4OA8A

X-ray crystal structure of o-methyltransferase from anaplasma phagocytophilum in apo form
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
214
structure length
214
Chain Sequence
SLSKQDEYLNKLFAVDTEGALKAHKTAPSELRMAQLGTVEGQMLQLLIRMAGIHSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTANQNIVNCKLEDKITVLHGEALAQLNTLKEMAPFDMIFIDANKSSYLAYLNWAKMYIRKGGLIVADNTFLFGSVFDEHPTEKVSSNAHASMRAFNDELANKEKYLSTIIPTSEGMMVSIKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase family protein
publication title An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.
pubmed doi rcsb
source organism Anaplasma phagocytophilum
molecule tags Transferase
total genus 76
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4oa8A00
4GC9A 2YXEA 3LL7A 1B42A 2GH1A 4EMSA 3HCDA 2ZBPA 3OZTA 3DTNA 3P9CA 2IDJA 5FQNA 2AOUA 4C06A 2PY6A 4F85A 2O07A 5P8WA 3SX0A 2HTEA 2NNWB 1UWVA 1WXXA 1G8SA 1NT2A 1XCLA 3Q7EA 2VDWA 5HILA 4ER3A 5IKMA 3BUSA 1YFJA 2AVDA 3DMFA 3I53A 5E1DA 1ORHA 1QZZA 2IH5A 3BGVA 4RSRA 4QVKA 4P58A 5EG5A 4DZRA 2ZZMA 5DSTA 1JTEA 4KIFA 1VL5A 1YF3A 3CC8A 2XYRA 3C3PA 1G8AA 2AN4A 2GA9A 3I9FA 4WXHA 2P8JA 3PFHA 3Q87B 4UOEA 3FYCA 1IXKA 4M36A 4C4AA 3KQPA 1R8XA 2FRXA 4KRGA 3S68A 2XBMA 1EJ0A 1XDSA 3NDJA 1JG3A 2Z6UA 3UWPA 3R24A 4RVFA 1EQAA 2B25A 3SXJA 2ZZNA 3MQ2A 5EVJA 1L3BA 5M5BA 2OB1A 5ICFA 3SSOA 3TR6A 1NW6A 1WS6A 1SVUA 1Q0SA 2AOXA 3C6MA 1D2GA 3KKZA 3MHTA 1RI4A 2CKDA 3JWHA 2JH9A 1I4WA 2CWWA 4R8SA 5HEKA 1H1DA 1JSXA 2F8LA 3R6TA 3G89A 2EFJA 3KQYA 4A6EA 1RI2A 3B7PA 3LKDA 5CVUA 1JQ3A 4RVGA 1JR4A 3ELYA 1KIAA 5K0EA 5DXAA 4MQ4A 4GBED 5DPMA 4MIKA 3E23A 1SG9A 1IY9A 5BP7A 4E32A 4PYQA 3M6WA 3L8DA 5DRYA 2G71A 5KS2A 5B1SA 2LD4A 2AOWA 2ZW9A 1VP9A 3DR5A 4QQKA 2IFTA 5CM2Z 5E2BA 2BR4A 3TFWA 3THRA 5KQRA 3P71T 5FULA 3MGGA 1P1CA 4C05A 2PX5A 3HA3A 3BZBA 3CCFA 3I64A 1JG1A 2FK7A 3KPJA 1YZ3A 1R00A 4GQBA 4M37A 1BKYA 1FP2A 1X1CA 3V97A 3D2LA 2FHPA 4EQZA 1NBHA 3BWYA 2H00A 4V0QA 2BZGA 4ZTBA 2ZBRA 3JWJA 2FPOA 3EVZA 1XDZA 3LCUA 1NE2A 3SM3A 1YFLA 4HSGA 5E2AA 5E8JA 2HR1A 2WA2A 4CKBA 3LCCA 2AOVA 5FUBA 3KR1A 5FTWA 3TOSA 1X19A 2ZIGA 5DM0A 3PTAA 2IIPA 3B5IA 4P7GA 1AQIA 3BWCA 1R6AA 3MCZA 3DXYA 1XJ5A 2GPYA 3LECA 3QV2A 1UFKA 4X41A 4PNEA 5FHQA 5KYGA 4FT2A 4X60A 3SMQA 5BW4A 2YR0A 1M6EX 5GM2A 2O05A 3SR4A 3TLJA 3HCAA 3FUTA 1U2ZA 2QRVB 3GCZA 5HZMA 3F4KA 2UYHA 4ER0A 2P3LA 3G8AA 2P41A 2P7HA 4DQ0A 3CJTA 3FUWA 1PRYA 5FWDA 1FBNA 1KPGA 2ZFUA 4X63A 5C0OE 4ATNA 3FPJA 3R9XB 3OZRA 2ZSUA 1XXLA 4LECA 5DXJA 5KQSA 3QOXA 4GUAA 5DX1A 1AQJA 3B89A 3G2PA 3I5UA 3HCEA 4IV0A 1R74A 4RTPA 3HA7A 1BHJA 5EQJB 5EKXA 2QYOA 1O54A 2PXCA 5IH3A 3FUVA 3UA4A 1SUSA 2FYTA 3HP7A 5F2KA 4PCAA 1NV9A 3OE4A 5ICCA 1N7JA 1I9GA 3GRUA 3NJRA 4YUZA 5F2NA 5MHTA 3UJDA 3GGDA 2B3TA 3M4XA 4OBXA 3DMHA 2ZTHA 3MERA 4R8RA 5EKUA 3A26A 4LG1A 5DTQA 2DPMA 4ER6A 2XYQA 5DM1A 4AZVA 4KVZA 4YUYA 1JG4A 2PX2A 3BGIA 5EMKA 2EX4A 5LQJA 5K05A 3V8VA 3WSTA 2UZ4A 3HCBA 3M33A 3OCJA 4Z2YA 4GOLD 2VP3A 3ELDA 3TQSA 3EEOA 3EMDA 3ME5A 3P2EA 3ER8A 4EKGA 2PVCA 1TW2A 5GIPE 1KYWA 3JWGA 1VIDA 3IV6A 1AF7A 2B9EA 4R6XA 3DOUA 3P9IA 3ELWA 3GJYA 3P9KA 3OU2A 4P7JA 3AXTA 3JWIA 5CD1A 2PLWA 1INLA 5LR6A 4ISCA 3P2IA 2KW5A 1NW3A 3TM5A 2HV9A 3GXOA 4OQEA 2IH4A 2AOTA 2FK8A 3GRVA 5K0LA 3LDUA 3A7EA 3KHKA 1ZHFA 2ZWAA 1JQEA 1JTFA 4IWNA 2BM9A 4RTJA 5EMLA 2G8NA 2AS0A 3HCCA 3NTVA 4FR0A 5EPEA 4EK9A 3LCVB 5T64A 5CIYA 2C7RA 3MAGA 1O9HA 2AOUB 5E9QA 1RJDA 4RTMA 3NVMB 1BOOA 3PFGA 3OU7A 5DLYA 2P40A 1P91A 2YQZA 5D1NA 5GINE 3FUUA 3A25A 3KQTA 3SGLA 3KQSA 2OYRA 4OQDA 3FTFA 5LSAA 4G56A 3IYLW 2JHAA 2YXDA 3MTEA 3UJ8A 2AR0A 2OKCA 2I9KA 4C08A 1VPTA 5K0CA 1JSZA 2YX1A 5EEHA 5ICGA 1TPYA 4R6WA 4MWZA 5K09A 3HM2A 1ORIA 2NXJA 4HTFA 5DT2A 3ER9A 2QM3A 2N47A 2OPBA 5EHIA 1YUBA 5FQOA 4CKCA 1ZGAA 2IP2A 4CTKA 3FTEA 2B78A 2R3SA 4ER5A 3O7WA 4QQNA 2ZLBA 3FPGA 2OB2A 5DM2A 4GC5A 3LX6A 3A7DA 3OU6A 3GRRA 4E2ZA 2P3QA 4PGGA 1RJEA 3CJQA 5K01A 4X61A 4XUDA 3OFJA 2ZULA 3VSEA 3KPVA 5K0BA 1T43A 3PX2A 1ZQ9A 3LPMA 2NXCA 4GEKA 1EJ6A 4KWCA 2PWYA 2IPXA 2NYUA 3PVCA 1RI3A 5CCBA 3LBFA 4PYIA 2ZBQA 1KPIA 2ESRA 2PSSA 5EGSA 2AZTA 1TW3A 1YB2A 2CMGA 3M70A 3G2QA 2ZCJA 1RI5A 1SUIA 3B3JA 3TM4A 1XVAA 2K4MA 1RJGA 3DXZA 3ID6C 3MCTA 3T0IA 3UBTA 4MTLA 3BT7A 1R8YA 1WXWA 5EIWA 4FS8A 5GM1A 2IGTA 3SSNA 5FCDA 3DULA 5E9JA 2IBSA 3M6XA 4RTQA 4XUCA 3G8BA 3I58A 4KIGA 4RTNA 3ANXA 3GU3A 4JXJA 5HIKA 3C0KA 2BM8A 4RX1A 4AZTA 3VC2A 3RIEA 2EJTA 4FP9A 1VBFA 3O31A 5U4XA 4E33A 4AZSA 4PYMA 3EVFA 1XDUA 2AN3A 2JHCA 2PBFA 2ZIEA 3B3GA 3C6KA 5EC8A 3VC1A 1KXZA 1DCTA 3FZGA 4XCXA 5HIJA 3FPEA 5C1IA 4CWAA 2H1RA 4E30A 4BY9E 4AX8A 1PJZA 4DCGA 1MJFA 1SQGA 2I6GA 1DL5A 2P1DA 5LQRA 2YVLA 2P7IA 3BWMA 3TKYA 1G6Q1 1KP9A 1SQFA 1R18A 4LWPA 5HIIA 4POOA 3KPYA 2ERCA 3EVAA 1JG2A 3HCFA 1NKVA 2HWKA 3HEMA 3HNRA 2VZ9A 5DTRA 5EEGA 3UJ6A 5C9ZA 1NV8A 2OO3A 5K0FA 3NMUF 2VDUE 5FHRA 3LSTA 2JJQA 4E2XA 5CCXA 3KR9A 3TPZA 3AJDA 5D1HA 3UJAA 2Z6QA 1F38A 10MHA 4AUKA 2OXTA 3AWIA 2NXEA 3HVHA 4LWOA 4R05A 3KPUA 2VS1A 4BLWA 4YV0A 2QE6A 5DRTA 3EPPA 3K0BA 4PWYA 3R3HA 2PT9A 3UJCA 4U7TB 2JHPA 4PYNA 3FPFA 1L3IA 4FT4A 3EEYA 5K03A 2ZIFA 5T67A 5DX0A 5EHGA 3G5LA 1NW7A 