1V5IA

Crystal structure of serine protease inhibitor poia1 in complex with subtilisin bpn'
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
275
structure length
274
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'
rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/protein binding
molecule keywords Subtilisin BPN'
total genus 97
structure length 274
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2003-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1v5iA00
1NDUA 2SICE 2PYZA 3L1KA 1ZVJA 1V5IA 2ST1A 3DE4X 4CG0A 1AU9A 3PTLA 1C9JA 1GTG1 1A2QA 2PRKA 3P5BA 1SIUA 3DE7X 3DW3X 4LVOA 1PEKE 2DUJA 1WVMA 3SICE 4C3VA 1SCBA 1GNSA 1UBNA 5FAXA 1LW6E 3LPCA 3F49S 2PWAA 4M1ZA 4OMCA 3DE0X 3DE2X 3LPDA 3QMPA 4J94A 1SUBA 1Y9ZA 2ZWOA 4WOBA 1NDQA 4CFZA 1BH6A 2SBTA 1SH7A 1WMDA 2W2OA 3ZXXA 1SUCA 3EE6A 3BX1A 3DW1X 3AFGA 3DDZX 3DYBA 5AMXA 1GT91 3I34X 3VSBA 1S01A 1BJRE 1Y3DE 2W2PA 1ST2A 1TM4E 2WUWE 5FBZA 4YN3A 3AJ9A 2W2MA 2Z30A 1V6CA 1SBNE 2Z57A 4MZDA 3VYVA 3ZXYA 1KDYA 1AK9A 3QFHA 2W2QA 2XTJA 5B1EA 4OV6B 1AH2A 1GCIA 1C3LA 3CO0S 1BFUA 4KG7A 3F7MA 1SBIA 1SELA 1Y4AE 3DVRX 5AQEA 1TM5E 3BGOS 4H6XA 1TM7E 4HX2A 3TECE 2DQKA 2Z2XA 5I9SA 1Y34E 1Y1KE 2P4EA 1TM3E 1BE6A 1Y3FE 2ZRQA 3D43A 1KDVA 2ID4A 2GKOA 4K8RB 4H6VA 4KPGA 1JEAA 1SPBS 3A3PA 3VV3A 2PQ2A 1SIOA 3DE1X 1P7WA 4DZTA 1DUIA 1SBHA 2HPZA 3SQOA 2WV7A 3TI7A 5JXGA 1Y4DE 2WWTA 5FFNA 1PTKA 1Y3CE 1GNVA 3AJ8A 1R64A 1SN7A 3CNQS 4ZARA 2SECE 2W2NA 3DE3X 3EIFA 1KDZA 3UNXA 2QTWB 1C9NA 3T41A 1BE8A 4C3UA 1IAVA 3H42B 3A3NA 3GT4A 3WQBA 1S2NA 1PJ8A 1R6VA 2Z58A 4B5LA 3WIVA 1SUDA 3PRKE 4NE9A 1XF1A 2XRMA 5ARBA 1P8JA 1GA1A 2TECE 1PFGA 2X8JB 3EDYA 4NMXB 3VTAA 5JXJA 4KB5A 1Q5PA 3GCXA 1TO2E 1SUPA 1Y48E 2PKCA 1SVNA 3DWEX 1GA4A 4JP8A 1GA6A 4CFYA 1AV7A 4BWGA 3TI9A 1AQNA 1TMGE 1MPTA 1T1IA 2PWBA 1KE2A 2V8BA 1T1GA 3GT3A 3GCWA 1TECE 1CNMA 1TM1E 2Z2YA 1OT5A 1AVTA 1CSEE 1TO1E 3WIUA 5JXHA 3LXUX 1R0RE 5B1DA 2HD4A 1S02A 1SUEA 1WMEA 1OYOA 1EA7A 1AF4A 2IXTA 3DE5X 2WUVA 4RYDA 4LVNA 5AVJA 4DWWA 4AKSA 1SIBE 1VSBA 2X8JA 4WOCA 1SBTA 4AKTA 1GTJ1 1YJAA 1SCJA 2ID8A 1Y3BE 1YJBA 3Q5GA 1ST3A 1IC6A 3I2YX 1SCDA 1GTL1 1P7VA 2B6NA 5ARCA 3VHQA 4FONA 5K7SA 1Y33E 1YJCA 1BFKA 3LPAA 1NLUA 1SCNE 2G4VA 2SNIE 1THMA 4ZOQI 3HJRA 2E1PA 4OMDA 1OYVA 1WSDA 3A3OA 4NE7A 2DP4E 4I0WB 3F7OA 2PMWB 5AVKA 3VV2A 4HVLA 4Z2AA 4GI3A 3D9QX 1HT3A 2IY9A 5SICE 1SUAA 1TK2A 3BPSA 1EGQA 3DVSX 2Z2ZA 3I37X 5ARDA 3DVQX 1WMFA 1KE1A 3DE6X 1MEEA 3I30X 3OSZA 4DJ5X 1DBIA 3Q40A 5JXIA 1SBCA 1YU6A 2Z56A 1T1EA 1SCAA 2ZWPA 5JMOA 3WHIA 4H6WA 5CW1A 1ZVKA 3QTLA 1C9MA
chains in the Genus database with same CATH superfamily
1D2MA 3LC7O 4F6RA 2B0CA 1RLTA 3GN2A 4Y6LA 3IURA 5HMMA 3EAQA 3RFCA 3DNMA 3K6JA 4CFYA 2X7XA 1OGIA 4FOSA 1XCJA 2P9JA 1PFYA 2AQ8A 4H31A 2VAXA 1XA4A 4PCUA 3GIWA 2DLNA 4F2HA 5K6AC 4LC1A 3G59A 3O6VA 4LQ4A 4U2CA 2P40A 4DIOA 4RD1A 5AJVB 3BULA 5DB4A 4CT5A 4A2QA 3V1LA 1FOEB 2R6JA 3UWSA 1K6MA 1J97A 2O0JA 4JOBA 1RAIA 3OZAA 3EH1A 3FOWA 4UC0A 3ZOZA 4C4ZA 2A9RA 4EG7A 4C06A 2RGNA 4NBUA 3BIXA 3ABRB 5CLHA 5F4ZA 5A06A 2DUUA 1SBNE 1LLQA 1O4WA 3GU3A 2JIZA 3WV4A 1YQTA 5E1DA 3VJLA 2COEA 3OPQA 2L17A 1R0KA 3GXBA 5CFOA 2IYXA 4GDMA 3C3AA 2EGUA 4GVLA 4M89A 1L4GA 4LF8B 4DCMA 2XAUA 2P69A 3KQYA 2YWBA 3QEOA 4JB0A 3V1NA 1XZAA 1F9EA 3A9WA 1KARA 2VHCA 4CL2A 4ZOLF 4AJEA 5A5DA 3EVBA 3RRBA 5EZYF 4X7BA 2I1LA 3UMJA 4CT0A 4OFXA 3OZSA 1A5SB 3JQEA 4MLPA 3GUHA 4L5AA 4CTNA 4TT8A 3U7QA 5ALRA 1KBOA 4D6YA 2X4IA 2GBLC 3RC2A 1P31A 4KIJA 1NU8A 3N39C 4DMMA 4UZFA 3U56A 3SJCA 5KSZA 3VR5D 1PNTA 1T6XA 1L9KA 2ZJ2A 2ZWMA 5LSAA 2IX9A 5IX8A 4U3JB 1N2JA 4N5LA 2W4IA 2QUJA 4RESA 3FOEC 1F0NA 5M29A 3DKPA 2DR2A 5AM4A 3VO2A 3QKSB 4U7HA 1THGA 2D62A 2QTLA 4O8ZA 3TK1A 1MIOA 4LZOA 1UZMA 4UXHA 5FPSA 3DAOA 4FQ8A 4HUJA 5FT9A 3W9UA 1RRGA 5AM0A 1ODIA 3CO5A 5EXEA 3S2YA 1JJVA 4E31A 1OWPA 2ZJ8A 1PHRA 4ETIA 1DIGA 4UNIA 3K9QO 4RNCA 1XIVA 5I4CA 2GF2A 4C6SA 1AGXA 1UBTS 3MOIA 1UBLS 1E20A 3MTEA 3R40A 4IMRA 3ZCQA 4LG1A 2PUBA 1N9KA 4BNKA 4HH3C 1QVWA 4V0SA 1PTJC 4OIMA 2HHAA 3TB6A 3TJZA 1C2YA 1U3TA 5GP1A 3JRWA 4IDGA 5GONA 3WLMA 4O33A 4AAYA 2H7CA 1TIBA 4R41A 4D8TA 3HM9A 2HAEA 2X6RA 1XTVA 1PT6A 2XUIA 4C7MA 2OBFA 1QUFA 5IKEA 2FFHA 4C0HA 2HV8A 3AFNA 3V1YA 1DCFA 1THMA 3QU4A 2OOKA 2VAVA 3PZRA 1ZD3A 3ZGLA 1F2TB 4KQ2A 1IY9A 4U7FA 1IUKA 5IVDA 1VHDA 2Y0BA 1IB6A 3GZNB 2I33A 2PZ8A 2V3WA 1WF3A 4PPGA 1TVMA 1NRIA 1G20B 2WFAA 3V5NA 2QVXX 4GL4A 3V2GA 2WF6A 4J49A 3WHIA 3IEUA 2GF0A 3EXEA 4ZQCB 1CUVA 3E9NA 5EAIA 2A94A 1RM5A 1L9XA 1YHYA 1SHKA 3DZGA 4OXXA 2PVCA 3WIOA 1U3WA 4HSEA 1HTBA 1LVUA 2HJ9A 2FFAA 3RYHA 2RBGA 2JIPA 2HK6A 2MT9A 3JW8A 3Q7EA 1CS0B 1UPTA 2IE0A 5JMTA 2W6JD 3M1YA 3UAWA 1SUBA 2NV0A 3A26A 1KDOA 3H04A 2HF2A 3BSYA 2OYRA 4YAFA 1BAPA 5ALNA 2WYVA 5BWMA 3RIHA 2Z4TA 3QOWA 1QKJA 3AINA 1KJNA 5D3MA 5F76A 2XCIA 1GGFA 3WIEA 3ZIUA 2R00C 2PJDA 1MX5A 3IAHA 3MSCA 5FBZA 3W8FA 1CQJB 4N5NA 4OHFA 1Y89A 3S70A 5IN5A 4E07A 5E6UB 4MUBA 4F85A 2CCKA 3PQ6A 3TW4A 3S40A 3I6ZA 3LP8A 5BR7A 3DVRX 3OM9A 2QPAA 5BQFA 4Q47A 2ZSHA 5KBYA 2XUOA 1E4EB 5TE9A 1P0FA 1Z88A 2XHEA 2SKDA 1KJ9A 3E4DA 4YMTA 3PS9A 