4OA8A

X-ray crystal structure of o-methyltransferase from anaplasma phagocytophilum in apo form
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
214
structure length
214
Chain Sequence
b'SLSKQDEYLNKLFAVDTEGALKAHKTAPSELRMAQLGTVEGQMLQLLIRMAGIHSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTANQNIVNCKLEDKITVLHGEALAQLNTLKEMAPFDMIFIDANKSSYLAYLNWAKMYIRKGGLIVADNTFLFGSVFDEHPTEKVSSNAHASMRAFNDELANKEKYLSTIIPTSEGMMVSIKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase family protein
molecule tags Transferase
source organism Anaplasma phagocytophilum
publication title An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.
pubmed doi rcsb
total genus 76
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4oa8A00
3NJRA 1JQDA 3BZBA 1UWVA 3I5UA 3KU1A 3T7TA 5K0EA 3BT7A 3AY0A 4PCLA 4AZVA 3M6VA 2P40A 3FUUA 1M6YA 1NT2A 3GDHA 2VP3A 3A7DA 2Z6UA 3QV2A 2IH2A 3OFJA 3SSNA 2P35A 2PGXA 3LCCA 1L1EA 2NXNA 3FTCA 2PXXA 3BGDA 3S68A 4BLVA 3VC1A 1XTPA 2PY6A 3EVGA 3AJDA 2NYUA 3GXOA 2CWWA 3HVHA 5CD1A 3LDUA 5DRTA 2P3QA 3IYLW 4HG2A 5E2BA 1RJGA 1YFJA 2Z6AA 4QPPA 2V74B 3UJ6A 3X0DA 1RI3A 3LL7A 5CUQA 3BUSA 3GGDA 1SG9A 5U4XA 1WS6A 5EIFA 3KQMA 2PX4A 2PX8A 5E2AA 3VC2A 5FWAA 1EQAA 4E2XA 1O9HA 2PXCA 4E2YA 3C6MA 5EMMA 5K09A 4RTSA 1KXZA 1SQGA 1NW5A 2DULA 1ORIA 2FCAA 3A26A 2ZIEA 3DMHA 3I64A 4K6MA 5K8VA 3B89A 3MTEA 5EPEA 5CM2Z 4A6EA 3HCFA 2BZGA 3EVEA 3RW9A 2EJTA 3EVDA 3IV6A 3O31A 5CCBA 2IBTA 4GBED 4P7GA 2YXDA 4IV8A 5FUBA 3G2QA 3FRIA 1BOOA 4KWCA 5CVEA 3CC8A 5K0NA 2JG3A 3K6RA 1R8YA 2P8JA 5LQJA 2OKCA 5DX1A 3DH0A 5KQSA 3FTFA 5BXYA 2QRVB 5EC8A 4F86A 3GRVA 4MHTA 4GC9A 5ICFA 3REOA 3PFGA 2VS1A 3UA3A 3M6XA 3TM4A 4DMGA 3TR6A 5G02A 1JQEA 3SM3A 1DL5A 3FYDA 5K03A 5FWDA 3GO4A 1P91A 3HCAA 5HFJA 5LQRA 4LG1A 5K0JA 3LKDA 5EHGA 5K0FA 3UJDA 2G72A 2O07A 2P7IA 3UJAA 4AZTA 2H00A 3BXOA 5C1IA 3TQSA 3HVIA 3DMFA 3DXZA 4GOLD 4P7JA 4F84A 1VE3A 1ORHA 1QANA 1XCJA 3P71T 5D1NA 4LWOA 2OYRA 4POOA 4C07A 1L3IA 3CKKA 1JTFA 2JJQA 2AZTA 2NXCA 3FTEA 1JQ3A 2G70A 2QRVA 3ELUA 3GCZA 3Q87B 4OA8A 3R24A 4HSGA 1VBFA 3MCZA 2NXEA 5BW5A 5ICCA 3RODA 3HCEA 4FR0A 1VL5A 2ZLBA 4FP9A 4GUAA 2AVNA 3M33A 3EMBA 3CJRA 3HP7A 4GOMD 4PYQA 2VDUE 3LPMA 2GB4A 1QYRA 5MHTA 4P7FA 3T0IA 1NKVA 2XVAA 1F3LA 4RWZA 4C4AA 3BKWA 2PWPA 1NBIA 3DUWA 4HTFB 4MQ4A 1G55A 1HMYA 5B1SA 4YV1A 5GM2A 4MTLA 3PB3A 1UFKA 4R8RA 3V8VA 3VYWA 3O7WA 5DTMA 2ZTHA 1T43A 4EMSA 4QDJA 4E31A 1NW3A 4EKGA 4RTNA 4R6XA 3UBTA 5DXAA 2XYQA 4KDRA 4OBXA 3TLJA 3LGAA 3TKAA 1O54A 3P2EA 4E2WA 1HNNA 1Y8CA 2WK1A 2IDJA 1G8AA 4YV2A 5K01A 5DX8A 7MHTA 4RVGA 2H11A 3OPNA 10MHA 4KVZA 3T7SA 4KW7A 1IM8A 4QDKA 3GWZA 3VSEA 4HC4A 3PT9A 1P39A 4X41A 1L3BA 2CMGA 5C0OE 3U81A 2IH5A 1X19A 3FUTA 2AN4A 2OPBA 4NECA 3V97A 4EK9A 2HR1A 4X60A 2ZWVA 3TFWA 1KR5A 1AQJA 3LBYA 3E23A 3UJ7A 3F4KA 3LSTA 2B25A 3UJCA 3NWEA 2QE6A 4ZTBA 4PCAA 1U2ZA 1X1CA 4FS8A 5EKXA 1NV9A 4P7KA 3I9FA 3OZSA 4GQBA 4OBWA 2VDWA 2YTZA 5DWQA 3PVCA 3KQWA 3TMAA 1FP1D 4KRGA 2C7PA 3LHDA 3C6KA 3FPEA 2OO3A 1P1CA 4GOND 5LQCA 3AXTA 3UZUA 2P7HA 3HEMA 4C05A 1N2XA 1NV8A 3KKZA 3G89A 2C7QA 4RTRA 1I1NA 2BM8A 4FT4A 1JG2A 2ADMA 4IKPA 5EEGA 3UA4A 3UWPA 4RVFA 3DR5A 2EG5A 3BKXA 3ELYA 3OU6A 1MJFA 1ZGJA 2AR0A 3PS9A 4KIFA 4O29A 4U7TB 3UFBA 2ZW9A 4PYKA 2HWKA 5BW4A 1KYWA 4C03A 2I62A 3LKZA 1JTEA 1O9GA 2ZWAA 2PT6A 2ZSUA 3HNRA 4QVKA 4WVLA 2EFJA 1P1BA 4HGZA 4B17A 2ZFUA 3ELWA 3R3HA 4PYNA 4YUXA 1JG4A 1NW7A 3KQPA 1PJZA 2BH2A 2Q41A 3KQTA 3JWGA 2JHCA 2QY6A 4FSDA 3I53A 2CMHA 5DXJA 3SX0A 3B3FA 3M6WA 3OCJA 3CGGA 4HRAA 4LECA 3H2BA 2FK8A 2FPOA 3I58A 2PXAA 3G8AA 1INLA 1RJEA 1X1DA 3G2OA 4X63A 4WXHA 1XJ5A 5DM4A 1L9KA 5FHQA 2YX1A 1YUBA 2P1DA 2XBMA 5EZSA 2XYRA 2PWYA 3KPVA 3OE4A 5CVVA 3LDGA 3DXYA 1FJXA 1VPTA 2PVCA 5KVAA 3KR0A 5KYGA 3EEOA 3CCFA 5HIIA 1D2HA 3E05A 4GOOD 5DTRA 1BKYA 3JWIA 1KPIA 4RVHA 4CTJA 4EKIA 1NW6A 4FZVA 4M7RA 4ER6A 3M70A 4DCGA 3HTXA 3TRKA 2UZ4A 2C7OA 5F2OA 5LQAA 2IH4A 5BP7A 3B5IA 2ORED 1JR4A 3DXXA 5DLYA 5GIPE 1EJ0A 2YXLA 4YMHA 2GAFA 3A25A 5T67A 1RI4A 2IGTA 4OQEA 4RTOA 4YUWA 3SSMA 1FPQA 3NTVA 4R6WA 2CKDA 2XVMA 2GA9A 3KQQA 5HEKA 4YMGA 2N47A 4QQKA 1SVUA 3HCDA 1KPGA 2WA1A 4GF5A 3UJ9A 1WZNA 5EGSA 5K0BA 5E1BA 2PBFA 2FK7A 3OU7A 3GRYA 4BLWA 3HM2A 2JHAA 1I9GA 2VDVE 3BGIA 5HIMA 4KDCA 1JSXA 1R6AA 3FUWA 3KPJA 3KPWA 2OXTA 3HA5A 5K0GA 2OB1A 3P2KA 3HVJA 1KHHA 1NBHA 1EG2A 3DMGA 3KR9A 4E30A 5LQNA 1ZGAA 4AZWA 1KP9A 5GP1A 2Z6QA 3G7UA 4MWZA 1G60A 4L7VA 2AN5A 3ERCA 4QTUB 3SR4A 2YR0A 1AV6A 4RTJA 3MTIA 2B3TA 2IPXA 4PYOA 4PINA 1FBNA 1YZ3A 4PGGA 2R6ZA 2AOWA 4E70A 5CVJA 4QPNA 4QTTB 1BHJA 4PYJA 2PLWA 1VQ1A 3DP7A 2PV0A 1IXKA 4IWNA 2BR5A 3GRZA 5CVDA 1WG8A 1KPHA 2JH9A 4RTQA 1IY9A 3IHTA 3LX6A 3P2IA 3FYCA 1XCLA 2O0LA 4IV0A 4V0RA 4ER3A 1VP3A 1KIAA 3FRHA 8MHTA 3B3GA 1XXLA 3THRA 4V0QA 3TOSA 4HH4A 4YV0A 3ER9A 5JUWA 3DLCA 5DPMA 1OR8A 2AOTB 3G2PA 1FP2A 3A4TA 1R8XA 5GIOE 2ZZMA 4XUCA 4BP1A 1WY7A 3C3YA 4RV9A 5E9WA 3MAGA 2ZBPA 2ZVJA 1B42A 2IBSA 3AWIA 3KQOA 1R00A 4CTKA 2VZ9A 4EVIA 3P9IA 3ANXA 3FPHA 2OB2A 5CIYA 3P9KA 1MHTA 3ID6C 5EQJB 3EGIA 1SKMA 4UOEA 4Y2HA 3TM5A 5CVUA 3G5LA 3LCVB 3EVCA 5DSXA 4BLUA 3BWCA 3EEYA 2XYVA 2LD4A 1Q0TA 