4OA8A

X-ray crystal structure of o-methyltransferase from anaplasma phagocytophilum in apo form
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
214
structure length
214
Chain Sequence
SLSKQDEYLNKLFAVDTEGALKAHKTAPSELRMAQLGTVEGQMLQLLIRMAGIHSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTANQNIVNCKLEDKITVLHGEALAQLNTLKEMAPFDMIFIDANKSSYLAYLNWAKMYIRKGGLIVADNTFLFGSVFDEHPTEKVSSNAHASMRAFNDELANKEKYLSTIIPTSEGMMVSIKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase family protein
publication title An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.
pubmed doi rcsb
source organism Anaplasma phagocytophilum
molecule tags Transferase
total genus 76
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4oa8A00
4FT4A 2YX1A 1KPHA 1M6EX 2ESRA 2H1RA 2I9KA 3SSMA 3HCAA 4M36A 2QRVB 3G89A 3GRUA 1D2HA 2XYVA 2XVMA 1QANA 4PYKA 3EVEA 1NW7A 4Y2HA 4Y30A 3HCBA 1EJ6A 3DXYA 4PWYA 5DTMA 1I9GA 5HIKA 2O0LA 3LKDA 4X60A 4F85A 3B5IA 5K03A 4RTLA 4F86A 2PWYA 1NE2A 4LG1A 3SX0A 2IPXA 3BKXA 2YXDA 3V97A 3I9FA 4BLWA 4ZTBA 4OA5A 3EVAA 1YFJA 4RTSA 1AF7A 3H2BA 2ZFUA 5CCXA 2FHPA 2OZVA 2E5WA 3CJTA 5CVUA 5EEHA 4EMSA 5ICGA 2YXEA 4IV8A 4V0QA 3I53A 3G5TA 4DCGA 3BWYA 3DMGA 3FPEA 4RVGA 5CD1A 2G70A 1R8XA 1VIDA 3UZUA 3MCZA 1D2CA 1ZKDA 1VQ1A 1INLA 5DPMA 5DM4A 2FRXA 3TOSA 4ER6A 1VL5A 5DTQA 2YQZA 5KS2A 1JSZA 3KR0A 3P9KA 4KW7A 2AOTA 5FHRA 2NXNA 2PWPA 4U7TB 5K0NA 4EQZA 1L1EA 4LWOA 3G2OA 3DLIA 3M70A 5LQKA 2QYOA 5U4XA 3KPJA 3UBTA 5ICCA 2ZVJA 3BZBA 5EC8A 5CVDA 3BUSA 3TR6A 2AR0A 4ATNA 5CIYA 4GOND 1BHJA 1WXWA 2UZ4A 4ER0A 4RTRA 3A26A 3P9CA 3KQQA 1KPGA 5G02A 2OXTA 2JHAA 3CBGA 1O9GA 4AX8A 3KPUA 4BY9E 3OE5A 3CCFA 5K0FA 5EMJA 4RYLA 2PKWA 1G38A 1F38A 3GRVA 4GOMD 4YUXA 1YUBA 2FK7A 1YZHA 4R6WA 2VDUE 1ZGJA 4A6EA 1MHTA 2G8NA 4IV0A 3LSTA 2PLWA 2ZBQA 5T67A 3AXTA 5H02A 4RTJA 2AOTB 3D2LA 4R05A 1BKYA 3MB5A 4PGGA 2YR0A 4QQNA 5EMLA 3B3JA 1QAMA 3EVGA 3KKZA 4MHTA 3THSA 3DOUA 1ZQ9A 5C1IA 1P1BA 1R00A 4PIPA 1SUSA 4CKBA 5EHIA 4CWAA 3HVJA 2EFJA 3K0BA 3P71T 4QDJA 1KR5A 4P7JA 4C05A 3IEIA 2CL5A 2O57A 3UJAA 2OPBA 2EJTA 4YMGA 2NXJA 10MHA 3KR2A 4HG2A 4DQ0A 4EKIA 3E7PA 3EGVA 2B2CA 3DXZA 4OX9Y 2BZGA 3A4TA 3NDIA 4DCMA 3AJDA 2P41A 1KYZA 2R6ZA 4DKJA 1RJDA 2PX4A 4C07A 3IHTA 4PCLA 1QYRA 1FP2A 4FSXA 2ADMA 3EMBA 5FUBA 4GQBA 4EVIA 1XJ5A 4E2YA 2GPYA 3GRZA 5KQRA 2NP6A 4R8RA 3LL7A 2HV9A 1NW8A 4GC9A 4A6DA 2UYHA 3CKKA 1AV6A 2XVAA 3NVMB 3HCCA 3KQPA 3HTXA 1QAQA 2NNWB 2ZSUA 2ONZA 2P3QA 4EK9A 1G8AA 5CCBA 5K09A 3BGDA 3M6UA 5GINE 4KVZA 3LHDA 5EEGA 4R8SA 1VE3A 5DLYA 1SQFA 3DR5A 2XYRA 3RODA 2C7OA 3MTEA 2H11A 3G5LA 3FYCA 4RVFA 4OA8A 5E8RA 2ZWVA 2O05A 3LBFA 5EGSA 2IH4A 2QY6A 2ZTHA 5EMMA 4E33A 3ER8A 3I64A 2O06A 3T7TA 4XUCA 2G1PA 3R3HA 5HEKA 5EVJA 1DL5A 5FWAA 5K0JA 2AZTA 3RIEA 3O4FA 4CXMA 3BT7A 1IXKA 3G7UA 4ISCA 4RTOA 1VBFA 4CKEA 1KP9A 4BLUA 1RI4A 3FRHA 3M6VA 5E8JA 1JG1A 1FP1D 3HM2A 3LDUA 5FQNA 5HIMA 3EVZA 3HNRA 3BXOA 3MCTA 4E2XA 2EX4A 3PFGA 5DSXA 2XBMA 2HMYB 4RVHA 5E1OA 2OKCA 1JQ3A 5FULA 5KVAA 2PXAA 4GEKA 1Q0TA 5HZMA 5K0LA 2ZWAA 1AQIA 4KRGA 3KPVA 3FTCA 3UJ9A 1ORHA 3GXOA 4DZRA 1TW3A 2P8JA 3FTFA 4YMHA 4YV1A 3HA5A 3OPNA 3KQVA 3TKAA 3EVDA 3PFHA 2IDJA 1UIRA 1XDZA 4FT2A 1PRYA 1G55A 3B3GA 5DX8A 5ICFA 3THRA 3DH0A 2P3OA 2QM3A 1SUIA 4AZTA 4EKGA 2WA1A 2YUIA 5E1DA 3M6XA 5E9WA 3TM4A 3CC8A 4DA4A 5B1SA 4QPPA 4GBED 2JG3A 4QVKA 2ZIGA 2AOUA 3R6TA 2UYOA 3JWIA 5DXJA 4DM3A 4PYIA 5GIPE 5HFJA 3TMAA 3BGIA 3EPPA 1WXXA 5JR3A 1KPIA 3A7EA 3FPFA 3KQMA 2AN4A 4LWPA 2ZZNA 1M0EA 1RI1A 3G8AA 1NW6A 4C4AA 1SG9A 2GAFA 1JQEA 3FUWA 4MWZA 2ONYA 3OZTA 2GA9A 4PYMA 3UJ7A 2OB1A 3TQSA 3DMFA 4KDCA 1XVAA 5EZQA 1X1CA 4GOOD 2IIPA 1VPTA 3B3FA 2V7EA 4RTMA 1KXZA 1Q0SA 2FCAA 4O29A 3OZSA 4E30A 3CJQA 3HVKA 2B3TA 2OB2A 2ZBRA 4QTUB 4WXHA 2NXEA 4RTPA 3UJDA 1EAMA 1ZG3A 5DXAA 4RVDA 1NBIA 3LX6A 3VC2A 4CKCA 2P3LA 1EQAA 1YZ3A 5LQCA 1R18A 3X0DA 2EG5A 1IM8A 4HH4A 2IP2A 5LSAA 2I62A 3BWCA 4LECA 3KR9A 5CVVA 2AOUB 4E70A 4E31A 3M33A 2UYCA 3B89A 3OE4A 3EGEA 3QV2A 3EEYA 2PJDA 5F2NA 3JWHA 2NP7A 1EG2A 2XYQA 2Y1XA 3G2PA 4YUYA 3EVFA 3FPHA 4M38A 4GC5A 5JUWA 3A25A 1N7IA 2OYRA 5ICEA 3UJBA 1JG2A 3ERCA 5DTRA 4FR0A 1BOOA 3UWPA 4P7FA 3S68A 2IBTA 4OBXA 1XDUA 1V39A 5CVJA 2GS9A 3NVKI 3GU3A 2KW5A 3LGAA 1VLMA 3KPWA 1F3LA 1NW3A 5DWQA 4HGYA 4RTQA 5K05A 5DX1A 1XTPA 3LKZA 3A27A 1G60A 1L3BA 4WVLA 1RI3A 3RW9A 2OY0A 4OQDA 2WA2A 3BWMA 5GM1A 2G71A 3UA4A 2A14A 4QQKA 3GNLA 2QE6A 2B25A 3PB3A 2CWWA 5GM2A 1NT2A 4MQ4A 1WZNA 5FA5A 3WSTA 5EPEA 3ORHA 3LECA 2IH5A 1WG8A 3MAGA 1XDSA 2VP3A 2BM8A 5FWDA 3LDFA 4AUKA 1H1DA 3GO4A 1Z3CA 1NV8A 2ORED 2VDVE 8MHTA 2PV0A 1IY9A 4C06A 2AN3A 3O31A 5E1MA 1AQJA 2BM9A 2Z6AA 5D1NA 5F2OA 5LQJA 1XCJA 3PX2A 4PONA 4NECA 2N47A 3PTAA 4KWCA 2AOVA 3R9XB 1NV9A 3PVCA 2JHCA 1WS6A 4P7KA 1X1AA 3NDJA 2NYUA 3GDHA 5E2BA 3MHTA 1HMYA 3A7DA 3TKYA 1VP3A 2PXXA 2PX8A 3BKWA 4G56A 3JWJA 1L9KA 4FSDA 5HILA 7MHTA 3LDGA 2PVCA 3KHKA 3HCFA 3HCEA 1O9HA 2B78A 5EIFA 3M6WA 3FUTA 4YUVA 4E2ZA 5GIOE 4E32A 3UJ8A 1YF3A 4HRAA 3FYDA 4E2WA 3E05A 2JHPA 4QTTB 5MHTA 2IFTA 2EJUA 5FQOA 2BH2A 5EIWA 2CMHA 4XUDA 5K01A 2UYQA 4RSRA 5C0OE 2O07A 4X1OA 2YXLA 3UA3A 3UFBA 3GWZA 