3G8DA 1HDOA 2B7BA 4QLOA 1QKIA 5JANA 4ENPA 2B61A 2VK4A 1DARA 3ITKA 4HWRA 4DSTA 4C78A 3TRFA 2GHRA 2RKWA 5EQJB 2QT1A 5DIFA 4XJSA 1MORA 2INGX 1MAAA 3KR0A 3QFFA 1JPNA 3SYTA 4ZMSA 2W6ZA 3K9LA 3ZPXA 4QU9A 5H68A 1ZMXA 3Q9UA 3BXGA 3NNNA 1QFMA 2VBFA 4ZYZA 5KYWB 3A3NA 3WADA 3O2SB 1RTKA 1ZG3A 2J0UA 4Q3EA 2W6OA 4P0TA 1QIGA 2OCPA 4RHYA 1TPYA 1EZ4A 3BRCA 2XB9A 1QSGA 3N2KB 3DHNA 4FVTA 1SQFA 1DGQA 4MA4A 2EW2A 4BECA 4B3MB 3FPLA 2P2LA 5C2JB 1MC5A 4BFVA 1U2DC 3F2VA 5P8WA 4QYWA 2NZXA 2VTVA 3GP3A 3E53A 4BZXA 4UBOA 3LVRE 1MPTA 2BOVA 2J6BA 3ZJ5A 1EHIA 4JQSA 5ALWA 3NOVA 4OLFA 4Q9DA 2YYZA 2C3OA 2F8SA 1MJ5A 1DKPA 2ZCJA 2D1RA 3EIQA 4HX9A 4IW3B 3U7JA 1RWWA 2X8JA 1FVHA 2X76A 3PEVA 3UK6A 1LF5A 1LCIA 1SVOA 5AUNB 4I3HA 3U6KA 4MB0A 3CH7A 3H5RA 3R5FA 4OBBA 1ONSA 3LTEA 4KAJA 2CFTA 3LQ2A 3PBKA 5LYYA 1ODSA 2P27A 4CU2A 4MVJG 4X64B 2GWHA 4JMPA 4LJSA 3LV8A 5A02A 4HV4A 3LPMA 1XMPA 3U4DA 2YINC 1CQIA 4JK3A 4PHGA 3LC0A 2C7GA 4AMUA 2E4YA 2OSBA 2NYVA 4FN5A 4DNPA 3DDHA 4GP9A 1UWVA 4EM6A 2QN9A 3U37A 2BRUC 4LRSB 3KDSE 5D1HA 4EH1A 2O59A 2CB9A 2RAPA 4BV2A 1MGPA 5L95A 4MTLA 1WAMA 2P6RA 3IOBA 1L5SA 5KTSA 3NHLA 4KPFC 3FNIA 1OAOC 1NBEA 5CYGA 4E5UA 2PK3A 3CIOA 3HPQA 2AMVA 4Y2QA 3RYTC 2X9QA 4ENSA 5K3DA 3DXXA 2I80A 3KU1A 1POWA 2CNLA 4IZIA 3S1AB 1FVOA 3QVWA 3FCXA 2BKAA 2ODPA 2ZBFA 2LP4Y 4GECA 4XEHA 4ZZ2A 1ZNXA 2I1VB 2LCIA 1JG6A 1VMDA 1RWNA 1ZLXA 3GWZA 1NURA 4J75A 5K0TA 4H1HA 2F00A 2G70A 4V0OA 3PI7A 4EUEA 3T5PA 2O23A 4BJ1A 1Z6XA 2NW6A 5AW5A 1QGAA 3OTHA 5K0EA 3U61B 2DEUA 4JNKA 2PTGA 2YIMA 1XA3A 3AFHA 1FU4A 3QA3E 3G1UA 2GT1A 3L7MA 4JQZA 4QPCA 4V0KA 1X7XB 2WVGA 4XOIA 2GBFA 5G4LA 5BOSB 2OV2A 3I92A 2B30A 3LUFA 3RYFA 2WP0A 4BFSA 4DGSA 3HDGA 1OTXA 1MJFA 2ZRLA 3FD8A 3SZMA 7YASA 5JWRA 4YUWA 2PEZA 1J8QA 1W5FA 4LWQA 2HCJB 1OCEA 3WWPA 5K8IA 2PXXA 3SEAA 3VX3A 2G88A 1B6RA 2WA1A 2AZMA 4QRHA 2ZZMA 2VSOA 5WRFA 2PZEA 3EZNA 4Y2XA 1JPJA 1XRMA 4ZI3A 4MUNA 2LE0A 2P1DA 5A0TA 4MVJD 3CRNA 5HZKA 3N2GB 2IX3A 1DXQA 3LVQE 3IVMA 3FMGA 5KDDA 3IE0A 5DBEX 2QP9X 4ND7A 1C50A 4QG3A 2N3ZA 1BQ4A 5CNIA 2FSHA 2PFSA 3PWTA 4GXNA 2PSFA 1YA8A 3H2IA 3HVIA 1VLLA 3NBFA 4IFIA 4C7BA 3PYMA 4E88A 2ZKLA 5DCYA 1KGSA 2OFWA 4ISBA 3RTBA 1CY1A 1B2RA 4NBNA 4JT8A 3K9HA 4WKNA 4ZA2A 2FXIA 1GGHA 2XITA 2HLHA 4MRRA 3NATA 5DXFA 3UT5A 5JASA 5M34A 5EWLB 5BYKA 1XRNA 4XQCA 3PGKA 3E84A 3AXSA 3R8FA 4TYNA 1ECFA 3EMKA 4OI0A 1TKCA 2ORIA 2PUHA 5ESWA 4RPIA 3MUFA 3A36A 1ZVMA 4GEGA 5H59A 3WB9A 2YWGA 4MQ6A 1U90A 4BN0A 4UPEA 1YRAA 5LQMA 1RIIA 1AS2A 1FDOA 3LZDA 4PBRA 4DPKA 1DZIA 3ER6A 2YX1A 3B9PA 1MIOB 3BD6A 3NM5A 1YC2A 1ZCZA 3F9RA 5JRZA 1R6XA 2FR8C 2OMEA 1DAKA 2VYVA 3WL4A 2B94A 2V5AA 3SXUB 1XFDA 1Y42X 1FFHA 1D6MA 5BW6B 4OSPA 1O58A 3PRHA 2RHLA 4OG2A 2G7ZA 4QOEA 1KXJA 2C78A 3DTTA 3DWIA 2FK8A 2HRDA 1XZFA 1DTWA 3RS3A 3EGVA 3EAFA 1XDSA 2I2CA 4GPBA 2AYYA 3DBRB 4WZAE 1OBHA 2AOTB 4IDAA 5HDQA 1NAIA 4KV9A 3WKEA 1W4BA 4G5SA 2XWPA 3W3AD 2NXEA 4LF6B 3V8RA 1AS0A 1NXVA 3BE8A 2XIJA 1BDJA 1EBBA 1LS6A 2FWAA 2H51A 2ZJZA 4NU0A 1MABB 3MNFA 4S1OA 1BRMA 3ADPA 3D54D 4IIBA 4AD8A 1IY0A 1EFPB 2ZIEA 3JZMA 3NBMA 1WDWB 4HLUC 1NVDA 2QVGA 4XKJA 5K3FB 4H3SA 2JGIA 1H2ZA 2YW2A 1EAMA 3JPYA 4OQNA 3V4PB 3DW3X 5J1TB 1ZXLA 3QELA 4IDDA 2HFKA 3BTUA 5DGHA 4AX8A 2B1JA 5TR9A 5BMVA 4M1ZA 1LRJA 2PWAA 2YYYA 1KETA 3INNA 1M9NA 1RI1A 1GR1A 4C0JA 1VYUA 3FE2A 3WBBA 1FZQA 1M0SA 1Q74A 3A31A 2FSVC 3UHFA 4B44A 5DXAA 4L28A 4F96A 3QOFA 1W5SA 3QKRA 4BFCA 1P6QA 1Y4SA 4JH0A 4RKWA 3CE9A 2UZ4A 4XJVA 2P35A 5BT8A 1M66A 2W6PA 4DANA 2GN1A 2VRCD 3RRXA 3IUQA 2BFFB 5D87A 4LN1A 5LOVB 1NT4A 1SXJA 2P9HA 3MJFA 1UKAA 3PL5A 1TM3E 2H9YA 4IH1A 2D1QA 3D43A 3LX4A 4RANA 3KT8A 1OU0A 3IVXA 4P31A 1FNBA 1XDGA 5AESA 3L06A 1A97A 1G21E 1TJ5A 3LQRA 1H3NA 4TXLA 1CF2O 1WV0A 5GJCA 2I4IA 4MDFA 4MWOA 5AJTA 3PJRA 3E5NA 2XJ9A 4YRQA 2JEZA 1LPMA 1VRCA 3EGOA 3H5LA 3N2NA 4IOKA 1R64A 3K3PA 3QU5A 4ITRC 3PKIA 2Z8XA 2PIAA 4U2KA 3PNSA 3H1GA 4CGZA 2BMEA 4GBGA 4TXNA 1P7YA 4ZDWA 1QP8A 4ZWNA 3ECAA 1YDFA 3A9TA 3PNQA 4JB2A 3VZRA 4A0RA 3USCS 4TKMA 2ZT8A 3JQFA 2HCTA 2XKKA 1Q7RA 4L4XA 2I8LA 2VP0A 1Z35A 1N6RA 2H2FA 2ZT7A 2WD7A 3SZUA 2V6JA 3BJIC 1T9HA 4WKCA 5DHTA 3MK31 3O2JA 4ZVRA 3UHOA 2JFUA 2ZAYA 4H7JA 1XPJA 2JJ1A 2Q4RA 1UPFA 2Q2NA 5L3RA 1CNMA 2AJDA 2C3YA 3WR5A 5HKKD 1NKTA 4YQYA 2I34A 2WUGA 2CJYA 3B78A 3D8TA 4MB2A 2XT9A 1RJ9A 2WE8A 1PR2A 3MFYA 3SIPA 1RXWA 1TPZA 4JXXA 2NUPA 4XE5A 3CUEF 4LDRA 1E64A 1UC4B 2AC2A 4IHJB 1AKVA 2WINI 1NM5C 3IH5A 2WABA 3FY4A 4TMVA 1FUUA 3S44A 2DHEA 4HQNA 2CXNA 4XQ0A 1XEWY 4RTSA 2OT3B 1RP7A 3IA2A 3O91A 1GM5A 3IJ5A 4KO2S 4X5OA 5CP8A 3RVOA 3HFSA 3TVDA 2HXGA 3V8MA 2GWRA 2VYFA 4KQ1A 1NYLA 5FORA 3BVPA 4FHFA 1WU8A 3NTOA 5I9TA 1YXMA 3U4CA 4GKKB 4LMPA 3FWHA 3CUWA 4AO6A 5I8WA 1DT3A 4B4WA 4BE9A 3V2UA 4E32A 1J06A 4RCYA 3QTLA 4M37A 3WGQA 3EHDA 1NP7A 1UF9A 2HO5A 2ZJ5A 1J1IA 1RQRA 3M0EA 4Y18A 5KWSA 2OGUA 5GM2A 4OQFA 2BP7A 4DCGA 5CB4A 3C0KA 3DE7X 4QOIA 4N9QA 1DBPA 3ONVA 4M8LA 2NIPA 5JATA 1NBOA 4AUMA 1HF3A 4JP3A 1XDUA 1RE0A 4OMCA 4JX9A 3F9CA 1Z6GA 2J3JA 3OD1A 4EVIA 3LBHA 5DK4A 1BH6A 1E2IA 1OI2A 1A3CA 4P4LA 1RW4A 4J1NA 3LM8A 3NC1C 4AY6A 2PXAA 3NIBA 4R2IA 3BX1A 1DIHA 