3LDFA 3OZRA 3KQVA 3CVOA 3SGLA 5EKUA 1D2CA 2B78A 3G88A 1QAMA 9MHTA 4PONA 2AOUA 3EVZA 3HVKA 3O4FA 5DX0A 5EHIA 4CKEA 4DZRA 4FT2A 1JG1A 3M4XA 3L8DA 2JH8A 2GLUA 4RYLA 2F8LA 5JR3A 5LR6A 3WSTA 4ISCA 1WXXA 3NVMB 4X61A 1QAOA 2KW5A 3ORHA 3OU2A 4RTMA 2HNKA 4ER0A 5GINE 4C04A 3DLIA 3DULA 2I6GA 4LWPA 3LBFA 3KQYA 4OX9Y 4RSRA 4ATNA 3LCUA 1ZQ9A 3QOWA 1VIDA 5HOQA 5EG5A 3GIWA 4AUKA 4C08A 3MB5A 1XVAA 1RI5A 1ZHFA 3D2LA 1F38A 1M0EA 5GM1A 4M38A 3CJTA 2ESRA 5FA8A 4DKJA 1JSZA 4G56A 2O57A 5FHRA 5FQNA 2G71A 5K05A 2PX2A 5DRYA 4AZSA 1R18A 5H02A 4XUDA 3A7EA 3NDIA 4RTLA 4XCXA 2QM3A 3CJQA 5DM0A 1X1BA 5ERGB 4H0NA 4U7PB 3C0KA 2V7EA 1EAMA 3E8SA 4EQZA 5HIKA 5FA5A 3NDJA 3FUXA 1SUSA 5EIWA 3IEIA 3HCBA 2QYOA 2FYTA 3K0BA 2YVLA 2AVDA 2UYCA 4PYIA 5FTWA 5DT2A 5IH3A 2A14A 4GC5A 2P3OA 5GWXA 3EGEA 4CWAA 3EPPA 4RTPA 4Y30A 4Z2YA 3OZTA 3P8ZA 4KIGA 3TPZA 5EZQA 2NP7A 3DOUA 3KQSA 3G8BA 1RI1A 2ZULA 3OE5A 4R8SA 5M5BA 5DM2A 3THSA 1XDUA 3EVBA 3UJBA 2OY0A 2H1RA 5E1MA 3P9NA 3EVAA 2NNWB 3QOXA 5E9QA 5D1HA 5E8JA 1VLMA 3EGVA 4JXJA 2HMYB 3B7PA 5IKMA 3CBGA 2GS9A 3E7PA 4CXMA 2NP6A 2AS0A 4C06A 3FPFA 2I9KA 2YQZA 2PSSA 4HTFA 3BWYA 5KQRA 3MERA 5P8WA 4M36A 3ME5A 2B2CA 2YXEA 3PLAE 4DF3A 4PYLA 4ER7A 1TW2A 3G5TA 1I4WA 5KS2A 3LECA 2C7RA 4RVDA 1YF3A 4E32A 1QAQA 1XDSA 5E8RA 4DCMA 3OFKA 5E9JA 5K0LA 2ZBQA 1D2GA 4PYMA 4DA4A 2PKWA 2PX5A 3FTDA 1DUSA 4P58A 5CCXA 2ZCJA 3P9CA 3R9XB 1RJDA 1G8SA 3PX2A 4FGZA 3EMDA 3BGVA 3KR1A 4DQ0A 2ZIGA 2P3LA 3R0QA 3FPGA 3PTAA 2DPMA 2EJUA 4QVGA 5FULA 4XUEA 2AOVA 4RX1A 1VP9A 1WXWA 4HGYA 4CKCA 4ER5A 1RJFA 1ZKDA 3KPUA 3HA3A 5K0CA 1N7JA 2ZIFA 3M6UA 2Y1XA 3TKYA 1M6EX 2BM9A 2OBFA 5HILA 3EVFA 5EMLA 3SXJA 4CKBA 4RTKA 3GU3A 2G8NA 1ZG3A 3NWBA 3PX3A 3Q7EA 3R6TA 4OA5A 5F2NA 2BR4A 3GNLA 1KYZA 2FRXA 1X1AA 3SVZA 2WA2A 2BR3A 3JWJA 4A6DA 2I7CA 2HTEA 5EVJA 2GPYA 2IFTA 4PWYA 2UYHA 4BP3A 3GRUA 4YUZA 2CL5A 2UYOA 5DM1A 3FUVA 3PFHA 4AX8A 4E33A 4PNEA 1TW3A 5ICEA 3B3JA 2FHPA 4M37A 1NW8A 5E1OA 2IIPA 1AF7A 2EX4A 2NXJA 5EOVA 1SQFA 2R3SA 3GJYA 1Z3CA 2HV9A 3BWBA 3FPJA 3HCCA 4PIPA 5E1DA 1UIRA 3GRRA 5DTQA 5LQKA 3NVKI 2ZBRA 1PRYA 2UYQA 3HA7A 1YB2A 2AN3A 3UJ8A 3FZGA 5HZMA 3NMUF 5EEHA 2G1PA 5HIJA 5EMJA 4YUVA 2Y1WA 3A27A 2ERCA 3KR2A 3P97A 2AOTA 2AOXA 4QQNA 1G6Q1 2ZZKA 4X1OA 3RIEA 2O05A 2IP2A 3MGGA 2O06A 1AQIA 1EJ6A 1SUIA 1XDZA 1RI2A 4OQDA 4GEKA 5F2KA 1NE2A 3DTNA 2B9EA 5DSTA 4PGHA 4FSXA 3SSOA 4PIMA 1N7IA 5LSAA 3MHTA 2E5WA 2JHPA 1YZHA 3ER8A 2PJDA 5C9ZA 5FCDA 1EIZA 1TPYA 2GH1A 1R74A 1L3CA 4F85A 4BY9E 1H1DA 2IDKA 2ONYA 3AXSA 3BWMA 5EMKA 5T6BA 3T7RA 4DM3A 2ONZA 3NW9A 4E2ZA 3C3PA 2OZVA 3SMQA 5ICGA 2K4MA 1V39A 4MIKA 1JG3A 4R05A 2AOUB 3KHKA 3G2MA 1G38A 1DCTA 3KPYA 2ZZNA 2YUIA 3MCTA 5T64A 1YFLA 5GOZA 1QZZA 1BC5A 3ELDA 3JWHA 5FQOA 1Q0SA 2PT9A 4YUYA 5LQUA 3MQ2A 5FADA 2P41A
chains in the Genus database with same CATH superfamily
3CCBA 4W6QA 5AUPB 2ZG6A 1P9RA 4QYXA 1ZR4A 3BT7A 1W4LA 4WN9B 1NT2A 2A9QA 4AO8A 2VCHA 3RDPA 3LXRA 4Q7LA 1Z07A 4DCJA 3QG5A 2PXXA 5F1KA 5LUBA 3OPYA 1WXIA 3DWEX 3OE7A 1T2NA 3CNEA 1JX6A 4DNPA 1CZOA 1A9RA 2SECE 3TS1A 3LI2A 2WMOB 2JFYA 2CB0A 2CFRA 3UMFA 4AUEA 3L7IA 1F6BA 5KSPA 3TOVA 2IF2A 3X0DA 4FDTA 4Y1RB 4IFTA 5T8KA 4B0PA 4EATA 2XLCA 5CG1A 4CM4B 1ONSA 1LNZA 2D8MA 2XJ4A 2H51A 3MJ4A 4FNOA 4HL6A 5AW7A 2V9PA 1TCUA 1E4EA 3BDAA 3LX4A 4MI9A 2W6IA 3FBGA 1CUZA 1D1SA 1M6WA 2RHOA 1J2YA 3I9MA 3O6VA 1ECLA 2FN4A 5DYNA 3OA2A 3SJ7A 3TJRA 5KTKA 4MQFA 3J7AC 4KGDA 1KU6A 1NW5A 1XWFA 5K8VA 4K6MA 1ZH6A 2ZIEA 4IBOA 5IAGA 2A0FA 3CRW1 3HKBA 2WMDA 1TFRA 3WA7A 3C5WP 3AB7A 5J1TB 3WMFA 1MXHA 1JBEA 3CE6A 3FJOA 5T3UA 4NBTA 2AUNA 5I48A 4EG3A 2IYQA 3MUNA 1Z56C 1J07A 2HC9A 1YOVB 2JGKA 4Q3CA 1HKUA 2HA7A 5CNIA 3T52A 1IH8A 3IP1A 1UWCA 4BQEA 4G2NA 5DASA 5CDSA 1YB6A 2JG3A 1K4KA 1E2GA 4DUZB 4ZTZB 3NRBA 1HZZC 1KFJB 1LD3A 1MO4A 3DQQA 4WLNA 1QZ3A 5CJPA 1DAIA 1GPMA 1I6MA 5EC8A 4DV5B 3OJ0A 4WHMA 5IXSA 4JOBA 2VTDA 5C7LO 2HLDD 4MQFB 3PBKA 3L02A 2Q2OA 4RK7A 3UUWA 3ZJYA 4FOPA 3I1IA 3NHPA 3O0TA 3HCAA 4N5DA 4WH0A 5B3JA 4LG1A 4QXPA 4XVHA 2JLYA 3ER6A 2E6KA 2R47A 4D0GA 1O4VA 2HF7A 2VKTA 1TC1A 3GPDG 5JSFA 1SOVA 1G0OA 1GAQA 1NXXA 5IDXA 3PEYA 4YMWA 5MF6A 2I4OA 3AR7A 3L6EA 4YGYA 4O02B 5D1NA 4LJ7A 5CURA 4LWOA 6REQA 5DNUA 3UAOA 5EXTA 1L7XA 1JTFA 2NXCA 4D9NA 4CMKA 3I9V1 1E94E 1AZTA 1Z8HA 1KSFX 4QUHA 4D02A 1Z5ZA 4E5SA 2QLNA 1VBFA 2H48A 3X43A 2WF5A 4G1UC 3HCEA 3I8XA 4J43A 1ZH2A 2XEDA 4Y2VA 4GECA 1CB7A 3VKUA 1YU9A 4JIGA 3AFMA 4AKSA 3LPMA 1OB2A 3DCYA 5ELMA 1ZN9A 2G9RA 4HDRB 2XZLA 1SG0A 1TVCA 3B3AA 1NJ1A 3FSJX 3ITKA 3L8EA 1R9GA 2XMRA 1TYDE 4IIJF 1N1GA 2Z58A 1I4OA 2BEUA 4IG4A 4MQ4A 4QYMA 3P2JA 5TV2A 1SELA 5G2OA 1HLPA 1Q1AA 4H6PA 1JEYA 4FS3A 2QX4A 2R25B 2GF0A 2O2EA 2PU7A 4ZO9A 1PR4A 3EXFB 1Q17A 4M89A 4LRXA 3TNYA 5IH7A 3A2MA 1LA2A 3C7CB 4KDFA 2XYQA 3TKAA 3TGPA 1MDBA 4FBGA 1XZCA 3ND6A 4R2XA 1TF2A 3GGCA 4BV8A 2JEOA 1FS6A 5AR1A 4PG4A 4YRQA 4OLBA 2JI6A 1ZGGA 1JDVA 2FWMX 3VGPA 3OFSA 3VHQA 2H11A 3ZKAA 1YMUA 2COUA 3N8GA 4HMQA 7MDHA 3W7AA 4NBUA 1P75A 3PT9A 4W9NC 1CK4A 1A04A 1SPBS 3U7JA 3HB9A 5KMGA 2IH5A 4XVUA 2G9ZA 1PV4A 3T0FA 4GLLA 1D04A 2ZWVA 4WDRA 4KQCA 3N3AC 3QYPA 4ZK6A 5LC1A 4IPTA 5CDHA 1SQ6A 3FLEA 