1V41E

Crystal structure of human pnp complexed with 8-azaguanine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Structure of human PNP complexed with ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v41E00
1JDZA 4TXNA 3OZDA 4FFSA 1Z36A 4M1EA 1VMKA 3K8OE 2HN9A 5CYGA 1V4NA 3E9RA 1PW7A 4TTJA 4YO8A 3D1VA 3K8QA 4OEHA 5F73A 4D98A 5IU6A 1U1GA 1ULAA 4D9HA 3MMSA 5EFOA 1PR5A 3P0EA 4D8XA 3EMVA 1JPVA 3OF3A 4BMXA 4OF4A 1T8YA 2PGAA 1M73E 1V45E 5F7XA 1I80A 1RXCA 2QTGA 1TGYA 3E9ZA 4QAQA 4TYMA 1Z37A 3P0FA 1A9OA 3NBQA 1LX7A 4WKCA 5CCDA 1OU4A 3OZEA 4LNAA 1PK9A 4NS1A 5K1ZA 1A9PA 2Q7OE 1JDSA 1A69A 4QFBA 1T8RA 4WKNA 4L5AA 2QTTA 3OOEA 1LVUA 3TL6A 3FNQA 2BSXA 1C3XA 3DPSA 4F3CA 1RT9A 4DA0A 1Q1GA 2QPLA 3UAXA 4UC0A 5F7ZA 3KVRA 4OGLA 1TCUA 2AC7A 3OZCA 3O4VA 4M7WA 5JPCA 4F1WA 4LDNA 1JYSA 1T8WA 1Y1RA 3NM5A 4PR3A 1TCVA 1ULBA 1SD2A 5B7PA 4YNBA 2OXFA 3KVYA 1RXYA 5I3CA 4ECEA 1G2OA 3EUFA 1RFGE 2A0YA 5CCEA 1JP7A 1JDVA 4GKAA 1RSZA 1Y6RA 1VHJA 1Z39A 2AI1A 1YQUA 4DAEA 4QATA 1WTAA 4X24A 1PWYE 1VFNA 3U40A 1Z34A 2RJ3A 4G41A 4NSNA 4IP0A 5CYFA 4OGKA 3GB9A 4LZWA 4QEZA 3LBAA 3DF9A 3FOWA 3FWPA 3SCZA 2AI2A 4DANA 3FUCA 2A0XA 1FXUA 1U1EA 4BN0A 4G89A 4D8YA 4NY1A 3UAWA 1A9TA 1LV8A 5EPUA 5ETJA 1ODLA 2I8AA 4JOSA 4BMYA 4DAOA 1YQQA 2ON6A 4GLFA 1VHWA 1T0UA 1K9SA 3KUKA 3NM6B 5FAKA 5F78A 4TXLA 4TS9A 3KVVA 3NM4A 4WKPA 4MCIA 3UAYA 3OZBA 3OOHA 3ENZA 4TXJA 5KB3A 4TS3A 4DA8A 1B8OA 1SQ6A 4H1TA 3DJFA 1ODJA 5F76A 3UT6A 3UAZA 1Z35A 1PK7A 1YBFA 2IQ5A 1OTXA 4MARA 1YR3A 1Z5PA 5B7NA 5F77A 4DARA 1N3IA 4GLJA 4WKOA 4E1VA 1CB0A 4U2KA 1V41E 2B94A 5C80A 2A0WA 1ZOSA 4BMZA 3IEXA 4LNHA 1A9RA 1PBNA 4L5YA 3EEIA 1RXSA 5CXQA 4OY3A 4JP5A 3FAZA 1OV6A 2AI3A 1Y1QA 1ZL2A 4QASA 1OTYA 3LGSA 2QSUA 4YMLA 1PR0A 4L6IA 4DABA 1U1FA 1Y1SA 1Y6QA 2HSWA 4F2WA 4DA7A 5DK6A 1U1CA 1NC3A 1CG6A 1JDTA 1RCTE 1Z5NA 3QPBA 4TTIA 1B8NA 2XRFA 4KN5A 3ONVA 2HRDA 4R31A 1PR1A 3BSFA 4OJTA 3BJEA 4R2WA 1U1DA 4TTAA 1PR4A 1YRYE 1A9SA 4GMHA 2H8GA 3DDOA 3BL6A 4QARA 4F3KA 4WKBA 2OC9A 3OCCA 1RXUA 3PNPA 3PHBE 3GGSA 1V2HE 3T94A 4R2XA 4TXHA 1T8SA 2P4SA 4MCHA 3FB1A 1K27A 3O6VA 1JE1A 4I2VA 2ISCA 1OUMA 3DP9A 5EUBA 4LKRA 4L0MA 4M3NA 3EUEA 3F8WA 1SD1A 1TD1A 1PKEA 1QE5A 4L5CA 3ODGA 5B7GA 2I4TA 3MB8A 4RJ2A 4F2PA 4G8JA 1NW4A 1Z38A 4PNPA 1ODIA 1JDUA 3C74A 1PR6A 3KHSA 2QDKA 4JWTA 3KU4A 5F7OA 1A9QA 4P54A 3OPVA 1XE3A 2A8YA 1Z5OA 3BGSA 1V3QE 3LA8A 4TXMA 1TGVA 5B7QA 3PNSA 5CXSA 4EB8A 5IFKA 1OVGA 4EARA 1JE0A 1Y1TA 1PR2A 1RYZA 1Z33A 1V48A 3PHCA 1ECPA 1ODKA 2OC4A 1K3FA 1NC1A 4D8VA 3IOMA 4DA6A 1SJ9A 4YJKA 1PF7E 4K6OA 3INYA 5F7JA 3UAVA 2OECA 2GUWA 2HWUA 1RR6A 3E0QA
chains in the Genus database with same CATH superfamily
4CM4B 4RCZA 3QVLA 4UVDA 3BXEA 1UOEA 2G88A 5K0CA 1E92A 2ZYDA 4TRJA 4A0FA 3ZQ4A 1UMBA 2JHGA 4BQIA 2W2MA 2PMDA 3K8OE 3WNDA 2IFTA 3Q5EA 4Q01A 2RBEA 5CYGA 1YKGA 1JSLA 4G9BA 3LPNA 1Q0QA 4RKYA 2QE6A 3I2JA 1DJPA 2A30A 2UYGA 3DOUA 3I2IA 2JASA 4P7BA 4Y2SA 3T5CA 3UWKA 4D81A 3X1YA 5FTJA 4HNGA 1NMYA 3CONA 4FWBA 3FFAA 2C3OA 3H11A 4IHJB 1YQGA 5HIJA 5ULLA 2FFHA 2EDAA 1PIWA 2FSUA 4G4JA 2PBFA 1VLMA 5CEFA 2Z6VA 4URYR 3WNZA 3EPKA 5JZVA 2HDHA 5AM4A 3AOEC 1RM5A 2GSDA 2GDZA 2W4IA 1M67A 4IIBA 4PLFA 4RTOA 1K8RA 4QLOA 2NT3A 5ALQA 5HUHA 4TQ9A 3AB8A 5BR1A 4LK2A 3OF3A 4TTRA 3WXBA 4TKVA 3C8DA 3L1IA 4UTRA 2A5FA 4OF4A 2I4NA 4BXOA 3AHCA 4KI0A 1I2MA 3CW8X 4FOPA 1Y4ZA 5CXUA 1JUDA 3BULA 3LBIA 3FR7A 2QWXA 3QE2A 3TB6A 2QZZA 2FDXA 2V55B 2BDUA 1F48A 4YP5A 5CNKA 2HWYA 4O8ZA 2P5YA 1Z68A 3DTVA 1J23A 3FD8A 3JQ9C 1T8UA 4FNMA 4G23A 1T24A 3FBGA 1UIRA 1NFRA 4F86A 2HSDA 1T5DX 4EF6A 1B76A 1COWD 5SZIA 4J0KA 4W1QA 1JEJA 1GAJA 3UA4A 3E9NA 3AVXA 4DQVA 4O4JA 4QYWA 1SKQA 3ED5A 4GPZA 1ORVA 3V8NA 3O8CA 3VSCA 1XZ8A 4RGYA 1B7GO 1E89A 1MLDA 3F90A 3V1NA 1QLJA 2NV2B 3RSCA 2JCBA 3PVSA 3S1AA 3TTWA 4GSKA 4A6XA 4ZI7F 2NO1A 5JALA 2JFHA 4DYHA 1CD5A 1JVSA 3O95A 4CQLA 1MENA 4YQEA 5K0JA 3ZXIA 1UAGA 1J0DA 1SBIA 1T8RA 2JCVA 1XCJA 2VF8A 4PANA 4ZOBA 4C2BA 2CNKA 5L3QA 4QGHA 3UBTA 1H9CA 4IM7A 3C4VA 1H1TA 3SP1A 2ECQA 2P62A 3VR0A 2JVJA 3RYCB 1NASA 2C9BA 4LVOA 5LP6A 3IPCA 3JZMA 2HRQA 1WNFA 2QOEA 4EX6A 4NCKA 2G1UA 2VHJA 5ADHA 2QLMA 4RC9A 2ZQZA 4BV8A 2GQ0A 3FNQA 1OXUA 4RD1A 1J2EA 3RASA 1NOKA 1ZCBA 4P35A 5LA6F 4F12A 3CNHA 2EERA 1QK5A 5I9IA 5CCXA 2ANCA 3MINA 1DEAA 2P9GA 3OTHA 1OKKA 1TTQB 4IS2A 4EUNA 2FEAA 2X23A 4EHFA 1TM2A 2DERA 3FYDA 4R1SA 5ALPA 2CK3D 3BM5A 3B1VA 4UTOA 4ZC1A 1RNLA 2G09A 2NTYC 4BO1A 2QG6A 4EKIA 1XZQA 3EXG2 5FBRB 3GMTA 1NVMB 2ISQA 3FF1A 3PRHA 1CETA 5LQJA 1Q0LA 1DB3A 4UPEA 5CBKA 3RC1A 3B8HA 5DCYA 3H5VA 4KO1S 2RHLA 3DYBA 4BNNA 3DAOA 5HRAA 1H0RA 5CM9C 3BCHA 3RAEC 3SIPA 2RH9B 4CDNA 4OHWA 5BQPA 1GFSA 4Z7NB 4XGIA 2GPWA 4B3CA 4RV5A 5CJPA 3AY6A 3COVA 4EHBA 5C5CA 2HUNA 2Q4DA 4EY3A 1TQHA 3OC0A 3WIVA 3CTMA 1NF8A 3NTXA 4CF5A 2MSKA 5CH8A 1NDUA 1IN8A 1L5FA 1R0CA 2QRNA 2WSSA 2XD4A 2V97A 1W85B 1DTSA 3BE6A 4XX1A 3V1KA 5JH7A 1JFSA 4HQOA 3CBGA 3QKRA 5KPDA 2P6UA 1NG9A 3KSRA 4ND8B 5EE1A 1TVMA 2ACEA 1P0PA 2P2SA 2J46A 4EA6A 1Y3AA 4MGKR 1JKJA 4MJLA 5FOXA 1T36B 2QK4A 2RHMA 4K9DA 1GTJ1 4GUDA 4HDOB 2NO7A 