3JVUA 4NR0A 3VZCA 4Q4JA 5AMXA 2Q9CA 1F4LA 2WM8A 4K3UA 1CZLA 2PGOA 2DKOA 3DBLB 1X7HA 1ZHOA 1A8SA 4BJHB 3VR6A 1ENZA 2WTNA 3C7DB 4EGCB 3EG5A 1KC1A 2AOUA 4F1WA 2QRZA 3L0SA 4ZC1A 3WKBA 1N0UA 4EP1A 3OM1A 5EIHA 4FI3C 2WV9A 3ZV4A 4C87A 1SULA 1E8DA 2ERXA 3WGLA 2GM9A 2J5KA 1BO6A 2BDUA 2XTAA 4OQEA 4J2HA 4V2UA 3IAS6 1OMOA 1V1JA 4Q9JA 5HIKA 1MT0A 1XRPA 1QPGA 1KBQA 1VKRA 3VGPA 4LE2A 2J07A 4MO9A 2ZTVA 3CWQA 2R2GA 1G2QA 1IY2A 1U9IA 1CY6A 1O7JA 1D03A 3D6HA 4N5MA 4PIVA 4Y2UA 1RC1A 3VC7A 5KQMA 2YJGA 3CLHA 2AK2A 2OUIA 4ZVVA 1ELOA 3O82A 2B21A 4G07A 4DUZB 3I6BA 2RKOA 3P20A 3AR5A 1GARA 2GCOA 3SBOA 4S1WA 3FVRA 3QPAA 1DAFA 1HTTA 1ZOSA 2VAWA 1LC0A 1KDPA 3OIDA 3WGYA 4HLNA 5JHGB 4CKBA 1KI2A 1QHGA 1ZCJA 2PWZA 1LH0A 3HU1A 3TX2A 4CWAA 3GCGA 4FYXA 5F9MA 1JBEA 3MELA 2QRGA 3PGXA 4FDMA 2A67A 1JQ5A 2ADOA 1PR6A 2B8NA 3NBAA 4L57A 3TD9A 1A7AA 3GLVA 4DJAA 1KDRA 2FPOA 1I1HA 1HQYE 4MR7A 5K9ZA 4X24A 3WRXA 1I32A 2Y77A 1PYGA 3WL3A 5KHAA 3U62A 5JAOA 2FPPA 2AR7A 2V8BA 1M7GA 2OK8A 4G0YA 4II2A 3AVTA 5TNXA 4PAOA 3K2IA 1JDTA 5CU7A 4Y2YA 3OFJA 3RJ5A 4ENWA 5AW0A 2ATCA 4B3DA 4AN0A 4Z4HA 3CRZA 1L7VC 2G40A 3NDIA 3DM5A 3M6VA 2ANCA 3C1TA 4RHTA 1RNLA 2E55A 4E30A 3ZLVA 1NG9A 4MA5A 5T67A 4RULA 2WVAA 4BBPA 4PONA 4D44A 1WCIB 2PD4A 1TF5A 5COBA 2BWJA 2ZE8A 3I45A 3X0DA 3DFFA 2JS7A 5F64A 3CLUD 1WM1A 3H17A 4QFDA 4S0XA 1UMDB 2XDAA 4R71A 1FDRA 4OP1A 2OENG 3RD5A 1VM6A 3NMUF 4CDNA 2PMEA 1M34B 3SLGA 3N8HA 5B36A 6REQA 3Q5EA 1W94A 5JISA 1Z47A 2Q4EA 1G5RA 4YH1A 1QYVA 2HK9A 2V1UA 1YSCA 1AUXA 1K89A 4CCWA 5D7BA 1G8MA 4RFVA 1LTKA 1QIMA 1KKLA 2KWIA 2GTPA 3PVCA 5E3JA 3VNRA 1JZSA 5FIUA 3HEBA 1WA5A 1XZHA 2Z1MA 1U5AA 2FSSA 1M6WA 4MIKA 2NPIA 3DQQA 1U2GA 4L74A 5FFMA 3E9YA 2ZRJA 3RWMB 4NPCA 1JYSA 1W4LA 4C4PA 4TOIA 5E2AA 4MJXA 2ZBDA 3JVEA 3QU9A 2JJ8A 2AMFA 4RPHA 5AR1A 2XCOA 4JBNA 2REQB 5CHEA 5AXDA 3IEIA 1VFNA 1Z4QA 4GGOA 3LK6A 2WAMA 3E7PA 2LGJA 3LIIA 1HM5A 2FPSA 5B37A 4EUHA 2MYUA 1CZHA 3QLUA 2JLSA 1XCLA 5EE3A 1EFPA 1N34B 4CZ2A 3WZLA 4NG4A 5DK6A 5IVHA 3EW9A 1ZRHA 5HCIA 3ZE9A 3DKRA 4R16A 4K3VA 2BFCA 5LA6B 3M34A 1DG1G 1LQ2A 4IXNA 4MI9A 2Z08A 3T61A 1KRHA 4H6XA 2HQRA 5HQ3B 3TECE 1XUOA 4M9ZA 1IY8A 3DL0A 5BNWA 1OFIA 2NT3A 5EG5A 2VEOA 3E18A 4RH3A 2YOFA 5GM1A 2HXSA 4Z4EA 3EODA 5BQXA 2WUFA 3AR4A 3QKRB 3DE1X 1VIVA 3BXZA 4EG3A 3DZHA 2WV7A 2BR5A 3DHEA 3GJ0A 5EKTA 1DKMA 1G5QA 1Y1TA 1L5FA 2XA9A 3NASA 5AO9A 2JVJA 3P0EA 4V1CA 4L08A 3NB0A 1ZUD1 2ACKA 3KZCA 3MGKA 4WK4B 3Q88A 3TQQA 1VJ0A 4NFHA 2FF7A 4WECA 5CTAA 1VKJA 5AOAA 2FMIA 3ROKA 3IEMA 4MJ7A 4D3DA 3ET4A 3JALB 3H3JA 3LCJA 4BRUA 5DW0A 4HMOA 1IL0A 4N1AA 3UJ3X 5AW7A 1R9JA 4FM9A 2HR1A 4JUAA 4J4TA 5CB8A 4C3OB 2DFKB 5IF3A 1M3SA 3CLVA 2YYAA 1I3NA 1RPAA 4OFWA 2OXEA 1Z26A 5BV1A 2JGKA 2EFDB 1KZ9A 5IDXA 4JLMA 4PS0A 2P4HX 3DZDA 3FUCA 1CK4A 5KX5A 3BZWA 5DZSA 5A9SA 4MQUA 1E79D 1JQLB 3H19A 4DLVA 5DNDA 5JQGA 4FHGA 3IB3A 4L3VA 4M1TA 3B1FA 3LUKA 2I7DA 3U7HB 4PLYA 1NVXQ 4ZCQA 4EY5A 2F9MA 3IBYA 4WOCA 4D3SA 2PSSA 3QRWA 5BN4B 1VBFA 3TL3A 2VF5X 3ITEA 4B7ZA 4DUPA 2ZB3A 3VHQA 2IUEA 4DRZA 4FYMA 3O1IC 1W4ZA 1LEHA 1SOWA 1JFFA 4CDGA 4TT3D 1L1QA 1EFHA 1WSWA 2FW7A 2PANA 4GRDA 4RDIA 3NI2A 5CK4A 4E5SA 3F73A 1U0FA 4BNWA 5CA1B 2HO4A 3EASA 3PNMA 3UWDA 3SS9X 3BTSA 3KPJA 2HT1A 2E5LB 1EGQA 1KI3A 2J3QA 5CA0B 5FH9A 3HC7A 4HZUB 3KWFA 5CH8A 3BJZA 2QN8A 2W8BA 3BDAA 1YU6A 3SYMA 1B0UA 1Z08A 3KZVA 2ZUBA 2A84A 4GW3A 2C88A 3TBFA 2WTAA 2I6XA 1D8TA 1CUFA 4ZVUA 2D2EA 2KW5A 4WEQA 4JFRA 3RKSA 3WLIA 1L7DA 3O9VA 2B99A 3M9XA 2NTYC 2V6GA 2B82A 1CZKA 1ZJJA 2ZVJA 3FFBA 3AETA 4PHCA 2DR0A 2OBYA 3D7KA 1E6UA 1M2WA 4ITVA 4OB7A 1Y4ZA 4LBVA 3GT7A 3O0TA 4UTPA 1IM5A 3OJCA 3QOXA 1RKBA 3IR6A 1GPYA 3FBTA 2BEWB 5JLAA 3TMYA 1W36D 4CEIB 4HVCA 1ESZA 5KOHB 1M2OB 3R1IA 5COQA 3DYBA 5BSRA 3W2GA 2C5HA 3ESZA 2WWWA 3R77A 1P60A 3AEXA 2WT4A 3IMGA 4J4BA 4TSKA 3TUIC 1LKZA 2IEAA 2RHRA 4GE0A 4HCJA 5KPDA 2WJGA 5ALVA 1VE9A 3QKSA 3NXSA 1XTJA 3N7UA 4YX9A 3WTBA 4G5FA 2DTXA 1TUBB 4MV5A 1T36A 1F17A 2A5YB 5T6MA 3OZWA 1SZPA 4V24A 1SJ9A 3MWYW 5KDLA 1S9DA 3VH1A 4ZJYA 5AYVA 4NYJQ 4O29A 4URUR 4NBLA 1DRKA 1GCAA 2UVPB 3K9BA 4H6VA 4IIUA 4NQRA 3ZKAA 3A3PA 2Q2QA 4P7FA 5ELXA 4MCAA 3JATA 4BNUA 2JCGA 4Z49A 1E69A 2JEYA 3BKWA 1CRWG 4RV4A 1OWMA 4RTLA 4G3XA 1N1MA 1FFBA 4OGWA 3GRCA 4UZEA 1LY1A 4RENA 3ICEA 4IR7A 3GRRA 1KH3A 4OHUA 4QDJA 1CV2A 1Q1ZA 4DBZA 4GRAA 4BE7B 2NP7A 4D9MA 2ZB4A 2CXTA 1EX6A 2RAFA 3LT4A 2QAGB 4HB2A 4MWBA 4CG2A 1Q1AA 4TWAA 5T6BA 3N75A 4DLNA 1DQZA 3EXHC 2WU4A 4X92A 3WS7A 1G9XA 2YVKA 1TO2E 2X0NA 2IEGA 5A4AA 3G0GA 3J81A 1M2GA 3DLIA 3H8SA 3GRUA 5EY5B 4CMEC 4JEMA 5JI2E 1NVMB 4Y0VA 3ZX5A 3I62A 1E62A 3CH5A 2VKQA 1SXPA 2XDQB 3KE8A 3QI2A 4FDLA 1I4TD 3MWFA 4Q5IA 5CGZA 1YCHA 4N0QA 2EKZA 2GPAA 4OAOA 4O4LB 4OI1A 3UOAB 3VHXA 1QV6A 3EDRA 1FS5A 2MSCB 1R74A 1F2UB 1WMEA 2HMSA 4PVDA 4ZJPA 1UDBA 3TRKA 2AG8A 2EDAA 1KNQA 2WUVA 3DBVO 4XUDA 1E66A 1LJUA 2OZVA 1P1CA 2JBAB 1CIPA 1OR8A 1HYEA 1TDJA 3OZCA 5DP1A 2J9YB 4F4UA 5JSQA 1JR3A 3W5CA 5DBFA 3H7AA 4GKBA 4DE5A 1Z16A 1VFPA 3MC1A 1X15A 1YZVA 2IUTA 2HOQA 4KZKA 4LWPA 4YJFB 2W6MA 2ZT5A 4IWXA 1EWTA 4F5EA 2VXYA 2Q0XA 4LSWA 3QOYA 3URMA 3JTMA 3QXXA 4JEHA 