4NONA 3WGIA 2WJ6A 1NV9A 3DMTA 3JQGA 1I3OA 4RDHA 3FDIA 2AYZA 3DFMA 3OZSA 5PNTA 3U31A 4CF4A 5JY6A 2ATEA 1MGPA 2VDWA 2RDMA 2VXYA 4LRUA 1XMPA 3RIHA 3EZ7A 3P0RA 2J9ZB 4F6CA 2J31A 4J76A 1IY0A 3OLXA 2Q1TA 3K5IA 2HDNB 1IBRA 1GG8A 3OM9A 5IMSA 1SCUA 2ZPUA 4C76A 1I1NA 1JLHA 1RXUA 1KBZA 1WCYA 3JV7A 4HXEB 4ATNA 1CR1A 2ZXFA 3GRCA 4LJSA 3W4KA 4M0DA 4F5ZA 1ST3A 2JVKA 4PSUA 2XNKA 4BFXA 1U7HA 1J5EB 1Q83A 3ZWBA 3LKZA 4DV0B 3PUWA 1PWYE 4FOTA 4XIYA 3U16A 2EFJA 4NXNB 4P80A 5F23A 1CUWA 4MW6A 3MBIA 4MKIA 1MDFA 1NXQA 5EWJB 4Y2XA 3ZQKA 3JYOA 1YTLA 5EKDA 4P08A 5F1PA 4O1MA 1DINA 2WHPB 4M0CA 5CXSA 2H4XA 2NU9A 1L9KA 2P3SA 1RWWA 2DWCA 2OFOA 5JNWA 1LDMA 2J5KA 2J09A 3AEUA 3FZYA 2PXHA 1T0IA 1SGWA 1ZQ1A 2XOEA 4D9EA 2EW1A 1RZRD 4M49A 4QX6A 2E4YA 1UMBB 3PCTA 4M7RA 1IHUA 1A5BB 1GPYA 1QFMA 5IVIA 1N3YA 2GPWA 1PG5A 3MT9A 4X92A 2WUVA 3TRKA 3GZTB 2R4UA 2GEFA 4Q19A 4YV7A 4EMTA 1T2CA 1J0CA 1L5RA 5DLYA 3ZDFA 2Q2QA 4MAAA 5CFNA 1H1LA 4JFAA 3NM6B 1QHEA 4ND6A 4F21A 2WF8A 1BMFD 4OPMA 1NOIA 1RI4A 2D0IA 2G7MC 3KHTA 4RTOA 3BTSA 3C3CA 1R6BX 2B8TA 3OMWA 3JVIA 3NTVA 3QKSA 1DJNA 4IGEA 7ABPA 3U09A 1HYBA 2BHRA 3KQQA 4UU7A 1YRBA 3PXCX 1QFSA 4IEFB 3SHWA 1WW3A 1V3QE 2R8BA 4G1BA 3KBOA 3VUEA 3IOYA 1WZNA 5CM8B 5BNFA 3RRZA 4AKEA 1IXZA 3L8HA 1NPTO 2P6RA 4LNUB 1XLTC 2PBFA 5JI3E 1YO6A 1QHIA 1C4KA 1FYVA 3L2OB 4H7EA 2CFTA 3MUEA 3HU2A 3QE4A 4IVPA 2NYVA 1XLUA 4GX5A 5IULC 4F11A 2PGLA 4ENQA 4EFDA 2PFGA 3MBOA 4TXNA 3G7UA 1DAGA 3DNPA 1F2DA 3NKLA 1DLJA 1G60A 1NLZA 3O8QA 4MWZA 3S2YA 2WWRA 3SYKA 1E2PA 1GAEO 5BYKA 5I7FA 1M1ZA 4PSAA 1UXJA 2WKWA 2X1MA 3HYLA 2ODAA 3EZLA 3RFVA 1MPXA 4G24A 4BCCA 1K5PA 4JN6B 1DX6A 2QE7A 2RAUA 2POCA 3D6AA 1WRBA 1BDMA 2GWHA 1T9GR 4IJ6A 2YYAA 4EG1A 4OG2A 3UMBA 1DCKA 4RK0A 2E21A 2YCLA 4URUR 1J99A 5TVKA 5DI9A 3TLXA 4RTQA 1KPHA 2J5BA 4GWGA 4W7IA 1IY9A 3LX6A 3JWEA 4J49A 4R0NA 5GVRA 4AG6A 2WHYA 3AP3A 4FEYA 4EQ6A 3IQGX 1QOPB 1GA1A 2ERYA 4IXTA 2AK2A 3WHLA 3JD4A 3N75A 3CB4A 3O9ZA 1SZCA 1WJGA 4GXNA 4V0QA 5L45A 2VYND 4JA0A 3TNDA 4K6CA 1QFXA 3G2PA 2R2AA 1DTSA 5H5JA 3UVEA 3U19A 2RIRA 3O8BA 2BKVA 4X45A 5LBTA 1RHJA 1XRJA 4C0BA 4JVNA 3TLKA 2JLWA 4OQLA 1RWNA 2PWAA 2XUZA 3R4VA 1NZDA 4BN5A 3DAHA 1ZONA 4IJWA 1UQRA 5AO9A 2BEKA 5F76A 1ELOA 2BDEA 4WK4B 2PDAA 2IEBA 3ADBA 1MIOA 3EGIA 4WINA 5LOVF 5FORA 1X1SA 5CVUA 3DFKA 3F67A 4Z0TA 3TM5A 2D3TA 3CH6A 3B13B 1NC3A 2XYVA 5IVKA 1RQXA 1U65A 3OZRA 4ZEVA 4LY6A 4RW0A 2BZ0A 4IQ0A 3VTFA 5JSHA 4IOMA 5HQTA 1N25A 4FWIB 2VJLA 3EVZA 3MN1A 1KGDA 3GY0A 3KZCA 4BV9A 3Q3GE 5BRJA 5EHXA 3WWZA 3X1YA 1JEOA 5FTMA 3BDIA 1GZ6A 4ISCA 1UL1X 3M6LA 3TQIA 2QIPA 3VHRA 5A06A 1B74A 5DXFA 5C8YB 3PFIA 1XEXA 2FLWA 3STWA 1KOLA 2CLDX 3ORHA 4EH1A 2W6ID 3TXYA 4XVQA 1P7CA 2I6GA 4F12A 1Y34E 1FYXA 4GPBA 5KTOA 1T4MA 1ZQ9A 4RGBA 1YOVA 4Z9YA 5JIBA 3R8XA 1G8KA 4X54A 1LK5A 1ODTC 1Z8FA 4LXUA 2JFNA 5DYYA 1U8FO 1I7NA 1W6UA 2OV8A 3AJEA 2YJ3A 5FFNA 3NHSA 3IXQA 4D25A 5JECA 3UGKA 2HX1A 3K1AA 4TKMA 2IE8A 1N9ZA 2YL2A 2ESRA 1F5NA 4KGXA 2PPVA 3CE9A 4OL9A 3ZI0A 3OURA 1AA9A 1XZQA 4FUQA 5EA2A 1WLSA 4NZZA 3WLQA 3EPHA 1OXSC 3K0KA 4GMGA 4XCXA 1XBTA 4TTSA 4CQLB 3G79A 3VVCA 3ZIDA 4K7JA 1NWCA 4AM8A 3BGOS 4L5IA 3A1EA 5TJHA 4XLTA 1GZ7A 1U2QA 3RYCB 5K4AA 1ODJA 3S2SA 4ZVSA 2YN2A 2W71A 4MJ7A 4Z4EA 1AC5A 2UYCA 1DFHA 2F1RA 4JDPA 1NMZA 2VFAA 1QO0A 4BVFA 2C2HA 3GGSA 3KYCA 1JLLA 3MCUA 4Z5XA 2FUNB 2VH2A 3C6BA 1Z6YA 2I8AA 4QATA 4Z2YA 3PUVA 4A5OA 2VUIB 4UTNA 3T1NA 1N34B 1GFIA 3DMTC 4JIMA 3WI7A 5BSWA 2C2ZA 1FNDA 2A1UB 2D5AA 2XMGA 3DOUA 1JLRA 3G8BA 3Q7IA 4NPCA 4NOLA 1LDYA 2R00C 4K2HA 2OY0A 3GN1A 2H7CA 4S2UA 4L4ZA 2ZYDA 3PD7A 3NH9A 4RV5A 1EA7A 3FDZB 5CIWA 1FRVA 1TO2E 4XFJA 2ZRLA 5IKMA 2IL1A 3IULA 2OM2A 1MTOA 2JD0A 1PJ2A 1S8FA 1XU9A 4DBLC 1NTOA 2VHYA 2R87A 4KI7A 4Q1AA 3TI7A 4BGUA 5CBPB 1FFAA 1NASA 4MR7B 5EKTA 1OASA 2XAUA 2YW2A 4JOQA 4LF5B 2YXEA 1H2RS 2D0OB 4KH1A 4MEJA 1KI1A 2I80A 4U3JA 2H4FA 3RKUA 1SM4A 3ABSB 3C15C 5DGXA 5C35A 3G5TA 1SIBE 3NGXA 4BZZA 4UKDA 7YASA 3KDSE 4RD4A 8GPBA 5MGNA 3PUKA 3SBDA 2OG1A 1OFUA 2PH1A 2BYTA 3L7NA 3OX2A 3KJIA 3MMPA 4I3HA 3UAXA 5HM6A 1HQCA 5ALFA 2JI9A 4R41A 3WYAA 4TUYF 2GSWA 5FP0A 4Q9JA 4TTVA 5KTTA 2PUHA 4HAVA 5MN4A 5CCXA 4Z1MD 4M0LA 1Z0DA 1BFDA 3P9PA 1C0LA 1NQ5A 3PJEA 4FGZA 4ZAYA 1KYIA 4YMUA 5IWCA 2GCEA 5CT9A 1P9WA 4PZAA 3AW9A 4H3SA 3PR2B 1J2RA 4R8KA 4MARA 2AOVA 4QUIA 1SBZA 1KKMA 4I9FA 3RS4A 2Y1OA 3F9RA 5ULLA 1IXYA 3W2FA 3IBSA 1OKKD 2PUJA 4XQ0A 4NE7A 2R4QA 2HOQA 2TS1A 3Q7EA 4AZ3A 4FNGA 3H0CA 4UVEA 2HHCA 3N3BC 3FIUA 3WRYA 4S24A 1BJTA 1YZYA 2IZ0A 2PM8A 4L27A 1Z2OX 3TMYA 1AMOA 4MWBA 2NPOA 3ESBA 3OHSX 3JQAB 1GSHA 4QBFA 3NAGA 3TIIA 3P4YA 3B82A 1SB9A 3H5VA 3WVNA 3OQNA 1QU2A 5A6SB 1I0IA 1FSSA 1V9LA 2BUCA 5G0TA 3R3ZA 3W1VA 3FA2A 4XWGA 2P6OA 4QPCA 1E0JA 1ZJJA 3KIPA 4C7JA 3O9MA 2NXJA 2PZLA 4ZMBA 3DT6A 6NULA 3KAQA 1IZYA 3F6SA 3COJA 4TMKA 3L1KA 1TB4A 4WKOA 4IRUB 1Z75A 3HA7A 3PKIA 3QEOA 4K26A 4NHEA 3TRJA 5KKNB 2W6OA 1KO8A 1GN9A 1JMKC 4DLVA 1MRSA 1C3JA 1NKTA 4OI4A 1P8JA 2QXTA 1ZUIA 2PD6A 4C3UA 1CP2A 1SZDA 4NYMQ 3KX2A 4B3TB 2YIDA 2YNMD 4ZVOA 5A9SA 1UBRS 1STOA 1SUIA 1ZI8A 3IO5A 4JODA 5ICSA 1DWQA 2AGVA 2E4AA 1US8B 3IDAA 1QYVA 1ZSVA 1TZKA 3OZBA 5JPIA 1PJ3A 