3OU7A 4PINA 5EG5A 4K6MA 3HA3A 5IKMA 2ZCJA 4V0RA 3P2EA 3LBYA 3CVOA 5EKXA 3TLJA 4YUWA 2AVNA 2BR5A 2PSSA 2VS1A 1RJFA 4RV9A 4X41A 5E1BA 5E9QA 3UJ6A 1P39A 3REOA 4ER7A 1KHHA 1UFKA 2OBFA 3SMQA 3TRKA 3T7RA 5IH3A 4XUEA 4PYNA 3SSOA 5KQSA 2IGTA 1OR8A 3HEMA 5LR6A 1ZGAA 2FPOA 3Q7EA 5E9JA 5HIIA 3ID6C 4MTLA 3NTVA 2ERCA 2PT9A 5LQUA 5EHGA 2JH9A 1TW2A 1QAOA 3FPGA 5DM1A 4AZWA 5BW5A 5BW4A 1D2GA 3UJCA 4BP1A 3KQSA 3KQTA 2ZBPA 2K4MA 3R0QA 1N7JA 1L3CA 3LCCA 4QPNA 1T43A 4B17A 4FP9A 2Z6UA 4R6XA 1NKVA 3KQWA 1I1NA 3TM5A 1SQGA 4C08A 1FJXA 1P91A 2CKDA 4YUZA 2P35A 1G8SA 2C7RA 3C6KA 1X1BA 1RJEA 3DP7A 5F2KA 2VDWA 3HP7A 5DX0A 2YVLA 3ME5A 2Z6QA 3SSNA 3PS9A 2P1DA 2ZIFA 4H0NA 5FA8A 3LCUA 2HR1A 1P1CA 3MQ2A 3ELYA 3PX3A 2FYTA 1R8YA 3P2KA 3QOWA 3TFWA 5C9ZA 1N2XA 1WY7A 1XCLA 2NXCA 4P58A 1PJZA 5EOVA 4ER5A 3NJRA 4MIKA 1SKMA 2VZ9A 5E2AA 3C3YA 1QZZA 5T64A 4UOEA 1JG4A 2PBFA 2PT6A 3DUWA 1JSXA 4IWNA 5DM0A 2P7IA 3I58A 4OBWA 3SR4A 4JXJA 3E23A 4FGZA 4YV2A 4RTNA 3DTNA 3EVCA 2G72A 4YV0A 2I7CA 3SGLA 3AWIA 3GRRA 1O54A 3FZGA 5FCDA 4ER3A 1BC5A 3LCVB 3NW9A 3NWBA 3OCJA 1G6Q1 2AOWA 2HWKA 3P9IA 3GGDA 3VSEA 4X63A 4HGZA 1MJFA 3HVHA 4P7GA 2H00A 4M37A 5DM2A 5P8WA 4PYJA 3DMHA 4FZVA 1Y8CA 3OZRA 3P2IA 1HNNA 3U81A 5K0EA 5BP7A 2P7HA 5GOZA 3C3PA 4XCXA 2GH1A 5DSTA 3FRIA 4QDKA 1RJGA 1YB2A 3C0KA 1NW5A 4PIMA 4PYQA 1SVUA 2PXCA 3DXXA 3SXJA 3HVIA 5LQAA 4X61A 3ELUA 2DPMA 2ZLBA 3G2QA 3CGGA 2PY6A 4BLVA 1JG3A 3FTEA 3IYLW 4GUAA 5EMKA 1KIAA 2F8LA 2ZZKA 4KIFA 4F84A 4U7PB 2AOXA 3MTIA 4RTKA 2LD4A 4GOLD 4RWZA 2WK1A 3ANXA 5K0BA 4POOA 4Z2YA 1KYWA 5BXYA 4HC4A 4HTFA 2PGXA 3V8VA 1JTEA 4CTKA 2OO3A 1EIZA 3GCZA 3JWGA 3DLCA 3P9NA 3FPJA 3OU2A 1DCTA 2B9EA 4KDRA 2DULA 4RX1A 1R74A 3MERA 3P97A 1FPQA 1UWVA 5GP1A 3MGGA 5K8VA 5D1HA 2ZULA 1NBHA 3NMUF 2PX2A 1I4WA 2P40A 2JH8A 5GWXA 1B42A 3FTDA 3IV6A 4CTJA 2Q41A 3AXSA 5FTWA 3VC1A 2GB4A 5LQRA 5ERGB 3GJYA 4PNEA 2I6GA 4OQEA 3PLAE 1ZHFA 3P8ZA 4AZSA 5HOQA 2JJQA 3KPYA 5CVEA 2V74B 1VP9A 3FUUA 4QVGA 1ORIA 3L8DA 2AN5A 3DULA 3E8SA 2CMGA 4C04A 3O7WA 2HNKA 2AVDA 3ELWA 2IBSA 3I5UA 5DT2A 3R24A 3KQYA 4PYOA 3KR1A 4HSGA 5FHQA 3BGVA 3C6MA 2Y1WA 2ZW9A 2ZIEA 3K6RA 2C7QA 9MHTA 3FUVA 3OFJA 3EMDA 1L3IA 3NWEA 1RI2A 3ER9A 2ZZMA 2QRVA 4KIGA 3HA7A 3F4KA 3TPZA 4HTFB 5HIJA 1M6YA 3OU6A 3HCDA 2IDKA 3ELDA 3OFKA 2BR3A 2R3SA 3T0IA 1YFLA 3B7PA 1JQDA 2YTZA 4M7RA 1FBNA 3FUXA 3SM3A 1XXLA 2C7PA 1X19A 1DUSA 3LPMA 4IKPA 4AZVA 5LQNA 3PT9A 3QOXA 3EVBA 5KYGA 3SVZA 3VYWA 3M4XA 1TPYA 4C03A 5EZSA 1U2ZA 3CJRA 3KU1A 4PCAA 3G8BA 4DF3A 5DRYA 5K0CA 3EEOA 2BR4A 2PX5A 3KQOA 4PYLA 5EQJB 1JTFA 3T7SA 3AY0A 2AS0A 1JR4A 2HTEA 5CUQA 5T6BA 4DMGA 2IH2A 5FADA 4FS8A 3G2MA 4GF5A 4PGHA 3G88A 1RI5A 4L7VA 3Q87B 5CM2Z 3GRYA 1EJ0A 5EKUA 3EGIA 3GIWA 4BP3A 1X1DA 5DRTA 5K0GA 5M5BA 2FK8A 3BWBA 1R6AA 2GLUA
chains in the Genus database with same CATH superfamily
5A05A 1YACA 3ITNA 1T4CB 1QHEA 1JI0A 3N5CA 2BAGA 1WXQA 3IURA 4IGIA 4TKMA 1UXOA 5E3HA 3LUDA 4IOMA 3FZQA 3M34A 1CJKC 1JHDA 3DL7A 5FPPA 2P6OA 1U1CA 2PMEA 1G5RA 4JLPA 1DJPA 4GM4A 1NUPA 1OHHD 1Y8AA 5JECA 5HRUA 3DNMA 4LMBA 2FQQA 4BNMA 4LJLA 4JB2A 1FPMA 5IFLA 5IAKA 2JDIA 1PZEA 3SY8A 3ZHUA 4NKRA 4X1KB 2G0TA 4RTSA 4MWOA 1NJ5A 3D4LA 1FP4A 2R48A 4QATA 2QF7A 2J67A 1TIKA 4YJKA 1Q6YA 4C4XA 4ZPXA 4D3ZA 1IQRA 1NFRA 4H7EA 2DKNA 1K86A 4D4HA 5IWCA 3ELBA 2YY6A 3EUWA 4TUYF 2IK8A 3ZJYA 2JLAA 4FXOA 4KQWA 3V7WA 2D1YA 3IV9A 3UZUA 2WAOA 1JJFA 3SZUA 4QREA 3T99A 1JYSA 1MQAA 2D2XA 5BPHA 2OLJA 4DLTA 2OCGA 1H4SA 3C1UA 4YAFA 4C4OA 2NO1A 2VAVA 3MPUA 4EX6A 5IG2A 2LBPA 1IH8A 1JSZA 3T15A 3MD9A 3FWYA 5A5GA 1EKXA 4OFWA 2IS1A 3LWZA 3Q7PA 3SJ7A 1TJYA 3GEIA 3O6VA 1UAGA 4FYXA 1QH1A 2PD6A 2SKEA 4M1QA 3FUCA 1I8TA 4W63A 3QITA 3SYMA 5F98A 2IS6A 2ZVJA 4TWBA 3R9IA 4EVRA 2ST1A 3DEKA 4TM7A 4D4GA 4GXTA 4I1RA 2XF8A 3NOVA 4IOLA 3WAKA 4AKTA 5KSYA 1JMKC 3ZN2A 4DEYA 1FJ2A 4DR6B 3A26A 5AKIA 4BMSA 4D0GA 2XBMA 1QX4A 1QB8A 2B0CA 1QTIA 3EXEA 4NULA 1MA0A 3CBGA 4I55B 4OQFA 4RJ2A 2QR2A 5ILGA 1WETA 4GYKA 3ZQ6A 1QFMA 3GRVA 3JQFC 3Q6IA 4IJWA 4QAJA 4QE3A 5PGMA 1TRHA 2Q6VA 3T9EA 4CIYA 3U6KA 4MMXB 1U31A 1DQSA 2NSYA 2PLWA 4BVEA 3PEEA 3Q0IA 2AYYA 5FLEX 2R7LA 1BA2A 4H7FA 3AXTA 1BRTA 3QJYA 4RTJA 3D0KA 3ZUGA 3NNDA 4ZAYA 5JZVA 1H2BA 3IPLA 2XB2A 1HDGO 2CJXA 4KNWA 3MM4A 1JNYA 1FEZA 3LLSA 4AULA 2O1XA 1RBQA 5C1IA 1SUSA 1S7CA 2C97A 3TQTA 4NAUA 5LC1A 4C05A 1P1FA 3ESAA 5C1BA 1ND5A 3RK4A 1R9GA 4BZXA 3F47A 3H5VA 4LK3A 4Q15A 1S8OA 2AGVA 3JYOA 1EE9A 2H4FA 3QENA 4HGQA 1E92A 2XWPA 3OT1B 3EGVA 4LBWA 4IX9A 3AEUB 3K30A 3SKXA 3GV0A 2L17A 1RIIA 2PBRA 2IHUA 2HA0A 1E7QA 1ECFA 1YOVA 5AKHA 4UPEA 2H4XA 4QGHA 3IBSA 4DKJA 2JJ2A 2PX4A 1RPZA 1SURA 4TMZA 3QUSA 2VF5X 3EZ9A 4RMNA 3KQNA 2PS0A 1N33B 5AM4A 4P22A 4U6SA 4U3JB 3GRZA 2NP6A 2VT3A 2C8LA 1VRCA 4LI0A 1LVHA 5FPKA 1K2VN 1PJAA 3KQPA 2G5GX 4KXUA 3OOEA 4OP2A 4YASA 5IC4A 2PJZA 2ONZA 3SJCA 4NV1A 4LJ4A 4PSDA 5EJGA 5K8IA 1S3IA 4LVNA 3M89A 4ZN6A 1DOHA 2IXGA 1OWPA 1LDNA 2ETVA 2RGEA 3ENQA 3G5LA 4X1IA 4EG4A 1XTUA 1VBMA 1NXXA 1ENOA 2QLFA 5HJ2A 1HA3A 2ZJ4A 2FWPA 2GN6A 1UF9A 3O74A 1TUGA 1N77A 1BXRA 4WWHA 1OUMA 1DL5A 3MTDA 3O4FA 1N5JA 4QJBA 2ZAMA 3ZI0A 4G8JA 2ZK7A 3HO6A 3IRUA 1XEXB 2JF0A 1KP9A 