1V5IA

Crystal structure of serine protease inhibitor poia1 in complex with subtilisin bpn'
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
275
structure length
274
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin BPN'
publication title Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'
rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/protein binding
total genus 97
structure length 274
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2003-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1v5iA00
1SBTA 1TM3E 3HJRA 4KPGA 2Z2XA 3GT3A 4C3UA 1Y3BE 3EDYA 1VSBA 3BPSA 3DE6X 3DE4X 5JMOA 1CSEE 1S02A 1XF1A 4CG0A 4BWGA 3L1KA 3Q40A 1SBCA 1P7WA 1HT3A 1AV7A 3DE5X 3CNQS 1TO2E 2PMWB 4B5LA 3UNXA 1PJ8A 3GCWA 3QMPA 4HVLA 4DZTA 3LPAA 2Z58A 1BFUA 2W2MA 3DVSX 2SICE 5FFNA 1ZVKA 1WVMA 3DE2X 4CFYA 5CW1A 2WWTA 1SUCA 1T1GA 1Y1KE 2ID4A 1ST3A 4AKTA 1YJAA 1Y3DE 1NLUA 1BFKA 1V6CA 1P8JA 1GTJ1 1Y3CE 3DVQX 1Y34E 2Z57A 2ZRQA 4NMXB 4WOBA 1SVNA 2WUWE 4JP8A 3DW1X 2TECE 1NDUA 3DE0X 5ARCA 2HPZA 4GI3A 4LVNA 2PKCA 2B6NA 1KE1A 1SBNE 3DWEX 4YN3A 3DVRX 4DWWA 3WIVA 2IY9A 3LPDA 3DYBA 4AKSA 1GNVA 3I37X 2PRKA 5K7SA 3EE6A 4H6WA 4DJ5X 1SUDA 3F7MA 4OMCA 1SH7A 1KE2A 2XRMA 1C9JA 3DW3X 3I30X 5AVKA 4KB5A 3PRKE 1WSDA 1DBIA 3BGOS 1BE8A 1P7VA 5B1DA 1EA7A 2E1PA 1Y48E 5JXJA 2PWAA 2QTWB 2DP4E 1SELA 1WMFA 1IAVA 1S2NA 3ZXXA 1DUIA 1T1IA 3AFGA 1YJCA 4OMDA 2P4EA 1SUPA 1GTG1 1PFGA 1NDQA 1AK9A 4LVOA 3SICE 2ZWPA 4OV6B 1UBNA 2X8JB 1KDYA 2DQKA 1Y4DE 4ZARA 1THMA 4I0WB 2WV7A 1TM7E 2Z2YA 4NE7A 2Z30A 1GT91 1SCJA 2W2NA 3DE3X 4M1ZA 2ID8A 4FONA 2Z2ZA 3DE1X 2W2PA 1SUAA 5I9SA 3F49S 1GNSA 4MZDA 1SBIA 1SN7A 5JXHA 3A3NA 1GA6A 5AQEA 1EGQA 4RYDA 5ARDA 1MPTA 2PWBA 3VV3A 4H6VA 3AJ9A 2ST1A 1R64A 1YU6A 2HD4A 1TM4E 3I34X 4C3VA 2SECE 2Z56A 1WMDA 3WHIA 4H6XA 1AVTA 3QTLA 3VSBA 1C9MA 1R6VA 3WIUA 1S01A 5JXGA 1CNMA 1KDVA 5B1EA 3A3PA 1GCIA 1TK2A 3CO0S 4ZOQI 1GTL1 1AH2A 3H42B 2SNIE 5JXIA 2G4VA 1GA4A 5FAXA 1SIBE 2XTJA 3D43A 1BJRE 2X8JA 3A3OA 1C3LA 5ARBA 3GCXA 3AJ8A 2W2OA 2SBTA 3PTLA 2ZWOA 1YJBA 1LW6E 3VHQA 3WQBA 1KDZA 2DUJA 1IC6A 5AMXA 3F7OA 5AVJA 1SCDA 3Q5GA 1OYVA 1OYOA 3VV2A 3BX1A 1SCNE 1ST2A 1A2QA 4KG7A 1PTKA 1AF4A 1Q5PA 1TM5E 1SCBA 1JEAA 3LXUX 1TM1E 1SBHA 4K8RB 3SQOA 1Y33E 1GA1A 2W2QA 3T41A 1PEKE 4NE9A 3VTAA 1Y4AE 1OT5A 4CFZA 1SIUA 1SPBS 1SUEA 2GKOA 3DDZX 3LPCA 2WUVA 3DE7X 3D9QX 3I2YX 2PQ2A 1BH6A 3ZXYA 3TECE 5SICE 1SUBA 1R0RE 1Y3FE 1AU9A 1SIOA 3TI7A 1TMGE 4HX2A 1ZVJA 3QFHA 1SCAA 1TECE 1T1EA 3EIFA 2IXTA 4J94A 1Y9ZA 1AQNA 1WMEA 1C9NA 1V5IA 3TI9A 2PYZA 3P5BA 1TO1E 1MEEA 3GT4A 3VYVA 5FBZA 2V8BA 4Z2AA 3OSZA 4WOCA 1BE6A
chains in the Genus database with same CATH superfamily
1VECA 2F1KA 2J9RA 2ZRHA 3BICA 4UCXA 3KP1A 4XWOA 1TIPA 3ZDAA 4FZ5A 5K3OA 3BF7A 4B4OA 2ZE6A 1NAIA 3W5VA 1AF7A 3B1JA 1TM3E 3D8HA 4Y8VA 2JFHA 2PFSA 1CY7A 1M1XB 3RYFB 1P4RA 1NX6A 3NT4A 5K0EA 3LZDA 4LG1A 2H9IA 1ZITA 2ZSBA 1HDEA 1RC0A 4D0NA 1U8UA 3EOAI 1CEYA 3ZWNA 1QAOA 1E5XA 1IUOA 5LD2C 3ZWOA 5JAOA 1TL7C 1A8QA 4FYHA 5C31A 3X1MA 3LW7A 1VSBA 3B89A 3DBRA 2HGZA 2WD9A 3S2YA 4DR5B 4DA4A 5HA5A 4NR0A 3LX8A 3LQRA 3U80A 2DHCA 4FT2A 1VL8A 2QJOA 4AUNA 1PL7A 1PT7A 1TYDE 4JUDX 5FUQA 1B1AA 2IOQA 3LT1A 4HNSA 1HQKA 3CLTD 2AGVA 3GNLA 4IIFA 2PZKA 2CFIA 1HE1C 2C1EA 2DVMA 3TBKA 4BMDA 2RIRA 3WGLA 2PKQP 2WJPA 1WCWA 4F4CA 2IHNA 1BXGA 5AKLA 2VSXA 4PGAA 3AF6A 4FD2A 5L4NA 1MX5A 3BQNB 5D5QA 4YWJA 1E20A 1L8XA 1SQGA 3KQPA 3A7DA 1KAOA 5AK5A 4Q7QA 1DAFA 2IZ6A 3D4OA 1QG4A 5ILGA 4I1OA 1PJ8A 5A5GA 1ZK2A 2GM9A 1DBPA 1YKGA 2C42A 3ASZA 3G5UA 3P0RA 3ZCRA 5CA1A 2XVXA 1LLUA 3H2GA 2QT1A 1YJ8A 1ECJA 4C3OB 1TKBA 1EBFA 4EUHA 5DNUA 4RTRA 1CVLA 1ZD5A 5ECWA 3IP5A 2AMLA 4WUTA 3NTQA 4XOIA 3ZHUA 2Y4NA 3GPLA 1IMJA 1T9DA 3D8BA 5U4QA 2GCGA 1NWCA 3UQZA 1UZUA 3AHEA 4HATA 4MUFA 6NULA 2DBYA 2CHGA 3ABRB 3IA7A 4JVSB 1N1MA 2BFEA 3BAZA 1WHTA 4JI8B 3HKDA 3KR9A 1YL6A 2R6HA 3DF9A 3MUNA 2QW8A 4JSTA 3QEOA 4NNJA 5ALHA 4BMPB 2BTEA 2A59A 821PA 4N6GA 5KCMA 4G5OA 3MK31 1EPUA 2FEMA 5A6SA 2BMFA 3DZDA 5AYVA 1PBNA 1CY0A 2O2CA 2YMMA 2OVBA 3HLYA 4X6UA 4BKRA 4BXOA 2WWVD 3CRQA 4ARUA 5CFZA 2I91A 4LGMA 721PA 2H4ZA 4JLVA 4V0LA 3SHFA 3IR5A 5K9ZA 1XE3A 4P7GA 3WBFA 1V6CA 1N9GA 5JALA 1P74A 5C53B 1YONA 4BNXA 2BBOA 2VAWA 2C3OA 2JD1A 3K05A 4M9CA 4HWKA 4GX5A 1VRVA 2H17A 3SSNA 3HXKA 3NALA 2VUTA 1AGXA 3EIOA 1SAYA 4M1WA 4BNIA 2A5DA 4EMUA 3R1IA 3RIEA 1O94C 5LBIA 4UCQA 1FNSA 1EMDA 1N5RA 2HDOA 5E6UB 1G8JA 1U2GC 1YS4A 2JS7A 2ZB8A 1R15A 3AINA 3E23A 1AKVA 1I2AA 2BBWA 1THGA 5TGZA 4BZQA 3RKRA 1SXJA 5E3IA 4QXQA 5EAIA 3AUSA 5G0TA 4BNTA 1VKRA 1Z6QA 3M4NA 1M54A 4C05A 5A03A 1LTHR 2B9EA 2F9LA 1L8LA 4HWPA 2BSQA 1Z6GA 1G4HA 3KOUA 3QE9Y 1PJLA 4QXRA 5PNTA 4FYIA 3RRNA 3BRWA 1G9TA 4LYEA 1PZNA 3WWZA 2IYEA 3ETLA 5DT9A 5TVKA 1GG9A 3USES 2WM2A 1I2CA 2CVPA 4MA4A 4Y6SA 4Z3OA 2QJFA 1RLOA 3QXCA 2IITA 4KBFA 3B3JA 1XROA 4XCQA 2ZKIA 3SC2A 2E18A 4CNBA 1R8SA 3RTGA 4UEOA 4PVDA 2EDCA 1TUBA 1NP6A 4KK4A 4NE2A 4GDMA 1J8MF 5HBRA 4F1WA 4AP9A 5BRJA 4RIHA 4N7BA 3UZUA 2VLIA 1QWSA 5JJ5A 2RARA 5EIAA 4FM9A 2Q9BA 8MHTA 2OZLB 5KSYA 5EZYB 1HT2E 2YW9A 4E2FA 2X8BA 4N9QA 4OHKA 