2O0LA 3FRHA 3KQQA 4NECA 5EZSA 2XVMA 1YZHA 4YUXA 5JR3A 3BGDA 2V7EA 4KDCA 4Y2HA 4PYOA 5E1OA 4DA4A 1FPQA 4X1OA 2EG5A 2XYVA 3A27A 4EVIA 2B2CA 5ERGB 4RTLA 4RTRA 3LHDA 5E8RA 4CXMA 3LDGA 2IBTA 1I1NA 5F2OA 1WZNA 3FRIA 3GNLA 4PINA 4XUEA 5DSXA 3UJ9A 5HOQA 4HG2A 5DX8A 4FSXA 2ONZA 1L3CA 4YMGA 4E70A 4DF3A 1VLMA 1V39A 2GB4A 3H2BA 1G60A 3BKWA 2AVNA 3KQOA 3MTIA 5EMMA 4YUVA 3UJ7A 3KQWA 3HVIA 5BW5A 3PT9A 1RJFA 1QAOA 2CMHA 3OE5A 1JQDA 5GP1A 4KW7A 4MHTA 3IEIA 1ZGJA 2G1PA 1X1DA 3SVZA 1N2XA 3A4TA 4QDKA 3KU1A 2FCAA 3FTCA 2OY0A 3FPHA 3THSA 3UA3A 4E2YA 4P7FA 1M0EA 3AXSA 3MB5A 4RYLA 1NBIA 2O57A 4L7VA 5K0NA 1NW5A 5BXYA 5EMJA 3T7SA 2DULA 2E5WA 3CGGA 2PV0A 1P1BA 4BLVA 2PX8A 2PXAA 3FYDA 4C07A 5LQAA 4O29A 4BP3A 3B3FA 4KDRA 4K6MA 4GF5A 3GWZA 2R6ZA 5EOVA 3LBYA 1VP3A 1QAQA 1BC5A 5CVDA 4E31A 4U7PB 3LKZA 4RTKA 2I62A 4QDJA 3FUXA 2Z6AA 3PB3A 4M38A 4QPNA 4QTUB 1VE3A 2BR5A 3EGVA 3P9NA 3OZSA 3ORHA 3AY0A 1DUSA 4YV2A 5CVVA 5LQNA 1FJXA 2AOTB 2PWPA 2GS9A 4ER7A 3HTXA 2YUIA 3GRZA 3ERCA 1F3LA 4IKPA 3E05A 1QAMA 3G5TA 5GOZA 4F86A 3PS9A 4V0RA 2OZVA 1ZKDA 3NW9A 3G2MA 1QYRA 3P2KA 2A14A 2IDKA 4B17A 2NXNA 1G38A 4RV9A 4GOOD 5FADA 5EZQA 3BKXA 2VDVE 2JH8A 4PYKA 4OX9Y 4M7RA 4QPPA 1SKMA 1L1EA 2PT6A 2PJDA 2UYOA 3KPWA 3QOWA 3DUWA 2BR3A 3CKKA 3U81A 4E2WA 5K8VA 2I7CA 5K0GA 3EGIA 1HNNA 2CL5A 1ZG3A 3KQMA 2ONYA 1UIRA 4HH4A 1D2HA 2C7OA 2WK1A 3KQVA 4HGZA 1KYZA 3KR0A 4AZWA 2BH2A 1D2CA 3EVBA 3GDHA 2Y1XA 3OPNA 4HTFB 4PYJA 2GLUA 3DXXA 3KR2A 2PX4A 2PGXA 4C04A 8MHTA 4RVHA 4PIPA 5E1BA 4GOND 9MHTA 5DWQA 5FA8A 3E7PA 2P3OA 1X1BA 1RI1A 2PKWA 3GRYA 3C3YA 2NP7A 4OBWA 1G55A 2QRVA 2C7QA 3G7UA 3T7RA 1X1AA 1KR5A 3CVOA 2ORED 4FSDA 2XVAA 3ELUA 3R0QA 2OBFA 2G70A 3PLAE 4DKJA 2ZVJA 3EVEA 3NWEA 2ZZKA 5FWAA 1MHTA 3CJRA 3NDIA 3M6UA 5LQKA 1Q0TA 3T7TA 3EVDA 5EIFA 3IHTA 1VQ1A 1AV6A 2AN5A 3NWBA 2HNKA 3RW9A 1WY7A 2IH2A 4OA5A 4RWZA 4FZVA 4PYLA 5CVEA 3UJBA 1XCJA 5KVAA 7MHTA 1WG8A 2YXLA 3P97A 4RVDA 2UYCA 2ADMA 3LDFA 3X0DA 3EVGA 3HVJA 2G72A 5DM4A 3DLCA 4YV1A 3E8SA 4QTTB 2O06A 3BWBA 3GIWA 1EAMA 4PONA 4F84A 4PGHA 5JUWA 5CUQA 3RODA 2C7PA 5E1MA 5H02A 4A6DA 4Y30A 4C03A 2NP6A 4PIMA 3HVKA 1XTPA 1KPHA 5ICEA 1HMYA 4P7KA 3GO4A 1L9KA 1EIZA 3G88A 4YUWA 4QVGA 4CTJA 1P39A 3DP7A 4H0NA 4HRAA 5T6BA 2H11A 5CVJA 3DMGA 2P35A 5E9WA 3EGEA 4BP1A 2Q41A 3G2OA 1FP1D 5GWXA 3CBGA 1OR8A 3P8ZA 4PCLA 5HIMA 3TKAA 5K0JA 3M6VA 3PX3A 1KHHA 1O9GA 4IV8A 3EVCA 4EKIA 1QANA 5GIOE 3VYWA 2QY6A 4HC4A 1M6YA 3EMBA 2HMYB 3FTDA 4OA8A 5G02A 2ZWVA 4BLUA 2WA1A 2GAFA 3OFKA 3LGAA 3NVKI 5HFJA 4GOMD 5DTMA 2UYQA 3UZUA 5LQCA 5FA5A 4RTOA 2PXXA 2YTZA 3HA5A 4WVLA 3BXOA 3DLIA 4DMGA 1Y8CA 2JG3A 2EJUA 3DH0A 4DM3A 4CKEA 4YMHA 3UFBA 1Z3CA 1EG2A 3O4FA 3REOA 2Y1WA 3K6RA 1IM8A 4HGYA 3TRKA 3TMAA 4DCMA 4RTSA 3SSMA 5LQUA 1NW8A 4FGZA 2V74B 1N7IA
chains in the Genus database with same CATH superfamily
1T2AA 1MQAA 3IO3A 4AJHA 4OHBA 2R7LA 3BGWA 1WW2A 1G8PA 3TDKA 4ZO9A 1OHHD 2RGXA 5KSOA 2AOUA 2DTDA 4M99A 4BNDA 4N0PA 4OREX 4EKDA 5EIHA 2AJTA 5A9RA 5JJKA 1WHTA 5LIPA 2XB2A 4PRLA 3V8EA 5KREA 4IIJF 3CRW1 1UC8A 4R0VA 2J3QA 1WB5A 2VRBA 3FNQA 4UZEA 3V1NA 1M1YE 4MV6A 3QELB 4KAFA 5ALFA 1B3BA 5M3BA 4BO8A 5HM6A 2OZEA 1BQ3A 2YJNA 1TYDE 4DZRA 2RI0A 4N3AA 1I24A 4TKMA 4JSTA 5EJ5A 1USIA 3DAPA 1AK1A 4JOCA 1TOAA 2E4YA 4DIKA 6NULA 2X86A 3AY7A 2HN9A 5GQSA 5TJHA 5CHYA 4PR3A 5AW7A 1VKJA 3NKVA 3Q87B 1PS9A 1K27A 2W4MA 4CMGA 1V11A 4Q3DA 4EHNA 1XEWX 2FR1A 1WNFA 4RKFA 3CN7A 2C20A 4OVKA 4KSCA 1M34E 4S1PA 3OSZA 3QRWA 1YBVA 3ENVA 1N36B 4CCYB 1UP6A 1OWLA 1UPBA 2RGCA 1E2GA 3HABA 4PNHA 2WYOA 1CQPA 1PF7E 4HNSA 4R84A 2OB1A 3VNAA 3ILSA 4CLOA 4GP9A 1FDOA 3U7HB 2ZM5A 2EP8A 4LFAB 3UKOA 5FI1B 1QTIA 1JF8A 3TAUA 5K2MA 3O93A 1GDDA 2H59A 3FCXA 2DXIA 2WZCA 4PX3A 1CUZA 2XVYA 1WKCA 4M7PA 3ZKWA 1HQCA 2HK6A 2FZLA 3OECA 2X8JA 4I1OA 3JALA 3UUWA 4Y9DA 4PGAA 4J1SA 1BDBA 5K8TA 4KH0A 5C4MA 2PRZA 2C2MA 4JFAA 3THOA 3KZMA 1L6IA 4RZQA 2HPVA 1VP9A 3C4QA 3P20A 2XCRB 4LF5B 2CYCA 2BR4A 5SZJA 3AB7A 3DPSA 3KZCA 1LZKA 2QL5A 4W1RA 4X7PA 5FFMA 4CM1A 3S99A 4RA6A 3S1LA 2E3JA 2EARA 2ZB4A 3N2IA 1JG1A 3AM3A 2O0JA 3DVAA 4FMDB 2M9MA 5JSZB 4M0PA 1J0XO 3O4JA 4LN1A 3G9QA 1FFCA 3RC7A 5AVRA 2J87A 2PWBA 3I5AA 4NCJA 2PUBA 2BEWB 2JCXA 2O0MA 2V8BA 4ZTBA 1ABFA 1QQ6A 3DQPA 3EVZA 5ESDA 3JAWB 4NENB 4HSGA 4RPIA 1K3UB 4EG0A 5LIRA 2B8JA 3WGOA 4RORA 4C7XA 5JQWA 4PS1A 1VKOA 3SX2A 5DXFA 5FDFA 4LGYA 4UBKA 1I2AA 2X2PA 5FJJA 4Q12A 3RYHB 2GGSA 3PTAA 4RF3A 4O1HA 4IMIB 5KNCD 2C2OA 4Q3EA 2XUHA 3K3PA 4BO3A 2H48A 1XJ5A 2O3UA 2C2HA 1PWZA 1BGVA 1ENYA 2NYAA 3L1UA 1FW6A 5KYGA 4RZUA 5LU9A 1LVUA 2BBWA 2C8LA 3K2QA 2IYTA 5E6UA 4B3GA 4KHPB 2HQSA 2W6ZA 1N0VC 2QPLA 1FFBA 1NM5A 1QM5A 1XYGA 2NAPA 2QUIA 4IZOA 1CQXA 1E96A 3FUWA 1QDUA 2O7SA 4GVLA 5A3SA 1LRJA 1ZAKA 4X63A 5JALA 2VDNB 1A2KC 5IT4A 2RHRA 3G0DA 3IPYA 1ST2A 4J4HA 4HUTA 1J5EB 1XMQB 1EUDB 1BS9A 4AECA 1AQJA 2XNCA 5LCXA 2SECE 3AZQA 1DAKA 1SCQA 3JY6A 1UDBA 2Y1DA 2PZAA 1RQGA 1WY5A 3K1AB 2UVDA 4EF5A 3K2IA 3MWLA 2P0YA 4KTTE 4UTXA 2YZ2A 5TC4A 2XMCA 3RS9A 5AJTA 3VUEA 3S0JA 1LPOA 1E8NA 5F2KA 4HXYA 3RROA 4MW7A 4QPDA 3GGDA 1V8OA 1EXMA 2QTMA 2A9FA 1LW7A 3INNA 4JL5A 4JXXA 2VL7A 1YZVA 4P35A 3PQ4A 3F6YA 