1Q14A 4RACA 2PGLA 4LHEA 2HHHB 5JRDS 3EZ9A 2GD2A 2P2GA 3PD0A 4YRGA 3ASZA 5C4IA 3LFUA 2DZDA 1YFJA 5IVKA 1WCXA 2UVQA 5LC1A 1IZYA 1TA0A 2PY6A 2BHRA 2O1XA 2P0AA 1EBUA 1RMYA 1U0TA 1KMCA 5JDIA 3OCUA 2JLUA 1TF2A 2HJHA 4NSNA 1VI2A 5EIOA 1FNMA 2HMWA 1QK4A 3D6NB 2B8TA 3D3WA 4BFVA 4BKMA 5F21A 4B6GA 3FPHA 3IIJA 3GB9A 1JLSA 3FOBA 1KKLA 3ILVA 5E4JA 2ZZMA 4GLLA 3PQCA 4HYYA 2YX1A 3LBAA 1CR6A 3PPVA 2UYOA 5KINB 4C22A 1T1IA 3SIWA 1HH4A 2QSZA 2VAWA 5DLYA 2J31A 4FMDF 3QXJA 4H2DA 4QNMA 1YDWA 4FQ7A 1E3WB 5ESRA 3S2FA 3B82A 4NTZA 2ZS8A 1W5TA 3SX2A 3ECAA 3HUEA 1G6HA 2OGTA 4AJ2A 1SK8A 4ZYTA 3MF4A 1YZLA 1FTSA 4IDHA 4GE3A 2PBLA 3ROFA 1N9GB 1PGOA 4ZTUB 3FKSA 3DGFC 2Z57A 4F60A 3F96A 3R7DA 2HHLA 2XE4A 4JV5B 4N3NA 4OQLA 1RAIA 3A58B 2ATEA 2AIRA 2PLAA 2F9FA 2Q2WA 3S0JA 3CF6R 1ZAKA 4N9QA 1YJCA 4DJEC 1KYXA 4AW9A 1II8B 4MQEB 1ZIDA 4X54A 1YRQA 2D4HA 1DKLA 1NXVA 4PPGA 3RU9A 1XALA 4LDQA 2NN3C 2WILA 1KWGA 3CSDA 2GTIA 3GZJA 3FOAA 2YVKA 4LCEA 1P18A 4P1ZA 3ZS9A 3KVVA 4N6NA 4KC0A 3L0OA 3TZ6A 4F21A 1EWTA 4A2WA 1YVDA 1L7VC 1IHPA 1E5LA 3LW7A 4GC9A 3OOHA 2O2YA 2O05A 4X44A 1FLAA 3CJQA 1D09A 4Q5IA 1SCUB 1XZIA 2OZEA 3KJGA 4ZTBA 1KBQA 1NI5A 1XTUA 2V6BA 1KS9A 1FXSA 1LQUA 4QRDA 4RANA 3NPMA 3RYFA 5BQ3A 4ZOAA 5TGTA 4F6RA 2IXTA 3NIDB 5FTNA 1EJBA 1ODJA 2BMWA 2YY6A 3QFFA 2VQ3A 3T7AA 4DSOA 4INPA 3U26A 1DKPA 4Z51A 3ABSB 4REOA 4IZOA 3AEQB 3ANXA 1TJYA 4NARA 2BHLA 1YSCA 2F1RA 2G06A 3HEBA 4RZSA 8MHTA 2RSLA 4ZRNA 2CZQA 2FZGA 4QICA 1A3CA 3JVDA 3OPYB 5DIFA 3WJAA 5DM0A 2PMWB 2XAUA 4JBIA 4X1YA 1G7RA 3DZGA 5KUTA 3L92A 1RYDA 2D2FA 3JSAA 4JFAA 2XNKA 3KYIB 2VUUA 3CRVA 3NIWA 4ZMBA 1WU8A 1FMTA 2PJUA 3B6ZA 3Q6NA 4L8YA 4PWYA 1SZCA 4FXOA 4HGQA 3ZGXA 4RD4A 3D1LA 4QBGB 2BFPA 1ZIYA 4KR2A 1KYQA 4O59O 3K72B 1OIWA 1DJMA 1E3DA 4PFKA 5COAA 3U7QB 3OTWA 1U8ZA 4GYYA 1BX0A 2IXAA 5C80A 3Q5DA 3I04M 4OQZA 3RS4A 3QEAZ 5F98A 2A0WA 4HVTA 1ZOSA 3IEXA 3GUVA 4QT0A 2F62A 1IUPA 2HMAA 5EQJB 2X7JA 1N0IA 3DBHB 1B0PA 2LIPA 2W2QA 3I2KA 1YQXA 2GF2A 1FRNA 3K09A 2WWYA 1CIVA 3UFBA 4QFMA 3VVCA 4MP3A 1JQEA 1NP3A 3OHPA 3IUMA 5ITVA 5KVVA 4NAHA 1P0IA 3DPIA 4TVBA 4YEDA 3ZDBA 1GTSA 1R4ZA 4C01A 1TJ5A 2HTEA 3AY7A 4JHXA 4QFCA 4FGSA 2J5KA 4KO4S 4YMLA 1ZMXA 4PFQA 5HK8A 2C3MA 1ULZA 4CIBA 1VBFA 1HZZA 1QAQA 4TWBA 3HKEB 3IMEA 5C1IA 5EIWA 1GJRA 3HP7A 5BN3A 1MU0A 4LZPA 1AGPA 3SJBA 3I3SR 1N57A 3ZE2B 1TMKA 5BSWA 3W5UA 3JX9A 1U1CA 3KTOA 1NC3A 4JLNA 5CFPA 2GTHA 1HDCA 3KX2A 1ZGAA 3BKXA 4GYJA 1K8XB 3LJKA 1MIHA 4K9KA 4PHHA 3ETNA 3DP7A 4IDPA 2ZGVA 4CLEA 4ETMA 3U56A 1VG1A 1B8NA 4FLMA 3RFTA 3MAAC 5FXMA 3CN7A 3I1YA 5LMCA 1OI3A 3G0DA 5FPTA 3CLUC 2GKGA 2P9ZA 5JADA 5F9HA 5GOZA 2FX5A 2QN6A 3D7KA 4Z86A 4H15A 1N34B 2BGGA 1C4KA 3QHQA 5AWFC 3MFQA 4EFNA 2AQ8A 3MPUA 4QECA 1KDOA 3AM4A 2IPAB 4MHOA 2JFWA 4D3SA 4QL3A 4RTMA 3BIJA 4L16A 4Z0HO 5E7IA 3L4SO 2B36A 2BFDB 1LDYA 2V6MA 3E05A 4IUDS 2AGVA 1EFVB 4LWZA 4NENB 2Y1WA 1K8YB 5ECWA 1JAIA 4TTAA 4XIYA 4M6WB 4A5OA 1WUJS 3FWHA 4YPVA 2FDRA 2RG1A 2X19A 1N4DA 3TQFA 2OORA 3REFA 4EJSB 3H2SA 1N8TA 3M83A 3O2SB 1KEWA 3TLEA 3N7TA 3SOZA 1Y63A 2WKWA 2GBCA 3LKVA 3R09A 4QARA 1B41A 1P1RA 3VZDA 5JDCA 1H3NA 1OW3B 4CM1A 2OC9A 4A6EA 4YMHA 2H1SA 2VSQA 1VLHA 1C30A 3GYGA 4L8VA 7REQA 2CWDA 5C53B 3PNPA 2DHRA 2RH4A 5AT1A 1JHAA 1XLTA 1ZW1A 3W9YA 3G0BA 4CMCA 2Q46A 3Q0IA 3KQPA 4BCDA 4EF4A 2NACA 3OY7A 4G56A 4TXHA 4AMUA 2ZUWA 2JGFA 3ER9A 5BP7A 3K16A 3TSCA 4WX2B 1P29A 3C6XA 1A2OA 5EXEA 3T3GA 1J1ZA 4V1CI 2VTBA 1U28A 4ZQHA 1LEHA 1I5RA 2V7PA 3OA0A 3ZBPA 4WJLA 821PA 2R8PA 5K0BA 3GFOA 1FXWF 3D6FA 4F11A 2EWMA 4Z49A 1E64A 2M1ZA 4US0R 1UJBA 1LH0A 4DQDA 4AQYB 3DAFA 3ZLVA 4MR9B 3G85A 3NVAA 1NPTO 3RUDA 1IB6A 4TL6A 2VHXA 2HA5A 1E2LA 2QRHA 4H7EA 3MXOA 4RFSB 4B7ZA 1BE6A 1NGSA 1DRKA 2J07A 5H83A 1EGHA 4J9UE 1VIAA 3F5SA 3TVDA 3UMJA 4C6HA 1CR1A 3GXOA 2E4XA 3MJVA 4HR7A 4HQ6A 5L3SB 3CE9A 2X2FA 3IKVA 4IUYA 5ENVA 5M7EA 5I9TA 1D2GA 4O02B 2IH4A 1Q16A 4R1PA 3ZWYA 3LYLA 4G8JA 3FPJA 3OEWA 5DGXA 1BMTA 5AOBA 5IJ9B 2DPYA 2CLSA 1NP6A 2N0SA 3DMYA 1ATZA 5E7QA 4AJ4A 3U7FB 1MH1A 2HHAA 5GJVC 2ZI5A 2E85A 1V95A 1D6MA 2OZLA 4KQMA 3TR6A 4JUFA 1DBWA 2VO1A 3HYNA 3C3YA 3OD1A 2NYUA 2A6PA 3WE7A 4IRUB 4C03A 1UL1X 4IO0A 1CVRA 4L8GA 3GQBA 4PYLA 2XKBA 3AZOA 2B5WA 3DXZA 1O0SA 3F3MA 4NMMA 3OM1A 2B1RA 4MHSA 5C2JB 4TN1A 4P54A 4DBZA 7AT1A 4UUAA 3P2YA 1GA6A 1BRTA 5C1PA 4RVUA 3QIAA 3THYA 3L0YA 1ZGBA 4OBBA 4R9VA 1M1UA 2BFBA 1DUVG 2WC1A 4IIEA 1PJZA 1JALA 2Z83A 4E7PA 4RULA 2WYOA 1CQIB 1AVTA 1JL3A 5BUSA 2XI4A 1N3BA 4HOYA 3PNSA 2RK6A 2PXCA 2VL7A 4G0YA 1E5VA 2PSDA 1YCDA 1WNTA 4QPDA 2K2QB 2I7DA 1EUCA 5LVAA 1EDBA 2FSHA 3WGYA 3WLRA 1ZI9A 4H7DA 3WRYC 4KBYA 4C7KA 1MX5A 2PT7A 4Y1FA 1XDZA 3IPYA 5D3QA 4UVGA 4D96A 4TZ0A 4W6QA 4HSGA 2EFDB 2ZJ1A 1A5BB 2GO7A 2ZJ5A 4LDJA 4A0SA 3KKZA 5FBKA 3U61B 1XP5A 2EX4A 3ZHTA 1ZN8A 1XEWY 3OO0A 4ZGWA 1OC4A 1GZHB 4N5IX 1Z7BA 5LZ5A 4CV1A 4GVLA 4NONA 3DE2X 4A8JC 4G3XA 4JR1A 4OFXA 3CUYA 5CEEA 3HA3A 2IK8A 3JQBA 5EI5A 1Q1BA 2H1OA 3QITA 1AH2A 1M2JA 1HE8B 2BUBA 5KDDA 3IOYA 4N6OA 3PBKA 3O47A 1LK7A 3TXAA 2GUWA 1OYOA 1YBFA 3DOHA 2XADA 5BQOA 4L74A 2DR2A 2WUGA 3E81A 4PO8A 4Z9XA 