2BFBB 1OB5A 2Y05A 3OMLA 1C3OA 1B41A 1E1CB 3PUWA 4C04A 1Y6ZA 2WE8A 4BQNA 3LCRA 1R0WA 3FCEA 3ZJYA 4C1NA 3KX2A 4I9HA 5JSZA 1ZESA 1JJAA 4J6EA 3W7AA 1JG3A 1T4BA 2H0AA 1DQNA 4BJ5A 1EA5A 2RJ3A 4DM4A 4RCVA 3FTCA 4A36A 3PC7A 3U16A 1V4BA 2PX0A 3BGOS 1HM5A 1KNXA 2IC5A 2QTVB 2X2OA 3ISVA 4IY1A 4MDYA 3RUIA 2OD9A 1PJBA 4OU5A 1US8A 3VVMA 1FSFA 3HB9A 5KKNB 2NLOA 3RC1A 4TXLA 5FL7A 2ZTLA 3AILA 1Z16A 3EOBI 4P34A 1RJFA 4Q1CA 1ML3A 2G70A 2A86A 1D2EA 3SJCA 1M1NB 4JYBA 1XO1A 3G85A 2PWAA 2JD2A 2ZKLA 3NB0A 2IF2A 4CR8A 3C7DB 4W82A 1DEXA 4C4YA 4QWWA 1PQWA 2ZCJA 4C29A 4HQLA 5G02A 1DUIA 5CTJA 1VKJA 2CXXA 3BBPA 2QXTA 4Q39A 3QY9A 4HRVA 3RWOA 4C89A 3OI7A 3IVGA 4PAOA 2GXQA 2GAFA 1EUDA 2QUAA 2WIFA 2X2PA 3E9CA 3L4EA 3WAGA 2P7HA 4KQ9A 4DLYA 5FYQA 3VZRA 2IQIA 3IVXA 1HF3A 1MOPA 3AEZA 1L5OA 1JIQA 3I1FA 4XSVA 9LDBA 3LKBA 4TUYA 4HN2A 4X84A 4P3NA 5EVJA 1TJNA 4EHHA 4ES6A 4NCIA 4M9QA 5DISB 3JAKA 1KEKA 3GLIA 1QTIA 2H92A 1GZVA 4EG1A 4P9NA 1KZ7B 4OGFA 4Y1EA 5EIXA 4IEEA 1NQUA 4TTPA 4OJYA 5DXAA 2IHUA 4REQA 1KXJA 1VLZA 1NMEA 1TMOA 2X0JA 3ND6A 3D2LA 2QY9A 3PHCA 1YIOA 1EWKA 4HQ6A 4KDCA 5EWMB 3KU4A 1NVAA 1PJCA 3E7DA 5JV5A 3MWDB 2V6GA 4BUZA 2GF0A 2HNKA 3C43A 4O4IF 5GADl 2IZOA 1NNUA 3TRDA 2I4LA 2PXXA 4OMFG 5D3MA 2DOKA 1BKSB 1E6KA 2QAJA 1EK5A 1NW8A 2F2TA 3B1KA 3UHOA 1R5NA 5TGDA 5JNRA 2AJ8A 1D9XA 1EJ2A 1SNYA 3B6MA 3W5UA 1KY5A 4QFCA 2OG2A 2HX1A 2Y1KA 4XR9A 1GQFA 3E9RA 4CR7A 1I94B 1R9NA 4N3GA 4ZOEA 1P29A 1OBCA 1YJXA 5EL0A 2XA2A 3DBHA 4IJQA 1IEWA 3MT9A 3LNTA 2ZTSA 5DK4A 3VDMA 2R4QA 1B0ZA 5I9SA 3L8HA 3M34A 1FU8A 2W8BA 4N01A 4M0MA 3GLSA 5D7NA 4IOLA 4DEXA 1RYDA 1PJQA 1H85A 4QC2A 121PA 1SY7A 4J49A 1Z5WA 3G88A 3A3NA 3WA6A 1YKFA 1T5HX 4AG5A 1MO3A 3LIPA 2BR3A 2OBFA 1JNYA 1T3SA 1IN8A 5HM8A 2I9KA 1VPWA 3MXOA 3DXXA 2HA6A 1V8OA 4KSBA 3TLAA 1VBKA 4HGPA 4Y2JA 1MPTA 4UHKA 1OLUB 2I4MA 5E9QA 3OUTA 2E4AA 2XGMA 5D5HA 3N2YA 5BWLA 4W7HA 4LW8A 5T4FA 1NUPA 4R7GA 5AESA 1ULZA 5K0GA 1LBIA 1NJ5A 2DQSA 1XEWY 3BMOB 1NVGA 4E12A 3HJBA 1UMBA 1I32A 1XRSB 3Q8KA 1D4FA 4L07A 1HDXA 3QX8A 1W85A 1X8JA 4PQRA 4YJ2A 2WMOB 3L0DA 5DIFA 3QHQA 2DX7A 3C39A 4RPCA 1RWNA 5DNCA 5HKKA 2RI1A 3JS5A 4H6XA 7GPBA 5CCDA 4ZI7B 3QF7A 1TU4A 1UC4B 3O2NA 3OZDA 1NQVA 1V47A 5JSQA 2JIDA 3JR3A 4IRXA 5A62A 5JNLA 1VLMA 3MQ4A 5C2JB 1LNQA 5L40A 1AN9A 2JLWA 1USKA 2DFKB 2E49A 2N3ZA 1E6MA 3EXEB 1C1HA 3QM1A 5SY9A 1OLXA 3NYIA 2NO9A 2PR7A 5I45A 1H42A 3IALA 3QOYA 3HU3A 1KARA 4XUDA 3QVSA 4HDKA 3KLMX 3QMVA 4NBUA 5AOCA 4CZ2A 1QXSA 1RWMA 1KK2A 5JE8A 2ZATA 3FZYA 2NSJA 3L2OB 3G0GA 5DHAA 3SVZA 4YUYA 4NWIA 1SKUA 3TSOA 1KVQA 1KTVA 2IYRA 3FSGA 1QQ6A 3PGLA 5EP1A 1MVOA 2C3UA 1LSOA 5DYWA 3IUQA 3H42B 2XRYA 521PA 4HNGA 5TF0A 3MFYA 1SVOA 2P3LA 2EFGA 4DG9A 5JXIA 2OV8A 3INTA 3QELA 1COWD 1LI7A 5FAXA 4ZICA 2YJTD 1XCGB 3KVOA 4MIOA 1P4GA 4Z3KA 3O2QB 2ZBVA 2WAYA 3NX4A 5DFAA 4YAIA 4LJ9A 2PT7A 4QOFA 3CLTC 4QSHA 2OE2A 4MW7A 4YJFA 1X0XA 3E1GA 3ZVNA 3HXLA 1WSBA 5K0ZA 1E66A 1JX6A 1WHSA 1TCCA 1L7PA 1XK7A 1LU9A 3BRCA 3C74A 2B34A 1K4YA 3EYWA 3GGCA 3OCYA 4P8RA 5C4GB 1Y6GA 2ZSEA 2ZUVA 4YNBA 3HO8A 1SQSA 1BS1A 1JU3A 2FDXA 3DFFA 4KI0A 4Q1DA 5D87A 1Z5ZA 1J09A 3CN7A 2ZPUA 2ZWOA 2FVYA 3R5TA 1YHNA 4CKYA 3WGHA 2CLOB 1GDTA 3COYA 4KRYA 4C0WA 4ZGWA 5GV7A 2AFRA 2IE0A 3CB2A 2C98A 3DOOA 1X1BA 4C22A 2Y1GA 4BO2A 1FW8A 2IXBA 4MLZA 2P9QA 4OU4A 4MQEA 4XD7A 1NVEA 4HDNA 5DJ5A 4LC0A 3O3NB 3NAMA 1ISIA 1L6RA 1TTPB 2HA5A 3OX3A 5HZKA 2G8NA 5FADA 1L5RA 5CX1B 3AP1A 4WVFA 3V8NA 1UDXA 2XBUA 3EF3A 4HXEB 3WBKA 1FF9A 4Q3KA 5JNWA 4LVCA 5F7XA 3BX1A 2X0IA 3IEIA 1SCNE 5BWOA 4JOBA 1OF1A 3OUZA 1XTJA 5JVDF 3DDCA 1QCDA 2JHCA 1PTKA 3FN4A 1WETA 2AYYA 1Q15A 2FJ0A 1V3VA 3AUAA 3QPUA 2X15A 1UK6A 1LNZA 2J6IA 1NUQA 5COAA 7ADHA 1T0JB 1RAIA 2PS1A 3ZQUA 2NVWA 3A31A 4E4YA 2QQEA 4B43A 3OJFA 3H4MA 5KNBA 4MV0A 5FFMA 1W76A 4P0QB 2G5GX 3C7KA 3ZUPA 4K8RB 3QU2A 3RC9A 1K6EA 5KWVA 3TS1A 4OJQA 1ONPA 1T34A 2PLNA 5F12A 1N5OX 3AEQB 3LTNC 3GJYA 4MYSA 3IODA 4B46A 4C4XA 3CVWA 2REQA 3WHPA 4Q3EA 3S4YA 3GFRA 3ZNPA 3DDSA 4LF9B 5FD8A 3FHOA 3W7VA 4BJHB 5AJTA 3O8QB 4KGDA 1P5HA 1UK7A 4LYAA 3QVLA 4AP5A 3HM2A 4LXGA 4NZOA 3N3BC 3R0XA 5DYYA 1ZJYA 3PVZA 5LB2A 4F86A 1EFPA 2J3MA 4Z1MA 1G8KA 4OHMA 2CE2X 3BA1A 6ABPA 3RVJA 2PQ2A 4AYWA 1JWLA 1HPLA 2E6KA 3LP8A 5LQMA 1XN1A 1QIDA 1VBFA 4PU0A 2BEVB 2Z95A 4JXXA 1KZYC 5DM4A 4TKZA 1WMBA 2ZYWX 1OC4A 3C97A 4OLJA 5AIBA 4F91B 1OI3A 3QTBA 1JDBC 1UBTS 3PXEA 2C20A 4D96A 5HCIA 2R48A 5CNIA 2CF6A 1PL0A 2PL9A 4HY3A 4ID3A 4GRDA 5CCEA 2CZGA 4OQ4A 4L8LA 2YVLA 3GJ7A 1XD9A 2BL4A 2QG6A 4NCKA 4RA6B 2PANA 3E1SA 4UATA 2B8EA 3L0YA 5ITSA 1CUUA 1RWQA 1ZK1A 3T1YB 4QUJA 2B7LA 4LVUA 1P0QA 2OXTA 2HF8A 2P2YA 1FTGA 2DUUA 3KALA 1VG9B 3JQ7B 2Z43A 3LT0A 3LRXA 4RORA 3ZI0A 3O1LA 5T4HA 2J3HA 3EA5A 3N2GB 3JYOA 2IQ5A 4RM3A 2GN1A 2OO5C 4OXXA 2YDYA 1WDLA 1RMQA 2DPHA 1ZRSA 4K6FA 2VBFA 4KUEA 2ZBEA 4WLVA 5DP1A 4W5QA 2UZ1B 4RTOA 5CH5A 2ASVA 3P0FA 2GAAA 4LIPD 4P7FA 2X7XA 1PRYA 2A5FA 3ZGNA 3KKZA 1QYVA 1ZJZA 2NNWB 4ER5A 1AK1A 1WWKA 2PPLA 4Y2VA 2FX3A 2R6ZA 3V5NA 1LBSA 4IIGA 5DTRA 3ZWCA 4LY3A 4E03A 1VKZA 5HFJA 4G5GA 4KV9A 4UAGA 3ASVA 5JPCA 2DY1A 1H6CA 3ROTA 1SXJC 3W34A 5CK5A 1BA3A 5T4EA 