1V5IA

Crystal structure of serine protease inhibitor poia1 in complex with subtilisin bpn'
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
275
structure length
274
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords Subtilisin BPN'
publication title Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'
rcsb
source organism Bacillus amyloliquefaciens
total genus 97
structure length 274
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2003-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1v5iA00
2Z2ZA 3TI9A 2Z57A 1BH6A 3BPSA 3QFHA 3I30X 3DE1X 1T1EA 4MZDA 1SIOA 2Z56A 2SECE 5AVJA 1AVTA 2PYZA 3DW1X 1Y48E 1VSBA 1GA6A 5JXIA 3Q5GA 1YJCA 1SBHA 1SCAA 3UNXA 3PTLA 1Y1KE 1SIBE 3ZXYA 4OV6B 2SBTA 4H6WA 1TK2A 3F7MA 3QMPA 1AU9A 4KG7A 1C9NA 1TM3E 4KPGA 1V6CA 1LW6E 3WQBA 4ZARA 1NLUA 1TECE 3DE6X 1C3LA 3AFGA 1BJRE 3VTAA 1Y3DE 3D43A 2DP4E 1PJ8A 2PRKA 3I34X 3DW3X 3LPAA 1MPTA 3P5BA 3T41A 2WUWE 3A3PA 2W2MA 1JEAA 2SNIE 1GA1A 3VV3A 3LPCA 4C3UA 2WUVA 3EIFA 1TM4E 3A3OA 1BFKA 1WMEA 3CNQS 2W2PA 1HT3A 3BGOS 2W2QA 1AF4A 3GT3A 1R6VA 1BFUA 2SICE 1PTKA 1UBNA 4OMCA 4C3VA 2Z2XA 3LXUX 1YU6A 1GT91 5SICE 1S2NA 1AQNA 3DE7X 3DDZX 3PRKE 3SICE 4ZOQI 1V5IA 3DVRX 2ZWPA 1AH2A 1S02A 1DBIA 1TM1E 3WHIA 5JMOA 4H6VA 5FBZA 1BE8A 2HD4A 3AJ8A 1SBTA 1SBIA 3QTLA 3EE6A 1KDVA 3ZXXA 5ARCA 1SBCA 4AKSA 1GA4A 1SVNA 3WIVA 1SIUA 1WMFA 3TI7A 1OT5A 1TMGE 1SH7A 1TO2E 4HVLA 1YJBA 4LVOA 2G4VA 2Z58A 3BX1A 1SCNE 1S01A 1SCBA 1SPBS 1TM5E 2E1PA 1SUDA 2ST1A 2WV7A 3VV2A 1Y3CE 5ARBA 1GNVA 1ST3A 1Y3FE 3VSBA 1R0RE 1IC6A 1Q5PA 3AJ9A 4M1ZA 3I2YX 4NE7A 4KB5A 2ZRQA 1KDYA 1TO1E 2IY9A 3VYVA 2Z2YA 1BE6A 1Y9ZA 3GCXA 5AQEA 2XTJA 3F49S 1SN7A 3TECE 4DWWA 2Z30A 1KE2A 1OYOA 1OYVA 2PMWB 1GNSA 2PWAA 1C9MA 4CG0A 1IAVA 5ARDA 3DVQX 1EGQA 4GI3A 5K7SA 4B5LA 2TECE 1AV7A 1THMA 1AK9A 4CFYA 2B6NA 1NDQA 3DYBA 1XF1A 2PKCA 4DJ5X 4WOBA 1T1IA 5FFNA 2V8BA 3Q40A 1PEKE 1Y34E 1Y33E 4LVNA 4RYDA 4NE9A 3DVSX 1KDZA 5AVKA 1P7VA 1SUBA 1GTG1 2HPZA 5B1EA 4NMXB 1GTJ1 3HJRA 3DE2X 5B1DA 1Y4AE 1MEEA 2DUJA 1EA7A 2IXTA 1DUIA 5AMXA 4HX2A 1ZVKA 2ID8A 1GTL1 1KE1A 1T1GA 2QTWB 5CW1A 1SUCA 3SQOA 1GCIA 1WSDA 3EDYA 3GT4A 5FAXA 3F7OA 3DE5X 3DWEX 2P4EA 1CNMA 3L1KA 2X8JA 5I9SA 4I0WB 4H6XA 4JP8A 1SBNE 3H42B 4J94A 1C9JA 2PWBA 2XRMA 4OMDA 1P8JA 1SUPA 2W2OA 4Z2AA 5JXJA 1SCDA 2ZWOA 4FONA 1Y4DE 1PFGA 3DE3X 3A3NA 2GKOA 5JXHA 4BWGA 2ID4A 1TM7E 1P7WA 1SELA 2W2NA 1YJAA 1Y3BE 4AKTA 1SCJA 2PQ2A 1SUAA 2DQKA 4DZTA 3OSZA 1A2QA 3I37X 1WVMA 4CFZA 3DE4X 3WIUA 2WWTA 3DE0X 1R64A 3CO0S 4WOCA 5JXGA 1SUEA 3GCWA 1NDUA 4YN3A 4K8RB 1CSEE 1ZVJA 1ST2A 3LPDA 3VHQA 2X8JB 1WMDA 3D9QX
chains in the Genus database with same CATH superfamily
3T7TA 3NBAA 1KIMA 3QIVA 3L1IA 5J59A 4EVQA 1FVFA 1QBKC 4MWTA 1EWYA 4ZPXA 2F1OA 3BAZA 2NV6A 4IGIA 3R40A 1KZHA 4F56A 3A26A 4C7KA 4ND4A 3M6IA 1FXWA 4XCVA 1D1SA 2D2XA 1XJWA 1Q19A 1W48A 3K94A 4QU0A 4WKNA 4XIGS 2I0FA 1P18A 4DSAA 1D07A 4DVGA 2IELA 2Z1MA 4EX7A 4M0KA 5DULA 5EL0A 2QL6A 2B7LA 2GVDC 1NG9A 1YWGO 1GPJA 2QTAA 1FNMA 4GX5A 5AHXA 5HOEA 2CYCA 2X58A 2FV8A 4F46A 4IICA 1W2GA 3WLEA 4J6FA 3QSYA 4OHPA 2HHLA 4RY0A 3LLVA 4XM2A 1GKKA 3MWEA 5ELMA 4AN1A 4UTXA 4TWRA 1NX6A 1L9XA 4LKRA 1T6ZA 3Q5GA 3U09A 1P0QA 2RARA 3OZVA 5IDQA 1PBTA 3VR5H 1FUEA 1U7ZA 5K0LA 4FYPA 4RDCA 1KJQA 4FOTA 1KETA 4OB6A 5ABPA 4ETIA 2JNWA 3DR3A 1AUXA 4FCCA 4DADA 3FKQA 2VUSA 4NBRA 1QG6A 1T8UA 4HHEA 1NVKA 4Q9AA 4ZREA 1L6IA 3RC3A 4ABYA 2Y68A 3B2NA 2VBCA 3N8HA 4DQLA 5HA5A 3VDQA 1GQOA 4R1LA 2ISQA 3CE9A 1A2OA 3M49A 1HA3A 3G0HA 4DDWA 2PRIA 2FX2A 2BSQA 4X41A 3WL5A 1XDBA 1MDFA 4G0UA 3X44A 1TZBA 1Z5NA 3V3TA 2GBIA 2W6JD 1SA0A 1GSAA 1Y5RA 3ASYA 2LKCA 1Z0UA 2YC4C 4Y18A 3PQ6A 3KZNA 2XYVA 3C85A 4JBWA 2GN0A 2I78A 3EY9A 2FQQA 3RRNA 4BNJA 3E22A 4R9UC 4WCVA 4CKXA 3L6DA 3JATA 1GNRA 4B80A 1N2CA 1VJ0A 5LZ8A 2AIRA 1YL5A 1PTJA 5FA5A 3WO0A 4EFLA 1H42A 5D84A 3T5BA 1BJKA 4JITA 3VHXB 1SHZA 4YROA 5ALEA 2DTEA 2O8FB 3H87A 3E03A 4H7FA 4L75A 4M6WA 4Z6KA 1YTUA 1ANKA 1V1RA 4QASA 5TC4A 2VJQA 2NVUA 2I6SA 1CF2O 4IHAA 3O8DA 1GP2A 2ADFA 5JDCA 2AMJA 3ZDFA 3P4YA 3EGIA 1WUHS 3PGLA 4O4IB 4Y0VA 1RADA 2DTDA 2Q3CA 1WDWB 4D81A 3QKUA 5FTMA 3U16A 4DC9A 1AHPA 3L40A 2XEDA 5CM2Z 1ZU4A 4QTYA 1PU2A 5BW4A 4XEUA 4KGXA 1OWLA 1M83A 4XD2A 4EL5A 4ZCRA 4GX1A 3O4IA 4JT9A 4FFLA 4RH0A 4AF8A 5TF4A 2PN1A 3DBHA 2QJFA 3GLFA 1YGPA 2UZ0A 4C29A 4DXDA 5DI3A 2BFFB 4RVCA 4XGKA 3R3WA 4MP6A 5J2TA 1KNXA 1XQ6A 2WHXA 1ZYUA 1BMFD 3G79A 1D2GA 2O5CA 3GT0A 3C74A 1NOKA 1TPZA 1VLQA 2OK8A 3LUCA 2JIPA 1RI5A 2C3MA 3NIFB 3LKVA 5E6RA 1AHHA 1Q15A 3MWFA 4DHEA 3I3OA 3IPRA 3KT6A 4PVDA 5HNKA 2HQSA 4DRYA 2X5JO 3GVXA 2MDTA 4X7RA 3RABA 2QDKA 2WG0A 3W6NA 4B87A 5BSKA 1PQYA 4R7GA 4HGRA 3KD2A 1PQUA 4IM7A 4O4HA 4PGHA 4AUMA 3CJTA 5ECGC 2UXCB 3HKEB 5IAJA 3T7JA 2HLNA 3L93A 2BGWA 4A8JA 1XTUA 3MJFA 4NHOA 3M1AA 2JVIA 3VR3D 3WADA 1OXXK 3IQHX 2XNCA 3PJFA 1P74A 2W83A 4UPVA 1G5TA 1YA8A 2AH5A 3ITEA 1V5IA 3CPHA 2V59A 3FBWA 4X44A 5DE3A 1I13A 3DVRX 3EOZA 4FDLA 1U0HC 3ZK8A 4FPXA 4I4TA 5K1ZA 4PAWA 2XCIA 4ZQCB 3QUTA 1CIJA 3VU1A 1NW5A 2K4MA 1O1YA 1YA4A 5JRZA 3RC8A 3W5UA 1EQ2A 2FZWA 3IE0A 4CM7A 3M5DA 1FVXA 