1V41E

Crystal structure of human pnp complexed with 8-azaguanine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
publication title Structure of human PNP complexed with ligands.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v41E00
4WKPA 3BSFA 1T8SA 4F2PA 1ZL2A 1JE0A 1U1DA 3LA8A 1NW4A 4DA6A 1OV6A 4K6OA 3K8QA 4EARA 4OY3A 1JE1A 1XE3A 1WTAA 4NSNA 3NM6B 5EUBA 1U1GA 4TTAA 1JDUA 1ULBA 4R2XA 1B8NA 4YO8A 3E0QA 1U1FA 1Z35A 3OOEA 1K9SA 3ONVA 3NM4A 1A9OA 2Q7OE 2AI2A 4D8VA 3KVYA 4YNBA 2HWUA 4GLJA 3BGSA 2ON6A 5CCDA 4TS3A 3KVVA 1RFGE 3F8WA 4QEZA 4LDNA 3FNQA 4YMLA 3BJEA 3EMVA 3PNSA 3ENZA 4DA0A 4F3KA 1A9QA 5DK6A 2BSXA 4DA7A 1Y1TA 3E9RA 3OZDA 4GKAA 4TXHA 1YQQA 4MCIA 2A0WA 1RXYA 1A9SA 1TGYA 4F3CA 2I8AA 4G89A 4QAQA 4M3NA 1JP7A 4X24A 5F7JA 1JDZA 1V45E 4LNHA 4DAEA 1K3FA 3DJFA 1LV8A 1VHWA 2OXFA 1I80A 4LZWA 5F76A 3GB9A 1TCVA 5I3CA 3KHSA 1ECPA 3TL6A 3FOWA 4E1VA 4DABA 3PNPA 5CYGA 3EEIA 2QTGA 4IP0A 4LKRA 1C3XA 1V2HE 5EFOA 1N3IA 4OEHA 1LX7A 1M73E 1B8OA 3UT6A 3SCZA 5B7PA 1ULAA 4L0MA 1PW7A 1ODKA 5F7XA 1U1EA 3OF3A 4P54A 1RR6A 2H8GA 2AC7A 3UAZA 3FUCA 3OZEA 3LBAA 1PR1A 4U2KA 3EUFA 5F78A 1LVUA 3OZBA 4JP5A 1JDVA 3DF9A 4KN5A 4DANA 4QASA 1Z33A 5F7ZA 4NS1A 5JPCA 1OTXA 4OGLA 5CXSA 3NBQA 3IEXA 4BMZA 3UAYA 1A9TA 4OJTA 1YQUA 4PNPA 4PR3A 3ODGA 4OF4A 4YJKA 5CXQA 1RXCA 1Z39A 1JDTA 4LNAA 4BN0A 1RXSA 1OTYA 1ODIA 1VFNA 1CG6A 3EUEA 4R31A 1K27A 1Y1QA 3UAWA 3MMSA 2QTTA 1PKEA 1Z38A 1PK7A 1T8YA 1VMKA 3UAXA 4ECEA 3UAVA 3QPBA 3BL6A 3P0EA 3E9ZA 1U1CA 1JDSA 5F7OA 2HSWA 1TCUA 1ZOSA 3OPVA 4WKOA 1T0UA 4BMYA 3LGSA 4JOSA 5F73A 1PR4A 4WKNA 1TD1A 1Z5PA 4OGKA 1T8RA 4QATA 4RJ2A 4MCHA 1Y6RA 2AI1A 1SD1A 5ETJA 4L5CA 1V48A 4H1TA 3OCCA 1Y6QA 1Y1SA 3DDOA 4GLFA 2HN9A 3KVRA 2RJ3A 1Z37A 1PR6A 2GUWA 1ODJA 2HRDA 2AI3A 3O6VA 3PHCA 1OVGA 2ISCA 3MB8A 1A9RA 4WKCA 4JWTA 1QE5A 1NC1A 1Z5NA 1SD2A 1RCTE 4TS9A 5C80A 2QPLA 3OZCA 1NC3A 5EPUA 2A8YA 4MARA 2QSUA 4QFBA 4GMHA 5CYFA 5B7NA 1PK9A 4WKBA 1PR2A 3C74A 1SJ9A 1RXUA 1Y1RA 1ODLA 5CCEA 5KB3A 3FAZA 1PWYE 1VHJA 3D1VA 1TGVA 3FB1A 4R2WA 1PR5A 4TTJA 1PR0A 4DAOA 2IQ5A 1YBFA 5IFKA 1RT9A 3DPSA 5F77A 1V3QE 4G41A 4DARA 4D8YA 4TTIA 4DA8A 4F2WA 4D98A 2B94A 1OU4A 5FAKA 3KU4A 2A0XA 4BMXA 3OOHA 1PBNA 1V4NA 4TXNA 2OECA 1V41E 1JYSA 4I2VA 4EB8A 4NY1A 3O4VA 1Z5OA 2I4TA 3NM5A 4F1WA 1OUMA 3FWPA 1T8WA 4D9HA 4M7WA 4TYMA 1Q1GA 3INYA 1Z34A 2OC9A 1A69A 3KUKA 1JPVA 4TXLA 3T94A 2P4SA 3P0FA 5B7GA 4QARA 4TXJA 3GGSA 5B7QA 1SQ6A 1RYZA 3IOMA 1FXUA 2OC4A 1CB0A 4D8XA 3DP9A 4L6IA 3K8OE 4M1EA 2A0YA 2PGAA 2XRFA 4UC0A 4G8JA 1Z36A 4L5YA 4L5AA 1YRYE 4FFSA 2QDKA 4TXMA 1PF7E 5IU6A 1YR3A 5K1ZA 1RSZA 3U40A 3PHBE 1G2OA 1A9PA
chains in the Genus database with same CATH superfamily
3UYLA 4BJHB 4Y3UA 2Q62A 2J33A 3MD9A 1P44A 4KLCA 4WLVA 2V3WA 4I6EA 3TWOA 3DAHA 4BRSA 1LWOA 1IJEA 2I7CA 4KRFA 4KQHA 4EMSA 4ZHSA 4KODA 1MGOA 4NESA 5C1DA 3SYTA 3V46A 1AMNA 2CJWA 2R6R1 1F8YA 1Z6GA 2Q5FA 3K8QA 3QX3A 2FGJA 3DUWA 3F71A 3RS5A 1NRJB 1BJRE 1N3BA 1R8YA 3QELB 5F21A 2GF2A 3ZX5A 4FOOA 4YALA 4BVGA 2PZEA 3ZN2A 3WA7A 1E89A 1XCLA 5ITZA 2OBBA 4DTCA 5CVTA 4UNQA 4LZPA 1JNXX 3FMGA 4PQFA 2BONA 9MHTA 4FHGA 1RKXA 2IXAA 2WUVA 4PG4A 4R2XA 2BKEA 3EMDA 3I2HA 1RRMA 3ZLJA 5T57A 1SHTX 4P86A 1EWKA 4OO3A 4AY3A 1ZAYA 5HKLA 3SX0A 4IM7A 1YGPA 4P36A 4FCTA 5JYCA 1VKHA 3FRHA 3DXXA 4EFLA 1F4LA 3EFHA 3GDOA 4G5XA 1GG8A 2G6TA 4BKUA 3R4CA 2NZWA 3GLVA 4CCYB 1O03A 4DR7B 3DVAB 8MHTA 4EGSA 4M9ZA 1DFGA 1CDDA 3Q9NA 4B6RA 2QMQA 4OXYA 2IYLD 2AI2A 1G3MA 3NWJA 3R44A 5AM5A 3UZUA 4RDXA 1MB0A 3I6MA 2RI1A 1IEVA 4YUZA 3PQDA 4OXQA 4A5OA 3B6IA 4ENTA 1R9JA 3QITA 5ECYA 1ZN8A 4PX2A 3WVNA 3MVEA 1T35A 2ON6A 1SC9A 4YAEA 2L2QA 4JI2B 3ZJVA 1RZUA 3I01A 1AKMA 4W9RA 3MCZA 4EUFA 5IEBA 1CUGA 2QTZA 4IYJA 1PAUA 1EWQA 1F2UA 3GQVA 2JFPA 1G8YA 2NSDA 2P6PA 3AHJA 1FUKA 4GWLA 3VDMA 2EEPA 4JI0B 1CYEA 2C1ZA 3KK0A 1E3JA 1K4MA 1CS0A 2WHRA 5ALTA 1L5QA 5E7JA 3NHKA 1MA3A 5HJ2A 4R6XA 4N8EA 2B69A 2A14A 2OFFA 3GNTA 5LQRA 4CV0A 3L1KA 3DFFA 1UBJS 1AA6A 4YJ2F 1DADA 3WYBA 4RTJA 1QH8B 5C8YA 2QORA 1GAQA 1P5JA 3V2IA 4NQZA 5BPFA 4RZHA 2H5IA 2JRLA 4NBTA 3OCWA 4NYJQ 5DN9A 5A0FA 3A1WA 2C04A 1Z4JA 2PX5A 3IB3A 4FGLA 1YD7A 4I5FA 4PRYA 1EK5A 3L1UA 4I5GA 5FFMA 2X8WA 4C29A 5A3SA 3ZQ4A 3GX1A 4OKNA 1EP1B 4DJJA 3THWB 2DOKA 3AGQA 1G18A 4RABA 4D8TA 2XY4A 2R6DA 2VHEA 1YR1A 2WTXA 1NYQA 4JU8A 1GP2A 2FI1A 3COVA 3DFZA 3P2YA 3VBCA 4ANFA 2HIGA 2JLAA 5LXTF 3VKWA 3D2LA 4FNAA 5E2AA 4UMFA 2ZWIA 5LZ5A 3AR5A 1U90A 1ZGZA 1QYCA 2VXCA 4GH5A 3FLMA 2VJOA 3UH0A 5B1YA 3ZWNA 3GBPA 1SU4A 5A4KA 3S3TA 3GLFA 1LRLA 4D44A 2J08A 3KHTA 4OLBA 2DF8A 4ZYYA 3AK4A 4U2EA 4GLBA 1QO9A 3KQHA 4WL0A 3VZCA 2OHOA 3N39C 1X2EA 4QL3A 1PSWA 1J21A 1YHZA 4DQDA 3I1FA 4EYEA 4ZYVA 5IXYA 4JEMA 3VX3A 4YV2A 1KTVA 2A9FA 2V7WA 2VRBA 3K31A 3QY0A 5L4SA 4DV0B 3M1IA 3UGKA 3X1ZA 4EUSA 4RK0A 5AM3A 2Z2JA 5KPDA 3NBYC 1U7ZA 3TQFA 3HXPA 1LDYA 3HS3A 2VAMA 1NBOA 3KKEA 4KPYA 3RVRA 1ZNWA 2GTPA 5IABA 1Y6ZA 4IIJB 4IVPA 1PS0A 1T1RA 2BM8A 4E5VA 4EG3A 2YYYA 3PQ2A 1G20E 4K5QA 3ZV4A 4B9EA 3CFYA 2G1JA 4EATA 1PGNA 3ZWCA 4ZKDA 1GA4A 3AL2A 4E1VA 3EUWA 4CM8A 1T5SA 