3QQPA 5DT9A 1HQYE 2FDRA 2W9XA 1ZNWA 5JWOA 2OCBA 1GVNB 1Z6AA 4MR8B 5AKZA 1RE0A 1DXQA 4H3HB 4ARUA 3DEHA 2X8JA 3DKRA 1JP7A 1LB1B 1QYDA 4NZOA 1A8QA 1N9ZA 1YBFA 2BFMA 2HMYB 2JFBA 5EQTA 3EF1A 3FCUB 3THOA 2OKCA 3N8GA 3SIRA 4EGCB 3HKBA 2PXAA 2E1PA 2QNRA 2VPZA 3CW9A 3UVEA 4S1VA 3ZLUA 1TEHA 2O7VA 1N1MA 2ZWAA 3CZMA 4N3AA 2OWDA 4W7IA 4Z54A 2CY0A 1F8UA 4K9MA 5SICE 2WPDD 1EUDA 4WV3A 1RXIA 1UIMA 4OBBA 1USKA 1DQZA 3F78A 3IIEA 2A7XA 2QTVB 3P0HA 4O02B 4CU2A 1EVEA 4DLSA 5IVHA 3OLZA 4MKRA 2VF7A 2QG9A 4MIYA 5AKYA 1G1AA 2QZ9A 3MMSA 2YIDA 1IEQA 5K51A 3TM4A 5IVDA 3H8SA 5B1SA 1JALA 3HA2A 4PG7A 1B1AA 1ONPA 4Y2QA 4BNDA 1N36B 1PQ4A 3AWDA 1LDEA 4YCMA 5BXQC 1ZNZA 2OCYC 4HI0E 5FF9A 5JXWA 4NXNB 3BGIA 1U6IA 3C70A 4L4SA 3HKEB 1I5RA 2WIGA 3LBIA 4LWPA 1GKIA 5JLAA 1TUIA 3VJKA 2E2WA 2BUBA 2QW0X 1L5QA 2QRGA 4UE2A 4TZ6A 3ADCA 2FW0A 5K8CA 3FUWA 1P31A 1FVXA 3HJRA 1HR0B 1BU5A 1XVAA 1UJMA 3B8HA 1TZ2A 4Q1BA 1H8HD 3U3JA 1VL1A 2G09A 2V7EA 3RDPA 5JS7A 3ZGZA 2VQSA 2JBAB 4XCVA 4CEJB 3OZSA 4D0LB 1PLJA 2B4AA 3WX0A 4EKEA 2B4YA 2QL9A 3H5NA 2VJMB 4LOHA 5JXHA 2E6KA 3DKPA 2H7XA 5KSOA 3JYQA 2CNOA 4DQKA 2DBZA 4X3OA 1R18A 4LFCB 3MS2A 1FQJA 4RQTA 1EFPB 2B7CA 3MGBA 5JAUA 4OLAA 4LXQA 2W2QA 4IVPA 2H4HA 4GDMA 4JCCA 4U00A 4UM8B 1NVBA 3HG7A 4L6AA 5KJ1A 2GYWA 2WYWA 2LKDA 5D5QA 2DUMA 2QP4A 4PY2A 3ZYCA 1GTSA 3NYIA 4PRYA 3SQLA 1JJ7A 1B0ZA 2O2XA 5I6DA 3DCNA 2A5DA 4B7CA 1AZWA 3LPDA 1EDOA 4MUBA 3GW8A 2VXYA 1T2UA 1XTVA 1KIMA 3A25A 3CF4G 3IKLA 3NBXX 4L74A 5DEOA 3R75A 1ST2A 2INGX 3WK6A 3B9RA 3B1FA 1A7UA 4EYQA 5A1TA 4QHSA 1TTHA 1AG9A 3BXFA 3BDIA 4Q02A 2ZXEA 5FPQA 4GW3A 3AI2A 1ECLA 4RVNA 1Z73A 5JHGB 1VG0B 1XSEA 2OCAA 4ZAFA 3WVNA 1R0ZA 4QBTA 4KOEC 1NX6A 1F3LA 5JFOA 4HGYA 3CO5A 2J5KA 4INPA 4P34A 1CUGA 1JPVA 2AD1A 2DPXA 2Z8YA 1L5ZA 3LKZA 3GLHA 3PZBA 3QZUA 4X6XA 2Q2NA 2FUKA 2A0YA 1CUWA 4S2EA 1TYAE 2XVZA 1ULAA 1LBTA 2W83A 2Q99A 1J07A 3BZUA 3HCPA 1LV7A 1BE8A 1FW8A 2QTZA 2DTXA 5D3QA 1CY0A 1M7BA 1PR0A 1K8XB 1TYEB 1XTKA 2ON6A 4NBRA 4DLLA 5JQGA 1ESEA 2WSMA 3H8WA 5BNFA 4KBYA 3RYFA 1BW9B 5FLKA 1RLJA 1L4HA 1X6VA 3I9V6 2Z6VA 1C1DB 3PQ8A 4JB8A 4JBYA 5A9RA 5IDYA 8MHTA 3K2EA 3KB2A 1XMOB 3AHDA 4BLSA 3ILVA 1U7ZA 5KU1A 1HX7A 1DBQA 4MYSA 1H1TA 3CRZA 3ASYA 4FQ7A 2J0EA 3KZVA 2AOVA 2G5CA 3B6MA 4M0EA 3F1KA 4TTTS 2OAEA 3GR6A 3F5FA 3IAEA 3ITEA 1BH6A 4KVGA 3TYXA 2PX8A 1PYDA 4KIUA 2O8CA 4FX5A 2VLBA 3V4VB 1I2CA 1W8IA 4M60A 4FONA 4MK4A 5AK0A 4BJ5A 1AB5A 3COSA 2C4MA 1U2SA 1ZL2A 4HQOA 3ZY5A 4ND8A 2O14A 1JDPA 5KTMA 2VWGA 3G2KA 1PWHA 2Z2XA 2JHPA 5FQOA 1H5QA 5EIWA 4PNHA 4XUDA 1DIGA 1K8RA 1ZS9A 4C3VA 1IAVA 3AZOA 3R74A 4R2XA 3DOHA 3L92A 2WG1A 4LS3A 2FG7C 2GYVA 1G7RA 2Q4EA 1KZYC 4FCWA 4OI4A 1V5GA 3VR6A 4DMKA 4Z1MD 3FKQA 3ZU3A 5CX1B 5HS6A 3B1XA 3CVOA 1DARA 1GPLA 2W43A 4KQCA 4O0MA 2YFQA 3FVWA 4GMGA 4D9IA 2ZYIA 4UBLA 5HF8A 4B09A 4ARZA 1W85A 3EMKA 4NMWA 1DRJA 1OHHA 1HDEA 4DGQA 4M46A 1W4BA 1RRKA 3EF0A 5LLSA 3S3TA 3SJZA 5HIIA 1H5NA 3LK6A 5JD5A 1S0UA 3BB1A 3S0JA 3U62A 2DF8A 4RJLA 2IHTA 2Y0PA 3UGQA 1Z4KA 5KJFA 1W4LA 4RD3A 1H9CA 5BW5A 4G85A 2ZYVX 2OQIA 3E18A 2ZRHA 3KQSA 3L0CA 3JW8A 3DNFA 1M6HA 3V4ZA 2Y1LA 1FSZA 2XZPA 4D5EA 5ALHA 4DJAA 4DWVA 5D2CA 5C7LO 5ELLA 2XKKA 2Y05A 4JHXA 1T36A 2IBMA 1T6NA 3EARA 2DBRA 4G1FA 1DKRA 1X7XA 2CYCA 4D9EA 2VUHB 2ACVA 4YJ3B 5DX0A 4TVBA 3ECCA 4JY7A 5AUPB 1EJ2A 2RAUA 4EA7A 1DB3A 2V7XA 3ZWPA 2JLSA 4ETIA 4ZCQA 3GLSA 2C8KA 4UDYX 1JAYA 2BUCA 3A06A 1HE2A 2RB5A 4EAQA 1ESNA 3AUAA 3DDZX 1CNFA 4EY4A 1B3RA 5LNK1 2QTTA 3T61A 3VHXA 4XRGA 5T64A 4F2WA 2W22A 2PUAA 1CG6A 5ECWA 2B34A 1AOXA 5G40A 3ZHBA 4JXJA 4HR7A 2F64A 1U2EA 4UHDA 2B94A 3KKOA 2ZCUA 4ZICA 1GGVA 4GMHA 3LY9A 2XW6A 3VUFA 4DBLC 1N0UA 4HO1X 5FPYA 2EKZA 5E7MA 4NBUA 3HFJA 5DM2A 3HGTA 4I08A 5AK5A 1Q0PA 3JQRA 3JQAB 4I4TA 4JWTA 4M1OA 5DO9A 2PE5A 4TMWA 3HN6A 1HNXB 1HNNA 3IEKA 2I3BA 5F5NA 1PTJC 4B4OA 1E4VA 4BEVA 1GPJA 1X86B 2YIMA 3A1NA 1XU7A 4L5YA 2PT7A 2I4MA 3E7WA 3TIXB 3C97A 2PXCA 3REGA 1R88A 3BMNA 2FXVA 3VR1A 4E5PA 1GSIA 7ADHA 1X9HA 2F1JA 3WWCA 3ZLJA 3AIMA 1XLUA 4LK2A 3PFIA 4KQ6A 2GXSA 1PJ8A 5ADVA 2EHDA 2FPIA 3NHKA 1MG5A 1K88A 5I9LA 2WHEA 4J0FA 4UTZA 1E4YA 4LJAA 3UFXA 3BCHA 4HTFA 3IULA 2C31A 1VGQA 1N8SA 4PXSA 2VNJA 3WDLA 3WLFA 3ZDXB 1U9ZA 1SD1A 1YI0A 2QD3A 5KDOA 4WFKA 1W5TA 1YKSA 2B9EA 2YV3A 3RYHB 1XRSB 4D8XA 4MTCA 2HHHB 5B3LA 1I10A 3T3DA 3P97A 1IUOA 6AT1A 2HJRA 4D8YA 4UQOA 2CDRA 3VR5H 4IFTA 2HHCA 4E46A 1I4WA 1SZDA 3SR0A 4FKZA 4CQMA 3F73A 4PN3A 4FHGA 3AY6A 2F90A 2Q41A 1ZVJA 5FTWA 2Z83A 3KOUA 2YWGA 1ENYA 1E99A 3P8ZA 4AZSA 1QKJA 2V74B 3FUUA 2FW9A 1ORIA 3L8DA 3LQRA 4RHFA 2OA0A 1DU4A 4BNUA 3C3WA 1O08A 4A27A 5HIAA 1ZOSA 2AVDA 2W6CX 2IBSA 3RC8A 4XB6B 4QL3A 1ID8A 3KR1A 4JFAA 4TMXA 5FHQA 4KLCA 4MRRA 3VTZA 4B3BA 2WFLA 2H51A 1FLNA 1RXSA 5B58T 1VLZA 1NUTA 3MNFA 2GYYA 4LI3X 3HA7A 3U7RA 1FVFA 1ILEA 2ADOA 3ZKWB 4R1UA 1ORDA 4NNJA 1P3Y1 5KREA 1V3UA 2I7DA 1GTJ1 1LV8A 3ITKA 3L0BA 2AX3A 3EPHA 3IERA 3E2MA 2PLFA 2J30A 3B1WA 4LJRA 1QHHB 3U48A 1TVMA 2KS6A 2GCNA 3SVZA 3UV3A 3M4XA 2P77A 2ZUWA 3U4IA 2J0UB 1PLKA 2ZVDA 3OQ6A 4RA9B 3TI9A 3ZDCA 2YQ4A 4G01B 2BR4A 3LE8A 1MT0A 3V1TC 4BFYA 3EEOA 3ACCA 3H9EO 4TLBA 3GJ3A 3JPWA 4MUNA 4YMSA 