5F9MA 1L8AA 1U7HA 1TEHA 1OBFO 4I4NA 2GLUA 2PWPA 1DAHA 5TNXA 2C84A 2DULA 3PHIA 4AJIA 4ESOA 3H1AA 2JLWA 5AOAA 1SEPA 1HWYA 5B1HA 1IL0A 1Z8HA 3DT8A 1C0KA 1FFGA 2GI4A 2VDQB 4N03A 4HMOA 1CQWA 5CDTA 1E69A 1PWXA 5JZMA 3IHKA 5IU6A 2PGIA 5AJHA 5GY7A 5H3LA 5M3BA 3GBSA 4JQOA 1IY8A 1QGUB 1R0KA 3KAKA 3P32A 2BRUC 2ZCJA 1KRXA 1HA3A 1R6BX 2NU9A 3SMQA 3NKVA 2H54A 3CIOA 1HGXA 1N6NA 4JEHA 5EYPB 4QBHA 3ZCRA 5LA6A 4JJEA 2V65A 1ZXLA 4NZYA 3QVUA 1R64A 2I78A 1SUEA 4WNIA 4CIVA 5A3JA 1DAMA 2JGKA 4KDCA 2BMJA 5JMWA 3LO5A 1ESZA 1TK3A 2GA9A 1GPBA 1I3CA 1PJ8A 2X7XA 4GPEA 4S0ZA 3X1JA 3ZW7A 4LJKA 3ZHQA 3GGDA 1RJDA 1HURA 5B1IA 3OT1B 5LQUA 3GYBA 5EN4A 2IA5A 3KTFA 3WGZA 5CA1B 2J0SA 4Z2YA 2JZOA 1J33A 3PGMA 1J8QA 3VH1A 4W5TA 2I7TA 4IWNA 2ILVA 1SFRA 4CTNA 4C2AA 4TL9A 2OHHA 1DMSA 4RKWA 4MO9A 2XUZA 3EZFA 4IEIA 4YRBA 1PGPA 3COJA 3RRJA 1TJPB 1EGMB 1MBZA 1KERA 4E5SA 1ZH8A 3TNYA 3L0IB 3KC2A 4IOKA 4MAAA 3RVMA 1OBHA 2IZ7A 4DNFA 2PFKA 5EJ2A 2GF0A 3L4BA 2DT5A 2G71A 2IYWA 1Y6FA 2CXUA 2XNSA 1XCMA 3WWDA 2OAQ1 4WY5A 3WWYA 5C4MA 5K03A 2LBPA 3KZMA 1YZGA 4F9FA 4D7AA 2IX3A 1RHMA 1P2VA 2BLNA 3OPXA 3PZBA 1AQIA 2HY7A 5BN4B 3KB2A 2O2DA 4J4BA 4MI9A 3ROMA 3ENWA 5ALMA 4F4HA 5BV8A 3IVGA 5KKNB 1RLUA 4MCAA 1JIXA 2XR1A 1SWVA 1XLUA 2IXDA 1I4LD 5JI3E 1FFCA 2Z9DA 1ZLXA 2HIMA 2BZGA 2WP8J 3GAMA 4KHZA 1K88A 3K5PA 2Y2UA 3OKAA 1M1XB 3RHSA 2Q6TA 2O8NA 4C5BA 1LSJA 2MWMA 3L9XA 4JB8A 3FZYA 4RSGA 3DA8A 3TAXA 1G6OA 1K3TA 2HMTA 4RO0A 1RJEA 3V4FA 5KNDH 4K9OA 3DCNA 4W1RA 4MGYR 3DBRB 3DB2A 1H2BA 1QJCA 1K8ZB 1F3LA 3L07A 1NU6A 4CMIA 3M4NA 1VIVA 2GEBA 5LXTF 2JGDA 5SYAA 4ZKEA 4N76A 3TMYA 3L7LA 1XAGA 2EZTA 1VP3A 2H9IA 1AS3A 1W19A 2BV3A 5BWMA 3NV9A 2G5GX 2Z1NA 3L8HA 3EGIA 4CNQA 1D2NA 3OIYA 1GSIA 2NXCA 3THXB 2I7CA 2VUSA 3Q9NA 4J3FA 3IV7A 5CLJA 1QYVA 4BKQA 1Z8FA 4L76A 1TO6A 3SEAA 3K0CA 4V2IA 1BGWA 1WXDA 4GI5A 4X6LA 5UKDA 4EGFA 2L2QA 3TM5A 2H4ZA 5JPCA 3W77A 5D2CA 5HS4A 1N5JA 2PRKA 3FCCA 2LXNA 1U2TA 2NZWA 1HNXB 1VECA 1KOJA 2SHKA 2VP3A 3AJEA 3Q7IA 1T3SA 4LC9A 4HYEA 5D86A 4NU6A 1YJ5A 5TQ2A 2H07A 3VNSA 4GRAA 4MGZR 3WMRA 1O96A 1PGQA 3VR3A 5FEUA 1US8B 5KSYA 5A62A 3NM5A 3AILA 2PVSA 3ZGOA 4XQ0A 3GNTA 5JPDA 4UUQA 1ZX1A 1LK5A 3NIBA 4L4UA 1SG9A 2YN2A 3TL3A 4BU1A 2ZJZA 1CR4A 3D02A 2BKXA 4I19A 1XQYA 2BVNA 3DKVA 1MQAA 2QDXA 2KLHA 4FKBA 4JBXA 3UATA 3ZIUA 2VPWA 2DQSA 4D97A 3QF7A 3PPWA 2C9CA 2VPIA 3NHWA 3PC7A 1X39A 2YV3A 4TV9B 4YAFA 1XEAA 2HWWA 2WU8A 3C3JA 1PEDA 3EVNA 1FSGA 3D3QA 1N5IA 4N48A 1DJOA 2O2XA 5HJ7A 1DCKA 2BPOA 2CB0A 4L6AA 3HKCB 2NO9A 4L9WA 2FPLA 2YHUA 4N0PA 4RSHA 1KEUA 1IVNA 1ZGCA 3WL8A 1OLOA 3IMKA 5EIAA 2RJ3A 3TIFA 5B5SA 3ZWNA 4R1QA 4GBJA 4GX0A 1S2LA 1H1LB 4YCAA 4WA7A 2O20A 1MN6A 1Y8QA 3GBVA 5DV9A 4IBOA 4M1YA 3WL3A 3AETA 4LZWA 2FG7C 3MD9A 1UK7A 3LV8A 1I6WA 2CLOB 3I5XA 3DQPA 3PYMA 3NBAA 4PG7A 2FQYA 5F5XA 3VDMA 3FOWA 1C4WA 4E3WA 3FWPA 1EWQA 1T5OA 3AR6A 5FR2A 4AD8A 2BR5A 4M9CA 2YNMA 3WZMA 5JATA 4JLKA 1S3GA 4NMXB 4RNDB 1ORHA 4XRGA 1E2PA 1T9CA 4LFCB 1ZI6A 1HYBA 1T9DA 3M82A 1GRCA 1UDXA 1FUUA 1UKCA 3H1GA 4I1UA 1ZXXA 2V0CA 3HJRA 4JVNA 3E5NA 4KI7A 4BYMA 5HKKD 2UZ4A 2QYHA 2RK3A 4OFZA 4DV2B 2MINB 4MGEA 1L3BA 2DU8A 3CX6A 3CW9A 4F38A 3OUZA 4OI2A 1RAFA 5HE8A 3X1MA 5L4SA 3VZCA 4BRWA 2E21A 3EEQA 2WI8A 2PX3A 5AVRA 3NBMA 5A7FA 2ZJ4A 3WTBA 4Q9HA 4GKBA 3QGMA 4XJSA 3CNBA 3WYDA 4E4YA 3KXDA 1T9HA 2TSYB 2B2CA 5H9VA 4I36A 3LUAA 3FSGD 4KFCA 1JJIA 2CL0X 5BWLA 1VJ0A 4DIEA 1JFRA 2VK8A 3D6UA 4G07A 2WAAA 4GUAA 4HPXB 4BCBA 5I7HA 4F3TA 1NN3A 2V6IA 3U7HB 1AU9A 2KI5A 1SIOA 4KB5A 1BCSA 1PW5A 4OOEA 1DO2A 4HNAB 1BQ3A 1GPJA 5EXPA 2VPZA 3TGPA 4XWWA 1C9KA 2COKA 1UBEA 1Z83A 2FPIA 2EFCB 2NW6A 1KR2A 4Q7QA 2AFRA 4L72A 1DJQA 8ADHA 1V37A 4WXYB 1QMPA 2JLVA 3ZZUA 2FCAA 2FPUA 2WJHA 5IS2A 2VZEA 4N3CA 3NEJA 4GMGA 5IM5A 1J0BA 3PLRA 3GO4A 1XDBA 1EZ4A 2IYYA 3C3AA 1ZYUA 4F5WA 5AVZA 3KTAA 2IEZA 5T5QA 1G5IA 1HKUA 1KYWA 5KYNA 2V7EA 3TBHA 5A2QA 2HRZA 1XZGA 1FDWA 1XQXA 2FPSA 2H2IA 4RK5A 4Y2YA 4DARA 1G5FA 1PFVA 1QFJA 3JQFA 4JNCA 4RF4A 4EELA 4ESVA 4ZAVA 4PNZA 3FW1A 3UVEA 4KGZA 3IOCA 2R79A 5KSOA 5ITZA 3NRCA 1ABBA 4MVCA 5C5IA 3CVOA 4WZAA 2QT0A 3UKOA 2YV4A 5J58A 2WJJA 4AJ1A 3HVIA 1JIVA 1JQBA 1YRWA 5EKTA 1R0LA 5HUQA 3RB8A 1CQJA 2NYRA 3NIFB 1JQ5A 5A5GA 5GVRA 2XWBF 2I2CA 4HAOA 3ZJ4A 5EHZA 1QNLA 3QPDA 4QDOA 4L0QA 1SXJA 4HC4A 4BQPA 4I5EA 4JYMA 4UMDA 3D7LA 1HQYE 1PN3A 3AUXA 4UKDA 4UVIA 3SI7A 1BO6A 3KYDA 3AUKA 1E7YA 3HDGA 2B2XA 5CVVA 2WOJA 4PCLA 1UXIA 4JP5A 1FP4B 3D4BA 2VK1A 4LJ7A 1GP2A 4S3MA 1LFDB 1KP2A 4KQHA 5D7NA 3DKKA 3TLBA 3MEQA 2GWRA 3KXPA 4EYSA 2CL6X 2GN6A 4JS0A 4P33A 3E9CA 4QASA 1T26A 2BSAA 5CM2Z 1XJ5A 3BFKA 3KKNA 2C99A 1F1BA 3VR5A 2A9PA 1SM4A 2KJQA 3DLHA 2AZMA 1LC3A 5ALIA 3AO0B 2EJCA 3KKMA 3RIYA 3QNMA 4GR9A 2JAHA 3KT3A 4X7MA 4YDRA 5DM60 2GZSA 3RHTA 3P45A 1WVMA 3C43A 4I8DA 4Q1CA 2X58A 1B6RA 3GQVA 3OX1A 4KLRA 5IX8A 3LBYA 1RM3A 3GGJA 1DCFA 1Z5NA 2WD7A 4NEQA 4X7RA 3V33A 3PF8A 2C0QA 2QN8A 2WMOB 4QU8A 1EFPB 2AFHA 3UM9A 5BUZA 3NKFA 2NNLD 4JLJA 2R6GA 3SNKA 1R6VA 4LF6B 1ZJ5A 3MAJA 1TVKB 4NOLA 5FLYA 1FC0A 1YZTA 3M4YA 3WLNA 3PYXA 4KFRA 3PNMA 3OC6A 2HRCA 3HRIA 