3DCYA 4HQLA 1ZSVA 4DQKA 3D6TB 5JXIA 4UBKA 5ADUS 1VL5A 2GA9A 3DUFA 4KQCA 2BM8A 4PYRA 3VKVA 2IW3A 2W6CX 4L0CA 2YH2A 4XM2A 3DLCA 3STXA 3VMFA 5HTOA 2FWPA 3FI0A 5I9BA 5FTNA 2XRZA 2AZ4A 3CZ9A 1C2TA 5FPYA 1HT1E 2H1FA 1FY2A 2XZPA 3B6EA 3MILA 3VRHA 1ZRMA 3NVAA 3H13A 2D5LA 4E5DA 1GWNA 1CIJA 4I4NA 4A23A 4HZIA 5L3VA 5BRAA 1GKUB 1OT3A 4WNIA 2PGJA 3AVPA 1LI5A 3C85A 4NYMR 3W04A 4D79A 3KKEA 4ND1A 4ZI2A 2PSJA 4OKNA 2HQ1A 2WBLC 4PG4A 4KP7A 4ZYTA 5FO1A 4F92B 4J7UA 1I0LA 3AEKA 4LYJA 2FWJA 3TBHA 3A4NA 3RAPR 1OAAA 3DFMA 3I9LA 1L5KA 4CBVA 4UBNA 2C0QA 2CNWA 2YXDA 4G0PA 4LKOA 3RVBA 3RSZA 1O6ZA 2FUCA 3OFNA 221PA 3S2UA 1K5DA 3W6PA 1U02A 2VNIA 1JEYB 2A0YA 3HS3A 5A6SB 1N3LA 3NP9A 5EWJB 3R6GA 3LYHA 3PFBA 4UQPA 1O4VA 3W1WA 4B3HA 4EDHA 5TLSA 2AFVA 5CCEA 1Z5WA 5FB3A 3V4LA 1C7RA 2QTVB 5IZCA 5KYUB 5F9FA 2VJCA 2QG9A 1EP2B 2A0KA 4KGXA 1NW4A 5CB6A 2ZTSA 2XOKD 3VR4D 3R6WA 5AK0A 5IAKA 3GMTA 6LDHA 4F4DA 1B0AA 2F3TA 1Q0HA 1VIYA 4M76B 1GVNB 4UQLA 3PX7A 2FPGB 4IP0A 4QXMA 5C5IA 3V8PA 5J2TF 3ZHVA 1A88A 1F4PA 3AUKA 4I5GA 4N4AA 4TTVA 5SY4A 3VA7A 4D9BA 2QTMA 4M21A 3SVTA 3HO1A 3O38A 2ZE5A 4Q3CA 2JAQA 2LW7A 4M9SA 2Q6OA 5IUNC 5AM1A 4X1KB 2B7CA 4XWTA 5TDHA 4Q3OA 1AKEA 2AF4C 2Z5FA 4L8VA 4HUQB 4BWYA 1YFLA 3GB9A 3GGCA 3EEBA 2C2ZA 2BPOA 3TVYA 1YFZA 2GRUA 3WSVA 4ZANA 1Y3AA 1KO5A 1SXJD 1XVUA 1GA6A 1R4ZA 1ZJZA 2WYWA 4OUKX 4D6PA 4QFCA 3SIRA 4TMFA 5GOZA 2OAP1 1EWVA 1XQ6A 1BS1A 2GYWA 2YDYA 5EP3A 1ZMRA 5ENDA 1P4AA 2JASA 2PX3A 4JJ7A 3GNLA 3N0VA 4QBFA 1CF4A 2NPOA 2B36A 3D0OA 4K03A 3HRKA 3QY0A 2C42A 2JAPA 3FSGD 4FKZA 4NENA 4YECA 2H0RA 2AI3A 3G9UA 3VNQA 4HN9A 1PYDA 4Q7QA 5K3BA 3NHWA 4MWCA 1SCJA 5LDHA 3EDQA 3KQMA 3PNPA 5F7ZA 2I22A 3JWHA 4JASB 2QQ0A 3LL7A 4NAUA 4Q4HA 4P83A 4RADA 1WPQA 3KB8A 1USWA 2XRYA 3MHPA 3BICA 3IP9A 2C7OA 2W00A 3EDMA 3Q1KA 4E08A 2YUIA 1XEXA 1NJ1A 2Y9MB 3FHOA 4Z4FA 5IRCD 4RLSA 3HY3A 2FQ1A 4P5EA 2Y1FA 3TTXA 1GCUA 2JHPA 1L4NA 3WVNA 4KEAA 4X6LA 3NCTA 2X0DA 2FVYA 2HC9A 1FPMA 4IXTA 5JEDA 2IZ1A 3LZCA 4FS8A 1QIIA 5T41A 3SEZA 3EIOA 1VP9A 3EXFA 1IQ0A 3MYRA 4P5DA 3X1XA 2QVLA 1KGDA 4RTPA 5KSYA 4RS4A 1RPJA 3UJCA 3PSAA 5EJFA 4MQEA 2G82A 1J21A 3RIXA 2ZJ7A 3SY8A 3T95A 3WIUA 5JXHA 1OBFO 3N2ZB 5BNZA 1HEUA 4Z2YA 1V8ZA 2RJOA 1NVWQ 4P35A 3EQ8A 4XFJA 4C0QC 3ED1A 2CLFB 3VR1A 3W5UA 4A36A 5AK6A 1RCFA 4ZYVA 3PXDA 5DO9A 2HL6A 1KPGA 1ZP6A 3FYHA 4ADSG 4QPPA 4URZR 1V6CA 2Z57A 2F7SA 3KOWA 4D9FA 4RH1A 1QYRA 4C89A 2AGVA 4YV0A 1EFDN 3O8QB 5EGNA 2O8DB 1V8BA 1EFUA 5IAJA 4EA6A 3O47A 5J2TB 4XVRA 4NBKA 1BWPA 4CMCA 4YRGA 3DEYX 2JKYA 3T15A 3I64A 5I9SA 1Y34E 5LWQA 1CLUA 4EUNA 3MCZA 5D8DA 4CG3A 2ODTX 3P8ZA 3Q6IA 4C6TB 2OHIA 1Z6PA 4GLJA 5F2OA 3AQ4A 1OGYA 3CA8A 3RVDA 4UFPA 4BMCA 1YVDA 2IOHA 4L6CA 1OLUB 4MLDA 3FB4A 5DLQC 1FFWA 1G8GA 1CJTC 1NOJA 1Z4LA 1PFUA 3VBCA 1G8SA 1N2CA 5K4GA 1DNPA 3A8TA 2Q7XA 2QX8A 5BNFA 4MVYA 3E03A 5LA6F 1R88A 2VI5A 2ZU0C 5ED4A 1J8FA 2HSWA 2RG1A 4U2BA 5AKZA 1YKGA 2V6FA 2G1KA 2W90A 3HN2A 2JDIA 4QYSA 4XVQA 2OCYC 3SXUA 4HBZA 4K1LA 1WNFA 4KK4A 3ANYB 1TD9A 3BUSA 3NALA 4CCYB 1TA4A 5DNUA 2YMQA 2ZTUA 3HUEA 3UKOA 1PD0A 3E3LA 3E0XA 5JTTA 2WD8A 3CSUA 3EXIA 4KXLA 1ND5A 2DPGA 4F2WA 3HN7A 3BXPA 4M8NE 1APBA 2CVZA 3AVYA 4WQMA 2P3OA 5DWVA 1Y8RA 2E37A 4EJFA 4R7TA 3DB1A 3CT4A 4KIUA 2YMMA 2PKQP 2BFAA 2Q8PA 1U0LA 1UK6A 4MIEA 3UFBA 3ICQB 4IV5A 3VJRA 4A8TA 4HPWA 4X44A 2A33A 1G8KA 3TIVA 2YASA 2FP3A 1A2KC 3V7WA 4U2GA 4AMVA 2J1LA 3OZRA 2OV3A 4GX0A 1X1RA 3WL6A 1NBIA 2B34A 1UBCA 2R5WA 3HCFA 4EKNB 4JUIA 1W9HA 2GUGA 3Q5DA 3MBKA 4XVHA 3G0OA 5TRTA 1OXMA 3OUZA 4RA9B 1G2OA 1IYZA 1OWNA 3S5JA 4ANFA 3LYAA 4EVSA 1ECCA 3KD2A 4MH0R 3T5CA 1UKEA 2RARA 1PQUA 1TUEA 4E12A 4CTMA 3V97A 1JLSA 2FEWB 1E9DA 1N3IA 2OY0A 3PRYA 1CIVA 2C2KA 3OCJA 1W4RA 4G1UC 3TSOA 1PJLA 4MICA 4HVLA 3FVVA 3PGLA 3BPSA 3C3MA 3WBJA 3DVQX 2NADA 4BQQA 3CB2A 4W82A 4XIFA 3SI7A 1ZK2A 5D3QA 5JRJA 3C1OA 2GVZC 1MRNA 2P78A 3C7AA 4UEQA 1IUNA 1T3TA 5LD2B 4D9JA 1G1MA 3ZWOA 5BVGA 1MUUA 3GFPA 1JA9A 1JQKA 5CVCA 2XMDA 4UEKA 2Q1XA 5E2BA 2W5UA 4ENVA 5HHTA 4QXAA 2QOEA 2WW8A 1M0EA 3W5BA 1U7WA 3W8DA 1RHJA 5ER6A 3CQ9A 5ECWA 1RQXA 1ZK0A 5JARA 2BCEA 4ASUD 4MDHA 3IUMA 4WOBA 2GZHA 1C5KA 5IZ4A 4OP2A 2GZRA 3I76A 2HZ7A 4NMMA 3ZWVA 3TFOA 1O97C 3THOA 1PL7A 5K01A 1YL7A 4DQVA 2B5OA 4BYGA 1J5PA 1XF9A 1K86A 3F6SA 3HCRA 4DG5A 4HEQA 1P2BA 4K5QA 3GJ7A 4G23A 1WULS 2UXCB 2PH1A 3SD7A 1K7EB 3L7CA 3OIVA 4GR5A 4B6SA 2O8CA 1JB9A 2AX3A 2YC4C 4MP6A 2ZRDA 1MENA 1YZQA 4UXIA 5A1TA 1TZCA 4R8SA 1UXHA 4M8IA 1AT1A 4MAAA 2DCMA 4MI6A 3ZWBA 3LFTA 4W6ZA 4FXPA 4ZVOA 5JSZA 1F7UA 4KRFA 4ZODA 4QUHA 3FVQA 1XJWA 3HP4A 4KK3A 1F8YA 1TQ8A 1PT8A 2JLUA 4UD6A 1HV8A 4BL5A 5F3RA 5D5QA 4RE5A 3UT6A 5FOSA 3FNHA 3OX4A 1FYVA 4QQNA 4UM9B 1WZNA 2VZ0A 3BREA 2CXSA 1DO2A 2GGSA 4Y1GA 3NNSA 1X77A 4YRNA 3E48A 4R8MA 4P38A 4C03A 2B4RO 3NG1A 5AJYA 5C5EA 1QFXA 1LLUA 2ZZNA 3TKYA 4BIIA 5H3LA 1SUDA 5CM2Z 1AHIA 2PNJA 4FFDA 3TXYA 4RVOA 4EZEA 3BWMA 3KTFA 3L79A 3LZ6A 3PA8A 5HS6A 4UHCA 8GPBA 1U2RA 1BS2A 1Q5PA 1GDHA 2J4DA 2WJJA 3EOZA 4J9UE 3VVLA 1QNFA 4BLWA 4CV0A 1XRRA 3S8YA 4EMTA 1Z0KA 5K0CA 4HYEA 5M2QA 2YOGA 3MRVA 3LT5A 4HL6A 1JZTA 3LYUA 4EF6A 2AQKA 3AF2A 1XQ1A 