3PZBA 4B0OA 4YUYA 2AEEA 2AN9A 3LP5A 1T29A 1IBKB 1ESMA 1IC6A 4IGAA 4DG5A 5B6JA 2CK3A 3WG9A 2X2EA 2QAIA 1EP9A 1GPNA 2QYSA 2EWMA 2VP3A 1KDYA 2JKVA 2VQFB 3O3CA 3N2KB 3TLYA 1J7JA 4ASUA 1XKQA 4AMZA 1TX4B 1Z7GA 3OM9A 3LWBA 3IV9A 5FV7A 1PV1A 2V5AA 3UKJA 2BUBA 1GXSA 1KDOA 1RZVA 8GPBA 2QLMA 2C2XA 5HTOA 5KTSA 3WGGA 2GFHA 4UBMA 2GNAA 2PLWA 2XUZA 5LR6A 1JR3A 1XD2B 3QVGB 1FMCA 2HBZA 2R6CA 1YZYA 4MQEA 1JAXA 1ZNYA 2JATA 4OQEA 3WY9A 3DAYA 5H0IA 2OXIA 1D4FA 2V6JA 3A6HA 4UBJA 1COZA 4WW0A 2BM9A 4BMOB 2VLIA 4OI1A 3ADOA 3AHHA 5EMLA 4BQIA 4CZ2A 2C3UA 3LFUA 1NYRA 3MINA 1YUNA 4P6VF 1GPJA 2HD4A 3IFSA 1PUIA 3LCVB 5FI3A 2IPMA 4WJZA 3VR5A 4KV7A 4CE6A 3M4JA 4FEAA 3ZV3A 2FWJA 4V3CA 3V4ZA 1W9HA 2ZYTX 4IM7A 3A2KA 3LOQA 1NBME 2BZ1A 3QOYA 1Z5WA 1RRPA 4CL2A 4ZPJA 4A2WA 1ABBA 3DDCA 1X80B 4NBNA 4ZJYA 4LOHA 1T3GA 2YXDA 2AI3A 3WIVA 4ZXPA 3K1TA 4WXMA 3QEJA 2NO5A 3EQ9A 4LXTA 2Y2UA 5EXSA 1CUCA 3VDXA 4Q3BA 4WY8A 1XQYA 3HM2A 2ZKIA 3ESYA 4MR8A 3BD7A 1I5OA 4ZHQF 3EFHA 4NX2A 1DJOA 5FP0A 5KC9A 4LVCA 1VPDA 2IP2A 3P4XA 5FWXA 4D9NA 1I36A 3KOWA 4ALIA 3UOAB 2BFEB 2B78A 2B94A 3SCZA 1S1MA 2C59A 5UKDA 1VHWA 3FGOA 4BNXA 4EG4A 2BGMA 4I81A 5EP2A 3LX6A 1ZMTA 2IPAB 1TA0A 1OC2A 5DEIA 2NVWA 5KYTA 1VHLA 1Y7PA 2MHCA 2FWRA 4H77A 2OT3B 1FX0B 1FUKA 1FU4A 3L01A 3N1UA 5AWFC 3GBPA 2IS1A 3UAYA 3FDIA 3OOEA 2AC7A 1M75A 1PDVA 1RKVA 1RQLA 2ZVDA 3OG9A 1Y5IA 3FGNA 4OEHA 2QD2A 4FQ7A 3VR4D 3T3HA 1OIXA 5LQMA 4Q3CA 3I4FA 2EBFX 3V7WA 1R37A 3OH8A 4UM8B 1GARA 1YB2A 4BMDA 1H42A 3CUTA 3OZ7A 2B4KA 4K86A 4PZZA 4C7OA 2PR2A 3FCYA 4DTIA 3GYBA 4KQKA 4ZIRA 5CA0F 3E3OA 1Z36A 4RETA 1HE8B 1PG2A 5DNWA 5CM9C 4MI1A 621PA 4MPJA 3AONB 4LRWA 5K3DA 1GQYA 1M73E 3L7CA 4XUCA 4Q3KA 4PE5B 1FVFA 1ZYUA 1T24A 3QBDA 1ZU5A 3ANXA 3GU3A 5SV2A 4UM7A 7ADHA 4A15A 2IHNA 2O7RA 1QX3A 1E60A 4Y9SA 5HZGA 5KNCH 1IY0A 2X5OA 2REOA 2I4MA 4ID3A 1ISIA 3C6KA 1XVLA 3JQPA 5EJIA 2C77A 1DCTA 2ABWA 3CBQA 2VH1A 1I2ZA 4BVLA 4XCXA 4L5IA 4CWAA 4NU6A 4PX5A 2W2OA 3TDMA 1JFRA 4MW1A 5B1IA 5K8CA 4ZANA 4P83A 2G1JA 4GMDA 2GSDA 4ND1A 1KERA 3T3DA 3VKWA 2DFNA 3G3EA 3WLSA 2YVLA 3KU4A 3N86A 3ZDYB 3ZIAD 1JXQA 1ETHA 3ZCPA 3NR2A 1Q7RA 4PAGA 3H0CA 4ECAA 2BFCB 2IZ7A 3ASVA 3UJ6A 5K0FA 2XLCA 1W4BA 4Y1EA 1BAPA 1VRVA 2NYVA 3TIXB 1UXGA 1YZFA 2JIRA 3IC5A 3LSTA 3AJDA 1ZN2A 1IFXA 1G3MA 3F9CA 3FMGA 3SHFA 3D8NA 4V3BA 1RWBA 2H51A 1HT2E 4EELA 4QJ5A 3RVNA 4XSVA 3KJZA 4ARBA 4D4HA 5CK5A 1QFSA 3D6TB 5E95A 4PYNA 3AETA 1HDZA 4FT4A 4HWOA 4JBGA 3GHHA 1BE0A 1PBNA 3LS2A 1YZHA 1Z08A 1K2VN 3EC7A 5E1OA 3TECE 4MV9A 4PG5A 2IYYA 1CVLA 3RVJA 2Z0MA 4H1WA 3WNBA 3QYFA 2B2CA 4ML3A 2OBXA 3CLRD 5ES4B 4AI6A 4JBHA 2F1JA 1PFVA 1SAYA 3CCCA 3O21A 4YMUA 3C4JA 2W6IA 1VL8A 1JDUA 2CVOA 3WFIA 4E70A 2F55A 4MP3A 3UMCA 3MTIA 1D2EA 3ZNOA 1C3JA 1ZH2A 3P4UA 1KRXA 1IHOA 4GUDA 4QRDA 3QX3A 2AJLI 3SAJA 2KLBA 5ILOA 2ATCA 4LZWA 3EPKA 4RIEA 1RWPA 4OLFA 5EJAA 1CUIA 4UNIA 5FJIA 2H0QA 1IAVA 1MX1A 1IPFA 2HQBA 4MYCA 1RKXA 3TR0A 1X9IA 5CIWA 1X70A 1JW9B 1X86B 5A6SB 3OBIA 5KYUB 3MB5A 2DY0A 4CR7A 1MB3A 4X0EA 3B48A 3B2EA 1A96A 2GVDC 5JNTA 1F9AA 1OREA 1W4LA 2HRBA 2FSUA 4G09A 4D8UA 2I54A 2GBLA 2P6NA 2EKBA 2Q6KA 3U3RA 1MB9A 3LQFA 2A1TR 1U8YA 4OD0A 1QKIA 2FW9A 4KYIB 1EKXA 3HWX1 4DSAA 1Z9BA 3K9QO 2ZJ7A 1ELOA 3F2VA 5TQ2A 8ABPA 4M49A 4NDZA 3ZWAA 2AE2A 3N8KA 5F78A 5A3RA 6ADHA 2AZXA 1G8FA 3ZBPA 2C5EA 4KUHA 4F2HA 3EDMA 4ZOLA 2G77B 2O5RA 2O7NA 4C3OB 1JVSA 2GXQA 4XQCA 5DK6A 1RE1A 2EZ8A 4ZYYA 4JI0B 1WOYA 1PR6A 2DVMA 1U0SY 3NU1A 4FS3A 3NTXA 1HDCA 4U9UA 2EWWA 4FMBB 1ULHA 2DP4E 5KYYB 4BNWA 1D4OA 3EH2A 3HYTA 1SVOA 1YJXA 5HSGA 1DKLA 4JLVA 4M54A 2ECFA 4B17A 3ET5A 1RXSA 5IAJA 2ZU6A 4G0WA 5LA6F 3FKQA 1MV5A 1UKBA 4QPPA 4PV7A 2ZOSA 3KPWA 4HXGA 3B36A 3IBFA 3L18A 1E1LA 3R7WA 2CUKA 1ZG3A 2HSGA 2QU7A 4ZGBA 3QEAZ 1SC6A 4AY4A 5BXQC 5JYDA 3WWDA 3EVBA 3OQ6A 2Q0HA 2XA9A 2X3YA 3QHPA 5KDLA 4Y2TA 1BCRB 3VR4H 4RVHA 4CKCB 4XQ9A 2CVFA 5BV0A 3FY4A 4I3HA 1NQAO 3PPVA 1XK7A 3IKJA 3NM5A 4LK3A 4M9UA 1AHIA 1PR1A 3BRQA 5B55A 2ZRHA 4NVRA 1KS2A 3D64A 5KQLA 2ZJBA 5HS6A 1FDVA 4LNAA 1QCZA 1TU4A 1ZUWA 3KLNA 4J4TA 4OHOA 4TN1A 1A4IA 4GVXA 2Z3VA 4HDQB 4UTNA 2FMFA 4IKEA 1MABB 1TA4A 2QMUA 3KTOA 3OIGA 3B1YA 4KOAA 5J9FA 2VJOA 3C7KA 3E35A 3IHTA 3IEVA 4S2EA 1HYQA 1L4EA 3MC1A 1BHO1 5KVAA 4RVDA 1QHSA 3D4LA 1KK3A 3OPMA 3I6QA 3EIHA 4TV8B 5KAMA 3CMMA 1NNLA 3PE3A 1V8ZA 4RO0A 5ULLA 3SE7A 4GR5A 4H7KA 3KZOA 4QTTB 1ZK2A 4D99A 3HBMA 4LSZA 3FDFA 1W59A 1JHXA 1PE0A 2RHCA 2VJQA 3CLVA 3OKFA 5TPWA 2CLMB 4IILA 3WZLA 3EX7C 4CUZA 3SYRA 1RKBA 2ASVA 1Q15A 2GCEA 3DP7A 2FP4B 3D2AA 5DFAA 2Z5VA 2ACEA 4G01B 3U1VA 4MNTA 4E11A 3ZTYA 2VK1A 3D6UA 4Z8YA 4PAQA 3A6KA 1UMCA 3I76A 1ZIXA 3VR6A 1M1NA 3EJ6A 1XN1A 5K8UA 1I2DA 1A72A 1QANA 2CHUA 2HU5A 2J07A 3FTNA 3HDTA 3QMVA 1SUWA 4WAUA 4UTOA 1M1YB 4RS4A 2XDWA 3K5WA 1B76A 3AR9A 5FUYA 4ZI2A 4DARA 4I9HA 5JH7B 1X7YB 3ZOZA 4ZT7A 1YRHA 1M6VA 3GT7A 1ISMA 5HFJA 3RASA 5FA5A 3PP8A 2PX3A 3N5CA 3F3YA 4P4GA 4W6ZA 1TQ6A 4OB6A 1EWVA 3H0EA 4PLVA 2AG1A 4BFCA 3O2SB 1W5SA 3A9SA 3JSXA 4NESA 1ZGCA 1VE1A 2I6FA 2IX9A 4MVXA 3B1FA 1E6WA 3MWKA 4K9DA 3D5EA 4J0QA 1CQZA 1RC1A 1QF7A 1XXHE 1DEKA 3N0RA 4J7XA 2I3BA 2E37A 5EQTA 3PHLA 4BWYA 1M34B 2J9FB 