5HJ7A 2Y0EA 2W2OA 1UMKA 3GROA 3JQBA 1CBUA 1QZ3A 1GN8A 4C76A 3VYRB 5H3CA 1DIBA 1PFVA 4D1YA 2OUKA 5BOVA 4CF6A 2GERA 2O7RA 4ERXA 3BWEA 4GT1A 5IMBA 1KA9H 5BR1A 4A6PA 3UV7A 2AI3A 3A4MA 1TUEA 4B2YA 2E3JA 3FF4A 3G89A 3HDTA 2NVOA 3NM6B 4RCYA 4E88A 2YBDA 3BX1A 1T9ZA 1UZUA 1YXMA 1NW7A 1T3SA 1KY2A 1N5LA 1V8OA 1Y3BE 1MOSA 2G4LA 5GOTA 4BQEA 4PWYA 1DWQA 4ZEMA 4HDNA 4MVJM 5FO0A 1CCWA 4DJ5X 1BXGB 1YQEA 1UFOA 4QOHA 1XDDA 1BX0A 2QAGB 3KT0A 4LJSA 4ZAGA 3R8CA 3SX0A 2UZ1A 1I4LD 3V7YA 1Z3IX 4DNFA 2VJQA 4E22A 1O6ZA 4EG6A 1Q14A 4H1TA 5JRZA 5LU8A 3F8SA 4KMOA 4BPBA 1YR3A 3NKLA 1QQ6A 1TFRA 2QXTA 1IZ8A 5EP1A 3W3ZB 4A82A 2O8EB 2ZUTA 2YOHA 3IEXA 4RJTA 4QFDA 1YL6A 1W1WA 2X77A 4NRDA 3BXZA 3AK4A 3FB1A 2BZ1A 4PFJA 2JIZD 1ZKDA 2ODBA 1PKEA 1H8HA 2OHGA 3NTLA 5BSEA 5HK9A 3FCXA 3HL0A 1UXGA 1C1XA 1Y7IA 3QU2A 5HKKD 5JTUA 3HXQA 2WJYA 2C92A 1ND6A 5IJ9A 4DLNA 1AZSC 4KN8A 2GZ3A 2OC9A 3G7SA 2NXNA 1I30A 1AGYA 4IFEA 4UDNA 3AC0A 2AG0A 4C0QC 3BIWA 4PNZA 2XXBA 3G2OA 3GVCA 1WQ3A 2ANBA 3A3KA 4RMIA 2HWXA 4YBRA 5JPCA 4DV5B 1PV2A 2NO9A 1XCOA 3PI6A 4F2GA 4YRZA 1OJ7A 3R7WB 3LHFA 1KJQA 4L15A 2EJVA 2YHAA 4G4SO 3TR6A 2FN9A 1NNI1 1UEJA 2UZ4A 1UK6A 2P68A 3CPEA 3C1TA 4OGGA 2AN9A 2DJIA 2BM1A 3OIGA 5AMXA 4E13A 2C88A 1KYVA 1Y82A 4US2R 4HEA6 4RWEA 4BX2A 2JCVA 4F8EA 1W75A 1GUBA 3AIOA 4U7GA 3HFSA 1HDZA 2MSDB 4J9UE 1AXRA 2H59A 4GGOA 5BVGA 1ODKA 2XD9A 3WDKA 3T7AA 1TJ3A 3AR2A 3ZW9A 4QEKA 3CLRD 3KBOA 2IKQA 1D2AA 3R3ZA 5JG7A 3SC4A 2P27A 1ZUNA 1K8QA 5IT0A 2AFHE 4F5EA 5B1IA 2IU6A 3HRKA 2QS9A 4PBTA 3DLAA 1M8KA 4W82A 4F4UA 3KT3A 3E5RA 1IN8A 1QIDA 4MHTA 3Q15C 2XGJA 3DOUA 3KV3O 3LLUA 2DM6A 2ZVPX 3IUPA 1XMJA 1JLLA 5BN5B 3C8HA 1FFDA 2D2IA 3IAS6 3PFCA 4HVLA 4J2OA 1OXKB 2EJTA 4CZ2A 3KQLA 4MYUA 1GDHA 4FFSA 1K7SN 1Z28A 3QKTA 4PPYA 2H4ZA 3C5VA 1OIWA 1XCGB 4IQ4A 1UFRA 4CMJA 1LC0A 4AWBA 5HDQA 4PTLA 4RMHA 3C7DB 2GCOB 2IEYA 2PKEA 2V65A 1F0PA 3AUKA 4PZZA 1COZA 1K7EB 1IFXA 1RKUA 3SDZA 1QGAA 5CH3A 2JZCA 5I4BA 3JAWA 5IX8A 1M0TA 2XQJA 4EW1A 3WNVA 2C7OA 2F55A 4UU8A 2QX4A 4X8HA 3C2QA 4LYFA 3RVKA 3IELA 4J1TA 5JRDS 1XRMA 5TXGA 2BFBB 1U1FA 5IXJA 2XVAA 1T3TA 3S2FA 1Y1QA 3G9ZA 1KAQA 2UDPA 1U2GC 2V7VA 4R1MA 1SVMA 3QKRB 3KLOA 1DC4A 3DOIA 3OOHA 3RC9A 5DKFA 2NVUA 5DLYA 5CFMA 1LQUA 1CU1A 1EWKA 1LNQA 1Z5UA 2Q3FA 3LBFA 1NONA 5E8RA 5EP3A 4E12A 4YAUA 3ER8A 1XJQA 2GNPA 2FW8A 2QZ4A 2H57A 4KFTA 5FLXA 3CF6R 2UXCB 2F1RA 2YUTA 3G13A 3R76A 2C0PA 2R8OA 3U7QB 3E9MA 3ZNQA 1E8DA 1CQXA 1VHWA 4Z1MA 5CA0A 1VBFA 2P2LA 3AJ8A 1AKNA 3Q88A 1IK4A 3M6VA 5JWHA 2QIPA 1Q0QA 1VSQA 3JX9A 4XOUA 1N2JA 3HNRA 4AKSA 4GSLA 4PSKA 2OBMA 3LJKA 5LB4A 4KFUA 4QNMA 4DCPA 2J9YB 2LV8A 4EJSA 4Z86A 1U9IA 2C99A 5FYQA 3RTGA 4DADA 3LP8A 3QVVA 4X0EA 2GAJA 2X9VA 5A4FS 3RYIA 3WRXA 3U7EB 4IDOA 4A1FA 2REOA 1JB1A 3V34A 3UJ9A 4P0QB 1DJOA 2IHJA 2QB5A 3QI2A 1QHFA 3D8TA 4G36A 1E5LA 4Y6GB 3PUKA 1MORA 4FW8A 1RHRA 3E7FA 4EHIA 3FTFA 2R8ZA 2MSWA 3NBUA 2VPYA 3T5CA 3K0FA 1XJCA 3PF9A 4R5MA 2XZOA 3HXOA 3P0IA 1L5KA 1AH2A 1PQWA 2NSJA 4M0MA 4JUCA 1ZINA 2J09A 4WZZA 1YQDA 3ZV4A 4OHPA 1HYQA 4IP0A 3C6BA 3RJZA 1FTNA 2QLBA 2FETA 1WHTB 3EGXB 3I1IA 1SUBA 4GLBA 3UV6A 1ISMA 1DC6A 5G4KA 5IPFA 4LDNA 4XGQA 2JG3A 4LHXA 2ZIGA 1YT5A 4MJXA 1PAUA 1GLVA 4Q9LA 3ZDQA 2VDRB 2RI6A 4B5KA 3DDWA 1JZQA 1IPHA 2QKYA 2ZIUB 3H05A 1TIPA 3N86A 3DWIA 3OQJA 1V0JA 2HA3A 3VSCA 2HCRA 1JWAB 4H1UA 4BC0A 3BE4A 1V4VA 3T5AA 5EE1A 3WL7A 2X9NA 2ZS7A 1CZNA 4WH0A 2GAAA 2C2KA 2DETA 2AE2A 4NG4A 2OB1A 1BYIA 5JMPA 4MLZA 4WBNF 3G2JA 2H9YA 2NZXA 4JOBA 5CYOA 4ANFA 1UEIA 1L2TA 3A28A 1D0SA 3D4BA 5B1HA 3DYBA 4BNJA 4RTMA 2FCAA 3RAPR 3WL8A 4I5IA 1VZ3A 3AR5A 3EBPA 2EL7A 2OVFA 3F49S 2CFSA 2ZBRA 3PC8A 4NBLA 4QEZA 4TM8A 4H17A 3TNJA 2OKGA 2VFAA 4OAQA 3NHYA 1CQJA 1O3YA 2FUG6 2P3LA 3B6IA 1XZFA 4AIRA 4CKCA 2PZGA 4G26A 4E09A 3TW0A 4IJUA 3KD3A 1UOPA 2EG5A 3LBHA 1N92A 3EB9A 3W5VA 3LPAA 3NIDB 2I62A 1A9ZA 4KRYA 1NPDA 4LECA 1FNDA 2C5HA 1DAHA 2FPPB 4QOSA 4WD3A 4XDYA 4X97A 5AM0A 1Z18A 3TPFA 5E6RB 4OJMX 2UYCA 1WB5A 3PQFA 4QWWA 4OJTA 1QS0B 1R5NA 2II6A 3LQKA 2FMTA 1UOOA 1H1LA 4IDCA 4Z51A 4J7AA 3TOVA 4M38A 2P0YA 3MEQA 4KSCA 1DTWB 3GAAA 3H1FA 4IZ6A 4XYMA 2PBLA 4H4DA 4RS4A 2DEUA 1AKVA 5H5JA 3K9CA 4YJDA 4JEIA 3RQIA 1GPYA 1D4ZA 2UZAA 3OC0A 4UM7A 4GRIA 2WHQA 4P4GA 4E5NA 2BH9A 1PNRA 1KVUA 1HE3A 1ZRHA 1Q11A 2CL7X 2HT6A 3I72A 2OLKA 2CLMB 3PJFA 4DIDA 1JHVA 3MVEA 3NPMA 3Q6NA 1IL0A 2C95A 2DHQA 2GCGA 4M1TA 4ZQFA 1FMJA 1JA9A 3I5MA 3H4MA 5FB3A 3D8HA 2Z8ZA 4ALMA 1B7GO 1L3BA 1QFXA 4MQFB 4AJOA 2HJHA 2F2TA 1CUJA 2QX6A 3GMIA 5BV8A 5TMDA 4I50A 1V2GA 3U2QA 4ZHQB 4DMUB 4B3FX 1T0HB 1ARZA 2CMKA 3RSLA 5E6UA 3RGWS 1PWXA 2E4UA 2BSQA 3S5JA 3WE7A 3HUDA 2JK1A 1PVVA 5C31A 4ESVA 3WGVA 3LECA 1FJHA 1EGMB 4EZEA 2XZLA 4NL4H 4HAWA 1TYCA 2C2OA 1JIVA 4L73A 5FPSA 4G23A 1H1DA 5IM4A 1C1YA 2YRWA 3LYLA 4CLXA 5CFQA 4G81A 2BEVA 4OL0A 4DJJA 2AN3A 4BZZA 2QLNA 1QH8A 2FP4A 1X74A 2PUJA 3BH7A 2RK4A 2P0EA 2W48A 3KUCA 1E2DA 1J6UA 3NUZA 3ESYA 4C2TA 3RD5A 3P4YA 4X6YA 1DJLA 2WKWA 3OIYA 4QQFA 1G64A 2O7NA 2LIVA 5G1PA 5JVDB 1L9KA 2WTUA 4K1XA 2I2BA 3IODA 4QX6A 1IY8A 2DOKA 3RRBA 3W9YA 5IUKC 3NVDA 5CFOA 4NK5A 3G0BA 3HCEA 1EINA 3M6WA 3EDCA 5ALUA 3VH3A 3FYUA 2WJVA 4FWTA 