRXA 3O9MA 2ZRKA 4AZ3A 4R83A 4RHXA 3AK4A 3TLJA 2PKRA 3T9BA 1UJ6A 1FSZA 1H0SA 4UARA 1ZNWA 3NTUA 1DO2A 521PA 1HSOA 3VZDA 1DQZA 1ZP6A 2AG6A 4DZRA 4S04A 1NQVA 3ROFA 5IKPA 1QK5A 1RYFA 4OKSA 2A9PA 2PV7A 2ZCUA 2B8WA 2YY5A 3CO5A 2B9VA 3G13A 3URMA 4ZEMA 5IKXA 2EZ8A 1BGXT 2Q8QA 4FN4A 3W8DA 1QP4A 2XLCA 2IZ6A 1S2MA 3HU2A 4QFBA 1SB9A 1PZEA 1WKBA 3FDJA 4IQ8A 2D1FA 2JCBA 2JANA 2VOJA 4UAVA 4F5WA 1AUXA 5KAMA 1BCSB 2ENWA 1C1HA 1U1GA 3V00A 4R05A 5A9SB 4IHAA 5TS3A 4ZCRA 1F20A 3WIOA 1NNSA 1JKJA 2JW5A 3ITDA 4LXQA 1VKHA 2PQMA 4XX0A 1C4WA 2VJYA 2Y2UA 3R3HA 1SG9A 1Y7PA 1IOZA 1QZ3A 3QVXA 1VRVA 3N7UA 3PYMA 1CY1A 4ZEOA 3C4JA 4F5DA 1DKRA 2WJ6A 1S8OA 2HXSA 5PGMA 1JBEA 5DB4A 4QTTB 2VK2A 5T8KC 5KOYA 3AUXA 4MO9A 3AR4A 5KOJB 1M8JA 2Z95A 4II7A 4EATA 1N7JA 2HRRA 2Y1FA 4UC0A 1IBRA 3VDRA 2PUTA 1RC0A 2ZJ6A 3H9GA 3K9NA 3P9RA 4PNPA 1E2JA 2HGZA 4Y1RB 4ZO9A 1VZ3A 3OF3A 3TQFA 1WA5A 1OZGA 1C1XA 2O1EA 3GROA 1Y4SA 2EKDA 2H2HA 3L7IA 2YWEA 2EL7A 5HFNA 4B09A 2GXQA 2PV0A 1IK6A 3MAJA 3VPXA 2NLOA 5BXYA 2PPVA 3IUBA 2E85A 1BEZA 4DGSA 5K5EA 3TX6A 1M74A 4HAOA 2Z57A 4CNBA 1L7QA 4XWTA 2YYAA 3QFRA 4RZIA 2C07A 1O6CA 4MQ6A 2DWOA 3A25A 1YDWA 4HLCA 4B7ZA 5HUHA 1M5RA 1HGXA 3UENA 3O2QB 1QVWA 1S7GA 4ID9A 4QL3A 3F6BX 4X90A 4Y2UA 1Q14A 2P40A 4OHYA 1QIKA 2G8LA 4RIHA 3S2UA 3L7LA 4X1KA 1X7XA 5K99A 1D8AA 2RONA 3M6FA 4QOJA 2DY1A 2X1LA 5HZMA 4CG3A 1CUWA 5KQRA 1F2TB 1W6RA 2WSIA 4RKFA 2V6IA 1K89A 3MJRA 1N2HA 5ERGB 2GCOA 4MR7A 4TSKA 1XZDA 3IOMA 2IA5A 4LX8A 4C30A 4OFBA 1BVUA 5ABPA 3VHXA 4DR7B 1TZ2A 2FZWA 3IE0A 1JDNA 1CLUA 3DWEX 1RRGA 4EB0A 2AJ8A 3D4OA 1L8QA 2DC1A 3FF4A 3QOFA 2DTDA 2YKGA 2RGYA 2NUAA 5LZ8A 3EGCA 4JFRA 4ND8A 4GO1A 2DU8A 2Q6OA 4GEKA 3QPUA 2Y0BA 2VHQA 3AEQB 1U3DA 2M1XA 2VKQA 