1ZI9A 3QVUA 3R3YA 1KYXA 3KU4A 4K9QA 4NYIQ 4P83A 1OGJA 4J16A 2GAIA 3W3AA 3QBVA 3V1LA 4YMLA 1S8OA 2O07A 2WDPA 1SBIA 1VJRA 2B61A 4POAA 1SXQA 1NASA 5LA6F 4XB2A 1UPBA 1FSZA 1YCFA 3VXKA 3ZU6A 4DEXA 1HX7A 1AKWA 3HFRA 4ARZB 4GGOA 4M0CA 4KVAA 3LYLA 4WNYA 1V71A 4GOXA 3DPUA 1QQAA 1ZP6A 2X4LA 3GU3A 1KAQA 4EKGA 1MZPA 1NONA 3LBHA 4OOEA 1XMQB 1Z33A 1WBDA 1G16A 3B3FA 4RZ2A 1NUHA 3ZU2A 3FPAA 2POQX 2H2WA 1M75A 5CJJA 3DMTA 1BDJA 1MGOA 3SZLA 2XRZA 3CUUA 4BNIA 4G1BA 1LUAA 1EG7A 3HI6A 4JCOA 4BP8A 2P4HX 4B3XA 3CXRA 3RRBA 4C5BA 5HF8A 4RZUA 2WTEA 1KMCA 3QJGA 2AX3A 1QUFA 2YYAA 2FWJA 1FFBA 1JKMA 2B7CA 2VHVA 3B6ZA 3LK7A 3MXTA 3KWLA 2NZ8A 4JJ7A 5AJVB 4C4RA 2JIRA 3IEMA 4UPEA 1DO0A 1HTTA 1ZJ6A 1ZKDA 1TCCA 4HGYA 4WY8A 5BPFA 2R4TA 4MEBA 1SURA 4YACA 3AOGA 3K1ZA 4KWHA 5DXFA 2G4VA 1R0XA 2H5IA 5FNVA 4MHTA 2IS1A 5E6UB 3B8EA 3NDJA 1TB4A 1I10A 2B0JA 2ZYSA 3GRYA 3O8QA 3RAJA 2Z4TA 5JD4A 4PFJA 3V55A 5ED0A 1VGVA 1NI5A 2W2TA 3A4IA 3X1ZA 1RMTA 3I52A 3OG9A 4EBBA 3WZ2A 4Z7OB 5BR8B 1SCBA 5BSFA 5ILQA 4RFLA 2OEPA 1II0A 3THYA 2DQZA 3MNFA 1ZJZA 1PGJA 1WCIB 1U8UA 2DLDA 1GAQA 1UMKA 1L4FA 1PK7A 4KPUA 3SSAA 3VO1A 3VJKA 1U8EA 2WD7A 4ZDIA 2A9JA 4H7DA 4EJSA 2O8NA 1U2DC 2XNHA 3VSBA 5HKOA 2I03A 2C3YA 2VHZA 3R3VA 4GBGA 4P84A 3U7RA 1IC6A 4GH5A 3R9XA 1Q5PA 3C5WP 5DP1A 5K09A 4CKBA 4WNAB 2F1KA 4KV7A 3VU0A 1F9AA 2CXPA 1SOUA 3BF7A 1CUAA 3I2YX 4D0SA 4II2A 1HLDA 4LRSB 1MW9X 4QPPA 1JJ7A 3WG9A 3DEIA 4Q4AA 2FQYA 1PO7A 4H0CA 5D3MB 2DT5A 3HUFA 3MUNA 4RF4A 2WLTA 3ROTA 2IS6A 4AKGA 1KI9A 3IBYA 1ISHA 4P3KA 2VP0A 3GFFA 4MUBA 1PJTA 5CYGA 1SG6A 1FSPA 4G5GA 1OH5A 3T3EA 1VKHA 2UZ3A 4U7JA 5JCPA 4LFBB 2FU5C 3NHFA 2QE6A 2GN6A 3TAUA 1LTHR 1F6DA 4RD0A 4NBLA 4YHHB 5HUJA 2EHDA 3F49S 2OUKA 3TECE 3D3QA 1HG0A 1AA9A 3V4LA 5JD3A 3ZV5A 4Y2GA 1YZVA 5EMLA 4ALIA 3ZR4B 2FMHA 2ZPUA 3UTDA 2BFAA 4XFDA 4XDYA 3CRZA 3WZLA 4V1CB 1YR2A 4EJ0A 5BQXA 1LX7A 4MRMA 4FWTA 3FDJA 3HSYA 1HT1E 2J0SA 1E4EA 3M6UA 2C00A 4TXLA 4WACA 3B1ZA 1NSFA 2GILA 3PU6A 4O63O 1SCUB 3HVHA 4RH3A 5AJYA 3VOBA 4EMTA 3S7ZA 4TN1A 4FGSA 3RROA 3SVTA 4OQ4A 2Q5EA 1DC4A 3VZSA 4YJ2A 3F6YA 3FHLA 1MG5A 2VT3A 4LDAA 5ALFA 4DM7A 2HTFA 1D2RA 2BM9A 2OCPA 2Y0BA 3EULA 2X3YA 1ZSNA 3LW7A 3OZWA 4GQBA 3VO9A 4B46A 4EW1A 5JEDA 1I36A 2HMWA 3F4LA 2BMFA 4UDYX 3UBMA 1WB6A 1AKUA 5ARDA 3ZUPA 4N0QA 3KKKA 5IC4A 2VF8A 1KZYC 2A33A 4KQFA 4XM0A 3VJMA 2QD5A 1E9CA 1N9ZA 1DFGA 1KYQA 3HI4A 4X7PA 3L6BA 3ONFA 5JC8A 2MINB 1GU7A 2QMQA 1VCMA 2UVPB 5JALA 1G5RA 4QQRA 3MELA 3FTPA 1P1JA 1YJXA 2B6NA 2WTXA 2ANBA 2PG3A 4B6GA 2BUAA 2EQ5A 1EGMB 3FKJA 1I4EB 1IRIA 1JJBA 2DBRA 4INJA 1CUZA 4P5DA 1Y4UA 3UT0A 2IGBA 3FOCA 4FC7A 1RXYA 2VXYA 4PYOA 4WW0A 1EFRD 4CKEB 1SOWA 2IVZA 3MCZA 2FPGA 3ELWA 3ZVMA 2AFHA 2B3TA 3OSUA 4GHWA 4PANA 3I62A 4LISA 1K68A 1U3GA 2GVNA 2JATA 2M98A 1KAMA 1N7JA 3U4IA 3O8OB 1O8BA 3WP1B 3ZZUA 1H8HD 1KO8A 2ATVA 2BTQB 2DHQA 1QPGA 3K8QA 1N0HA 3RU2A 1SR8A 4ZIRB 3IV9A 3U80A 5KU7A 4JEMA 1HOXA 3EDMA 1RCFA 2V3VA 1G66A 5B37A 5L6LB 1JIIA 1NMEA 4TL6A 2YBEA 3E81A 3L7YA 4DE5A 3EOBI 3BK2A 2FWPA 4MAMA 3R5FA 2OVBA 4MVJD 3ZTWA 2E48A 2Y77A 3FUUA 3URMA 1J5XA 1S9HA 1U8ZA 3UG7A 5KNBD 4DDTA 1F4PA 3SQOA 4A0FA 5BUCA 5KX5F 2JGFA 3PQCA 1XEAA 1O5TA 4QXRA 4NSNA 5LA6B 1MO2A 2FKNA 4JDUA 4ALJA 4CTJA 3RYFB 1KH1A 1R0KA 2XKKA 3H11A 5AI0A 5FOQA 1WQ3A 4Q4CA 4MP3A 4B75A 1T13A 1M10A 1TQ6A 3IP7A 1RC0A 2IOFA 2BFMA 4GT1A 2ZIEA 3MD0A 3H5LA 5JROA 1DG1G 2ACVA 1GZVA 4OA8A 1ZW6A 3WYNA 1R1DA 1IB0A 1A76A 1PX2A 4BB9A 3ENWA 3OAAD 3N53A 1DO8A 4L57A 2EW8A 4UC0A 2BZSA 4YMHA 1CZHA 4NJEB 2C20A 1VZ2A 3GUZA 3MTIA 1QZUA 1TYDE 3N0XA 4HB3A 4OGGA 8ADHA 1GCIA 2AKAB 3GRCA 3N2IA 1QG2A 4YASA 1KBQA 1R4MB 1HEUA 1NVGA 4GPEA 4DQXA 3BSSA 1H8EA 3EWAA 1M0WA 1N6NA 4KDRA 5K3BA 2GCOA 3PXEA 2CUZA 2WW8A 2GCIA 1K8ZB 2JLSA 2W6MA 3QYFA 1DB3A 2B4TO 4GZMA 2JH8A 4HQNA 1YE3A 3C15C 4G5SA 3U4AA 4X65B 2Q4RA 2WAYA 1KEZA 2JHGA 4HRAA 2WYUA 4NBSA 4C0QC 2FLKA 4I3GA 2VWPA 4DW8A 2W42A 3BMXA 2E6KA 3K5IA 4UD6A 4Q15A 3UY4A 2C5SA 4PPYA 5EJFA 1O58A 1Q7BA 2DFVA 2PZLA 4N3GA 4CF6A 5BYJA 1Z6ZA 4AUKA 5ITZB 2TYSB 4N18A 1MEOA 3TX6A 4JJ8A 5FI1B 5BRAA 1VP9A 1QYXA 2NYAA 2VAPA 3P9XA 1R0WA 2W2OA 1IOLA 2ZWOA 2MU1A 2UYHA 2Y1GA 1Y4DE 1HMPA 3G5AA 4BDTA 4RY9A 3O38A 5GM2A 3OWXA 1U8CB 1YL6A 5KS2A 3OQIB 4MR9B 5DHFA 4CL2A 3FNRA 1OMOA 1XJ5A 2YXPX 3R7BA 2DSNA 5JQGF 1DIGA 3RFXA 4AD8A 2X6QA 3I32A 4TZ0A 2J3IA 1C9YA 4OGWA 5IM4F 1Z63A 2V0NA 4R2LA 1RRPA 2GXSA 2QG4A 4B0OA 4N0DA 3TMAA 3K0KA 2G06A 3CG4A 3C2QA 3I6BA 3EZ2A 2VHUA 2QS9A 4P34A 1DMSA 1EZZA 4ZTZB 3B85A 1N1GA 3VZDA 3QVWA 4BNKA 4LTNA 4AKTA 4C1BA 4FMBB 4KR9A 1JHAA 4MW0A 3NVKI 3N0TA 5DYNA 3BBPA 1QDLB 3WLNA 1ZCAA 2F43B 1FY2A 3ZE7A 5KVQA 3JV7A 4BNDB 3AF2A 3I4FA 1QRAA 2WTUA 3UJAA 3AEZA 4LXUA 2IF2A 2ODWA 2SCUB 4X71A 3R7FA 1Q2UA 4CUKA 3NRBA 5C80A 2WMNB 2YH2A 4I2VA 1YS4A 4HJXA 2GEDA 3L0PA 3I37X 5BYKA 5CXQA 1BGVA 5K8IA 3P5SA 4DR4B 4IGFA 1XCPA 3HBNA 3IULA 4QDZA 1SUWA 3UJ7A 4AU1A 2HL6A 2E4ZA 2CXRA 3NHUA 1V7ZA 3O9ZA 3ONNA 3QW4B 3DE0X 4NI5A 3U4QA 1W85B 3OM8A 3Q7IA 2QZPA 2Y1XA 3N2NA 1JHVA 3OQ1A 5A9TA 4YRDA 1CT9A 2GMWA 2ODBA 4F5DA 1PJ3A 2VRWA 3F1KA 1XRSB 3HH8A 3IP3A 4MWZA 4CUZA 3ZW9A 5D1HA 4GBJA 