1OX6A 1EJBA 2AZ4A 1GZ5A 1C7FA 3WRVA 1L9XA 2ISQA 4N4AA 1CIPA 3SYRA 4J3JA 4L27A 3VO2A 1C80A 3RC7A 4N0MA 4PHTA 3UWPA 1Q92A 1S8NA 4EATA 5BV0A 5E8RA 1AO0A 1KR5A 5T5QA 5T8KC 4I4IA 3FPJA 1YDGA 1WV1A 3OKFA 1IM5A 1G9SA 3IQFA 2C04A 5JLAA 5HRUA 4DV2B 2NVBA 5AVYA 2ONJA 5HJ2A 1JL3A 1U2QA 4DIKA 1RKQA 3EB9A 1HO3A 3MMXA 3SJ7A 1ULHA 3I2KA 1IJKA 1I80A 1ICEA 1YOVB 4D98A 5ALVA 3MW8A 1F7VA 1I7LA 5C9ZA 3VOBA 3CNHA 5LMCA 1AURA 4OQXA 2P69A 4H15A 1D5WA 2C2HA 1YDWA 3PD0A 5C1PA 1HUQA 4K0RA 2X4LA 4WQMA 5GAJA 5IT0A 3IUYA 2IHKA 1SGWA 1VJDA 1CZLA 2C9OA 4LWZA 3RD5A 2P9JA 4N12A 4Q9LA 1OWPA 3UWKA 1PEYA 5DN9A 1Z5OA 2NPOA 1KDPA 1D4OA 1XCJA 5JNTA 4OM8A 5AI6A 4O8ZA 2PKRA 3OTIA 4KZPA 5IBPA 4PZZA 3KSBC 4MCJA 1DC7A 5I5GA 4HEHA 3HFJA 3K94A 4YP1A 5F9FA 3TVTA 2IPAB 3DONA 3B5JA 4M9SA 4DCGA 1HT3A 2YWBA 3RFTA 1AB6A 1H2WA 3E9EA 4B3DA 3FPLA 3N53A 3DE5X 4PNPA 3GC6A 4NVRA 2FG6C 2IH2A 4KPEC 4W8OA 4ARBA 4GPTA 4U6NA 3JXEA 1F3LA 2MR6A 1R3UA 3A04A 5CNKA 4NEGA 2JGMA 1AUXA 3DGEC 4QEDA 1GG2A 4TTJA 1H94A 4WGFA 2Q6KA 5CLGA 2VYFA 3ZWQA 3P9IA 4C01A 4Z3DA 3EPPA 4RGYA 1Y6JA 3MVEA 1S3SA 1ZYUA 3IESA 4XRRA 2LCFA 1RFGE 2LWIA 4D9KA 4J1QA 1NFRA 2B36A 4OFWA 1OYYA 2HHCA 5G0UA 3SXUB 4DANA 2EG9A 1ESMA 4ZVOA 4D9JA 3FBWA 3AW9A 3C45A 3O0DA 2Z3ZA 1MJGM 1N25A 4LXTA 2FN3A 4MRRA 5KU7A 2XGJA 1V5EA 2Q3BA 5FBRB 2OGSA 2ZYIA 3IKJA 3ON5A 2KLHA 4Y98A 4ONEA 4MKIA 1CDEA 3EARA 4HRXA 2JD0A 4JI7B 1ZU4A 1NLUA 3DVAA 3QWBA 4JVOA 4KI7A 4O5AA 3VFDA 1MTZA 1P3JA 3PF9A 5EGSA 2PMBA 2X1MA 1JN0A 4PLTA 1M8GA 4M3NA 1ZJJA 3RG8A 1O5IA 3CZ4A 4Q01A 3DZGA 1H9AA 3INRA 5AJYA 4YREA 4YJGB 1DAEA 2JGFA 4XM2A 3U4QB 1Y34E 1K98A 4NMXB 3T0GA 4MO2A 3Q8XB 4FXOA 3OH8A 3PU6A 3R6WA 1V25A 1RQPA 3UCFA 2WUWE 2DTXA 2YFKA 4TUYF 3UMBA 4INJA 4PLWA 1UR5A 2BH9A 5FNZA 1QH8B 4EARA 3A1DA 3OKPA 2A78A 3BL8A 4LHVA 2FN7A 4PAQA 1YS1X 5ECYA 3H75A 2HPZA 5IVIA 3ESXA 3UIEA 4G26A 3FSRA 1M5UA 4N5IX 3WGKA 1SHTX 4ARZA 5IU6A 3RREA 3FGOA 3QUQA 4LJAA 2CJPA 4J4HA 2R60A 2WFAA 3WNDA 3WRXC 4DJDC 3DLIA 1V16A 1ZS9A 1UQRA 2Y99A 5AWFC 2HMVA 3GZ4A 3QVVA 1PAUA 2VA9A 3PK0A 4QLOA 1CRPA 5DH9A 4LECA 3ROGA 1M72A 2VYVD 2QUJA 3HQ4O 3RVKA 4ZV4A 4ZOCA 3KR0A 4DARA 3NAGA 3LPDA 4PANA 1H22A 1Z22A 4IMPA 2FMUA 1IB0A 2PG3A 3SJUA 4CQLB 4L0QA 3OFKA 1Z45A 2QL5A 5FLYA 2CLKB 2QRLA 4B87A 3FGNA 2OFXA 2QMYA 2MSWA 2VNJA 4KO2S 5A3JA 5KTMA 3QSYA 1U8CB 1F6BA 4DLNA 2MINB 2RGNA 4FJ2A 4QUBA 3U5ZB 2H08A 1KGSA 2IEZA 4PPYA 5KOHB 1OX5A 1JR2A 1KSHA 2VQ3A 3KNZA 4LZZA 1GD1O 4PYRA 4ALMA 4AW9A 5DGDA 1J7JA 1B0AA 1VMDA 2CD9A 4FNOA 4N3NA 2FZ4A 2ZPTX 3IPXA 3PNVA 4WKGA 3L7IA 4EB0A 4I8DA 2WSYB 4LMRA 3NOXA 2C54A 2HLDD 5HKLA 2UYHA 1FJGB 1UBFA 2QQ0A 3FHJA 1TDJA 1TM2A 4R31A 4ZI3A 4J16A 4Z4CA 1N5JA 3IO3A 4L3VA 3LUKA 1V7PC 1JPJA 2JJQA 2NV6A 1N2BA 1Z63A 1E3TA 3UUWA 1E9SA 3NEJA 2HIMA 3U2QA 1MA3A 1EB8A 5E1BA 3QVTA 4ENQA 1U0NA 1YS7A 2VHJA 4ARAA 4A4DA 3O8OA 5CD9A 4OX9B 3PTAA 1QZTA 2CXQA 1Y1TA 1H66A 3CR7A 3EZ9A 3UJ3X 4BKUA 4EZEA 3MHPA 2VDMB 5BYKA 1JILA 4BN0A 1XU7A 1Y7HA 1ZLYA 2YY6A 4IGIA 1XHEA 5CT9A 4WEOA 3I3OA 1PEAA 1SJ9A 3ZW7A 2BTQB 2HA3A 3MCVA 1LWNA 2ZP1A 1HL3A 5C8XA 2VSFA 4Y2QA 3S2FA 4B7AA 3JQQA 1W1IA 1HRDA 5L3SB 1JDTA 4AYTA 3ND5A 1K66A 1NBHA 3HB1A 4AZ0A 1TLLA 4X66B 1XMOB 4YQYA 4CU5A 3K8YA 4IXDA 5JT1A 4NFHA 3WGQA 5BYAA 1QO0D 1T8UA 5A06A 5KDOA 4MUMA 4JJAA 3GEIA 3R5HA 4JBNA 3RSHA 2IP4A 3NONA 4G0UA 1J0AA 3GAZA 2NZVG 5TB5A 2C7PA 2X1LA 1IWPB 3K5PA 4Z9FA 5LZ2A 3T3NA 1B76A 1EGMB 3GZNA 2VTEA 2RD2A 5G4LA 3T9FA 1M75A 2BEUA 3NCTA 3T3HA 3M6XA 1UBRS 5EHQA 4XYMA 1QANA 1XJWA 5DB4A 1QHHA 5HVNA 2YMPA 4IIVA 4DMHA 3JW8A 3MTIA 1SCUB 5A02A 4IJVA 1FNDA 4JQSA 4KIFA 4O4LF 3UICA 4I6JA 1QP0A 1R4MB 2BI7A 2RGGA 2Y1XA 3EF0A 3PVCA 4G0MA 4RJ2A 3ZWKA 3ER8A 3QIAA 4WNAB 3KKPA 1XI2A 2QAGA 3M7IA 1FRFS 1BOOA 1EHCA 5ADHA 1RHMA 4QAJA 5FA8A 5CAEA 3DP9A 1RADA 1LI5A 3FYUB 3OPNA 1PFVA 2W11A 3E4DA 1I5RA 3P4YA 4HNAA 1EZ1A 1F8GA 4M7PA 5UKDA 1N92A 1GR1A 4M1ZA 4WXYB 5EUCA 1SUFA 3TSWA 3PDCA 5H5JA 4CM7A 2V97A 1XCPA 2WJ6A 2FA9A 2V0CA 4O2BF 4MKRA 5CT6A 2H7CA 4OQYA 4LC9A 5HQJA 1PT8A 3H5NA 2A67A 1DVRA 2H1LA 2RAUA 4WLEA 5AVOA 4Z0PA 2R44A 5THKA 1JFRA 3KHTA 4IQ4A 4TQ9A 2C4MA 2OILA 4UAVA 5DBHX 2IV2X 3SR4A 2XZOA 4FB4A 3UPUA 3CBQA 4QJIA 4FMCF 1P62B 3ZLVA 4PAWA 2HXGA 3NJ8A 2XOXA 2IGTA 1ZUD1 3OPVA 1JMKC 4IWXA 3FCUB 2EJTA 1D3AA 1WXWA 4PO9A 4XWTA 1ORIA 3G2NA 1HFJA 1T2VA 1W9HA 3H9UA 3QUCA 4TTTS 4IMIB 5F35A 4CG3A 4PLZA 3RKUA 4P84A 3R7FA 3FTEA 4LY9A 1RAAA 1U3GA 2YOFA 4EHJA 3B1ZA 4JKYA 5KPDA 3KKEA 3BM5A 2B78A 3DA8A 5AK3A 4KXWA 1ULTA 5DLEA 5SY6A 4ZMSA 3C16C 4OGWA 2H06A 3O4FA 3Q2OA 5TGTA 1F0NA 2A5GA 4HN9A 4G0WA 3WTBA 3GVCA 3PZBA 4CDMA 2LVBA 2PZBA 1L7AA 1PVDA 3AVOA 1C3VA 4OVKA 5LBTA 4C78A 1Y8QA 1UKAA 4DG8A 2OV3A 4M1YA 1MA0A 4Q5IA 1BYIA 2O3RA 1SIWA 5HEKA 4DIFA 5LPNA 4E2ZA 1QK3A 4KFRA 4UNSA 4BP1A 2E5LB 1QAQA 4WN9A 3RYCB 1HE2A 5ERGB 2B6HA 2DUMA 1RI2A 3IVAA 5EEHA 5ESDA 3NBFA 3VHLB 2GO7A 1QP8A 4BIMA 4EYSA 4KR6A 3WIUA 1IDOA 2FCRA 5CLIA 2CNNA 1FFAA 3L0BA 3FCYA 4L5AA 1NXOA 4MRVA 1K7YA 3GPBA 2FPIA 1XQXA 2I6GA 4WXRA 5KDLA 2FPGB 4V24A 1QK5A 1SO8A 5HQTA 2WPDA 2JASA 4GKVA 1L5VA 1CG6A 3NNNA 2G72A 4X6XA 1FSZA 2C00A 2ZWMA 2A92A 3QLEA 