4UTXA 1T25A 4S1WA 3V3KA 1ZMXA 1M1XB 4D42A 4J7UA 3ET5A 1HSZA 1M34A 2JD2A 3K9NA 1Z73A 1UOPA 4Q7KA 4UU1A 3T7EA 3E8XA 1RI1A 2XYQA 3BWMA 3DDWA 4P4UA 5CTAA 2BUCA 4KXFB 3VDNB 5IZ4A 3IPCA 4IDHA 1C8LA 1QZZA 2FUNB 1E3DA 1V2HE 1IHXA 2X9VA 3IHKA 1JQJC 3EUAA 4JLWA 1N3IA 2YTZA 4ZFNA 1A50B 1NQOA 3PQ6A 2FHSA 2R4UA 2Z3VA 3GPCA 3M6FA 5FFNA 3DLCA 1C7RA 3KSBC 2GPWA 1P0QA 3PC3A 4ZANA 1IOLA 3NOOA 1M73E 3Q7IA 2H85A 3DDNA 4WOKA 4A1OA 4XUDA 1TM2A 3TH5A 5IF9A 3EDYA 4QDZA 5KMGA 2VUHB 2PNJA 1LDGA 3DONA 4JR0A 2NPFA 1G8AA 4OYYA 1KZ9A 5F9MA 3IA7A 1EUCA 4M7RA 2FZ4A 3MLBA 4WY5A 2E7ZA 3L8DA 4E0BA 1J0BA 4WBXC 3ZU3A 1YBHA 5L3ZA 4HEA6 3ANNA 4PZCA 1YVUA 2IUSA 4Q9HA 3Q41A 3BG5A 4TKLA 2PFKA 3EUFA 4ALIA 2I87A 5AVSA 4IXMA 1BGXT 4QVIA 3I4CA 1AB5A 1T8PA 1QVRA 1MO4A 3NHWA 3CG4A 3OICA 2GI4A 2D0DA 2JLXA 4G1EB 1MW9X 4OH7A 5LQSA 4AJJA 2G72A 1J9GA 3NVAA 4H4EA 5F3DA 3PUYA 3PWZA 3LUFA 1SBYA 2EF1A 1JG1A 5HUHA 5EJ6A 2BTQA 4PN3A 4Y1RA 2ZZKA 1LRKA 2BKVA 3ORFA 1II8A 4J0JA 3TD9A 1TOAA 4BLSA 5JPCA 2WILA 3HPRA 1VP9A 1VHDA 1QFYA 3BWBA 3OFSA 3PE4A 1C30A 4KAFA 5D1NA 1XMOB 4HMOA 4TKVA 1AUXA 5JYDA 2ZBRA 1AHHA 2IYOA 1BYUA 4JJKA 1R27A 4H3SA 1JHOA 7REQB 4WXMA 4H0CA 2PUCA 4FIDA 4ZVUA 3UT0A 4PR3A 4Q3KA 3BM5A 4OI2A 1JKIA 3PQ7A 1ILWA 2XWQA 2I33A 3WLHA 4G2TA 4YROA 4XARA 2YR0A 1SKQA 3FFWA 4HWPA 4LXHA 3UWMA 4WZAA 3CM0A 4HWOA 3R7LA 3X1WA 2Y0DA 4KKXB 4B31A 1KVQA 5C8VA 4PAOA 3ZDZB 1OBOA 1AQNA 5BVHB 2R8BA 4CN8A 3SZRA 1IU9A 3V2UA 1J6UA 2R6ZA 3E5HA 5KOHB 4IXNA 1XT6A 2AS0A 1T5HX 3AEUB 4E5NA 5JSHA 2UYCA 3GPLA 2BHTA 1TUGA 2WVHA 3E8MA 1IAQA 4P3XA 4HT3B 4YMHA 1PN3A 3AVVA 2IY9A 3FRJA 2J9FB 4MA5A 3RQSA 4A9AA 2HQOA 4ARCA 4XYBA 1JDBB 4DUZB 4ENSA 1FX1A 5E7IA 3M4YA 2EEZA 3TAUA 4EJ6A 4JOQA 5BURA 2JIPA 5BO5A 2VSYA 5CB4B 1G7RA 2XWBF 2VTBB 3BBLA 1GITA 3CZ4A 2WMNB 1LJUA 1N5IA 4HSEA 4RPKA 1T2AA 5LB2A 1QKKA 4EEXA 4RJTA 2V7TA 3WFZA 1UFRA 2RHOA 3E18A 5CMLA 1P0CA 4X3CA 1YWGO 1E9FA 4TUYA 3T34A 2XMSA 1UIMA 4JSTA 1RE1A 3LDAA 3MD0A 2LR0A 3AVTA 2D2FA 4EHNA 4TV8A 1YNSA 3NBXX 1TM3E 2BLLA 3MIZA 1ICIA 2X0KA 1WXXA 4PSVA 3ZUGA 3ZS8A 4QHSA 3UB3A 5I7OA 1KK0A 2CLHB 2XTJA 2R7AA 2I9KA 5CFZA 1NI4A 5G0SA 4FE3A 3WGQA 3WQSB 2XCOA 3H0EA 1X87A 2OENG 4GBMA 1XL0A 2IXGA 2ZCVA 5E6RA 2EYQA 1UEJA 2D2EA 2P7IA 3GGDA 1WUJS 1OIWA 2XR1A 4M22A 1OXXK 4N49A 1FW6A 1F14A 1JSLA 4RGVA 4UASA 4XEHA 4NJMA 3HY4A 3QYJA 3ON5A 1K7EB 3AHDA 3TXAA 3MELA 1DTWA 5JNRA 4R7ZA 2K2QB 4WNCA 1XYYA 3WGKA 1GKUB 2VEDA 1CVLA 1E2EA 1T5IA 2JHCA 1PQUA 2ZSKA 1DAKA 2V6FA 3PLNA 5G4KB 3TIXB 3EZGA 4Q0MA 1DBQA 2YNMA 2VDRB 4QDOA 1LPPA 1E2LA 5I9MA 1SHJA 4LCBA 5IN5A 3EG9B 2AW5A 1LC0A 2ID8A 3AZPA 3QJGA 3HFJA 4JJZA 2OD7A 3AIIA 4OQDA 3OCCA 1B26A 1EDBA 1CKEA 2PQ2A 4RAQA 3N74A 1E6KA 1FYFA 3LWZA 5KI6A 3RSFA 3A1TA 3I05A 4W6QA 4B3GA 3N5KA 4JMLA 1I1OA 1UWCA 2G9QA 2C78A 3GR6A 4XSHA 2ZI4A 3H5WA 3I2GA 5FBHA 3RIGA 3D9QX 5AUPB 1IBRA 1TFRA 2W8BA 1I7LA 2AOTB 1VKNA 5E6UA 1WM1A 3OZXA 4EBBA 2AI3A 2AZMA 3EWAA 1JGTA 4CKEA 4INJA 3O6VA 2R85A 4GX5A 2QYOA 4B6EA 2PLWA 1LCIA 4YPFA 5ADUS 1UBUS 2FFQA 3TSAA 3EASA 4UPEA 1FRZA 1N8SA 5KCZA 4UUBA 4PZ9A 4NRDA 2QQFA 4UVIA 2VTVA 1O1YA 2UZ1A 1Z5NA 3MM4A 1VLVA 5EE5B 5J43A 4C7OB 1JQDA 2R68A 2ZYGA 3VMFA 4BECA 3MPOA 4YIHA 4K26A 2O9JA 4H35A 5A62A 3AVWA 2DFNA 1UXOA 4M98A 1RDFA 1KQNA 1U3GA 1Z6TA 1ZNYA 3LYUA 3TUIC 2YS7A 3EVZA 2J3LA 1P1BA 3ZIAA 3DLHA 4ZXPA 2M32A 1XWIA 4IDPA 4E94A 2WD8A 1U4OA 4RVOA 5K0NA 1A88A 1L9XA 4FCVA 3WLIA 5AJYA 4BNYA 1WZCA 1E4VA 2BSAA 2IY8A 3IYLW 4OHCA 5HHTA 5A0VA 3QUTA 3L0OA 1YS1X 4C4RA 3HXMA 3RHZA 5C8DA 1CZKA 3OTIA 5KB3A 3FAZA 3OSZA 1DKRA 5T8KA 3VZRA 3URMA 3F4KA 1LUAA 4NFYA 1XDSA 3TZQA 2WK1A 3DCYA 1XU4A 3AP3A 4Q48A 2Y0CA 3BQ9A 3NJ4A 3OLVA 1GR1A 1M72A 1R0YA 5FPHA 4ND8B 3M5PA 4UCWA 3VV3A 2AN9A 1XZEA 4HGOA 1UT8A 1PGPA 4DLXA 4EF5A 4KQMA 1NONA 3TW4A 1QRUA 2H4YA 1AKVA 4NG5A 3UJHA 2E4AA 3QWFA 1DV2A 4GYJA 4LXYA 4AO7A 3IHTA 4DA8A 2FMUA 4KMMA 1DC3A 3KKMA 3EXFA 1KDYA 3TQHA 1MVOA 1H5UA 1FTGA 1PZNA 1QO7A 3VHLB 2QK4A 4CUJA 4PS0A 2BMDA 1YL7A 3HJHA 4UXJA 1U7XA 3RYCA 3JVUA 1IUNA 4CMEA 1OI2A 5EGSA 3F5SA 1YXMA 2C00A 1QCYA 2QVCA 3UT5A 2O1WA 1MCZA 3EF1A 4EJ2A 1C7QA 5KX5A 5LNK6 4KDCA 4PONA 2GZSA 4TMTA 3ACBA 4R41A 5E6SA 1D6JA 3UY4A 5DX1A 4XEUA 2GSWA 4DV5B 1ZM3A 1EFPA 3MPUA 1BFUA 2YBEA 3G82C 1JHZA 1NLFA 4KN6A 2GLUA 4XAQA 3W8EA 3AKZA 4JFAA 3FWPA 3I5AA 4L08A 1XZLA 2HIHA 5THQA 4IGIA 3OTWA 2CNWA 4LXXA 1ZH8A 3AL0C 1B43A 1JR6A 1CTQA 1C41A 3DYIA 3F5MA 3IKLA 2AB0A 2PS9A 3UWDA 3R7FA 1AS3A 4O4HB 4CMGA 3K0KA 4M37A 4QUAA 3ZV5A 4HNUA 2VHUA 3FMIA 1Y42X 3L6OO 4U7WA 4Z4IA 4LZOA 4OQYA 1R4MB 2G9UA 4Q1CA 4WWHA 2D62A 1YRQA 4L0QA 1N57A 4EVIA 5LMUB 2ODNA 4ZI5A 4IF4A 3E7FA 1I3OA 3PYMA 4K2AA 4F1JA 2YINC 3CGGA 1Z7GA 4K6HA 4NULA 5L8VA 3JSAA 4QO8A 3VKGA 1RWKA 4GM0A 3PWTA 3FNRA 2VPIA 3SVZA 3CLSD 1RYZA 1YR9A 2GEVA 4IDOA 2A1UB 5ITZB 4Z99A 2W11A 1X2BA 3OG9A 1NHWA 4PLCA 5G2OA 4MINA 3CPSA 2E85A 4X7PA 5ALUA 5IHPA 5LN1A 3NIDB 2QVXX 1J42A 3TLGB 4PHFA 3FOZA 5HKBA 1I8TA 1ZNXA 1KOJA 2YNMC 4L5YA 4L5AA 4R1UA 4JODA 5BV0A 2WFZA 1EVIA 4KIJA 2C77A 2V7QA 5I7UA 1JFTA 1TF5A 2UUCB 2QE6A 4TGLA 1H23A 3PA8A 1LS6A 