4BNIA 3BREA 1QWSA 3DMPA 2DG2A 1VIMA 3QJ5A 2XTNA 3WK8A 4D1YA 3PIDA 5HIAA 2PX6A 5CA0B 2BI7A 3JD2A 2WJ3A 4KQ6A 1L0BA 4PYRA 4BFTA 3HRHA 4R0NA 3GVXA 3SS8A 4ZEVA 3WB2A 3NVKI 4O1IA 2QYSA 4N39A 1DLJA 3DDOA 2EW2A 2B34A 1X9IA 1G2QA 3KPVA 1ZK4A 3N6VA 4MYSA 4QVIA 1GFWA 4D46A 2ZIAA 3BKWA 4W9NA 2OCIA 3R3SA 1XZAA 2JFGA 2F8SA 2FPGB 3LC0A 3WTCA 2IYNA 1H6AA 3G13A 3FDZA 3I01M 3VAZA 5B12A 3ZWAA 1WP4A 5IDWA 4CLOB 1QKIA 3ZXUB 4PZ0A 2H1VA 3I9V6 3K1TA 4YRRA 1R12A 1SA0A 2Q8PA 4WESA 4WDRA 4Y2PA 4KTVE 4RD0A 1YB2A 2EEPA 1TU4A 4LWPA 3T5AA 1HE2A 2D7CA 2QTWB 3I6ZA 3PWZA 4NBTA 3SBDA 3AR3A 4U7PB 1GV0A 1M2VA 4P38A 4CIXA 3MWGA 2JIOA 1M1NA 5DYYA 4IMIB 3JV7A 5IJXA 5MDHA 3SFTA 1CR2A 1ZZGA 1LDNA 3HB0A 1T1GA 3E03A 4DMRA 2FFQA 1TMOA 1C0LA 2WA1A 2F64A 4PAQA 3AF4A 3QK7A 4RABA 4AO8A 1V9CA 4DSAA 1SIBE 3FMGA 1SY7A 4R1NA 4DV4B 4O3FA 4DSNA 4DY4A 4PRLA 4TL7A 2H85A 1DTWA 5BURA 1R37A 1KJNA 1NUQA 2QTVA 2WYVA 2ZR8A 2BFCB 3U4MA 1KDVA 5KTTA 1XJCA 4FIZA 2WUDA 3ODGA 2V3WA 1KIFA 3QBDA 4GBGA 4HLUC 4I1OA 2A9KA 3HB1A 1T1EA 3P9SA 2QZ9A 4JI1B 1GVHA 1DQPA 2JJ2A 4F2PA 4PGAA 3P9KA 1IB0A 4EH1A 4ZOLF 5IF9A 3RVPA 2YWDA 1KAEA 4FJ1A 2UKDA 4L8FA 4OX9B 4CI9A 3HB4X 4ZV7A 4LBYA 5CIWA 1OAOC 3H05A 1IATA 2KYRA 4ILKA 4FNGA 1IRIA 2R1VA 3JAWA 2G08A 1KEVA 2XOKA 3E22B 3KWFA 1QHXA 3ZDFA 3LXRA 4JHLA 1AB5A 1I51A 3O8OA 4PLPA 3UFXB 2BW0A 4LZJA 2FR8A 4KODA 1GCAA 3NS7A 3N2KA 3PT5A 4UBOA 5JYEA 2QB5A 3PQ8A 3GZNB 3JY6A 3L41A 4ZMRA 5P21A 3IUNA 4HVAA 1Q0SA 5JBIA 2IEDA 3DDUA 1YIAA 3JD3A 4PZ9A 5IYZB 3UJ7A 4EG5A 4IR7A 1RAGA 4WLOA 1ODCA 1OTHA 4MVJH 4BTVA 3EY4A 1J25A 1HZJA 1WXWA 1DOAA 1E59A 3CNNA 4JUIA 1UMKA 5JO9A 3RS7A 4Q37A 4O2BF 1IM5A 2GRJA 1SQ5A 2H2GA 2ZRJA 3L0PA 4LEIA 2BFFA 3WLMA 1QBKC 4WFJA 4FFPA 1QVWA 4AS1A 2B8NA 2H0AA 1UDRA 1N3LA 3FKQA 3VPXA 6REQA 2B37A 5JXJA 1VFPA 2O7QA 2PLNA 3R3JA 4XWYA 1KJIA 1WV0A 5ILQA 4ZHSA 5CBPB 3FPGA 2FW7A 3IAS6 2GXUA 4X6YA 3TEFA 3D7NA 2ZWPA 3WQQA 1W96A 1J5XA 2ZB7A 2AR0A 4JZYA 1HG0A 1UZLA 2G5TA 3P2KA 4Y2UA 4DWJA 2JLQA 3W5VA 1OLXB 5J43A 1VM6A 4OM8A 1P33A 3UMMA 2RHOA 3CJTA 3GT0A 4QOGA 1L7EA 3L5KA 1P6XA 1TADA 4KYUA 5T8KC 4EPYA 4BLVA 4BFUA 1PVOA 3N8GA 2Z04A 4UTZA 3ISJA 1OXBB 1WULS 2ZE8A 1VOTA 2IX9A 1L7NA 2P90A 4JU8A 3FTDA 2H52A 4PG5A 1U98A 2FZLA 2V1XA 5KQRA 4AKHA 4LFBB 2H9YA 1QNFA 5KTRA 3HVUA 4NU0A 1IIBA 2OZVA 2BTOA 5MN6A 1ZD1A 1RM0A 3BDIA 1ZZEA 3D4NA 2AYXA 4I50A 1G42A 1R66A 2ZEJA 4FHZA 2VNKA 4H7IA 3ZDYB 4G6ZA 3K2EA 1JDZA 1ILEA 2ADOA 1Y5LA 2XV1A 2F43B 3R7FA 5MHTA 2ZT8A 1YO6A 2NQTA 4G1EB 1QIDA 3IB6A 2HA7A 1RQGA 2D06A 4O4HB 1G8AA 2VZLA 4ZO7A 2QX4A 3VSDA 3IDSA 1SXGA 2F1JA 2ZOSA 4PLZA 1JQLB 4K2HA 4N8SA 4PINA 4EITA 1ACLA 3P71T 3LFTA 3T1VA 1X6VA 3A3NA 2DAPA 4QZVA 3O2NA 4D9HA 3HR8A 3QTLA 2GBIA 4U6QA 2OM2A 1DKRA 1YOBA 1LLUA 4J6EA 4I66A 1XWIA 3W7VA 3VU1A 3JU3A 2NZVG 4L5JA 3T7JA 5LB2A 2ECOA 4BCCA 4C7MA 4OQQA 4Y6RA 3K70D 4V0NA 2XZLA 4IY1A 4ZVVA 3ITDA 2FQXA 2R87A 3AL2A 1NVFA 2X1VA 4I4TF 4HNUA 1VRCA 1PZNA 2J6BA 2D5CA 1XF9A 5GJBA 4MVJE 3MIZA 3WYAA 1AQLA 3BZUA 3KP1A 4CCYB 1KOGA 1IU9A 2GNPA 1PAUA 2O0MA 3K0SA 3X1WA 3F6RA 4KLZA 3T3DA 1KDRA 3LQFA 4B3GA 2AD1A 4LRWA 4CGZA 4E4RA 4B3XA 1J2JA 1E6LA 1GTL1 1JA0A 2UYYA 4J43A 4A6PA 4CLHA 1BH2A 2R8XA 3FJYA 1IPEA 1JLMA 3H13A 3TE6A 3WWEA 2DFPA 2BZ1A 4EDFA 4I1PA 2P1DA 1QQ6A 4TKUB 2QLNA 4MX8A 4IKPA 4AUKA 3AUAA 5K1ZA 4OI4A 5IAKA 3AHHA 1TFRA 2D2XA 3W6UA 4K6KA 4UATA 4E09A 4GM0A 2Q7OE 2QR2A 1RZ3A 4YCDA 5A4IS 1XFDA 2B2NA 4WBNF 4YMSA 1K08A 1R5BA 4AJLA 1RWNA 1SHJA 2W2TA 3G5LA 3PUXA 4FP9A 5DFAA 2BHSA 1GZ7A 2VNIA 4L5AA 2Q2NA 1YR7A 5HZKA 2CKMA 2BD0A 2QTTA 1HEUA 2F8MA 2W43A 2Y1LA 3EG5A 3H16A 3BD9A 4N1AA 3S2ZA 3VPAA 2WV7A 3TM4A 2G04A 1CU1A 2XUFA 4LDZA 1S1CA 1FRVA 1N1EA 4G37A 3SQOA 4JYAB 1FA9A 1FYEA 3KXLA 2ZIXB 4LJ8A 4QUHA 2FXVA 2NGRA 2WLTA 4FYPA 3GLHB 1ITZA 2YRWA 4L07A 4UCWA 4XFKA 5I7AA 3C5EA 3LDHA 1W4AA 1X86B 1ZUIA 2VSNA 2HJRA 5TQ0B 3HA2A 3R8XA 3SDSA 2Y1OA 4EG0A 1T10A 2FP4B 4FHFA 4URZR 2ID8A 5JANA 2QXTA 4AN4A 2JZNA 2IUYA 3ENNA 3B1WA 4I08A 2HXYA 1JI0A 2HJVA 2NYVA 3UOGA 3B9BA 2YWXA 5E9JA 3CM0A 3BGDA 1G4HA 4OH7A 5E1OA 5AVJA 3TOVA 1E4OA 3J7AC 1QYIA 3GJ5A 3G5MA 2CFOA 1Y4DE 2QE7A 4NF2A 5ALGA 3UAXA 4AJNA 5AI0A 1M6VB 3KE8A 4AI6A 2X9GA 2I2BA 3D54D 2G6TA 3L6DA 4V0LA 4OX9Y 3OJEA 1RMQA 4HS9A 3TVTA 5FOUA 3V3KA 5GM1A 4AB1A 3FUXA 3L7CA 1OLUA 4JB0A 4HLDA 3G59A 3UANA 4XQCA 3VKWA 4ZRMA 4RKRA 1RYNA 1WDWB 2HQSA 2JIZD 3LQ1A 5KPJA 3PX2A 1UKBA 4RF5A 1JYSA 4H0CA 3A1SA 4WWHA 3HKBB 5D6OA 3IALA 4MUGA 1NXTA 1F06A 1G8SA 4MS4A 4Y6LA 4FFLA 1J8DA 5KTNA 2M2IA 4MNTA 4GZ6A 4LE1A 5AW1A 1ZMTA 1PX2A 3V4PB 2JH8A 4FEGA 4QAJA 3WGUA 2HL6A 4IVPA 5A4DA 4KCGA 2YHSA 2J3IA 2PJZA 3SLRA 4YCLA 4CM8B 4D4LA 4L9RA 3L2OB 4Z5XA 1PS9A 4FR0A 2Q99A 4ZD6A 5TIIA 3IJ5A 3WLJA 3FSEA 4RIGA 3GGPA 4IYJA 3OQ6A 2IY7A 2O4UX 2OD2A 3AF6A 3P0IA 1QHHB 4B2PA 1MB2A 1H69A 2QZ4A 4TLLB 2O50A 2OV2A 3LHFA 3TN7A 2BSQA 3CR7A 3RS8A 1QTIA 3QP9A 4K1LA 3OZWA 4U00A 2FPPB 4DAEA 2ES4A 4FLFA 4RVHA 3PENA 3AEKA 4ZO6A 1DC7A 4G0OA 3SJAA 5DHQA 3OZUA 1EKXA 2BONA 2XQGA 2Z1DA 4QATA 1SIWA 5DYWA 4D42A 2YZMA 1QLHA 3W9BA 1HYGA 1HYEA 1ZUHA 5F33A 3R5FA 5DNVA 