2WHXA 5IC5A 1TECE 5CIQA 4C7OA 1CSEE 1LI4A 2CNKA 2C3MA 3BDIA 4G41A 1M5TA 5JY1A 1ODFA 1VA4A 4S35A 1E2MA 3Q2OA 4K9LA 1QYIA 5AK5A 1UC9A 1Z3CA 4G5OA 4QUDA 2JDID 5GZ3A 2O3TA 4GMKA 1J6UA 2HBYA 1W46A 2C7VA 1SU6A 4Y1RB 4B34A 3NUQA 3LMKA 4O2AF 4TN1A 5IDYA 2ZUUA 4MLZA 3FTFA 3GI1A 5KYYB 3LUPA 2ZXEA 2JEOA 1J9EA 3WP1B 4EYEA 3T1OA 4KFUA 4BCBA 2H11A 3PNKA 2G4VA 4Q37A 5CA0F 7ABPA 2CXXA 4BO2A 2ZUEA 3N3AC 1R9MA 2R8PA 2YR0A 4EL0A 4Z2AA 4WASA 3IOYA 3JQ7B 1Z15A 3S2FA 4BKUA 3IMEA 4LJKA 5JLJA 2QMQA 4LOAA 1ZKDA 4AZ3B 2OC9A 2OHOA 3DBRA 4UUAA 4XDGA 3ZQJA 2EATA 5FXMA 3MTJA 1YQEA 3G0CA 1ZSYA 1FVXA 2JL1A 2ZJOA 2XI4A 4KLNA 4PGHA 3QU2A 5CW1A 4YQZA 3NRBA 3KWLA 1XYGA 2VQDA 1NATA 4PXSA 2J46A 1W4CA 2Q3FA 1EESA 4O3MA 5D6OA 5AWFC 3S8EA 4DQXA 5F23A 2JVKA 3ZW9A 4DLYA 2W98A 5A3VA 3R0IA 2QGZA 4FR2A 3T9CA 3OSUA 2FPIB 3AK4A 2YV4A 3HV0A 3KEGA 2VP5A 1IONA 1WXWA 3DAYA 3WGJA 1T8PA 1KY5A 2YWRA 1ZO8A 1JIVA 3I5YA 1TU0A 4YJ3B 4IXMA 4MV6A 5D1NA 4AURA 1DS6A 3HWWA 1D2EA 2G67A 4DLSA 3ZDBA 1X7ZA 3ZDXB 5EXTA 3PG5A 4J6FA 3WOHA 1I36A 4FYVA 3AUFA 4CKBB 3GP5A 3M4YA 4BTEA 4G0UA 3KOZA 2OLJA 1VJTA 3CO0S 1JVSA 3M6MD 2O1EA 1KSJA 5JG7A 3TE7A 3L8FA 2XWBF 3C3WA 4Q1CA 4CLOA 1E9AA 1B0PA 1P3Y1 4WZZA 3UBTA 1U0TA 2B3DA 2EQBA 5H4GA 4K8RB 2GKOA 1VKZA 2DKFA 1G0OA 3EVZA 5JZ9A 2OAEA 3RVNA 3LW7A 1JVNA 4XYGA 4BB0A 2X0RA 2Y99A 1X6VA 1LPAB 1SOAA 1V5FA 4E5PA 5SY6A 4OMFG 5LMZA 1RCUA 3U31A 1OGJA 1I3OA 4LJLA 2Q3LA 4MKIA 4TUYF 5REQB 5FNVF 5BV7A 2P2NA 2RB4A 2SECE 4OQQA 4U3JA 4IZ6A 2R47A 5JEEA 1RWPA 1UR5A 3NM6B 3IESA 4N7MA 4PIMA 4AMZA 4OHWA 1ZD2P 1DAGA 2I66A 4RMNA 4EX7A 1VLJA 1DC8A 2GKGA 2ZUCA 1RT9A 2D7JA 1NW3A 3Q15C 3ZQ4A 3H6GA 4H59A 1L5LA 1GZHB 1XL1A 4PGFA 2ZT6A 2GBCA 3ORQA 1M2VB 4RDXA 1TM2A 2Q2OA 2V74B 2AG1A 1LGYA 4O2BB 5F7XA 4F4JA 3ZWKA 4FZJA 1C30A 2P2ZA 2JKZA 4FSDA 3JD4A 3JQ9A 4R4JA 2C95A 1AVTA 4I50A 1KJQA 3PT9A 2H7XA 5J47A 1N2BA 1MD9A 2P7IA 1I94B 1B6GA 4IDEA 1YQ9A 1QF7A 1UAGA 3PUHA 1IJFA 4DG8A 4RFLA 2E89A 1OLSA 3GEDA 4HKTA 4QU0A 4BP3A 2RI6A 4UDYX 4N47A 2FUKA 1TADA 2X1MA 3GG2A 2AC7A 4YVFA 4DSZA 1Z0JA 1L8QA 1JPUA 4ODIA 2HQOA 1JUDA 1Q1BA 3EIXA 2LWIA 1BIFA 2H2IA 4KE6A 1KSHA 3WB2A 5KVQA 1JXAA 5AW8A 2CZQA 2ZYGA 2AYXA 2X0EA 1WHSA 3O74A 2C59A 5DYYA 5IBPA 4I1PA 1TK2A 2OHJA 3KCNA 2ZEJA 2NG1A 3KJNA 4COOA 3AVUA 1LK7A 4BHTA 3KT3A 3P9YA 2XW6A 4YJHB 5I45A 1IBLB 3QUAA 4OQLA 2R97A 3GBVA 1SOMA 2QRQA 4WAUA 3W6OA 4YUZA 2IH4A 1QE5A 2YFHA 1OF1A 3TZ6A 3WLKX 1M10A 5SZHB 2W71A 3DOHA 4TVOA 4JJZA 2BBSA 2VWHA 3FLMA 3IPCA 4PY2A 4D0RA 5EJ6A 4WESA 4IRUB 1IK4A 2V7QD 3AGPA 5CVUA 1VZ3A 2RIRA 3D1VA 3FNBA 4OM7A 4BVGA 3U4GA 4Q1DA 5LZ4A 2ZBRA 4BZZA 1TTHA 1XQVA 1FLNA 1XALA 3DFIA 3HJTA 5AKLA 2JA1A 2V5VA 2B37A 2BF7A 1USGA 4BN5A 3T8YA 3WJ2A 3HXLA 4JENA 4UNPA 4GYWA 1E4EA 1AQ6A 3A27A 2R1ZA 2CDCA 3HQ4O 2Q9UA 1YASA 4TXMA 1ZVQA 1JB1A 4I2NA 4QODA 3V00A 4AQDA 3EC7A 1SQGA 4L5YA 1LDMA 2EZ4A 1Z4PX 2WUWE 1EM6A 1IAQA 1RCTE 3CJQA 4CIYA 2CSUA 2XF2A 1JG1A 3MTGA 5HTKA 3V7UA 3UJ7A 1NVVQ 3E9EA 5D5PA 3S2GA 1JHAA 3MXTA 4C04A 5B3JA 1O9HA 1R37A 3QW4B 2ZYRA 1HGXA 4BFYA 3H65A 4V38A 2DZDA 2EIHA 2EGHA 3ANTA 4MS3A 2C8LA 1GP2A 5C37A 1BE6A 2ZRQA 5SYNA 4EY6A 4UTOA 1JXMA 3BS4A 4K05A 1RHKA 1Q0SA 3GUVA 5TQVA 1KAQA 3AWIA 4PN3A 1XGKA 4U7GA 1GADO 1TA9A 3A4YA 1Z7BA 2C83A 5IXJA 5ELMA 1AIPA 3B6JA 1E59A 2PKYX 1P4RA 4FBGA 4KXMA 1B26A 3JAWB 4YRJA 4AU1A 3ZDCA 2FH5B 3GLIE 4E3WA 1UDCA 5F5LA 1I6KA 3GPIA 1MHTA 1QIFA 4XB6B 1MEOA 1QGUA 2QENA 2PKXA 4FX5A 3VBEA 4M87A 5G40A 5AM2A 4YI3A 3PDWA 4AG3A 1DJOA 1FS4A 4WMLA 3D4PA 3FRHA 2DFDA 2XKBA 3IUEA 4XLLA 5DYWA 3KR9A 2VDWB 3RNLA 2CUKA 2O2YA 3PR2B 1D5CA 2C54A 2C4NA 2J3LA 3NX4A 2X8JB 3PI6A 1TO6A 2PL9A 3DL7A 2GK3A 2P11A 1DG3A 2ABWA 5ENVA 4HAYA 5F2KA 4EKIA 1KP9A 2XY4A 3I1JA 4BQSA 4QYXA 4ECAA 4NNJA 4IX1A 3OZGA 1YE3A 1SIWA 4JS0A 2BMDA 4EYKA 1D1QA 3FVTA 3NEPX 3O4HA 5IYZA 1AQNA 2VHWA 3ZU5A 2E4XA 5BV8A 2XECA 4ZAVA 4MPRA 1YL6A 4DCCA 1YQUA 1TAHA 4L75A 2GAAA 2J67A 1PS0A 3FWPA 3QBDA 3OCUA 4QGFA 1U8XX 3ZVRA 4MCHA 1SMKA 3HADA 1G7RA 4WBSA 2ZG6A 3W2EA 4ENQA 4KTVE 1U3DA 1D9ZA 3AF5A 1XPRA 2HFJA 1NR5A 4Q3KA 3A1TA 4EY4A 3GRPA 2OGSA 3NYWA 4BY9E 3FCYA 3H5TA 1NX6A 5FUWA 4YAIA 1B6TA 3RAJA 3IV6A 3EY4A 4XUCA 4TTQA 2CUZA 3LX6A 3THWB 2IYEA 1HEYA 3LPAA 2VH1A 3GMDA 5KINB 4ITUA 1QR2A 2FR0A 2YFKA 3HXKA 1EJ0A 3LBFA 2G06A 3BSSA 2CLEB 4CMKA 1WSDA 5LP1A 1XZNA 1V0JA 4LX0A 4CLEA 2L0XA 3VV2A 1KAEA 3HI4A 4RMGA 4CF5A 1KVRA 5TQ2A 4DIEA 4OFZA 3PHLA 3R3HA 2QMUA 1VECA 2QU7A 3EQ2A 1Z45A 4WGFA 3SN6A 1KAOA 4Q9LA 3TDMA 4LDJA 4E1BA 2GA8A 3G2QA 3AR6A 1TUBA 5K3SA 3SJUA 1ZL0A 2QW1A 3I9NA 3WA7A 4FGZA 2K87A 3LCCA 1I4OA 4GL2A 2I76A 3W2FA 3UKJA 4Q3BA 3WRYA 5BOSA 3CJRA 4BQOA 4BEJA 3EIEA 1D0SA 2I55A 3I9FA 3ZBPA 1DJLA 4HQKA 1G9SA 1GNQA 3C1AA 2VLIA 4JLWA 4XQGA 4F84A 1ZK3A 3P9RA 2I67A 1ZS9A 2SKCA 4HXEB 2A9VA 3MWGA 5DRYA 2CWWA 1T2FA 3HB9A 4RL4A 4LEIA 2FPMA 4M7RA 3E1GA 5B2ZA 4EQ6B 5JZVA 2RCNA 3ICVA 4P3KA 3C4VA 5HXAA 1Q22A 2IPLA 2C2GA 2Y9PB 3OX3A 3MJRA 4YRCA 3SX4A 4A10A 5AVRA 4M7OA 2AW3A 5JPDA 1V16B 3E4CA 2P9QA 4OV6B 2BGKA 1AG9A 1NJGA 3D3KA 4QU8A 3OBIA 1BCSA 4OQYA 4I08A 1SELA 4NOKA 5F12A 2XYQA 3B8EA 1TX4B 1Q20A 2QUHA 