2AVDA 2H9IA 1UBTS 1L5FA 3VR1A 5IU6A 1G16A 1DARA 4EG8A 4QM7A 1PFWA 2PL9A 3NHLA 4YFVA 4IWYA 3QYAA 2A92A 2XTZA 3K0AB 3EB9A 2PX4A 1C8VB 4NBWA 4QRHA 4DY6A 5A06A 5KQLA 2RAUA 3SX2A 4OYHA 1G5TA 2DG2A 2Z56A 4QU0A 4MW1A 5D5HA 5IN4A 5CK5A 1WF3A 2D0PB 3G49A 2Q49A 4WY8A 1EVQA 4NBKA 1M8PA 1XHLA 2BFDA 4JT4A 4KMSA 4Q9AA 2G0TA 2O54A 5BORA 4K6OA 2YY6A 5AI9A 4JXZA 3IL2A 1ISPA 2UV8A 3JWEA 4XD7A 4UZSA 3A9CA 1KYYA 5HFNA 1O5TA 1E3TA 2OZVA 4FSDA 4UBLA 1HNZB 1E58A 3C7AA 2DHQA 4LJLA 4IDQA 1QS0B 4W1QA 1Z2DA 3RRZA 3G7NA 3ND6A 4UVDA 4BFTA 2HA2A 1SC4A 4X6YA 1ULBA 4BQOA 3NV7A 4ZHQB 2LPMA 2DFPA 2VRCD 1UIRA 1JIVA 1B6GA 4HDRA 4R0VA 1G1AA 4CCSA 2A3NA 2FWRA 1A8UA 3EHDA 4KRGA 4Q9LA 1AUOA 4F9GA 1RWXA 1MB3A 2K87A 2NTVA 4TMFA 2BDEA 2PMCA 3FFAA 3HWSA 2QVLA 5I8ZA 4K0RA 5T8KC 1YONA 4CHTA 1KO7A 1A4XA 2ECKA 3A27A 3AEXA 3F6RA 4D8VA 4PYJA 1OHHA 4LQDA 1HMPA 3ZE7A 3H5OA 4BWFB 1U6KA 3C8ZA 3RVMA 3NTOA 3A6PC 1CJKC 3I83A 5JAOA 2GQ0A 1WDLA 1PS8A 1OZFA 1J8DA 1T5DX 2BE9A 2ZWPA 1RM3A 4QODA 4C21A 2DH6A 3DCIA 1LVHA 3VGPA 5EAIA 4X61A 1RQGA 3I9KA 5SZIA 5MN4A 1M6NA 2X3UA 4DCJA 5KVVA 4C06A 3U7QB 5EMKA 2OYCA 1D1TA 2WHXA 2J67A 2ZJAA 2QD3A 5JEEA 1US8A 5JV5A 2ZM5A 3FUXA 1E1DA 1I30A 3OH8A 5FP0A 2HTEA 4C08A 3LOPA 3RG8A 2ETVA 3BB1A 1X7WA 3EMBA 4V0SA 4BLTA 2QM8A 2GA9A 5IBQA 4DNOA 2A7QA 4P4NA 4RELA 2QTAA 1N0HA 1ZFNA 1Q14A 4I08A 1LH0A 1N5OX 1Z2CA 4X92A 4CMEC 2OM2A 2YYAA 3RTDA 4Y2UA 4M0DA 4O2LA 5LWHA 4D56A 4B5LA 3HR7A 4K9KA 4EKGA 1CZLA 1MMFB 2B2NA 1FRQA 3CLKA 4ID9A 3UOWA 5JH7A 2PKEA 4E4RA 2E87A 2IYZA 3I34X 3BGVA 5AXAA 3H2IA 2BSXA 2V0GA 1GG9A 4Z7NB 3GQBA 4OK6A 3AOGA 2OV2A 2ZR8A 4D9KA 3WYNA 1DOHA 3SSMA 4GI2A 3KVNA 2CXNA 2H2IA 2EF0A 5ISMA 4BE4A 4CM8B 2GCGA 4UBKA 4YO7A 2QTRA 3IT2A 4Q4DA 3OY7A 3RHFA 2BR5A 3EJ6A 2D1TA 5GJWC 1LPNA 1S8NA 2IDKA 4UPVA 1UZMA 3T1NA 1SVLA 4K03A 4IIDA 3P4XA 3WWYA 3KZNA 2BFPA 2J41A 3DEAA 5B6IA 2XAAA 1P33A 1R3UA 3N0VA 2VNJA 4Z9AA 4N48A 4EM6A 4BNIA 2AN1A 4X65B 2FETA 1E1CA 2WNSA 2X77A 3FYHA 4PRZA 2RCNA 3FDFA 3NHSA 2JGRA 1HL7A 1JT9A 1FSGA 2FWBA 4HX9A 4IEIA 4QAQA 3RRNA 4ARZA 4MTLA 4BNJA 4OXRA 4P58A 4EG4A 1I36A 5DASA 2Y1KA 3NP9A 1Y8CA 3KSMA 4IKPA 2AX4A 3TOVA 4RVGA 2Z98A 1HPLA 2XVAA 4UULA 2NYUA 2NU8B 3IV9A 3HKCB 4S2UA 8GPBA 1J7JA 3EPKA 2C9DA 3B52X 1I3KA 4W5OA 5F12A 2BGMA 5FL7D 3ZGZA 1JW9B 1S7CA 5FL3A 2RGNA 3P2JA 1TZJA 2OXFA 1R18A 1N0IA 4LZWA 3TIVA 5KVCA 3D7RA 1UJ2A 3M6IA 2WYVA 3QNMA 5AK5A 4F9TA 2ZUFA 2C5EA 3HCCA 4FYWA 1M0WA 1PGOA 2N47A 4LJAA 1C0LA 1ZK2A 3CW8X 2AWOA 2WBLC 2X1MA 4D5EA 1R12A 3E84A 3T5AA 3DBRA 3MNFA 3PC8C 3W7VA 2QX7A 3RGGA 5HEKA 2RHJA 4EL5A 4Z1OA 4S1TA 1RPZA 1A2OA 3ZK8A 4J94A 1XAJA 1VSTA 3ML1A 3I2KA 4HQOA 3LF1A 1AGYA 1PZGA 1TPYA 2OV1A 3HXOA 4D4MA 4RD3A 4QYWA 5A4DA 2NMVA 3LBFA 1E1RA 1T36A 4Y1EA 2PD6A 3F3SA 2C3MA 3D8UA 1P7VA 1VG0B 2XYGA 1PNTA 3TIGA 4U4AA 4BPBA 2OWDA 3Q3IA 3H11B 1NW3A 2J5QA 2W4MA 5B7PA 5AXDA 3Q3JB 4BUJA 1ODKA 4LG1A 3ETLA 1Y82A 2J5RA 1NG1A 3GRVA 1DDOA 2WP0A 4GEGA 5EIFA 1Q0SA 4DMKA 1P2VA 4FSXA 3R0VA 4EG0A 2C9CA 3B70A 5CU7A 3T3OA 1DIBA 2GN1A 4J1NA 4WK6A 2FN3A 1D0IA 3PTZA 1KMHB 2AEJA 4BCBA 4TKUA 2Q3HA 3MJTA 2Q2QA 5DNAA 1DAGA 4F4CA 2Q0SA 1V6AA 3R6GA 1NIJA 4FYIA 1XTUA 5T7BA 2E0IA 3P0RA 3AKEA 1R0BA 5HWSA 1TO2E 4HZUA 5HW0A 2HJGA 1OYYA 3IS3A 3MGCA 4JJFA 1JEOA 2DAPA 3NUZA 2ZITA 1OD6A 1T2NA 1L5KA 3TOSA 3WB0A 2V8OA 5FUMA 5IC5A 1H4SA 4W5HA 4RLSA 3WV5A 1CIJA 1UBNA 3NIWA 5BOSB 1Z33A 4HAUA 1J9ZA 1H8ED 4PG8A 1P80A 2REQB 3NOXA 5AM0A 5LMZA 2HF2A 1JEYA 5DN6A 2YVUA 4DIDA 1U99A 1T0JB 2UYHA 2QYSA 3OM8A 5I8WA 4DJFC 3K5IA 3DB1A 2BKXA 5DTQA 2X0RA 1H3EA 2R8EA 1ESDA 2X9NA 4H77A 2YRFA 4R5HA 2HEIA 1QWOA 1I7QB 3HNRA 4RC9A 2PEYA 4ZCPA 1FF9A 1ZIPA 4KE9A 2R1VB 4MX8A 3HUEA 4KBFA 3SQXA 3OA0A 1E4EB 1JH9A 4QBKA 3DO8A 5KQGA 1ARZA 2G71A 4FPXA 2H08A 4OHOA 3T4EA 3KJHA 1X13A 2JAUA 2WJAA 3DKRA 3PIRA 4YRTA 3RLFA 1W35A 3LM8A 2Z9BA 3UK6A 3ZIDA 4FHDA 3MC1A 3NC1C 3TVDA 1J8FA 1IUPA 5JI2E 5LOVB 3I62A 1I5OA 3VI3B 3L1HA 2YDXA 2J3MA 3FBTA 3FZNA 2CFCA 1S96A 3QEKA 2H11A 3D0QA 3AEKB 3WGJA 2XLBA 1UBOS 4I9GA 4EPXA 2B82A 3LO5A 3PEUA 3FPJA 3CNHA 2QTHA 4PWYA 4FXOA 3GMIA 3DUFA 5HZHA 4RQUA 2XZLA 4BL5A 1UPCA 4NZPA 3HRIA 4RADA 4CKBA 3QF4A 2HMUA 3K0SA 3N5CA 4C2BA 2PR7A 2X5OA 1OXVA 4GBED 4XB2A 2OUKA 3VHXB 2C95A 3LBNA 1RTTA 2HDOA 3DBIA 2RHDA 1RQRA 3ILVA 4DCTA 4RZUA 3T9DA 1T8YA 1RBYA 4LBWA 4RMHA 5GJCA 5J5AA 1WLSA 1RWBA 1Z07A 4HH4A 721PA 1QOQB 1WD7A 4HFMA 3AF2A 4ROSA 3B36A 4M9SA 2P2SA 1JIQA 1G20B 1RHQA 4DLUA 3G8DA 4KX3A 4B0OA 4HB3A 5GJBA 2H2AA 4RHEA 3T1VA 3UV3A 4ECAA 4ZCTA 1TIKA 5F7OA 3N05A 4AAYA 4BOYA 1B0UA 1T9GS 3CRVA 2D4AA 5AK3A 1CIPA 3QXSA 1M1NB 4Q3AA 1P7PA 2WC1A 4KBYA 1EBFA 4K88A 1N5LA 1N2CA 1DPFA 3D5EA 3IAFA 2WZQA 5A9RA 5F5LA 2V65A 4AFNA 1C2YA 1TJNA 2C82A 1XC7A 1UCFA 2V9CA 3BB4A 4JOBA 4PIPA 5K0LA 2PJDA 1PFVA 5TC4A 4E5MA 4DB4A 3RADC 4RZXA 2VK4A 3PFFA 2PL5A 5JZSA 3FCAA 1YUBA 3R5HA 3PC7A 4TT8A 4EA7A 2GLXA 1I7PA 3R3UA 4JLDA 3V4RA 2XB8A 1ST3A 1MVNA 3HB5X 4E4TA 1ITZA 1OYOA 3ICEA 4DMLA 2GXQA 1SD1A 3OCYA 5HG0A 1EFHA 2IZ5A 5FQOA 4RPGA 2LW7A 1DHTA 4GKKB 3R7NA 1RYHA 2YV1A 4LDRA 3PICA 5D7NA 1XQXA 3KELA 