4MMXB 3PBKA 3ST7A 1JQKA 1MGOA 5K4GA 2DR2A 3TTWA 4GICA 1I5OA 2F1IA 3OIFA 4IVRA 5HUQA 3VO9A 4IG4A 3SHVA 5EJ6A 2OOSA 2Q4DA 1EWRA 3UWOA 3MT7A 3AF2A 1MX3A 4I19A 4KQHA 2QR5A 3BMNB 2O2DA 1SC6A 2PUEA 4H7FA 2CT8A 2V7VA 5L3QA 4H1HA 3EPKA 2CJWB 3K9BA 2JVKA 3EBPA 4EYOA 5FDFA 2DWPA 3ZKAA 1SEPA 1Z8HA 4WUVA 1KFCB 1CNEA 1EDBA 2AFHE 3AOEC 1X2BA 2AYZA 3JD4A 4HTAA 4Z4FA 2BGIA 4MWBA 5LQNA 3V32A 2HXYA 1NP3A 2PHZA 1YO6A 4YAOA 1EVZA 3FLMA 1AXGA 3SS7X 5BNZA 5LZ5A 1D8AA 1LBTA 1T9AA 4MQUA 5F23A 2NU8B 4DDUA 1SKYB 1B14A 1C7IA 2GJKA 1U7HA 3DNPA 2V9PA 1G17A 3RR2A 4G89A 2O14A 3E7FA 2OCXA 5J5CA 4EEXA 3IOYA 5I3CA 4JB8A 1K86A 3B5EA 2W58A 1I6MA 1VSTA 2ENUA 2NAPA 4D9NA 4MV5A 1WU8A 1XTBA 1GPWB 3BCHA 4H3SA 4W1PA 3H8JA 4RK4A 4DLVA 2QD4A 4P53A 1L7EA 1ZCZA 2YJGA 4NBVA 4LC1A 3NWOA 4TKLA 3R9IA 1VYUA 1R74A 1Z0ZA 2XF2A 2F59A 5COBA 4I4TA 4GX2A 3ZK8A 1OTHA 2TS1A 4BBZA 4CM6A 4OXQA 1JG6A 3AUXA 2HKIA 1GL7A 1QZXA 1AMNA 1IXSB 4FUQA 4EG7A 1X92A 2ZI3A 4C14A 4W1SA 1OYOA 5AW6A 1PQ4A 1VFPA 3GFBA 2P9ZA 2Z2IA 4Z7JA 1N5IA 4YMVA 1DWUA 3II6X 1VIAA 4CM4B 1A2QA 4HH3C 3ITNA 2G9RA 1L3BA 3UAXA 3WSTA 4ER3A 3SJZA 5AJXA 4P0TA 3T7AA 4YALA 1WNFA 2R00A 3N59A 1P0IA 4EMBA 1BEUB 1NSFA 2VP9A 2XQGA 3DO6A 1FX0A 3C1AA 3MT8A 1MOSA 5ED0A 3PHJA 1VZ2A 2RBKA 1Z39A 2NU6B 2RHBA 2NZWA 3LW8A 1UPXA 3FTPA 1O77A 2GPAA 3RGGA 4ZIRA 1EZ4A 1Q0RA 2UZ3A 4B3BA 4TYWA 2ENWA 1GA1A 4AKIA 3K6RA 2XZTA 3P9ZA 2Z8YM 3O82A 1GPLA 5GV8A 5IYZF 3VKUA 3HKCA 3N1UA 4L6AA 1ODKA 3IKLA 1CQJB 2P4SA 3BGDA 3O84A 2XE8A 4JLPA 2J5BA 1RQRA 1O0SA 4A92A 4D4JA 2YY5A 1OXTA 3GGSA 4OPMA 2OKCA 1IN7A 2G63A 5KS2A 2FSVA 3IT0A 4LBVA 2KQUA 3HN2A 5EP4A 4MUXA 5EZYA 3WBJA 4EZBA 3G02A 4WGGA 1NMZA 4TZ0A 1GAEO 2BFBA 4LZOA 1LPOA 3KQWA 4FR5A 4A8TA 1TRKA 4QSMA 4W9MC 3ZD6A 2ZI7A 4AKHA 5K1ZA 3GROA 1IRXA 1E1CA 1XQWA 3BK1A 4WKOA 1P7ZA 3RVNA 1XJQA 1UDCA 2V6BA 2XITA 1GXSB 2A9RA 4RE6A 3C6ZA 1JFVA 2HIAA 2ZXUA 1ZJWA 2WEKA 4LJ6A 4CPDA 2RHWA 4XRGA 2IS6A 4G8CA 3RFXA 2I7XA 3OPYB 1TUIA 2F3TA 1L4GA 1E0JA 1DCMA 4PM4A 1O0BA 2DQYA 5FTWA 2Y92A 5TPZA 3A3KA 4E5NA 4EHIA 1P7CA 1WO8A 2QRHA 1ZVJA 3VPSA 4AAYA 3OJWA 1DBSA 1T91A 1X2EA 2HJHA 3R0IA 4MYCA 4FYWA 1FBNA 2HSDA 2ODPA 2YV3A 4EKDA 1T6YA 2P27A 3LU1A 4QUKA 1L5GB 3QUSA 1Z2DA 3HRIA 3VR2A 1GAXA 4FZRA 1OJLA 5A0TA 4UHEA 4U7HA 3TNDA 5IH7A 1RLIA 3D4NA 2PWYA 2PZLA 3K3PA 4IL5A 5DSXA 1AGRA 2WV9A 3ZZ0A 5K0CA 2QROA 5D8DA 3D7SA 3Q3HA 5G3ZA 5K3SA 2OXIA 4MVCA 4EGFA 6ADHA 2HO4A 3VVCA 4A15A 3EUFA 2DPYA 2R8EA 3ZVKA 4ZDWA 3GA5A 1B6TA 3MWFA 2EOAA 4UVEA 3L7YA 4X44A 2AKEA 4RE5A 4ACBA 1YR9A 1A0OA 4BL5A 3R8FA 4PFQA 2ODNA 1U65A 2PRSA 3RVQA 1WRBA 4PPQA 1TGYA 1KQFA 3VYWA 1VBMA 3LWBA 3W9SA 4ECEA 3NG1A 4FU0A 5CIYA 1XF9A 1PKEA 4NDNE 3WIBA 1T4DA 1PUJA 3BZWA 1ZNYA 4MNTA 1E6WA 3ZXIA 3BSFA 3ZBTA 3MHTA 2ZRDA 3HUTA 3KJHA 2IODA 4QOJA 4M36A 3UJPA 1T2NA 1XP5A 3ANNA 2C0QA 2IK8A 1Z2AA 2NO6A 4ZU3A 1L7QA 1N7HA 1OI7A 5EWMA 1FLVA 4CDRA 5BMOA 2BRUC 5FLEX 3H9EO 1JG7A 2HRQA 2QSYA 4B76A 3MWDA 1LQ2A 2IPLA 2N0SA 5I4IA 1FUYB 1JR3E 2VUSA 5FORA 4PWYA 3SBOA 4BV3A 3FZQA 4P08A 4TWJA 4FN4A 4M98A 1CRWG 2X5XA 4Y9RA 3VPCA 2VHZA 2ZIZA 4EF6A 3MCZA 4XB1A 3TE7A 4CQJA 4KBYA 4ER7A 3EAQA 4QYIA 3GT3A 2JEZA 4WK2B 5DRTA 5EYPB 3RYIB 3CPHA 1DEAA 2CZCA 3LY7A 2PJDA 4F11A 1BC5A 3E8XA 2HQRA 2FQ1A 4KUGA 4CWAA 2DHEA 3AB8A 4US0R 3EF1A 4KQ6A 5LUBA 4BNZA 2XUGA 3EVBA 3ETDA 3OZEA 2Y1EA 3M2PA 5KSPA 2C9DA 1USGA 4ZRNA 2POQX 4OG2A 4E0BA 4TSRA 4TKVB 3K0HA 4IDPA 3M3DA 3NUZA 4H0CA 3GLFB 3QPCA 3FCSB 2HA4A 3CO5A 4O4JB 3O38A 2YV4A 3B38A 1CJMA 4PQFA 1N34B 5JAIA 1X7GA 1X1RA 4JT8A 3AKEA 1HYEA 1UFQA 3F6EX 1G20B 4BLQA 1QP7A 4XDHA 2XYGA 4DV1B 5DI9A 2JKVA 2HHJA 3OO0A 3Q40A 3KOZA 1SBCA 4A8HA 1OLUA 3DCNA 1B8VA 4W5WA 4B4VA 4NCBA 1V11B 2WKWA 1KZGB 4X60A 5DYTA 1P0FA 1FQWA 3U37A 3K30A 4Q4CA 3HWRA 1PZGA 3NVKI 5FEUA 3BMOA 3PNQA 5EKTA 2IY8A 4QPZA 1WY7A 2ZR7A 4FOPA 3P9YA 2VBGA 4TLMB 5A4AA 3ZQKA 3KRTA 2D2XA 4MEJA 1XDGA 1S3IA 3HVKA 2IWHA 2BMDA 3QBTA 1X39A 1ZD8A 4EHDA 3JZFA 1XNRB 4N5MA 4HAIA 1Z2PX 4BKQA 3BL5A 2A6PA 1P2SA 1JZTA 4M60A 4LGVA 3V7NA 2LP4Y 3ZS9A 3T3DA 2C2WA 2J7KA 4ZZ2A 4MVJE 3EXEA 2CY0A 3JSAA 4UZEA 4DIMA 2GQ0A 2HLPA 1LZKA 3ZH9B 3A1SA 2PBRA 2PS3A 3H18A 3MERA 2VRCD 5A04A 3KYIB 1IATA 3VUFA 4IDAA 4DCJA 1B8UA 2XNDA 4U7TB 3S2SA 4JT4A 4UARA 3KB2A 1CQXA 2H1RA 2I54A 1E59A 5DZSA 1ZR4A 3MSCA 3E2IA 1Y7PA 4XIYA 4YMIA 2PFKA 1JLSA 1HE8B 1OAAA 3LH5A 5DSZA 2HF2A 4FHEA 4ROSA 1AKUA 3EEQA 4KKXB 4DA7A 1DZIA 4Y2RA 4DB4A 4EQ6B 4KTVE 4QGFA 3SZMA 1CR1A 4QYXA 3X3HA 1N2SA 4W5NA 3WP1B 4PZ9A 4AC9A 3EQ9A 4JODA 4GI2A 3ONWA 4C4ZA 4LZLA 4OP1A 4TQUS 2YOGA 2A0FA 2XF8A 2QAGC 1EFDN 4GOKA 3RS5A 1XJ0A 3F8WA 4YYEA 4NBRA 5PGMA 3O8BA 3GNQA 3LCCA 5ARCA 3KKMA 4LGCA 1UPBA 4RXUA 2DFVA 2BWJA 4ICIA 2QLJA 3EZFA 3S40A 4BY9E 3ER6A 2ZZMA 3NEPX 2WKQA 3EFOB 4DDVA 3ERCA 2B6NA 2NTJA 2I3ZA 1FZTA 4BNMA 3ISJA 3ROQA 1ZH6A 1KEEB 2EG5A 3NS7A 2CLDX 4O02B 4R3UC 2EP5A 5ALPA 1RP7A 5AKJA 3COPA 4JDUA 1X1EA 4BO6A 4MWEA 3QLVA 4AI6A 1NXPA 4OA8A 3IP1A 4B9EA 4WKPA 5GONB 4YR9A 3KT0A 1DC6A 2ZVQX 1ZH8A 1B0UA 3EW9A 3LSTA 5CEJA 1PZFA 1ODSA 2W6IA 3SX2A 2VRBA 3FH0A 3DFZA 4RPGA 3STVA 3WMEA 4IEIA 4D41A 1ZRMA 5HF5A 2XB2A 2W2LA 