3L92A 1KZYC 3HCDA 5I7AA 4QM7A 1XWFA 3UTCA 5FQNA 1OYOA 3CNBA 3K9HA 3QF7A 5FTJA 4G0PA 4DBLC 2X6QA 3PHGA 1FTSA 4GICA 2EZTA 3AKZA 2FH5B 3CRMA 4XDYA 1GPUA 5P8WA 3CVXA 2B1GA 1UWVA 4PC3A 2XPCA 1YFJA 2IJGX 3WS7A 5JV5A 1YE8A 1WBJB 3UAVA 3KZKA 2IYUA 3ND8A 1Y4DE 1AK9A 1F4VA 2IYQA 4MRPA 4RMJA 3FAZA 5B3AA 1UOQA 3Q0IA 4B3CA 2AXNA 1E9VA 4TLMB 1SXPA 5IJWA 2QTVA 4UE3S 2A1UA 1GQRA 2HMWA 3HHPA 2JGRA 3T4UA 1LSUA 4LCEA 3DMYA 4C22A 4WECA 4RL4A 3RFCA 3AHFA 4ZO8A 2BKUA 2QUAA 2V7TA 1IDN1 2X2FA 1E2UA 1PJLA 2VJKA 5EPUA 3CUYA 4L0QA 4ESEA 3TLGA 1S6YA 4N6NA 3R24A 3TPFA 3WWYA 3BM5A 4GKVA 1Z6AA 1QOPB 1WTCA 3KJHA 3X1JA 5CBPB 1OW3B 1XZEA 1ZNQO 3PTLA 2ZSFA 4BYMA 5AQ1A 5L9AA 1NW6A 2VOEA 5JSKA 4O25A 2VJYA 4N1AA 1Y6FA 4DPMA 4GYWA 4O2AA 3MA0A 1D2GA 2BHTA 3PXDA 1RI4A 3TQIA 4OQ4A 2CFCA 3DZGA 2I22A 1DOZA 5G3ZA 5H3CA 5F1YA 4GSKA 1DTWB 4WNIA 5TB5A 1RI2A 1NGSA 3B7PA 1HR0B 2CDBA 4UHFA 3OM0A 4B73A 1U1DA 2CNOA 4K6GA 2AT1A 2GNOA 1PQWA 3CZRA 4NK5A 5DXAA 1V2GA 4KR9A 2AMYA 3L4SO 3VNRA 1CUBA 2D1RA 3T5DA 3CZCA 4AFNA 2NQ8A 3L7AA 5E6RA 2WM9B 3A3PA 1NVTA 3CLSD 3ILYA 4WESA 4WT7A 2IQ5A 4L8FA 3SHTA 1IZYA 1MVOA 4C9BA 2FQ1A 1VSUA 1O1YA 2N75A 4BTVA 1OGIA 3G85A 3RRYA 1OPRA 2CBGA 3NPAA 2AHRA 2C2KA 3QNMA 1ULUA 2NN3C 4DJEC 2HA4A 3MIZA 1KZ4A 1YBMA 4I4TB 5F5LA 3BWYA 4N7JA 1CY7A 3LCUA 5LZ2A 4BVKA 3DNPA 1B3RA 2CVPA 4XPIB 5F4BA 1P45A 1RYYA 3CXUA 1VMEA 1CWUA 2ZS9A 3EG9A 3LCCA 4A8HA 3D8SA 4ALJA 3RC1A 4EX6A 1NQOA 2VAPA 5AK0A 3ZC3A 1J56A 5IJAA 1FB5A 1YULA 2DHCA 3BE6A 4JKIA 4O4HF 3ZU3A 1IB6A 3CLKA 1Z0ZA 1TK9A 1WHSB 1H3FA 2PXHA 3SF0A 4PRZA 1AQIA 3M89A 3ROPA 3SZGA 4L0CA 1T4BA 1ZRHA 3K0AB 3VM6A 3WMRA 3HBJA 5T8KA 4V1CA 1EE9A 5COBA 2P5YA 2XOEA 4X8HA 1K8XB 1NZFA 4BAUA 2P78A 1ZN8A 4WDRA 4P86A 3L6CA 1NNUA 3KOUA 3LLMA 1WAMA 4RQBA 3VZRA 4DIDA 4UCXA 3F4KA 1AKMA 2HSZA 4MPTA 1MENA 3G8AA 5IVDA 6CHYA 3UHAA 1E9DA 3A4MA 5E7JA 1FJHA 2GAIA 2XNJA 5C0OE 4GM4A 3FPJA 3H1FA 4FW9A 5DVZA 2IHJA 3A31A 4N8EA 2PCLA 4M8KA 1Y1LA 1JQLB 2OD9A 2WDZA 1EINA 1IE3A 5AM0A 5FR1A 1YS9A 3G2KA 3B89A 1NHGA 3ZTWA 3KKQA 1XNJA 4D6XA 3PC7A 4RTPA 3WLLA 2WF9A 4NIMA 3LXRA 1VG1A 4A0GA 4B7CA 2JLCA 2GZMA 1ZBDA 5ALMA 3OIWA 3FBTA 4R41A 1V5EA 2ZYGA 1QGED 1JEYB 2WFAA 5HX7A 5KTYA 4AURA 2BF7A 3BMQB 2DEUA 2ZUWA 1LBEA 1N2BA 5CJ2A 5AFSA 3CH5A 4BE9A 4RXTA 1GUBA 1W49A 3CUEF 4EDFA 4GM1A 4XX0B 5JFTA 3OP4A 3NJ8A 1HM5A 2GD6A 5LNK1 4JI2B 1NFRA 4GBMA 3VGJA 1WTAA 2WRZA 4I46A 3D02A 4UULA 1JDVA 3M33A 2IOQA 1T9KA 2L17A 1OH5A 3ELDA 3JVVA 5LU8A 1Z5PA 4YT8A 1C8BA 2VLBA 1MX5A 4QFBA 1ZOPA 2PVCA 5GJCA 4RLSA 3A4IA 2Q0SA 4FOLA 3FF4A 3CONA 3TRIA 3ENQA 5KTOA 1P9NA 5ALIA 1R9MA 4YBRA 5DSZA 5ER9A 1KY2A 3IA7A 5ALZA 3VR1A 2P6UA 2YJGA 2A9JA 3GXOA 3LA8A 2VYVA 3O8QB 5FFNA 4CMBA 3QLVC 1L5VA 4CIBA 1OTHA 3MCUA 3RVDA 5IAGA 4EEXA 3AL3A 2ZANA 3ZI7A 4HJXA 3LH5A 2M6RA 2WDPA 3V4LA 4AM8A 4MQ5A 3C3WA 3BHIA 1GY8A 1MP0A 5HXAA 1U7UA 3AFHA 3Q72A 2JKZA 1ODFA 1GG5A 1KMHB 3AEZA 1H85A 3KIPA 3A25A 3LT4A 4MX8A 4RF2A 1U8AA 2Q46A 2D1YA 3BC1A 3EXG1 1G3QA 1QYDA 1D2MA 5LSAA 4AS1A 3G23A 4UZFA 2I3AA 5JATA 1HNWB 2B34A 2GEFA 4CQMA 3K0EA 2BPOA 3FETA 5AXAA 1Z0IA 3HDVA 3LRTA 1WXIA 4GH5A 3KYBA 2CT8A 3OOWA 1XWIA 1U8UA 3EFOA 2RGBA 4MWZA 2JIDA 1CIVA 3T7AA 5FBRB 2REXB 1VBNA 2OPBA 3L04A 1FFXA 3TGPA 2BDEA 2GMWA 4U0JA 5E7IA 9LDTA 3FTEA 4LBZA 1GFZA 3IKVA 3R1IA 3KKNA 1SQ0A 2PJUA 1A9YA 3QHQA 3F7OA 4JR2A 3GJXC 2EL7A 4RMGA 1RRMA 1QS0B 3AUUA 4GC5A 3VO9A 3L7MA 3VQTA 3G13A 4AJKA 4DDKA 1XPOA 1HOXA 2WTMA 1FXWA 5ES3A 1XWWA 2BMJA 3U31A 3CJQA 2XNDA 2BMFA 2F59A 2IEYA 4X61A 3VKFA 1NAHA 3DZJA 4TV9F 3GVIA 4RK7A 3JQ7A 1GRNA 1TF5A 1XYYA 3HSSA 2BJWA 1QGDA 1TM7E 4ND6A 2OBNA 2PWYA 1V7PC 2IXBA 5C32A 3CPSA 3OPQA 5EIAA 2P9ZA 2QZPA 5D51S 3AUAA 3VOSA 3WNVA 1R50A 4GHWA 4BEJA 1VLLA 2AZTA 1VJRA 4GI7A 5A0TA 2V5VA 2VI5A 1RI5A 3BK2A 2D8AA 4W1PA 1M6WA 3E2IA 2C2WA 2VJMB 3QVLA 5H83A 5BW8A 2IPLA 3Q8MA 2ZYWX 4HLNA 4Z5XA 5I9LA 4ALMA 3RSOA 3V8PA 4B3TB 3W06A 2ZROA 3STYA 2VBGA 2PZEA 4MS1A 2CN1A 1CE8A 2OUIA 3H4VA 5KVSA 2YQ5A 3WRXC 3FVQA 4XGKA 521PA 2BM8A 4Q01A 5EY5B 5HKBA 3U56A 1LW6E 3WGVA 1DBSA 2JGKA 5TF4A 4BPRA 4TMVA 5CFOA 1P7CA 1TK3A 2EDCA 5LDDC 4C2AA 1TJNA 5FAXA 2VXOA 5F35A 3BOSA 1DB3A 1FS5A 1UADA 1VL0A 1KMIY 1YB1A 2KPOA 2ODBA 2PBFA 3IT2A 4HYEA 4V0ME 2CNKA 3UK6A 2A9OA 1JEQA 1KQNA 3SVLA 1KRWA 4AWXA 4AX8A 3PGLA 3ONWA 4QBIA 4GRAA 4O6VA 2F1HA 2P1DA 3TMKA 2CJXA 3BWMA 5JO9A 3B70A 3CUKA 4CKBB 4CIYA 1HL7A 1IL0A 2ORYA 1D8AA 2J0SA 3TTTA 1WEKA 1PK7A 4JB2A 1DT5A 3NUGA 4O4LA 2HWKA 1VGQA 2FEMA 3B78A 5C9ZA 3KETA 4EQ6A 3B2QA 4HDAA 2CK3D 3QVTA 4ZHSA 1XT6A 2PUFA 4B71A 3IMKA 4ASUD 2R8PA 2FMKA 4O4IA 3T3MB 2XOKA 4IQ4A 3T3PB 3TQQA 1ZIOA 2VJCA 2X3UA 2PGAA 3H11A 4UXIA 4EGQA 3K0BA 2IW3A 1FIUA 1R6DA 4L02A 3T34A 4OL0A 4XJXA 1D2RA 1EWRA 4OYLA 4TTPA 4MI9A 4AYTA 3NXKA 4K8RB 5EHGA 2B1JA 5EJ9A 5IABA 1JR3D 3W5VA 4TVKA 3ZJUA 3BSFA 4CV1A 1CNMA 3A14A 2NUAB 4Y2HA 4IIYA 4MPPA 1D1TA 1W5EA 2O8DB 2WTXA 4GKAA 4UCQA 4YRMA 3THYB 2C7GA 3Q2OA 3JQBA 4OKSA 4CXMA 2VZLA 5FRDA 4CKXA 4PINA 1L4GA 3EDQA 2Q3EA 3J81k 3VR5D 4AICA 3LE8A 4DNOA 3PUJA 3SNHA 4HSEA 2NO6A 5LP1A 1E2PA 3KQOA 1ZVVA 1NX6A 2BRUC 2ZRBA 5HGJA 4J94A 4JXKA 4YX9A 2QDKA 3PT9A 4JR1A 3J81A 