2HCBA 5E3JA 2X19A 1YVEI 2XUHA 4HLQB 4IH4A 5IMBA 1O97D 1Q0QA 2V03A 4IUDS 4RY9A 4TROA 4W6ZA 2X0DA 1X7ZA 2G7MC 5A3RA 1G59A 2I6UA 5BMOA 4OHXA 3W2TA 1ID8A 1CEYA 1SXJA 1HEIA 2QXTA 2VCYA 4OBEA 1KSGA 4N18A 1CQJA 1WMSA 4G0PA 4LOJA 3CRRA 3RTAA 3HM2A 2I3DA 1IG3A 1UBHS 4PV7A 2ISCA 3IAXA 3OKCA 4LN1A 4HQNA 3ZNQA 4NECA 3VNUA 3UFBA 4M1QA 1W34A 1YO6A 1M8JA 3A8TA 2YXNA 4RFSA 3SQDA 4G0MA 4EYSA 1L6IA 4GXNA 1VSUA 2AK3A 5DX8A 3UO8B 1BU8A 4QOHA 2AN4A 5D3MA 5EPOA 3GOHA 2V6GA 3Q7SA 4LMAA 5LVAA 4MR9B 1UMDB 1MNQA 1YR8A 1QX4A 3ONDA 1RMTA 2HSDA 1WU7A 4HTAA 4NEQA 1M0SA 1AKRA 4C4XA 1UDCA 2GJKA 5ESDA 5F1OA 4RTMA 4J3FA 3D4OA 4JT8A 1WXWA 1SVUA 3I9OA 3AP2A 2H1FA 1BVUA 4IDNA 5JPIA 1E61A 3KDAA 2KLBA 4TWJA 3MOIA 2VJDA 5EHIA 3U5ZB 5KHOC 2GAIA 1Y8QB 4BN4A 4AMBA 1GZVA 2HUNA 2HHAA 2ZYIA 3KL4A 1XXHA 2TMYA 3RRBA 1U0JA 2CLOB 3PXXA 1M8KA 3UK0A 2I2FA 4HWKA 4RL4A 1UF9A 4BBAA 2DCMA 1YS7A 2GNOA 2NZXA 3CW9A 3KWLA 3OQBA 3LUBA 4MUJA 1OI7A 1PU2A 3H42B 4QQFA 5LP6A 1E9DA 2LV8A 3PFCA 3OKAA 2OHXA 4M4SA 3U4HA 1RT9A 5DHPA 4BHTA 2O48X 4MS4B 5KNBD 1T6BY 2JGAA 2C5FA 2OO3A 2O0LA 2O20A 4B4WA 2GCPA 2ZUSA 3X1YA 2ZRCA 3C1TA 3L49A 5ENDA 3VDRA 1R0LA 5C37A 2ZTMA 1U94A 4F2WA 3HSSA 2ZCJA 3GIDA 1NKSA 3P5BA 2B94A 4R8KA 3KYDA 2SCUA 4TV9A 2FQWA 3DAOA 4NU5A 1C81A 5HJEA 5A0TA 2QL9A 1B0PA 4OHWA 4JX9A 1FFHA 5DT9A 1XVIA 2BTEA 3UWPA 3ZE0B 1AC5A 3UWOA 1PBNA 1RACA 1YCHA 1SZPA 2MYUA 3FLEA 2CV0A 3LUDA 2Z5VA 1WW8A 4IMPA 2OECA 4RCVA 3WRWA 3VU3A 2Q4RA 2AR9A 3I0ZA 1OOEA 1Q3TA 3LT2A 4ZVNA 5TS3A 2GT1A 4AJKA 5DHUA 1EVLA 3O3NB 1ZGJA 3CUEF 4EB8A 2EQ5A 2A88A 5BNZA 1TK9A 4X1KA 2NVUB 4ERXA 1GHTA 5IJWA 4AUMA 4MI9A 2F3SA 1UDAA 4C7KA 4EKDA 5LKRA 1FU7A 1YE5A 2AEMA 2X7JA 3RWMB 2I3AA 2WKRA 3A1NA 4XB1A 2J09A 1EVJA 1EXVA 5FO1A 2WZBA 2ALJA 3C97A 4P7JA 4WCFA 1RXVA 4TYMA 2RBEA 1Q1GA 3D3NA 4B8ZA 4Y1GA 1OW3B 5I01A 1BROA 1L4MA 5JRDS 2ODTX 2AOWA 2OCAA 3C7CB 4Q7MB 1VYTA 5BQ3A 2ZZNA 2ZIUB 3P4UA 4QPNA 4FOLA 3AI3A 2VDVE 2WYHA 1UOOA 2J4FA 2E6KA 2FOLA 4XVUA 2OHGA 2ZSIA 5J2TA 2X6QA 1BVHA 1C3OA 2X15A 2R8PA 3D3EA 1MXHA 3DHEA 3QLVA 1QHHB 2EFJA 1KEUA 2RGEA 2H52A 3FZQA 4BLVA 1PDVA 2FSFA 5K0TA 3IUYA 1UZLA 3RIYA 1KPIA 2O3TA 2GCEA 1DDGA 1GKYA 1O0SA 1O9BA 1OZGA 3TGWA 4AZSA 1GUYA 3R0JA 4BVAA 3COJA 5A5GA 4BZWA 2ZSUA 3HKEA 1FXUA 1L5GB 5FUBA 4X3PA 1GLNA 1WAMA 2Q8NA 2WE8A 4F5DA 4DMMA 2C0PA 1J49A 3QEOA 2VJMB 3M3HA 4OQLA 4BFVA 4F84A 5AW4A 5LQDA 4LXIA 3K8OE 4ZEOA 3ZC3A 4MRMA 2D7DA 4U39A 3O84A 4ENPA 1D2AA 2VWHA 1A3CA 1PT6A 1K6JA 3GLKA 1S2OA 3M89A 2PS1A 1V6SA 5EESA 4FI3F 2GAAA 3V55A 5IXJA 5KQPA 3PVSA 3IKVA 1DFHA 3PQEA 5ALJA 4MIEA 2H2FA 2Q5HA 1D9XA 4JJ6A 3QKWA 1T26A 5A1JA 1JPJA 3KFLA 2XDQB 4BP1A 2I8LA 1M5RA 3HKDA 3U40A 1DG1G 1H9AA 1VI5A 3K2BA 3KKOA 2SNIE 1G66A 3VUEA 3DMTA 3X44A 4I36A 5JFTA 4LRUA 4PSKA 1JECA 4WKPA 5K6AC 4LY3A 4Q3NA 5D3KA 4RH0A 1ZL2A 2ZT5A 4ZT2A 4TN1A 3AR2A 3W0LB 2E55A 1JE0A 2PO7A 5FPPA 3NEAA 3LK7A 1RM4A 3EC1A 3EGDA 3A70A 3G2QA 3I12A 1CUXA 1Z12A 3FTFA 3TINA 3HA5A 3EGWA 2WPDD 4HS9A 1NHGA 4R68A 1PT5A 3GCXA 3SYMA 4YR7A 4NMLA 5AW2A 3QVXA 3OWXA 4UTVA 1FNCA 4MPDA 4KO2S 4CFSA 2GVNA 2R48A 4UEQA 3BYZA 4FYYA 4PC2A 4GP7A 4YJ3A 5EA2A 4KIUA 2JVIA 5K0ZA 2ODWA 4DHWA 5J4KA 2A33A 4F93B 4PXAA 4C7VA 4EX7A 3IPRA 5JUWA 4ZRDA 4AJPA 1JLSA 1K6IA 5JH7B 4QDTA 5EC8A 5IT4A 3D6VA 1B7GO 1EXWA 4RUKA 5IAOA 3FB4A 3IBSA 1MX9A 1ORHA 3IVXA 4YRBA 2OZKA 1E3EA 1A9YA 2NTJA 1ZYUA 2B1QA 4YJHA 3DM9B 3FGZA 4LY9A 2NUAB 3QHAA 1RBMA 5M5BA 4E5PA 3DPIA 3ABIA 1X70A 3GJ8A 3PUZA 3C3DA 2AFHA 2PUVA 3ZTTA 2OA0A 1XRPA 4H6PA 1YZ3A 2YZGA 4EELA 1M1YA 2DZDA 4ZZ3A 2GM4A 2QLJA 1DBVO 3ONFA 1V7ZA 5CCDA 5DGCA 1DGQA 2FMHA 3MTJA 1RMQA 3FCXA 4KBGA 3OFVA 3L6CA 1NQ5A 3IUNA 1I3LA 1KKUA 1QLWA 4YAIA 2VLBA 5J4VA 1YF3A 4MDFA 1KY3A 3K96A 3BIXA 1H2FA 3WGZA 3LQFA 5AWFC 4MR7B 3SZLA 3HXLA 3FJ1A 3NIBA 4REQB 1AD2A 1FUUA 1R66A 4XIYA 1QC5B 4PINA 3TW0A 1Z47A 3LXUX 5DNEA 4I9NA 5JD3A 4XX0A 2ZVQX 1JAZA 4O2AA 1EINA 4JT2A 5BW8A 1R10A 3M6AA 5K8CA 5L3SA 5A4AA 1CP2A 1ZM4A 2B7BA 3G2MA 5H83A 1CJSA 2JFWA 4PQYA 2I6QA 3F4BA 2VKTA 1EX6A 2WKSA 3UMSA 5FWYA 1VHLA 4QJBA 3W1WA 1PNVA 1U5BA 4O0MA 3JX9A 3D64A 4M6WB 3RT1A 2QR2A 5J4LA 2O2IA 4IDCA 1RLJA 4GG1A 1ZCJA 3C3CA 1XCPA 2AJTA 4DKJA 2CL6X 2NIPA 3VU0A 3DBOB 3FNFA 4F3CA 1ANKA 5DXFA 4L2IB 1J25A 3J7TA 3T0FA 1I10A 2AC2A 1EAMA 4M3NA 4BCCA 1RU3A 3QLVC 5F9HA 3WKEA 2BP7B 4H7EA 3QLJA 1YQXA 2IH4A 1SOVA 3PPIA 2O8FB 2XMZA 4RQAA 4A6DA 4O4LB 4IHJA 4OMUA 3I9LA 4I14A 4A91A 1NI3A 4B82A 4EY7A 2XYHA 1IJKA 3TNFA 3WGVA 5C4GB 1X9HA 1PJLA 3HYRA 1U0FA 3TLYA 4RH3A 4YP7A 3PUJA 2DC1A 3GLIE 2GPTA 3PYLA 3LY8A 4BKMA 2W00A 3KJGA 4I46A 1UP6A 2FPPB 1ZGGA 3QU4A 2I4MA 1WQ4A 1W0KD 3IMCA 4PYNA 1G5IA 3DR5A 5CH3A 3WOHA 4XXHA 3WGMA 1C4OA 1I2DA 3UATA 1KU6A 2VSQA 4MB0A 1IBMB 4F96A 3LT5A 1P3JA 1Q84A 4DWOA 3T12A 4G07A 1HDZA 3IP6A 1CVRA 3VNRA 4XA8A 3K0BA 4TVOA 3QUAA 4Y2HA 1C3XA 4O63O 5AJTA 4C4YA 3DE2X 4AWBA 4TTTS 4BNTA 1Z63A 2J1LA 1JEYB 2NQTA 2NXEA 3DMTC 4HDMB 3GAAA 4KQCA 3CPHA 2ZWAA 2JA2A 2X8AA 2WG1A 3R0QA 2NZ2A 3O92A 4H7PA 4M9XA 2PZ8A 3EXIA 4WZBA 2NYRA 3KSDO 4Y2TA 5HDBB 3SS7X 3V9PA 2JCGA 1O0BA 1JHPA 4UNIA 