4X91A 1D7OA 4WKBA 2X8WA 3A14A 3D8TA 3M9XA 4IDFA 5JR3A 1NW6A 2C57A 3GLRA 1R0YA 1SURA 5AM5A 4A0FA 3VPXA 3H1AA 2W43A 5AHXA 1D9ZA 1SH7A 3FIUA 2PX2A 1TW3A 4DBLC 1DIHA 3O7MA 3KWFA 4K9SA 4F3NA 4D56A 4XWYA 2W0MA 3ORYA 4D6XA 1TZJA 4WZAA 5AVKA 3R7DA 2Q9UA 4U6SA 1UINA 2FW6A 2E7ZA 3AHGA 3VTFA 3AEQA 3KXLA 2M6KA 4CM8B 5IDQA 4DLLA 1HLFA 3PJDA 10MHA 1FFYA 1W36D 1WQ1R 4IDBA 2JCYA 3ODPA 4ND8A 2DCMA 2AX4A 2QZPA 1F38A 2P8JA 4GLLA 4HFRA 4CMBA 2FK8A 4E94A 2XE4A 2I7VA 2XHEA 5HCUA 4BFCA 4B33A 2BGWA 5C80A 4N41A 1G21E 3K53A 1DKPA 3DEIA 5KYNA 4XWGA 3ORRA 1WB6A 1HZZC 2X42A 5AQ1A 4X1IA 2ZYTX 4YAEA 2BEVA 3K92A 4RQUA 1HDYA 4Z9XA 4W5JA 1EU1A 4WY8A 4EKEA 2AZXA 2I67A 1BHO1 5B53A 1V5GA 3CLKA 4PY2A 4MB2A 4KXYA 3G3EA 3P5SA 3BIFA 4ENTA 3V1KA 2JGAA 4L8FA 3JZMA 5B37A 1AZLA 1W46A 2NGRA 3F71A 3H5VA 3H9QA 1CZOA 1BN6A 4RA6A 4D45A 2B5VA 2JDID 4G0OA 4HAOA 4L02A 2M98A 4DXDA 3ZDFA 2Q07A 1ORTA 4D97A 5F2NA 2GZMA 1NE7A 3MT0A 4DSTA 5A4KA 5BVGA 3CX8A 1ZHOA 4FFWA 2IYFA 3N2GA 4FW8A 5DNYB 4BQRA 4M99A 4ZK6A 1WG8A 2JAUA 4YUAA 4KN8A 5F1YA 1V3QE 2DQKA 1G5RA 2HQBA 1C9DB 2UZ1A 1SQ6A 3T34A 1U6IA 1Y4DE 5H3HA 4BE4A 1PR5A 2OLEA 3AUFA 3PTZA 1KFBB 1XZIA 3V1UA 1PYGA 3PYXA 1JJBA 3Q6MA 2Q6LA 2XQIA 4L73A 3RF7A 3GXBA 2C8LA 3NO4A 5CFOA 4PC6A 3ZDDA 5DN6A 2UUAB 2QNBA 4JCCA 3F8SA 4LDNA 3T7SA 5EJ9A 1JEYB 3OT4A 2C84A 2C3PA 4XKJA 1VE1A 1U2ZA 3LFHA 2PR2A 1PK8A 1YJ5A 1OA0A 2QRMA 4QG3A 4AO8A 4DQDA 1QHFA 3M6AA 4TLCA 2P8SA 1ZO8A 1DJMA 1X0VA 1M2OB 1E2MA 1SG0A 2OHIA 3HFRA 3JQ8A 4WA7A 4QD3A 4QXOA 4Y2PA 1EEXB 3R4CA 1JDJA 5FFFA 4JS0A 1B6RA 1XAJA 2EHDA 2C1XA 5H9WA 4EGAA 5IDWA 1EFRD 3E5NA 2N75A 1E58A 1YNOA 2B1IA 3AJAA 5GP1A 4TYQA 3WNCA 2UXCB 1MAHA 1XRNA 3BEOA 3NFRA 1OWLA 3M5PA 4KJXA 3QF4B 2NMVA 2PWBA 1UJBA 1W87A 2Q9CA 1Q7EA 2C5AA 3MJFA 5L45A 3B6KA 5ICSA 1Q11A 3I1JA 4WZBB 4YMSA 2VDLB 1SR8A 4WFKA 4GLOA 1ZCJA 1R50A 1XELA 3O90A 3H3FA 1GQSA 4ZYTA 3K7EA 3MWEB 4U2KA 4DQKA 3V33A 3L7NA 3NXSA 2GCOB 1YZ3A 4R0VA 3RADC 3W8EA 4BVFA 2SECE 4X41A 2Y77A 5ALZA 1Z88A 1E2FA 2ZAOA 2EBWA 4B48A 2IEYA 2QG4A 3HY4A 5FHRA 1DB3A 3V8VA 5H8WA 4LZAA 2CUTA 3A1WA 3MRSA 5E6RB 2QR3A 3BJIC 1P5JA 3I04M 4HS4A 3U3MA 5JZ9A 3OQNA 2ZAMA 1V2HE 3A1TA 3ACBA 2BLLA 1Y4UA 1U9IA 2PO5A 4CM5A 4FFMA 4IQFA 4NMLA 5JXGA 4NPAA 3L8CA 4EX6A 1O4VA 1HEIA 2NXWA 5EZYF 3K70D 3DHWC 4BQPA 3JD3A 4CEIA 2OC9A 4UBIA 4DRYA 3R09A 1IM2A 3PDJA 2EKDA 1Z8DA 3U3ZA 3GEGA 4LYFA 1TK2A 3P0JA 4JXJA 4ER6A 3SJBA 4JI4B 3GA0A 4BNWA 5F51A 1MAUA 4EJSA 4MRSA 4F0JA 2CL7X 3ABSB 3BHNA 4HQ0A 1QOZA 1R00A 1U2EA 2A5JA 3E3AA 4IZ6A 5E2IA 2QZJA 4TSFA 3TUIC 4KTTE 4BMCA 2GM5A 2FRDA 3TTYA 1RM3A 1U3VA 3U1TA 3H4TA 1A9ZA 1L4KA 4OYHA 5AKZA 2ZUUA 3SXUA 2JK0A 5KNCH 5LDDC 1TCUA 2YQZA 1YTLA 4CQMD 2YFHA 3PA6A 2DFDA 2B5WA 1GY8A 1W2HA 3IEUA 4L2IB 2PKQO 3RODA 4ETIA 4GBJA 2ZWIA 1TTHA 4FDMA 5SZIA 3VTZA 3DBOB 1NI4A 4TKUB 1XBTA 2X6TA 1MRNA 2IOFK 3U7GA 3IP7A 1HY3A 2BISA 1Q1GA 4LHWA 3JR7A 3F1LA 2VYND 2H4YA 3CLRD 4N39A 5YASA 5B5SA 2ZUWA 3R44A 3JWHA 3ZI7A 1HV8A 1ISFA 4DCVA 3GO4A 3ET4A 5LN1A 1B42A 2GEFA 1NLZA 3R4VA 3G9TA 4HAZA 5K8VA 4C9BA 5ECDA 1UXOA 3U4QA 1QR2A 2H85A 5AW0A 5KMGB 3SZLA 4UPEA 1DX4A 4J91A 1KJZA 1W49A 4JB0A 4MWGA 5ELMA 3N2KB 2CHUA 2Y6VA 2L82A 4GYYA 1EXWA 3GK3A 1IY9A 1R0KA 4TT3D 2DU8A 2EJBA 4H3HB 3L0IB 3N0TA 5CLJA 2CMGA 1V37A 2ISCA 5AKHA 3ZR4B 1NKVA 4PLHA 1CVRA 4RHFA 3UMVA 1CZHA 4QGSA 1OXVA 4KN9S 3ETEA 4D8XA 2I9PA 1IK4A 5G53C 1AF4A 3CF4G 2C99A 3ML1A 1CQIB 3GRAA 3P9QA 5EG5A 2FFRA 2EX4A 2O05A 1N6HA 3N3AC 2IXAA 1ZN9A 1G2PA 1Q7TA 2JFGA 4KCGA 4BJ1A 1I6KA 2WWYA 4K7JA 2HFJA 3VSDA 1KFKB 5CCBA 3EGWA 1SBHA 1YFKA 2HCBA 1TRHA 3EVCA 4GSKA 4WADA 5AXDA 3DBVO 5CB4B 2G9NA 1HTWA 3FLAA 3VOAA 2PBFA 2XI4A 2XBLA 4YP6A 2YN2A 1TAHA 2VP3A 2B2NA 3OCWA 2QTAA 3TRIA 1QS0B 2YYSA 1TZ2A 2E3JA 1RYFA 2YYYA 3ORHA 4NE9A 2PUTA 4OUKX 5HDQA 3L43A 3QWAA 3QP9A 2DHQA 4QQNA 3CKYA 5B4VA 3QEAZ 2X3UA 3DDZX 3NT5A 2VP6A 2RKBA 3NDBB 5G3YA 1HFKA 5KTYA 4L1KA 2O8NA 5HQ3B 1M73E 4YQEA 3G49A 3QPBA 4L0DA 1JGTA 1T4CB 3MAJA 4G81A 4J6FA 1ZLXA 3WLTA 4O08A 2N42A 2ZQZA 1K3FA 3USCS 2ATCA 5MN5A 2W7TA 4AWBA 2Q6TA 4GU5A 3PPYA 4DLSA 2VJDA 3LJKA 1Z9BA 1KZHA 4Y1FA 3KJEA 1M8JA 4RIIA 3NXKA 3ZCUA 2FWAA 2GKSA 2PVCA 3OZ7A 3C1OA 4MRMA 3LK6A 3MGCA 3WAKA 1PVVA 5JW6A 3ZDBA 1JAZA 1PJ3A 1GRQA 3NWEA 4NEHB 4Y6LA 3LWDA 3OQPA 4NMHA 3UC5A 3RVMA 1RYMA 1JVSA 4ZCLA 3VNSA 4OJMX 4CQNA 1UCFA 2FCAA 1JLKA 1TYZA 2QLMA 4FK8A 4HMQA 4RSGA 4ND2A 3LDHA 1AHPA 1GGKA 2BTQA 4HNQA 3N8KA 3C3AA 4GKAA 3ZLTA 4ZI7F 1XQ6A 2G6TA 2IXTA 3K2QA 5K4AA 1NRJB 2X0NA 4J94A 2BLNA 5L3SA 1E2NA 3E3LA 4DOMA 1BDMA 2NACA 4GW3A 2Q0QA 4M88A 2FPRA 2VDWB 3WFJA 5KTSA 4PPFA 4HT3B 1LI4A 1OBOA 2HL6A 5FI5A 4S0ZA 5EMJA 5IPFA 2WF5A 1V5IA 4LMPA 2O8FB 4ZVMA 1PWZA 5TPWB 4JDPA 3SSOA 1TNDA 3IPRA 3KTFA 1Z7WA 4PLFA 1FMCA 4CLEA 5IJ0B 1N2OA 2OHGA 4QBKA 4PFJA 4XARA 2Z6AA 3GFOA 5IRCD 4Q4HB 4F93B 3V80A 3ZHYA 3AVTA 3A6GA 4F85A 1DT3A 4BJ3A 1JV2B 1TEHA 3V2IA 1MC1A 1PJ2A 3EGXB 4HLDA 4NHOA 1NUTA 4WERA 1W36C 1EBBA 5AVSA 1XN4A 2WIAA 1HR0B 1BEEA 1DIBA 3CH6A 4JX9A 3Q5EA 4BUJA 1FYFA 4MR8B 4Z2AA 5HOQA 5K6TA 1TQ6A 4CUZA 1YQWA 1NBME 2BKVA 4BYGA 1E62A 2HIHA 5EIHA 4HH4A 5EGNA 1IVYA 4P6VF 