5HRUA 1E1RA 4JC0A 2TRSB 4KRGA 5J4YA 4LKOA 3WQRA 1N6RA 3HBFA 1SEPA 2VOEA 2BI7A 3TD9A 4EJ0A 1YR9A 2BFCB 5E4FA 2ZI6A 3WHLA 4ESEA 1CKEA 4UZEA 4WINA 1MC5A 1R0YA 1BC5A 2A5YB 3JQRA 4Y2TA 1Z15A 5JWHA 1SKQA 2VWQA 4EY3A 2ZT5A 3IBTA 2X3FA 2V6GA 4DWVA 4H9GA 2FPWA 2C4KA 4ZT2A 4D9GA 4ZAWA 1D6SA 2HSWA 5D86A 2Q1YA 3BF7A 3Q3JB 3M83A 4L6IA 4OMUA 5CT9A 2VDJA 5FQOA 2JGLA 3RR2A 2OZVA 3CUWA 4CDMA 4LY9A 4L8LA 2VDVE 3EVTA 3DLAA 4N3NA 5JC1A 1JECA 1UMBA 1JYFA 2PTGA 2ZJAA 1PBNA 3LO8A 3NBFA 4E1AA 1GT91 1Y3DE 3SBDA 4NJEB 2OZPA 4WACA 2Z2ZA 3CLVA 4EOGA 2VTBA 4F4UA 4GBGA 1ZI9A 3E3OA 5DW0A 4O4JA 1JDVA 5BOSA 5C7LO 3PSAA 3ANSA 1RJ9A 4GXNA 5TVKA 3WYAA 4WRRA 3DBOB 1BVRA 2J30A 3M5WA 3P9XA 3TOXA 5CD1A 1Q7CA 1N5LA 1W0CA 2LUOA 3LBAA 3QYPA 4ALLA 4ZZ0A 3SQNA 2DM6A 2WQZA 1PU2A 2A35A 3F3SA 1NATA 4CR8A 1TXGA 1USKA 5EMLA 1YK0A 4CUJA 3BIFA 1OFVA 5K2OA 4ZVQA 4H6VA 3FTFA 4QDUA 3AUUA 3RS4A 1MXFA 1W8DA 5JBNA 1NRWA 3W3ZB 3WDMA 3AM4A 4LDAA 4BVFA 3TZCA 2GD2A 1Z2EA 2I80A 1E58A 1R66A 2XRMA 4L73A 1TQ6A 2ZATA 1ZH0A 3NZEA 1TYEB 4JC8A 5FWYA 5JZBA 4FGJA 1V5IA 3BHMA 1BROA 3EF3A 4L5CA 1Z75A 3LIIA 4NZNA 1D04A 5JE8A 3PQ6A 1N2CB 4QJ3A 4Z51A 2BFBA 3F8SA 3ORHA 5CA0F 2Q28A 3C6MA 2YWBA 5AQEA 3MUEA 4EB6B 4F2DA 2YWJA 3KKKA 3USZA 3R1IA 1YBMA 1L7AA 3DFIA 4Z54A 1E60A 1C9DB 5AYVA 2FR0A 2HWUA 3KOWA 4RNCA 4QEDA 1PSWA 1OOEA 4IMRA 1XGKA 1JDBB 1T9DA 4PAWA 1EUYA 2DJIA 2R87A 4R2WA 2Y1LA 3O1HB 3WLEA 4R1SA 4D25A 3C5CA 3KXDA 3LKVA 1NPTO 2FUKA 3U40A 3NAZA 5EQDA 4WJKB 3DMHA 3QTBA 2JARA 5HBGA 3ZHYA 2CCJA 3UANA 1E0DA 1DFHA 4MPJA 3PJDA 3CF6R 2YHSA 3RG2A 4YP7A 4A6EA 5C5IA 2VUUA 1U1CA 2JLBA 4LJAA 5A71A 3RIXA 4EQ6A 5HRCA 5KOHB 4FFDA 1YDEA 2BE9A 2MR6A 4R2LA 3H13A 3DPIA 5M7EA 4KJXA 2AYYA 4JENA 4AS1A 1K8ZB 