5IHXA 1P31A 1KJNA 4MGZR 3RFVA 5K9ZA 5BSVA 4LHXA 3IERA 1H5QA 1GZ3A 3INRA 2Z3WA 4LEIA 5F7XA 2HBQA 5CAEB 5CT6A 5JVDA 4CRWB 1OFVA 2OUIA 4PNZA 4YBZA 3ZWMA 4LYJA 4Z4CA 4O5OA 2AMVA 1DS6A 4OKIA 1HKHA 2MOKA 4M1MA 1K97A 3C8MA 4B4KA 3SX4A 2YMLA 1C0PA 4ETIA 2IYAA 2SECE 2VS1A 3REQA 4Z4HA 5CEJA 3I1IA 3WBJA 3PQ5A 5ADVA 1IXKA 2PFGA 3AF5A 5COQA 3IAS6 4EHBA 5IKPA 3QPDA 1KU0A 2MSNA 5DM60 4C0BA 3R5TA 5HZKA 1IC6A 3NIFB 1PX2A 1ZVQA 3DF9A 3DOCA 5HIIA 1ZW1A 4MDYA 4FT2A 2YWJA 3JAWA 4LJRA 3QF4B 2YWBA 4QASA 4WK2B 1G2IA 4Q39A 4RF3A 3U9TA 4CL0A 1RD4A 1XTTA 4E5KA 3TEMA 2IJGX 4PN7A 2QZ4A 3RYHB 3ADOA 3ND8A 1J8VA 1KZYC 4ER5A 3R8CA 2V4UA 3OCXA 4B7ZA 4YV0A 4MUEA 4IZOA 2NTYC 2FUKA 4XFJA 1PEAA 2IHUA 2Q5EA 4MDHA 3VZQA 1U3UA 3DLTA 2B5VA 4LTNA 1U9CA 3IXMA 3MT8A 1Y9EA 5H02A 1FPMA 4Q34A 5CEFA 4B2LA 1Q0UA 2DY0A 2EKLA 1ESNA 2CMGA 2JCVA 4F6RA 1Z39A 3G6KA 1P4SA 1EAYA 3L0IB 1DAIA 2QVGA 5TEWA 2WWVD 2YJ5A 2W22A 1CHDA 3B3AA 4UREA 5TQVA 1UKZA 3BCRA 2WFAA 1QE0A 2CDCA 3H1PA 2B61A 3ESBA 4FIZA 5IKOA 2PT9A 1OTYA 1UKEA 1WZEA 4G5GA 1PFGA 1ODIA 2IZZA 1XBTA 1XGKA 2EKBA 1O96B 1RBQA 2Y9PB 3CPJB 3LDGA 4OQ4A 5EMNA 3GMDA 3T3GA 3WMWA 2OO7A 1BOOA 1CY7A 2ZJ3A 1U8XX 3WNZA 1M74A 4DWWA 1ML3A 1WCYA 3OUZA 3H9BA 4LAFA 4JAVC 2IYXA 5FUYA 4DIFA 4Y2VA 2G5GX 2WVGA 1QXSA 2R751 5GGYA 1HUQA 3GGOA 3MCAA 4R1OA 3RJ5A 5LM3A 3RTGA 3X1XA 3Q4GA 4ZI2A 4DLKA 1RYBA 4JR1A 3GV0A 3DEZA 1AKWA 1PKEA 1MQSA 4GRIA 2ZUUA 1I2ZA 3K1YA 3K9GA 1FFXB 5B3LA 5AKEA 1H05A 1GEEA 1VMKA 3URKA 2JH9A 1N2BA 1JHDA 1SB8A 4NZMA 5E4YA 4ECEA 1SCKA 2PX3A 4UD6A 2P0YA 3ANMA 4JJGA 2DX7A 3IDQA 4KPUB 4YAUA 4CR7A 1N2IA 4Q4AB 1A2QA 2Q9AA 3ZWXA 4K9NA 3I28A 1TADA 3VA7A 4H60A 3SPXA 2PQMA 2H1LA 3O2JA 4JNKA 1DIAA 1P75A 4FSHA 5B12A 1OA0A 1LBIA 3LGSA 4JOSA 1VPTA 2VF7A 1E8NA 1Q17A 4WESA 3NKVA 3BIWA 2A1TS 1QK3A 3U17A 1OQAA 3QV1A 1PJRA 1XROA 3ZCRA 1QQBA 2YBDA 3STUA 3D3JA 2HQSA 2AZXA 5LLTA 4YACA 1WXGA 3WIEA 4O0LA 1K7XB 5CM8B 2CB9A 1AUVA 3E7PA 4AD8A 3UJDA 2FF7A 3D02A 1JJBA 4NNOA 5ERXA 4RIIA 1QYXA 1CQPA 1KOLA 1YIOA 2JAHA 3GN1A 3RV3A 1Y1LA 2IUEA 4M21A 4V0NA 1T4DA 2CVQA 5D6NA 1E3WA 1HMYA 4QUDA 2GGSA 4K7JA 2XQGA 2UZ3A 3B48A 3QYFA 3H5NA 4UNSA 4V3CA 5L3QA 4I1YA 2ZBFA 4GI3A 2FW8A 2XXBA 5B1SA 3LPMA 3FOEC 2APJA 3WV4A 2WFMA 4H1TA 3NHZA 4MV1A 1EM8B 1ZW6A 3G8YA 4P3KA 1KYIA 1S2IA 5J2UB 3EPRA 4RWZA 4UDOA 4RIHA 2XNDD 3ABOB 2D3WA 3JYNA 2YIVX 3DO6A 3FBGA 1OWPA 2N75A 4Q4CA 7AT1A 1KZHA 1Z37A 3C5WP 2I9PA 1YT5A 2ASEA 5BR8B 1NT4A 2J9GA 1HQDA 4ZRNA 3MFQA 4F3RA 4Q15A 1BCSA 1E20A 4ZVPA 5IDWA 4AY4A 3DAPA 2FW0A 4YXWD 1TFUA 4S24A 1N4DA 1X80A 3LHKA 3MB8A 4II7A 1K6EA 1P0MA 2ZYHA 3ZHXA 3PYXA 1FDSA 1SK9A 2WF9A 3IUMA 3PIIA 5EXEA 1MLDA 3K92A 3OWOA 3RS3A 2BZ0A 1WF6A 2XUPA 3EQZA 3UWKA 1L5MA 3RWBA 1U3CA 4F3NA 3IELA 4TS9A 1FL9A 1GQRA 1R0XA 4RORA 1BCRA 4W99A 3AEQB 1L5NA 1SIBE 4JCCA 4HVLA 2OCLA 4KV7A 1ZD4A 2CW5A 1LKZA 2NGRA 2CGEA 3GLGA 3ZNPA 2NSLA 1UH5A 3ECAA 2QUIA 3TOXA 2OYRA 1AKTA 2VYFA 5BN5A 5BY2A 3AESB 2PPVA 4DXHA 3JWHA 4WKBA 4ZVSA 5JLJA 2E4VA 1QO0D 5CFMA 5BYBA 3QI2A 1V3UA 4RD2A 5AVVA 4JHLA 1NRWA 1SWWA 2XVMA 5HMMA 2VXOA 5U1PA 2X3FA 4XIJA 1E6LA 3QLTA 4CEHB 2XKAA 5JBQA 2ZU6A 1FXWA 1DNPA 3DMPA 4JKYA 1P62B 3AF6A 3MILA 5BQOA 1NZDA 1Z4MA 5LUBA 1ZBQA 2LD4A 4RA9A 3W6UA 2V6BA 5ALWA 2YY5A 1JEQB 1Y5MA 3Q7EA 5EQJB 3QIAA 5K2MA 4FILA 4DARA 1Q2XA 1XRJA 3ANYB 1LGYA 3Q85A 4QGFA 5BSEA 1Y5RA 2P0EA 4DHEA 2HCJB 4Y6QA 5BSWA 1KHTA 1DXOA 2VYNA 4S3MA 1RQLA 5J2TB 3P96A 4OH1A 4DKXA 3UJAA 2FEAA 5CA1B 5LU8A 3DBLA 3VPGA 1KK3A 1MP0A 4PYMA 1I6WA 2WIGA 2EYUA 2UVPB 4CMBA 2J30A 1A71A 1NF9A 4CVNA 3L18A 2CMHA 3KYBA 3Q1LA 4G97A 3AB3A 1RWWA 4QUJA 5J1SB 1WEHA 2ERYA 2COUA 1LRJA 3HLYA 3TE6A 3RRFA 1E6WA 4GU5A 4OHVA 1WETA 1KH1A 4BEVA 3D4IA 4EG6A 3SYNA 3TLXA 5K4HA 5AOCA 3N2GB 3QX9A 2I4TA 3GEPA 5I48A 1ZHHA 1EFLA 1L7MA 3W1EA 1CB7A 5FOWA 1RW4A 4RYDA 4FNMA 1MFZA 2BFCA 5LQJA 4FYKA 1YDFA 1ZMOA 1IN6A 4NARA 3HU5A 1KFBB 2HOQA 3FI0A 1HTBA 2GKSA 3BBPA 3INYA 3MW8A 4OHPA 5C1IA 3PD1A 5JW6A 4X1IA 3LBYA 2IV2X 2GJ9A 4KR0A 1JKJA 3BRWD 3KKLA 3LY9A 4Z8YA 4FQ8A 4U6NA 1OA1A 4DJTA 2VJLA 4JUFA 4BQPA 4ETMA 5F2OA 1YB5A 3THSA 2R6JA 1CRPA 1JBKA 3P0FA 4FLEA 5CIWA 3VU9B 5KVAA 1NMQA 3N8DA 5B7GA 2MMCA 3U37A 3DDCA 1E8MA 1U9YA 2OFWA 3DMNA 1JALA 2P68A 3HCWA 4QUGA 3TCXB 2I67A 2JLVA 1M6WA 4IZIA 1Z25A 3OU7A 3RI3A 3T38A 4BFYA 1PSDA 3ZW7A 4X7RA 1TLFA 3DE4X 1CUZA 2HBYA 2AJDA 1MQ9A 4CLHA 1L5ZA 4C07A 4UTZA 2YV4A 2G40A 4YJDA 3V1TC 3AERB 2QN2A 3PNVA 2QENA 3DEJA 3QVGA 1SBHA 5CLIA 5TQ0B 5CLFA 4R54A 1QQAA 3LP6A 3VNSA 4BX9A 3DZFA 1UMCB 2DTDA 3CRW1 4GO1A 2XRFA 4EJSA 1F8XA 4V0KA 3FUWA 2CUZA 1I4WA 5EIAA 4BC0A 1IEXA 2HZ7A 3O8DA 2Y0EA 1OH6A 1NNUA 2GMWA 1G6HA 4YA6A 1VECA 2Z3ZA 2V7GA 4MS1A 3UK2A 2V59A 4ISCA 5F98A 2YWXA 3DXZA 4KYIB 1CLUA 1WDWB 1WV1A 2PL1A 3HO6A 2VCHA 4LYEA 4OQMA 1YTLA 4HAIA 5JMTA 2B7CA 2VP9A 3BXZA 4YJ2B 4X93A 5JJCA 1NAHA 4CQMD 2WT4A 3R6DA 4J1TA 3DL2A 1E0AA 1PJSA 1H1LA 3MGAA 3OOWA 4DL9A 3OQIA 2X2FA 3LA8A 5K0CA 1IMJA 2HKIA 1NW4A 1HG0A 3EWIA 4DCNA 3ZDEA 1WMBA 2FW6A 3ETDA 3B8EA 3NBKA 4R81A 4XLZA 1C3JA 3LFHA 1WHTA 3WB2A 4M9UA 3T1QA 2BLNA 1PZFA 4KWTA 5AJHA 