4WZBA 4MRPA 1S1MA 3FKJA 2EFDB 2ZUDA 1TQ4A 3ZV5A 5K99A 2C98A 4RSRA 1OTYA 4IXDA 1GG2A 4TVKA 4EHFA 1OC2A 4A8PA 1C0LA 5GGXA 1A9XB 1H2HA 5AOVA 2PANA 2RK3A 4F6LA 2H7VA 3CYFA 2IYTA 3NWPA 4HNHA 4ZANA 4Z4HA 2R4UA 2WM9B 3OCCA 2WLSA 2NPOA 3A1VA 3EFBA 3N07A 3KQUA 1CJBA 1EX6A 1GNQA 1SVOA 1PSZA 4WUTA 4YJ2F 1GU7A 4TT8A 5IASA 1LPOA 4FFNA 5FBLB 3IRVA 2F3RA 4R83A 3RC2A 4LNUB 4DNQA 3PNSA 4J3NA 3FSRA 4FMDB 4DMFA 5BSMA 1QO0D 5AJZA 3PE6A 1T3LA 2EX1A 2Y6VA 4B7AA 4JR0A 1J7KA 3H9GA 1SIUA 4C0XA 1TZMA 2J08A 4OX9B 1HWYA 2AK3A 1C7QA 3MELA 5AR1A 4ZI7F 4W7HA 4UHKA 1SNYA 2AG1A 3FNQA 2YV4A 3R3VA 4IKEA 4NYMQ 4ND6A 3NU1A 1NDUA 3BICA 4IUCS 1BEEA 4KV9A 3ZY3A 5AJTA 1JDUA 2BN4A 1AA9A 2HSZA 3B2QA 4RIIA 4C0SA 2JIZA 5IWAB 3WA6A 1ISSA 4E7OA 1Z8NA 2FJ0A 3UK1A 4MEAA 1NN5A 1SVWA 3RUHA 5HKKA 5LXTA 5ALMA 2AFVA 2QJOA 5ALEA 2JLUA 5FA8A 1VKJA 1Y63A 2DFPA 3Q1KA 2OFWA 3GRAA 2NU8A 4HDRA 2D8MA 4DYDA 3FW1A 1MB2A 2W2NA 3GA5A 4J0IA 1PJZA 4X00A 1JH9A 3NJRA 3KEQA 4LIPD 3QFSA 4AFNA 4NQZA 3K5HA 1A4RA 3D8SA 3X1XA 2QY9A 2OTCA 4YRLA 5GV8A 1T3GA 3GGPA 4CV3A 2Q2VA 4BTLA 2GN0A 2HEGA 3SZGA 2HRBA 3INYA 1T8TA 2ZRPA 2AL7A 4Q7KA 2FSFA 2W2XA 4FFOA 2QDKA 4MR7B 4BGIA 1XE3A 5IAGA 3GY0A 5AOBA 3NW9A 3NAZA 4MV5A 3GGDA 1XRRA 4YAIA 3G82C 5JCOA 5C5DA 1MJFA 3HVHA 3ORSA 1Q5PA 1TTQB 5HS4A 4FZVA 1CY4A 1JSLA 3FOWA 3P2IA 5K0EA 1JJVA 4XSGA 3C3PA 1RHUA 2PZKA 4ZT4A 4Y2JA 3J81A 1JDSA 2VDWB 1E3TA 1H69A 1NLUA 3CSDA 1A4XA 2C5EA 1UJNA 4C6RA 3GVXA 1NUHA 2C8VA 2GD2A 2Y1KA 3F7NA 3G9TA 4MB0A 5F4ZA 3DFZA 4B9EA 1ZUIA 2Z9DA 2PY6A 2ZBVA 3GNQA 5ALIA 3WHPA 4P98A 3W6NA 3VTFA 5BSVA 1XNJA 5KQPA 3ZHSA 5ALSA 4GAEA 4UUMA 4QVIA 1IMJA 2ZRGA 3PTLA 5CYPA 2QN2A 1JBQA 2O3SA 3ND5A 2L19A 3FCEA 3BD6A 1DT5A 5SY6A 4E6PA 4ZZ3A 5BQFA 3N39C 1YSCA 4LZNA 3TAHA 3GT0A 3U9TA 3GZ4A 1NZFA 3E2IA 2B8WA 4NSNA 4FKMA 1RPTA 3GQVA 2HDOA 3D6AA 2HZ7A 4UQLA 1VG9B 5J3JA 2BFOA 2B1QA 4BRUA 3EH1A 3QLJA 1DVRA 3H84A 3SQXA 3KYBA 3HBAA 5GWXA 2FPGB 1HT2E 4ZVSA 3AXSA 4DWJA 3DOFA 4FSHA 4UNRA 3M2TA 5KKCA 2D1FA 1VI5A 1BEUB 1F2DA 4YUAA 4HX9A 1YD7A 4DSZA 2XGSA 1N0HA 1YS1X 4CDRA 2J45A 1ZA2A 3ELWA 3D1LA 1C0PA 2P62A 2I6QA 2E37A 3D8UA 4TVOA 2VNIA 3GT7A 2P4EA 4LXTA 5ITZA 3BGVA 1PJLA 3BHJA 4MEJA 1BCRB 1YQUA 4JBIA 5IM5A 1L1QA 4ZQHA 1X0VA 4LZAA 4IXTA 3FX2A 5KNBA 2YJ5A 1XD2B 3K2BA 3URMA 2J3IA 2SICE 4C3OB 2VJAA 2FZKA 3TFQA 2VDLB 4ZHSA 3WP0A 2NZJA 4HMPA 1V5FA 2V9PA 2NUPA 4F7DA 5EWJA 3QLVC 3LQ4A 2OHHA 2H48A 4L27A 1YZYA 1LFDB 5BMVB 2WM2A 1BHQ1 5EXDA 1CP3A 3A9CA 3H87A 1JKIA 1W2GA 2B92A 2BLNA 4DUYB 2C94A 2FEKA 4RIFA 4URZR 1S96A 1M2FA 4CCYA 1SPBS 2FFAA 4BGUA 4DMGA 4Y1FA 1KP2A 4ZVLA 4PCUA 1U11A 3RSZA 5CDYA 3UMYA 3OUZA 4WZ6A 1GRCA 1ZU4A 4RAQA 4X5OA 1UP4A 1B14A 3URKA 4OYYA 3OURA 5DRTA 3KZKA 3ZYZA 1L4KA 2FK8A 3MRXA 2C9YA 1JFFB 1QC5A 1R6AA 4TWAA 5HCNA 4G86A 4JWKA 2M6LA 3T3EA 3CVWA 3LOQA 2VP6A 4RDCA 1SC1A 1ZQ1A 4IMIB 5AI8A 3ZCTA 1AS3A 4B80A 3AF3A 1KPHA 3VO2A 4XE5A 4X44A 2OEPA 1K5PA 4HXGA 3CVXA 1D1QA 2QRVB 3N0TA 4W9NC 3LDAA 4KXVA 3RPEA 5JBIA 2GJ8A 3CTPA 1JL3A 4UD2A 3TXXA 4ZVRA 5C5IA 4BPRA 1GP2A 3HR7A 3TVTA 1MA3A 4EGQA 2ASEA 3LKDA 3LVFO 2GZHA 4GVPA 3UATA 1P9WA 2FG6C 1GGEA 3ZBPA 2IYQA 3AFMA 5KYUA 2ZT7A 4AN4A 1KEPA 4AU1A 2PRJA 1Z68A 4PANA 1GXSA 1C29B 1XI2A 1T2AA 1V1RB 2I8AA 4G1VA 4GWLA 4OA5A 4JYCA 1P4JA 4V0QA 2YVKA 4R1NA 2B4KA 5AUOB 5M7EA 4ACBA 4A4DA 2HRCA 1RCUA 2OZLA 2OG2A 3M6MD 4TL9A 4G8CA 2FRXA 3TRFA 4WL0A 4EA6A 2W6JD 1JJBA 2DAPA 2PKQP 5JAZA 3MT9A 1A8UA 1TGVA 1XTZA 4PQYA 2RGYA 1KYTA 4KW7A 2HR1A 5FHRA 3IUBA 2JA2A 3UEOA 3G8DA 5H82A 3C24A 1Z83A 1ENZA 5ISMA 3ZQKA 1APBA 3IHLA 1G21E 4ME6A 1ISFA 4IM7A 4AG5A 3M70A 2QYOA 4H3KB 5FTNA 1CRPA 2G4CA 3VDRA 2O1EA 2ODNA 1C7RA 4INZA 3BL8A 4W8OA 2VHJA 3QH4A 5EJAA 4ZD6A 1T5IA 2O2CA 1ZITA 4UNSA 3KSBC 1EUYA 4FHZA 2WIBA 4ATNA 4XOIA 2YXNA 4XQ9A 3JZMA 5B1EA 2Y66A 1FP4B 1A8HA 2D13A 2Z58A 3ZIAD 2W6ZA 2HLDD 1P4HA 4K6GA 4S1WA 2ODTX 4XASA 2G06A 1YO6A 4TRJA 5E6SA 1RPNA 3ZZNA 4M9ZA 1SUPA 3QPBA 1R5OA 1FTSA 4YJ2A 5BQXA 1RJ9A 1ZIPA 2DWUA 3VAYA 4FDTA 1N6HA 5FI3A 3WRYA 2OGWA 3I8SA 4UDOA 1XFAA 1LDMA 1KI9A 5EHXA 4BBAA 4XXHA 4XPZA 3H2YA 3TTYA 1XKQA 3RFCA 5AM1A 1CY2A 5K8LA 2Q2QA 3AOEA 4IHJF 4NCJA 2A8YA 3EPJA 3GPLA 2YR0A 3NLLA 1NI3A 1QAMA 3QQ5A 1TL7C 3FJOA 1ST3A 1QH1B 3JWEA 1SXGA 4NU6A 5JWRA 2EFJA 4G0YA 1EGAA 1ONOA 4V38A 4QDTA 4PG6A 4O4IA 4HK4A 4LGMA 4G09A 4M9QA 3UJAA 1O57A 2JKZA 1U02A 4HJXA 4K9PA 4DQ0A 2DWQA 3LW8A 4C4RA 1HE1C 4S1OA 2XRZA 1KMMA 2G5PA 3BRWD 3DXZA 3OF5A 3EBOA 4OHOA 3FPLA 3MHPA 3ZQ4A 1ZM9A 2G63A 1BHSA 1IEXA 1P2BA 3EXEB 3I04M 4Q01A 3OA2A 5REQA 5G0UA 4V1CI 2O5VA 2HWUA 4CM9D 1KYZA 3EWNA 2XMCA 1LPSA 3OQPA 3ZTYA 4U6QA 3CA8A 5DNUA 5TARA 4YX9A 1BG6A 1MJGA 5L6LB 1FP2A 3EMBA 4EOGA 1U8YA 1QBGA 1VHQA 1EFDN 5DSZA 2MCFA 4DE5A 2AF3C 4NU5A 4BLQA 5BSGA 3W3AH 5HKOA 3BL5A 4A6DA 3DKIA 3OMLA 4UFPA 4Z7QB 5LM3A 4KI0A 3MBOA 3TW6A 1N3IA 4HQRA 1AJEA 4LAFA 1NHWA 4K86A 4QXMA 2DWPA 3KAQA 2R2AA 3LHDA 4OD0A 3EQ8A 3L8HA 2R7MA 3MTEA 1GCUA 1Z4NA 2NVWA 3FYCA 2GPSA 2GD1O 5F64A 4OFXA 3M9XA 4EQ6A 4F45A 1SVLA 4KFSA 4ND5A 2QRQA 4R0NA 1DX6A 1N3LA 3MS4A 4DAEA 4OHFA 1UQTA 2ATXA 3DFIA 1B43A 3LUGA 3MIIA 1Q17A 1EK5A 1YOVB 2XBLA 2WVHA 1VIYA 3C5EA 