1LC3A 4RL6A 2Q9CA 3Q7RA 2PGIA 2M6SA 4WZBE 3RS3A 5C9ZA 3JQFC 1J90A 3IOCA 3AXSA 5HRUA 2IHKA 3GFBA 1AHNA 3MELA 3IIEA 1J24A 3M5PA 4B73A 3K4QA 3WL3A 2C92A 4L8VA 3WYEA 1U7ZA 4UVGA 4MIKA 5DLDA 2V7XA 3NBFA 5JMWA 1OYVA 2R1VA 4UVDA 4KSBA 3EXAA 5CB4F 4KQKA 3T5BA 1G8YA 1QZZA 1H8ED 4RD3A 1OIVA 1YIDA 3WZLA 4K81B 5DK6A 3HJTA 3TZKA 4NR0A 1KBQA 3BZBA 1CRQA 4D4GA 5EUBA 4F9TA 1E6UA 4Q4AB 3KEGA 1RAEA 2FCRA 4TLMB 2P40A 1HYGA 4ZA2A 1M6YA 3T5TA 1GT6A 2VP3A 1Z34A 3ZOKA 5CG2A 4EHBA 4DIFA 3RO7A 2A67A 1EHIA 2GM5A 2I2XB 4PYRA 4F8YA 2FEOA 4Y98A 4M83A 4COOA 1NQOA 1OE0A 3S8MA 2JEZA 3R76A 4BBJA 1VFNA 5C46F 2MTBA 5DGDA 3JZAA 4NG5A 1RI3A 1XZDA 3K1YA 3BUSA 4BXOB 1WS6A 2B21A 5KVSA 1SKUA 2GPAA 5C5DA 1XU4A 3L82B 4FYMA 2YY6A 1FZTA 1Z5WA 2V8OA 4NK5A 4TTPA 3HJFA 1W46A 1RRCA 2IX3A 3IB6A 1I7DA 2VQ3A 3BXZA 1FFCA 5FWXB 2HYDA 3TW4A 5EMMA 4RTSA 4FQ7A 3UCFA 2NO0A 1E9SA 3M3HA 1DAEA 5FLYA 3UXYA 2OHJA 1FLAA 1YV9A 3H7AA 4A82A 4JC0A 3STVA 4FFSA 5EPEA 4V0SA 1EUQA 4NU5A 2IEYA 3PNMA 4YRBA 1KEZA 3ZDXB 1BS9A 1EWYA 4PZ0A 4M6WB 3UQYS 1UAYA 4XPIA 5H8WA 3Q4GA 1PT6A 1UOOA 1VGVA 3ROPA 1ZK4A 1ZL2A 2AE2A 2HBZA 4KLZA 3E9DA 1R8YA 4TLAA 5EYPB 1QKIA 4N0DA 1T3LA 2OKCA 5FBVB 2K7ZA 1E9FA 4OK5A 2ZJYA 2W83A 3CUUA 1RQPA 1TZ2A 1WDLA 3GR6A 3UA3A 4AF8A 2A58A 1ODFA 1CVLA 3TM4A 3CXUA 3TR6A 4OHFA 1R1DA 4MB2A 2QUJA 2OR3A 3H83A 3HJUA 5FWDA 2GCNA 1E0AA 3VC7A 1O94C 1G21B 5KDLA 4NZ9A 1WXDA 3JZMA 2C2GA 2DY1A 3QE0A 4KR9A 3WB1A 1W6RA 3C5EA 4G3XA 3UPDA 1H9AA 1AN9A 2ZJBA 2FMTA 1DOZA 1JHOA 2B20A 3BXOA 1Q84A 2G28A 1K6MA 4ONEA 5ADUS 2VC2B 3UWKA 1CUYA 2M6RA 3N5CA 3OQ1A 4QOHA 3S6JA 1GFWA 1VE3A 4FYIA 2PQ2A 1T24A 3CUKA 4B48A 1BQEA 2CKMA 2C5GA 2GO1A 2XMCA 4PCVA 4D0SA 2DC1A 4NCKA 4AQDA 1ZIDA 3OTOB 3NHFA 1YXMA 4UFPA 1TADA 2Q29A 4Q3LA 3H19A 1GGKA 2VPXA 1ZUNA 4WLOA 2NOAA 1NDQA 2JD1A 5AVSA 2QQGA 2GN6A 3BOSA 1NKVA 5AP9A 3G2HA 2PQ6A 4KOAA 4RWZA 4MA0A 1BCRB 2PWPA 3AESB 5JAQA 2JJ8A 3V8NA 4A8PA 1NLMA 4M8IA 1R0YA 5TQJA 5KNBD 4TLEA 3PDIB 5LP6C 3B8EA 2X1HA 3D4BA 2AW5A 1VG1A 4G36A 2CUZA 4XEUA 4B45A 3RU7A 3FZNA 3TQCA 1WX1A 3GMDA 4B2PA 4DPMA 2AE1A 3Q9LA 4F3CA 4I1PA 3MD0A 5HOEA 2IIVA 3UBTA 1CQIA 1Z39A 3I28A 3SZLA 3ESYA 1NNEA 4Z53A 2AFIA 3MS4A 4E12A 1YT5A 1X80A 1AUXA 1XQ6A 2YS6A 3QH4A 4HNGA 4YBZA 1GTZA 1Y3FE 2O3TA 4B7ZA 3RLFA 1BKSB 1V4BA 2YVKA 1TD1A 3A2NA 2YWFA 4V3CA 1L3BA 1KKLA 2BBWA 1G98A 2WOJA 1EWRA 3T41A 2ZATA 4GU5A 5CAEB 2WQ7A 1N6HA 2YV5A 3ETJA 4WNAA 1QONA 2B8JA 3AFHA 1IY2A 1KR5A 1RBZA 3OM0A 3LSTA 4LWQA 3NETA 4AZ0B 2BT4A 4YPVA 1X1CA 4FS8A 4RVCA 3GG2A 1TA9A 4ITUA 1A8QA 4DJDC 5I7UA 2ISCA 1XA4A 3EODA 2CDBA 4M98A 1JHVA 4HX9A 1CDEA 2CL6X 2VXCA 3LSYA 4R5MA 3RREA 3VSBA 4YCSA 3F4LA 4XJTA 1FS5A 2ACVA 4C05A 2X40A 1JH8A 4A6XA 4CR8A 2HMSA 3VR6D 3W2TA 2B4AA 1VJ1A 3IAAA 3IDSA 2ADMA 1M6VB 1IB6A 1GRVA 1SVSA 3W4JA 3TCXB 1F8XA 3ZE2B 1UXIA 3INRA 3N8NA 3PEEA 2AR0A 3BB4A 4KIFA 4M9XA 3TW6A 4AXBA 4TQ9A 4CT5A 1RLMA 5CYOA 2WTXA 1L5HB 3LDAA 5AKKA 5HMLA 1LRLA 4A3SA 4CV3A 5KJ6A 1VJGA 1RPZA 1H5QA 2HRQA 2E55A 3ZHUA 2ZSUA 1WMBA 3H5AA 3ABIA 3SFTA 5JYCA 2AFVA 3JAKB 4XE5A 2ONKA 3WGKA 2Z5FA 1N4DA 4EELA 1DS6A 1TEXA 3H11B 3B6IA 2FEKA 1YCFA 3P9ZA 2QY6A 3V2HA 1UDRA 3CLRD 3D1VA 1B0PA 1MAVA 3B3FA 3COZA 4J7UA 4LECA 4ZJPA 4Z4GA 2FK8A 4Y18A 4PVDA 4YMSA 5ESXA 2RKOA 5FTKA 3DT8A 2ZI7A 1YUBA 3T61A 3OQMA 3OKPA 4B6RA 4BBAA 4CNBA 3BGSA 4PZUA 2DWPA 1C7IA 1W4AA 2ADOA 3LDGA 4Z1MA 4DBVO 2PVCA 1V9SA 3LUKA 1I6WA 3E9YA 4XDGA 3X2FA 2GTPA 2PN1A 1P9NA 3BTUA 4RVHA 4TSRA 4ER6A 3ISVA 1NW6A 5HJ7A 4NYIQ 4RHYA 3O5AA 1MQSA 4WEOA 1V1JA 5CA1B 5DN6A 1P80A 5DOVA 4RLHA 1T1SA 1C1DA 2G67A 2V1XA 2W6PA 3L1VA 4Y9RA 3QYJA 3ROKA 4DQUA 3HEAA 3WNQA 3F78A 3CZPA 4MUGA 4K9RA 1Q1ZA 4DZZA 1WXGA 4KC0A 2P30A 4QOEA 4DNFA 2DETA 3KAPA 3R7LA 4Y2QA 4C5AA 4PFJA 4UQLA 3GF4A 5JVDF 5C8DA 4G0PA 1K7XB 4LRWA 1KE2A 3UO8B 4II3A 2M1XA 4B4OA 3OP1A 3KG2A 2X5XA 2YOFA 3N07A 2BRUA 5KVCA 3C6QA 5EXPA 2IXTA 1CFZA 3JQPA 1FNNA 1MENA 2HXSA 4PLFA 4TL8A 1S2DA 3BGWA 3AT1A 3H5LA 3KELA 4F46A 3W9YA 3QFFA 3M5WA 3L8YA 3RSGA 3VR5H 5IASA 2FLKA 4M1WA 3L49A 1R4ZA 5E1BA 1EWQA 2EZ9A 2R65A 3AI7A 3JASA 1E2HA 1WXHA 2P2SA 4WOBA 1JSXA 4HNRA 2APJA 4M7PA 1GZDA 5DF1A 4YONB 4A26A 1T2FA 2H1OA 3LT5A 5L3QB 3Q2KA 2X9QA 4M0PA 3KAKA 4ZGBA 2FOXA 2PAAA 1QHNA 4DJFC 2CMDA 2Z5VA 4CMHA 3FZEA 1XVIA 4FN4A 2H4HA 1TFUA 2FWPA 3WYCA 3LBIA 4LWZA 5I7AA 3M5CA 1KQGA 1Z38A 3E53A 5ARCA 4BO7A 1PQUA 2HB6A 4MQBA 2LGJA 4RFSA 1XRMA 3R3SA 1DRWA 1TK3A 3PA8A 3W5DA 2Y2VA 1M2GA 4HXFB 5HTOA 1BH2A 5CVJA 3U7EB 1P8AA 2TECE 3FIJA 2Z9BA 2R60A 4DDKA 4UHFA 3GT0A 5B1YA 4CM8B 3VNRA 4TWZA 2OZEA 5FUXA 3ZVLA 5DO9A 4OBBA 1BZYA 5HGJA 2KE5A 4J0IA 2ZAGA 3HI4A 5ECDA 2QSYA 4PZLA 5EE0A 3X3HA 1TUGA 4NYJQ 1ZMXA 3L0DA 2WILA 1TF7A 3B3GA 3BK2A 4LE0A 3VUFA 2G8LA 4XWOA 1OIXA 1SHTX 1YKGA 3QX7A 5KI6A 4P4SA 3TSCA 2BGMA 1TYZA 3V4FA 1P0PA 3CTPA 1IXSB 3L77A 1QF7A 2IUEA 1P5HA 3DVAA 4LBWA 4M3NA 2DUNA 4MMZB 3IBFA 4RV9A 3A37A 3FTQA 1NC1A 4NATA 2DMRA 1QIKA 4ZAWA 4HR7A 4R2KA 3HRKA 4UE6A 5KYUA 1ZSYA 3RADC 1KQFA 1XNRB 1FMCA 4HH1A 4MGZR 4JI0B 2ZUEA 1A3CA 3JALA 3KK0A 4PX3A 1PTKA 5AJUA 5FPSA 4F6RA 3LQFA 1S9HA 4M76B 2XQFA 2A1IA 1L7AA 1MO6A 2UVDA 3OTGA 1NF8A 1KOFA 4BZWA 