3CRW1 4HYYA 2HMUA 3EVDA 4QOHA 4ESEA 1L7OA 1N5KA 2VT2A 4X00A 3VKGA 5EQTA 2O0LA 2QLTA 3QF4A 4RY2A 3KEOA 1D2NA 1T25A 3HO6A 1NWHA 3SG0A 3V1UA 4JT2A 3V4VB 4PLPA 2G1AA 1CP2A 2WVJA 4F9TA 4K81B 4RZUA 3L8YA 1CU1A 3F1LA 5TY0A 3VXKA 4B7CA 1IXSB 2WC1A 4UAGA 4R9VA 3MWDA 1T2CA 4KITB 1TGYA 3OE7D 5CNKA 3T0IA 3ML1A 1M83A 3MCVA 2Y4NA 3LI2A 3T7DA 4CCAA 1T9GR 1XDBA 4MP8A 2JG3A 2QYTA 4HB3A 1JG7A 1C8KA 1M0WA 1BMDA 3VGJA 3BGIA 4MR8A 2DLDA 4TUYA 4KPYA 1U2SA 4QOSA 3QJ5A 1UINA 8MHTA 3BK7A 1Z4NA 2CNNA 1ZN8A 3BORA 2PNFA 2PS0A 2W58A 4JWKA 3STVA 3TW0A 3W3AA 5A4FS 5A71A 3BA6A 4FDUA 2HNKA 1HT2E 4FGJA 1DDOA 1PG0A 3VAYA 2XAAA 3FYUC 3GCWA 3FNQA 3VPHA 4GLFA 3KZXA 4KXWA 4EKDA 4U1RA 3ESYA 2I6TA 1SKBA 4BTVA 2FW8A 4WINA 4RXMA 3KHTA 4JBXA 1JAZA 2FZEA 1GEEA 1W0KD 2PUJA 3G88A 3ILXA 1Z13A 4BKRA 1MQAA 1YOBA 3UAZA 3BF8A 3UFXA 4JFAA 1BXGB 3IP8A 1M34E 2NZ2A 1YJ5A 4AP9A 2ADMA 1X7YB 2PZBA 1J0DA 4U39A 1PSDA 2GEJA 1T0IA 5K0LA 1AD2A 1EUDA 2A0FA 2FFQA 2ZK7A 1DEKA 1Q6YA 3H9UA 4X8OA 2AOTA 3ZHZA 2O2SA 5IM4F 5L6LB 4ZQEA 1DC3A 1UM9A 1L5HB 2E3JA 3ABQB 3JVVA 2P75A 4L5IA 5HJ2A 5BUCA 4YMLA 2BBTA 4JI2B 1YVEI 3CIFA 3S2EA 3Q3VA 1M67A 2HUNA 1C81A 3MT8A 4RQUA 4LRXA 2QUZA 1SVMA 2YWJA 4PTYA 4R98A 1AN0A 1SG9A 2DHCA 2HA4A 4WUTA 3TM4A 2D6FA 4KR9A 1ADJA 2R2AA 1O03A 1XNHA 3FUTA 1VBNA 3DONA 2O20A 2I2DA 1XMIA 2CBZA 3D3WB 4H18A 4HC4A 4X8MA 3RREA 5AOVA 3SKYA 1R4AA 1TMYA 3QVGA 3WMXA 3ZCXA 4IDFA 1RI5A 1WXQA 1E9BA 3MTQA 3T1NA 1P6XA 3GRYA 4G1VA 4A0QA 4CV1A 3TOSA 4OHXA 4M1OA 4KUEA 2CNDA 4GYJA 3IPRA 2RGCA 2BEJA 4R8RA 1MJGA 5AHKA 3TNDA 2OECA 3QV2A 3X1KA 4PN7A 5AD1A 4HXYA 4XYBA 4YROA 1LX7A 4EECA 4GC5A 3TX6A 4B71A 4FR5A 5LU8A 4OLHA 2EFHB 5A2QA 4F9GA 4HEJA 4NXNB 4PSAA 5B12A 1G2IA 2W2QA 3SYKA 2YOHA 2OWEA 3GLRA 3HYSA 1JVBA 1CKEA 3LHKA 4IM7A 4OGKA 4WNAA 4YAUA 1EI9A 2C61A 2ATIA 4NIMA 1MO2A 2IOFA 3UIEA 3I6IA 3NW9A 2WRZA 1KEWA 4JL5A 5BUZA 1K92A 4WCDA 1DZ3A 2BHTA 4W8OA 3EA0A 1YOVA 1NM5A 1YB2A 4X7RA 4G89A 3ZZ0A 1G4UR 2CXPA 4P54A 3P0FA 2IZZA 4TXJA 3WFIA 4HN2A 4N0EA 4RTMA 4DLUA 3AHGA 2XNDD 4PSUA 3DKVA 3TTSA 1D04A 1SHJA 2HCBA 2YJ4A 3HDTA 4JGBA 4NV3A 5KNCA 3BMQB 3OE4A 1JDZA 2P4SA 5HEKA 1EGVB 1Z5VA 2NO6A 3QUBA 4Q7EA 4PF1A 4QTYA 5AVZA 1NVUQ 1ZICA 3VJMA 3RYCA 1X9IA 1XZPA 5EKXA 1XCBA 1Y6GA 3GJ8A 1MB4A 3RVKA 1NU6A 1Q0UA 3HVJA 3R5HA 1IE3A 1MO6A 4MMXB 4QELA 4YMHA 4P3OA 3KQTA 1BEEA 3UA4A 4B3SB 4WZBB 3K31A 1VLVA 3GYGA 1Q1NA 3ZLJA 4H7DA 2CYCA 3GEIA 5G02A 2YY6A 3EGXB 3MJCA 5JROA 4R51A 4LBYA 2FKNA 1R8XA 1Z83A 2R5NA 3JQFC 2K2WA 4H60A 2D3TA 4EB3A 4FUTA 1QRRA 3WLNA 1V25A 1A9RA 2IT1A 4OGGA 1P3JA 2LIVA 4TVKA 4M9XA 5JNLA 1V4VA 4X8HA 3U4IA 1KRXA 2O8VA 1U3GA 2D1YA 1CW2B 5JVDA 3DV9A 5D00A 4FFVA 3BMOA 4DL9A 2R6CA 2AFHB 5HFNA 4C4SA 1F2UA 1PLLA 3KQNA 3DXYA 3JYPA 4GI2A 3AP3A 3VZQA 1T5DX 1USKA 3B82A 9ABPA 4NK4A 3CMMA 1IQUA 5H7XA 3CW2A 3BF7A 4Q02A 1BOFA 2ZRCA 3GELA 4DZZA 3QLEA 4UU7A 3LX8A 1NVTA 3GK3A 1D0IA 1JEDA 2WM3A 1I4LD 4DNFA 1QM5A 4AUEA 1R2QA 2HBZA 4EW6A 1OV4A 4ZU6X 1P18A 2ZXFA 1HQKA 1E63A 3K4QA 1SXJC 5IKOA 4XPIB 3P1JA 3B1YA 5EUQB 2WHPA 1G6Q1 2C03A 4MGIR 2BFWA 3I0MA 3W7AA 4XJXA 1TUIA 1SUAA 3R09A 1QC5B 2RFLA 1TEXA 3ESBA 2X0FA 1SWWA 1MN6A 1AKWA 2Y92A 5CA1A 5JNSA 3TQOA 4X6YA 3ELWA 3ADOA 3RK4A 2Q5LA 1MNAA 4PNHA 2Z3ZA 5H16A 2VQFB 3RRNA 3VUEA 4WLOA 5I8ZA 1TAUA 3B5IA 2NYRA 4PAWA 4YASA 4F2GA 2X9GA 3LH5A 3PR3A 2NZWA 4NMLA 4ZPXA 3GGOA 3WYBA 1VHTA 2R79A 2QD4A 3LO5A 4PCAA 4YDRA 2HREA 5TT0A 2X40A 4JI0B 2LKDA 1EQAA 1RBYA 3GEGA 3GFOA 2V8OA 1A5AB 5EZ6B 4BTLA 4L7QA 4OAPA 1GNSA 4A92A 1GD1O 3F49S 4M1YA 4ACBA 2CLMB 4BNNA 4IPTA 3MT0A 5FCDA 1DC7A 3FPHA 3MCAA 4RK0A 3RIGA 2FFBA 3SS8A 1P19A 3QVUA 3AG5A 1LPNA 2TRSB 4HLUA 3O4VA 2LXNA 4WCFA 1T1RA 1Z56C 3LBAA 1E1QD 4IMJB 1DKOA 5BSWA 3JV7A 4W5QA 3N6VA 2OP1A 3HMKA 4XD7D 2R1UA 2EJUA 4BRSA 2YQ5A 1RXYA 1N2XA 4DJTA 4G81A 1ZKMA 2RHOA 4RAOA 4EGJA 5GVSA 2JGDB 1XHLA 3EF3A 3I4LA 2WILA 1OKKD 4IHKA 3SPXA 1P91A 4HDOB 1E1RD 3PIRA 5FV4A 3LWZA 4YRIA 3FM9A 1I80A 1JILA 4NU8X 1QG4A 3ORHA 1AMNA 3BRWD 2HNBA 3WLJA 3DMPA 2ZAMA 3N0TA 2X4DA 4JVSB 2E49A 1A4RA 3CBGA 2GASA 1AM4D 1GQYA 4U2EA 3WRYC 1XC7A 2IDZA 4XR4A 3IAXA 4LVUA 2R6ZA 4UNNA 3A0RB 1CWUA 4XD7A 3D1LA 4PO1A 2PKEA 3E9DA 1GSHA 2EP5A 2QMOA 3KOMA 5BP7A 2RK3A 4IMIB 4TLAA 1E2BA 1XSEA 2OOSA 3T7JA 1OB2A 4B09A 1HMYA 3OKPA 3CR7A 4EY7A 2V4MA 4GSYA 4LRWA 3HZRA 5AKJA 4CEHB 4CNBA 2VLBA 3ETNA 2D5IA 2R66A 5JS7A 4TLMB 1UAAA 4Y6PA 1DQNA 4MVJE 3OJOA 2YZ2A 2GMWA 3WICA 4CM4B 3OLQA 2VSFA 4I36A 4FKBA 3RQIA 3MW8A 1WB5A 4WE3A 5HS4A 1YR2A 5JI3E 4WKGA 1ML3A 1Z17A 4IIYA 4RY0A 3T3HA 1GNTA 2IHNA 4ZQIA 3QEAZ 2IL1A 3IUBA 1AKMA 3FYCA 3PC6A 4LWOA 1YK0A 4JBHA 3ZNPA 1SQSA 1T0PA 4PZAA 2EC5A 4DCSA 1AA6A 4GHWA 4TLDA 4QNMA 1YV9A 1IM2A 1S02A 3USES 3I05A 4PQRA 1TNDA 3VYSB 3AOGA 3IVGA 2P7HA 4REMA 4UOZA 4I1VA 4B73A 1R15A 1ECLA 4WBNF 4W5OA 3P9XA 2EHJA 1YJBA 3L6DA 3IHLA 1R8YA 4DV7B 4R05A 2RGEA 4BFUA 4EG6A 4B7AA 1VHWA 4EEZA 2ZAOA 4EVRA 1EINA 1RWMA 3U7IA 3DTVD 2FMKA 2WF5A 1G55A 3UC9A 6AT1A 1N6OA 1N1GA 2P5YA 3FPCA 2Y1LA 5H82A 2IW1A 1EEHA 1OSNA 2E5WA 2OCIA 3D9QX 4L9SA 1S6YA 5AVVA 3P2OA 3Q72A 2OE2A 4IJ6A 5DN9A 2ATVA 3RWOA 3KSRA 1KO4A 3OY2A 4P7BA 