4ISCA 4ZO9A 5F35A 5IDVA 3FMOB 3ZHZA 3ZHYA 4BLUA 4DDUA 2I66A 1JR6A 1ISGA 4F3YA 3EXG1 1WSAA 5B53A 4IILA 3EVZA 4WLUA 1JTVA 3B7GA 4MCAA 1F7VA 1QO0A 3B1VA 1TPZA 2WR8A 2PRKA 3FGZA 1IHOA 3SHVA 1FFBA 1MX5A 3VBEA 1V3TA 1OAOC 4OKIA 4UFNA 4MO9A 4WKPA 1EK6A 5KHLB 5JH7F 4BJ3A 2V7PA 3ANTA 1RWXA 4BBZA 2ZJOA 4ZXPA 5F52A 3MPOA 1HTWA 2CFIA 3KG2A 3JSXA 4IWXA 3OPNA 1XO1A 1AK2A 4ID9A 1PW5A 4X1IB 4ZCPA 1J0BA 1WUIS 2P2NA 3BK2A 1NMEA 3AY3A 4FW9A 4HGOA 4OYLA 4P80A 2P3OA 3NHZA 4R51A 1ZM3A 2KLBA 1BXRB 1CV2A 3PQ3A 3M6XA 5KAPA 2CFRA 4CG2A 1ZH6A 3PHCA 4MVJH 5FEMA 3TB4A 3V3TA 3WG9A 4F96A 1JBKA 4R0MA 2FW1A 3AVPA 1YVDA 2X0NA 2FRDA 5KMGA 4GMDA 4DEXA 1Q2XA 2ZQYA 2ZJBA 4HB2A 1Q2UA 4NH0A 1U3FA 2A1TS 2X8JB 3T1OA 2Y2VA 5CM8B 4FEEA 1Z4MA 3QX7A 1NDQA 2OXIA 3OIWA 1E9DA 1XMQB 1HFKA 3O4IA 3OOYA 5CLLA 4EJ2A 3HKBB 1VDZA 2EDAA 1NPYA 1XL1A 3QMWA 5B4TA 3WBJA 5IYZA 1PBTA 4KTTE 2VUTA 5J2TF 1EUDB 3ZJTA 2FDCA 2B37A 2NOAA 1GVHA 5PNTA 1E9SA 1ZONA 2IZ6A 5JS1A 3VC2A 2WW8A 1NI5A 3TQOA 5LQCA 3AVVA 2JFZA 4KR3A 4URUR 5LZ8A 4WZAE 5H4GA 2W5UA 3AUYA 2MYPA 1GQFA 1Z25A 3R4CA 3ZXXA 4BNDB 3SQWA 1JEJA 1R4NA 1POWA 1U2TA 3FAZA 2HBQA 3MC1A 3AVTA 1Z38A 4IX1A 1PJRA 2C3OA 2GX6A 2MYUA 3EQ9A 1IN6A 2BEKA 1ZK0A 3OCXA 4RK1A 3S1AB 3TQCA 4B1FA 3VH2A 1RT9A 1PL7A 2NZUG 3EEYA 1ADJA 1JJIA 3FGOA 2G88A 3I9KA 5FI0B 1PGQA 3WNQA 9LDTA 1OY1A 2HBYA 3RSHA 3RYCA 4FFMA 2B3DA 2YBEA 4B47A 3ROTA 1JE0A 4DXDA 2AXQA 1NU6A 3L02A 1SULA 4KO8A 3R9XA 3H9BA 5SV2A 1QV6A 3NTRA 4Y2UA 4DNOA 2B1IA 2YMLA 4DQLA 1Q7CA 4DR2B 1DDOA 4CLEA 2KYRA 2O3QA 2ZB2A 3HDYA 3HI6A 2ROQA 3CLUD 2SKCA 3HABA 3TE6A 4NP6A 5DX1A 1C81A 2EZ8A 2AJCA 2QMYA 3MMXA 3W7VA 3NI2A 3WC4A 3OCUA 1IJEA 1GPH1 3UA4A 3NAQA 3EDMA 4TN5A 1RMYA 4WPGA 1E2GA 1T1JA 3G2IA 5FA5A 2CNLA 5DDIP 2YINC 4MDFA 5DHSA 1MD9A 1YZUA 2ZRLA 3EVTA 4IKOA 1BJTA 5JJLA 2VAWA 1GKUB 1XDSA 2HADA 1WP4A 1ZBQA 1D6JA 1T29A 1W76A 2QW8A 4OB8A 5CK4A 3VPBA 2VRNA 5KNCA 4LBYA 4KR0A 4TQGA 2Q5CA 3I6YA 3RRZA 5AFSA 2WM3A 1NVEA 5CA1A 4P0PB 1R6BX 3A4YA 4LHEA 4NECA 4KWCA 3TLBA 3E1SA 2VZ8A 4ZI3A 2OP1A 4IF6A 5ALWA 4QXAA 1U7OA 4YI3A 5DFAA 3GDHA 1FNSA 1X7GA 4XLLA 1EVJA 4QDOA 3A7DA 3CZCA 2V8OA 3HWRA 3WMEA 2OFPA 1XALA 5F21A 2VKTA 3AIIA 2W4IA 1JRLA 3LDGA 1OA0A 1XIVA 2BD0A 1TAGA 3GLHB 1YRYE 3KE8A 2FHSA 4OQ4A 3WHKA 5EIFA 3PD1A 2UU9B 1VLHA 4EARA 1IUPA 1K3UB 2QTMA 4RIGA 1LXCA 1Z2NX 4BFZA 4HRAA 1HUQA 2WSYB 1F48A 3WK8A 5BR4A 3IDQA 1IEVA 2RCNA 3EAFA 3SK0A 5U9CA 1XUOA 1VPLA 1RP7A 5JQGB 1TT5A 4MUKA 3VYUB 3RRXA 4XJVA 2L42A 4RSGA 5C0OE 3RYFB 4I4IA 2YXLA 5KYTA 4YIKA 1L8XA 3RT1A 2XZTA 4K6MA 1L5NA 1NOIA 3MG9A 4IHJA 1SM4A 2CLLB 4KLNA 3LAWA 1PR6A 1CRZA 2AVNA 3CONA 3UTDA 5FA6A 4IIEA 4ENSA 5GQSA 1TUBA 2HLPA 5B1DA 1KHHA 4ER7A 1UKZA 1FX1A 1Z7WA 5BW6B 4XUEA 4BE9A 2GPBA 2WJZB 3R7NA 4JA2A 5HUJA 4UCWA 3M82A 4OHZA 4L50A 4ETWA 4G65A 2WJPA 3OLVA 4B3HA 2O8CB 4HZGA 4L78A 2J3DA 1DBWA 4KRFA 3ZHTA 1U0RA 4AZWA 2BBWA 1GU1A 3DVRX 1VJGA 2CNWD 3I45A 1BVUA 2JI7A 4MS4A 4QFCA 3M1AA 4ND8B 2QGZA 4YAEA 3T0GA 3LCCA 5F76A 2I3GA 2CSXA 2VJKA 3JD0A 2Z6UA 2A86A 2CXSA 3A4NA 1I1NA 2H4WA 4ID3A 4C7JA 3ZG6A 4WKOA 4PZ9A 1KOLA 3W7AA 1OX4A 2D59A 3KYDA 4KR9A 1U90A 4LY6A 1G17A 3SSNA 5EJ2A 1VSBA 1E1NA 3OPYI 1SUEA 2V6MA 4C4ZA 1W4RA 1YBAA 3MQ2A 2C5GA 1U1GA 1AQLA 4NTZA 3TECE 1NTRA 2FYTA 3DQZA 2QXYA 2JFFA 3EJ6A 2YXBA 4ARZB 1W85B 5EOVA 4BVGA 1T8WA 1Y5MA 4BO9A 5DB4A 5A71A 2I0FA 4B73A 4I36A 4WKCA 1L7RA 2NZWA 4MGHA 2H6EA 3OTQA 1AKMA 2RHRA 3ANMA 4Q6WA 3SR4A 4YV2A 1LRJA 2Q46A 5HA5A 3RFTA 5HOEA 4XWWA 1QK5A 1GCGA 2CWDA 1DRUA 3CZQA 4URXR 5JY1A 1UKAA 3FZGA 3O0TA 3ZIAA 5L53A 1LPAB 5KWVA 1M5RA 2HLDA 3KBBA 1CY7A 1TIBA 1II8A 2ZIZA 3BSSA 1ZAKA 3FETA 4FZ5A 1SG6A 3FH0A 3K0HA 1EP1B 4RF2A 5KTRA 1K97A 3X1WA 1EUZA 1E2MA 4DC9A 2X41A 1WSWA 4FPXA 1T36B 1R7RA 3CEMA 1NXVA 1X7XB 1HK7A 1TMOA 2OQRA 3MT7A 2B0JA 1RJGA 1Z33A 3KXPA 3I92A 4KI7A 1GT91 3ZDEA 1ULHA 1YUMA 4WK0B 4MA4A 2GK7A 1W0JA 2H63A 2JL1A 4GYWA 4PO8A 1KQOA 2P5SA 2JA1A 3NNNA 1L0BA 1ETHA 4D4IA 1O5TA 5I47A 1B3BA 4Q4CA 4HSEA 1TC1A 2B35A 4UBMA 3QE2A 4JQYA 5DGIA 3BHIA 3VHXB 1LTKA 2Y3IA 2A78A 3H86A 4LZLA 2C4KA 1PG0A 1MMFB 1Z47A 4JB0A 3P9XA 2V0GA 4XX0A 3TXAA 5ADHA 3GCZA 3OLQA 4HDMA 1U94A 1MF7A 2TMYA 2O2ZA 5F12A 5J9FA 3UB3A 1WCV1 1NFQA 4MRNA 2RGGA 4B8ZA 2C7GA 3TSAA 1E3IA 3MERA 5TF0A 2I87A 3GJ6A 1P18A 2GJ4A 2NZ8A 3NM4A 4O2AA 4V03A 5FWXA 1BTOA 2J87A 2WIKA 16PKA 3SHWA 3SX2A 2YOGA 4CM9A 4EG3A 2QN7A 5BUCA 4BUZA 1TK2A 4I4TB 5ABPA 3WA7A 4DV3B 5TB5A 2OVBA 4CTJA 4YCNA 2D7DA 2GB4A 4QBGB 3RC1A 2GWRA 3H2IA 4D4JA 4BGEA 2CGEA 2MMGA 3WLSA 4G8DA 5TEWA 1HFWA 3C4JA 3KPYA 1SB8A 2O2EA 3NASA 2ZR9A 4QVGA 5LZ4A 3TUZC 4DKXA 2X0EA 3BMNB 1TCVA 3DULA 3FSGA 1CZKA 2Q7DA 1RPAA 1Z56C 3M1YA 2C3YA 1BX3A 4JJEA 4MI1A 5DT2A 1YBHA 3GFQA 3EDYA 2FUCA 3OJ0A 2X40A 3OAAD 2I7VA 3E3AA 2N46A 2SNIE 3HFRA 1AGPA 3IQWA 3C6MA 3OY2A 1G9TA 1K3FA 2FPIB 1EB8A 1SWWA 1KEZA 2Y1WA 4L4UA 3T5GA 4AYWA 4NBNA 1W36D 1DT3A 5FT9A 1DXHA 3KV1A 1ZEMA 3UFXB 4X6UA 5BSWA 4HTFB 3CKLA 4Z9FA 5BT9A 1H42A 1MH9A 2FX2A 3QTBA 3PD0A 3T0IA 3V4OA 4EKNB 2HBZA 3H6HA 2G25A 4E31A 1FA9A 4EUSA 3SM3A 5HQTA 2HI0A 2PWBA 1AQ6A 2VPWA 2JRCA 4JX8A 1BD4A 4PICA 3H2ZA 4YCDA 4ECAA 5GZ3A 2CV1A 3I62A 