3CUYA 2ZRNA 1SRRA 1SK9A 5FR1A 3AK4A 3KUCA 4MROA 3WWOA 1IATA 1Y7HA 2QW8A 4DIEA 4V3CA 2CVZA 5WRFA 4N82A 1X77A 3PDUA 3ND5A 2ISCA 1BCSA 1P5HA 3GYGA 1IBLB 1G5PA 2PVCA 4JI6B 4UBNA 1QHIA 4DLKA 1XU9A 1YONA 1H3FA 3C7AA 1M5UA 3LGSA 4P98A 5HK8A 3E2IA 1Q12A 2CLMB 4BNLA 1BFDA 5AM4A 1UM9A 1HM5A 3LNTA 3CLVA 4OHFA 3H9BA 4RHUA 1HOTA 1E9EA 3UWMA 5AVUA 1ODKA 3BK1A 4Q7LA 4RHFA 3ANMA 3S3TA 1MX9A 4LZZA 4LX0A 5FBKA 1G38A 2RHGB 4U3JA 3UCFA 3VM6A 3A7EA 4XIFA 2WPNA 2C2YA 2Z1DA 2O1EA 1DOZA 1E2LA 3QVGA 3WGHA 4EK9A 1AVTA 2H9AA 1JLKA 1GFZA 1R0ZA 5DEOA 5JATA 5ULLA 2YWXA 3W9BA 4F4HA 1SU8A 5FYDA 3F1LA 1XP8A 1YFZA 1B3RA 2CV2A 1XYGA 5AR1A 1KXZA 1K5PA 1RWVA 1KDPA 2Q1WA 3U7JA 1W75A 4AY6A 3TXXA 3N2GA 2X0FA 4ZI7A 1FRFS 3AVPA 3JXEA 3PQ2A 2WWIA 2QJOA 4L4YA 3ZXYA 4YCCA 5JASA 2FWIA 3STVA 4F71A 5GOTA 4DKJA 4MKZA 4D8YA 4CT5A 2DUNA 3HB5X 2FHPA 5KSZA 4TSRA 1CZOA 4RNDB 3QLVC 3RNOA 5KUTA 1Z4KA 3DAYA 3A6KA 3ZY5A 4IJKA 3MRTA 1Q77A 4HWKA 4L1KA 3RKRA 2CZGA 2PHZA 4ROTA 2QTZA 3PEYA 1VL6A 2FG5A 1QVRA 3IVGA 4WQMA 5A5EA 1OV4A 5A3RA 2V6JA 2JFYA 1M6EX 1TVKB 2W58A 4M89A 4D80A 1W36D 3FMOB 3EW7A 2XTNA 3H9UA 1J2EA 2HSWA 4KZPA 1GQFA 2ALJA 4BJ3A 4YCMA 3KQMA 2VDPB 2HCBA 3PQDA 1GKYA 5BV1A 5JCOA 1FS4A 4JKOA 4G81A 3UW1A 4M9QA 1QFZA 1ZR4A 4AO7A 2YRFA 5DHQA 4MUNA 4AF6A 1CY4A 2IY8A 2ZRBA 1T0JB 3P19A 2VRBA 1LNZA 3COZA 1V7CA 4K6FA 2C2ZA 1FXWF 3VZQA 4G0VA 1DAPA 3D43A 4U00A 4HB2A 4E1BA 2FCAA 3BXOA 2W2KB 1LPMA 1WWKA 1GN8A 1X86B 1YDHA 4R8MA 1X13A 3BEOA 2Z6QA 2XGSA 2YL2A 3CLUD 3KJIA 4BMPB 1FLAA 3T41A 4Y6SA 2JRLA 3FNBA 2BTEA 1RJEA 1BYIA 4IF4A 1RVDA 5JD5A 1JWLA 1KPHA 1X8LA 2NU7B 2W2MA 1E8DA 2AHRA 3P96A 1GA1A 3TLJA 1NURA 3P97A 1DMRA 4K81B 4LDJA 4ZJUA 4MWCA 3KE9A 1XQ1A 2X15A 4KSYA 4CPDA 4N1AA 1CE8B 4OHVA 4QFBA 5CDUA 4DYHA 1GUDA 4BLWA 2BZGA 3D6FA 5HW0A 2ZQYA 3K0HA 1T9BA 2YN2A 3KKNA 3DD5A 1XELA 4JVLA 1XNGA 3IHWA 2N46A 3O2SB 1UJMA 5H8WA 5JQGB 2VOEA 3D4LA 3AFIA 3DSRA 4DB4A 4HDSA 3N6XA 4KODA 2RGYA 4PFSA 2V3CC 1LWNA 1Q1GA 1ZCFA 1JEDA 2OBFA 4RGQA 2H2GA 2PWPA 4HDQB 1FQOA 3WWDA 4JR0A 1VL2A 5F2NA 5L45A 2ZJ3A 3PQ4A 4KXXA 4BS9A 1RXCA 4PG6A 2JD2A 5HCIA 5U9CA 4QPZA 2GEFA 4L78A 3ZU5A 1L1EA 3DBRB 1WO8A 4IDAA 2PT5A 1QKIA 2QTVB 5B2EA 4EFDA 2I1VB 2A14A 3RB8A 5L3SB 1TZKA 1LI4A 1ULZA 3MN1A 3T1VA 5M29A 3W9UA 4WZZA 3U4CA 2P0YA 3F3KA 5T64A 2P65A 2P4UA 4JLMA 4GMHA 4P33A 2XIJA 3VHXA 5CD1A 1X3SA 4G8JA 2V5AA 4MDYA 4REOA 5FNZA 3SJBA 2ZU6A 1W0KD 3COWA 3UFBA 1B0PA 5HJEA 2QNBA 3VNRA 1HDRA 1KO4A 1M8FA 3DEHA 3GJZA 4ND6A 2M6SA 3Q3JB 2ONCA 5H80A 4Q7JB 3F3MA 4RTKA 1U3WA 4GS5A 3OCZA 1LFAA 4LYYA 1VTKA 1Z6XA 2JFQA 1PK8A 2C9MA 2HLDD 2CHUA 2QL7A 4IFIA 4O4IA 1KYTA 4KDFA 1X7HA 4JT4A 1NVUQ 1Q7CA 2XGGA 3P2YA 2W2LD 2HA0A 4CU2A 2GK7A 3A27A 3KYCB 3DT8A 2XQIA 1ZM4A 2N42A 4OQYA 2J0QA 2B92A 1K0FA 4WXMA 5EKDA 1U90A 2YWHA 3A8TA 3GLKA 3RBXA 1CRWG 2ONYA 4FDTA 4DMFA 4LFAB 1AURA 4KHZA 4D92A 2BFFA 2HPHA 3I1IA 3D3WB 1V48A 4RPHA 5T8KC 2XIQA 4FC6A 2IV3A 1C0EA 5FPSA 2JH9A 3H2HA 2DUWA 1Q74A 2W8BA 4NOJA 3F6RA 1XRQA 2PV7A 3TQIA 4ATNA 4Q4LA 3RT9A 4G97A 2AB0A 4M53A 2CUNA 1ZR2A 2P30A 2P6RA 3LY7A 2GN2A 4FFDA 4GPTA 3GDWA 4WK4B 3LKDA 3LX5A 5F2EA 1SVSA 2PJRA 4G0PA 3DYVA 3JQAD 3CLTC 4KPFC 1TF5A 2E4VA 2FPRA 4G1MB 5DCLA 1JB1A 1Y63A 5ALPA 4JJFA 3NIWA 3SSNA 1XWIA 4DBLC 3AVTA 3EXG2 1E2KA 2ZRLA 2L0XA 3K1TA 3KSMA 2W6JA 4WBXC 3EMBA 5FL7A 5I4IA 4WKBA 3ZU3A 5EKTA 2WOOA 4HAZA 4A36A 1RQ7A 3VZBA 1K6MA 4AMZA 4Y9TA 2Z2IA 4PBTA 1XZDA 1K92A 1Q44A 3OHPA 1XF9A 3R6LA 3BXPA 5FBHA 3T6KA 4B8ZA 4RQAA 3HA2A 2CMKA 1X7YB 4NVRA 3BZUA 2V7QA 4M1SA 2CKMA 2ES4A 2LXNA 3A0UA 3IH5A 4EHAA 4BGVA 5KQGA 3ETLA 3SX4A 1EGHA 3BWMA 2O8EB 5EP4A 2NUAA 2YFQA 1QH0A 3ONEA 5HIAA 3QVXA 2FRDC 1MXFA 1J9EA 3G2IA 3OX1A 3SJ7A 2PUVA 1JR2A 5M2QA 2ZRPA 4DSZA 3PDJA 1GRNA 3W4JA 1LLCA 1FB5A 5K3AA 3X1JA 2CLKB 2JI9A 1XV5A 3KLBA 3KZCA 3OCYA 3T1HB 1R8YA 1J06A 2EF0A 4QICA 4O2AA 2MMCA 5F3RA 2Q46A 2I3GA 3AERA 2XE6A 2EFDB 2IU6A 1X1QA 2YVAA 4G5FA 3HMQA 3U4DA 4PYKA 3H2SA 4D0GA 2XQFA 4NP6A 3IE1A 1VMDA 1J25A 3IDAA 5KO2A 2GPJA 3NT5A 3H2YA 4BE7B 5EUQB 1EX1A 1VKRA 3TMYA 1SHLA 1O5OA 3GRRA 2C95A 1TADA 2BMJA 3F9CA 1BMFA 3EARA 3KUKA 3ZGVA 3FHJA 5IBQA 4LNUB 1N5OX 1NKVA 4M37A 1NI4B 5E9AA 4KQMA 3KE8A 3RUIA 3TN7A 5BQ3A 3UMJA 1ZQ1A 3AUYA 4TV9A 1XTKA 4JBGA 1RHKA 4JUCA 4N76A 2ZBEA 3GK3A 3SM9A 3R24A 2G1PA 3BGVA 3SK0A 4NH0A 1QK5A 1E58A 4K9SA 3W9SA 1P2SA 5J5AA 4HUJA 4ISBA 1YFJA 4BN0A 3D7MA 3TSAA 4J4HA 4R1SA 4XRGA 4ZZ0A 3IJRA 3RSOA 4CM4A 4A73A 3LL7A 3HKDB 4BFXA 1NXQA 4PXAA 1MJNA 5DGDA 3KZ1E 4DQ0A 3VR3A 1IZ9A 1NTRA 4D9KA 2DMRA 1HDZA 2V55B 4YVFA 3IT2A 3VPXA 1CEEA 2CK3D 1ZIOA 2GXAA 1DAGA 1NBOA 3ZDRA 1OYVA 2ZETA 3DWFA 2FSIA 2H63A 4NJMA 4CZ2A 5I7VA 5KOHB 5LLDA 2ZWAA 3LX4A 2QLBA 4H3HB 2FMIA 3C43A 3SP1A 5K0GA 3LU1A 1E79D 3GPCA 5CIQA 5JVDB 3VKGA 1UXIA 3ENKA 1CU1A 4IJUA 1DQPA 4EL0A 2JLUA 2IUFA 4ZP1A 2HOQA 2XMZA 3NHWA 5AKZA 1EJ2A 3KR0A 3LECA 4H1UA 1ODJA 4DMUB 5CNKA 4EVIA 3CN7A 2IYEA 1XK6A 2QD3A 2VRNA 4IXNA 4QFMA 4IPTA 2X9VA 2GO1A 1OFVA 1GPYA 1T3TA 1XMIA 4S35A 5EE0A 1U0EA 1WZUA 1IU9A 2I29A 3INGA 3I1JA 3C6XA 4HXEB 3ZHSA 5L4LA 3RQSA 4LF9B 3DFZA 4JEIA 4ML3A 5HF6A 1UP7A 2I6TA 1UDXA 4QBHA 