4F84A 1ZGCA 1QHIA 4QATA 5JHHB 4C7BA 3TQRA 3I76A 1R4MA 5D85A 3I09A 1Y6QA 3L7JA 1NQTA 4I5GA 2GN2A 1T5OA 4KXNA 4WNAA 1RJWA 2K5UA 1Z5PA 2H8KA 4R1NA 4UVDA 1FQJA 2XD4A 3T9AA 4QVIA 2CLLB 4KPGA 3WDMA 2AJDA 4K3VA 5BQFA 2WU1A 3FYUA 4ZCSA 3WKAA 4ZWNA 4DV4B 5JXWA 4QUGA 3N58A 4DUGD 1ADCA 4C3UA 3VH1A 2VDVE 4XYEA 4O25A 3IAS1 1PX0A 5HIIA 1N5LA 3F78A 1MJ5A 2JGNA 3RS7A 1BMQA 5AI4A 3O4VA 1TXGA 1WTAA 2G09A 1XJ5A 1HC7A 2PAFA 3A37A 3E0QA 3ZHCA 3PWTA 4EBFA 4B3RB 1GL3A 3M5CA 4KFTA 2P11A 2AZTA 3CEPB 3AR2A 1GN9A 3CE6A 2PEZA 4AN0A 1RD4A 1JTEA 4BWGA 4MB6A 2JZCA 2QN9A 1Y8ZA 2FSHA 1ZSVA 3ICQB 1USUA 3MCAA 1D1SA 1P7WA 2A58A 5CLLA 3DT9A 4LXUA 1J2RA 1Y5MA 1OR8A 3IGFA 4KOEC 2IX9A 3UNXA 2CHEA 2P9YA 1QV7A 2GNOA 3KJNA 3PE3A 2VDOB 3GCZA 3ESDA 4PGMA 4EJ6A 2QJTA 2XMQA 3W9UA 1XTSA 2QR2A 3CUKA 3M9LA 3S6JA 1E2EA 3QMPA 1Z3IX 4O4HA 4ZT3A 1EE2A 4TN5A 1IJEA 4EY7A 2QV0A 4MQFB 3ZWPA 3PT5A 5BPFA 2ZGVA 4XQCA 4Y30A 1T4GA 1BWSA 2ZANA 1NJ2A 3BXGA 4L75A 4PRKA 5FI0B 2PGOA 2WHPB 3FD8A 5ITVA 4RKFA 3DVSX 1PV4A 2PLFA 3OEEA 1J2UA 4UTPA 1H3NA 4FC6A 4IDOA 4O63O 2IU4A 4A0QA 7REQA 1ABBA 1TAQA 2VZEA 3A36A 3QVXA 5LP6C 4BNHA 3FCCA 4E22A 2F9MA 1NJ1A 1G8FA 3HCBA 3GJQA 4GG1A 1T1GA 5JDIA 3W2TA 1N6KA 3ET5A 2G1UA 4FNMA 3QRWA 4RH0A 1NOJA 2JKZA 1KJJA 1Y8RB 4LA4A 1H8HD 3LGSA 4N7JA 1OZGA 3EQ7A 3LKDA 5EPOA 4AKTA 4P54A 2CD7A 1FYVA 3QMMA 4DTIA 2IBSA 1O6CA 2WPNA 3T06B 5IC5A 1J0XO 4F5EA 4HAYA 1Z4NA 4EW1A 2VP0A 1O3YA 1P2FA 4K9MA 5HIMA 1DXYA 1C0EA 1ZOOA 1BHQ1 3N2NA 2JA1A 1W0JA 2XMPA 3A05A 4GHWA 3RVOA 4CMEC 2O20A 2B8JA 1NZDA 1BW9B 4YP5A 5JQGB 4EOGA 3P1JA 5E1OA 1HQCA 2GUGA 2W98A 2AC4A 2YNMA 4EG3A 2DFLA 1SA0B 1UAGA 1QQBA 5IDVA 1CZUA 2O5EA 4EENA 2OPBA 3EIEA 2CEKA 5T3UA 4ZOLB 3G9ZA 3DEZA 2JFZA 5ALLA 2EGGA 6REQA 2DE0X 4MA5A 1DC5A 1NDUA 1RXYA 1XZAA 2VF4X 3KB6A 1A50B 3IR6A 3QOXA 4RS4A 1GUAA 5CYOA 2IY7A 3AERB 4IWYA 3ZS8A 1MB3A 2ZUCA 3VZBA 1DJOA 2AXQA 2PKCA 4JA2A 3EQ2A 2LW7A 3FVQA 4GPEA 1AE1A 3PD7A 4K28A 5EXSA 4P0PB 2Z5FA 1RRGA 1RI5A 5EXEA 2QZ9A 3K70C 1U2SA 4N65A 3LFUA 4OTZA 2ONKA 4OCZA 4X1KB 2PUVA 1M2VB 1AHHA 1G8AA 4RL6A 4UMVA 3W1EA 3BS4A 2VF2A 5JSUA 2PDAA 3FG9A 2VKTA 1ZDMA 3GLTA 1O57A 4FIZA 4WD3A 1PSWA 1XTRA 3TGPA 3HDGA 3OD5A 4R9NA 2CSUA 4B2LA 1X70A 1L7VC 2HF7A 1RPTA 2BP7A 4JXZA 1PX2A 1K5GA 5HGJA 4Q7JB 5E6SA 4YDSA 1ESEA 3OLCX 4ASUD 4EY6A 3EXAA 1JEQB 4NJMB 4L51A 4OHFA 4BYMA 1UDRA 2WWWA 3L4BC 4C4SA 4PO3X 3K9HA 5IAAA 4PIPA 3ITDA 3CRVA 3BH0A 2SHKA 3AEXA 4MJ3A 3F6BX 3GJ8A 2GTHA 5E2BA 5KNCD 1HDZA 2IDJA 2DRIA 3PUVA 3VPGA 1HETA 4B74A 4EGQA 3PR3A 2R9VA 3WI7A 4C0SA 1C9JA 4EVIA 2O8EB 4J7AA 3HEAA 3LBAA 2NU6A 2O5VA 5I7OA 3CLRC 3IOEA 4ZALA 4E15A 3BMCB 1ZMTA 4GM4A 2WQZA 3UPTA 3DLCA 1U3TA 1LC0A 4R9VA 3ZWYA 5DXFA 2PT6A 3H9GA 3F4LA 3BWBA 1GSAA 1QVAA 4KIGA 4EH1A 4DYVA 1IOVA 5EC8A 1JLLB 3ANLA 2FSIA 5CVVA 4IUDS 1Z2CA 4AJEA 1D1QA 4FE7A 4KQIA 3H11B 4BVEA 2A7XA 4Q4AB 3UAGA 4R16A 3ESQA 1UJNA 3P2KA 1U1FA 5JCJD 1BROA 3PCRB 1DDIA 3K1ZA 4EJSC 1IXRC 1K08A 2CV0A 4QUDA 3U09A 2D7CA 3QHPA 4XI9A 4BB9A 1QJ4A 3F46A 3PGA1 1BHJA 1NU6A 1GXSA 2RH9B 2ZQYA 2A88A 1HSZA 1T8RA 4RPLA 5BR7A 3OPYA 3O83A 2BGTA 2ZRMA 4YIKA 4II2A 1EGHA 5IC6A 2PRJA 4GPAA 4G1UC 4MVXA 3ZZMA 2BFFB 2QRZA 1UMDA 3HJUA 1YQGA 4TXMA 2VDPB 1A9XB 4ARSA 3AI1A 5BNWA 5AKKA 3SICE 4XLZA 1LUAA 1QGOA 1JSZA 2ZWPA 1PJAA 4F2DA 1O96B 1QRUA 1I0IA 3PDHA 4N5LA 4D9FA 2QVBA 1ZUNB 2W2XA 3VSCA 3AHFA 2Q0SA 2I71A 2VXCA 1VA5A 1ZD1A 2JCVA 4DJTA 2JF0A 2L17A 4WRRA 3UMYA 3P9XA 1I33A 2NPFA 4LV5B 3A6DA 1E7RA 3IVCA 1FU7A 2W71A 4ZARA 5FO0A 3NZEA 3WLLA 5JISA 3R7SA 3TD9A 4D8UA 1THMA 3RQIA 1M2HA 4F2PA 5BR8B 4NYJR 1T35A 4UFPA 5KWJA 4EPTA 2VZ8A 4YMHA 1D09A 1FLAA 3JQBC 2OQVA 4HAUA 5KWSA 1C41A 2VHEA 3PWZA 4Q6BA 2VSYA 3MYRA 3BDVA 3IAUA 4F45A 3S8YA 3GFFA 1U1EA 4UM9B 4LCEA 5K0TA 3KXPA 5DYNA 2DGDA 1RR6A 1XZHA 2I03A 4GMXA 4X7PA 2ZJ2A 2X23A 4XD2A 4REOA 3L5OA 1R5JA 2ZRPA 1C3EA 5LP6B 4I5IA 3KZVA 2GRAA 4B82A 4D5GA 2D5AA 4U2CA 4I50B 5HK9A 1C0PA 1RM4A 1HDIA 4EJMA 1R88A 1S2MA 4NOLA 3NHZA 1JG1A 5E3HA 1JA9A 2IUSA 3EXHB 2HWXA 4WNIA 3V8RA 4YB8A 2HJVA 1FRVA 3S1AB 1SN7A 1E6UA 4NMMA 2PSDA 4J0CA 2G82A 3CEJA 3PHIA 2MU1A 4B6FA 1M1UA 4ZEVA 1EGQA 2NQTA 3DBLA 3IR7A 4FMPA 4RZ2A 5LVAA 2WJVA 3JASB 1UXIA 3G17A 3H87A 1SG9A 2RK4A 4EQZA 5E95A 1NVKA 1GGFA 1R10A 2TSYB 4AF6A 2JFPA 1ADBA 1RRFA 5B6PA 3RYIA 2QWXA 3EDRA 3HEMA 4KXLA 3VZQA 3QEMB 4ND3A 4KSCA 2HTFA 3V00A 4FDAA 1GPAA 1UDWA 2PXAA 1ECLA 4KVAA 2JFXA 4V02A 1J90A 2G5PA 2ZJ8A 1O08A 5JCXA 3FI9A 1YDHA 3FNGA 5K09A 4MWTA 3PYLA 4TKVA 2XUZA 2CJXA 2OP1A 2HU2A 3WHIA 2IIQA 2VHTA 1S8OA 2ZTUA 3LG2A 1AZTA 1IUNA 4O4JA 4P35A 3OU6A 3T5TA 4HWRA 2FZCA 2QU7A 1VJCA 3P9NA 4RJKA 1RFLA 1WNTA 1CUYA 1G20A 1VIMA 2PIDA 5AOAA 3CSUA 5ESRA 1ILEA 4IJUA 2DWUA 5J5AA 4IHJB 3TLBA 4MA0A 1Q6ZA 1R6VA 1VI6A 1OHHA 1JE1A 1EG7A 1D4AA 3DEHA 4FBLA 3KAQA 2J09A 1V11A 1X1AA 4JELA 1J9ZA 1QGYA 2PSHA 3QMWA 4LRSB 4R9SA 1KI9A 1QIMA 4B6SA 4MARA 5B1EA 1TFRA 2LD4A 4NCNA 5JRDS 1CEQA 2INGX 3KETA 3IQDB 3I0ZA 3LLMA 3JD1A 4IJWA 3FUWA 3ZD9A 1GTL1 2FWPA 2H5IA 2I4RA 3PUIA 4S12A 1XMIA 5A6SB 5BV7A 5JMTA 3PJRA 4NXMB 5ALIA 5I4CA 5IXJA 3ZW9A 3IP6A 1PHPA 3OZVA 4ZAFA 1BAPA 1SXPA 2Q6OA 