3OWOA 3DTYA 2R85A 1QVZA 2Z3VA 4WN3A 3RIGA 1W581 5GJBA 7ABPA 4CQMB 5MF6A 2GK3A 3NTUA 4TXMA 2V59A 1RR6A 4L8GA 4OGFA 1QKIA 2H18A 4FBMA 4JFRA 3V32A 2IH2A 2WJ6A 2ZI5A 3MCUA 4TTVA 1EXDA 4GPTA 2ZTVA 1TA9A 2QP3A 3L4KA 3GIWA 4K8OA 2O20A 2XDWA 4WOKA 4RD0A 2GLUA 2H1SA 2GK6A 1EWYA 4RABA 4AYTA 4MGYR 2OMKA 1MNQA 3MWGA 4B46A 2CFCA 2WFLB 4R8LA 2XNHA 1N2CA 2I9KA 3A9VA 3DZFA 4YI5A 1Q3HA 5FOVA 3ZWQA 1UM8A 2UUAB 3I73A 3RYTC 2H1LA 2XHZA 4JYPA 3AFNA 2AN1A 5TIIA 2J9RA 1EJ6A 2WUFA 3DHWC 5EY5B 2J9ZB 4QTZA 1AXEA 3O9VA 3DBRA 2VZ0A 1AXGA 1VMDA 2M2IA 4FMCB 4YROA 3F46A 4B3CA 4QGFA 3FMGA 2N1BA 3JVVA 3Q9LA 1SCUB 4JLDA 8LDHA 1OH6A 4J0CA 4XTCS 5AM5A 1EP2B 2YXEA 4JL8A 4REOA 4TV8A 4IVRA 1PSWA 4LF4B 3KJNA 3Q5EA 5CJPA 2YHBA 1TA0A 1RYNA 3S2ZA 3OEED 5JROA 1LC3A 4TZ0A 3AYZB 2CVFA 3IQXA 5AICA 3JQDA 2DJ5A 3E15A 4JI1B 4ER6A 1XZPA 4NZNA 4E3ZA 4Q34A 1AU9A 1ADCA 5LD2B 2BGMA 2B8NA 3RRJA 3DQPA 1YS7A 4XGKA 4CM8A 5IARA 1MEEA 3M5WA 3WQQA 3GJZA 4II7A 4EPTA 1V35A 4KUGA 3Q8XB 4PF1A 2BMAA 2LR0A 3E8XA 1OPRA 2FLKA 4M0CA 4YQFA 4W5RA 3EWAA 4PG5A 4ZEVA 2ZSBA 3G85A 4HDNB 4N3CA 2EIXA 3ZHVA 1V47A 8ABPA 4FGUA 3SVLA 1WB6A 2EJWA 3NETA 5DNCA 2VNKA 5J47A 4LTDA 6CHYA 2UZ1B 2QRJA 4B8WA 3A1UA 3DFUA 1YDEA 2FR0A 2HUNA 3D1JA 3PU6A 3E53A 4G5SA 1J0CA 1E0SA 2EW8A 3PWZA 4FYHA 1JJAA 3ZGNA 3L1VA 1I4OA 3IOEA 3ESBA 2JHAA 4HFNA 3FOBA 3WR5A 3MJCA 1O9GA 2PKXA 3ILHA 5L8VA 4KREA 1NLZA 3RAFC 4N5IX 1F38A 2J6CA 2NTJA 4W1PA 3BAFA 4Q3OA 4HFJA 1J9GA 3D2AA 3K1AA 2YL2A 2G8NA 1QSGA 1NX9A 2PYDA 3GFTA 3HL4A 4P4SA 5T4EA 4WLNA 4A7PA 4C7BA 2ZYWX 1C1XB 4G4SP 5FOQA 4UUPA 3I8XA 3LPLA 1C4XA 1CUZA 2ZSEA 4MO2A 1KMIY 2R6CA 1XZQA 4JODA 3NC0C 5IJ9B 3CW8X 4YBZA 1GN9A 2ENUA 4R05A 2VXBA 1OU4A 4ENQA 4QQNA 2G9UA 4LGYA 3W2EA 2X5OA 3EEFA 4X7RA 2BCGY 3THSA 4C43A 5DGCA 2QZZA 4GP9A 3W6PA 4CWAA 2JCYA 3GXBA 4Q3EA 4E4YA 4CETA 1FOEB 2R87A 3IEIA 4CG3A 1G8JA 1BS9A 1WEHA 1KVRA 4BQFA 4YP7A 10MHA 2LGJA 2W2TA 1HKUA 3KR2A 3NAGA 4MULA 2BTEA 3IC5A 3PEYA 1E5DA 1UJCA 4YRPA 1AB6A 4BMOB 3CX4A 5EL0A 3E0XA 5KEIA 2BZGA 5ALNA 2QVLA 1Q0UA 4OJYA 4MKGA 1I01A 1Z5WA 3JALA 2C4HA 2P41A 2M1ZA 5AO9A 2NADA 1RJDA 1OT3A 1U65A 1K0UA 1N1EA 5BVGB 2GJAA 3CX8A 4FSXA 1J8MF 3K3PA 3AKCA 3HWSA 4Q3BA 1ZUNB 3CS3A 4IL5A 4ZRNA 4MVJP 3ONEA 1FY2A 3CRRA 4AO7A 1GLGA 4DA7A 3OM9A 1Z6ZA 2UV8A 4G24A 4MW4A 1O6CA 1F20A 5KO2A 1V6CA 2F8TA 2FV8A 1JEDA 2Z1NA 2RC6A 3JRXA 5KCMA 4KVAA 2YHIA 3IB6A 5K09A 3M6UA 1PT7A 2D5LA 4H59A 4KVZA 4MWEA 1A8PA 1U0TA 1QUFA 2H11A 1JLLB 3PK0A 4DPKA 1FRQA 2NZ2A 2Z30A 3EIUA 3ZVRA 4EHDA 3RF6A 4O5AA 4DV2B 2PGLA 3H1GA 3UUWA 3ZWKA 4BN4A 2IH4A 1AHPA 1NVMB 3VU8A 3CMMA 3N2KA 4OGKA 3FTNA 3KZ1E 4RY8A 1T6ZA 4A10A 5EP4A 5KPDA 1B15A 1GGJA 5H0IA 5L4LA 3RIEA 2XNDA 4H77A 1YDHA 2F3QA 1O5IA 1PEDA 1V6SA 2QPAA 4C7MA 4MSUA 1OZ0A 3D6VA 1LSOA 1CQIA 4COKA 3LDUA 2AA3A 4IEFB 4EAAA 1FTYA 2C5AA 1EI9A 3I05A 4RY0A 3JAWB 4K3UA 5DSXA 1GO2A 1C4KA 4EVQA 2CUKA 4RVHA 3PL1A 1K5HA 3I09A 2YWJA 3AILA 1HOTA 3ISVA 2Z09A 4R3UC 5HZMA 3ZHCA 4CLDA 2AC4A 1FFEA 1MQSA 1JDBB 1QTRA 4KGXA 3GXOA 4MCJA 2P2GA 1NNLA 3AV3A 5GZ6A 2CNWA 1RXCA 3VR4A 2G3YA 4F0JA 3ZZUA 3F6RA 3CISA 2NVUB 3X1DA 3P5BA 2WHYA 3UPDA 4YXWD 1UBSB 3DHEA 1U7PA 3KQVA 3P19A 1GQ2A 1WXDA 2XUOA 3GEHA 3PFHA 4XVHA 3VYSB 3TGLA 1EB9A 5E3IA 4ZI5A 3E22A 1NVTA 5B7NA 1RWBA 4ZV9A 2JGMA 3FWZA 1FRFS 3O84A 5E1DA 2ONKA 4LYYA 4MS3A 2ZITA 3X3HA 1FB5A 5DNEA 5CA0B 4ZCTA 1BOFA 1H0RA 2Z2YA 3BTVA 3QF7A 1FUEA 4NCNA 1WV0A 2GEJA 2AXPA 4XIGS 1MXFA 3VU9A 1IVSA 2UYYA 3DDUA 2AN4A 3DWGA 1HLPA 3WKEA 4EJSB 2O3TA 3LLCA 5JAIA 2C7BA 3K1JA 2O0HA 3GVPA 4EYSA 4UD6A 1MPXA 3OLWA 4I1IA 3RYIB 1SKQA 2J31A 1JU3A 4G0PA 4KDCA 2QRKA 3L1JA 4OXKA 2YOFA 3T41A 2ISQA 5HBGA 4E5VA 5JS6A 2FE1A 3HR8A 2IZ5A 5A4MS 2JC3A 3K8YA 3JQBC 4TS4A 3K0FB 4MAMA 2A84A 4M9CA 1EWQA 1KRXA 3HB9A 3LWBA 1EAMA 4F4DA 4C5AA 1NBIA 4H0FA 3RU3A 3HFGA 2DCMA 2OMEA 1YZ3A 3W4KA 1YZGA 5KKNB 1P1KA 2ATEA 3EK2A 3K9GA 4JX9A 1VG1A 2QAIA 4QG3A 2VT2A 2O50A 3HH8A 5G4KB 5LD2C 5A6VA 5K0SA 2GXAA 2CEAA 3E7XA 5CVVA 4MI6A 2EEZA 3R8XA 2YZ2A 4S35A 1YB7A 5KI6A 1IULA 3FM9A 3GCDA 4GX1A 4IDAA 4MA5A 3VNAA 5CDFE 1Z07A 3OE4A 4TXJA 3TDMA 3ZC3A 5I51A 2XYQA 1UFQA 1N6LA 1YI1A 1C50A 1PK8A 2JLQA 3FPHA 1TMGE 4ZVQA 4AKGA 3VOAA 3HUTA 4YPFA 2PMKA 2FN4A 4P86A 3EOAI 2OHOA 3GDWA 1Z5GA 3MK31 4PSAA 1Y4ZA 4RIHA 1FMTA 2QRNA 2BF7A 4MUEA 3AI3A 1L5YA 3O4HA 1M9NA 2NW6A 2P91A 4K9QA 1M1YE 3ZDRA 1O03A 3WJAA 3BC1A 1HYGA 4O2LA 3WWOA 3AVQA 1SUAA 3ZIUA 1UXHA 3WIDA 3D8BA 5FTJA 2E4XA 4EWLA 2O0JA 1QF7A 1UJ4A 1HGXA 3BFJA 1A1SA 1X7YA 1CQJB 3O8NA 4ZZ1A 4CKCB 3M6AA 2BFAA 3B48A 5FOWA 5M34A 3HUUA 4UREA 4F93B 2NPIA 1V1JA 1HDRA 3GNTA 5J1SB 2CWWA 1HDYA 1NF3A 2W2LD 1E2IA 1L5VA 1DC3A 3L8CA 3E9EA 4NDZA 2CK3D 2HF2A 4O2BF 3ROXA 3B12A 1XNQB 3KVVA 1KFBB 4UZEA 3UH0A 3CN9A 3MAGA 4ENPA 4P35A 1ZVMA 1HZZA 4E08A 3FVVA 1H1LB 3E2PA 5DCUA 2ZT5A 4R01A 3JS5A 3KOOA 4ZO6A 4R69A 1L9XA 1MC1A 3N2IA 4G0OA 5LQJA 4Y9SA 1G20E 3F3SA 3PUWA 1OI7A 4BATA 2QTGA 4N7RA 5LYYA 2GBLA 1JIKA 2CHGA 2JBHA 4O4LF 3GLRA 2J5RA 1NBEA 2A9QA 3KJGA 5LMUB 2ZETA 4XIFA 5A0FA 2BE7A 4X7BA 4Z0NA 1OI3A 3CZAA 2C03A 3ES9A 1VE9A 3LHSA 1ZXXA 2Y9PB 2ZRDA 3HCFA 3K0AA 4OYRA 1TX4B 1A27A 2HJVA 4F4JA 