4S1WA 4MWCA 1TKBA 2UXBB 4DV7B 5H4GA 2QVYX 5A4MS 4WW0A 4N65A 4F4IA 2JEYA 1CERA 1RWKA 4MI3A 3DOIA 4BMOB 3INGA 1NQUA 5E7JA 2HW8A 2XWPA 3PG5A 3R40A 2J30A 1JR4A 1LF5A 1Z16A 1UMBB 2A3RA 2I62A 2BF4A 1N0UA 1EVQA 3PGXA 4GMFA 2B1IA 4R2HA 4M46A 1AC5A 5I3ZA 1U5CA 3C45A 4I55A 3GAAA 1U94A 1ZBDA 4WBXC 1QCCA 2H9AA 3SSNA 3I4LA 2W6PA 3PLAE 2X4IA 1HE4A 2YJNA 3VBCA 1Y4AE 1TRHA 4PIVA 4HDCA 1LS1A 1Z0DA 1MC5A 5B4TA 3HYRA 1WUYA 4ID3A 2HCFA 4MUIA 1T8TA 2HH9A 5K01A 4QJIA 4EFDA 1AKQA 3VZPA 1IQUA 4NBNA 4Y9DA 4KRGA 3BMOA 4X97A 2WMYA 3AF3A 4OGWA 1QIMA 2HJGA 2IIQA 5G4LA 1ORWA 4DSUA 1V0JA 4YP6A 2X1HA 3FFXA 4QT4A 1V2GA 3QSGA 1VKHA 3RVLA 1W46A 2ON6A 5IUJC 4LK3A 4D9CA 4Q4CA 1AGNA 1NJFA 3I1JA 4IDQA 4RF2A 2BZSA 4RDXA 2G4VA 4AX8A 5JMOA 1Q22A 4RDIA 3ZGLA 3U5ZB 5L3VA 4BXOB 1BA3A 5AI6A 2O54A 1U99A 3MAGA 1G7SA 3WVNA 4YJDA 1KEKA 4HX2A 3HCFA 4FDVA 4PIMA 4E70A 1JLHA 2J5XA 4MDEA 3MCWA 5AJVB 5DHPA 1NLFA 1NLYA 4P32A 2VH2A 5IN4A 5LN1A 2A2ZA 3A7EA 3ORHA 3QBTA 4KIJA 4YQYA 5LDGA 1NBMD 4EMSA 3EZGA 3C8ZA 1T9ZA 4GP9A 3DTVB 3X2SA 2YMMA 3E6AA 3PP8A 3Q12A 4LSMA 3COZA 1LQTA 5G0TA 1JKMA 1GZ6A 5PNTA 1T4MA 2WWTA 1VL5A 3O2JA 3GLIB 2PX2A 4O4JB 3AM3A 3EH2A 1RQNA 5L9AA 1Z35A 2PUVA 1YXMA 3F8SA 3ZWCA 4AZTA 4WQMA 2I03A 1L3CA 2WIDA 1R5NA 2V5VA 1NOIA 5F5LA 5FHQA 5TPWA 3UYLA 1HQKA 3WDSA 2XT0A 3PSHA 2ESRA 3S1AB 5KKAA 1E2JA 3F3KA 1EDEA 4QELA 4M7PA 4CQLB 3E5MA 4B6OA 1QG2A 2BZ0A 3IUEA 4XDGA 3TSWA 4ARCA 1GL9B 1AUOA 3C5CA 3ON5A 3RS0A 3B6MA 5L3QB 4J4TA 3C24A 1KO8A 1W49A 1FZTA 4J2TA 1DV2A 4P34A 2YQZA 2IYAA 1OXKB 4E1VA 4EO4A 5LP6B 4LRQA 2IYQA 5ADVA 1AS0A 2E37A 4OA5A 3Q7QA 4TX1A 3FGOA 4QX6A 2FSVC 1KC1A 4GOOD 4X00A 2DLCX 2OCGA 2PWAA 2R8OA 2UUAB 1Y6JA 4K0KB 1INLA 1D07A 1KNQA 2VWHA 4P82A 1VLLA 2B7BA 3W3AA 3RVSA 5E4TA 4IFBA 2FA9A 3MINB 1O08A 1YB1A 3DDHA 2W6NA 1V47A 2PUGA 4FOLA 3ESAA 1P5JA 3IBTA 1USWA 1ZOPA 4R81A 1DJNA 5I7WA 3SNHA 3B70A 2HO4A 4E08A 4O6VA 1WY7A 2D7JA 3DM5A 4BTLA 5HBGA 3QWIA 3G9XA 4IOJA 5TVGA 2W2XA 4KH1A 5T3YA 1C8LA 3GLHE 1VB3A 3KZVA 2P8SA 3WFJA 1KQPA 1T3GA 2FMXA 2WSIA 1GL3A 3NB0A 1D4FA 1JFTA 5TY0A 3NVMB 2L82A 1RHJA 2PANA 2Q4RA 3NGLA 1SCDA 2A92A 1GPYA 2FZCA 2XDYA 1AGXA 4JJIA 4KXWA 1M5UA 3N75A 3RFUA 3UJCA 4EG1A 1ULTA 3CLHA 1SBTA 1L1EA 1KAGA 3PVZA 4AZ3A 5A1JA 2QRMA 5KWVA 1E1RD 2V4UA 5TPZA 1E94E 1UFVA 2OHXA 1GPAA 2CNLA 2WLSA 3M70A 1TAGA 4WZZA 3KQHA 5JH7B 4IKEA 5ENDA 5ADUS 3ABQB 5EKUA 2IKQA 5I7EA 3QKRB 1C9NA 2Q9AA 2R00C 2XRFA 2ZRKA 3AYZB 3H42B 3RJ9A 4B31A 5JEDA 3ONVA 5FO0A 1KMIY 1ZM4A 2PMBA 5AIAA 4R51A 5JWHA 1DWPA 1ZN7A 3H2YA 3OETA 6ABPA 3OJFA 3TIXB 1T15A 1JKJB 1OYYA 1SB9A 3WI7A 3AEYA 1J99A 4F91B 3C14C 5EWLA 1E2MA 1NXQA 1WSDA 4DDKA 1NR7A 3A06A 2QTHA 2VCYA 1XD8A 4F84A 1F17A 1PJQA 1HE1C 3MWJA 1SVKA 2MOKA 3BK7A 1IQRA 3V7NA 2K5UA 3ID6C 4MWZA 3HWRA 4IEEA 3IXQA 4JJ7A 4OP3A 3T8YA 3U3MA 5KQSA 3EVFA 1AUQA 2IHBA 2BDEA 5DPMA 3AQ4A 5SZJA 4A5SA 1O1YA 3OIDA 3BCSA 3EDCA 1NW6A 2DHCA 4N5MA 1DL5A 3FPBA 3D3WB 5EJ7A 4YQZA 4QTUB 2FMKA 2V5AA 3WSVA 2GN4A 1O77A 3KJNA 3V9AA 4HEJA 4EW3A 5JAPA 2GD0A 2VTKA 2CXRA 4C0WA 2O8DA 1ID8A 3GGSA 1V2HE 2I29A 1KH1A 4JUAA 1DDOA 1E8NA 3F1LA 3HR7A 4OXKA 1Z45A 3EQ7A 3IV9A 4U7FA 2H1LA 1UAAA 1ZUNA 1NURA 2F00A 3LU1A 3AFIA 4QGFA 1OHHA 2P4SA 4CU5A 3LLUA 1NT2A 1YI1A 3M6AA 2O3JA 4HQLA 2XQJA 3M3DA 4F5YA 1OH8A 3A14A 3C97A 4K6CA 1H8EA 1W52X 3OJXA 2R25B 4K9SA 3UXEA 3MCUA 4MWSA 4ND7A 4UM9B 4I3FA 1VMEA 1XTRA 3O8QA 1M83A 3QX8A 4P3YA 2G6BA 4HNQA 4YBRA 3TMAA 4ZDIA 1UEJA 4Y2GA 1DFHA 3F6CA 1RYFA 1JXMA 3F8WA 4E31A 4WOJA 3OCJA 5IDVA 1MR3F 5I5EA 1C1HA 1IN6A 1HNNA 1GSOA 4MW2A 4L5CA 1OPXA 2PXHA 5LJIA 1D1QA 1QIFA 2CNWA 4NWIA 3V1YA 2ZSDA 4ZCLA 4RZQA 4RJ2A 5EQFA 2P3OA 1L5NA 1O6GA 3RS5A 1I14A 4N5DA 3D8HA 5CK4A 4TZ6A 1NNLA 4BVLA 3CR8A 1FDRA 1Z5ZA 2QQGA 2EWVA 3O7WA 1IXZA 2WUEA 4RNCA 3SZOA 1AGRA 1Y0BA 4PAWA 3F4KA 1LPNA 4HFRA 2RCYA 1R8JA 3O1LA 1NM5A 3TJMA 1Z7YA 2A58A 2C78A 3QU7A 1JNXX 3V55A 5JAZA 3O91A 1JN0A 2BBOA 3HDTA 3HCAA 3AHDA 3RYFB 4F6RB 1VB5A 1PYDA 4ANFA 2R44A 1RTKA 2GPTA 1C9YA 1FW8A 2KHZA 2VEDA 4QUJA 4MUMA 3JRNA 3IOBA 1WRBA 3KKEA 3P0HA 2PTHA 4JT2A 4XWTA 1M0EA 3VKGA 1RBZA 2ZVPX 3D81A 3DAPA 3IUBA 3OP1A 5AKLA 3V8VA 2W48A 1JQDA 4O2AF 3R7SA 4C6TB 2IOYA 4MITA 3ZDEA 3ETHA 4MQLA 2X9VA 1UWLA 4X1YB 3ZQJA 2QL7A 1MJFA 2YOFA 3DDZX 2DUWA 3DZHA 1Y3IA 4RVDA 1KK0A 2VBGA 4XUDA 3ZIAD 3MLEA 1RWVA 5A5FA 5HKAA 1O8CA 1ENYA 2JIZA 2JJ1D 1GYQA 3CZCA 5CRIA 5EVCA 5FBLB 3GLIE 4IVNA 5KNCD 4DXHA 3Q6MA 3TG2A 3IS3A 2AWNA 4EO9A 3TR0A 1CNMA 2WG1A 5FL3A 1BHJA 3BA6A 2EJBA 4DG8A 5GPBA 4MQ4A 4ARZA 1JMVA 4FFRA 3WIDA 3GY0A 4Q4LA 3KZCA 1OI2A 3PC4A 2ZULA 3VR6D 3BMQB 1BIFA 3DW3X 2R96A 2VHYA 4JKOA 4R05A 1KYIA 3C6ZA 3R77A 1ULUA 5FULA 1IAQA 2JZCA 4DIUA 1BMQA 4URHA 2BGLA 1B15A 4RK6A 1RIFA 4MLCA 2ZKLA 1WL8A 4HGYA 2ZPTX 4L3VA 2VT6A 5EP2A 4NMHA 1XYGA 3H8VA 4OYRA 1GTRA 5ILGA 3JWGA 4BJ1A 4OSEA 5E9AA 5F7JA 2KQUA 1Y3CE 2Z4TA 2W90A 3EDQA 2PKCA 2OXCA 2C9OA 1C8KA 4POOA 2WJGA 3FUTA 4JBWA 3ABZA 5JCJA 4I1SA 4BX8A 1P8JA 1V8OA 1RVDA 4UULA 1CF4A 2C7GA 3A9TA 2Y0CA 3P9ZA 4ARSA 1IYZA 1U9YA 5EMHA 1IJKA 4JLWA 2OFFA 2EFGA 1MAWA 3NHAA 2HDNB 1LCIA 