1AN9A 1JRLA 2XNJA 3OAAD 1N3LA 5CX4A 5DTMA 2Q0XA 1Y4AE 3RF7A 4LRQA 3U7IA 3QEMB 5BWOA 1G6OA 3W3AH 1G8HA 3OKPA 4N82A 4NCHA 4BASA 3ABIA 3CRQA 4G5RA 3TBHA 4DCMA 1JZTA 3HPQA 4AP5A 4GI7A 1JDZA 1AUQA 1CRZA 3VVBA 1B42A 1H5UA 3QFSA 4MVJI 3AEUA 4YMSA 1IN1A 1ZRMA 1X7WB 4RVGA 6ADHA 1E9FA 2ZRQA 3FNQA 2P3QA 1UOOA 1XZFA 5DEIA 1C2TA 4BVKA 1PFGA 3OM0A 2ZXFA 2ODBA 3EGVA 4O5AA 4D6PA 1Q57A 1EX6A 4IIUA 4C7KA 1A77A 3R6TA 4ZI7F 1Z8FA 2D7CA 4NU5A 1I13A 3HHPA 5EHXA 4RD3A 2Q1WA 3R5JA 2WVGA 1R3UA 4WFKA 1C0EA 1R18A 1IHYA 3KLNA 3NC4A 4YAFA 3H0KA 1JPVA 3AHJA 4YYEA 2GFHA 2FEWB 4EG8A 1ISJA 2RGEA 3KPJA 2QYHA 2Z58A 3IQDB 4AKGA 2RGUA 4YRCA 3GZNB 5IM4A 2EKBA 1U3TA 2FV8A 4YIKA 3ZZMA 1ZIXA 3CWCA 2JAWA 3HB1A 3E81A 1UXIA 4Z8YA 4Q1CA 3B1ZA 1K7SN 3WNDA 4IO0A 3UT5A 1WB4A 4QHSA 2RAUA 3QEJA 1SURA 2EJCA 1TEXA 2IOQA 2DFVA 3G2JA 4AS2A 2I33A 3CPJB 4PSCA 4BV3A 2Q07A 1XD2A 3DZHA 4BAGA 1Q6YA 5FTMA 2CMKA 1JHYA 4F6RA 2C9BA 2UXBB 1I2AA 5DIFA 1JPUA 1Q1BA 1TRHA 4KDEA 2F17A 4RAOA 3K05A 2JFGA 5ESWA 3TMAA 5K0NA 1QLHA 2NZ8A 1JHZA 3HXOA 4JI8B 1L5KA 3OJCA 2F9FA 4MI1A 5AR1A 1KNXA 1X7ZA 4I6GA 4PBSA 1A8HA 4Y6GB 1KI2A 4HGZA 3A36A 4AJIA 1Y33E 4A92A 3NXKA 3U6BA 1B2LA 3T1TA 3GFTA 4LYYA 1ESMA 3W6PA 2C5BA 5LOVF 3PL1A 1QNLA 3T6KA 1LS1A 1RWMA 2FWPA 5EIEA 3R6WA 4ZV7A 4C4XA 2IVZA 3B12A 5CCXA 3L6OO 3I6QA 5GM2A 4J90A 1PR0A 3WJ1A 1L7MA 5JIBA 2QA5A 3HGMA 1QWOA 3OE7A 4IVNA 3D3QA 1U28A 5KSWB 1FTGA 3DFFA 2QL7A 4YH1A 3WGKA 4ETNA 4I55F 1EDEA 1GNPA 1P73A 1UM9B 2DCMA 3HLYA 4DLUA 4I4CA 2Y1DA 5DM4A 3USCS 1Z16A 5BW4A 4B31A 3MJHA 1FFHA 2I65A 5DGHA 5IU6A 2IYZA 2ENUA 3LMKA 4H15A 4TM8A 1DRWA 5BWBA 3RUEA 5JMWA 1NVFA 3DV9A 3TK1A 1PG5A 1X8KA 2JFPA 1HEYA 1FYXA 1NW6A 1TEVA 2YRWA 3B1YA 5DH9A 4DADA 4F9TA 5L3SB 