2QX9A 4ZZ2A 3OE5A 3AKDA 1JQDA 1M33A 1KI1A 3PHBE 5L45A 2W6NA 4NQZA 3D6MA 5D3QA 1N2SA 3GLIE 1L5MA 1N2XA 2N46A 2QB5A 4RLQA 3V7FA 2FCAA 1RR6A 1L1QA 3FTCA 3LOUA 2XLBA 3EPLA 4E2YA 4DRYA 3TEFA 4MUYA 1VHJA 2FPMA 1KDVA 4HQFA 3FYUB 3U6KA 4L7VA 4OFZA 3T7SA 3O0DA 3WIDA 1XZHA 1U8XX 2G07A 1Y1KE 3CGGA 4RFVA 3IEKA 4CPDA 5JLJA 4FHFA 4P93A 1GCOA 4KDRA 2A6PA 1BMDA 1GU1A 2NV0A 3QKUA 2X9LA 1VP3A 3WQBA 4NAUA 1WETA 3QEMA 1PZHA 2CE2X 2P62A 1UJNA 4D4MA 1Z2NX 1NI4A 1JKXA 2HBQA 5KOIA 3PNBA 3K71B 2Z6AA 3ANLA 4FX5A 4XLLA 4YRKA 4BNZA 4NDNE 3A9CA 2PMDA 3LC7O 3UYLA 1V9CA 3GI1A 3CLUD 3UW1A 5LYJB 3WRYC 1STOA 1WB6A 3OKPA 4FILA 3THWA 5I3ZA 1TDJA 1U2RA 2WM2A 3AERA 1KBOA 2PVPA 1WCXA 3M8KA 4TVOA 1KY3A 1U90A 4HFNA 1DAGA 5BQFA 2OESA 5I7HA 1UXOA 3D7RA 4RJLA 2X42A 1N2OA 2X5NA 3I34X 4HLDA 4IXWA 2ODTX 3SBXA 4ADSG 1O6ZA 1ECBA 3KBBA 2VT2A 3CZQA 2F3RA 5F21A 3MJVA 3BICA 3GUVA 4BEVA 2C4WA 4IEIA 4GP6A 4E2WA 1QYVA 1RXCA 2J33A 3RVPA 1O03A 1NOJA 1BGWA 4ZZ3A 4WOPA 1V2HE 5G41A 1EZ1A 1OAOA 2B6HA 4S1OA 2O9JA 1G21E 3ESZA 4IF4A 1TU3A 5T57A 5JNSA 4KIUA 4ZV9A 4HTFB 5J4YA 3DKRA 3AEXA 3LW8A 5DTEA 2SCUB 3NYRA 2ZAMA 3A70A 1I0IA 2OCLA 5FWYB 2ZWMA 3TI7A 5EXPA 1NVAA 2IF0A 4JVNA 4QVIA 1X94A 2YFQA 4NMMA 1RXVA 1IHXA 4OBWA 2QRVA 3T7RA 2QUBA 3LHFA 3OUZA 4NBSA 4HN2A 1UL1X 4C6TB 2JGDA 3JRWA 3PIDA 3NHKA 4AZ3B 1KYIA 1GNTA 1IWBB 3DEIA 3OE7A 4CRWB 2G70A 1B2RA 4OBEA 4FWIB 2X8AA 2FFBA 2Q5IA 3DTVA 1V7ZA 3QKRA 2FY8A 1P60A 3PX7A 3PXEA 4B80A 4DCPA 5HKKA 3OD5A 1Z13A 3ESRA 3CZ5A 1NRIA 5FYDA 4TSFD 2IHKA 3NWBA 5ECWA 1SXJE 1A0OA 1RM5A 1RC8A 5F2EA 2DT8A 2J5RA 2C5HA 2GEBA 2OBYA 2DFPA 3G2JA 3HCPA 3NGMA 3P97A 4N0QA 4OJNA 4DDVA 3LC2O 3DAFA 3LDFA 2VWPA 3RWBA 3UAWA 2NU9A 3IVMA 4B44A 1M83A 3HJBA 4QTYA 2WKSA 3BWBA 4ZKDA 5CFZA 1MTZA 1JLHA 4J16A 3JVIA 3GQBA 3L49A 1NL3A 1XXHB 3GY0A 4PIMA 2QL6A 2EFGA 1X6VA 1U28C 3SKVA 3B1JA 5A71A 3TJMA 5G1OA 5BQXA 3HXPA 1ESCA 1P3Y1 2KYRA 2HF9A 1CS0B 3I30X 3SIWA 3UFXB 3U3JA 2QTBA 1KU6A 1DC6A 4L9SA 3B3QA 5ED0A 3TKAA 4IFEA 3AUTA 2DGDA 2W2LA 4L6IA 5HCUA 2G17A 2W6ID 5H81A 4AROA 2FEWB 1ZCFA 3R3VA 3K4QA 5JNUA 4HF7A 2A2ZA 2QDXA 4HC4A 4LOJA 1ZCJA 2HMYB 3CTMA 4DLYA 3H18A 2WA1A 4ZTUB 1XVVA 2QRJA 3L02A 1R10A 4D79A 3ZGZA 3EULA 1O57A 1SH7A 1XRLA 4OFBA 1U0LA 2Q7OE 5IAAA 2YTZA 1DDIA 3LVQE 2GZDA 4RJJA 2I3GA 2F4VB 2YJ3A 2D6FA 5EP3A 2IBMA 1DXHA 2C42A 5LQUA 4A6XA 1GTRA 1BVRA 3V2UA 1L8LA 2NU8B 3HK2A 3HKDA 2AI2A 2WG0A 3A0UA 3P9CA 4V0NA 4EJSB 3GD5A 4KPFC 3Q40A 3VR5H 3R44A 4HV4A 5BR4A 3SX0A 4MP6A 2UUCB 2HTEA 1V37A 2BEJA 1LTKA 1B8UA 3GFSA 1WXXA 3FLMA 3GP5A 1LEHA 5AXCA 5KWSA 3CSUA 4H7JA 5BRNA 2ZRLA 1KETA 2JVJA 1L7DA 1SCDA 3RK1A 4C3VA 1DUVG 1DKRA 4UFNA 1XZ8A 4A23A 3K16A 2I4LA 4OAQA 4U2FA 4WBXC 2WICA 4JVLA 1Z07A 4KOEC 1WSBA 3G82C 3LPAA 2FJ0A 1BDIA 3ZDCA 2F3UA 2R5FA 4G0VA 1YRLA 2GA9A 2PL5A 2NUPB 2VHQA 4FHGA 4WXHA 4CHGA 2I1QA 1DC8A 1ZQ1A 4HGRA 2HK8A 4OIFA 4YIKA 3ETNA 3DVSX 4MKHA 1L9XA 3MSCA 4HD8A 1MV8A 3GMIA 1SQSA 2EJBA 2HZBA 1P2FA 3KLOA 3NHWA 4HAOA 3FSRA 4LYGA 2Z6UA 4JGIA 4MVWA 1RVV1 2WYHA 4DLPA 4G2TA 5FLYA 1AKRA 3UO8B 3DT6A 2BMDA 2I2AA 3CLTD 5FORA 3DCYA 1A9XB 3PHJA 4KLCA 4CU2A 4E03A 1HSZA 1WS6A 3LBNA 4WEOA 3S29A 1NDHA 2JH9A 2TMKA 4BU0A 1I3KA 2QXYA 5DGCA 5JTTA 1QQBA 1ONOA 1UC5B 1WMEA 2QR3A 3OTWA 1C3OB 2MYTA 2R6R1 2DKOA 2Y1LA 4ODIA 1R9JA 1XLUA 2EFJA 4R5HA 1TK2A 4FYXA 3T15A 3TD6A 4JLOA 1J42A 1GV1A 2FW6A 3CUVA 3JWPA 3OMLA 3QG1A 4KKVA 3L0CA 4LW8A 4ZYXA 5K2OA 3D6FA 1Y37A 1DAIA 3QVKA 1GZ6A 3A1WA 1X0VA 3ZXYA 1SUFA 1QQAA 1CNEA 1SZDA 5J2TF 4WXYB 4OHCA 4A82A 2C3MA 4K05A 4QUKA 2C1XA 3C8HA 5DW3A 2FPPA 5DHAA 2VJDA 2CZGA 2HWUA 4QIHA 2VJLA 2H4FA 3MJRA 4J7AA 4DREA 2JFZA 1T6XA 2QRKA 1HKUA 2JLRA 3IDAA 3V1MA 5JTUA 3QE0A 1W4ZA 4GBJA 3KD3A 4RSHA 1JXMA 2ZK7A 5TR9A 4Q6BA 2V9ZA 3CRVA 3NBZC 1Y6QA 1W9MA 4PVDA 4DE5A 2H9IA 1F48A 2E4AA 3RLFA 3TZLA 2RGEA 4K9OA 2AWNA 1X7WB 1OYVA 2C92A 4G23A 4M0MA 3Q3JB 5LOVB 3TCKA 3AF4A 3OCUA 4EY5A 4JENA 3JQAB 2X22A 1KY4A 4FFWA 2PEYA 1JDBB 4UE6A 3ZDQA 2P9GA 1JFTA 3NT2A 3UWKA 3BS4A 2HBYA 2XI4A 1Q2XA 3FX2A 2LIVA 4L2IB 4BFLA 4BLPA 1HDGO 4LBVA 1ISJA 5DH9A 5KPJA 5DM0A 4CYMA 4QPCA 1X38A 3ONEA 1TUBA 2ICAA 3KJGA 3OX1A 3U44B 1D9ZA 4QDOA 4E5KA 2WMNB 3I73A 3MCZA 4ZVKA 3RI3A 3VR6D 1VL2A 1V5WA 1N6KA 3I2HA 1PV2A 2Q5FA 4MUIA 2WY2D 3TXYA 3KB2A 3SMQA 2HK7A 3OZIA 1V43A 4RE6A 5C1DA 4WLEA 2IYLD 1N6LA 3HCAA 1M8FA 1PNQA 2CXSA 4G0NA 1N25A 2ISCA 4KI0A 1UZMA 3D43A 3D9QX 3PDIB 2DWUA 3E5NA 3GCDA 3QEKA 4KYUA 2X0FA 3E7FA 3CJTA 3UWDA 1PRYA 2CF6A 4A5OA 1NASA 5JVDB 2HSEA 1QSGA 2JA2A 1UJBA 3U7EB 2QW8A 3OOJA 5DXJA 1JT2A 4JV5B 3C5CA 1OI4A 4D8VA 4BPBA 2REQB 4HAWA 1CUUA 4PAOA 2PZ8A 3CTPA 3BVPA 4RGYA 1HOTA 1FNDA 1CS4C 4G0ZA 4AIIA 4DLRA 3LL4A 1C4XA 2C00A 4DJTA 1M10A 1Z8DA 1KYVA 3K05A 2PXCA 3MG9A 4I1IA 5CYPA 4JJ6A 4HHEA 4IDPA 1QVRA 1SIBE 3H9UA 3PDUA 5FPYA 2VAMA 1OXTA 1QLWA 2HHAA 5LLTA 1Z28A 5F2NA 3PJFA 5FBWB 3Q88A 4U2KA 1LPBB 1E5VA 1FFGA 2W6MA 2V0CA 2XZPA 4ZOAA 2QQGA 4LG1A 4BB6A 4K2AA 2JFFA 2QYTA 1FX1A 2NUBA 5B64A 2X14A 3UGQA 2IL1A 5LQJA 4C2TA 3KXLA 3P2MA 3BRCA 3MWGA 3QELA 1R0LA 4OB8A 2C78A 4NONA 5FBZA 5HQTA 1LBQA 3QVWA 2VBFA 1RFLA 5FXMA 3NBQA 1GEEA 4JB8A 1WLSA 1N32B 2G83A 3I5XA 