1RE0A 5EKUA 5JMTA 1UK7A 2XOKA 4CYMA 1TYAE 1JG1A 3E9NA 3FFTA 2ZIXA 1KS9A 2Q0QA 4D26A 4A36A 1WXXA 4UEKA 3CPEA 1H8HA 3PG5A 5TDHA 2DX7A 3T3HA 3PC4A 4RNCA 3T1QA 3RVJA 5HA5A 1UUFA 5TPWB 1MOQA 4C08A 5AVYA 3A3PA 3MB5A 4IF6A 4AIRA 5JD6A 3PZRA 2EFCB 4N41A 3P27A 3F6RA 1W5TA 4KWTA 4R9VA 1H6AA 2X8JB 2Y1EA 5FA8A 2GBPA 1R7RA 2QRGA 3J7TA 5LLDA 4K8RB 1YZNA 2IOYA 2NADA 3COWA 1PFYA 1UQTA 4FMDF 4NYJR 2H57A 5FBRB 5LMZA 1JU3A 1O03A 1JALA 3D8RA 4LNHA 1ZR2A 5B30A 1QHSA 4L73A 5CH8A 3SIPA 4EUNA 2YCBA 3OCYA 3VKFA 2MSKA 2QRZA 2H2GA 1L1FA 1GYPA 4J6FA 1DO2A 1K8XB 1QGUB 3VI3B 2VPWA 1GRCA 1KVSA 8ATCA 4URXR 3PI6A 1JE0A 2Z2JA 5FTWA 4PZ9A 1NW9B 3BE4A 4FGLA 4HD8A 5ADVA 3NV7A 1IVSA 4ZQHA 1GKLA 3L6UA 5TMEA 1JECA 1U7WA 2WUGA 4A73A 4EA9A 1CZKA 1R64A 1PVVA 3HNOA 4DIBA 3QNMA 2KBEA 4KIGA 1YCGA 3GBPA 3ZU2A 5E3HA 1JG6A 1VDZA 4NJEB 2FZKA 1AKTA 4BCBA 2XVXA 1E2MA 2ZIZA 4BQPA 3TD9A 2LIPA 3LV8A 1YJXA 1E69A 5CK5A 4Z3KA 3KSAC 2XA1A 1HBJA 2D5IA 3PUYA 3DR3A 2X0FA 1TKRA 1ZM3A 2NVUA 4U0JA 3T1HB 1G5TA 1M54A 2BPOA 2YZNA 4DB2A 2O1EA 4GOKA 4JKYA 1NJSA 4B4KA 4LJRA 1U2DC 2CDNA 3MERA 1ACMA 2AJ8A 2QVYX 4LQLA 2WUDA 4ZOCA 4DLKA 4RAQA 2P9QA 2AWOA 5E6RA 1P2DA 3KOYA 3R5SA 4PNPA 3P19A 3W9SA 1Q6ZA 1X3SA 4MPJA 4FUTA 3WBBA 5TMPA 3H2YA 4XYLA 2WW8A 4QFBA 1T4CA 4CM4A 3F3KA 2R7NA 5JDIA 2ANBA 1PVOA 3RF6A 3OX1A 1T8SA 3ITDA 3OBBA 1IONA 1E4EB 2O14A 2QSUA 4JBLA 5G1OA 2OSVA 4KN9S 5LNK1 2EGUA 3HY3A 3TB6A 1LJLA 5IP5A 2XSZD 5HQ3B 3NUZA 4Z7JA 5HYVA 4X7PA 3FPGA 5CYPA 1NE7A 4XUEA 2H92A 1UDCA 5ALVA 1FCJA 4HGYA 3PHJA 3Q6NA 1CC1S 3KYIB 5EJ9A 1Y3DE 2XF2A 5I7VA 2MIIA 3AY3A 3M6UA 4XM0A 1Y5MA 3RJTA 4UHEA 1P2UA 3T3MB 4Q3EA 3CZ9A 3NHMA 4P3PA 3JQ7B 2QVZX 2ZQYA 4HGRA 4JZKA 5B1DA 1WL8A 1BHO1 3JYLA 1II8B 1AGYA 2IYWA 3C43A 2WA2A 5I5EA 3JX9A 3PQ2A 1HDGO 4BBPA 4EY5A 3GUYA 3IT1A 3M6FA 2DFKB 1JDPA 2EU8A 3HDVA 4INPA 3VSDA 1T9ZA 3IO3A 3W05A 3TVYA 3IR7A 1YSCA 4RHUA 4GXQA 4MUEA 1CP3A 4R3UC 1GGEA 4YRLA 4B5LA 1OA0A 1UC5B 4FYYA 3K0AB 1WPGA 4TSFA 1FEZA 1P18A 5EOVA 1P81A 3ULKA 1RXVA 1A8HA 2FEAA 1CG6A 4L4SA 4NBSA 4ZN6A 5JQGA 4L3VA 2CJWB 4IDBA 5KMGB 1D8TA 2MMCA 5LZ2A 1D6SA 4MCJA 4COKA 4QPJC 4RK6A 3H11A 4KUEA 5HZMA 2OENG 3BL5A 3DV0A 5EMJA 2GBFA 3FGZA 3X2SA 1CJUC 3P2YA 5AVRA 3HU5A 5A4MS 4D4KA 3QXJA 3RC9A 4D1YA 4RFLA 2GHRA 2ROQA 4OXKA 3RG2A 1HTTA 1X77A 4O25A 5COBA 4WY8A 4YRAA 3ETEA 3I92A 4GR5A 3DBVO 4WMLA 1RADA 5AJXA 1RZ3A 1BJRE 4L5CA 5E6SA 1PJLA 2NAPA 2GH1A 2CHQA 3HJHA 4LZZA 1G4HA 3IOMA 1R5JA 1L4LA 1Q3KA 2EG9A 1C41A 2NSLA 3EFEA 4WFIA 2IUFA 4KAAA 4UMDA 2OV4A 2B92A 3EC1A 3E4CA 3F2IA 3KOUA 5HCIA 3IPCA 4DA9A 2WSSD 1YQUA 2XQKA 4JJ8A 3GARA 1YAJA 4AJ1A 1DCTA 1Z6QA 2ZZNA 1GCIA 4NV1A 5BYJA 2CV2A 4UEOA 2JGFA 4Q16A 5AI9A 3DZFA 4YJ3A 5GOZA 1JAZA 3WGMA 1YFLA 4YUYA 4CLEA 4JQOA 4OF4A 4XWWA 3IHWA 1DQZA 1F1BA 2OZPA 3QK7A 1Q0QA 1QHGA 3T7TA 4BNNA 1XRLA 3TOZA 1SKBA 5COAA 1S3GA 4FEEA 4HRYA 4EX6A 5JAOA 2Z6UA 2CHEA 3S68A 16PKA 1L1EA 3HM9A 1SCBA 1E58A 1Y89A 4UAVA 1VLJA 5KHAA 5JLJA 4AJHA 3CX7A 2YHIB 2CWWA 1DEAA 1I0ZA 3ONEA 1WNFA 3BXGA 4RZIA 4HG2A 1ETUA 5E2BA 1TA4A 1U9IA 4O6VA 2Z8XA 3UJ6A 4IY1A 3WSVA 1SG9A 4K6GA 1Y3BE 4KV7A 4PLVA 3CLKA 2B4YA 5BV2P 1IPFA 4Q6BA 5ESDA 2XTAA 5HF8A 2A5FA 4P7BA 5IVDA 5E2AA 2HFKA 5BQOA 4BQSA 2B1RA 1B3RA 5FUYA 3B60A 1EMDA 5LOVA 2VRNA 4HBGA 3PX7A 3UQZA 1E2FA 5J2UF 1P2SA 3GGPA 3GN2A 4BJHB 4CM9D 1C8VB 1KXZA 1X39A 4EAQA 5B4VA 5J40A 4XI9A 4HS9A 4TMZA 3ANYB 3GCGA 3CLTD 1XD2B 3AU9A 3ZVKA 2G76A 2GK6A 5GMOA 4B6EA 5FOUA 2FG5A 2JJYA 4YDQA 3W9BA 5EN4A 4CM8A 3EVDA 4M7WA 1IN7A 1XVVA 3IJEB 1A2OA 4V24A 3IIMA 3JRNA 3K1ZA 2H31A 1OLSB 3FW1A 3KE9A 1CEEA 2OLKA 1PTJA 1Y1KE 2HMVA 1Q21A 3V2UA 3W8NA 3V9AA 2OO5A 1F48A 2P75A 1W5BA 2QRVB 3LQRA 3WWEA 3GRVA 4CMIA 3BXPA 1K0FA 2HRBA 3DVAB 4F4CA 1S1MA 4XM1A 2GXAA 2CCGA 5LD2C 1P6QA 2R6JA 5C7IO 4URYR 1NTRA 3DB2A 5DCLA 4OREX 4H6WA 3DVLA 4E5UA 1GUBA 4JBXA 3WS7A 3KLNA 3SF0A 3U9TA 3USES 2WHXA 2XXAB 3QVLA 3RK0A 2HWXA 2RSLA 1Z6AA 5AVOA 4AZTA 1S0UA 1DAFA 1J7JA 3ZNNA 1L4YA 2Z2XA 1RWOA 1NR1A 2R96A 4DT1A 4G5GA 4I2VA 2QTWB 4GKAA 1FLNA 1XTIA 1J22A 1K08A 3DS8A 4P2GA 4M1MA 3CKKA 4C3VA 5G3ZA 3C6XA 4N4AA 5J58A 1J0BA 3DZIA 2AG0A 3WTCA 2V65A 2ZRQA 3D4OA 3L18A 5A02A 2OM6A 1Y9EA 1F0KA 1KMHB 2P1RA 2QTFA 3IX7A 1KI6A 4CN9A 3HP7A 2IJGX 3KZVA 3QWHA 2BV3A 2VDUE 4J0QA 4RJJA 1A4RA 2YY5A 2QX6A 3FCXA 3QKSB 3O3NB 3PJDA 2O0JA 3E61A 4LEIA 2QB5A 2E82A 4XQGA 5IDYA 2JBWA 2FNAA 3LVRE 4DV7B 5FV4A 4LC0A 4QT0A 2ZAIA 2ZRFA 3QENA 5CJJA 3QPWA 1Z6TA 4XDZA 1OWPA 3IP9A 3GLHE 3IV7A 3VXKA 1GNSA 1G7RA 3AG5A 3E0XA 4LJKA 1A1VA 1MIOB 3ZQJA 1P1JA 5FAXA 4AN4A 4BBZA 1T3TA 3J81k 4RTNA 3X1MA 2GK7A 1LBTA 4GZMA 3GJ4A 1RKXA 4MR8B 1Q92A 3C87A 9ABPA 5AKYA 5B4UA 3RARA 2FETA 1SVOA 5C37A 2WM8A 4MWSA 2VXOA 4NEGA 3C8UA 3RSFA 1VMIA 2H3HA 2BJHA 2C9BA 4KW7A 4HC4A 3FH0A 3K4PA 4CL2A 3ILVA 1ODIA 1AF4A 1XEWY 3LUPA 1FFBA 4IKOA 3E70C 3IIJA 4NWIA 1KH2A 1VL6A 1F6DA 2MYNA 4S1OA 4E08A 3IT2A 3EEBA 4FGKA 3EAGA 1DC7A 4IRMA 4C20A 4LFAB 1WPQA 4W1SA 2RGNA 2ZE7A 3PYMA 5GONA 1Q16A 1XK7A 3U49A 2QTGA 5K51A 5JJIA 1WBJB 2ONCA 4JUIA 2FX3A 2YV4A 1PR5A 3QUAA 4GQBA 4OBWA 4CW7A 3HYTA 3NTLA 2NU7A 5DBEX 2XMPA 5DYWA 1VI6A 2C7PA 1L5YA 1Y3IA 4XZ3A 2ZSHA 