1HNXB 3UAVA 3G02A 3IPXA 4Y9UA 3RADC 1FYFA 2R3SA 4IF4A 4U7PB 1G8MA 1SPBS 2O14A 2ZLBA 2ZRDA 2ZITA 2H18A 3IDSA 4MVYA 4O2BA 5DM1A 1XJ0A 4C43A 3SX4A 4L08A 2ECKA 3WR5A 4DYVA 3KSRA 4ND4A 3GUYA 1JHMA 2OBLA 2PE5A 1PR6A 3R6LA 1KEPA 2WHXA 3OJLA 4NBWA 1LSUA 1LDYA 3FB1A 2NU6B 2I2DA 4IW3B 2FWAA 1E6WA 1R6VA 1XTVA 1YBVA 2AI3A 5JAIA 4RK1A 2Z9BA 4RWEA 5F77A 1V7ZA 5HPYB 3EQ6A 4GZ5A 4OP3A 4PAOA 3PVCA 1RP7A 3A6LA 4JUFA 3OHSX 4G5GA 3JSAA 2D59A 3DOUA 4KZPA 4TVBA 1TQ2A 3EEFA 4KRFA 4HC4A 3CGWA 1P29A 1YS2X 2BD0A 4Y1FA 1NJ1A 4YTEA 3RWBA 3LP5A 1K8RA 4BOYA 3UMBA 2IU4A 4M54A 3ZE0B 1ACMA 3EWAA 4YMIA 5KHLB 2ZTMA 4KX3A 4HAZA 3GFFA 4I9NA 2ZIZA 3WIVA 4Q66C 3VI3B 4Q3CA 1FYEA 1ZRHA 3PQ5A 5BORA 5FOQA 1V0JA 2OR3A 3BAZA 5I01A 3M34A 4OA5A 4BFLA 4YJ2F 4FSXA 3Q3CA 5T7BA 4Q4CA 2VNSA 2GZ1A 2ZW9A 1F2VA 2QSUA 1N57A 3T3PB 4HZUB 4XD7D 4DDKA 2JFVA 2HZBA 5C35A 1R00A 1RZRD 2H52A 3A9SA 4R8VA 3KZ1E 4R0MA 1OA1A 2EEPA 1E0AA 3G7NA 2XNKA 5EPUA 1JW9B 1RXYA 1T8UA 1Z74A 2QSJA 1P17A 3HJRA 1QM5A 2ZIVB 3R0QA 4MP8A 4EWLA 2TMYA 3C8MA 2ZRJA 5KSZA 2P6OA 4W1SA 5D3MA 2NU9A 2P30A 1YC2A 2QTTA 1ILEA 3QVLA 5EJ5A 4IMIB 4NENA 3O73A 4EB3A 5L3QA 5BYKA 2I3GA 3PLNA 2Y71A 2R1TA 4P3NA 1P6UA 4RH0A 2HWWA 4D0LB 2IK8A 4OSOA 5EXSA 3R74A 3N2ZB 5EESA 3TCNA 2YWGA 8OHMA 4MWCA 1JQLB 3BN3A 4B34A 4F91B 4XJXA 4YMLA 1JQEA 5AW2A 1QQAA 1WDKA 3JAWB 4V0MA 4IWNA 5CXSA 5FP0A 2C7OA 1GL6A 2ZYGA 1HE8B 3DTYA 4LKRA 5F52A 1NVDA 5DWQA 5K3EA 2JKVA 2J4DA 3AIOA 4ZC1A 4O6VA 2JLYA 3THYA 2ZSEA 1IJEA 3OTGA 4L78A 2HRZA 3O31A 5EPEA 1DG3A 4E11A 3JQAA 4KPEC 1HDGO 3CNOA 3KOMA 1JTVA 1WXXA 2PEZA 3KC2A 4JHLA 1NBME 2XBLA 5FNVF 2VPTA 5A04A 5LUBA 3PC2A 3CNQS 5DT9A 4LF9B 4L4SA 4FFWA 4A26A 1OFHA 1HNZB 1QHXA 3ZW8A 2CV2A 2B2CA 3P32A 2BHTA 