1NQAO 3IHTA 4FIZA 4AECA 1YB7A 5CIWA 4JVNA 5JMOA 1LLCA 3ZEAA 1JH8A 3IULA 5JXGA 3E2IA 3MTDA 1F2VA 2GNOA 2WKWA 3PX3A 3T7CA 3U17A 2ST1A 2CYAA 2E2WA 2COKA 2QL9A 1HQDA 3BGWA 4URXR 4BKOA 4EKYA 4XTCS 1FQJA 1T8TA 1UEJA 3LKBA 1M7BA 1L1EA 2ZETA 4MCIA 3QMWA 3QNUA 1YS7A 2MSWA 1N6IA 1I3LA 1I9CA 2A0XA 1I2ZA 2PSEA 3P2JA 3Q41A 4EYGA 1VJGA 4QULA 5AKHA 1WZUA 5DNCA 2DBYA 2IRWA 5IH7A 1JI0A 5EPOA 4CHGA 5KVVA 2IYAA 1Z29A 2A57A 3NKLA 3E70C 2VF7A 1E58A 2BYTA 1Y3DE 1BJRE 3S55A 1H3EA 4B7XA 4WLUA 2W42A 1K7SN 4N7BA 1NYTA 2RJNA 5C53B 2GAFA 1TQHA 2H1CA 3RYIA 3SX0A 4BRWA 3RHSA 3ZU2A 5JHHB 1PR1A 1QP4A 5F2EA 1UQTA 1NFFA 1T3HA 2FCAA 4RKEA 1KQNA 2WQZA 3NCHA 1GPJA 3U3OA 2O8DA 1V6AA 3ILSA 4ETWA 4BJ3A 2H48A 2O5VA 2H31A 3UBMA 4B76A 5AOCA 4PWYA 3ADKA 4ZO9A 2DPYA 2ZCVA 3G68A 1L3CA 4PXYA 3O4IA 4B3RB 2C20A 2QGFA 3F5MA 1EK6A 2EP7A 2VP4A 3A1NA 4X97A 3EYAA 3A4IA 5DBHX 5F1YA 3WLOA 5IC4A 1GPAA 2IVFA 3BCRA 2WU3A 3CKMA 1A50B 2ID7A 1VSVA 2ZZKA 3SYRA 1IRIA 4PU0A 2IPXA 2JCXA 1KDZA 1YKFA 1Y5LA 3FMIA 5DGDA 5JFGA 4XLTA 2L82A 2QMYA 3HR7A 4Y2PA 3IFSA 3CWZA 1R6VA 3SM3A 5EZSA 3U80A 1TEHA 5EZYB 5ERXA 1VKOA 1CNEA 1KQOA 3LY7A 1U2DA 4XRRA 2IEZA 3BH6A 3BRQA 2M6LA 5A3JA 2B4AA 4UTXA 2XOXA 3B20A 1T1JA 2RGUA 3HU5A 8ATCA 2H2HA 2QRUA 2PR7A 1NQXA 4I8IA 3RTCA 4F11A 3OIGA 4HNQA 3RYCB 2FPKA 1QAOA 1DBQA 3PFFA 2C2HA 3IYLW 3QYJA 3ODGA 1C9DB 3H4IA 1C4KA 2IGBA 5H9VA 4G0WA 4BZWA 3ESAA 3WK5A 1CJBA 1GZ7A 1RI4A 3BILA 3N1UA 5ERYA 4HDKA 5CA0A 2WMNB 4WX2B 3REGA 2FMHA 1R9GA 4I1SA 3FPFA 4OOEA 4BBZA 4BVHA 2GLXA 3CSDA 4INOA 1E2PA 1U2EA 2G9NA 1OASA 2XQGA 3LQKA 4KUGA 2MMCA 2NACA 4LWZA 3ONWA 3SR4A 4C76A 3BQ9A 4RQTA 3EEFA 1P2FA 3E2MA 2YWFA 3N05A 4KQKA 4GFDA 5ARCA 1GTVA 3DPSA 4YPOA 1YJCA 1K6XA 3GLHA 4Q4AB 2F43A 4M38A 2FV8A 1Z0FA 4J6EA 2EX4A 2EX1A 3JD2A 4LZZA 5HILA 3RU3A 3TQTA 2ZBVA 3CLUC 2F62A 4KKVA 4MW0A 3X3HA 4B85A 1KC3A 2VF4X 3F1KA 3WJ7A 5HP4A 4AJNA 5EMMA 3DHYA 4IOJA 4XAQA 4HZUA 3UH1A 1K5GA 1TL7C 5DYIA 3EFHA 3LQYA 5ARDA 3AI7A 1XO1A 3I30X 3FAZA 3CURA 3Q40A 4BB6A 4BEVA 1QTNA 1SCUB 4Z5XA 4GI1A 3GEHA 1T9KA 5DM60 1FQOA 3E9CA 4EEXA 1RWVA 1T6BY 4ENUA 5ILGA 2D8AA 4OJQA 3WAKA 2OCAA 1RLMA 4KX5A 3ZCTA 4P36A 4A8JC 2OP0A 1ZM4A 2VP6A 4N82A 3WJAA 3STWA 2F3RA 3LQ4A 2QJOA 1JTVA 3EXFB 5JWOA 2XBMA 4GRIA 1SD2A 4KGVA 3R0QA 5CD9A 2QUBA 2NUTA 1H2BA 3ETHA 1ESDA 3AEUB 3WGIA 3FZNA 2E7ZA 3ZXXA 4I4LA 3KUUA 2X9NA 3BQNB 1XYYA 1GFIA 4GKAA 2NM0A 3ZKWA 4DM4A 4IEIA 5J2UA 2OFFA 3JATB 5ICGA 4NARA 2WJ4A 2H1HA 4BASA 1PQ4A 2W2MA 4WERA 2WOJA 1FMFA 3HBNA 3UUFA 2HV9A 2ZYWX 3H4VA 1IQPA 1CR2A 1SQ6A 2DPHA 2DQSA 1Q7GA 2UYQA 3COZA 3HDJA 5ALYA 2YKGA 4GPIB 3LUCA 2O8CB 1TM7E 5A1JA 4NE2A 3JQ9C 3K9GA 3BHIA 4O2BA 2JIDA 3MS2A 2G08A 2Q3BA 5FD8A 5ICCA 5LUBA 1YS1X 2WZBA 3AM3A 4D3XA 5EJAA 4EITA 5LMUB 2FGKA 2XQKA 4EGQA 4I8DA 2QQ5A 5ALHA 4TQUS 5CDHA 1IK6A 1PTKA 3WSTA 4BO6A 4G2TA 1Y9JA 1EWQA 4YT2A 5IMSA 1KMQA 2A92A 4N48A 4RETA 2AOVA 1EHCA 3LAWA 5BQPA 1KI9A 2XCRB 1E0KA 1LQTA 2AQHA 2YHSA 1RXSA 3L46A 5L3QA 1M2HA 4OB8A 2H1IA 5CDSA 1EHYA 4R6XA 1H9CA 2AEEA 2REBA 2VQ3A 1PWHA 4IAOA 1HLDA 1R18A 3R3SA 4R1LA 3PQEA 3R7LA 1YAJA 1BZYA 3RBAA 5TQJA 3TE6A 3MT9A 2C07A 1RXVA 5MFZA 3EXAA 3INTA 2G1PA 1P33A 2PT6A 4MVJI 4E09A 3GPLA 1NJFA 4PZLA 1J39A 1XAIA 2ACVA 4C7KA 4PFKA 1U81A 3RJ9A 3L92A 4FDVA 3IBTA 5CT6A 4ZI7F 5CX1B 1N5LA 2YIJA 1TM1E 2P0AA 4CIAA 2IU3A 2IEYA 1H2EA 3DYVA 5E4JA 3O4RA 3PQ3A 3H2ZA 1N4DA 5HBGA 5BOVA 3LRXA 3SNKA 4P2GA 5CJPA 1QIEA 3UJ6A 1RKQA 3EUWA 4K6CA 3KTAA 1GQOA 2OQVA 1U0EA 1JF8A 1ZA2A 2IS1A 4P3PA 3FPAA 1E5DA 3LQ1A 4GX5A 1T2DA 3ZCUA 4B3TB 2JD2A 4FONA 2X2OA 4IH4A 4N7RA 4WOKA 1TU3A 1FDTA 2IDJA 4O2RA 2D7DA 4OLBA 2Q3MA 3K6SB 5J2UF 4U6SA 4ZRMA 3T99A 5FTWA 3Q2KA 3UAGA 4YRZA 5DSZA 1K4YA 1JT9A 1V96A 3I6QA 4XH9B 3NAZA 3G6KA 4DA8A 4AG5A 1PD1A 2QB5A 4F3TA 4JEUA 4WVFA 4QEDA 4FB4A 1NW7A 2R6GA 4FMCF 4YCNA 2DR3A 3EWIA 1P0MA 1YZ3A 1JT2A 4J0EA 4NH4A 4TVSA 2I6FA 4PRYA 4OHKA 4WJLA 4QTZA 3G8BA 1QYCA 5LPNA 4AZSA 4K0RA 4I99A 4UAVA 5BW8A 1C9MA 4G84A 3K53A 2IZ7A 2OVBA 3S2ZA 5ICSA 2H2GA 4G0OA 5HRCA 4I1OA 4PLTA 1GYPA 3DL2A 4R2WA 3QVMA 1RXUA 1WW2A 4JLOA 5K6AA 1MO5A 1U7ZA 4UU1A 1LW6E 1NULA 4TM8A 3R7SA 3REOA 1FNMA 2QY6A 1UPCA 1ZD4A 2MSDB 3HFJA 1ZGAA 3HYCA 3IXQA 3L0DA 1EVQA 1S2OA 3SZ3A 3MMZA 4JEIA 1P81A 3MJTA 4WKOA 4M2LA 4MPDA 1IHOA 1XYVA 3DDZX 3DHVA 3OAAA 1JBKA 2OFOA 5K20A 1UBMS 4TWZA 2VNAA 4OPMA 4GMDA 4MS4B 4NYIQ 2B5WA 3GLSA 3KC2A 3UJHA 3YASA 4DJEC 3TEFA 3CZPA 5B1EA 5FEMA 4E15A 3THYB 2VDWA 1TCUA 3I01M 4I9UA 4LX8A 5C8YA 4MYHA 4N6NA 3RBXA 4DCNA 3AKDA 1Y8AA 3CX8A 3WDSA 4LTDA 2HPHA 1VPVA 1EDBA 2ODWA 2PV0A 5B1HA 3GWGA 1HYGA 2VP2A 3N74A 3U1BA 2PBLA 3HZHA 4EB6A 5BMOA 1QE3A 1LSUA 2BTOA 4FILA 4HUQA 4NVRA 3JZFA 2XOKA 3CPSA 4X0EA 4EVQA 1SIOA 4DHWA 1JP7A 2WM9B 2GOYA 4RD0A 8LDHA 5JAHA 1C7IA 1LNQA 1PBNA 4JJEA 4RCVA 1GDTA 2JI4A 3ZE0B 7ADHA 5B55A 3WLQA 2HPAA 3EZXA 3ZXUB 2C0CA 1N2GA 2WPDA 4K6MA 1IVYA 4HD8A 2WAYA 3SC3A 4BNZA 3MINA 4FGLA 3D8HA 2ZS8A 4HTFA 2QR5A 1DP4A 3HXQA 4NE9A 1U3VA 2BAGA 5FR1A 2CNWD 4LZPA 2OORC 3OKAA 1H65A 4KYVA 1XZIA 1P9OA 1ZK4A 4N3CA 4P6VF 5AJUA 1UDRA 2QSUA 4RKFA 4EBFA 2C2OA 1UK7A 2OD7A 4OF4A 3WMGA 3BXEA 