1L7DA 4QJ4A 2JL1A 5E8JA 1DAPA 2HU8A 3L82B 3CF0A 3U7GA 1KI2A 1GM5A 5BN3B 3FX2A 4LY6A 1GAXA 4E22A 3K6SA 1P2SA 4QE3A 5FCDA 5LQDA 3T15A 2F3RA 5IH3A 5KMGA 1Y42X 3EGEA 2P4HX 2ZVDA 4C5CA 1Z2NX 4M76B 4AF7A 1JX6A 1RI1A 4B3MB 3Q4GA 1MTOA 5A5VA 1DCTA 3EF3A 3IJPA 3RT1A 1O5IA 2QTRA 2DKNA 3KHKA 3ITNA 2CUZA 1M5TA 2HB6A 3NT2A 4MP6A 1VPEA 1HDOA 3QVVA 5CDYA 4X66B 5JHHB 3KDPA 1P4RA 2IOHA 4BFLA 1CUDA 5LZ7A 5L7YA 1PTJC 1USKA 2H5LA 4F8YA 3EQ9A 3GRKA 1CUZA 2AKAB 2OD9A 5CGQB 2HJWA 3AHIA 3B6JA 4FGZA 4ILEA 5EPOA 1YBVA 4KFUA 3S29A 1M1ZA 2ICAA 3I4FA 1YFKA 3UJAA 3QBVA 3M6FA 2H29A 1EJ6A 1TEVA 3E5RA 2ZM5A 1VCOA 1FYWA 2P30A 1Q95A 4JP1A 3B3QA 4NCHA 4R8VA 3RFXA 4EQ6A 4OYYA 4KUEA 3EG9A 1WSWA 1T29A 2H2WA 1C7QA 3NBFA 5DB4A 2ZUDA 1Q2UA 1C30B 3IR7A 3DBLA 1NBMA 7REQB 1OB2A 1IONA 2CEAA 3AW9A 5AHWA 1S3SA 4RXUA 1TYZA 3IT2A 2WFMA 3UOAB 1AZWA 1XTJA 3OZFA 4M0DA 3SE7A 1JHZA 3KU1A 3QUBA 2R7KA 2UXCB 1PWEA 3AUFA 4GP6A 3U6KA 3QFSA 4JIMA 2OXEA 2ZB2A 5KYKA 3HCOA 2WSYB 1M8GA 4PCUA 4C07A 4B6JA 3W9UA 2VTBB 3F6PA 1RZUA 2Z8ZA 3N5CA 1FK8A 2D0OB 3KZ1E 1P7PA 1HNZB 4AXBA 1F14A 4JCOA 4LA4A 5K0FA 4AY3A 5CDGA 2O57A 3T1NA 4NU8X 5J4LA 1JJAA 4HLNA 2YWGA 3P27A 4L75A 3CURA 3O8BA 5CVCA 2YFKA 5ECGC 5L8VA 1KVTA 1DBPA 1A82A 5E1BA 3VJKA 3TFQA 1R8QA 1GGVA 1ZCFA 3LPLA 3CVVA 2R6FA 3QXGA 1I2ZA 2WKRA 4REMA 1V39A 2IZ1A 4KR0A 3AJ8A 3T7TA 1KAQA 2DH6A 2QMEA 1CYDA 4FCTA 3PRKE 1KMQA 5LWHA 3WHLA 2IY9A 4W5WA 2X13A 5T41A 4Z9YA 2FWIA 2A7XA 1HQCA 4ZEWA 3VM6A 3J81A 3ASUA 3PFGA 4IIUA 4QPZA 3GH3A 5SY6A 4IPTA 2GZRA 4XH9B 2GPAA 4ECAA 1I6MA 1FX1A 3O4RA 3R74A 5HZMA 3C70A 4U2DA 2JFBA 3GQBB 3AUSA 2IHYA 3LBNA 2ZIGA 2A88A 1IXSB 1L7MA 4JT8A 1V25A 1W9MA 4GI2A 1NWHA 2VNSA 4N7JA 3VYRB 2XRZA 3THYB 5F2KA 3DMHA 1KVUA 1VKJA 2BFBB 3ANYB 1K6XA 4AIIA 2OBNA 1ZSYA 3BICA 3DJYA 3LVRE 4OCZA 4UZSA 3RHZA 4I3GA 3JASA 4BLRA 4A8PA 1DJLA 4CFSA 1RHUA 1N2IA 4JYCA 3B6EA 5C1OA 2D13A 4ITRC 3RS2A 2VNHA 3N70A 4XWGA 1VJ5A 1WV1A 5DBFA 1YAJA 4PZAA 3MERA 1JB1A 3SE0A 3B1YA 2KBEA 1EUCB 1RXYA 5ALYA 3HHPA 4NS4A 3EQ8A 4QHTA 5FLEX 1AE1A 3VDXA 3WQHA 4GPBA 4D0SA 3DR3A 3FNRA 4ZEMA 1W87A 3NRBA 4B6EA 3PTAA 3EHDA 1WU7A 4RMNA 4YCBA 5GONF 4R2KA 1CEQA 4C30A 1Z4OA 4QOEA 1CJKC 1N5OX 1H3FA 3ESBA 4AWXA 5IASA 2ORYA 2ZIZA 4YCCA 1C1XA 3FYUA 3I23A 4MS3A 1OH5A 2EZ4A 4LXXA 4X60A 2EOAA 2DKFA 2NPFA 2ZDQA 4G5XA 5ANRB 2OCKA 2ZBFA 2VRCA 4A8HA 1NSYA 2EAUA 4D8TA 2GA8A 2VT3A 1QOPB 1C1YA 1PWYE 3U40A 3QVGA 5CNIA 3WYCA 2WVJA 5JT1A 3AC0A 1K0FA 3L0ZA 2NUTA 4IFEA 4D9JA 1QIHA 1N0WA 2IHKA 5M5BA 2QRJA 2HMYB 3M3PA 4FEEA 4HHEA 4RXTA 5JQGF 5CLLA 2AN4A 2F67A 1YHYA 2X4DA 2QRPA 4N7MA 4FE7A 4R9RA 5U9CA 1ZO8A 3GLGA 4JI8B 4NDNE 1K5PA 5BSFA 2NOAA 1UANA 2QMZA 3DLIA 3NEAA 3CNEA 3D59A 2Z6AA 1MKYA 3PJDA 1I2DA 4Y2RA 3VVMA 4OREX 4DGSA 4NY1A 2NQ8A 1JG2A 1W4ZA 1MRZA 3GMIA 1QBGA 1P1HA 2CFRA 3CN9A 4MQFA 3D4OA 3PR1A 3V9PA 1U7PA 3RTEA 1MG5A 2WR8A 3PXEA 1M2EA 2BHTA 3SF0A 2A9JA 2NU9B 3UUWA 4IHKA 4BBAA 4GT1A 5KTPA 2CCKA 1P0CA 1M5RA 3LVBA 3C8HA 4BN5A 5LA6B 1RYMA 3OBIA 2XSZA 2ETXA 4GG1A 3RAGA 4OHZA 1U0BB 1P9NA 2H59A 3K4PA 4DV6B 3VNBA 1DQZA 5L6MB 4HWSA 3ZY3A 3KUCA 2GZAA 3DHYA 2VRNA 1Q11A 4Q00A 3JR7A 3OF2A 4X71A 2JH9A 3VYTB 5K8LA 1P7YA 4XD2A 5L3ZA 1ESMA 1YHNA 2QYTA 1NFQA 4HH0A 4PE5B 2OCLA 4PZZA 5LZ8A 1ZAYA 3A3KA 5JC8A 3WIBA 3E3AA 4L22A 3DZDA 1FFWA 1I4EB 1B1CA 1FPMA 1YFZA 4YRTA 3IERA 5E9WA 5LNK6 1XCOA 1HPLA 3HSKA 4GICA 4PYQA 4UNRA 5ALUA 1OB5A 1YQEA 1J5EB 4B46A 3FR8A 4IVRA 4RMJA 3LHSA 2PKQO 3LQRA 3CLSD 2GMWA 3EMKA 3CKYA 3FHTA 1W25A 2Y9MB 1U7XA 3ZE0B 3RKUA 4M8KA 3QPWA 1S4QA 2B35A 3IP6A 2HX1A 1H42A 2QRUA 1XNQB 1ZKDA 1FL9A 4UTXA 5K45A 1IAVA 1PVVA 2EJUA 2XYVA 2TECE 5JNRA 5WRFA 1EUZA 3FOFC 1Z5PA 1Z6ZA 3DVLA 1N7JA 2FEOA 3O1HB 3O83A 1IBKB 2OGUA 2FKNA 3ZNQA 4RLHA 5IAEA 1VHTA 2KPOA 4HDKB 4KJZA 5E4YA 4WKOA 3VPSA 1ABEA 1MOZA 3D5QA 1R50A 5JSQA 3PQ7A 1IHOA 4G2TA 3D9QX 3WFZA 4H1VA 4BY9E 1GZ5A 2IU4A 3F4LA 4IQ0A 1KYZA 1M6YA 1EUYA 1MFZA 2DFVA 2YJZA 1G18A 1QGYA 3GMDA 2IP2A 2BY4A 3T06B 4GSYA 5DMHA 1FFSA 4PVDA 5C51B 4NJMA 4J7CA 4XWKA 4KKVA 4D98A 5EZYF 3KNZA 3WLAA 1PFQA 1C14A 1T4GA 1WVGA 2H1HA 4CMIB 2QD2A 2FJPA 3OTQA 2OV8A 3GEBA 5KYVA 2JGDB 4L5YA 3DV0A 4OFWA 1ZMOA 5FL7A 3X43A 2P3SA 3RIEA 3EBOA 2DMRA 3RTDA 4ZCRA 4AMYA 1YASA 3WHPA 1H93A 2PBZA 2J3KA 5IJWA 3L04A 3DEZA 2Q6IA 2DUUA 3LSYA 2BUCA 4OKNA 3R7NA 2YV2A 1H2EA 3TLCA 2B4RO 3LO8A 4FMDB 1NVTA 2H06A 2PRSA 3GFRA 1D2AA 5BV7A 1S2OA 3H2HA 2D1TA 5U1PA 3IEUA 3KYBA 1E99A 4FDAA 1Z2PX 1K6JA 4U7TB 4UMFA 2YBDA 3SYNA 4YMTA 4OQXA 1TZKA 2CUTA 3NYQA 3AL3A 2VYNA 4P22A 2Q7DA 2QJRA 2PLRA 5TQ2B 4PICA 3JW8A 2QA5A 1O96B 2HSWA 5DI9A 4C87A 4O4LA 5L95A 2PJRA 2CYCA 3ISTA 4B3BA 1WMSA 3WBFA 4DA7A 2X14A 4LHXA 1ECLA 3GT4A 3U3DA 5A9RA 5F2OA 2CC2A 3MTIA 1CG6A 3VX3A 1B93A 4IXWA 1F5SA 4FOOA 5BWBA 1Q6ZA 3DV9A 5EP4A 1GPH1 1FVXA 4YAIA 5ALVA 3OTIA 3G23A 3UJBA 4FB4A 3NLLA 1L3IA 3NBUA 3P9QA 4M55A 2Z5VA 4LF5B 3FNFA 4OFBA 4AY6A 2XQIA 4HLCA 4ZHQA 4GRDA 1QYDA 3EULA 4AM8A 2HPHA 3TO5A 5TS2A 3FGZA 4BNHA 1PT6A 4OJTA 4KQ1A 3WSWA 4D45A 721PA 3GELA 3PJEA 4DV3B 3Q10A 4ZO4A 5AQEA 5JZOA 1NBWB 1RP1A 2L17A 2P7IA 1DKQA 