3D43A 3DZBA 3I5AA 4ZEMA 2FN9A 3A3OA 1KO7A 2CLEB 4Q9NA 2WSLA 4M53A 3AO0B 1E1QA 1JQJC 4M9RA 3TGWA 5KYXB 3NTLA 1ECBA 4F2GA 1DV2A 3EUWA 4YMWA 3LHIA 2QBYA 3IHLA 4HH1A 2B8NA 4G8BA 2F43B 2VPWA 3AUTA 1WS6A 4PR0A 2Z6QA 1VIYA 4LDAA 3B20A 4UNIA 4WMLA 2AF4C 3DWFA 4YAWA 4WIAA 2QVCA 3DXZA 4BGVA 3PE4A 3WL8A 4DR1B 1J20A 1M0WA 3CS3A 2PZAA 3AFHA 5C1OA 3ZDCA 3CWQA 1NBWB 4M55A 5AUOB 4WACA 3B1XA 3URKA 1O5OA 5FI3A 2PRYA 1JEEA 4JOSA 1ZM4A 4NEQA 4EQ6A 1N6OA 1A3CA 1NT4A 2QEQA 3PIDA 2G9ZA 1MDBA 3GQBB 2OGUA 2BHTA 3DB1A 4AFNA 4F2HA 4XGRA 1PFUA 1B3BA 1GAQA 2VTDA 1FFGA 1U2RA 2C3YA 4NV3A 1MP0A 3WQBA 5A4FS 3FGZA 3O5AA 2O23A 1N77A 2V7TA 3F7TA 1P8AA 1GAWA 2X22A 1OAKA 5TIIA 1CQZA 1J70A 1O03A 1HTTA 3FZNA 2FWIA 4ZHQB 1Z0SA 3G8CA 2X13A 4WOPA 3WBBA 2XY4A 2OECA 3K8OE 4HFNA 4IGAA 4OYRA 3SFZA 5IULC 4TL6A 2AI2A 4EG5A 3VDRA 1Q5PA 1TM5E 3AETA 3AGPA 4Q1EA 5G41A 1IHPA 4W99A 3WYEA 3I5XA 2PMCA 1DAIA 3ER9A 1TQHA 3TAXA 4QO7A 3LXUX 2EIXA 1GDHA 4HTFB 3P97A 3ZE1B 4MEBA 3DR3A 4ZRDA 2OG1A 5A9SB 4C76A 4LX0A 3KSUA 2G88A 1POWA 4KWEA 5KYKA 4JVMA 4OP3A 4YFYA 1F48A 2VPPA 1OASA 4DNXA 1TJPB 1QQAA 3V4VB 1DV1A 2QX6A 4TX1A 4E5YA 1RKBA 1SPBS 1OIXA 3G6WA 5K3CA 3RPEA 3QYPA 5DHRA 3RIYA 3EODA 3U4IA 4P4UA 3WV4A 4PR3A 1MIHA 4AG3A 1ES9A 3H13A 2ZREA 4J0IA 4L4XA 2VG8A 1TO6A 1FFBA 1U4NA 2I62A 2WINI 3DL7A 4PICA 1Y3AA 3MTEA 4QG7A 4RYLA 3MJDA 4KXUA 5C1BA 5JAZA 4N5HX 5FOTA 4CKBB 4JVLA 4PX9A 4CUJA 3RYHA 5BUZA 3THRA 4D8WA 4GKBA 4YX9A 4MWZA 2CVHA 4MRNA 3LWZA 4YPOA 5GTDA 2BC9A 3OZFA 2PM8A 2YRWA 1Z33A 2GAJA 3HKBB 2ORYA 3ZE7A 1DIAA 4UTNA 5JPDA 4ZDKA 2YZMA 4H3KB 3FPAA 3GH1A 4PQYA 5JROA 2EFCB 1M33A 3NVMB 2FSPA 3PNOA 5JLJA 3OOJA 1CY4A 4WZZA 3DXFA 3GDGA 4JLKA 1RXIA 1SOVA 4P7KA 4Q19A 1XZNA 4A0SA 3GRVA 2OGWA 3SF8B 3CJTA 2A0YA 4K9PA 3GARA 4L3WA 2WHYA 3AONB 3GLUA 4BB0A 4BKOA 1E1YA 2O8VA 5EINA 5FOQA 2CLFB 4XX0B 1LLDA 2HSWA 2P68A 3E81A 1FLNA 1V3TA 3ENWA 1QHEA 4DJAA 5FBVB 2EX1A 3EPLA 1XDSA 1HYHA 1VE7A 1H4VB 2OBXA 2PVPA 3TLYA 3G2KA 1G3QA 4KQWA 1GGMA 5KYUA 4HB0A 2XUPA 4G4IA 2HT6A 3VR4H 4UUNA 5B4UA 2WD8A 2REXB 3ADPA 5GIPE 2PUFA 3EVFA 3IQZA 4YRIA 2FPOA 5C8ZA 1Z34A 1SD5A 1E1RD 1VL0A 1N2HA 2P3OA 1WU7A 1R16A 1CDZA 2VH5R 3DPUA 4HHEA 3LD9A 3ZV7A 4IO0A 3PENA 2B1RA 5E3JA 4B7ZA 3GLHA 2PH3A 3TSYA 1YQTA 1QHNA 3GG9A 3L5KA 5AJZA 4K87A 3HWWA 3PUHA 1BE6A 2J0UB 1KS9A 4KNWA 4GMDA 1DLIA 4X20A 4BLUA 1OFTA 5EHGA 4V0RA 1PYDA 4I5FA 3GWGA 5HYVA 1J39A 3C41J 4KRXA 4IV5A 4LX8A 1U0OC 2ZJAA 3I2GA 2I22A 4NCJA 2R66A 4UM5A 5F21A 2Z2XA 3LVRE 4MPTA 4RK1A 1I7SB 4AZWA 1MB4A 3A58B 4PN7A 3N07A 1LTKA 1NW5A 2CGEA 4Y0VA 4GPD1 5E7IA 5KSZA 3BE4A 2YWFA 3OX4A 3P71T 3LBYA 1BCSA 1IY1A 4PLCA 1RWBA 3ZXUB 4BV9A 4Q16A 1LRLA 2O7VA 4RSRA 3MILA 1ZMBA 3W5CA 4R1OA 2Z1NA 3AR4A 4IXTA 1DELA 2F48A 3CRW1 3H99A 1M2OA 1MZVA 3E5HA 1LSJA 4AIIA 1E3EA 3FWZA 3IOMA 5GJWC 5FWNA 1XXHE 5EXTA 1CUFA 4FKMA 3VNAA 4HDQB 2Z0MA 4N54A 4DV3B 3HUUA 1WEKA 5C7OO 1D1TA 2J9XB 3M82A 3NHWA 3FOEC 3QF4A 2GD1O 1FUEA 3T15A 3M6WA 4U8GA 1TO2E 2P40A 3K1AB 4WZBA 3TAHA 1T5LA 3M4ZA 4KE7A 3ADBA 3I01A 1EM6A 2B1JA 3T5GA 3MGAA 3TVYA 3LUFA 4G0VA 2G17A 3QLJA 2X14A 1KI4A 4RCYA 1EEHA 2XOKA 1YRWA 2GCOA 4J7XA 4G56A 4F1KA 2CE7A 5BW8A 2OZVA 5CHEA 4XIIA 3S28A 4C4RA 3HXMA 3I0NA 3O93A 1FXWA 4F4DA 5DYGA 1CY1A 1IY8A 4XIJA 3IV6A 2GFIA 2RC6A 3F4BA 1WVMA 3IHWA 5J2UA 1VP3A 5CW1A 3ZOKA 4E5PA 3CZPA 3DYVA 5AJVB 5AD1A 1Z6AA 2FW9A 2OOKA 3A4TA 1J8QA 2HB6A 3D2AA 1KSFX 2YZ2A 4G9EA 5SZKB 3OOYA 3A25A 2V7QA 1UP6A 3KSZO 3PNLA 3I45A 4R2MA 1YB1A 1L8AA 4AUKA 2VTKA 4FE3A 1ST3A 1WUJS 3P9KA 2LNDA 4R8SA 2FU5C 3KSMA 4W7SA 1QGUB 1SXHA 5AXAA 2ECQA 4Q1VA 3RNLA 3RUPA 1FDWA 3CPEA 1ZM9A 4X6YA 3UK6A 621PA 2OBYA 2EU8A 2DSNA 1XVLA 3QNMA 5LQSA 3SC3A 5CLHA 1T36B 3H05A 1FTWA 2Y0PA 2FZVA 3AF0A 4LK3A 3LSYA 1FC0A 3WGMA 2QK4A 4C5AA 2CXHA 2DKNA 1Y3CE 4BGIA 2BMAA 1YZUA 2WE7A 2CVZA 4HDAA 4Q6WA 3VHXB 4HBGA 1QF6A 5C1DA 2V5AA 1N5KA 4R9UC 4RF3A 2O8CB 2C2MA 4WX2B 3P2OA 1DWQA 1MOQA 5IG2A 4L2IA 2BJVA 1U0JA 2FSGA 3D0QA 2G83A 1F2UB 2RMKA 4A8JB 4CCAA 5KSOA 4BNNA 3EX7C 1WPRA 4K0KB 3K6JA 1RJ9B 2P35A 4GI3A 4AMUA 4Z8YA 2H1SA 2Q3EA 4Y2GA 3K1YA 3EZXA 4YCBA 1JBEA 1E8DA 2VK8A 4CM9D 3KXIA 2PGDA 2Y0EA 3L6UA 1KE1A 3O3OB 4EY5A 3I5YA 3E22A 1YT5A 2GYUA 3DFIA 2QD3A 3L05A 5DWQA 3V8PA 5CR9A 1BVUA 1N6LA 4ZZ3A 1ZH0A 2E87A 1X87A 3CV3A 4WBNB 1G6OA 4TV9B 2A5YB 3EDMA 4KIJA 4XLTA 1N9ZA 5C18A 1OAOC 2BFCB 4EHNA 5TMPA 1W4BA 5HDBB 5KMGA 3D3WB 4HDOB 2AZMA 2ID7A 4X7MA 1PWYE 2Z4RA 3DYBA 4OLBA 4L74A 2IHYA 1EFVB 4IX9A 3RIGA 4CI9A 4YRMA 3K5HA 2FFJA 3VO1A 4RCZA 2Q27A 3TWOA 7MHTA 1V9CA 2J8ZA 3C5HA 1XZQA 3H8SA 3NHUA 1W7AA 3N8HA 2JFVA 3SHOA 4CIBA 5TEWA 4HVCA 3NH6A 1ETUA 3ODGA 4OGKA 4L8GA 1VE5A 4GVPA 2HC9A 2LGJA 4QU5A 4TM7A 4G67A 2H5EA 1SUDA 2PLAA 3CR8A 3N0WA 2B99A 2CZQA 1YZKA 1ZUIA 3UJ8A 1JIJA 4DQ0A 2K6GA 5JTTA 4LBYA 4O5OA 3UH0A 4GLBA 2D5IA 3HDHA 2GA9A 4IFIA 3KHSA 1W8DA 2GBLA 1RVV1 1BA2A 4C0QC 5CB4A 1KWKA 3HYCA 5JC1A 2NAFA 1DKMA 3M4XA 1F2VA 4J4BA 4LF8B 4XVRA 4CJXA 4UQPA 1NVTA 2DLCX 3M6FA 4DW8A 1LNSA 1VMKA 2ALJA 3AT1A 2ZYSA 3AKYA 4RY2A 2VNHA 2Y93A 3DKRA 1U3DA 2QW1A 1W93A 3GD7A 4FS8A 2AMFA 4LXQA 5MN4A 4LF6B 5ES4B 5HQ3A 2CJFA 4HNRA 