2PZFA 5CHEA 1E32A 4YMSA 2AUNA 5DHPA 5GMOA 2AXEA 1NBWB 3PPWA 1ZQ9A 4TV8F 5LCXA 1NVFA 1V9SA 1SXJB 2IZOA 4PQYA 5DBIA 3SLRA 1RWKA 3GRUA 3ZCTA 3A2KA 2Q3EA 5D3MA 3T61A 3FOBA 4NYJQ 4WLOA 5CPFA 1E6UA 1ZL2A 3DL4A 3BCRA 3T7DA 2NUTA 2X13A 5FFNA 5ALXA 2YV3A 1ZESA 5DN6A 1EK2A 2P9EA 1IVNA 2GK4A 1K89A 1DQNA 2CUKA 4OYYA 1Y34E 1YIDA 2EKLA 4ISCA 4CM9A 4ETMA 4CETA 1SQ6A 3KD3A 1OOEA 4L2IB 1MABB 1XU4A 2R48A 2WJVA 3LF2A 2OORC 2DHCA 3BHIA 3CLRC 1AK2A 2PLAA 3DVSX 3V80A 2GOYA 3U26A 4FQ5A 4RSGA 2CSXA 1TI7A 4IOKA 4JR2A 1TUIA 2J9XB 2PPVA 1GM5A 1XGKA 2VP6A 1OH8A 1V39A 5IZCA 1RPAA 1B42A 2HO4A 1T9DA 4NESA 4CQJA 5GTDA 3LV8A 4KR7A 1G6OA 4WNCA 3RKUA 1O8CA 2VSYA 3PX7A 3LKZA 5EEGA 3Q6NA 5AW3A 4YJGA 4OHZA 4DDKA 1ISSA 3GRVA 5IF3A 1W581 1X39A 2EV9A 4KIWA 4V24A 1YCGA 1NPYA 4R84A 1OBFO 3VAYA 1TYEB 1JHRA 3MF4A 2JLRA 3N8KA 4IVQA 3WJ7A 3AFHA 1YU9A 3W8DA 2MINA 2XADA 1SXJE 2ERYA 1AQIA 3PUWA 1DJOA 1F2VA 1Y8QB 4B4VA 4EFKA 1GYQA 1FFYA 1O9GA 5E4YA 5LYJF 3JZIA 3EXIA 2XBLA 2O1SA 1Z5WA 5DLEA 5FTWA 3X1YA 5IWAB 2I6FA 2G5GX 1E2GA 2ILTA 5AXAA 1XNHA 4Z51A 2XTMA 4AZ3A 2IY7A 1IY0A 1DKPA 1DC8A 3DMNA 4YRRA 1CNMA 4CKEA 5LQUA 3K8YA 5JCXA 4ESVA 5KKAA 2DJIA 1FYWA 1E3QA 3GJ4A 4YCNA 1CJSA 5BVHB 2DWQA 1G8KA 4JP8A 1DAHA 1DJPA 5BNZA 5EJ2A 5CB4F 5ESXA 3SEZA 2I6XA 5TQ0B 3DDWA 4GP6A 1QTQA 4AURA 4K87A 1QU3A 5AJHA 3WWPA 5EJ7A 3LDAA 4AKHA 1K7FB 4C0JA 1FRZA 3NWBA 4TN5A 5AHOA 1GGJA 3BZBA 1TAGA 4NBKA 3T4PA 1BHJA 4RPCA 1P8JA 2DWUA 3JTMA 5GZ3A 1NW6A 2C7GA 3GAAA 4P31A 4UTVA 1P5FA 3KEFA 2FMKA 3PUJA 5HDQA 3WGNA 1RJDA 3RYFA 3EUWA 3ZE6A 3DCYA 7GPBA 2GKOA 5BRJA 5AVZA 4IILA 3T9EA 1JU4A 2OESA 1U1IA 1RZRD 3DG9A 1N8TA 3ABOB 1IZ7A 1SZJG 3GEEA 3ZHTA 4CMCA 2R3SA 4CEIB 3W34A 3W2HA 4TVBA 1THGA 3U3ZA 4D4IA 2EFCB 4N5LA 1IXRC 3WOVA 5IAGA 1C7JA 3LFUA 4KO4S 3JAWB 3RS2A 3S2IA 4F5ZA 4FQ7A 4CTOA 1RKVA 3HR8A 3VH1A 1I2ZA 2JLYA 1MW8X 3GJ6A 3LT4A 3G9ZA 2FSFA 4NDAA 4RD1A 2JFGA 4TTRA 4WOPA 2ZRCA 2FF7A 4X3PA 2BKEA 2DUUA 2Q5LA 3HGQA 3IA7A 4MUYA 4XSVA 4GKKB 4JYCA 2HDWA 1E9AA 3WFIA 3OJEA 1E1KA 2H54A 3WP0A 5K45A 3UPTA 4HLQB 1NQOA 3FZQA 3IO3A 4BJHB 3THXB 4CF5A 3W9YA 4MVJM 5IJ0A 3RVDA 2E49A 3FNEA 3RS0A 4ZOAA 2COKA 1B6GA 2YZNA 4MGKR 3VVLA 2FVXA 3SBEA 3WMRA 4EW6A 4JU8A 5KJCA 1EFRA 2G82A 2G0AA 1FJHA 3NTVA 4WOCA 4FYKA 1EE1A 1KTVA 1ZGCA 2VTKA 3E1KA 1MNAA 3PB3A 4QVKA 1L1QA 3DDCA 1A71A 1TYZA 4B6PA 1OZFA 3CWCA 2GBLA 2CV1A 5AKXA 1E5LA 3VR4H 2QROA 2NW6A 4IFTA 1T5LA 1O6GA 4ZAGA 4Z0HO 3K1AB 1NW7A 4LCEA 1IQ0A 2AE1A 1QFSA 3L0BA 3QP9A 4WZAE 2WP8J 4ZPJA 1J09A 1CB0A 2VWHA 3OPQA 3MJVA 3DEYX 3A4LA 2VP4A 3AXTA 3OQIA 4MR9A 3ZJVA 3FM9A 3PKZA 5KNBA 4J03A 3SXJA 4AY4A 4L3OA 2VXCA 1KI3A 2H4XA 4C30A 3BRWD 1MAUA 3NYWA 5HFNA 3BPSA 1O95C 2FHSA 4FYVA 4JNCA 3VUFA 4QBTA 1U04A 4RGYA 4YCDA 1RQNA 5DF1A 1EUZA 4D02A 3FFBA 4DBZA 4BNGA 5KQMA 3RH0A 3D7KA 1YBAA 2XPCA 3G82C 4YJFA 4BAUA 4D98A 2O2JA 4FEAA 4K0KB 3UA4A 4ZZ2A 5BPHA 1YF3A 2VHJA 1OASA 4D9JA 1OWNA 3SY8A 3OAAA 3U9SA 4UATA 1SG0A 3E2PA 3QEAZ 5DLYA 2VUUA 2DFLA 5B3JA 1NN1A 4M46A 1H4SA 3H6GA 3MGAA 2SCUA 1GA6A 4ENWA 4ZHQF 1NHGA 3GD5A 4BGIA 4HWGA 2FSVC 5ADWA 4EA6A 5CMLA 1DTWB 2WIFA 2C9CA 2IE8A 2WM8A 2Y0DA 3EQ7A 4IOMA 4I1UA 4HEHA 3JAKA 3RIYA 3RAFC 1HFEL 2ZCUA 4RXUA 2GWRA 3MCWA 3FPSA 5BSWA 1RHRA 4OP1A 1W85A 1Y6JA 3T0FA 1LZLA 4DGQA 2HU2A 2H1WA 1KI8A 2REBA 1WZNA 4P08A 1AOXA 1F51E 4E51A 2R1VA 3DF9A 3ENVA 4BDSA 1F5NA 1WL8A 2WZDA 3A1DA 1S4MA 2ZJ0A 1FFGA 1KP3A 3I42A 4KG7A 3IKVA 4BVGA 4ZEVA 3DLBA 1IHDA 2RGGA 3O4VA 1M8GA 3RO7A 5F51A 4LOHA 1XEXA 3VR6A 3ZHCA 2BVNA 1ZFNA 1V6CA 3GIWA 3IAM1 4N6NA 3ZGXA 4JGIA 1WABA 1HGXA 3OJLA 4Z0NA 1KZ9A 2HSDA 1BE0A 4M9CA 5C7OO 1C7IA 1OFGA 2VJYA 3RFTA 3ZH9B 4RVUA 1IN6A 1U5CA 2W48A 3AVOA 5K0ZA 3SEQA 3USES 5JSFA 4F7DA 3DA8A 3JZAA 2CHGA 2G1UA 4R3UC 4YAOA 5IUKC 3E8MA 4KVGA 3IDFA 4WZ6A 2HDOA 3DV9A 4LMPA 2XKJE 1B8OA 5FWYA 3EPLA 1A8QA 1TUGA 3QE0A 1E20A 2P1DA 4TLBA 5DYIA 4R1MA 5EXEA 3R74A 3GGJA 3R3JA 1WHSB 2A0WA 2ZE6A 2O3TA 2Z8ZA 4V3BA 4XLLA 3V4PB 1GPBA 5CEFA 1F8GA 4XPIB 2MIIA 2A1UB 3TB4A 5C53B 1B23P 2EWVA 2XOXA 4CEJB 1BVRA 1W1IA 1ABBA 2IPAB 4BNNA 1QIHA 1LTQA 3KLOA 2AOXA 4IS3A 4GC5A 2B7BA 4MV0A 4RHCA 4HQRA 4EFNA 1L5OA 1VECA 5K03A 1K8RA 1TM4E 2VPZA 1UWCA 3SHWA 1ISGA 1EPUA 3D5TA 3MGBA 4ND8B 2DPGA 5EJ8A 3ZBPA 1AS2A 1YNSA 1O0SA 3CR8A 3E70C 1F20A 3FLBA 4QBGB 5BV7A 4OFWA 5GZ1A 4E94A 1QO7A 3I58A 1YAHA 4QUIA 3X1WA 2IXBA 3M4ZA 1XRLA 4FXPA 4TYPA 3ITNA 1EHIA 1XD2B 1TMYA 3JU3A 3G9XA 4RGVA 2VZLA 4HGZA 3TLZA 4AWAA 3G9TA 4IMRA 2QUKA 1UZMA 1W2HA 2AJDA 2C9YA 4KX3A 4DZZA 3HTXA 1U7UA 4MHOA 2FSHA 3STXA 1P7CA 4Q12A 4BRWA 3ZC3A 1AGRA 2YHSA 4PQEA 1A9PA 3FCXA 4N7RA 3BMOA 5KWVA 1QIJA 2VTEA 1J7JA 2IIPA 2LD4A 4HFMA 1J2YA 5J4VA 5ICCA 4LRUA 1TMOA 3FPGA 1ZVQA 1PJBA 3QU5A 1QG0A 2OG1A 1IEVA 2DFPA 2B8WA 4CN8A 4C4AA 2ZUEA 2C98A 4QT4A 4NU5A 1YIAA 2A92A 2WZBA 3ETJA 3TRJA 2A9OA 5LR6A 2K6GA 2GN9A 2C94A 2IXDA 1YIOA 2FUKA 1FDRA 2W2KA 4P4GA 1DBRA 4TTVA 2BL4A 3EC7A 3LM8A 3PQ7A 4FZRA 5LZ9A 1URPA 5C18A 1UBHS 2NACA 2ZSHA 4DR5B 1Z0KA 2QOEA 2XXAB 4AJHA 3IQFA 1OBOA 1JFFA 4BZWA 2X4DA 2A0FA 1JP7A 4PLWA 2ZW9A 3WSVA 4UZFA 3BRQA 5AUNB 3EY4A 3JS5A 1N1MA 2I22A 1ZA1A 5KYVA 