5CVEA 4ZQGA 1RJFA 2P77A 4ZV9A 2I55A 3UIEA 5KCMA 3MTJA 3VZSA 2ORVA 3L8MA 3KWLA 4XDHA 3MJ4A 1RLTA 9MHTA 1V8BA 5BYKA 3QOFA 3VH4A 1PFWA 3TE7A 4KMOA 2JG3A 1BMDA 3FLMA 2LDXA 2IGTA 2W4QA 2EKPA 3GJ3A 1CZNA 5CFMA 1I94B 4WKBA 3CWZA 4P31A 2JGNA 1MX3A 1DDIA 1SZDA 2NLOA 2E18A 3LAWA 4M1KA 5KWJA 4D3DA 2VDWA 1L9KA 3PHBE 1U3DA 3EWSA 1XSEA 1KA9H 3NASA 3NDIA 4JI5B 1KTVA 2HAEA 4O0MA 5KNBA 1NNUA 4DM3A 1U5BA 3LMKA 4KVGA 5IT5A 2J0QA 2Q7XA 1WEHA 3QX7A 2DFLA 2VI5A 1W0KD 2EBWA 4A73A 2ODQA 2Y4OA 1TRKA 3FNHA 3N0WA 5J5AA 1ABFA 2WP0A 2IWHA 1JQ3A 4X8HA 4UBNA 4MPTA 4IKOA 2VCEA 1M2OA 3ROXA 1X1TA 2Z08A 3ADKA 3QG1A 4Y0VA 4YT4A 1BN6A 4BLOA 3GFBA 1ORTA 1HTTA 2G9VA 3AOGA 3KOZA 3IT1A 3VO9A 4M3NA 3VOSA 2F7SA 1C1DA 5CDFA 1HY3A 1S96A 2D2IA 2VSFA 5BYJA 1E3SA 2JIQA 1T9GS 3S2IA 3SYLA 3T1TA 1QE5A 1IPFA 4XFDA 2ONZA 1MC4A 5FLXA 2I4TA 3G3EA 3LX5A 1FLDA 2ZXFA 2GESA 1EK0A 4MYHA 1SKUA 4X61A 2EQ5A 4A10A 4YUXA 4Z4QA 1E0KA 1T9GR 1WXXA 3WGQA 2IUSA 1CIPA 4BRZA 1WW3A 5A06A 1JDUA 3DWFA 4Q3AA 1NOJA 2X1MA 4RIFA 2H16A 2NSLA 4Q19A 2J3JA 1BCSB 4TMFA 1ZRHA 3DWGA 2GM4A 4GR4A 4EYQA 3ICVA 1OWMA 3ZIDA 4FM9A 5FX2A 2ZI6A 1MDBA 2FPIB 3K1JA 3UW3A 3WGOA 4BJ3A 4UBLA 5IKXA 1LDEA 3OTOB 2CXQA 4O08A 5CP8A 1OE0A 4HT3B 1C8BA 1XX6A 3PC8C 2C83A 1SUDA 4NBSA 2A8YA 4IUCS 4OHRA 3RNOA 4CF3A 1VA5A 3AY3A 5IBQA 4WZBE 4YHHB 1CJBA 2O9JA 3LA8A 2AXQA 2BEUA 1VJ1A 4KEAA 4XD7A 4NQZA 3KTAB 3HH8A 3M4ZA 2BMEA 4RY2A 4EHLA 5JD5A 2JLZA 2IT1A 2AR9A 3E2MA 3N6XA 2GX6A 5G0SA 2OZKA 4K86A 2ZYSA 4IJWA 1D3AA 1EA5A 1OV4A 2G9QA 4KRYA 4WGGA 4GVPA 4S1OA 3LZCA 3V4SA 4ARVA 4E11A 2H4JA 1XQ9A 2O3UA 2GJSA 2JBHA 4WZ6A 5ITZB 2PRIA 2Y1KA 2D6FA 2C5HA 2CHFA 3TKAA 3NRJA 1L7XA 1Z2OX 1BRMA 3DFKA 4F7WA 1RC1A 4BFYA 1ZIPA 1ODKA 4CVNA 4DKXA 1CQJB 4AP5A 1ZK2A 4JYZA 1HLPA 2EL9A 2CY0A 4QVGA 4GFDA 1L4LA 2P27A 3NR2A 3ANNA 3LF1A 4NPAA 4WLVA 1SXJB 2HF8A 4I9UA 4UQOA 3HBLA 2Q6VA 1EGAA 2WJYA 3KYDB 5B1SA 1A1VA 2MIIA 3PK0A 2I67A 3QVKA 4GKVA 5BSMA 3FRIA 4H4EA 5GMOA 4CMJA 1P3DA 2ATXA 1YBHA 2PX4A 3VXKA 4M89A 3BB4A 2C5FA 3MFYA 4Q21A 2NO0A 2PFSA 4ZCQA 5IDYA 5A0FA 1ESNA 4LJ6A 2Z8YM 3RSZA 4LOKA 1LY1A 3DT6A 3HN7A 3ODPA 4UU7A 3EPHA 1Z36A 1QYCA 2HK6A 3H1EA 4KXQA 4PYNA 2HN9A 1SGWA 1YC2A 2C2XA 2YIMA 3KZKA 5AICA 5ALTA 4WVLA 3V7YA 1E77A 4CE6A 4FW8A 2O7SA 3L01A 5KU1A 1RKVA 5CJ2A 5DU2A 3T0GA 4E2XA 1UBFA 2VOEA 4B9EA 1I01A 2XA1A 4ZK2A 2YJTD 3OBBA 2H4XA 3LUBA 3OQIA 4NL4H 5J23A 3G02A 4WFQA 2WD7B 3CLVA 3WL6A 4EI2A 1DAOA 5EFOA 2WNSA 1FP1D 3L4JA 2AFHB 4I5GA 2JJ8A 4DV0B 1PLJA 3PEFA 1OPRA 3HJUA 3F47A 1BJRE 3MGCA 3UQZA 4FQ8A 3PDUA 5JEEA 5LM3A 3IVCA 4FILA 4CT0A 4JI0B 4YDSA 1VXRA 5AYVA 3V4OA 2W2OA 4RH1A 3N7AA 3TIVA 3U39A 5TT0A 1RRFA 1R4MA 3C1OA 2CBXA 3TI9A 2LNDA 3DVAA 3DM9B 1IN5A 3L4KA 1XGKA 2XCLA 4XPZA 2IPXA 4DQUA 2J87A 1QFZA 4RX1A 3SIRA 3AEZA 2P3LA 3LC1O 3VNRA 5DT2A 4LVNA 1A5TA 4OHOA 5TXGA 1IDN1 3VAAA 4MUHA 1Z4MA 1QP7A 1BDHA 5AOVA 1VIDA 3K8YA 3ZBQA 1WABA 5G53C 1D2EA 4AY4A 3IYLW 2JF0A 3ESQA 4MVJP 4NNJA 4YXWD 3BIOA 3COPA 3IO5A 5DXAA 2IEBA 5AXAA 1Y5MA 1CX9B 4BUZA 1FMJA 3A4MA 2W9XA 4RPGA 3AVUA 3FDZB 4FGWA 5BYBA 4KN9S 2W0MA 5K3OA 4O4IA 4ZVPA 3RU7A 1SA0B 2BAGA 1VMDA 1O97D 4WESB 1O0BA 4LYYA 3O3OB 4FYVA 1A7AA 3WO0A 4MICA 1K6EA 4Q1BA 3O0TA 2GJ9A 4L4ZA 2X5XA 5AJXA 1M2VB 4TV8F 1M1NB 1RAHA 5K3CA 4RM3A 1QH1A 2AWOA 4Q4HA 3VO1A 3KFXA 2FGJA 5DJ5A 4G5QA 2NIPA 3BD7A 1QRRA 2ZR7A 3HACA 4YGXB 3VU9A 4YLYA 2QUBA 1OZAA 4DJDC 5CEJA 1E0SA 2JATA 4LDRA 2AG6A 1Y5NA 1LNSA 1DTWB 3ZY5A 3VGJA 1N2JA 2QTVB 3GFVA 2DB3A 1D1SA 2YFHA 3N2EA 3ORQA 2J8ZA 5HK9A 4OSPA 1XHLA 1NP7A 2BGWA 2I71A 3USZA 4FZ5A 2ZSFA 4JLPA 2W6CX 3KQUA 1T35A 2O14A 3I1IA 3NYRA 4OMDA 6YASA 3VOAA 1FJXA 4NFSA 1WDKA 5AKGA 5T3UA 5A1TA 3PFIA 4Y0AA 3BE4A 5KOJA 5KTKA 1GO2A 3GJ0A 1XTPA 2ZRIA 1UBOS 4DUGA 3VR5H 4FCCA 2HEGA 5JQGA 1BFDA 2ZRQA 2R1VB 3JAWB 3PQ3A 2IDMA 4LJYA 3A1UA 4NBUA 4PC6A 1ZD3A 3KIPA 3HGTA 1J7KA 1JG3A 2ZI9A 3O8OB 1C4OA 3ZV5A 1CWUA 1KZ6A 2X9NA 2VJPA 3CE6A 3N2KB 4TYNA 2J9ZB 4OGLA 1YT5A 1ULSA 2OQRA 1JIKA 3FMIA 4XIGS 4D02A 4E32A 1TOAA 2P4QA 3UO8B 2X8BA 1GTG1 5DWDA 3K5WA 5J1TB 2FZKA 4X1KA 3SHTA 4L4SA 4CG2A 4D4MA 5LIPA 1MC8A 4RCVA 3WYEA 4M8NE 3OLVA 3D0OA 3SX0A 2VQ6A 3HBNA 4FBMA 3SZMA 2WIJA 4C06A 2I5PO 5A03A 4DHWA 3D3JA 2MMCA 3L0DA 1EE2A 2BFFB 1ZCJA 1LTQA 1ULBA 3PFBA 4JGGA 1O3YA 4GXQA 1R8XA 2P9JA 2XVXA 4PQFA 1YZ3A 5JCPA 1D04A 6REQB 4U4AA 4RJJA 5FBZA 4ZZ0A 2ZPAA 3MMZA 1DUSA 3MJFA 2GN1A 4Y1GA 4R1MA 4WAUA 4KAAA 5JTUA 1MJ5A 2QUJA 1QQ7A 3O4HA 2Q3EA 3N3BC 4EW1A 3OUUA 3AR9A 2XUDA 2PSSA 1MJGM 1K6MA 4R54A 4ZICA 3P1JA 1ZXBA 1N5LA 1U3VA 1KO7A 1QHYA 1RRPA 3HZOA 3O93A 4WXPA 2W70A 4FSXA 1L5QA 4B2YA 1YQUA 1SQ0A 5EUMA 1W6RA 2DPMA 3W6NA 1ZN9A 1DIGA 2JAUA 1MV5A 1KDZA 3ZK8A 2EJVA 1WQ4A 5DEIA 5FP0A 3TOXA 3ZNNA 3B9RA 3UCXA 5JLJA 4H6VA 3NBZC 1QB8A 4KU4A 4I50B 4DNOA 1QRTA 5D3ZA 2EF0A 1L8OA 3EZLA 2VS1A 4PC3A 3L8FA 3FA2A 4CUZA 3IFSA 5AW3A 3HP1A 4KXNA 3ZU3A 4EYKA 2CMHA 5FFFA 4UAGA 1SXJE 4OHMA 4B82A 1Y98A 4HPWA 1U4OA 4HNSA 5IWAB 1QZTA 1CFZA 1QOQB 3KTDA 1TM3E 4KSBA 2IU0A 5IUNC 3HZZA 5J5VA 1TTHA 3L06A 3HU1A 2O2ZA 4RE5A 3JTMA 4FCWA 4UUBA 2HLNA 1N8KA 4LXYA 3A9SA 