1ZA2A 3SQNA 4O4JF 4HLUA 4M6WB 1GTVA 4QARA 4EO7A 2QTWB 1HURA 3AWDA 3AYZB 4EHBA 2OM6A 1X13A 1YNSA 4WT7A 4CLRB 3KT8A 3VYSB 1QIFA 2WUFA 4FBMA 4LJSA 4XUGB 1ZOIA 2RGRA 2YHIB 3B82A 1YJCA 1CTQA 3FRIA 1P33A 4WXEA 3T4XA 3D2BA 3N7TA 5CGZA 4BNFA 4XVUA 2P4EA 1PUXA 1SUPA 3R5KA 1HDCA 3AOGA 1JFFB 2JI9A 3LS2A 4WK0B 5DX1A 2Y1OA 5BOSB 4XH9B 4DA0A 1JVNA 1LLCA 2NNLD 2R3SA 2WVJA 3K1TA 4N3CA 3FMIA 5D3KA 1VSQA 3FNQA 3TLGB 4XVQA 1MXHA 1CP3A 1KS2A 1L4MA 2PMFA 5B2ZA 1E6EA 3A1VA 4IIBA 5H9VA 2HYDA 2JIRA 2GF2A 1R6DA 2ID9A 3IV9A 4IS2A 4LYYA 1M1YE 1QTRA 2FLKA 2PK3A 3PQ5A 3TYXA 1NU8A 4KXMA 3C14C 4EYGA 4YVFA 3BTVA 3KK0A 4QXPA 3WLPA 1RAEA 2HEGA 5BV8A 1ATZA 1YZNA 5HP4A 1FMFA 3LDUA 3AI2A 3R8CA 4YWHA 1OT3A 2ZM6B 2O06A 4RDXA 4RTLA 3HJCA 2O8FA 2AC7A 5AKIA 2FXVA 5TPWA 2CV1A 2FZWA 3HCEA 1OIVA 1RAFA 1OFIA 4JP1A 2OVFA 3X1ZA 4YROA 5AVTA 4BMVA 3CKKA 3FE2A 4MI1A 4QDJA 4M0PA 1FVXA 2D5LA 4MRMB 5CB8A 2AJCA 3DE1X 3EBOA 1D6MA 2Q5OA 3EGXA 2XDYA 1HOTA 3GOHA 3H5RA 3PC6A 4DWWA 2XE6A 1A82A 1W4ZA 2O2SA 3H6HA 3R24A 2GEVA 2I76A 4RFSB 1KI7A 4C5BA 2KX7A 2AR9A 1A4UA 2RH4A 2GZSA 1Z13A 3BN3A 1TUGA 2H54A 2DWOA 2JGJA 1YZLA 1GNSA 1PWEA 1IOWA 1U7TA 1V1RA 1XTKA 2KLBA 1N7JA 3V6MA 3HHEA 2C4UA 4LKRA 3CH4B 2MDTA 4TQGA 3UJNA 2JH3A 2FEXA 4JVNA 4UTXA 5E4JA 1NC3A 3ABZA 3CWCA 5I4KA 3AY6A 5T3YA 3JTMA 3MJCA 3PEVA 4R8RA 4HLNA 2IEIA 4MV7A 2C97A 1GTRA 3EZGA 4D3DA 3OBBA 4GDFA 1VYHA 3C6YA 3WLEA 2PTGA 3IEPA 5EWJA 3ZNQA 3IA2A 1RYZA 1U80A 1G6HA 4OREX 4MQ4A 1R64A 3KT3A 5K99A 3AJDA 3U44B 3VKHA 4GI7A 4GD3Q 3HCPA 4Q21A 3MLEA 3TJZA 1ZC3A 2Y27A 4D44A 4ETMA 4KPFC 1YS2X 5M04A 5AVZA 2J32A 3I34X 3AKCA 3W9YA 1N8SA 2GZHA 3ZU2A 3J7AC 4Y2HA 3RAPR 4DLBA 5GONF 3MOSA 4TXHA 2HK6A 1F06A 1L6IA 5HR5A 2L19A 3QTLA 5HPYB 3TDKA 5FAKA 1VCIA 4HXFB 4FR0A 2XUIA 3DQPA 4EYKA 3KDPA 3VR4D 1OI2A 3UKJA 1SWVA 5BUSA 2O48X 3HDTA 1S2GA 1L4EA 1B6SA 5T67A 5KHLB 4GSYA 3O73A 3EZ6A 3IRVA 1E8NA 3OP1A 5ENVA 1UAAA 1PZEA 2G1JA 2QM7A 4MDHA 3PQFA 3UGJA 1VE9A 3BORA 1UADA 1BN7A 3A3PA 3O21A 1V1MA 1ZMRA 2ZTMA 5H83A 1A1SA 1WQ4A 3RTEA 8OHMA 2AFHB 3F7NA 3MBKA 4NHEA 2P1RA 3NTUA 4LQLA 1NL3A 4ZOQI 5IVPA 2JJ2D 3RSFA 1FS6A 1LJLA 2AW5A 1KEZA 3LC2O 1LBHA 2CF5A 3Q0TA 3T3EA 1GARA 2WHPA 3HNPA 1EVYA 1Z0IA 1P1FA 2RFLA 4Q7MB 5A3SA 5NULA 1VCHA 2ZYGA 3SPXA 3TLXA 4AROA 3SQXA 3D02A 2QTLA 3EMVA 3FKSA 1P1IA 1Y89A 3JTEA 3O94A 4K05A 2KSQA 4QUIA 3UVEA 4BBAA 4E88A 3I2IA 2R6R1 5LZ7A 1T15A 4N8DA 3UK1A 3I9NA 3UJ7A 1PR1A 3SCZA 4RABA 3R75A 3A4LA 1Y8RA 1UWKA 4ZEOA 3AC0A 3WL3A 3HVJA 2XV1A 4BX8A 1IZ9A 5A4MS 1OXUA 2IFTA 1MHPA 1SPXA 2J30A 2QD5A 2PWPA 4W9NC 1L5ZA 1RC8A 2JRCA 2WJAA 1QTNA 3HRHA 3IEXA 4PONA 4YPFA 1KZ9A 1T2DA 4IO1A 3HABA 1IZ7A 3BERA 4M7WA 1L4FA 1G6KA 2EBFX 3CX6A 3I9FA 2XQVA 4NZNA 4RXMA 4ZT4A 3L49A 2VDQB 4PXAA 2CNWD 5C3MA 1IJBA 1ZWLA 3AESB 3FI0A 3GBVA 2AK2A 5F7JA 5JQGA 3PC8C 3I28A 1CJKC 2RHOA 5IJ9B 1Z5VA 3C4JA 1KSJA 3OPMA 4HC4A 4WFJA 2UUBB 4OQFA 2GHIA 3OIYA 1N32B 1W2WB 2V4MA 3JQCA 4OHCA 4QJ4A 2AKAB 3KCNA 4S0XA 4ZKEA 1PN3A 3T54A 3ZCPA 2DUJA 2WJZB 4FFSA 4B81A 4CM1A 3KUCA 5BWMA 1MRZA 1MXFA 4BQQA 4D80A 2JIZA 1T3ZA 3C98A 4L76A 1OYVA 2FPUA 2QX8A 1YI8A 2VQDA 4J29A 4K6OA 1SOWA 1NF8A 2PA0A 5TF4A 1X74A 2QD1A 4OBEA 3QFCA 4AUMA 3ZKWA 3V8EA 2YJ4A 2J46A 3REFA 4CL3A 3AGQA 3ADOA 4ZQHA 4F3RA 2IEDA 5JQWA 3UMJA 4PCUA 4QM6A 4TM8A 2I1QA 4X1KA 5EHXA 1M2VA 4OH7A 3QBJA 5KYWB 2BM0A 1JQEA 3QY0A 1QGDA 4LNUB 1XFAA 1BE0A 1KYTA 3BGWA 3NEAA 1BJTA 1YE8A 1VGQA 3DV0A 3I2FA 3PXDA 4UM8B 3QYJA 4B2PA 2G1PA 5KYTA 2QN2A 1QSGA 1R66A 4PNEA 3D3EA 1REQB 1Y4AE 1ZIPA 3ZGZA 5I7FA 1SIUA 1K4MA 3OBIA 5H1YA 1JQDA 5A2QA 2HY7A 4C0HA 4QYTA 3QLTA 4C30A 4NJMA 3LBFA 2OAEA 3TZCA 3I4CA 1Z17A 4M83A 1Q3HA 4NG4A 1NQOA 1XVAA 3L40A 3TB6A 1Q0TA 3MWYW 1VG0B 3FIJA 5DGIA 5TX7A 5ALFA 4ENRA 4DNQA 1G2IA 4IWNA 3A1FA 4EYEA 4PZLA 2V7PA 3ILSA 2C7QA 4FINA 1CETA 1SUBA 1T43A 1E2QA 3BMCA 3HBNA 3O2JA 3UMSA 2FF7A 1E4EB 4BFYA 4Q1FA 4RELA 1MQAA 4PX3A 1Q7CA 3CYFA 3OTOB 1KZ4A 2MCFA 3N75A 4P93A 1ZP6A 1OZ0A 4RVGA 4X1YA 3BK7A 1GYRA 4KN6A 3VPBA 3WK7A 2VF7A 3B1FA 3CF4A 3DLTA 4GEGA 2I6UA 3FHLA 2DXIA 4YJ3B 2XGSA 4HFJA 3M3HA 1GUDA 2WJGA 1Z0DA 1ZFNA 2V7XA 3H11A 3K8QA 3NHPA 4Q4AA 5ENDA 4A23A 1DWPA 4BVLA 1OXBB 1M6VA 4Q3AA 3ELYA 4GQAA 4GZ3A 3W06A 3BC1A 3VM6A 1QKIA 3Q3VA 3WQSB 5C52B 4R7TA 5IKPA 5LKRA 3LQFA 4JENA 1NULA 5F2EA 4X3PA 4B7UA 3MUFA 2PCJA 3SYLA 1K97A 5JZOA 2XCSB 3DTNA 2WQ7A 4BO0A 1GN8A 3RB8A 3NANA 3ABIA 3QH4A 3RRZA 4BFVA 1ND5A 1NBMD 1F8UA 2FW1A 5CGQB 2VT3A 1RT9A 2BFFA 3CUSA 3MRVA 4U5QA 1NOIA 4ZAZA 4IRMA 3KV3O 1KK3A 2FPSA 3HGMA 3H97A 3VYVA 4TV8F 4AJ2A 1J9EA 3RS8A 1SG6A 4AS3A 4DTCA 1O96A 2VWQA 5HOEA 4Q9HA 4C4OA 4Q37A 1X1DA 1ZUNA 4IH1A 4O3MA 3OIWA 4JXKA 4AY2A 4HEA6 1DAHA 3CONA 4LAFA 1T2EA 2GLTA 2IYLD 2MWMA 2AV6A 2Q45A 3H9CA 5DHFA 3UHAA 4ZGGA 1XZ8A 3DZKA 3M4YA 3RH0A 4HQFA 4DT1A 1NR7A 1G5IA 4C7XA 4EB3A 2XJ9A 1XMJA 5LC1A 3RRFA 2BDUA 1XVIA 2GZ2A 2FUEA 3ELDA 3FDXA 5GGXA 3K32A 3MGBA 1QYXA 3P94A 4HSEA 6Q21A 3NYRA 4AJKA 2FETA 5FUVA 1DPFA 2AB0A 5HZHA 2G07A 4HG2A 3RVBA 1Q83A 4I81A 5JYEA 1E32A 5K3FB 3AM5A 3H2BA 5C46F 1LDEA 4HVAA 1BS9A 4LKOA 3T9EA 4FFOA 4PFSA 3IULA 3TOCA 4FDTA 4JYCA 2IBTA 2FMXA