1SD2A 1PUIA 4CW7A 3V4VB 5JLAA 4D1YA 3SZUA 1M1ZA 1E3EA 2B2NA 4IHJA 5FWXB 5LMCA 4ENUA 1ZXLA 1EQAA 3NWJA 4HNSA 3KU1A 3S7TA 4BNHA 3AU9A 2JASA 3ZUGA 2B8NA 2O52A 3T7SA 1EA5A 4F4DA 1H22A 2WK1A 4LG1A 4ZOEA 2XQJA 3THOA 5KYXB 1B4DA 4G1UC 4C7BA 3A25A 1OLXB 4LZOA 2Z1NA 4HLDA 4AP5A 4ZCLA 1D2EA 2G08A 3FTCA 5IUJC 1PZFA 4C22A 1I4LD 2VJMB 3LDFA 3FWNA 4ZT3A 3ER8A 1PWXA 4ZEMA 2I6UA 3QGMA 4NFSA 1LEHA 3C39A 3L0OA 1QZTA 4OQLA 3BMNB 4PE5B 5F9HA 2JAPA 2NO1A 3ASZA 4QAJA 3V4ZA 4KACA 1G6HA 3G5MA 2OHJA 1UKBA 1USKA 2E5LB 4WLVA 1VL1A 2PKWA 3CEAA 1ZG3A 1UZLA 5LMUB 2ODPA 2JFPA 1K6EA 3KR1A 2IUTA 3M8KA 3D0QA 1Z2DA 4JODA 4W1QA 5A5VA 3KHKA 5HIIA 3H84A 4M8IA 4M9SA 3O93A 3D5EA 3WK9A 3L4JA 5HF9A 1PZEA 3K35A 5KTNA 3WBFA 1XJ0A 3R44A 2I8LA 1C30A 1ZBQA 3EQ9A 2VH5R 3GP3A 3C6ZA 3HXPA 3K20A 4WY5A 4V0MA 5COQA 2YWJA 1M7GA 1BRMA 4HYQA 4XAQA 2CVHA 3TDKA 4QG3A 2Z58A 3PQFA 4Z4GA 2RKBA 4GRDA 1R37A 3DMHA 1NLZA 4ZMSA 2LKDA 3ZPXA 3ETDA 1XSEA 1LPNA 2V7VA 2BM8A 4WBSA 1CUCA 1OVGA 1ZDMA 3KYCA 1PFUA 2BI8A 3F90A 3I3SR 4ZEWA 5K99A 3O8CA 3MT7A 4NL4H 2VF4X 1P1FA 2AFIB 3Q2OA 2VAXA 4WBNF 3OOWA 1X42A 1T35A 4JKYA 1C3JA 3ZWCA 2JARA 1I0LA 1Z7WA 3IUSA 2WV7A 2W6ZA 4L08A 4OYHA 4RACA 1M2HA 1QGED 3MTQA 4G0NA 3TNDA 1MXHA 4F4UA 5CFZA 4L8YA 1P45A 1KFCB 2I4IA 2HRRA 3E6AA 4RORA 1XZKA 2A0UA 1TYCA 2CL6X 2W6OA 2ZBDA 3OQVA 1CJCA 4JLJA 4JLNA 4Q1FA 4E2WA 2GA9A 1P5JA 1W5EA 3IVXA 3SMVA 1F7UA 2RK4A 5BW8A 2BFDA 4O5AA 4XJSA 1GFWA 4B3RB 4E5VA 2GJ8A 3PC8C 4TTJA 1L5FA 1AIPA 1VJCA 4KB5A 2LE0A 2SKCA 3NONA 5FOVA 1Q91A 1KIAA 4KYTA 3D6VA 2FPLA 3GG2A 4DL9A 1T0IA 2O6HA 3M3HA 1DC6A 3JQRA 3EAFA 5MGBA 3L7NA 4AT1A 1I9GA 4JI4B 2UUAB 5AWFC 3M9WA 1X19A 4BO2A 4ENVA 2HHJA 9MHTA 3RHZA 1A3CA 4RKEA 5G53C 1XTBA 5NULA 2P9FA 2B2CA 2EG5A 4CQMB 2Q8PA 4EYSA 2JI6A 5IDWA 2PX4A 3GNSA 1CD5A 4QPNA 4FWBA 1X7YA 4W8GA 4JJ6A 4YJHA 1JVBA 2BHTA 2GRUA 3N3AC 1UOPA 4V2UA 3ZW7A 3R3ZA 1YBVA 1IQUA 2W5UA 4U2FA 4KRYA 1FCJA 4AC9A 4URYR 4YAUA 1PV4A 1W0KA 4UU8A 4DLLA 3ZQ4A 2AFIE 1POWA 1JHXA 5FDFA 1VPWA 1DBWA 4II3A 3TTTA 1SWVA 3WDKA 2FQ1A 1RDFA 4AMGA 3AF0A 3NWPA 4EIWA 2L2QA 4I4NA 4M8SA 2FAXA 2HLDA 3GI1A 5JZ9A 3LBYA 1GXSB 3O90A 7AT1A 1CTQA 2QF7A 1FJXA 1LPSA 4F91B 1KEKA 5PGMA 1BOOA 2PPLA 3D8UA 3FCEA 2YIMA 4R2XA 4U9UA 4Y98A 3SS7X 4YRPA 1L7DA 1GNPA 3VR0A 4RETA 1JSRA 5DX8A 4M0LA 4M4SA 2HR1A 4D4KA 2EX1A 1RQLA 4BO9A 3TGWA 2NX2A 5EI5A 3N7UA 2JLXA 1E1YA 2EP5A 2J3LA 3S6JA 4CFYA 4DARA 4EYOA 5DYGA 2X2OA 2YQZA 5DIZA 4UEJA 3EC2A 4TLAA 2JK0A 3L7IA 2PX8A 4L0DA 4AIIA 4C1NA 4G0OA 4UARA 3N58A 4GYWA 5DJ5A 5E3IA 3G0DA 5K51A 3SQLA 3K6SB 4PG5A 3HKBA 4RIFA 2WUGA 3ZWAA 4CU5A 3WY9A 1PQWA 2JLVA 2J5RA 3I6YA 5I9BA 2DKOA 3HG7A 3PNMA 2IHJA 4UVEA 2YZ7A 1TTTA 3DL2A 3T9FA 1X7ZB 4XYBA 5CVTA 2Y92A 4FILA 1MAWA 2NTYC 1HK7A 1KHTA 1MOQA 5FHQA 4LXYA 1A2KC 4CKWB 5ES3A 1TK9A 3UUWA 4AO8A 4EEXA 4P9NA 4ZO4A 4Z8YA 5M3BA 5KHOC 4BXOB 1IUOA 1K7YA 4KQJA 3TK1A 5HQ3A 4B09A 3OZBA 2Q5IA 3AW9A 4DLUA 1PR1A 4HYYA 4MMZB 3ORYA 4Z8XA 3ZZTA 1RE0A 4LN1A 1AUPA 2X5XA 1RBMA 3CUKA 3K72B 3LCRA 3HV2A 3HDJA 2G83A 4E07A 4F4FA 5CA1B 2BJWA 3NIDB 4C76A 8GPBA 2JA2A 2YRXA 3NC4A 3WJ2A 2QQGA 5T7BA 4G65A 4QRIA 4UHJA 4TMXA 5JVDA 1E2UA 3OBIA 2O8VA 3IHTA 2QMHA 3PIDA 3TKLA 2YWEA 3DAFA 3V7YA 3EXEA 1EFDN 1UZUA 3GEMA 1QGUB 2XBUA 2IZ0A 4S24A 3L05A 3TS1A 2WSIA 1N3YA 4X45A 5IYZA 4YUZA 2BMAA 2ZYGA 3TWOA 2VBFA 1NP6A 4MS4A 5FBLB 4A7PA 4LV5B 3W5CA 1ZL0A 5G41A 3SZOA 1X9IA 2PLWA 3I2IA 2HCRA 4R9NA 2ZE5A 2HDHA 5CM9C 4P5EA 3DL0A 3PL1A 3MTBA 3U13A 4GP9A 4NZ9A 4YDHB 1YZLA 1Z62A 1N78A 3EGXA 4RHXA 1RZVA 1M2VB 2QVGA 3FVRA 2EBWA 1GCGA 2W4QA 2QPOA 4P3YA 3TZKA 5C1PA 4MQMA 5I45A 2PM8A 1C7EA 2IIBA 3DKIA 3RLIA 1Y4ZA 1WEKA 3AB8A 5T4FA 4C6SA 4DV2B 2NP7A 3PDIB 4XGRA 1KMMA 3FAKA 3BJEA 2RI1A 3JQ9C 5GJCA 3ROZA 2P6NA 4D26A 1RXWA 2O7RA 1Z6AA 3LBAA 4ILEA 1EMDA 4JI1B 4JJAA 3LUJA 3WLPA 2B30A 2O3RA 3QMVA 1EFAA 3KL2A 2BFWA 4WBNB 1R74A 1UT8A 3R4VA 5LL6P 3D8BA 3GVIA 5KVAA 4MPJA 1KP9A 3ZN2A 2Q2OA 4IYRA 1II8B 2GCEA 4RZIA 4WESB 1MVOA 1PFGA 3W2EA 3I01A 1JJVA 4PGGA 1CUUA 4CMIA 4ZQIA 4ER5A 1Q0PA 2CK3A 5EPEA 1YK1A 2Z8YM 3RYIB 3WYDA 2IIQA 4RZSA 3WBKA 2KWIA 2X8BA 1PR2A 5CVDA 3BFVA 1BWPA 3PTAA 2Q2NA 3I9V1 1E79A 1OYYA 1UBCA 3PEFA 4LY3A 5JSYA 4W5OA 2VATA 2VHYA 3AG6A 1QIMA 5GONF 1RC1A 2GGSA 2HV8A 4JD5A 5B3AA 2ZRFA 3C8HA 1PL0A 4DREA 2H3HA 3R0XA 8MHTA 1X1EA 2VYCA 3CVYA 1CZKA 1PT9A 4MQEB 4OI1A 4O6VA 4C88A 2NOAA 1QQ7A 1XX6A 1HDOA 1Y3BE 4HWPA 1MJ5A 3N39C 3ICQB 3IPAA 1SCJA 3GQBA 1AKTA 4PAMA 4IR7A 1UMCA 4QYIA 1LPAB 4YTEA 1MC1A 3EH2A 1MRSA 5BP7A 1N2GA 2QRPA 2OQIA 1L8QA 1N0VC 3DD1A 4L27A 3WXMA 4AJOA 5JR3A 1E2MA 3I05A 3UFXB 3RFFA 4DIBA 1EFPA 1DGQA 1YRQA 3U1BA 2OZKA 2ZQZA 3QA3E 1GZ5A 3ZXUB 4ILKA 2FWBA 2J9FA 3RODA 1G2IA 5KTMA 5H4HA 4KDEA 2NAPA 4Y2RA 4DANA 2WWTA 4JJKA 4JUDX 3B1FA 1OKKA 5C8DA 1RR6A 3LSTA 1Q0LA 5DBEX 2NZYA 1RM0A 2F00A 3CO0S 3T3GA 2G9UA 2R87A 2G72A 3BH7A 3EVBA 3DPSA 1NXOA 1VPEA 1CDZA 1VXRA 1K4YA 4KJXA 5EP2A 1CSEE 1IXSB 1PFWA 4Y8VA 2YX1A 4Q9NA 3ZLTA 4BP9A 4CIXA 5BMVA 2GSDA 5BQPA 3R76A 3U56A 2QGZA 3LPDA 4AMVA 2AN1A 2VN8A 2X8JB 3T54A 4Q47A 2FOXA 3EQ8A 3F46A 4FYXA 2WZCA 1DHTA 2Z0MA 4WZAA 3WGOA 3LLCA 2JGJA 