3ZZ0A 5ALVA 2ZYWX 2VK8A 3BSWA 3N6VA 3NM6B 4LRWA 3RUCA 3BWYA 4MV4A 3STYA 4BU1A 1EGVB 4D0NA 1MH9A 4LHZA 2VEOA 2HHLA 2O1EA 4RPJA 5BQXA 2IZOA 2BDUA 3SXUA 1KRHA 5LXTB 1UJCA 1JSZA 1WUTA 1T9AA 1CQXA 2DLDA 1PT7A 2GRJA 4FM9A 3SS9X 3BT7A 3AUAA 3BN3A 4DBZA 4GICA 1VM6A 3NVMB 1SXHA 4P5DA 3C48A 3N53A 4FGSA 5JSZA 1G98A 2PGIA 1JHMA 2DPHA 1J06A 1TD9A 2JEYA 3C8DA 3KPYA 4QYSA 4ZOLF 5B64A 4OFBA 4JJEA 3ONVA 1T91A 1YL6A 1U5CA 2YHUA 2V9PA 3OD1A 3WIOA 4CQLB 2GHTA 4P6VF 2WWIA 1PBTA 4N0DA 4LMRA 5FNVF 4GGPA 5C2JB 1JA9A 1I1HA 2XRYA 3BD6A 2XCQA 4HY3A 1BXKA 4BO9A 3VR5H 2M98A 4BUZA 4E7OA 2AH5A 3SZMA 1P2FA 4S35A 3O4IA 4HRYA 3RRXA 3IP8A 5B30A 1ATZA 3TEJA 3EVCA 5TPWA 4LRTB 2HY7A 3KZXA 5ESRA 3H8VA 2BGWA 1XFDA 5JQGF 5FIUA 2VH1A 3EX7C 4ZOEA 4LBVA 2BH2A 1KP2A 4P31A 4Q3EA 1L5LA 3PD7A 4MW7A 1L7VC 4QX6A 2NAFA 2VPTA 4NBUA 3A1UA 3AVOA 4FK8A 3IUSA 3RBAA 3L9WA 3V8MA 4IH1A 1DKNA 1QUFA 3BORA 3GJ5A 3MJ4A 1QYVA 1X7XA 2ORED 3PGKA 4JOCA 3FGPA 3BJEA 5BMVA 1WHSB 1LZLA 2ORYA 1X19A 3NZEA 4C2AA 5KYTA 4RTQA 2Z2IA 3JQCA 3OVMA 3O8LA 4HAWA 4JS0A 4M88A 1P7CA 5P21A 1HORA 3EGXA 3RYIA 3AR7A 1DUIA 4CKWB 3QOFA 4ZTZB 3FI9A 2HZBA 3IIJA 3BFPA 3TM4A 2J5BA 1G41A 1JWBB 3DZDA 3RB8A 2CKMA 2OGWA 3DHWC 4B6PA 3V1MA 3PXGA 4U2BA 1DJOA 3BAZA 3FZEA 2UAGA 4MIKA 1NLMA 1SCIA 1SIWA 2KQUA 3UTCA 3M6XA 1ONOA 1URPA 2DHRA 2IK8A 1YOVA 4YDRA 1AQUA 2FN4A 2NXCA 3I8OA 3QWHA 4MEBA 4COKA 4DOMA 5CDTA 1A7UA 3EARA 4GYKA 3DS8A 5H68A 1OB2A 1XCBA 1EYZA 1GG2A 3MMPA 2NTEA 3OZVA 1HDYA 1IRIA 1QMGA 2FMKA 2QLLA 2V3VA 4FJ1A 1OKKD 4RLFA 5COAA 1Q12A 3PDIA 4GNKA 1C9EA 3A4VA 3CPEA 4JP3A 2VF5X 1HA3A 1TW2A 3V8RA 1J8QA 2WAAA 2XT6A 1DKLA 3HG7A 3KYCB 4NL4H 4R2JA 5INTA 4X66B 1VOTA 3P4YA 4F1KA 1VXOA 1LQTA 3AUJB 2WTBA 5IYZF 3NTVA 3TXXA 1YACA 3HCRA 4UUMA 3D3WA 1J33A 1YCFA 3TSCA 4OP2A 2FP3A 3EQ6A 2UVDA 3OZFA 4XQGA 3BXEA 2QT9A 4OUDA 1QRDA 3N2IA 4P7BA 4XWAA 3I42A 5JADA 3DAYA 1CR4A 2QW0X 4D80A 1UFOA 2EKZA 3O75A 3R3HA 2QUJA 4H0FA 4L8GA 3R7WB 1BRTA 4E2XA 1TEHA 2X9GA 1P0FA 3K6RA 3L06A 4EJSC 5EMMA 3TPFA 4TTVA 4KQ1A 3QTBA 1RADA 4R1QA 1F6BA 2VDOB 4ZEXA 4G4SP 4GQIA 4ZVQA 3SVLA 3ZWVA 8ATCA 1IUOA 3SQOA 4I55A 1YE3A 4B7UA 5E3HA 1VCMA 4UTRA 3T5BA 4BNHA 5KKCA 3SEFA 1N6LA 3IE1A 4QBHA 4L74A 1W1WA 4CXMA 1UC8A 2QPOA 4RK5A 1KDRA 2WDZA 2PQ6A 3F97A 4HH1A 4D0LB 2NSYA 2ZRIA 1RWPA 3DKPA 5ALHA 1ZA1A 1A97A 1ORWA 1RFLA 1W47A 5FL7A 4CQMB 3P9RA 4TVSA 2R1ZA 4B81A 4JGBA 2C5SA 2XQFA 4XGIA 1DQPA 4CMHA 1E7MA 4URHA 2F00A 3GP8A 1K4KA 4IIBA 5J1TB 1VHTA 2G25A 2VI5A 3QXCA 3I5YA 1V26A 4HNGA 4MUYA 4BO1A 5IJZA 5C9ZA 3JTMA 1TVKB 2AC7A 2P2YA 5ELMA 4UM8B 2ZYDA 2NV2B 1YZTA 2JLRA 5FNZA 2BKLA 1LF5A 1Z15A 2CHUA 3K2IA 4LCJA 1OIVA 2B0JA 1YUNA 1KMCA 1N0VC 1X92A 2J0UB 3ESAA 2QL5A 3KR1A 4HQLA 4XYMA 3JQBA 1UZNA 2GEUA 2OLJA 2PR2A 1Z2PX 2Q1WA 4IGFA 4LVOA 4QSHA 5AUOB 1QX3A 3I58A 4M0MA 4N5LA 3WSVA 5GWXA 3D8NA 2IPLA 2D2VA 3M9XA 4HVTA 1R6XA 4WK4B 2OKGA 4LFBB 5FLYA 4KR6A 2Q3LA 1HDGO 3WGHA 4PAQA 4DQXA 5KHLB 3KDPA 2HLDA 3MQ4A 4COOA 1R8XA 3AX6A 4BX8A 2BBWA 3NJ8A 4CCAA 3QWBA 4QA9A 3TJMA 1TIPA 2MT9A 1P7YA 3E61A 4X60A 4NS1A 1W88A 1FLNA 4X8HA 1TNDA 1ZUIA 2WKQA 1C7FA 2A0FA 2ID9A 3BMQA 1E96A 1R7RA 2DQZA 4RANA 1VE9A 1ZG3A 1PEYA 3BF7A 4Y6LA 3H9GA 5JALA 2PUFA 3RLIA 3TS1A 4CHGA 1J20A 3ILYA 1P60A 2GJ8A 2SICE 3HBLA 1F2VA 3AW8A 3OZTA 3O73A 3ORYA 3OZUA 2XSZA 2BFNA 5DYTA 3LECA 2DFVA 5TVGA 4YN3A 2XKBA 4YJKA 2VP6A 5LA6F 1EIWA 1M9NA 1JHAA 4IUBS 2ZCUA 3OOJA 4P9NA 3L79A 3TW8B 1POWA 1E92A 1QAOA 4WHMA 5KNDD 3VZBA 1XK7A 4QE3A 3KS9A 4NJEA 2Q4BA 3RSGA 5BW5A 1Q1NA 3P2EA 2JLQA 4X62B 3LC0A 2DUNA 4LX0A 1CC1S 3MBKA 4NK5A 4D41A 4KITB 1RZRD 4MYSA 4DEYA 1VFNA 2BMWA 4P32A 2I1VB 1A7AA 3WB9A 4PO3X 4DR1B 5J5VA 2G76A 2JAPA 2P1RA 4JZYA 3S4YA 4EITA 1N2EA 3QV2A 1YZKA 2X9QA 4AL4A 3NBFA 2CLKB 3OPYA 4U7PB 4FHZA 4FR5A 4TX1A 4DCVA 2AVNA 4F97A 3ROPA 2REBA 3TLZA 1DO0A 5J4YA 3GC6A 2EL9A 4HH0A 1UEIA 3GLIB 2H06A 1RKQA 2WM2A 1C4XA 2KE5A 3D8TA 3EEFA 2VZ9A 4NH0A 4PZLA 4R8SA 3U1VA 3OCZA 1L4BA 2QUKA 3JQ7A 5DEIA 3NQ41 2H0RA 3E4DA 1OFUA 3FLBA 1ZVVA 1B93A 3PEFA 3W34A 4B46A 4KZPA 5DOVA 3TOZA 4KW7A 4KSYA 1GTSA 2HNBA 1N1MA 1U1CA 3CN9A 4H3HB 3LO8A 1CJTC 3SVTA 2VNHA 1SK8A 1YS6A 1QG6A 2E9SA 3ZI0A 4BATA 3COYA 2I4OA 2ZULA 3LJKA 4I50F 4FOPA 1QMPA 4XB6B 3VKHA 5DTMA 2O6LA 1OJ7A 3LCRA 5I45A 4K28A 3K5HA 3U3XA 1MJNA 1ZO8A 3CZAA 2QRPA 4JVOA 5AOBA 2ATVA 3DEHA 4J07A 3IV6A 1YJAA 3NPAA 3C6YA 4WECA 1W76A 1D8TA 3GFGA 5BUSA 2I91A 1LJ8A 4PFJA 4R16A 4P8RA 4I1VA 5D3QA 5SYMA 4G0XA 1VYVA 4EPVA 4Q9IA 1L7AA 1V1MB 5EXDA 3W8FA 4BE9A 2Z4RA 3G13A 5B55A 4OIFA 3WFJA 4UATA 5EJIA 2XRMA 3W5JA 6NULA 3O8OA 3ZW8A 1TMGE 3JQEA 4RJ2A 4XOUA 5BNFA 3HXKA 1Z4IA 1WPXA 5DDIP 4W5QA 5HFAA 1EUDB 1YDEA 2GCOA 3WLAA 3NNNA 1NW8A 4J0FA 2OM6A 4LF7B 4DMUB 4MS3A 1BX0A 3UJ9A 1G8PA 1GFZA 3SM9A 2C2WA 2L17A 3PC6A 5KYWB 1QHEA 5F33A 1KI9A 3D6UA 1P8AA 1FTWA 4LS3A 1XAIA 4FGJA 4RTPA 2R60A 2QI9C 1NN3A 2Q0QA 3Q7PA 4ND2A 4CTKA 4DIUA 1IZYA 2PNFA 3ADBA 5CEEA 5IJ0B 4FWIB 5EIOA 1E98A 2A9QA 2VWPA 4P53A 3ED5A 2BI8A 4NATA 4YDSA 5AJWA 2ZWOA 2YQ5A 3K0FA 4AKHA 4DLWA 1O4VA 3D6JA 1MR3F 3CO0S 4BJ5A 4C05A 5DIFA 2AG0A 4GF5A 