4J0FA 3KV3O 1Y80A 3AIIA 4PXYA 1NVGA 2HIHA 2OQ2A 3DDCA 3ZXSA 3SJBA 4DCCA 3S55A 3AF6A 4Y2TA 4HZIA 1OXKB 2EG5A 3GEPA 1MJFA 1N6OA 1EXNA 4LIPD 2YZMA 4R68A 4U7TB 4JP2A 4UDXX 4ZAGA 3U26A 3ZNQA 1EP1B 4C03A 1LVGA 2G09A 2DY0A 2OXCA 2WRZA 3TLBA 2Z2YA 4EG0A 3ZLUA 4YUAA 3ZYCA 4HGZA 4LHWA 3KWJA 2ZRIA 4GI5A 4LXIA 4UTXA 2EP8A 1JKFA 3KYCB 3QKRA 4NNPA 9GPBA 1ZGHA 4K8OA 2X8AA 1DXHA 3FG9A 4I1RA 1GUFA 4LRTB 2VQEB 1O0BA 3PJRA 4CLXA 4D74A 2BMAA 3ND8A 3ZBQA 3MUFA 1PQ4A 3GJ3A 3FOAA 4KNWA 4KXLA 3VJRA 2D2EA 2WIFA 2WG1A 2XWBF 4ENWA 4UPVA 1E63A 4MVJM 1PLJA 4RDCA 3S44A 3TOCA 4JJKA 2RH9B 4I5FA 5B7GA 1RJWA 3PF9A 3GLUA 3NYIA 5A4KA 2XBMA 4DB4A 3BVPA 3QI7A 1U3CA 4J6EA 1ZCZA 3LO5A 2CLMB 3TF5A 5LKRA 2QZJA 1SQ5A 5HIIA 3GOQA 3SBXA 4XR4A 1Y63A 1BHQ1 1BKYA 4RGQA 1HXHA 3L0YA 4RPCA 2MSDB 3PWZA 1XALA 1KZ6A 1T15A 5ESRA 5BUCA 5CB4B 4FGJA 2AA3A 3U6KA 3GMSA 1CJMA 1M2OB 3F3SA 1CRWG 2VPQA 4IQFA 5C81A 4F92B 3OIFA 2P9FA 4JU9A 1PCXA 2FPKA 2RGNC 4LV6A 1QGZA 2CE7A 1D0SA 1YD7A 3I72A 4IQGA 1Z6XA 2EW2A 2WYVA 4AC9A 4CQLA 4MQMA 1NR5A 1XRQA 1ZUWA 2E6UX 2PKEA 1Z5PA 1TO6A 4AJLA 3QUBA 1V8OA 1VL2A 4IIDA 1BMDA 1VCMA 1N2BA 2FFBA 3HSSA 1W5EA 5BR4A 3LUGA 2A78A 1WQ1R 1O8BA 4Q3KA 3GJTA 3COPA 4UEQA 2IU0A 1D5CA 3E3AA 3S5JA 3RNOA 1YGPA 2J6HA 2FJPA 3DBRB 1I9GA 3RAFC 1G20E 3BIWA 2DPGA 1OC4A 1NUUA 4QJBA 1NMQA 3LT1A 2ZDGA 5LVAA 3JQQA 3ZD6A 2O8EA 2JLXA 2PSDA 4LOKA 1DXOA 2QQEA 4AZWA 1PW5A 4Q15A 5K99A 1I1OA 3L7CA 3R6DA 4W4TA 5FPPA 4M9QA 1A8SA 2QT0A 4GP9A 4OJMX 4QYIA 5C8ZA 1FJGB 1RM0A 1SUCA 3SR4A 3BRQA 2DCMA 2IEDA 1H85A 2WAAA 1LPMA 3HUFA 3LOUA 4PINA 1YZ3A 4KEAA 4QTTB 1TKAA 1NG1A 4IJ5A 3NUQA 2HZ7A 3FLMA 3M89A 4Y7DA 3SG0A 2F90A 3FCSB 2FMKA 1XZBA 2X15A 1IWPB 5F3RA 3TTWA 4PGMA 2F3RA 2JH9A 3FF1A 3OQPA 3SHVA 4BNJA 2F4VB 2B0JA 2YRWA 1LJ8A 1RXWA 2A33A 2C2YA 1UFVA 3KT0A 3KUXA 4NBWA 1U90A 3RT1A 2VQSA 2J30A 2ZWOA 1E6EA 4Q0MA 4QE3A 7REQA 3FPAA 4ERNA 2AT1A 4DSOA 4AJNA 3I52A 4E51A 4DDWA 3RROA 2E9SA 3W8DA 3R1IA 1T5IA 5C8YF 1CY6A 5GPBA 3DLHA 4TYWA 2W98A 3FYSA 4KGVA 3IBCA 4XOIA 3IEUA 1UF9A 2NU8B 2I2DA 4DG8A 4RA9B 4GEGA 5F7ZA 4R2IA 2XUKA 3ID6C 1FP6A 3NHAA 3TKLA 5E38A 4A2CA 2JLQA 3Q1LA 1SKMA 3C8DA 3LCVB 3UHOA 3DAFA 2CNOA 4E3ZA 1ORTA 4IEEA 2PMEA 3I6MA 3HYNA 4MRMB 5BUZA 1Z36A 1Q0PA 4FTWA 4QEKA 3P9RA 1OTYA 4GM4A 4J94A 3RGWS 1W1WA 3KKLA 3M6AA 1NF3A 4JNCA 2QUZA 2O4CA 4PO1A 3SYLA 5CDYA 1FYFA 4UBMA 1EUZA 3OD5A 3RCBA 3V7WA 1ND6A 1W1IA 3B1VA 1VE1A 3CNOA 3IFSA 3LP5A 5TX7A 1GZ5A 2P9TA 1AU9A 4B3GA 4QNNA 2C77A 2VJBA 2O5RA 4CF7A 5HOQA 5EG5A 3FFBA 4W5WA 1S4QA 4G1EB 4G81A 1KZ9A 3ZZTA 3GQBB 4UDYX 4HVLA 3F5SA 3C3EA 4MRMA 1A69A 3RTEA 5EJ7A 1UEJA 3MCVA 3I39X 1ZX1A 4DKJA 1U6JA 3DTVA 1L7DA 2NXWA 3EISA 2J48A 2PUCA 1DPGA 1SUBA 2XZPA 1KDVA 4JI8B 4GS5A 2JFZA 1NATA 1J8VA 3NFRA 3ZYZA 2HZBA 4LISA 1IFXA 1EQUA 4O3MA 5ED4A 2NPIA 3RKSA 1UDBA 1W0CA 2J33A 4FHGA 1WVMA 3GMTA 2WSLA 4TRRA 2QGNA 5FL7A 1VJDA 3K0BA 5CLLA 3HSYA 1NURA 1IYZA 3TBFA 5B1HA 4QLAA 3GLVA 1GQ2A 2YZ2A 4ZI3A 4M8NE 3R7BA 3I30X 3UEOA 3ZJVA 1O5OA 2MSNA 3GGOA 3GUHA 1JDZA 4WX2B 3TNLA 3KVVA 1D09A 2VLBA 2BZSA 4GDMA 3QSYA 1E2UA 3EZYA 5HR5A 2DQYA 2YOGA 5K2OA 1FQJA 1Y6FA 2CNWD 1QRTA 3KWLA 2C97A 3KVOA 4CIWA 1IEWA 2HSZA 2IELA 4L4YA 4MVJE 3S8YA 2HQBA 3OF2A 3ECSA 4H0FA 1KFKB 1EFDN 2EQAA 4GRIA 4J1SA 3VR4D 2OEPA 2EJVA 4UHJA 3VR5D 3Q0TA 1LCIA 2I9KA 2IITA 2PEZA 2XE8A 1JQAA 2W37A 5AW6A 5KYKA 2O8BA 1M6NA 1SVLA 2SKCA 1C9KA 1CQZA 1SNYA 3AO0B 3ZCRA 2CHFA 4CM3A 1ONOA 2WWWA 3W3AA 1U8EA 3H1PA 3N7TA 3LXUX 3Q8KA 1V8PA 2E4WA 1NVKA 1EPUA 1U11A 3LFUA 2QN7A 2Y67A 5EERA 2OZKA 4G0XA 2WG0A 1UBKS 2CVZA 1G5FA 1U7TA 2QUAA 4LVUA 1UBJS 4QSHA 5CYFA 5FPHA 4IIHA 5FYQA 4HNTA 1CXZA 4O2AA 4RKYA 4M1TA 4GMFA 3F5QA 3VGJA 5JJLA 4ODIA 3BMNB 2OBNA 1SFRA 3ICCA 4PAWA 4QVGA 2GKOA 1VP9A 1FFGA 4UCFA 5EPOA 1RJFA 3KPUA 4ZIRB 5K0CA 3L8ZA 4MRAA 1BCRA 1UPTA 4KIUA 4ZVRA 5BXQC 4WNCA 4N6OA 2K2QB 4QBIA 3DWFA 4R2WA 3SHTA 2GHQA 4XPIB 3VPXA 5DNEA 2RHBA 1QNFA 4UUBA 5BR1A 1K63A 2J6CA 3NIBA 3CZ4A 3AC0A 4D8XA 2ZM5A 3FSGD 1JIXA 3AZOA 1FL9A 1WV1A 3LT0A 4G5FA 4YUZA 1E3QA 4QJ4A 4XIFA 3DKRA 3HKDB 4TQGA 4AMYA 3IC5A 4DMFA 2JCGA 3ZKWB 2IYOA 2QLFA 5DZSA 1S3FA 2FG7C 3DV2A 4X71A 5IDVA 3W8EA 3IMCA 4DC9A 4DWJA 1JJFA 2VNJA 3TZCA 4ABTA 2I22A 5AJHA 1Z74A 1VCNA 1X7WA 2O7NA 1VA5A 1TRKA 1PRYA 2BMWA 1KAHA 4IO1A 4EW2A 1TCBA 3HJCA 4EYSA 2JB9A 3GUCA 4PC6A 5F7XA 2OCXA 2OMKA 3EAQA 2ZRBA 3HJBA 3KZXA 2X0DA 3TE6A 1L4FA 3WGTA 1ZD8A 4QOFA 4ZU6X 4X1OA 2ID9A 3ZS8A 1C7RA 1IZ0A 1Q57A 2E48A 2OOKA 4BLTA 4EYKA 2JGDB 3MGGA 1G8HA 2CD9A 3ACDA 1KVUA 5ES3A 3SLRA 3SOPA 3HKDA 4IFIA 4CGYA 5L3VA 4IUCS 2HD4A 1FRQA 1RI2A 4LQ4A 5CYGA 4DVGA 1E3LA 1MB4A 3L07A 3GLSA 5LXTF 1ZBQA 2PJDA 3EBOA 4M1EA 4BX9A 2PS3A 1Z5OA 1VHTA 5ETJA 2E18A 4NX2A 3STTA 5AVTA 3OMXA 2VK4A 1FW8A 1ZH4A 2C4NA 1DADA 2C00A 4QUKA 5K20A 1DQYA 3C3PA 3L4EA 4AYTA 2LNDA 3NDPA 1U31A 3MRXA 4EM6A 1C7FA 4B74A 2CXTA 4KMSA 4KH0A 3RC1A 4BNMA 2JW5A 2HWWA 2VN8A 5YASA 2D2VA 3VZSA 4CG0A 1YDWA 1XCOA 5CLGA 5E7IA 1Z8DA 5AWFC 3TAUA 2WVAA 4MW9A 2XHZA 5HKKA 2XWPA 1PLKA 5CCBA 1BW9A 1Q2XA 1GR0A 4Y6PA 1AUVA 1TM3E 3ZTTA 4OIMA 3M6VA 3DQPA 3C1AA 5AQ1A 1U9ZA 1Q15A 2GZSA 3SF8B 1GU7A 4RESA 2VTVA 1TJ3A 2NUPB 