1VHWA 2FH5B 1OBHA 4GNRA 2G1JA 1XNJA 4KKVA 5KNCH 3QNMA 2WOJA 5HKLA 1BH6A 2VNIA 4YC7A 3VOSA 5EERA 1QH8B 4X9XA 1H66A 4BL5A 4TKVB 4F2GA 3DE1X 3VX3A 4E09A 2I91A 4BUCA 3E61A 2EEPA 3TLBA 4FFRA 4YP9A 1Q7EA 1XRNA 1K9SA 2CB9A 4AJNA 4J0EA 1T1EA 2QMOA 2Y99A 2YV4A 3HCFA 4MSUA 2IDKA 3DHVA 4HWSA 3HPQA 1T3LA 5CLLA 5DWDA 4FDMA 1XTTA 4XVUA 3SQWA 4WKCA 5DGIA 4LSWA 4NXMB 1NW8A 2VPPA 3PEVA 2WD8A 1XA0A 1UBGA 3GFGA 5FB3A 4URZR 5FUVA 4D8XA 2GN1A 3OM0A 4TTIA 4REQA 3THRA 1W6RA 1GKIA 1GL7A 3LYUA 1QFJA 1A97A 1D5WA 1Y48E 4NNJA 1U63A 1Q84A 1V5EA 3CLSC 4UNIA 1JGTA 3K0CC 1NOIA 2G8NA 3JQ8A 5IDYA 3VBCA 3OMLA 1CJKC 2XXJA 3DC2A 4HRYA 1I5EA 2H7VA 4KI0A 1DHRA 1DEAA 1R27A 3HE3A 3LA8A 2VP3A 4DLAA 4W5QA 5JJIA 2VJOA 5FQNA 4GEGA 3CTPA 3I28A 5JW6A 2DY0A 1L1FA 4LK2A 1E60A 2BEKA 2WVJA 2ZI3A 3IERA 3TR0A 1FJGB 3E84A 4URWR 1F4LA 3QMPA 2L82A 4QREA 3ZHRA 3UJ8A 4ZT2A 1E66A 3OC6A 4JZKA 4DABA 3Q9UA 1UPTA 3A6FA 3RBVA 2QYSA 1WW2A 3C5VA 4OHXA 4G07A 3BJMA 4UMEA 3HLTA 4UU1A 3QI2A 4B43A 1JDUA 5SV2A 2HT1A 2RDMA 2CN1A 3AFNA 3IAFA 4MVJF 2Q50A 5IDXA 2CT8A 1XZJA 1NLUA 4FNOA 4J2OA 4Y2VA 2G1KA 3WDSA 3C8UA 4MB6A 2GXQA 3VQTA 1XCGB 4HZIA 2DT8A 4ADSG 2IHKA 1BJRE 3QIAA 3LC1O 4BPBA 3I6ZA 2MSCB 4GLFA 3I76A 2B98A 1RZRA 4G36A 4URFA 2XUIA 3AG5A 4LTDA 2AOWA 3HSSA 4O4JB 3VBEA 3N28A 4J7UA 5I9TA 3UHPA 1AV6A 3CU5A 1AC5A 1Z75A 2CFOA 2IEAA 2A5YB 1XZLA 3E0QA 2PX0A 1KKLA 3TTXA 2VHQA 2F4VB 4OM7A 1JZTA 1MPXA 1W35A 4Z9BA 2PR7A 1JL3A 1D2CA 4Q4JB 3LQ2A 4MA4A 4D9HA 1SEVA 3UV7A 3GFRA 2G6BA 1DE0A 3QM1A 4JI7B 2IHTA 2H1HA 4JAVC 5HMMA 1TEZA 1L4EA 2J31A 1UUFA 5FBVB 3NNNA 4AKIA 1KAEA 1NVVR 3AEUA 4E5PA 1JR4A 2IBSA 1IDOA 2ZIXA 4GVPA 2JCBA 4YFYA 1N34B 1MJGA 1YRHA 2CLHB 4HO1X 1HNWB 1FMTA 1ZUNB 3O21A 4F4CA 1OAKA 5UKDA 1BFKA 5FPHA 1SFRA 3D59A 3C3KA 2LNDA 5SZIA 3QH4A 1JKFA 1KK1A 4DA9A 2Q6OA 2YZKA 5EWMB 3OVMA 1MMFB 3GCGA 5EUMA 3KTDA 3QOFA 4S05A 5DNAA 3WLMA 3V97A 3QXJA 4OLHA 4K3VA 3FRHA 3RS7A 3TE6A 2WT9A 4DRZA 2C0PA 3ANNA 4AX4A 5AKGA 5GONB 2O2GA 4O4LA 2RGBA 4L4SA 1HZZA 1WXQA 1GPAA 2AEFA 1KC3A 4MR7B 3KZKA 3VPCA 3AUFA 4A26A 2C5HA 1I30A 1JQDA 4M1EA 4YLEA 4JH0A 4TWJA 3WGGA 2PXAA 4C3VA 1X14A 3RUEA 5IXYA 2YJTD 1YKFA 3U3MA 2IEBA 2AD5A 3E9QA 1G64A 1EWQA 3VPSA 1UJ4A 3IXQA 4EYKA 2PE5A 1XKTA 5ALIA 4DG5A 4OO3A 1ODIA 1A5SB 2WIKA 4IQ8A 3SD7A 3C1UA 3G7SA 5FUMA 5A4DA 2XZLA 4OQFA 2DBVO 3BE5A 3ZDDA 4H7PA 1G20B 4OQMA 3BRWA 3U17A 1YBMA 5D2CA 1DEKA 3I6QA 3DTYA 3IQIX 1RS0A 5IP5A 3O1JC 1E3JA 4ABTA 5EYPB 2F8MA 3JWGA 4FGZA 3KOYA 3ZD6A 3C3WA 3IKJA 4JI2B 1AO3A 1WHSA 2QIPA 3BK7A 4Q93A 1JA0A 1K4KA 2QTHA 1EP1B 2J5KA 4YJKA 4GYKA 1RWXA 2XMQA 4CEJA 2C8KA 4D42A 4KR6A 1TM1E 1AO0A 3BE8A 4AB1A 2BP7A 4DLZA 2M6KA 1MAAA 3KKOA 5FA8A 2WVHA 3HFJA 3S2GA 4B6QA 1L7PA 2QG9A 3AF6A 4RD3A 3RRFA 4EW2A 1DFIA 1T36B 4JQCA 1M5RA 1HT2E 4G89A 2Q29A 3QTBA 3T4UA 2FX3A 2ZYTX 1XRRA 4IQ0A 3LVQE 1NVWQ 3KL4A 3QZUA 3W8NA 4ZI3A 4G3XA 1NNLA 1MIOA 1ORTA 3ENZA 3GB9A 2V0CA 4CLEA 1HPLA 4KK3A 4LV8B 1NVEA 1Q21A 2VJAA 4QHYA 4YFVA 2V5VA 1U2PA 4RF2A 5JAPA 1UXJA 5MGNA 1KFEB 1IHXA 3O1LA 3AUAA 5JC1A 4ZVQA 4OBEA 3UOWA 3D2CA 5JAZA 1U98A 2O50A 2WSLA 1WDLA 5JBNA 4A6EA 1COZA 4XOIA 5E0KB 5GAJA 5CVEA 3RTGA 1XAIA 4DR7B 1AMOA 1LQUA 2XNSA 2H52A 2QJWA 4E4TA 4X93A 4EB3A 2D5LA 2JCXA 3D0KA 3CNBA 5KSYA 621PA 2SKEA 5J9FA 4XXHA 4DB2A 2OHIA 5CT4A 5LOVB 1H1TA 4DZRA 4DMLA 3HDVA 4DJJA 2VSQA 2QX8A 2VJLA 3DMFA 3S28A 3PLAE 1W4LA 3LFTA 4MQ5A 3T5GA 4C4YA 2RKWA 4JL5A 2PH3A 2EKQA 4KQ6A 5KEIA 1JU3A 4F1JA 2IDZA 1N6PA 1SVOA 1KZ4A 1EESA 1U6KA 3MXOA 4H1TA 4KQEA 4RM2A 2RHOA 4EMUA 5JNLA 4QUGA 3ZE8A 3E0XA 5DH9A 5IEJA 3FOZA 1E7MA 3AEXA 3LT1A 4JFRA 1R0LA 3LZDA 1IY2A 3TOCA 2VSFA 3WS7A 1G8AA 5E8RA 3WA7A 5D5PA 1HKHA 2PIDA 5ALUA 4FD2A 1SCNE 4J7AA 5IBRA 1NAHA 1AKRA 2XUHA 4H59A 3D6AA 4MKGA 4CG3A 4PGMA 3ZNOA 1IG3A 4NZMA 3IJ5A 4QU8A 2PWYA 3OE1A 3BE6A 1TM5E 4CNQA 3JQGB 4RFVA 5SYNA 4HQLA 1DJLA 3D4IA 5FWXA 3G7NA 3PNBA 3HGTA 4HUTA 4YAJA 3RT7A 2XMPA 1GLGA 2JCSA 1V16A 4JLVA 4U7WA 2R7NA 5G0VA 4S1WA 5DNEA 2FEMA 1C7QA 4BFCA 5AKYA 4UCXA 1R0RE 4RJIA 4UM8B 2Q07A 3ADOA 3TVDA 3UYKA 3LY5A 2WP0A 4C3ZA 4DIKA 3ANTA 3OTHA 2VJMA 3KYDA 5AOCA 4FFNA 4QBKA 4QJ4A 3RWOA 3LC2O 1WU7A 3QVMA 5A4MS 3BMNA 1FLNA 1TQHA 4DSTA 1YVUA 2Q4DA 3ND8A 2QN3A 3ZE0B 3T99A 3JYHA 1N9KA 3JASB 4PNHA 1DNPA 1T5IA 4GZ6A 2JGLA 4NE2A 1W34A 3D31A 3EA5A 4MH0R 4JI3B 4D4MA 4YQFA 1Y6FA 1CJUC 1NC3A 1NULA 1XTQA 2GN4A 3UWOA 5M34A 1G5FA 1USVA 4WXYB 3NANA 3CKMA 1SN7A 4X54A 4XYGA 1JDVA 5G4KB 4BQPA 4YRNA 3O7MA 4EVSA 2GA8A 4QXOA 1DKOA 1JLSA 4K6KA 3ZIAD 1PEAA 3VR1A 2C1XA 4C04A 2OV6A 1Q0HA 1NOJA 1ECPA 4RA9A 1DG3A 2X8AA 4RMNA 4EB6A 2FZ4A 4S2EA 4W5NA 3PUXA 4P3PA 4DPLA 5SYMA 3UQZA 1AUOA 2YZGA 3HO8A 3K9WA 3VTFA 5JYEA 4RPIA 2FJPA 1AJEA 2OV4A 1AGPA 3BL6A 3EODA 2G9ZA 3QXCA 1M67A 2CJYA 1HDCA 3GJ7A 3MCAA 2CUTA 3BTOA 3S2EA 3IQWA 1N6HA 5EAIA 3A4VA 3FJOA 2BOVA 3OLWA 4PHGA 3GEGA 3M89A 3GWGA 1PF7E 5IF9A 3ZOZA 2PH5A 5FUWA 4G56A 1A8HA 2QYHA 3HP4A 4Z3DA 1SVLA 2VZ8A 5BV8A 3JSXA 4ZRNA 3FWKA 1E3WB 2A78A 2FUG1 1QR2A 3FMIA 1VI6A 4H27A 4K05A 5AD1A 1Y9JA 1T3SA 4C2AA 2VAVA 3DZCA 2PZBA 1PUJA 3CXUA 1NMSA 5AFSA 2GX6A 3ZDBA 1RU3A 1BE1A 2R6ZA 4AJEA 1OLUB 