3DB1A 2LV8A 3HKCA 5C3MA 4Q3DA 4A0HA 3THXB 1O77A 2QW0X 4EJSB 2FG5A 4FZ5A 4EA8A 1XJCA 3FYUC 2V4ZA 3SXUB 5JAOA 2AFIE 4N40A 4OK3A 4J0GA 1DAOA 4R54A 2Z56A 2WF5A 5CB0A 4HATA 1KXJA 1MN6A 1UFOA 2B6NA 3H2KA 4LTNA 1TUGA 1VGRA 2GCIA 1YZHA 3B52X 3KXPA 1WMAA 1DX4A 3O8BA 3PGJA 3BJZA 4F5YA 3LPCA 3KUUA 5JROA 1OZFA 4L2IB 3SMQA 4E5MA 4ND7A 4Q4HA 4WKPA 2UUBB 1NG1A 3V1NA 2O4UX 1JQJC 1WMBA 2MDTA 1BW9A 4IJWA 4POAA 3NAMA 3NNDA 2H31A 3BMNB 5EFZA 3I9V6 1IN4A 1VIMA 1A5AB 1D2CA 2VDPB 2WLTA 5AUPB 4WW0A 3H1PA 1Y6QA 4HDRB 4R0NA 4YGXB 3MWDA 5A5GA 1E9BA 5U4QA 2XOEA 1YB2A 4K9NA 5ALPA 1RXVA 1FNBA 2PKWA 3T7RA 4OIFA 2Y99A 2QK4A 3HS3A 3HJCA 4K88A 4S3MA 3GEIA 4WAUA 1G2OA 4G1FA 3PDJA 5K0SA 5TV2A 3WIEA 4GGOA 3IQFA 4RJ2A 4YP9A 5MN6A 4ZPJA 2PJDA 3G0CA 4JLBA 4WZZA 5KNDA 1OTYA 3QFTA 4B76A 4WGGA 1GFWA 2PH3A 3WNQA 1QFYA 1GG5A 2NV2B 4W5QA 3R5XA 2HMWA 5E9AA 2RARA 1QF7A 2DE0X 2IC5A 1TJ5A 3KTDA 3ZNOA 4Z0HO 4EFDA 4Q9KA 3WL7A 1PGPA 4CM5A 1J5PA 3I2FA 1WUTA 2BSXA 4RHTA 3G59A 2OTCA 5IBQA 4E14A 1RWBA 4MLCA 4CEHB 3GNSA 3OI7A 1NRJB 2RHHA 5C3UA 4OVKA 5IYZB 2WHQA 3FOCA 1K7CA 2YJNA 3VYTB 4JROA 2CN1A 4R7GA 1U0RA 2C5HA 2GR9A 5B4TA 1R4ZA 3UB4A 1I1NA 5CB8A 4MWSA 2WU1A 2F62A 4UHHA 1HEUA 4RY0A 3ZWBA 2VF8A 3KVYA 4L72A 3P2YA 2GBPA 3VQTA 1FQOA 1OB5A 1VJ0A 1OBOA 1W8IA 2XRFA 3LXMA 4Q7MB 4H0CA 4TZKA 1Y48E 5ETJA 3ST7A 3VR6D 1F6DA 1U3CA 1Z5NA 2BGUA 2GKSA 2RH4A 3DEYX 1SCKA 1DV2A 3WGOA 3NGLA 4JH0A 3CEJA 1GNVA 1S8NA 2CWWA 3ZXUB 2PJRA 2DFPA 2XSZA 3I72A 5LBTA 1BEEA 1ODCA 1GARA 1ZD5A 3ANLA 3BFPA 1FRNA 3CCCA 4FE3A 4FOPA 4ONEA 3VXKA 3WYNA 2IEYA 4G4JA 3PPWA 4IZ6A 1BE0A 4X84A 5J2TB 4H0FA 4G01B 4PHFA 4CYMA 1ADJA 3G6KA 1O5IA 2Q99A 4GW3A 5AI0A 4OD0A 5I7EA 3LLUA 3T06B 2O5VA 3LP6A 4MV3A 1PHPA 1HT3A