2F1KA 3UMMA 2DC1A 1I3CA 3NWOA 3WDKA 4AXXA 1C14A 1Z3IX 2B9EA 1GDHA 1F8YA 1Q0QA 4WQMA 3T3IA 5CB4B 3O84A 1INLA 1Y80A 1F51E 2QW0X 3PLNA 3P2IA 1GSIA 2I8CA 3TINA 3VH3A 5J43A 1KDTA 5FEUA 3GUHA 1XNHA 4MIYA 5F33A 2A0UA 5K0LA 3CEAA 2O7VA 5D3MB 5ALQA 5SICE 3MTAA 4J1TC 4MV1A 2G6TA 3WGHA 3LWDA 3RADC 5EWLB 4EJ6A 4JI6B 4RTJA 3GN1A 1I0ZA 3M1YA 2GA8A 4TTSA 1CEQA 3UK0A 2V5UA 4AJIA 4M83A 5JNVA 4W63A 4CKYA 5IFKA 3G5AA 4ZN6A 3EVTA 4B6OA 1XAIA 1Z06A 3IQGX 3SGLA 2PMFA 3DHVA 3GHYA 4QUJA 2FEAA 1EUQA 2QPTA 3Q2KA 3UJ8A 1DKPA 3D59A 4J0CA 4M9XA 4UNRA 2FDXA 2PGOA 1T1IA 2DOKA 4GL4A 4WHMA 1EFVA 1JSZA 2YX1A 3KKLA 4US1R 3RS2A 4E6EA 4G8DA 4Q9NA 1Q7TA 1JXOA 5FKJA 5KI6A 4IMPA 2XXBA 4MWSA 1H2BA 4ZAVA 1JWAB 4QYSA 3QPAA 1KAMA 4ZCSA 4B2YA 2O23A 4HBGA 4RGQA 4MRMB 2R3SA 2V98A 2ZLBA 4MINA 1EFRA 3OOYA 4ZYVA 1X39A 4GEGA 5KMGA 1HT3A 1PHRA 2J3KA 3Q12A 1Y3CE 2GN9A 3U4GA 5I51A 5JSZA 5KVCA 1KXJA 4J07A 4O59O 4Y1RB 5K01A 4HDRB 5CH5A 4Q4HA 3AI7A 3LRPA 5ENDA 5IAKA 2BYTA 3ITEA 3VSEA 3N0VA 3QW4B 3JAWA 4A8PA 2NUTA 1K7CA 2Z43A 3GFTA 4S1NA 3OZFA 4OQQA 2Q4TA 1Y1SA 1GTJ1 2H0RA 4DA9A 3UGKA 1UUFA 3ZNNA 4Y6SA 3RANA 5GY7A 3SEZA 1T5LA 3MUOA 4J1QA 3RYHA 3L6BA 1F6WA 1N4DA 3G2HA 1VLHA 5DLQC 7ABPA 3QTTA 4BXOA 2J7PA 4JP2A 2V1UA 2XHZA 3R2JA 2YOGA 2BM1A 3L8HA 3ZWWA 5L3QB 1KOJA 4HNVA 3SSNA 4ZOLF 4PPFA 1YNOA 2GJ9A 2Q3JA 3DULA 4PHTA 3E3LA 2LE0A 5KJFA 1PNOA 4FNMA 2ZPUA 3BHMA 4N40A 4Z8XA 1RRGA 3NH6A 4R1SA 4JLUA 1LLQA 1Y9ZA 2ZAIA 4DMCA 4FP9A 1R0YA 3L7BA 3O0TA 4I3FA 4RHYA 2VIIA 3DL0A 1US8B 3PJGA 1G64A 3IESA 1KEEB 3T7EA 3VR6H 3GJ3A 3M6AA 3S7TA 1BU5A 2QD3A 3K0FB 4WN9B 2ZUBA 1UMKA 5A4IS 5EIOA 5AW6A 4DY6A 2H1RA 4IJ6A 5CFQA 3AUXA 5LUBA 2WV9A 4G4IA 4LQ4A 3Q8KA 3E9ZA 1IOWA 2GI4A 3DT9A 4CV3A 1V3VA 4NBKA 4E5VA 5KWVA 1R0SA 1JT9A 2W6CX 4WZAA 4F4HA 2CW5A 1R18A 5HKAA 1OGJA 2H4WA 2AWOA 5LVAA 4NFLA 1AOXA 4P3NA 2OO3A 2R8XA 1Z62A 1FFHA 2ECKA 4J43A 5CHEA 1LZLA 3K8YA 3JQ9C 3D0QA 3ZR4B 1DO0A 1WXHA 3FN4A 2PT5A 4QYIA 3O1IC 1EDZA 5JFOA 2FHSA 1ETUA 2QAGB 2OXTA 2VHXA 1NIPA 2H2GA 4N8SA 3GLIB 5GZ3A 4EG3A 4BNJA 5I9MA 1QE0A 1QP8A 2YZKA 2JHPA 4RPCA 5ELLA 3T1QA 1JWLA 1Y34E 3KVYA 3TD9A 1AGNA 4B81A 1G7TA 4EAQA 2DBZA 3AOGA 2VYVD 3LAWA 2HPAA 3BA6A 5DULA 2GPTA 3LC1O 4B6JA 1QV7A 2VH5R 3O73A 4ZEVA 2I2BA 2W90A 1P33A 3H4TA 3MT9A 1PGPA 5AHRA 1WSWA 2A1TS 2DR3A 2JFVA 2VYQA 3QKSB 4KUGA 3EXHA 1KVTA 2NZ2A 4L16A 4MW6A 4NMLA 4R3UC 3UYKA 1UWKA 4FSXA 4R1PA 2B21A 4MUHA 3D3QA 3S5UA 1EM6A 1V39A 1K5DA 2R96A 3BKWA 3MZ0A 3WIBA 1W5BA 3HLTA 4HFJA 1IMOA 4CKEB 4W5RA 4B6GA 3L4KA 1H8HA 3MVEA 5IXSA 5HCIA 3E9CA 4NYIQ 4CQMD 2W70A 3EA5A 2OY0A 4LDPA 4Z99A 1P29A 1X80A 4G9BA 5CK4A 1H94A 1YONA 2IVZA 3AXSA 4EL5A 3DGFC 3PUIA 4C7KA 4BX0A 4OHFA 3CT6A 2C4KA 1P0CA 2J59A 1XRJA 2DWOA 3RTDA 3SFTA 2PZGA 3SP1A 3RJMA 1Z4JA 2ZIXA 1XTBA 4EVSA 4O29A 4XB1A 5AKJA 3ZLBA 1CJBA 3K8ZA 1JLRA 3F6SA 4YTEA 1JA0A 2DFTA 2C3OA 2JPDA 3OTQA 4HBZA 5ERYA 1XBTA 3AC0A 4L73A 5CVDA 2VT7A 2L19A 4DZZA 1UXHA 4X6XA 2I62A 1G21B 3PB3A 3MTBA 3UT0A 3ZS8A 2F8SA 2YJTD 3FYUC 3TL6A 3QKIA 3WB9A 1ZKMA 3AINA 4MWEA 3UXYA 2NO0A 1XRQA 2G5CA 4BU1A 3C5HA 3HKEA 4RSGA 5JS1A 2B8TA 4WBNA 4KLNA 1CUVA 1JX6A 1FX0A 4MTCA 1XZKA 2GHTA 2J30A 2CL7X 2PDAA 2JIPA 3E05A 2ZG6A 4TL8A 4XTRA 2O50A 4C7BA 2RKOA 2EP5A 4RFSB 3OLXA 3UMGA 4H1UA 4TZKA 5BNTA 3WO1A 5B2FA 1NMYA 2H1OA 4CEHA 4CLXA 4URHA 4D3FA 1B41A 4IIDA 5KOJB 2O4UX 2YCBA 1UCFA 4BFTA 1ECPA 3DS8A 3DEZA 4D8WA 4DABA 4HZUB 3WLEA 2Q5JA 1HURA 1LNSA 3TL3A 1PV4A 1CY2A 5BQ5A 3INGA 1FFWA 3KALA 2WR8A 3GGCA 1SXJB 1H4VB 2GYWA 2G9QA 4HAYA 1UQUA 3U81A 5A3JA 1KYYA 4M0LA 1JMVA 1BXGA 1K0UA 2OD7A 2UUPA 3NOQA 4FFLA 4MKRA 4PZUA 3L0OA 3LF1A 5B12A 2W37A 2ZUVA 4TMYA 2IYWA 1XQ9A 3I09A 4J9UE 4BKUA 3QWIA 3EZYA 3PC8C 1HF3A 3UK1A 5JCOC 4TKUA 4ZCTA 1MNAA 1N2IA 3BXZA 1QOZA 4NEQA 5CAEB 4D81A 5JMOA 4AG5A 2JJ2A 1VJGA 2VSFA 1PJTA 4FWBA 3W1WA 1M74A 1BDMA 1XNRB 1U8FO 1QIEA 4ISBA 1V16A 3HU1A 4P53A 2RC6A 4YCSA 3IRUA 4LNUB 4MV0A 1SK9A 3RRZA 4F5DA 1M2WA 1MEJA 3MM4A 4O2AF 1H2FA 3SBDA 4F3CA 2P4SA 1UBKS 4QWMA 4RPHA 3R9XA 3PNPA 2ZZKA 3D0OA 3SC2B 5GMOA 5A4AA 3MS2A 1ZM3A 1V3UA 5AVVA 1E1KA 4ZICA 4KX5A 1T6BY 2OXCA 5G1PA 4Q9AA 4S2UA 2ODPA 2R60A 4XFKA 3TVTA 1PAUA 4UU0A 4OA5A 5BVGB 4FZVA 1CVRA 3NBXX 4JU8A 4O5AA 1DFGA 5EN4A 5KQMA 1YS6A 2XOKD 3X0DA 5JXJA 4F4DA 3FCEA 3DLCA 4YV1A 2P68A 3OVMA 2BDTA 4X91A 3DO8A 1TQDA 1XLWA 4YJGB 1Z4PX 2IV7A 3CO0S 1LDYA 4TKZA 4K26A 4I8DA 3ZOKA 2PVSA 2JGEA 1DOHA 4YUWA 3G1WA 1IQRA 1PD1A 2V54A 4I0WB 3DEJA 1P39A 1M2KA 4X45A 1HQDA 2B8EA 1NLMA 1JUDA 2BKVA 4BMPB 4RVSA 1KBZA 3IAS6 4OHXA 2Z9CA 1OFUX 5DBFA 1EUZA 3O1JC 4LISA 5ERXA 1GUDA 3ENKA 1HYGA 4BQQA 3KXDA 3QXJA 3VKUA 4U7GA 2C54A 3ZDFA 3WHPA 2C8JA 3BB4A 3N0XA 5M04A 5JRJA 1E0AA 3UVEA 1UMBB 1DTEA 3UZUA 1SEPA 1F2TB 3HPRA 5KKNB 3KEQA 4JJGA 2ATIA 1T2CA 4FDMA 3B53X 1VHQA 3KJQA 2WWYA 1DOAA 1GG8A 3O4FA 2X9GA 4FKZA 4JX9A 2H2FA 3EDRA 3DC7A 5TY0A 4F71A 5HQ3B 3A9TA 3UMSA 1N7IA 3JZMA 2KBEA 1IBMB 1YH3A 4H7EA 1V4BA 4Y2RA 1NU6A 5KYUA 5HP4A 2FOXA 4Z4IA 2HA5A 2JIMA 4YT5A 1U2GC 4EX7A 3CU5A 2CZCA 4FDLA 1G8SA 3IAHA 1P2VA 1W1UA 1ZOSA 3BB3A 4KPUB 5F7JA 3PZRA 4MJ7A 1JSCA 5JRZA 4DV6B 1DUIA 1T2EA 2Q5CA 3P2JA 3BH6A 4QVKA 1FP4B 