4OAOA 3WGQA 5LLTA 4NE2A 1F3OA 2FFJA 5IHXA 2A5LA 1HDIA 2H1CA 5DRTA 3K1AB 2M98A 2F9LA 4Q24A 4NE9A 4TMYA 4DE5A 3O4HA 4MDEA 421PA 4TXHA 4GG1A 3LL7A 1ZICA 2XE7A 2Q27A 2GFHA 4HAYA 3WFIA 4C7OA 1DI0A 3QFHA 4ND4A 1DARA 2QL6A 4MVJG 1MC4A 1KWKA 4W1QA 5JNLA 1CNMA 2HU5A 2B1QA 3WHKA 3WKAA 1UZUA 1RP7A 2JKZA 2XQIA 4MPRA 3TL3A 2CZQA 5GTDA 2W43A 1U3WA 3BQNB 1GSIA 3I2GA 1NHGA 3QVGB 4FX5A 3B89A 2J3HA 4EDFA 4CBVA 4DDMA 3NS7A 4GMDA 1FVHA 3WQBA 3T3NA 2AUMA 4IDGA 3K0EA 1KAQA 4MVJA 1TIPA 4BNTA 1TJ4A 4RFVA 3RW9A 1NBWB 3IV6A 4X7RA 4YJKA 5A4JA 3X1DA 1KDPA 3KHSA 5IBRA 5HKOA 3QXSA 5B6IA 3OM1A 4CT0A 3ZLVA 1SHJA 5JZMA 3R0JA 5E0KB 5G4LA 3HVRA 1O6FA 1YDFA 2O3RA 3N87A 3WQSB 2FX5A 4NU6A 4F4FA 1HRKA 1OPRA 1ZZEA 4BFVA 1F2UA 1JQJC 5A6VA 4BX3A 5HX7A 4RETA 2GFQA 1CCWA 1Q0RA 4MB6A 3T94A 2MOKA 4BL5A 3KC2A 1WB9A 4ESOA 1Q1BA 2WJVA 3LBHA 3U62A 3WYFA 3UFXA 1NBMD 3ZK7A 4NJOA 5KBYA 4INZA 4CTOA 4KWEA 4GMKA 5HFJA 2VF8A 2D00A 3PUIA 4QBHA 3QQ5A 4LY3A 1BX0A 4INJA 2HU8A 4B40A 3T5GA 4X1KB 2HCBA 3EG9A 2CLFB 3ZWKA 2IODA 1VE7A 1RWKA 4ZV9A 1QFYA 1SKAA 1VHDA 2DHQA 2VP9A 3GFOA 3Q9UA 2H5LA 1XZ8A 2GCIA 3KUDA 4H7IA 3RNLA 3GQVA 4YMLA 1EESA 1NI3A 5BSUA 2TMYA 2ZGVA 4DUGA 2JA2A 5AHRA 2HIAA 2GRJA 4Y6LA 3RODA 1Y5IA 5ICCA 4D2IA 5I9NA 2FHSA 2C3YA 4QYSA 4NCIA 5FI5A 2YJZA 1THMA 1AHPA 1NY6A 2REOA 2YFQA 2YS7A 1IBCA 3A14A 4KKVA 3E18A 3K5HA 3RFXA 3C8ZA 4OFWA 8OHMA 1PGOA 1JEDA 3GT4A 4H4CA 1R3UA 1YE5A 4YV1A 2X9LA 4DNOA 2PVSA 3GQBA 3VYWA 4NJMB 4FWTA 1N5RA 1Z3IX 3UB3A 3AIKA 5JDIC 1N9GA 2W2LD 1F20A 3LKBA 2DTEA 2A6PA 1FQKA 4KXXA 2JIZD 4R6XA 3DONA 1KXJA 4PQEA 4TMXA 2Y0CA 3HRHA 4UCQA 2Q5JA 1Y81A 5DXAA 4D9CA 1O54A 3AYXB 1X8LA 4WCVA 3QBVA 3UWMA 4EPXA 1L4GA 2XTMA 4XKJA 2ILVA 1SXPA 7MHTA 4V3BA 1ZD3A 1DUVG 2DFDA 4KVZA 5AESA 4ICIA 1E6MA 1DPFA 1DXQA 3GWZA 2C4KA 3B5JA 2H1VA 3CW9A 1YMQA 4R1QA 4O4HF 2TYSB 1UJ5A 1P5RA 1LDGA 2PGJA 4MIOA 5JZSA 2IVZA 5TGTA 1GTL1 4FMCB 3GRFA 4W1RA 2GJ8A 5JNVA 2Y6VA 1U7OA 2P67A 2B25A 3C1OA 3I62A 1QFZA 4R4JA 4ZTBA 3Q9NA 5KNDH 5HKLA 1Z29A 3OEED 1EJ2A 4LJAA 5I45A 1AV7A 3GFSA 1R2QA 1LWNA 2L42A 3UATA 2B4KA 2R8PA 1T2EA 3LNTA 3DZKA 2WNIA 1WMSA 4C0WA 1UEXC 1QCCA 3SN6A 2OHOA 3E2PA 2KSQA 2FMIA 4OHKA 3BMQB 4YJ2B 3TTYA 5F73A 3T9EA 2RJNA 1DWPA 1RNLA 1JDUA 1X3LA 3KKEA 4ZXFA 1NLFA 4L76A 2LCQA 3T9AA 3A2KA 4JT2A 1N32B 821PA 3NWJA 3FOCA 2C99A 3TRFA 1XO1A 4OYLA 3QW4B 1S6YA 4P5DA 4Q3DA 5JDCC 4DEVA 2AXPA 1KH1A 3VAYA 5IEJA 2JLSA 4JLAA 3T5PA 2FUKA 2B7CA 4QXQA 5CCDA 3TLEA 1GDTA 2UXCB 1Z0JA 2ID8A 1PZFA 1LV8A 3C5HA 3I1JA 1U04A 4L5YA 4NTZA 3BJEA 1G20A 4LOJA 5BSRA 3L79A 2WJHA 4QGSA 4KACA 3G0CA 1TKCA 3GT3A 4A8JB 2OUKA 2HA2A 3FKSA 1YL6A 3I58A 3MOSA 3BDVA 1INLA 1VYUA 5ENDA 1FB5A 4KXUA 2GGSA 1X87A 1UFRA 1X9HA 2I2WA 4IDHA 4Q02A 5FHQA 2JFXA 2DUUA 2PWYA 3RF7A 1RPNA 3QLUC 1CIJA 4FI3C 3M9LA 4HZUB 2H1IA 4D8TA 3UUFA 2IU4A 1J49A 1JLKA 2FW7A 4CLRA 4JXXA 4WA8A 2QJFA 4ZFNA 5KOIA 4MR9A 4RYDA 1SCAA 1KPIA 4CTJA 5JXGA 3PXBA 4B7CA 1I2AA 1OT5A 5BMOA 5DNAA 3UMGA 5LNK6 1NIJA 3F7NA 1N5MA 2QMZA 5J2UB 2D06A 2L0XA 2HY7A 4ZVPA 4QASA 5I9TA 3SX4A 3VO9A 4DGSA 4DLYA 4FXOA 4Q01A 5BP7A 4V1CI 3D3KA 2B1GA 2P4UA 3BIJA 4LF4B 1PX0A 3EZ9A 1E9AA 4OHPA 1AHIA 3TW0A 2WE8A 3JQRA 3ZU3A 3OF5A 3A1SA 4JLJA 2ETXA 1J8YF 4DLBA 3AINA 4W9NA 5HEKA 3SXUA 3PTZA 4A5SA 2O7QA 4CQMD 2GJKA 1TU0A 2WJIA 5FI0B 1QS0A 3HCDA 4MRRA 5B37A 4ZEWA 4ALLA 4D79A 2WA1A 4GF5A 5ELXA 3FNQA 4J0JA 2CLEB 1L5WA 3BFPA 4L51A 4R2JA 5IT4A 3Q3EA 5K0BA 4NXMB 3U9LA 4MRPA 2BN4A 4GSLA 1PFWA 1L7OA 1UMCA 3DVRX 4EKDA 4ZT3A 5AW0A 5HIMA 2ZWPA 5ALKA 2JGNA 1ISPA 2HDHA 1NOJA 1CQIB 2X0KA 1NPDA 3A4YA 1JYEA 5COQA 2AK3A 4X8OA 4LXTA 4BKOA 3PPIA 3PRHA 4TQAA 4U7JA 4F1WA 5J2TA 1X80B 3FVRA 1B8OA 3IE0A 4BS9A 3JSXA 4C4OA 5EZYA 5SZKB 2FE1A 1OI3A 4GL2A 1TKBA 5CFOA 1VLHA 4HQLA 3T95A 4LGVA 4RMGA 3AOEA 1OGYA 3QTTA 2FPXA 1ZD1A 3PRYA 4DIEA 3ONDA 3B6KA 3QU7A 4EOGA 3ZLBA 4PYJA 3SNHA 1MTZA 3CVJA 3F6EX 2ZITA 1XTKA 2JGAA 2PV0A 3H8WA 3V4OA 3WO1A 4N54A 3RBVA 4DHWA 4UE3S 1NHWA 1K3UB 1T9HA 1ENOA 3RS9A 1GARA 4IV0A 4PRKA 5HF9A 3IIIA 4QLOA 3QVXA 1XZKA 2JD2A 1RCUA 1ZLYA 3ER9A 2A9FA 3IMKA 3OLCX 4YGXB 4IW3B 4ZU1X 2CXXA 2E37A 4HQKA 4TKZA 4AG5A 4W8OA 1XQYA 1YFKA 4MGEA 4FW8A 2N75A 1CERA 1TAQA 2C4WA 2JJ2A 1MJNA 3H3FA 4X5OA 5E9WA 3R9KA 4KXYA 4D3XA 1V8FA 4Q3AA 2OUIA 2W2OA 3R40A 3CBQA 2EFYA 2G1JA 2YRFA 3BRCA 3QJ5A 5JI2E 4UATA 1LPNA 2ZTVA 2Z8ZA 3ZS9A 2FWAA 1ID1A 1TUIA 4ECEA 5LCXA 2N1MA 3ROZA 4JLWA 4DNQA 4NI5A 5I7WA 2X1VA 1WPRA 2KWIA 4KPFC 1RACA 1GAWA 1O87A 3D3EA 3CF4A 1U0HC 1FP4B 5DMHA 4ECAA 1S2IA 2BKLA 2Y4NA 4ZANA 4J3FA 5DP1A 1LNQA 2C5SA 2Z3WA 2FPIA 3OZXA 1U3TA 2RGCA 1X8XA 2PX3A 4YJ3B 4Q9NA 3WSTA 4ZKDA 1ZRSA 3NVMB 3UUEA 2W8BA 1E5DA 3BSSA 3CNBA 4RXUA 1EFRD 4S1WA 3KEQA 4DSZA 3VTZA 5AM0A 3DWIA 1QV7A 2BH9A 3GAFA 3CSSA 4K6KA 5DMXA 2HQRA 4B32A 4NARA 3WA6A 3OIUA 1O0SA 1JEJA 2PMBA 4K1XA 3WWCA 1PLLA 2WIDA 4DLAA 2I3AA 4OQQA 4RU1A 1SUPA 2CYAA 2YHUA 4UNNA 3I5YA 4FJ0A 4UMEA 4XSGA 1J0XO 2OXEA 3C98A 1KAOA 2X7XA 3DLTA 3MWFA 1RLIA 3HXMA 4LF6B 4UULA 4IG9A 2NVBA 1G1MA 3BYZA 3F71A 3GJ0A 2BHLA 3LRPA 3FROA 4D8YA 4K9LA 1JMVA 3VMFA 1N0UA 3I2JA 4ZI5A 3AUFA 1NVVQ 3DOHA 2GPJA 2YVLA 3K20A 4FFDA 1TT5B 3DMDA 