4KE7A 2Q4EA 1OBFO 1A77A 5LLSA 4ND7A 1U8ZA 2CBZA 2ZKIA 4I4TF 1L1FA 4C5CA 3ZTWA 1YA6A 1ZWLA 2OT3B 4FFLA 2ZEJA 1KVSA 2YOFA 3CH6A 4L3VA 4J3NA 3JQBC 3ESCA 4RFLA 1FDOA 2FWNA 3DLBA 2QYHA 1WCXA 2VTEA 3MERA 3RSZA 2JIMA 3BSYA 1J1IA 3W4IA 4KZKA 2POCA 1P77A 2KI5A 3ZXIA 5C8XA 2CYAA 2DKFA 3PB3A 2QA5A 4S0ZA 5TRTA 2BEWB 3IJPA 4RKQA 5GONA 3PPXA 2B34A 2QPTA 2XOKD 3BMXA 4YLEA 1P1KA 2WTMA 1MG0A 3HCDA 3H3JA 4DCGA 1PR5A 1W9HA 3KJXA 5LYJA 4WN9A 5H3HA 3I4FA 3G68A 1NXVA 4BMVA 4IY1A 2O6HA 4ZOBA 1M5UA 2AXQA 3IT0A 2DT8A 2IIBA 3OJEA 5DNVA 4DLLA 4Z9FA 3JU3A 4JV5B 1RJ9B 5LWQA 3LBIA 1BNCA 1P4HA 5LP1A 1GFIA 1OXSC 1MC8A 2JBAA 3QIVA 3QYPA 2VO1A 4PX3A 1UPBA 2OXRA 4PRLA 4C4TA 4HNTA 3KU4A 4H18A 5CT8A 3GARA 4ZYWA 3EXHB 4QM6A 1THZA 2P2ZA 5CFPA 3QPVA 3M7IA 3VSCA 3U6BA 2FSHA 2A35A 4YB8A 3RUFA 2ZLBA 4BMXA 5BWNA 3V6MA 4Y9UA 5J58A 1TK3A 3G23A 2A94A 1LK0A 2NNLD 2CLDX 2QTMA 3B6EA 3ZPXA 3ER8A 4BGDA 3WRYA 2GFQA 3N0XA 1GXSB 4CKWA 4KPEC 1QR6A 3WIBA 1X38A 4AI6A 1TTHA 2JZOA 3AVQA 3UXHA 2VUTA 4EEZA 2UUAB 1KAHA 3INTA 3ENKA 4YCMA 2VPXA 4NY1A 3O4VA 4EJSB 4LSGA 3NB0A 4LF4B 4JXXA 2BH9A 4C03A 9LDTA 4BX3A 2DP4E 5J3JA 5IJ9A 3FVQA 2AOVA 4N0EA 4LZAA 4ZU1X 4YJGB 4HPXB 4FJ0A 4GP9A 4D6YA 2XUQA 4MUBA 2JFFA 2YCBA 4DVJA 3R6LA 2Y92A 4TM8A 5ALOA 4ZI3A 4EVRA 1Z75A 2I1QA 3KG2A 4MQBA 3G0OA 5EXPA 3JD4A 4IJQA 4HFNA 3ZHCA 1Y7PA 4I1PA 2P1DA 4ZK6A 1BD4A 4LHEA 1Z7EA 2JGDA 3A6JA 2NO5A 4IHKA 3A1DA 2G09A 4ISBA 2BVNA 3NVDA 5KTOA 5JT1A 2PS0A 1IDOA 3CH5A 3PFNA 3TTXA 3ROKA 2OG1A 1JLHA 2OXEA 3OQIB 2OCDA 2WUFA 1TKBA 4POAA 4RK6A 2Q50A 3ZJ5A 1TJ3A 5D2CA 1P1RA 3U7RA 2HXSA 2WIFA 4D8WA 1HYHA 1E9SA 2SBTA 1G8KA 3K0CA 3OM1A 2X86A 1WHTB 5CA0F 1MAVA 4MEJA 4YUWA 5EWMB 1SZDA 1AO0A 3ZJTA 1T15A 5D3ZA 1ZNQO 4BO2A 3UBMA 3CVYA 1C3LA 4DV3B 4B34A 1HYBA 1E5VA 1D8AA 1R0KA 3FMOB 3M2PA 5DFAA 2WF5A 3TR6A 1IJFA 3PR3A 3DE1X 4HGPA 2D1FA 3FYUC 2A0YA 4IHQA 3BJIC 4LVUA 3UQZA 1YDGA 2G1UA 5HF5A 1Z36A 1EA5A 2JATA 3JYQA 2JNWA 4LBYA 2ZBQA 4RHCA 3CVXA 4PSCA 2G1AA 1NPDA 3NPMA 5EMJA 4S04A 4CZ2A 4V38A 4KH0A 1G55A 1EGHA 2WJVA 1GKIA 3HP1A 4QXPA 1K86A 2GN8A 1UMBA 4E03A 2L82A 2PSEA 2XCLA 1QPGA 4G0NA 4KO4S 4YAFA 4TSKA 4AS3A 4FB4A 4YRKA 1EVKA 3K53A 3RC3A 1Z6PA 3TQSA 1ENZA 5DBHX 1L5YA 3BXFA 2TMDA 5HK8A 3WLFA 1UQUA 2W6OA 2RJNA 4AN4A 5JXGA 1ZOOA 4KLNA 1NV9A 1OH7A 3EZNA 5TB5A 1PJQA 2X5NA 2CDNA 1XEXA 2R0QC 1TRHA 3AYZB 1Y1KE 2ZIXB 1S4MA 4RGQA 1VPVA 1W19A 2JCXA 4X6UA 4OU5A 5LZ2A 1C3EA 1OV6A 1Z5WA 5KHAA 3EPJA 1MAWA 4RPIA 2CV2A 3L7AA 2E4ZA 3NBUA 1SZCA 4R3UC 1W8IA 2E18A 2OZLB 3ANLA 4XOIA 5FWNA 2SHKA 2WWGA 1D6MA 3TO5A 3KEGA 3SZGA 1EVEA 3G88A 3M6UA 3SHTA 1ZONA 2YWGA 2AOUA 3O0DA 4KVFA 1TAHA 3JZMA 4DR2B 1X7YA 3S7TA 4Q16A 4Q24A 3GDGA 3PGJA 1OTHA 3FN4A 1B8NA 5IP5A 2ZR0A 1ZI9A 4GRAA 3MUFA 3WXBA 5CLQA 3G85A 2E2WA 4I6GA 3GI1A 1HEYA 1KZ4A 3GDFA 3OQ1A 5ULLA 3Q1KA 4YV7A 1Z35A 4QXOA 1XA4A 2BW0A 3CF0A 1VZ2A 2YVQA 4GM4A 4D4GA 4OA5A 3HYTA 1EFKA 3VTZA 1SHLA 2I66A 3PIDA 3TJRA 1SIUA 1AKNA 2FPWA 1Z0SA 4R40A 4JSRA 3S2FA 4ZO4A 3ZD6A 3MJEA 4U2GA 1PYGA 5LL6P 3DR3A 1DEXA 4WCDA 2A78A 4KO8A 5DMHA 5AW9A 3BL8A 4Z4QA 2XOEA 2O2HA 1JAXA 4V0MA 3OSUA 3WIVA 4I5DA 1V39A 3JAKB 4NMWA 1CRZA 3OQJA 1ULTA 1NOKA 4MLDA 4NU0A 2V4ZA 2ZRQA 3BMOA 3R3JA 5IWCA 2E37A 2Y0PA 3TTYA 2JRCA 3VYWA 4HV4A 3IKTA 1QBGA 1PV4A 1OXMA 2GVDC 2B4AA 3D31A 1NRXA 4IIJF 5LZ7A 3T7TA 4YDHB 5G1NA 1TMYA 5BWLA 1ZICA 3QPAA 3CNNA 3IAM6 2J07A 2JIQA 1FVXA 2DVMA 3ICWA 3PNOA 4AJNA 5IBPA 1EPUA 3ELDA 2IHNA 4RF5A 3BCSA 3CQ9A 5KSYA 1KGSA 2UDPA 2I3GA 3VHQA 5FHRA 3LZCA 3T7JA 4ZCMA 4YT8A 4DGSA 3EMVA 4PTZA 2C8VA 2MIIA 2NVOA 3PCTA 5E1OA 2JHFA 3SGLA 1I3CA 2HK7A 2QD2A 4OUDB 4ETWA 1W94A 3G1UA 4L78A 1KARA 4S05A 3N2YA 1Z0AA 3KZVA 3C8HA 4PAWA 3RAJA 4UVGA 1YDMA 1KI2A 3BULA 1E79D 3DW1X 3HP4A 1E9VA 5FPKA 1JLRA 2ECFA 1AK2A 2AXEA 3FJOA 4MMYB 4TTQA 4G2NA 1TA9A 1CR6A 2CXSA 3VKVA 2VDPB 4WLNA 3KQWA 4FFRA 3SC2B 1NP6A 4MGKR 2EJBA 4DWVA 1VSBA 2ONKA 4Z0HO 3MGGA 4TPKA 4B9AA 2ZSDA 2J0VA 3ZCQA 4HCJA 4DJDC 1GZ5A 4B4UA 1JIIA 1GPWB 3MS4A 3VR0A 4IMRA 4GRDA 3A05A 3HEAA 3RFUA 4N12A 1NUPA 3C3MA 3G5MA 1Y89A 5E9QA 3RK4A 4D3FA 5JSUA 5DLEA 1V9SA 2I7DA 4RTNA 3IEIA 2R1TA 1N25A 2GBCA 3LX6A 4FDLA 4LTDA 1JIUA 1RHJA 2WG0A 3A32A 3O4HA 3M4JA 3M9LA 3GJYA 1H22A 4G24A 4GT1A 2W48A 4XDHA 2QAGA 1UP7A 4DDKA 1Y3CE 1JDZA 3K0CC 4A0GA 4NYIR 1GZDA 2G07A 1YI0A 1ZMTA 3F49S 5AKJA 2YWCA 1U1IA 4WNYA 4O5AA 2HU7A 3L0SA 3LGAA 1CE8B 4Q7QA 3AM1A 3EIHA 4WQMA 3RUHA 1IEQA 1TF2A 2ZW9A 3PU6A 2CMKA 3MF4A 3EEOA 3GB9A 1VLMA 2NAPA 1A5AB 2IODA 5K0EA 1EBBA 4UAGA 4FGUA 1BWSA 1VA5A 1QFZA 1BVRA 3WI7A 3LT0A 4ZYUA 2YRWA 5A7HA 2B8TA 8LDHA 1NVFA 3N7AA 2OR3A 5I7AA 1Q2UA 3WIDA 1SEPA 2WT8A 4B3MB 4BVLA 4IIEA 5KSPA 1BMQA 1LD3A 3T4XA 1J0CA 1XDDA 2QT0A 2NQ2C 4H7JA 4M46A 2JGEA 1YZLA 4QLAA 2FOIA 2QNRA 4RD1A 3R3XA 4TL7A 3V2GA 4OEHA 4OHUA 3MUOA 2GERA 2Q45A 3T06B 4Q4HB 3PGVA 1D1PA 3NUQA 4YK7A 3ZY4A 5LUAA 3C5CA 4MR8B 4AF8A 5DM4A 1S3FA 3GAMA 2QTLA 4C7MA 1U1EA 4ZPXA 3R9IA 3TBFA 2YIDA 4MP6A 3T7DA 2H7XA 4JP1A 4R01A 2JDIA 4YP0A 3QZUA 5JS7A 1MABA 2JJ1A 1J0EA 5C7YA 3DNPA 1B6TA 1TT7A 4EI2A 5BV7A 5F23A 2XDYA 1XG5A 1EMDA 1Z4LA 