2Y1OA 5EG5A 3BJEA 5AXDA 1G0NA 3JSAA 4YO7A 3LZ6A 1X2EA 4YDHB 5FD8A 4D4GA 3I6ZA 3L7NA 1BHSA 2Q3HA 1E9RA 1DRUA 3I23A 4MQLA 4AC9A 4PHHA 3ZIDA 4AB1A 5B4VA 3IT3A 4ZHQB 2X15A 1CLEA 1G9SA 1K7FB 1JKIA 1YRWA 4GMKA 4LBYA 4D7AA 4ZVPA 3CVWA 3RRJA 2HFKA 3A4LA 3RS4A 1H2HA 1H5UA 4LV8B 4BHTA 1EQAA 2BTQB 2PMBA 1YMQA 4JHXA 2GUGA 1L5KA 2ERYA 3WL8A 4D3XA 3N74A 2QBYB 2XMZA 1DX4A 2VHCA 2YC4C 3SSOA 3FVWA 3HB9A 1KIMA 4NZ9A 3MMNA 4L8LA 3M1AA 1YC2A 4MA4A 3RTBA 3OT4A 1M2HA 4PLGA 1PNTA 2VJBA 3RUIA 2JASA 1WPXA 5HEKA 1E63A 4D4JA 1EESA 2CWWA 2ORWA 4FYMA 4DLAA 5FPSA 5JI2E 5E3IA 2HO4A 1ZOOA 3G49A 4RLHA 4JLWA 3TL2A 3GROA 1UBHS 1A9ZA 4L8YA 2O8BA 1QH1A 4NOMA 1N77A 4L3OA 1XDWA 1H05A 1BCRA 3IPLA 4FOPA 4GBED 4O4JA 2EGUA 2XBLA 3D3KA 3QA9A 3ZD6A 2EJCA 1WABA 3MWYW 3OE7D 4JLSA 4TRJA 5KS2A 1KJJA 5CA0B 3DTVD 3GJ4A 3QKWA 2AC2A 1MAVA 5B1HA 2AOWA 1E2QA 1OX5A 5D5QA 3TFWA 1PR3A 2PTHA 4A8JB 5AUNB 4ZC1A 3QFTA 1AQYA 2DKNA 2VDPB 3SOPA 1B74A 2C88A 3B85A 3FNGA 3ZZ0A 1R8JA 3QLUC 3PBKA 5DNAA 4ZT5A 3IIJA 2FN9A 4OF4A 4YIHA 1IHDA 2HA3A 1YZ3A 4GQBA 4H0CA 4D0GA 3W5JA 4KBYA 1W93A 3D2LA 4RHCA 3D5QA 3IDZA 3DA8A 1NBHA 4KKXB 2H00A 4JKYA 4MWOA 1U8EA 4X95A 1E61A 1H93A 4RAOA 1O6FA 4V0QA 5FUMA 4OO3A 3K20A 4TV8A 1M6HA 4GSLA 3ZZNA 1ICIA 2R6GA 2NM0A 4Q48A 1DBRA 4CHTA 1Z7EA 3PDHA 2H3HA 1W94A 1F6BA 2VNHA 3WQRA 4AUNA 4LFBB 2W2LD 3CH7A 4KRFA 2FP4A 3G0IA 2OQIA 2AUMA 3LX4A 4A4DA 1UFKA 5JEDA 2FV8A 5FHQA 3AVPA 1RXEA 1VHTA 4IIXA 4LJSA 1C9DB 3SDBA 3C8MA 2H1HA 1FXWF 1Z33A 2QTWB 1Z4QA 1F06A 2AR9A 1QG4A 2JS7A 1AVTA 3CYFA 3TKLA 3PIRA 3TXXA 4G37A 4F2WA 2WMDA 3GCZA 3LIPA 3OIVA 3W04A 2VHZA 2P7HA 4RIIA 5K0TA 1X7YA 2JFBA 3R6DA 4R1OA 1GIAA 4D98A 5K5EA 2Q28A 3CCBA 4E22A 4MWCA 2HX1A 5E6SB 3N2YA 4W5QA 2MMGA 1DX6A 4KXUA 4B2IA 3TVYA 5KQSA 4RABA 3HUTA 1P74A 1WDTA 1QH8B 3O2JA 4MVJA 5C8XA 1G5IA 4IV0A 4TXMA 1SGWA 4CF6A 1EFHA 4AP6A 3NB0A 1YDEA 4TMTA 2WYUA 3T9DA 4ZCRA 2DMRA 1EWQA 4EFNA 4NMWA 2J9FA 3DEHA 4E2FA 2QR5A 3FPCA 4DA8A 3ADKA 2KS6A 4PCAA 2ZBGA 1HBJA 3H1GA 1EVLA 1VDZA 3BA1A 2J31A 3IUNA 3VNBA 3ZE8A 4JHLA 5BN3B 5MHTA 2CDRA 5L4SA 4PXSA 2GYUA 5SZHB 4AJ1A 1GL3A 2GO1A 5IJ9B 4GW3A 3GRPA 3N7UA 3TSCA 3AJAA 4MJXA 3ZV5A 4B3JA 2ATVA 1OI7A 2QD4A 1S2NA 1G1MA 2IIBA 2NZYA 3HSYA 1SPXA 2YJZA 2EIXA 2H18A 4ETMA 4E5PA 1T1SA 2C0PA 3ME5A 1LRLA 3CRNA 3QUBA 4G3XA 5KYNA 1WJGA 4REQA 3F67A 2JFXA 3JWGA 3QBVA 3IV6A 3QVJA 1Z0SA 3JVUA 4N7BA 3UATA 1LSJA 2O3SA 1AF7A 2Z4SA 3URMA 2CV1A 2C2ZA 2CSXA 1G5QA 1Q7CA 3GJYA 4O4LF 2F2TA 3HDQA 3ZBQA 4RHUA 5CD1A 3K70C 2VP4A 1N9GB 3GCWA 4IDEA 2FSFA 2XADA 4UDOA 3KEGA 3ROQA 4EUFA 3HR8A 5K9ZA 2CNNA 2QLJA 1XQ1A 2QN8A 1GRQA 1TIPA 1JQEA 4QU9A 3SY8A 1G4UR 3HCCA 4EUKA 2C5BA 4J90A 5AICA 5EPEA 2V7QA 5JCPA 3LSYA 4IGEA 4OP1A 1DSSG 5F1KA 3H9JA 3DP9A 3ZHCA 1YL6A 3PD0A 3E5MA 1DWQA 1XD8A 2HWWA 2EBWA 2JK0A 2WYWA 5DNCA 5DYTA 4LSMA 3GGSA 1E92A 3KQSA 1ZISA 2ECOA 3VNVA 5YASA 4EB6A 1P1KA 2HU7A 4U7WA 3PSAA 3T94A 3ZI0A 1S8NA 2A0FA 5LA6B 1KI4A 4E13A 4BVHA 2QLLA 1SQ5A 3W5CA 2GN2A 4HB4A 3Q3IA 4RW0A 4MGHA 3IMGA 1HZZC 1PJAA 3PKZA 2M6LA 1J2UA 2IC5A 4JUIA 5GJVC 2PSEA 3QYPA 1U0FA 2QQFA 3RHTA 5I9BA 4DVGA 1PKXA 2AF4C 2D0PB 2XD4A 1R0WA 2Q4OA 3FRJA 1ZGAA 4KK3A 2IS6A 1W25A 4YPVA 2WP8J 5L6LB 3GJZA 4YAFA 1EBUA 4K9MA 3U0BA 2IDMA 4II7A 3UHOA 5AKLA 3NHRA 3E7XA 2YQ4A 3A7DA 3NASA 4K40A 1B6GA 1A4UA 1WZ2A 1SC3A 5IAOA 3G6WA 4Q3LA 4HQLA 2O19A 3IQWA 4P08A 4I4TA 3UNXA 2GWHA 2YFKA 1RQXA 4TGLA 3AVTA 2ZJ4A 1QQ5A 3AHDA 3KPVA 3WLQA 4RCYA 2H2HA 1KI2A 1N2CA 4N3GA 1ZQ9A 4L5CA 1ZJZA 1EJ6A 5IBQA 2ID4A 2IPXA 1NPDA 4LHZA 4OOEA 4UJ5A 4TVSA 4BO2A 2V4MA 4CL0A 4JA2A 1ML3A 3HFGA 4Q0MA 4Z7QB 4NQRA 3VU8A 1DARA 1GO2A 1SVSA 2I76A 4NPHA 2C7VA 4DSTA 4EENA 2JLQA 1SHZA 1TZBA 1EX6A 3K0AA 5CB8A 1GAQA 3LHKA 2XF8A 3UBTA 1XTUA 1X8JA 3PC4A 3GLFE 4GI2A 2P2DA 4ZK2A 1EX9A 2RI1A 4JN6B 3T95A 2B2NA 5DN6A 2HF2A 5A9TA 3I58A 3R0IA 4DSNA 4KIGA 1PQ4A 1JSRA 4QHTA 4WFIA 1WR8A 4YJFB 2F1OA 3D8BA 4FHDA 1AM4D 3JQQA 1Y82A 4KFSA 4NNOA 3E5RA 2HPHA 3C1TA 4IDHA 4FLMA 3QFFA 4RYDA 2FSPA 1BS2A 2EOAA 2ISSD 3VX3A 3GH3A 3MHPA 4IF6A 4PYMA 2WAOA 3V32A 1Q95A 5EC8A 3GLUA 2IZ6A 4MLCA 4FWTA 1KEUA 2NYRA 3FZGA 3NG1A 4BMCA 5G3YA 2H2WA 1K9VF 1A1VA 2O8VA 4WNYA 4DA0A 1EXDA 1MD9A 2FZVA 1KI6B 1OAKA 5T4FA 1NY5A 5DT9A 1T3HA 2E4UA 2WILA 3GJ7A 1K86A 2X5JO 4LWPA 3AL2A 3MK31 3NBAA 2FG7C 2G36A 3A2MA 3EVAA 3HEMA 3MUEA 4FEGA 4ESVA 1JEYA 2M1ZA 3BMQA 5IDXA 3DE5X 4E2XA 3Q9UA 4R0NA 3KR9A 1JLMA 1XFDA 3TPZA 1JIQA 1QMPA 2HMAA 3WLPA 3T7IA 4OXRA 1S8FA 1V6SA 3E15A 4WBSA 4D8XA 4WK0B 1GPBA 2BKXA 2ZTSA 2Q9BA 4XFJA 4XJSA 1KK0A 2B1QA 1ADCA 4I4LA 1UPXA 1CDZA 4JJIA 1N2HA 3JD1A 4QOHA 4F6RA 2H7VA 1WUHS 3BSYA 5A5VA 2ZP1A 1B0PA 3IUYA 3S8EA 1AURA 2JRLA 2QI9F 2GPSA 1LDBA 4EA8A 1M0WA 2UZ4A 2YVAA 3G5LA 3FRHA 3RRFA 1BD3A 1MT0A 2QV0A 2OORC 4HDKB 3IUJA 3NXSA 3DTTA 4LVOA 4TTVA 3WGMA 3G8CA 4BMVA 2R7MA 4YPOA 4K7JA 3NC4A 1WV1A 1C80A 4D0SA 1WDLA 5L53A 3LDGA 3V42A 4MV3A 2EYQA 1GFIA 5EIEA 1TU0A 4INOA 3O8QA 1NNI1 3IHWA 3MXOA 4LHXA 5D84A 1S8AA 5I8ZA 4AO6A 1JMKC 2FZGA 2G9RA 3E61A 1CD5A 4EGCB 1C29B 4OAPA 1V1JA 2H54A 1A82A 4OXNA 4MQFA 3O9MA 4EPWA 5DP1A 4EFDA 2VHJA 3AP2A 5KINB 1AT1A 5T7BA 3AESB 1E4EA 1KMHA 2VSOA 