2D8AA 3M81A 2QRJA 3N76A 4L5IA 3P9RA 3VU9B 1Y0BA 3KX2A 4ZVLA 1R5BA 3TNFA 1RAFA 2DC1A 1YR3A 3M4XA 1WCWA 1ETHA 2R1TA 4I08A 1Y5LA 1KGDA 2AT1A 2ORED 3VNAA 5FV4A 3AFMA 2R8RA 4OHCA 3ADPA 3GMIA 1KI6A 5EC8A 3W04A 1NY5A 3GEDA 3ME5A 4H15A 4OPMA 4PTYA 2JD1A 5EIBD 1CUBA 1IWBB 2CCGA 5EIXA 1ZY2A 2QWXA 3R9WA 2PTGA 5MN4A 1YH3A 2GZMA 3LO5A 1ZICA 1P9LA 5B1EA 1M1NA 3NBFA 4WFKA 1VSTA 4NZNA 3QX7A 4Z4EA 3HCDA 3DZHA 2AW3A 3UENA 4D9NA 4EGFA 1C4KA 4XGIA 1Y4AE 1VYVA 4L5YA 1L7XA 1NX9A 2G28A 4OBXA 5AIBA 5BWOA 2VJDA 1JEQA 1ISFA 4N6GA 1TFUA 1OI7A 3O47A 4PVCA 1GXSA 1Y7PA 3VZRA 4AJ1A 4CTMA 2VKQA 3KEOA 2XKBA 4E3ZA 4D5EA 2B5WA 3H18A 1ISPA 3G8CA 2IYRA 2XB8A 4JJIA 4EHIA 3GLQA 2XECA 3VR5D 3OIWA 1KY2A 4KXLA 2Q2VA 4EHNA 521PA 4RTLA 1GPH1 1ZVKA 2ODNA 3QRWA 3UZUA 2SKDA 4X7MA 4CV2A 2B35A 3K0AB 1ESCA 1QIDA 3OKCA 4KKXB 5FUYA 3K2BA 3ONVA 4UFPA 1AKEA 4WY2A 1P1KA 4U9HS 1ORWA 4KAXA 2WDZA 3G0BA 3PUKA 5B53A 1R6DA 4UE2A 4PWZA 2OWEA 1J0BA 3I9OA 2A58A 1PT5A 1E92A 2JG3A 1A4XA 4BB6A 3GDOA 3ZWPA 3SSOA 3K6SA 3A06A 4O29A 4EHKA 4FE7A 5IX8A 3ZDQA 4C3OB 5EWJB 2RBEA 4CKCB 2PUFA 2QENA 4WA8A 3OUTA 2JIBA 5AI8A 1V6SA 4D4JA 1IN5A 5GY7A 5KNLA 1SU7A 1JKJB 3CT6A 3IOCA 1KAGA 1N33B 1E2BA 3MPUA 1LDNA 2Y66A 1SBNE 4K9RA 5FJJA 1KSGA 5CDYA 4CKWA 1HC7A 4ON9A 1P2VA 1YCDA 4YMUA 4BIMA 3FLEA 3ESBA 3BT7A 4EAAA 5AK4A 2QPTA 1XA3A 1E3IA 3AM4A 1BDMA 3Q5DA 4NAVA 2BEVB 3F67A 3TLGB 2QSZA 4ZGWA 5JY1A 4J0KA 4OX9B 4H3VA 3QVJA 5DX1A 5CA1A 3RKSA 5CW2A 1HORA 2YRWA 4UHHA 4YAIA 3HA3A 2JAUA 1XZEA 4IJMA 3I6IA 1QP8A 4TZKA 4EQZA 4QSHA 3IOEA 1I4WA 1FVHA 2OPBA 1G8HA 3W2FA 3CH6A 1N0WA 4QPCA 5B3LA 1HY3A 5HCUA 4A16A 2WJ6A 1KQPA 3J81A 1WETA 4MUAA 3OZTA 1ZIXA 1J24A 1QGUA 2C9BA 2VA8A 3UAZA 1E2PA 2JBAB 3C97A 1QNFA 3KJHA 1WKBA 5EIEA 1UZAA 1CQIB 4LUCA 2WM9B 4EUEA 1AGYA 3A1VA 1WUKS 4Q3NA 2FMXA 4JBLA 4NHEA 5COAA 4YP5A 5LQNA 2HWXA 2PUDA 4EY4A 1CUSA 2WYVA 4G0XA 4X64B 5ENZA 1RJ9B 1ZINA 2VDUE 3V2UA 3FLMA 4LBVA 3W1VA 3A1NA 4DILA 2R6R1 4WH0A 3M6VA 1WZCA 4O25A 4B32A 3RWMB 1TT5A 5BSRA 2Y9MB 1SAYA 3QPAA 3UMFA 5LP1A 1J8DA 3G6WA 1ZNQO 4G1VA 1N1DA 4DZTA 2PUTA 3K5HA 2C0QA 4RJTA 2ZBGA 3NYRA 3OFKA 4FDUA 4R7TA 3QJ5A 4YR7A 1F0KA 1VJ5A 1GZUA 8AT1A 4MVWA 4XX1A 4QOFA 3PE4A 3G8YA 1K8YB 2FPUA 3DOJA 2X6TA 3TOSA 4CM6A 1O54A 2OM2A 3DQZA 3LSYA 4G4IA 4LECA 1QZZA 3F8TA 3HLYA 1B74A 1G1MA 4X7BA 3EG9B 4S12A 1A96A 4KN5A 2X1HA 3RUHA 3KTAB 1DRKA 4Q5IA 2VDOB 4CV3A 4TXNA 4UHBA 1AZWA 1PHPA 4ZHSA 5IFLA 1Q7RA 1SQFA 5DK4A 1TAQA 4FFWA 3ADKA 4D8TA 4F97A 3LT5A 1YOVB 4V0LA 1E64A 2XUJA 3BCSA 3RR2A 4EM6A 5HIKA 3HM9A 2EL7A 3Q7RA 5JO0A 4A15A 1JI3A 5F1YA 2O2EA 1HE1C 1UCFA 3U5TA 3K9LA 5JADA 1Z07A 5LBIA 5P8WA 1AXEA 4UEKA 5AI4A 2A30A 2EX4A 3NC1C 2IPNA 3TJMA 4RE5A 2Y76A 3M7IA 3G89A 2F1JA 3HGMA 2EBUA 4B2PA 2ZLBA 4MZXA 1Z6GA 2OD9A 2ZYUX 3P9PA 4URHA 4KITB 1G59A 1TCBA 4R2MA 1G41A 3P94A 3NHJA 3ZVLA 4NONA 2IQ5A 1PLKA 2CJWA 4MQEA 1EFUA 5JU6A 5M5BA 2I9PA 4W63A 2YDXA 5JNSA 1I7QB 1YZYA 4JB8A 4CCYA 2ZYIA 2R751 1BWRA 1IPHA 1DDIA 4MRRA 4ALNA 4BIIA 3GZNB 5FPKA 4GOLD 1MHPA 1Z56C 5ERXA 2D7DA 3GJSA 2ZJ4A 1CJBA 1JQLB 1ZH4A 4KXVA 4OHOA 3B9BA 4PHFA 3OZXA 5AKHA 2RGNC 3HJAA 3IAS6 4GPAA 1IH8A 1RRMA 3MWDA 2ZB8A 4J0QA 4KNWA 4ZK6A 1ZITA 3AHEA 3L7BA 1CS4C 1FUIA 4E46A 3H5TA 2ZT5A 1ZCJA 1FRNA 4GMDA 2WV9A 4XASA 1N2EA 1D2NA 4V02A 1Q3TA 3C41J 3QENA 1T8YA 1L7EA 1XCOA 4BCBA 2PK3A 3PR1A 2DR3A 3FRIA 4CL8A 1UQTA 2I6GA 1PZMA 2BJHA 5KVVA 2XGJA 2HDNB 2OSVA 1KY5A 5HRCA 2HF2A 3F5QA 2W22A 1SIBE 3KLMX 1XCMA 1LLUA 3DV2A 3KQWA 3PE3A 1A9TA 4FS3A 4NBWA 3ZHZA 5I3ZA 1Z6QA 3W5AA 4AUEA 1PN3A 2RC5A 4QO7A 1UEXC 1N5MA 2ZYAA 4I4LA 1SKBA 2QK4A 4AZTA 2HBRA 3U4GA 1JU9A 4ICIA 5FADA 3TLXA 1NZJA 3IKMB 1D0IA 2O8CA 2WFMA 2FG7C 2EWMA 4IOLA 1CR0A 2HA2A 2IW1A 2OZLB 4RMIA 2AC2A 1L8AA 2R47A 4N65A 4R1NA 4AKSA 4G8BA 1KVRA 5EUCA 2IYFA 2M9MA 2IH2A 4TYYA 2PL9A 4GOJA 1H2BA 4IIXA 1NUSA 4OBBA 1J07A 1EZ1A 2EW1A 3DE6X 3G2HA 4HDOB 1JHOA 2HI0A 3AFGA 1GV1A 5CDHA 1B6RA 3ODGA 2G76A 2J48A 2NUBA 4H3KB 4OVKA 4OXIA 3FMVA 4NK4A 3G68A 1ZN9A 3G2QA 5LFAA 5LP6C 3DWIA 5JZMA 3G9UA 4B3TB 1E5TA 3VUEA 3QF4B 4CMEC 2VDWA 4C7VA 3ISVA 4BNTA 1EB9A 3HV0A 3LCMA 1DC3A 4C87A 1OA1A 4KAFA 3OFSA 2R8XA 3QELB 4PZDA 1QVVA 1UBEA 4PG8A 4WVFA 3I2HA 1XCJA 1DIRA 5AOAA 4BX0A 1UBTS 2H7YA 1HQKA 4MLCA 3L0IB 3EAGA 4DCTA 1PJAA 4CBVA 3MRVA 4I6JA 1MOSA 4LHWA 1P2TA 1RW4A 1UAAA 3ILSA 4WDRA 4M9UA 3RYHA 2A35A 2YJ5A 4MYHA 1CS0B 1QYVA 1SUSA 1UR5A 4JXKA 5BR7A 5C7IO 2AXNA 5IBPA 2JLWA 2VG8A 3H75A 2C97A 1SCKA 1XUOA 3R1IA 1FP6A 2WUDA 3WTCA 5BNWA 2R7LA 4N5NA 2C54A 1ZD2P 2R00A 3NZEA 3P9YA 5EXPA 5BURA 2HV9A 5K0FA 1TM2A 1GOTA 2W2PA 4IGAA 1FRVA 3Q2KA 3ZQ6A 3VSCA 1J2UA 4EGCB 4MB0A 1WQ1R 2W2QA 3C3AA 1DP4A 2YQ5A 5E38A 2RIPA 4EG0A 1D5CA 4F2DA 5HPYB 2J5XA 5HFJA 5BN5A 1R4NA 1BFUA 1NBHA 2AQIA 5FTKA 2BMEA 5L3QA 2Y0EA 1YZUA 3CQ9A 5CIYA 1W9HA 4S1VA 3I64A 2PSFA 2XWSA 3R0VA 4FHZA 5DKFA 1UC9A 3NWEA 5H3CA 1I32A 3EPRA 4C6TA 2BISA 3FOEC 4LJRA 1UJ6A 2PZ8A 3D0RA 5K0EA 4HMPA 3EK2A 1JG6A 5EJ9A 2WJPA 4BO1A 4BEVA 3RAGA 4K3UA 2FX5A 3K09C 4YALA 4LBZA 4PHCA 5A4IS 1SULA 3NOOA 3TCXB 2YFHA 2H29A 1T9ZA 2WJYA 3BWDD 1W73A 4YWHA 4EDFA 1U94A 2FN3A 1YL7A 3TXAA 1VKOA 