2ZWVA 5AKKA 3RAGA 4CJXA 4EG0A 5JYEA 1SK8A 4Y9RA 3RS2A 4JNCA 1OFVA 4N01A 3WYDA 1P5FA 1J2JA 1H2YA 1FU7A 1V3UA 4G01B 3GT3A 4LJAA 1NRWA 3G49A 4ZOEA 3VR2D 5EIXA 3PJDA 1WLYA 3TXAA 4PZPA 1EA7A 3SNHA 3WGOA 5JNWA 4BU1A 4B3CA 2GJ9A 4QWMA 1NUUA 1BH2A 2FSIA 3A1DA 2C7PA 5IKMA 4ESOA 1HG0A 3GLKA 1B76A 1YRWA 1Z0ZA 1E5QA 2Y27A 3JD1A 3P9ZA 3Q3CA 4IG9A 2XXBA 2QLNA 5E38A 1HRKA 3HHEA 3M4ZA 3OTQA 1OZHA 4JIGA 2GPBA 2XYPA 2Q46A 4H7HA 4RUKA 3V6MA 4DAEA 4MROA 5JIBA 2JW5A 4ZT2A 5CCDA 4RJTA 4L72A 4PXAA 2JFOA 1LPBB 3JD3A 4H4CA 3O90A 1FCJA 1V1MB 3AFMA 2P3SA 1MABA 3SLKA 1IN6A 1JR3E 1WHSB 2QD2A 3S27A 3LLVA 1DKUA 3RV3A 4B0OA 5CD1A 4K9RA 1OC2A 1TT7A 1UOEA 1QLHA 1YI8A 2CLSA 2XMBA 1W5AA 3PICA 4LBZA 2QKYA 3DBOB 4PTLA 4OMUA 3WNQA 4CIXA 1QTRA 1II0A 5AM3A 1TYCA 2NVBA 3OIYA 2B4TO 1J9GA 2CWDA 3HNPA 4W1QA 1GJRA 1H2WA 5F9HA 3LD9A 1G9TA 3I5UA 2H8KA 4JL6A 3T0FA 3P5BA 4QLBA 2AT1A 1JG4A 1OW3B 1KP2A 1MH1A 1N5JA 2XB8A 4J16C 4AJJA 4ARZA 4WFIA 5ALIA 3TMKA 5F3DA 3RHTA 2FB9A 2CZGA 3AESA 2AJCA 1CUHA 3QLJA 4A5SA 3WKCA 2B8WA 2FMUA 1O9GA 1SCUA 4R8KA 4DN6A 1HH4A 4BUJA 2J9RA 4BEWA 2VPXA 5EJ5A 3F98A 1ZUWA 3HVUA 4J16A 5BN3B 4OKIA 1WHTB 4L8FA 1D7OA 5CEEA 3I34X 1V39A 4LHXA 1NBHA 1VMIA 1W59A 1TJ4A 2EWVA 4NTZA 1USVA 1I0IA 3FSEA 4QBTA 1L5NA 4X94A 4V0QA 2QSZA 1JIUA 1II8A 4H4DA 4QHSA 2PSHA 1OIWA 4AZ0A 1BGWA 1J42A 3TCXB 3UH0A 3RTGA 1LU9A 3KLPX 3R20A 3T5GA 3HDHA 3QIVA 4QSHA 2V6IA 1XWWA 2YXPX 3OPNA 2IU0A 3WYGA 2IHUA 1N7HA 4Q9IA 3AXTA 4BO9A 2V7WA 4OOFA 1N2OA 1KP3A 1UZLA 2AI2A 2XT0A 1GNVA 2PH7A 2PRJA 3IXLA 3MOGA 4JYZA 4IDCA 4FC6A 1REQA 1TVCA 2AEFA 1HC7A 4XDZA 1Z0IA 1RAAA 4Q00A 1BXZA 3KCQA 4QOFA 2JAUA 4PE5B 1E2NA 5SY9A 4EB8A 5HR5A 1MOSA 2C9DA 1GSIA 2I3DA 4KXNA 3ZOKA 2GSWA 4QDTA 4A7PA 4GOOD 4FINA 3VU1A 1UDAA 1XTIA 3C6XA 2JLZA 2X8WA 3C41J 3CKLA 3AF6A 1SHTX 1YQXA 4QVIA 1TJPB 1UMKA 4FU0A 3UMGA 1CUBA 1YR6A 4DMRA 1ZCBA 3L7OA 1VL6A 4HDCA 1DO0A 4BJ5A 3A6DA 4NF2A 3K5PA 4AI6A 1C9YA 1XK7A 1MRSA 2OORA 3B1WA 2RGDA 3L4SO 2C77A 2JZNA 2P5SA 1LK5A 1JX6A 1XTUA 4A2CA 2QIOA 2RGYA 1MMFB 2ZRIA 3LUAA 4GPZA 4HRAA 2JGRA 3O8OA 1UXGA 3BEOA 3HP7A 1Y7HA 1A5ZA 2D2FA 5IYZF 1GZ4A 3AT1A 3Q0TA 5CX4A 1Z3IX 4IIVA 3Q5GA 1JDNA 5TARA 2PXCA 2VJMB 4KAAA 3M5CA 4CM1A 4RIHA 4CKXA 3OEED 4FB5A 5BVGB 1GGKA 1BFKA 3KZKA 3NBUA 4XPZA 4OXQA 5ILOA 1WY7A 2HEGA 1SR8A 4L8WB 1BMFD 3NP7A 4LECA 4WBNB 4CL0A 3MUNA 2AB0A 4EENA 5FAKA 5HCNA 2BKEA 5U4XA 4V0MA 4W5RA 1O95D 1PGQA 1U99A 2ZRHA 3DC2A 1ISIA 1G38A 2AI1A 3A06A 1QZ3A 1VE5A 4KKXB 1C4XA 3I0ZA 4UHKA 4BNFA 3QG5A 4YJ3F 2AD5A 5DCWA 2YBEA 3H7IA 3RIMA 1OH5A 4O3FA 4DB4A 2Z6VA 3RLIA 1S8FA 2IOYA 2XGSA 3UHJA 3I01A 1S2IA 4YAEA 4KVGA 1DFGA 3OJLA 1IXKA 2MINB 4HEHA 5FTKA 4CEJA 1T10A 1M6NA 4CQMD 3DHWC 1MVOA 3KPWA 1R8QA 1H22A 1O95A 2VCYA 1NF9A 4GM0A 4BO1A 3ZS9A 5HZHA 2IH5A 1FW6A 2OD2A 1M2NA 4W8GA 1NGSA 1T1SA 3U9LA 2O8BB 2CE2X 1GNPA 4M0LA 2VK1A 2OVFA 5DHPA 4RVSA 1OI3A 1IOWA 2RG7A 3D7NA 2BKXA 4ZD6A 4C7JA 2Q3JA 4YNBA 1UQRA 4H1UA 5BY2A 3KQVA 3W9SA 1U9YA 1Y6JA 1E6EA 3ZWCA 1R0BA 2R5FA 2JIOA 3VPSA 3D7SA 2C1XA 1Z63A 1F51E 4FGUA 4WNAB 4CQLA 5J3JA 3WY9A 1TYZA 2C4HA 1G3IA 4P58A 1XKQA 1ZD8A 1A77A 2Z2XA 1JIJA 3BFXA 4U9HS 3VTFA 3ZUPA 5A4JA 3HEMA 4L1KA 4RNDB 3OZ7A 2VHTA 3A11A 1B73A 1UMBB 1R6DA 4MS3B 1VHLA 2BJWA 4NFLA 3PPYA 4BV8A 1SBHA 1VI5A 2PFGA 3ETJA 3ND5A 4J0GA 3AVXA 1A2BA 3PXAA 1QGDA 2YC2C 4D0GA 4TROA 4G5GA 4DDKA 3DZIA 1ZY2A 3KKNA 2AJLI 3PENA 3TKAA 4I55B 2FSGA 2C99A 2W2XA 3F5SA 3HCWA 4NULA 2HB6A 3BFKA 3VU0A 2WWHA 3HMQA 1TVKA 4UMFA 3S3TA 2BH9A 4HR7A 2C8VA 3I3OA 5K05A 1A9PA 4NCIA 4ZT5A 3VZPA 2KBFA 2X2EA 4ALKA 4YV2A 4BVJA 4MR7B 2QW0X 1NV9A 16PKA 1OPRA 3MT7A 1SUPA 3BK2A 3HB4X 3LP6A 2NZYA 4OIFA 5LQUA 5CDFA 1AGPA 1HI9A 1QMPA 1ZUHA 2EFJA 2HU7A 3CUKA 1Z8DA 3OOEA 3D5QA 3NHFA 3T9EA 2ZBQA 5HSGA 2MR6A 2D0OB 1V5WA 1Z22A 2QZZA 2ESRA 3GAMA 3TCNA 2GYYA 3H84A 4TLEA 2AOWA 2IPNA 1EDOA 2OXRA 1I10A 2DAPA 3KKKA 4GPTA 3ZHQA 4DIBA 1FA9A 4CMEA 4J7AA 4XSVA 1LDGA 2QNRA 5CRIA 2GD6A 1PGJA 3EARA 3QWIA 4BO0A 1LJLA 1ZISA 4ML3A 3HTXA 4P22A 3BWBA 3DF7A 3ELUA 3LWDA 4WZ6A 4XM1A 5KNCD 2RD2A 4Y98A 5FUVA 4ZP1A 3A7DA 3A6EA 1RYFA 2WIFA 2EU8A 2PZLA 3R2JA 4KIFA 4TYPA 5AUOB 5CFZA 2QN6A 3CZ4A 1G4AE 3MS7A 2QLJA 4F91B 4G2NA 4WCFB 3VR3A 2QA5A 4LJ9A 5FTJA 5C34B 4Q1FA 4NABA 2Q3EA 3M3PA 1C9EA 3SE7A 1V7PC 2V5UA 2Q28A 3ELBA 2ZWPA 4FFLA 4IUBS 4YP9A 1E96A 3LT0A 5BMVF 5A2GA 2WMDA 3HXOA 2VO1A 2IE8A 1B8UA 1QNLA 2COUA 2V7UA 4HGOA 2SICE 1VKHA 2QN3A 4QUAA 3RUAA 1KERA 5K8UA 2ICAA 3GCZA 1O0CA 5HRAA 2PLFA 4IQ4A 2RHWA 2G07A 4TWJA 1E92A 1L5YA 2P6NA 3L0ZA 4MNTA 3F8TA 4R2KA 1C1HA 3T3EA 3ERCA 1EUZA 4I46A 3S1LA 1DQYA 1T6NA 3KDAA 1RWQA 4MRSA 4BNIA 3AHFA 3ICCA 3PEYA 4ZEXA 3OIUA 4OBWA 5CCBA 1BYUA 1ZJYA 3C45A 4WY2A 3UJDA 2H59A 4A8JA 4EGAA 2Q3CA 4B8YA 4CMIB 1OX4A 5I7EA 2C5BA 1JQDA 1D4AA 4CV3A 1NVAA 2I4OA 3SJ7A 1DJPA 1UIRA 2O06A 3FYTA 4GX1A 1R6TA 3W79A 3GJRA 1GN9A 2D0PB 4UDNA 5FPTA 3L9WA 3L5OA 3CNNA 1QB8A 4BVLA 1RYBA 5HJ7A 1ECBA 1ZRNA 3K30A 5G1NA 2PSDA 3IODA 4W8HA 2F2TA 3AY6A 5IJ0A 5B2FA 1KNXA 4YK7A 5EWLA 2DWQA 3DV0A 1VLZA 3OWOA 1DFIA 1U28C 3G2JA 3SS7X 2JFXA 2R6AA 3KXIA 3T9AA 3NANA 1E7QA 1RXCA 2FUG1 3GFRA