3RRYA 3ER6A 1GNRA 1ZD8A 2C3YA 4N9WA 2QD5A 3EVBA 2E5FA 5CB4F 3TNYA 2GRUA 5CPFA 2HC9A 3AONB 3CF6R 2H2HA 3DBHB 1LVGA 3MUEA 2J3JA 4XQCA 3L8GA 3SIPA 2RD2A 1AV6A 1Z2EA 4EA8A 3WK5A 2TYSB 3K1JA 4JBXA 3PXCX 3WRVA 3SEQA 4Q66C 4DMFA 3ZDRA 1O6BA 4YJFA 2R6CA 3LTNC 1DIOB 4NHOA 1VLJA 5C34B 4MB2A 2Y93A 3FCOA 5C3MA 3GUUA 1VGVA 3D6AA 4XH9B 4EFKA 3G2OA 2IU6A 4XCQA 4L51A 2PBFA 4B33A 4BMZA 2P2CA 1GRCA 3JQ7B 4JLBA 3TAHA 5KQMA 4NCIA 5EFZA 4YMWA 1SOUA 1ORVA 2GBIA 2XUDA 3F47A 4CIBA 4CLRA 5JXHA 1HE2A 3P32A 4IW3B 4MI6A 2AG8A 5HK9A 1WW2A 4DRXB 4ZO9A 1QPZA 3G2LA 5EWJA 1P5ZB 3PXBA 3HZHA 4BFWA 5CBPA 4FFVA 1EZ1A 3GK3A 1G5PA 5JANA 2IWHA 1JDTA 5EJMA 5CYOA 2D7JA 4IF6A 3IALA 2VT7A 4MV3A 4A3SA 3JARA 1ZSYA 2ZIGA 5T4FA 5AYVA 5BNWA 1ZU5A 1KYZA 5GIPE 4C30A 2DFKB 4HOYA 3CWCA 1JB9A 2PY6A 2I1LA 3ILXA 4L85A 3WLOA 4CFZA 2NP7A 3RV4A 3LMKA 2J3KA 4MQ6A 1GO2A 2HCRA 1UDWA 3PUHA 3EZLA 4HNAA 2FSSA 3ANTA 2QMEA 4CR8A 2NPIA 1ONPA 3FYUB 4G23A 1NSTA 1YC5A 3C5EA 4BO4A 2HK9A 2FG7C 1HRKA 3MSXA 3F46A 3X0DA 2ZT7A 4UHFA 2AYYA 2F8LA 1DRKA 1HE3A 3NT2A 4PC6A 3IKMB 1FW8A 4IUCS 1WB4A 2NU6A 2H51A 3TZ6A 3K70D 3ZGVA 1LLDA 2B2XA 4JENA 1OAOC 2LVBA 4B3IA 4CUKA 4LX8A 3E9ZA 4IKOA 4RGBA 3LHFA 1LI5A 1TKCA 1JFRA 4GZMA 1VXRA 1T5OA 2NU7A 5AVKA 3T3IA 1IHUA 3RSQA 2HO5A 4PVCA 3E70C 5L51A 3ZVLA 3TTWA 3RNLA 3LLCA 2BJVA 2KS6A 4QYIA 2NX2A 3K5PA 4NE9A 4RZSA 2AKYA 4TQ9A 3SMQA 3GHYA 2FK7A 2XB9A 4ZI7A 3BKXA 1VL1A 2O8CA 2E21A 2ZYAA 3PWKA 1V4BA 3H1EA 1JS1X 3MMNA 2C88A 4C0SA 2XZTA 2R62A 3CUUA 4GPTA 5IDYA 3RKSA 3KETA 4AYXA 5A5DA 1NVBA 4HXEB 4JSYA 2AUMA 4EKYA 4Y2YA 2BUAA 4HH3C 4ESEA 6YASA 2PUGA 4WCVA 1T8RA 4QATA 4TL9A 1OLSA 1BO6A 3CNQS 3HEBA 1SC1A 4ICIA 3MN1A 3UFXA 4UM5A 4RACA 2HJVA 4B7XA 3GMSA 5I4BA 3QE4A 5HTOA 5E0OA 1XJ5A 1JMKC 1L4HA 4NAUA 1WZUA 1SCBA 3ECSA 1ZN7A 1TYBE 2WTEA 3AR9A 3KT3A 4J75A 4GWKA 3I2IA 4ALNA 4CLDA 1N36B 3RJ9A 3HVHA 4Y6OA 1KJZA 3KT0A 2ZZMA 2FMIA 3MHPA 3MJFA 3DOHA 1TPZA 3NHFA 3CSDA 2I0FA 3KVRA 2RJ3A 3PG5A 3S29A 1U2TA 1VE1A 2ZPTX 3PT9A 1XEAA 3E15A 1W0JD 5LDGA 4B4VA 4EBFA 2G88A 1NUHA 1KH3A 2O59A 1BHSA 3QMMA 2SKCA 4E21A 1ZUNA 1N5MA 1SG0A 2DPYA 4PXYA 5KWIA 2DR3A 5LQMA 3MWEB 4LC9A 3AW9A 1K2VN 2IHZA 4HYQA 4PLGA 3VJKA 5F51A 3WC4A 2F90A 4JUCA 3SF8B 3V4PB 1Y9JA 2AZDA 3PUXA 4TSFD 1VLHA 2PRJA 3P52A 1OCEA 2VAPA 2REOA 1X77A 2EU8A 3G2NA 2GF0A 3KLNA 4TS4A 2C58A 3IQIX 1Z62A 1P6UA 3TMYA 4GBJA 1RCTE 3ZWPA 3AMVA 4B73A 1TLTA 1KAQA 4LNUA 2C5BA 2H16A 3T4UA 3V42A 3D4BA 4ENRA 2FUEA 2KWIA 2CXHA 4UOEA 1WRBA 4DUGD 1KOFA 5K03A 4KWEA 5FFFA 4Z3KA 3DHYA 5K8JB 1Z8DA 1SCUB 1WCIA 4AIIA 4B3TB 5FQNA 2P9EA 1SZJG 4O4HF 2FSIA 4LBZA 3RS4A 3UCEA 2WD7A 3ZH9B 2C5HA 2WQ7A 4WGGA 4DBVO 1QGOA 5DGIA 3Q2KA 5CD1A 3PVZA 3F7MA 3GWGA 4MUGA 4XGRA 1G3IA 4BFSA 3ZVRA 4HD8A 3MWDB 2PZFA 2ZIEA 1D07A 5JYBA 4M7PA 2Z8YA 1ZESA 5EHNA 4DAOA 5ICCA 4IMJB 3SC6A 1K7FB 1MRNA 3FUVA 1RCFA 4O25A 3B1FA 5EKDA 2D5IA 3NTQA 4YXWA 1EUQA 1X1RA 5L4NA 2P9CA 4Z1MA 1UM9A 2N9UA 3AHFA 1XTVA 4AG3A 3L7DA 2ADOA 5B2ZA 3KX2A 1XRQA 3LVBA 2IS6A 5GZ1A 1C7JA 3CNLA 4CM5A 2PFSA 3GD5A 1FUIA 1A9XA 1AKYA 1GNTA 3IC5A 5I7SA 3O31A 1YULA 4KIFA 5IJXA 3AWDA 3DMRA 1AO3A 4LPKA 5A3JA 3FTNA 4LGYA 4ZCRA 1L4KA 2I5PO 3IT3A 3MSCA 4CWAA 3GDWA 1XLVA 1DIRA 3CINA 1QCCA 1OLUA 1WJGA 4MRVA 1HURA 1R16A 4W1PA 2WNHA 1P6QA 4P92A 2XE4A 3R9KA 1VA4A 1G60A 3K6KA 5K3EA 2PX0A 1FP6A 3GROA 1DEHA 1XNHA 2WJYA 4YMVA 5MDHA 2VHTA 3A4YA 3FJYA 3NFRA 4QUBA 1XNQB 6REQB 3RHSA 5LD2B 2XIJA 3G17A 3HUFA 2DQ4A 4NF2A 3FKQA 4CF3A 3OIFA 2GA8A 4CQNA 1A4UA 1YB2A 4MNTA 3OQMA 3OO1A 4IICA 4G56A 2EKQA 4J7XA 1EE1A 5M34A 3K70B 4M7WA 4C20A 3SBEA 5CHEA 1H2ZA 1XLTC 3PI7A 3A0RB 4OHMA 2NUTA 2Q28A 3B3JA 1NWCA 1QP7A 3AUKA 4G5OA 3T6KA 3KUKA 2B0CA 3FCCA 1RQPA 3ZXYA 4DIBA 4IOMA 1WSBA 1YZGA 4O02B 1CCWA 1NI5A 1JR3A 5HUJA 4XLLA 1OWMA 3TW6A 4YCBA 2Q1SA 2JW5A 5CUQA 3HC7A 2JFVA 2IPOA 3V4OA 3HRKA 4LQ4A 2HQ1A 3HVJA 1F12A 1GV0A 1TM5E 1PL0A 3I6BA 3O38A 2R66A 3FDZB 1A7KA 2TRSB 2VYVA 3VR5D 4E6PA 4CF4A 5LQAA 3EH1A 4AECA 3RAFC 4IQ4A 1E32A 2G4VA 4PZEA 2P9ZA 1NSYA 1UJ6A 1FNMA 1HYEA 3NHUA 2IU0A 3SNHA 4YRIA 4LI0A 3GEMA 1LSJA 2C4UA 2EBHX 2IHBA 2I03A 3HABA 4KV9A 1DT5A 1WIWA 2XXAB 1D2RA 4A6XA 1SCQA 5ECDA 1AGNA 1TZ2A 4INZA 1V35A 4HDNB 4EG1A 2WAMA 4O3FA 2QDKA 5AKXA 3T5TA 1R4NB 4F5YA 4OK5A 1E0SA 3FCSB 3PNYA 5EHZA 3QI7A 1PJ3A 1KSJA 3L6UA 4PHGA 3I3OA 1MIOB 1VPEA 2AN3A 2P91A 2QMOA 3QUBA 4OXXA 5ALFA 4QGSA 1TJ4A 1KQOA 1FFGA 2YX1A 3O91A 4UOZA 1WNFA 1HV8A 2CXTA 4B1FA 4E5YA 4YONB 4FB5A 3IT1A 1FX0B 1LBSA 4ZZ2A 3V80A 4NEGA 4C3VA 2EGHA 1QF7A 4AS2A 1U3FA 4F2PA 3IQXA 1VCHA 3G7UA 3B1XA 3R6TA 2ZJFA 1IAVA 1TCAA 1I9GA 2EC5A 2X0JA 4ND4A 1T4MA 3USZA 3WQRA 1R0ZA 3A31A 2BMVA 2VYQA 4KVGA 5A7GA 3BTUA 1X1EA 3CCBA 3MXOA 5JATA 2J7PA 4QULA 4B85A 1QP4A 4ZVMA 2FHPA 4Q02A 4CM4A 1YGYA 3G2PA 3QXHA 1OLXA 2R00A 3UHJA 1Y7HA 4DLBA 1FC0A 3COPA 2FSVA 3FTQA 4H1UA 5E1MA 1N6IA 1BSVA 4QRDA 1ENYA 1PW5A 1R0SA 1YI8A 3AF1A 2ECOA 1N9KA 1NQTA 2C83A 4DA4A 4K1LA 1WDKA 2P3SA 5EP2A 5SY9A 5KTMA 1GRQA 3OU2A 2ZTSA 3ZDYB 4NXMB 3QUCA 1T2EA 1LDMA 5CDFA 1KAGA 5K0SA 2HHCA 4KPFC 3KCNA 3II6X 1QIEA 4ZVRA 4JY7A 3C15C 16PKA