4II7A 3V33A 1TRHA 5D8DA 2CVPA 1LBQA 4U02A 5FOTA 1QF9A 2MJLA 5I8WA 1M3SA 4Y1FA 2W37A 1ENZA 3UM9A 2V4ZA 4UBMA 3AUXA 3UOAB 3ZLBA 2B4YA 3FYUB 4MVYA 1H2AS 1U8XX 1OLOA 3BDIA 3NLLA 3PVZA 1NJFA 3UMGA 4MAFA 1JB9A 4FKMA 1MQ8B 3DMGA 2NAFA 2OM6A 4QOEA 3V8VA 4U2KA 5HKKD 2HADA 2VPIA 4LHXA 1P3Y1 3C8MA 5BORA 2HCTA 2N9UA 5EJMA 4B48A 3E15A 4DT1B 5LPNA 1MX5A 3WYFA 5E6SA 5BY2A 4MUXA 5KREA 1QH1B 2NN3C 4AJIA 3ZDAA 1EK1A 1PSWA 3DBVO 3PJEA 4YPOA 4ZYWA 5EMHA 1BYUA 2OBYA 4O4LF 1PNTA 4LE2A 3IELA 4FN5A 3EHEA 3KXIA 1LKZA 2OGUA 3HY6A 3LRXA 4IJQA 2QLMA 5A4FS 3PQ3A 4M7PA 2G04A 4ENTA 1XB2A 3L43A 1Z45A 4TM8A 3EQ6A 2CKDA 4ZFNA 4UM7A 3MS4A 2P6PA 5AOVA 5J47A 3KFVA 3CN9A 4J0FA 5DPMA 3S68A 1AZSC 3NJRA 4O08A 5G4LA 3CVXA 1NVAA 3CGWA 5EYPA 4HVLA 5EPUA 3WLTA 4TSKA 4JHXA 2QVLA 2PLNA 4MI6A 1YJ8A 5B1SA 2WNIA 3QVLA 3VNSA 2ZR9A 3K9BA 1U1CA 2XGMA 1W49A 3FNFA 3HB1A 3NCHA 3TR6A 5AM1A 3VPBA 1X2BA 4DRXA 1G55A 2YWDA 4FCTA 1RXUA 1P61B 3CEHA 2Q0SA 4WCDA 1T6BY 2FMTA 3FOWA 2Q1UA 2H08A 1KI1A 1P3DA 5FEUA 1PG5A 2A86A 2Q3BA 3KZXA 4V0RA 1V11B 4LWOA 5TIIA 1ZD1A 2R5WA 2WWRA 3L7AA 4ZCQA 1ODSA 1W0JD 3HVIA 3OUUA 4FS8A 2JFFA 4HXYA 2JGMA 4P7JA 2BBTA 3H2JA 1E18A 2XCUA 4FKZA 1OX4B 1QMPA 1TA9A 3HJTA 2Q28A 3ICWA 3M3PA 4K9NA 3NALA 4ZOLA 3WRWA 5ED4A 1Y3CE 1H2EA 1XK7A 4JP2A 5ARBA 1IJEA 1ST3A 3RS3A 4JQYA 4NK5A 1MHTA 4NU8X 3U9LA 3BQ9A 3CJQA 1PJZA 4OI4A 3OO0A 5TMBA 4HZGA 2F48A 4EI2A 5JWHA 2O0KA 1DKMA 1E1RD 3AJEA 4M1ZA 1YQ9A 2C0CA 5FWDA 2O2DA 4JSYA 4QM7A 5DTJA 3ASUA 3I53A 3V1NA 1HRKA 2QN7A 2ORWA 3EZNA 4X91A 4EHJA 1FP7A 2ZT8A 5LOVA 3PC6A 2N75A 3WLKX 1J21A 2CY0A 3ZGLA 1K75A 3BTUA 5EGNA 1XTRA 2RGAA 2RHLA 4HF7A 4KN9S 3C1OA 4ONEA 3UAYA 4CMJA 5TR9A 1IHUA 1O9BA 1Y9ZA 3QX9A 2Y4NA 3DEFA 3PD7A 3ENNA 3N5KA 3LQQA 3C1TA 1UH5A 1TEXA 1X1BA 3WGJA 1JFTA 3MWLA 4RS3A 3NRJA 5GIOE 1RRGA 4NPHA 1E8MA 2FUNB 2I71A 3LXMA 4CLOA 4EF5A 3QBJA 1OFIA 1N2SA 1EIZA 1GEEA 2EJVA 4N03A 4PV7A 5CVCA 2IWRA 5F52A 1MO3A 3ESRA 1TT7A 1QAMA 1TIPA 2E5WA 3G8DA 2LZ0A 2UVQA 3CW2A 3A1TA 1M2GA 1JHQA 4CF4A 5A3SA 2ZSAA 3A6HA 4MW7A 2CBXA 3JX9A 2EFEB 3P0HA 3RTBA 3BGDA 4LDRA 1MLDA 2PKQO 1XBTA 1R2QA 3EWIA 5AH0A 1Z68A 1V8PA 2O0MA 2WE7A 3B6KA 5ICGA 3PFBA 1KEEB 4LWZA 5J5CA 3BS4A 1C9KA 2X5NA 1J4AA 4MITA 3MINA 5HTKA 1A8IA 3PGJA 3UCXA 1P4HA 3KPVA 4FJ1A 3NUQA 2OG2A 4UQPA 3ZGOA 5B1YA 1S8AA 1F3LA 5KTSA 1S0UA 1Y1RA 2Q4OA 4OUDA 1PVVA 2GZSA 1IN4A 3SF0A 3QG5A 3WKDA 1JVNA 3HFSA 3OZSA 5EUBA 1ZGGA 5DSZA 1TU0A 4DIDA 3O2NA 1NVDA 2DY1A 1WW3A 4RY8A 1T26A 1C7ZA 2PKCA 2X9GA 4D3DA 4EY3A 3BJIC 1JUDA 1X0XA 4W9MC 1MB3A 4TRJA 3PT5A 1M2KA 2PANA 3PDWA 3JASA 3S2UA 1R8JA 4JSRA 2AG6A 2XTAA 3UMYA 1IBMB 3BHJA 5F2OA 4LSMA 1U6IA 2WIJA 3O1HB 3HP7A 3W77A 5JS8A 4XUDA 4LC1A 4DR6B 1O94C 1L3BA 2WHEA 2CWWA 3TEJA 3TW4A 1HI9A 3KB6A 4Q1BA 3GP5A 2IYOA 2GH1A 3P4UA 4FU0A 3L46A 4K7JA 5TB5A 2KE5A 3GYBA 1L5YA 3CMMA 1YBHA 4LOKA 2D00A 3IB6A 3NYQA 4NE9A 3TB6A 4HLUC 3UXHA 5AQ1A 2J33A 1Y6GA 1GU1A 2AR9A 5COBA 3BIWA 5MN5A 1T4DA 4NMHA 4EUNA 3TUZC 3F71A 2VP9A 2WEKA 1E7WA 2HNBA 1HNXB 4D3SA 1Z0ZA 1AF7A 1BTOA 4BQSA 1A1VA 3G0IA 1OIWA 2AMVA 2Q21A 4U7HA 1GRRA 3UXEA 1S2IA 4QARA 2VJPA 1PFVA 2BCGY 3K8ZA 5JCJA 3PC2A 1V8ZA 2NZJA 1JLMA 4JC4A 4LXTA 1FQWA 4LHEA 2ASVA 1CY7A 5ALYA 1QQBA 1GPWB 2F8LA 2J0VA 3EXHC 1YQEA 2B21A 1N2HA 1TD9A 3OX2A 2QMUA 2WWFA 5FF9A 3UJ6A 4ZJYA 1SNYA 1X80B 4FK8A 1KI4A 3GG9A 1A88A 3RSZA 2IYZA 2ECKA 3AMVA 4R8KA 4NBVA 2VYVD 1WSDA 1UBRS 1SO8A 4A6XA 4AW9A 3R77A 2R86A 4HVTA 1VGQA 1XMOB 3GJ5A 5THXA 1XA4A 2OB1A 3E7DA 3A4NA 3BIJA 3LDHA 4NFLA 3HLKA 3MHPA 3IR7A 3D6TB 3C7KA 4I55A 2A5JA 4RK5A 4BNWA 1E94E 3AM5A 2KS6A 1HYBA 2NM0A 3DOHA 1C3OA 1XEFA 4L85A 5REQA 2FR0A 2W4MA 4E1VA 5TE9A 2F3PA 2GDJA 1USWA 1ZRSA 4K9LA 1US8A 1ID8A 5D3ZA 5LZ5A 3RG8A 1U28A 2VYQA 2ZSBA 4NQZA 4UTOA 2FI1A 3B2QA 1AK1A 3WL7A 4GDFA 1N77A 5CLGA 5JSHA 4DSNA 3CC8A 4PS1A 3CZMA 4UUBA 5C31A 3RVOA 5K6TA 2QGNA 4KJZA 1P4RA 1GDDA 2GLUA 5K8JB 3GP8A 2HXYA 2ZIFA 1Z3CA 3O75A 2WKSA 5IWCA 2CFTA 2GEUA 4JASB 1F0YA 3A36A 4J75A 2OL4A 2UYYA 1TPYA 1GZ4A 2XUPA 3FSJX 2FTKE 3PRYA 1DAIA 4IGEA 3ZIAA 4LIPD 1P31A 1I94B 1U7OA 4MVJG 9ABPA 3J81k 1TKAA 4DBLE 5EJEA 1LV8A 2RGCA 2OXEA 2VHWA 4I50A 5CYPA 5FCDA 1ZCZA 5JI2E 2C82A 2RCNA 4X1IB 1A5AB 5TX7A 4BWGA 1XZCA 2VCEA 2B1IA 2ZJ2A 1U6JA 3SKYA 3ICEA 4XSHA 1P5ZB 3M9XA 4IV5A 4HK4A 4D57A 1FSFA 3CZPA 3QLTA 3S5UA 1SUIA 3DDNA 1UWLA 3KPYA 4L02A 5LZ7A 1TL7C 2GAAA 5EMNA 3EEIA 2ZTSA 1PKEA 4YP7A 4MRPA 4D0NA 2R8BA 5CAEB 3EIUA 2QSYA 4CIAA 4WN3A 5ICEA 2IF0A 4DY4A 1TYBE 4NWIA 3R23A 1YHZA 2B8TA 4BFWA 7REQB 3OSZA 5HFAA 3RHSA 1UBSB 3JYPA 3R7AA 2CXXA 5FO1A 4DM3A 2INGX 5HJ7A 2TRSB 1JXAA 4ENSA 4S1TA 1CJTC 3BICA 3TNJA 4DMRA 2PIAA 1DVRA 1JKJA 4FSHA 4R81A 4BMYA 3WIUA 5EZYA 2E3JA 2PH7A 4IKEA 4L15A 4NCNA 1LDMA 8ATCA 4RY2A 1QZ3A 3OO1A 2D8MA 5KIAA 2XDAA 2JKYA 4EG3A 1XPOA 1DCMA 1I6KA 1U2DA 3LF1A 5JXGA 3JZFA 3TLGA 5IVKA 1ZZGA 2GZAA 2OCLA 2WSMA 3O2QB 4QU5A 3SSMA 1M76A 1B76A 4IV0A 3ZHVA 4AYTA 3E9MA 1N32B 1L4YA 3B82A 4J1NA 4H18A 4X1OA 3M3DA 3KFXA 4P92A 5F3DA 1VBMA 2QT1A 4HDNB 5G02A 2WTBA 3T1TA 4YCJA 1TLFA 5A5GA 2WB4A 1ZVMA 3IQEA 4DMHA 1DWQA 2B8EA 1H1DA 3BSFA 3C3XA 3WQSB 5EKUA 2CNWD