1DMRA 4BKUA 4BVFA 5ICGA 4HB4A 1WDTA 3C87A 1CTQA 4KDEA 4QQKA 5CLGA 3UAWA 4EKYA 1XD9A 1FFAA 3R3UA 2BWJA 4OMCA 1R27A 4BNZA 2GPSA 3EIWA 1QP0A 2NUPA 3U3ZA 3E7WA 2DJIA 2R6JA 3V2IA 4EM6A 5KJCA 3VR4D 4O8CA 1W0KA 1L9XA 3TOCA 3H17A 2I8AA 4P5PA 3I8OA 4XB1A 4NLLA 4BMYA 4I81A 3Q40A 3IUYA 2G1PA 1LI4A 2TYSB 5TX7A 1J8YF 5EZYA 3S6JA 4NOJA 5GZ1A 4IWXA 1SCJA 1P7CA 4ZI5A 1JSXA 2FEXA 1A4IA 3LYHA 3TCNA 1RI5A 3ZU2A 1CJTC 3K15A 3GGCA 1AKEA 3KK0A 2H08A 2XPCA 1WW8A 4G1CA 4ZYLA 1I32A 3EGDA 1OWOA 2IEYA 3H8WA 3I9JA 1M75A 1W44A 2QSJA 2DBYA 4PRKA 1K5DA 2AFHE 4KPFC 1GG2A 3ZU4A 1XTZA 5K0LA 1J21A 4Z9FA 4DSZA 3SC2A 3EZNA 3W2FA 3EA5A 2W2LD 3OLZA 4C4AA 1E1CA 5DX0A 5CB0A 4FYHA 3CUSA 3PB3A 2JFVA 4LMBA 5FQOA 1OT3A 2I8CA 3PHHA 3MD0A 2RCNA 3LKBA 3R8FA 4OKIA 2OAGA 5D8DA 5MN4A 2C7OA 4LY9A 3I05A 3A6FA 3MS2A 1PK7A 4RS3A 4L51A 4R4JA 2NO6A 5NULA 1D4OA 2PZ8A 1Z0UA 2OHVA 3NQ41 2WT4A 3Q9SA 1MO3A 4HAZA 4IVQA 4K87A 5KSPA 3SF8A 5AM2A 3ND8A 3HSYA 4YUZA 3V2UA 1XTBA 1DINA 1EFRA 1TC1A 3A6DA 4ZQCB 1FTQA 2A5DA 1FS4A 2NSHA 2PWBA 5AXDA 3RRBA 4D79A 3K70C 1YZHA 3TH5A 3EXHA 5B7NA 3H5NA 1NATA 4ZT4A 4C4OA 5CA1F 3RUCA 2ODNA 4HUTA 1YA6A 1IULA 2FPRA 3WXMA 4MRVA 4UHCA 1K8QA 2BMVA 1C7IA 3CEHA 1JTFA 3IBSA 5JD3A 1Y33E 2IYLD 3EGVA 4RCYA 3ZDQA 2JK0A 4FMCF 1MIOA 1A27A 4BKRA 1ONNA 3EGXB 1HKHA 2QD5A 1NZJA 3I92A 4NATA 4YV7A 4J03A 3I28A 1WOMA 1X8KA 3QLUA 5AK5A 2ZWMA 1L6IA 3ZD7A 3WICA 1SO8A 5EQTA 3WSTA 4HYQA 1WQ1R 1NPDA 3WFIA 4CFZA 4LI3X 1TYCA 2WIGA 2JFZA 4XOUA 3AB3A 2RDMA 1XWWA 1NR5A 3ERCA 2PL1A 4OK3A 5AVKA 1NW9B 5FI3A 1W85A 1QRAA 3HLYA 3IEKA 1VBMA 3BG5A 1UPXA 3A1CA 2LW7A 4M4SA 5HMLA 3WR5A 4D9EA 8OHMA 2Z3ZA 3WJ1A 8GPBA 2OSVA 2YIJA 2WB2A 1RWMA 5LQAA 4KLCA 5KAMA 5AK3A 1HTBA 4LTDA 4DWVA 4KWTA 2RD2A 3KJXA 4MUKA 2K7FA 1CUXA 4X84A 2CNNA 5D51S 4NCJA 4MWEA 1VPLA 3A4NA 1NR1A 2XJ9A 3R3VA 4L6IA 1OLUB 4J0QA 1SHKA 1XAHA 4C04A 2A86A 5CAEA 5DULA 3EXEA 4PFSA 1T34A 1T13A 5EJFA 4KPYA 1JHQA 2R7MA 5K0EA 1Y6GA 2QAGC 4CQMD 1QDUA 1ADYA 5HM6A 1USGA 1V9LA 2IYXA 3QJYA 4JX9A 1TAHA 1H0HA 1L7RA 3FBWA 1I1QB 1DIAA 1NUHA 1QPBA 3ME5A 1TO2E 3FUWA 4MS4B 3ZW8A 3IE2A 5GJCA 1F8XA 1NWCA 2C1EA 2QUIA 3K9BA 4I4CA 1OGJA 4ENPA 3QPBA 4RQBA 2Q3BA 4A92A 3VMFA 5C5EA 4URXR 1I7SB 1RVV1 4FGKA 1MA0A 1P17A 2XQVA 4C1BA 5JIBA 5JD6A 2ZTHA 5LMNB 2V4MA 2F1OA 2IQIA 3QFRA 4L27A 4W8HA 4BP1A 3RODA 3SYRA 1PG0A 2ZZNA 3JQDA 2PEZA 2Y1DA 3LX4A 2DP4E 3SLGA 1ICIA 2OV3A 1XRPA 5K6AA 4LOIA 2VUTA 2ONCA 3MOIA 3I5YA 1B0ZA 1JT9A 4M9RA 3D6JA 3E4DA 3II6X 5CH3A 1Z0SA 3AEKB 1C0PA 3R4VA 5GIPE 1ZH6A 4Q18A 3OCYA 1XU9A 1H1DA 1NV9A 5LUBA 3D8SA 3WP1B 3AIOA 2ATVA 3PE6A 3A2LA 4NZPA 1WZUA 3ZOKA 3V4VB 3U4QA 3AEUA 1ZGGA 1TJNA 1GN9A 1YIOA 2B4YA 2Y4NA 2CLCX 1CXZA 4KN8A 3M2PA 4K40A 4XVQA 4DS3A 1C0EA 5AK4A 3TJZA 2BGKA 5DCUA 3TMKA 4TMKA 4LYAA 3T94A 4MUAA 1I6KA 4DB2A 3I83A 4I55B 2EFHB 4UE3S 5H3HA 4DCPA 2DRIA 3EBPA 1P2UA 2RGNA 5KAPA 5BR4A 1Z7EA 2GVDC 3WADA 1I7DA 4TV9F 4BX9A 5K3AA 1D4ZA 2F1IA 1HEYA 4KYTA 4P2BA 4INAA 3T1OA 3BAZA 1PRYA 4NIMA 1Y9EA 4EG8A 3BMOB 2Q0SA 1H5QA 1L7PA 2HZBA 4MV9A 5JDIC 1NY5A 3K1AA 4CJXA 4P58A 1HX7A 2Z9BA 1FUEA 2FI1A 1E1QD 4K9QA 1FPQA 3C1TA 3MOGA 5E2BA 3JWJA 1ZD5A 3MILA 3VBEA 4DLVA 1O0CA 3JZAA 4JLSA 1ZVQA 3OX4A 5CFOA 2COUA 4AUNA 2VNJA 1H2XA 4LCBA 1RJWA 3DF7A 1KORA 1MEOA 4PQGA 3SKXA 4PPNA 2WWHA 4Q7KA 4Y98A 1N9ZA 4HB0A 3ZZ1A 5IT0A 1KZ4A 4JLDA 2IXFA 5IDXA 1ZNWA 1G98A 3BIXA 1P1JA 1NRIA 4DEYA 4B6PA 2FW9A 3DYVA 3ZTWA 2W6QA 2YYAA 4V0SA 5CHEA 5KNLA 4RLSA 4JSRA 3F6BX 1PNRA 1FDVA 1Z5UA 3VRHA 2AHRA 1FSSA 5CURA 1AOXA 1TJ4A 1TMYA 4HRAA 3WWZA 4OAQA 3S2EA 1I3MA 3ACCA 2JKZA 1C3LA 1MD9A 1X42A 3JWIA 1LKZA 4OL0A 4DNPA 5JY6A 3U44A 4CQJA 1B6SA 2OLJA 1TT5A 1W94A 2QW0X 3H2KA 1TGVA 1GILA 2BHNA 1PBTA 2XCUA 2VKTA 2HTFA 1ARZA 4QPNA 3DBHA 4FC6A 1GNTA 1YACA 2PIDA 3HZRA 5GV8A 2ZJBA 3L6CA 3VVBA 5K6RA 3ZE1B 2NTEA 2PPLA 4YAOA 4FHEA 3VTZA 4E5VA 3A6ZA 4PXAA 1YQWA 1RMTA 4UDXX 4MW1A 1Y1TA 3AOEA 4BB6A 4EJ2A 3PL5A 1S7GA 3PIRA 3EVAA 4FFWA 1FFEA 4IO1A 3CO5A 3O3NB 1KI6B 2PZJA 2YVUA 1KVSA 3B13B 2H2HA 1Y8ZA 1LBHA 3FZNA 4Z0NA 1JHDA 1JIUA 1TIBA 2E9SA 4ZCSA 1EXVA 4IDFA 4MKIA 1L5MA 5B36A 3GFPA 4GI3A 4DCJA 4EG4A 3AHJA 4W6ZA 3PI6A 1HI9A 1SJ9A 3I5AA 5CT9A 4EY8A 5AW0A 4QVKA 4EB0A 2XITA 1VSTA 5LWQA 5BQ5A 4FUQA 3DL4A 3JQ9A 5EOVA 4DCTA 4LF4B 3TGWA 1PG2A 3MMNA 3ULKA 2FEKA 4NV1A 5I7SA 4YRSA 2FN9A 1DEXA 3VZRA 4U9UA 3TQSA 5LD2C 2P11A 4YHBA 3QUSA 2RGEA 4BFWA 3KPUA 4EKDA 3W6PA 8ABPA 1U0LA 1G2PA 1G1AA 3IAS1 1C7RA 4LC0A 1V1RA 3E82A 1G60A 2Q4TA 2WOOA 3IIKA 4FSHA 4Z3KA 5YASA 4Z1MD 2F1KA 2FPMA 2Y27A 4TV8A 2VJBA 4NENA 1XKQA 2BJHA 2ZSBA 3QLJA 2QXYA 4AAYA 2C7BA 4AZ3B 3E9RA 3ENQA 5G02A 3HUDA 4LQLA 2FZWA 3QTBA 3DFIA 1JIJA 1O6FA 2M6RA 2HMVA 4HXFB 2Z4SA 3Q6IA 1EXNA 3C1UA 4BNKA 1VGRA 1JVNA 3MELA 3U5TA 2HJ9A 4MUEA 3I04A 3UV6A 4CF6A 1EINA 1H94A 1RYHA 2HT6A 1Y9DA 1ZRNA 2CKDA 2XE7A 3T3HA 2VTEA 2X8WA 3BXXA 4PCVA 3MVEA 5J2TA 5H9WA 3G6KA 3IAEA 1DIOB 2BM8A 3C6YA 4EA9A 1W0CA 4PLHA 1EXWA 3KR1A 1DQSA 4GGPA 2AFVA 4YAJA 2D5LA 3HU3A 1TCCA 4Q9IA 5EWLB 4OUKX 4ZAZA 3VPDA 1JJFA 4R41A 1N3YA 1Z7WA 3R76A 2BFEA 4AO6A 1ONBA 2QI9F 3GCXA