1J0EA 2Z2JA 2RSLA 1E2FA 4I50B 4HB3A 4JI3B 1KKUA 4TTIA 1Y9AA 2YYYA 1JHOA 4I5DA 2R8YA 4RHTA 5E6UB 1QBKC 1QRDA 3WGHA 4BMNA 4JU8A 1BAPA 2JIDA 2UYQA 5FBZA 4TLLB 4MH0R 4MLCA 1KZ1A 4Q05A 1ZIDA 1GA6A 2KQUA 3ZD7A 2JGRA 4I1SA 2AR9A 1KGSA 1Q91A 2FAXA 4QO7A 3SZRA 2BEVB 4MYHA 1HBJA 2K87A 2GXUA 3FY4A 3U49A 4YUWA 2H17A 1J8FA 3OZWA 1QH8B 2FP4B 1I7PA 2BR5A 2NSHA 5J4LA 4JXZA 4EFLA 4X7PA 1DIAA 2OBFA 1AK1A 3FPBA 4EHAA 4BBPA 2AFIA 2JCSA 4IAOA 3I83A 2I1VB 3QEMA 5IJ0A 2G6TA 4ERNA 1SUDA 1C7EA 4NHEA 5B58C 4K9OA 1T4MA 3DDNA 3GP5A 5AKJA 3F3MA 1EFRD 3H65A 3N2YA 3OP4A 3R4VA 5DM1A 1QU2A 3AI1A 4BP1A 4DV0B 1Y89A 2GPNA 3FYUB 2QK4A 4RGVA 3RF7A 4KQIA 1J1UA 4WZBB 3A3YA 4J1TC 1Y1SA 2CNNA 3EQ6A 4C08A 4O3FA 2V7QD 1P91A 1JQLB 2MMCA 1JDBC 3OEEA 4OBEA 5A4IS 1G8SA 1T2EA 3GGJA 4E5UA 2PUBA 1RJEA 4BS9A 4DTIA 3I1YA 2YVLA 5ARCA 1KDTA 5THKA 3PS9A 1YUNA 1QHGA 5CTJA 1UJBA 5K3DA 3KD2A 4PQFA 3REQA 2FQYA 2QJRA 3EPLA 3K96A 5FORA 2XECA 4DR1B 4Q6BA 3X1ZA 3VHQA 1QQ7A 1QZZA 4US0R 1JU4A 5BN4A 2QYSA 2PBFA 3M4YA 4UMVA 1JSXA 1NUQA 4V0NA 4KAAA 1MT3A 4OBWA 5HM8A 3E23A 5H59A 3F6BX 4E5KA 3EVCA 2W6IA 4DEVA 1RZRD 1VLVA 1BGXT 3SD7A 3TQQA 4DSTA 2VPQA 1KYIA 1QHIA 4PSUA 5FBRB 4RHEA 4CTNA 4RKYA 2FWRA 4EJSC 2AOWA 1U9IC 3O3OB 3OVMA 4AW9A 3RASA 4BMZA 1HC7A 4J7UA 3RS4A 1UZAA 2GUWA 1MABA 1UBFA 1YCGA 1LKZA 3L7DA 4HGZA 1O9BA 2P67A 1R8SA 3IAXA 4RZSA 5CNJA 3RFVA 3WRXC 2AR7A 2E4ZA 3UWDA 1W52X 3ZDDA 2ISSD 3ZWXA 4D57A 3I9V1 4KBGA 3JQGA 1BQ3A 4CT5A 3A9UA 4B3MB 5DNVA 5EINA 1M1XB 3CEHA 2BI4A 3CUTA 4B0PA 5LXTB 4NOMA 3BK7A 4TN1A 4F2DA 5ADWA 3PR1A 3ZW8A 1YR9A 1SELA 1ZNXA 2DYKA 2OCXA 2Z0MA 4P08A 2NU8B 1R0XA 4HDRB 3WV5A 3WQHA 1TM3E 5KUTA 4LQ4A 2B2XA 4Q9IA 4DJTA 3CCBA 3QWBA 3TCKA 4PVDA 4U7PB 2G80A 2YWXA 4HLDA 2GN9A 1T13A 3AH8A 3QXGA 1G2QA 3F4BA 3TO5A 3H04A 2H2GA 5E38A 4XQEA 2BYTA 2FW7A 3AMVA 4DMCA 5FX2A 1R6DA 4KDRA 5TPZD 4AKIA 3U31A 3ZHOA 2JAWA 1A8IA 1G63A 4PYRA 4OXNA 8OHMA 5HF6A 4F9GA 1C7ZA 4EUNA 4K6CA 4BTEA 1P1IA 1T2FA 3HEBA 4NCBA 1EU1A 2NUAA 3E1KA 3IUQA 2ZJ7A 2FPMA 1XA0A 2I6GA 4JT4A 3BE5A 2AQKA 4QOJA 4Z0TA 3T7KA 3WLQA 2NN3C 1NY5A 2WMDA 3PC8C 5T8KA 3VI3B 1P5JA 4RTLA 1RAHA 3HZRA 1VJRA 1Z6PA 2R66A 1YB5A 1AKUA 2MWMA 3C6XA 2QXUA 2ZSHA 4XSVA 4YWHA 4QUAA 2UZIR 5KZMB 1LBIA 1RWKA 5HKBA 1BMTA 2Z9CA 1XN4A 2EYQA 1Y98A 2VYQA 3AF0A 2AQIA 4KO4S 4F12A 2FGJA 5DMHA 3QBDA 3K6RA 3H9UA 5D6OA 3JVUA 4ZCMA 4YJFA 3OQMA 3RIMA 3QE9Y 2R47A 5TS2A 4IBOA 3F4KA 3PPIA 1VFNA 3N76A 3DL0A 3SOZA 3Q6MA 3K9FC 4N0PA 2JGEA 3RIHA 2VTBA 1L6IA 3ELDA 4LXUA 2IW3A 2WHPA 1J8VA 4M7RA 4EGSA 4NG5A 2XWQA 3CURA 3RTCA 4EI9A 3Q40A 5KYGA 2ZEJA 2J33A 4UUNA 4DLVA 3UXMA 1CUIA 3AUJB 1P1HA 1YE5A 5JANA 5B2FA 4Z4FA 3AP1A 4IXWA 3LQFA 1VLJA 5A1JA 2O5RA 1GQOA 1TKCA 1EBFA 2RHLA 4JR1A 1J39A 4GF5A 3ZK8A 4PGHA 1E1LA 1RI5A 4L7VA 1U0NA 4WN9A 4C3ZA 1XRPA 3RBXA 1S8FA 3KC2A 3C7CB 5K0GA 2W7TA 1V11A 4MCHA 1Y1TA 2RHHA 5ITZB 2Q3DA 4RF5A 2J7KA 3QHQA 4JBLA 3ET5A 1OF1A 2QMQA 3NO4A 2CLKB 4XM2A 2EWVA 3LO5A 4PYKA 3GLIE 2OK8A 3DPIA 2XX3A 2GEDA 3LT1A 2WM8A 4BQSA 4X8LA 2FZGA 2HJGA 3NC1C 1NTOA 4TWRA 5AVWA 2NUPB 4H7JA 2C7VA 4H31A 2GKOA 5EWJB 4PPFA 3K6JA 2IVZA 4EFKA 2AI1A 3T5PA 2JJMA 2BMDA 4UU1A 3VNUA 4RKFA 1C1HA 2OZVA 1YULA 3PYMA 5H81A 2RGRA 4MWSA 4EMSA 3QX8A 3R40A 4ZAVA 1CUUA 2O7QA 1BJRE 1D09A 3AW9A 2BGJA 4CCYB 3VKGA 1KBQA 3FPEA 4M1KA 1EE1A 2V3WA 3AG6A 1EHYA 2WAAA 1KDPA 2C3MA 1EM8A 3D7LA 3GFRA 3STYA 5FWNA 5JS8A 1EK0A 4IQFA 3N6XA 1UBUS 4KL8S 3KKKA 1QC5B 4I3HA 5EXEA 2G9QA 2R7NA 1P9RA 1ZCZA 3FBGA 1A9OA 3FYUC 3M5PA 2EU8A 4MYDA 1NG1A 2AMVA 4OY3A 3TN7A 3Q0TA 4ENVA 2FSGA 3FHJA 3OTGA 2PWPA 3D5QA 3D3JA 1FSGA 4X20A 4MV4A 4H27A 2X1HA 4X3PA 4GVXA 1KJYA 2GDZA 4D99A 2NYAA 3DD5A 3EIFA 1ENPA 5COBA 3IEVA 4F72A 1OWMA 2X5KO 1TLTA 1P8JA 3JARA 1T9AA 1NBOA 2XB4A 5KYUB 2CE2X 1TCBA 2GBFA 1HXHA 2GARA 3ABZA 3C8DA 4NH4A 2QOEA 1KFCB 1GXSB 3TOZA 2HB6A 4GOND 1XZBA 4Q3NA 2QMOA 4N47A 1XTSA 1WXWA 1EVZA 1YR7A 4HX5A 3C3XA 4ZAZA 2B1JA 1YS2X 4MHOA 5BY2A 1ILWA 1VHDA 1DAFA 2Q6IA 4DAOA 1LVGA 2GZRA 5EZYF 4AX8A 1F14A 1TDJA 2B36A 4L9SA 3VV3A 2IC5A 3G0OA 3AEKA 2HXSA 3K4HA 4LCEA 3UJHA 1B93A 1Z4OA 3FYHA 3UN1A 2IYSA 1J2UA 2OZLB 3AFIA 2PS1A 2X8BA 1KETA 1GL6A 1LVUA 3DAGA 3UJ3X 2ICAA 5BYKA 4KLZA 2Y92A 5B4UA 1XHEA 4JC4A 5C4GB 4WINA 1OYVA 4H4EA 1NP3A 2D3WA 1ZCFA 3RABA 4RDXA 5AXBA 3W5IA 3MB5A 3LOPA 4PGGA 1Y1RA 4S0ZA 4ARIA 2PGIA 2ZIAA 5AJVB 2J4FA 1Q92A 2XKBA 1D07A 1JR2A 1P5FA 4O6VA 5EJ9A 5KOYA 1N2HA 1VSUA 2W2LA 1MG0A 5ALYA 5KQMA 3PQ2A 2CK3A 4G0UA 4R8MA 1O7JA 3DP9A 5B6JA 2JFUA 1NQXA 4JLNA 4NMHA 3E7PA 2BFEA 2MSCB 1XEAA 1OB5A 3IP3A 4Q1AA 1NN1A 4PXAA 3GL9A 3R23A 4KRXA 2FZ5A 4BLRA 4Y9UA 2ID7A 5E6SB 1JR3E 5J4YA 4LXXA 3GEDA 4YJ2B 1RJ9B 1CJMA 3OF2A 3E3OA 2XB6A 1V48A 3R5JA 3KU4A 4JIGA 2HQRA 1VPDA 2P2DA 4ZZ0A 1XTRA 3LL7A 1I7LA 3P9PA 5JCOC 1W4CA 3SAJA 3Q1LA 1ZUD1 1D0VA 5GZ1A 3F6EX 2C2ZA 3NGLA 2YYZA 3VNBA 4CLRA 4MUFA 1N6NA 3V3KA 2O8FA 4UXHA 1DX4A 3CLRC 3PHBE 5LIRA 5ENDA 2GD0A 5FAKA 4O2RA 4IH4A 5C1OA 2QTWB 3KTAA 2IEGA 1YB4A 5BNTA 2A59A 3BJIC 4MV0A 4DQDA 4O4IB 3WOVA 1QO7A 1S02A 1OSNA 3C41J 3W9SA 1UBEA 3VA7A 1NL3A 1IATA 4EF4A 2LCIA 1QRAA 1FNCA 2GN8A 2FSVA 1Z26A 4F06A 2PD4A 3F96A 3HHPA 4K9LA 4EABA