3JYPA 1PX2A 4NBLA 5EESA 1VFNA 1ONBA 3H9BA 2ZI3A 4LI3X 2QTCA 3H16A 2AKEA 1T35A 4TQUS 5HA5A 3PXBA 1G8YA 3T7CA 4K6OA 4D5EA 5HOEA 1N34B 1VI5A 4MKFA 3HUDA 4E4RA 5AJYA 4Q1DA 1L8OA 4FZJA 5LQAA 2NTYC 3R23A 3B5JA 4HRXA 4D0RA 4AO7A 4QGGA 2XKBA 4IUCS 2CXXA 5JJ5A 1L7QA 1A3CA 1HQKA 1EFRD 5AD1A 2Y66A 1I80A 3WAJA 3TB6A 2D2XA 4RTKA 1RAHA 3ZWOA 5JHGB 3B38A 4D43A 2XT6A 4DLUA 5L7YA 5A2GA 1D09A 1Q17A 4EHLA 3Q9SA 4ZQEA 3RC9A 4A27A 4E08A 1E8DA 1ISRA 4YWHA 2VDQB 5ENVA 1S2LA 4FHZA 3IB6A 1COWA 5JAOA 5ALWA 1OLXA 1Y0BA 5D2CA 2BLLA 4CVNA 4IH4A 4YFVA 2J7PD 2ZR7A 4EYQA 3V8RA 4EJ2A 3KKKA 2RGDA 2Z1NA 1RADA 4FIZA 1FEZA 3EIFA 3P32A 4N47A 2W6PA 3MPOA 5LLDA 3B1VA 1OGYA 1ZJWA 4QJIA 1IY1A 2O48X 4RK6A 3S55A 4AQ7A 4HKTA 1QIDA 3AU9A 4MUAA 1UMDB 1HNNA 5HTKA 1P0IA 2Q2NA 4PG6A 5TJ9A 1QBKC 4LX8A 2W2XA 3C98A 1U2DA 2XJ9A 1IK6A 1XCMA 5B7PA 1N1GA 1GKYA 1JR3E 4O4HB 1PS8A 1NUTA 4OYHA 1CEYA 1T8WA 1QIIA 3SR0A 3HC7A 3WMGA 4JMLA 1OH7A 2J6HA 5AI8A 1KA9H 1L5OA 1SXJC 3L77A 1J8FA 3JQ8A 3ZNQA 1Z2PX 2VBIA 5DHQA 9GPBA 5ADVA 4WEQA 4DLTA 4L4ZA 3SJCA 2P2CA 3ASYA 3FYTA 3L8MA 3OIUA 4RY9A 5AOBA 4EO4A 2FQQA 1RWWA 3PLAE 2ZVJA 3V4OA 4HRYA 3AKCA 5LQKA 3IJ5A 1HTWA 4IXDA 2GCGA 4F2DA 3OEYA 1VJTA 2XCQA 4R9NA 3HDYA 4D9HA 1FRQA 2QM7A 1JPUA 4R51A 1P6XA 4KYTA 3ND6A 4E14A 2WFMA 1OZFA 2YNMA 5ED4A 1E5LA 1TZJA 4HH0A 1TE2A 1AY0A 3T0GA 1CPYA 3GIWA 1UC4B 5HRCA 3QSGA 3GUZA 3ZDBA 4MA0A 4MDEA 2I1LA 3PWZA 2FLKA 5ESRA 1M8JA 2BMVA 3NTQA 4BATA 3IQEA 4LYYA 3MBOA 4C78A 3N8GA 3L7LA 4J7UA 3DHYA 1I3MA 2K7ZA 2CL0X 1NX9A 5CXSA 1SJ9A 2I3DA 2P9TA 2Y1GA 2BSAA 4JI1B 6REQA 1D7OA 1ZONA 3BMNB 3THXB 3CW2A 3M4NA 3G9UA 4H7DA 3CBGA 3MWJA 1G16A 1A7UA 3OPVA 2W2KB 1Y4UA 5AVWA 1T5BA 3THYA 1UZUA 1AIPA 3HJAA 1J0AA 1T2FA 1YR9A 3QZUA 3FHLA 4HX2A 1GTG1 5G02A 3DKKA 1ZVMA 4JYCA 4F5WA 1ZINA 3H0KA 4GT1A 5DLEA 1OT5A 4RY0A 2VAWA 5EXTA 3Q2IA 3TS1A 2WF7A 5DCUA 3BXOA 1BMQA 1B6RA 3UV3A 1E6UA 4LE1A 2EQ5A 2X8WA 1G5PA 2ZB3A 3QY0A 4IDAA 1I33A 2NTEA 3LG2A 3REOA 3TF5A 1MO2A 3TMAA 3ICEA 4IEEA 3ZBTA 1H5QA 2C3PA 1Q57A 3FH0A 2QOEA 4J76A 4KH1A 3RQSA 5BORA 2I29A 2YXEA 3JYLA 3I1YA 2OKGA 2JI8A 1IY8A 2GTIA 3DTNA 4PLYA 4CJXA 2CFSA 1JDSA 4DR4B 3KC2A 3K35A 4MGYR 2NQ2C 5CX1A 1U0JA 4L3VA 2YN2A 3ZY5A 4L4YA 1CF2O 4ER3A 1CQIB 1C30A 1W36C 1U0NA 1O96B 2DQKA 3ZZ1A 3ENZA 3GFPA 3E2PA 4R8VA 4NS1A 3RK0A 3O8BA 3U9SA 4CN9A 4YT4A 3IEUA 3P5BA 3GFBA 4PICA 1M1XB 3WJ7A 5LZ5A 4QYXA 1T9CA 1YGPA 4JDUA 4LDQA 1RPJA 2A0YA 1BWPA 2KLHA 4P82A 4IIGA 2AXEA 4BEBA 3FGPA 3R7LA 2XB9A 4HNRA 3ULKA 3IVGA 3OAAA 3ZLUA 3HB1A 4QEKA 5IZCC 3BREA 1JVNA 4EJ0A 1CCWA 5ALTA 4CT4B 3E03A 2B37A 3GAMA 3NTUA 1FC0A 4MJLA 4MS4A 5CA1F 3FI9A 3LQQA 4KQ2A 1A5TA 1XPUA 4ZV7A 3B1WA 3KL4A 5CDFA 1NXWA 5L3ZA 1MNQA 2AYYA 5JS2A 3NHJA 1SUAA 2H4JA 3QH4A 4TZTA 4W7SA 3WMFA 2WIAA 1WF6A 5EKTA 2RGGA 3VGPA 1Q0SA 2XTMA 4MV7A 4RKEA 4TV9B 4YJ2F 4QJ4A 3Q0TA 1R8SA 2IOHA 3DBLB 4TVBA 3SI7A 3ZUPA 5EJ8A 4Z3OA 3QBJA 5SYNA 1D1PA 3SN6A 4C20A 2JJ2D 3TSOA 2XWJI 1RLIA 1V95A 3EXEB 3IHLA 5CVUA 4HVTA 5LZ7A 1N33B 3FNBA 4Z0NA 5IJXA 5FWYA 4FONA 3BXGA 3AVQA 4LDNA 3T1YB 1KS9A 2OBMA 4KXVA 1U7PA 4C88A 2IU6A 2ZW9A 5KJEA 3ABRB 1NVBA 2MIIA 4DIBA 1J8VA 2HA7A 4HB3A 2E55A 3OOSA 3QE9Y 3HBAA 2A0KA 2YOFA 1LXCA 3PFIA 3NV9A 4C05A 3ESXA 1H2WA 4IVRA 3BSWA 4PQGA 5DDIP 3QXCA 5G0UA 3TB4A 4COKA 5JZSA 3GLTA 3R7FA 4QE3A 2G28A 3HY3A 3N8IA 1G7RA 3GR6A 4PNZA 1FNCA 5D7NA 5FUVA 5GV7A 3O92A 2VF8A 2ZI5A 4UEKA 3JWJA 3TEMA 2IYVA 2NSLA 4NH0A 1DBQA 5FTKA 1QGOA 2XRMA 4CV0A 4QUHA 3JYOA 3AJ8A 1PNRA 2W2PA 3IUSA 5HKOA 3ZCSA 3K96A 1VDMA 2TMYA 4A8JC 1RXIA 2A59A 3I1JA 3LTEA 3H7IA 1Z6QA 3B8EA 2IUSA 2W7TA 1TIBA 1X19A 1UAYA 4A36A 1X2BA 1C1DB 1G42A 3H5OA 3WLNA 2I7XA 3P9ZA 4IUDS 2GTPA 5U1PA 1AF4A 4DHEA 3BFXA 4YAUA 2H63A 1E77A 1JLLA 2HDNB 3DXYA 3QV2A 2H5LA 1T4CB 4DNQA 2BI7A 4X41A 4JEHA 3ZVRA 4Z86A 5BW4A 1FRVA 4YMLA 1T4GA 1JMYA 1M6EX 4FINA 3VYSB 3WLTA 4LI0A 3EAGA 1QB8A 5J2UA 3GDOA 5G0WA 3COPA 3OJLA 5JZOA 3DMRA 4UFOA 2CGEA 4LEIA 3FMOB 3WZ2A 3RTCA 1KPGA 4WE3A 1SK8A 2RARA 4L6CA 3NEJA 3OZRA 1H4QA 2BHNA 3C74A 2OL4A 1Z4IA 2C9DA 1U7TA 4ZODA 5DX1A 3AP1A 3HFSA 2Q8QA 2Y3IA 1XX6A 5JNWA 1I4LD 2XQKA 2PL9A 2IHTA 2ZTLA 5JSYA 3UM9A 1JNYA 4Z1MA 4KX3A 4WFKA 3DVLA 3LPDA 1O4VA 2QYOA 4RY2A 3IOMA 3Q7IA 2QLTA 1Y8QA 5TGZA 2IHUA 1DPFA 2JI4A 3T1HB 5B53A 4ZT6A 2JJ1A 2PK3A 4EJSA 1SOWA 3TTWA 3NJRA 3VPGA 2GF9A 3VZQA 1SIOA 4I55A 2MMCA 4WNAA 3G0CA 5DGIA 3U39A 1KJWA 2FCRA 2HL6A 1OASA 5CB0A 1NIJA 5REQB 2XYQA 1XMSA 3R7BA 1L4FA 2IITA 1FNSA 4ANFA 4TM7A 4QXMA 1ESZA 2ZJ3A 2JVIA 4JBIA 3RG2A 1EB9A 2HC9A 2PUTA 4KK4A 1OLSA 1P62B 1PG0A 1I6LA 5TX7A 5IAEA 5I45A 4OLBA 3OC6A 1LQUA 3HUFA 3EGCA 2NADA 4TTIA 3C3CA 4JNCA 1NXTA 1L0BA 3R5HA 4FJ0A 4NBWA 3GCGA 3RVOA 1X92A 3RNLA 1SVNA 5L40A 2NUPA 1A2BA 2YN4A 3OT1B 2NV6A 2CJWB 2GARA 2VNIA 3DZ8A 1MVLA 1YTLA 2ATXA 3I8SA 4LZPA 3P9IA 3ELWA 5AK6A 4QL3A 1UDXA 1RZUA 1IM2A 2B1RA 2EBUA 4ISCA 4UPDA 2H4XA 4A6PA 1PEDA 2UZ1A 4YRRA 5E0OA 5DYWA 2WFLA 5AH0A 3DNMA 4UUMA 2G9VA 3LDUA 1TIKA 4A91A 1C7QA 1ZHFA 3STUA 3NT5A 3SXUB 4IWNA 4UMEA 2XUPA 2YW2A 2G8NA 3UG6A 1REQA 4YJKA 2SICE 4BKQA 2QN6A 3UB2A 3W3AD 4B85A 5HJ5A 4KTVE 3W5DA 3A6FA 4QEZA 2AOUB 2XGJA 4N76A 1E8MA 1GZ5A