4OP1A 2GLTA 4PLCA 4I19A 5IVHA 1JNYA 1MQ9A 2CNKA 1S89A 3HPRA 3MFQA 3TQQA 1PX2A 1T0PA 5BN3B 2XUIA 1QCDA 5CPBA 1G66A 1R8JA 2HHHB 3ZE8A 4ITVA 1XZIA 1J42A 4HYQA 1MG0A 1FDSA 2FFHA 3P45A 4MICA 3ZHOA 1PFKA 1TUEA 1JFTA 1JHPA 1P2FA 2VDWB 2Z3VA 3QOXA 4P53A 2ZI5A 2NTJA 3C2QA 4LOAA 1EK1A 1MEEA 3IELA 3CBGA 2QTLA 3PQCA 4L3WA 1QO7A 1NVTA 2BZ1A 2UYGA 2WSIA 1WM1A 2V7QD 3BMOB 4M0MA 1W29A 1EBBA 4CDMA 1T2DA 4IIFA 1P0FA 4YDHB 2EZTA 1FDWA 4NMLA 3VNQA 4FFLA 3B6MA 1PJ8A 4C29A 5A5VA 5I47A 4MPDA 3LECA 2J6IA 4YO8A 1C9MA 3BA6A 2P2LA 2JLZA 5FNVF 3H84A 3VYTB 3AL0C 4YNBA 4JCCA 3E8XA 1XN1A 1I3LA 4DM4A 1EUYA 3GK3A 1K9VF 4P84A 4UEWA 1KRWA 3AGPA 2KLHA 3S40A 1R0KA 4W5QA 3FTDA 5ALDA 3DZBA 1TMKA 4D46A 1RWBA 3P9YA 1A9ZA 4KITB 4EG8A 2DLCX 4KO8A 2GXUA 4DQ0A 1I24A 1NU8A 4D5EA 2PMCA 3E5HA 4QT4A 5ISMA 2A5GA 2FPGA 2X77A 5HDBB 4AUMA 3QLUA 3BMCB 5A7FA 3PLRA 1J09A 2L17A 3K5PA 4C4XA 4OJYA 2A30A 1N1MA 4PLZA 3WLFA 1TZJA 3A4MA 3OECA 5LA6B 4M0KA 1LK0A 4UQPA 3DAPA 4GX2A 4KBYA 3LWNA 5H81A 5L40A 4JASB 1H23A 2AXEA 3T5AA 1PR9A 3I5AA 1SIOA 1IHXA 1OTXA 2E85A 1C1XB 3ZBTA 4PX2A 2DLNA 1AG9A 4A6DA 1L4EA 4JYPA 5FOXA 1BFUA 4YAJA 5KWSA 4PWYA 1EG7A 3H7IA 3BMQA 2JRCA 4YJ2A 5T4FA 2A0YA 1J56A 2J6BA 4IHJB 4EO9A 4W5RA 5KX5A 2QD2A 4AX8A 4QU9A 3ZDBA 3Q2OA 2WUEA 3PNKA 1GR1A 1EI9A 4OSEA 2A0XA 4B76A 2DWUA 3WIOA 4P3OA 1G2IA 1TMYA 1DO0A 1SQFA 3GX1A 4BE4A 3LQ1A 1H0HA 5CT6A 2HV9A 1ZDMA 1ABEA 4LUCA 1M2VA 2H9YA 2ZBRA 3CUVA 1N8SA 1W30A 3DEHA 4G8DA 3WLRA 1PDWA 5CPFA 3WYNA 1WDTA 4DT1B 3WC4A 1PDVA 2CDCA 3IQWA 2PFKA 4LGYA 4YXWA 4DXDA 3I61A 1Z2PX 2RFLA 1G18A 3KR2A 1XC7A 4QFCA 3RIEA 4C7BA 2H8GA 5FTJA 1WEKA 2ZI4A 1ONNA 1E99A 2IYPA 2SCUA 1AK9A 2EBWA 3A70A 5GJWC 5JAUA 2C07A 3PR3A 4WWHA 3OLQA 3SSOA 1U8YA 2PCJA 4ENVA 1E7WA 4LYAA 2IYFA 2O3JA 1YQWA 1CT9A 1NXSA 2FDRA 3MT8A 5JCOA 5REQA 4DCPA 1M7HA 1NRWA 2ODNA 3L6BA 3ANTA 3WSWA 2Z4TA 4JP3A 2ZYIA 1LDEA 3CUSA 5TEVA 1JWBB 3A6PC 2QW0X 2V4UA 2NSDA 3NGLA 1Q7EA 3OPYB 5ALEA 5JEEA 5JATA 2W6NA 3F1LA 4H3KB 5J2UA 1CIVA 3FLBA 1G9TA 1UKBA 1VFPA 2AC7A 2GCPA 2PK3A 3C4JA 3GUZA 3OF3A 1N1DA 3KPYA 3QX8A 4H18A 1ZAKA 2H17A 2YUIA 1CB0A 3I2YX 3TO5A 4GYJA 4G9GA 4IDQA 5DLQC 1Y0BA 1Q0SA 5DTIA 1M7GA 3RYIA 1QDLB 5LQUA 1QP4A 4G26A 1M5TA 4FYVA 3N86A 3RYFB 1RWVA 7AT1A 4WI1A 1OFVA 2PX0A 3NC0C 4YP6A 4GGMX 1DAKA 4MA4A 4MQ5A 4P38A 1ECCA 2F1JA 3REQB 1Q0ZA 2XVZA 3LCCA 2NXNA 3AB8A 3IVMA 4LJYA 2B8NA 2J07A 5B58C 3FCOA 3BB3A 4D80A 4BNDB 3FB1A 3PJGA 1GGFA 2V74B 3IJ5A 4I4CA 4QPPA 3S81A 3OZIA 1C4XA 3OWOA 5F64A 2WVHA 2FR1A 4HN4B 1KZ7B 4BO3A 3VC2A 3PHGA 3ZK9A 4XGRA 5FWAA 1FVOA 1GPH1 4DG5A 4PZZA 4Q9IA 3D6HA 3VHLB 2XE4A 1RHRA 2DKNA 2QSJA 4BO0A 3ZBUA 4AJPA 2B2XA 3BPSA 3DE1X 3DD5A 1RC8A 4GYWA 3I04M 4CI0B 1ZI9A 1G3UA 2O23A 1KSHA 4QNMA 2AC2A 3S28A 1JPUA 1VC2A 1Q14A 3VTKA 1QG4A 2V97A 1XEXB 4MOWA 4IGIA 2JLBA 3EHEA 3F7OA 4W8GA 5K6RA 1UMDB 2EJTA 4C3OB 4GBED 3MWKA 2RGXA 3H6KA 1SBTA 3QHAA 4YJGA 1LW7A 4L4UA 1QC5A 2QJWA 1VMKA 5K0NA 1UK9A 3N05A 4HUTA 4MV1A 1UEIA 2W6CX 1YIAA 4AUNA 2BDUA 2CMFA 2YKGA 1BAPA 1TZMA 1EFKA 1E2KA 1D7OA 3GLGA 3BD6A 3LY5A 1RWMA 3SZGA 4BWVA 1Q11A 4G9BA 1Y1QA 3SK0A 1Z18A 3ADKA 3FYDA 2UVPA 3KKQA 2GZ3A 3WGLA 1DDIA 2PU5A 2WF6A 4QYIB 2WWFA 5JSZB 2I3GA 2CHVA 4OLJA 3QVUA 2W2MA 3GP5A 5K0JA 2CMKA 1RC1A 3WJ7A 5K0FA 1XMOB 1UMDA 5AJYA 4W63A 1KEEA 1T25A 2RK3A 3AFIA 1B2LA 2LKCA 3FLAA 3FAKA 3WB9A 2IS1A 1NQXA 3GZ4A 3V4SA 2WMYA 3SS7X 3HYRA 1HV8A 1JEYB 3C14C 2MU1A 3IUJA 3NHBA 4QQRA 3ROXA 4W5JA 4EDHA 3F6BX 1K68A 1LBSA 1ARZA 1M2OA 2HDWA 2YBEA 3ENKA 3NBQA 4HF7A 4NULA 2H7YA 2OYSA 4NENB 5KKCA 1K2VN 4FR0A 1L1RA 2VP2A 4OEHA 3CJRA 4ZT4A 2P5TB 1O8CA 3B3QA 2DSTA 4W7SA 5KJCA 2O54A 3RIYA 4B85A 1KY5A 2DG2A 2IU6A 2PGDA 2X8BA 2REQB 4ZQFA 3DDSA 1OXUA 2LDXA 1BEEA 2YWDA 3DUWA 1H2EA 3HXLA 1G55A 4N6NA 3OESA 1RT9A 1Z6PA 5F33A 5AXCA 3K73O 1TA0A 1XCMA 3JQ7A 4LDRA 3PVZA 3DHWC 3D02A 1GQFA 1G1AA 2CD7A 2YH2A 1MQ8B 3H1EA 3IPYA 3RQSA 3ES9A 4ROTA 5AKXA 2HRDA 4MNTA 4RE5A 2NVOA 3WV5A 3SM9A 3A9CA 5C3MA 3GMIA 4JVOA 4RNDB 3W5UA 4EABA 5AK6A 5DX8A 1ISJA 2JGEA 3OEEA 2RONA 2GFIA 4NICA 2QT1A 4F71A 1PNOA 1J8QA 3DEJA 2VKQA 3QGMA 5EIEA 3PQFA 3V8BA 3A4IA 1VCOA 5C0OE 3AUXA 1EEXB 1TMGE 2N0SA 2HI0A 3ORRA 4LNAA 1HO3A 5BN3A 1BYUA 2JLCA 2P0YA 2QV7A 1S96A 3C3AA 1JVSA 5EJ5A 5C51B 3CRQA 3FR8A 2FZCA 4DYHA 1RBYA 5T41A 1P3Y1 1CY7A 3KLMX 2HJVA 4XQCA 4R1LA 4NBRA 3G0BA 1WQ4A 1P5JA 2QPLA 4GL4A 3NPAA 4URWR 2BGNA 2Q2WA 2GETA 5LOVB 4TLLB 1MH9A 3S1LA 5LQCA 1JKJA 2I8LA 2KQUA 4X91A 1M2FA 3HYCA 5E6SB 3RQIA 3RR2A 5A6SA 2YVAA 1UH5A 3DR5A 4O5AA 4X66B 3AEUB 4MJ3A 1UT8A 3WRXC 4EHKA 2HWKA 2ZUWA 3AHFA 3VZPA 1DCFA 1JFVA 3WY9A 3KOOA 4ARZA 4P4NA 4I4TB 5KNCA 3F4BA 1VLQA 4OTZA 1BVHA 1XDWA 4IUYA 4KBFA 2QRQA 4LYYA 4I5DA 1PJZA 3TR0A 3AVTA 1ZJ6A 3OWHA 5EAIA 4CMEC 2XE6A 4DA8A 1T6XA 1OOEA 4F45A 2AN1A 4XTCS 1XMQB 4OQ4A 2JHGA 5EIOA 4LCEA 2A1TR 3ZWAA 3RK4A 2HBQA 3HLTA 2W2KB 2YX1A 5A62A 1ZJWA 3NIDB 3JVDA 4NMMA 4CIVA 3WK7A 2CYCA 2G0NA 5KNBA 3BQ9A 4FMCF 3KR0A 3VNVA 2NTNA 3DE5X 1EFLA 2VJNA 3QLTA 3E05A 4DMRA 1OX6A 5DTRA 1LW6E 2VYVD 3MEQA 1ZC3A 1EVQA 3LT4A 2EFDB 1E9BA 4RJLA 4YIKA 5IJ9A 3M70A 2YWXA 2V3VA 3O90A 1UPAA 1VG9B 1QK5A 1EFVB 1WULS 3FGNA 1QMGA