4OA8A

X-ray crystal structure of o-methyltransferase from anaplasma phagocytophilum in apo form
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
214
structure length
214
Chain Sequence
SLSKQDEYLNKLFAVDTEGALKAHKTAPSELRMAQLGTVEGQMLQLLIRMAGIHSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTANQNIVNCKLEDKITVLHGEALAQLNTLKEMAPFDMIFIDANKSSYLAYLNWAKMYIRKGGLIVADNTFLFGSVFDEHPTEKVSSNAHASMRAFNDELANKEKYLSTIIPTSEGMMVSIKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords O-methyltransferase family protein
publication title An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.
pubmed doi rcsb
source organism Anaplasma phagocytophilum
total genus 76
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4oa8A00
4OA5A 1X1DA 3ANXA 5BW5A 5DLYA 2B3TA 1FP1D 3NW9A 3SMQA 5HEKA 3A4TA 2IGTA 4F84A 5JR3A 8MHTA 3Q7EA 1ORHA 2IPXA 3TQSA 3MGGA 5LSAA 2O0LA 3G5TA 4EVIA 5EOVA 3REOA 3BGDA 3QOWA 3A25A 3P71T 3SM3A 2PKWA 2JH9A 3T0IA 2BR3A 3IHTA 2YQZA 3A27A 1QAQA 3IV6A 3KPYA 1F3LA 3M33A 5T67A 3SGLA 3TKYA 9MHTA 4E2YA 1YUBA 5DXAA 4MQ4A 3EVFA 3MAGA 3BUSA 5FHQA 1WS6A 1AF7A 5FQNA 2PV0A 2Y1XA 3GO4A 2OYRA 3B3JA 3BWCA 1T43A 4AZTA 1AV6A 2HNKA 1RJDA 1BOOA 4JXJA 3EEOA 1N7IA 3EVGA 2FRXA 3DXZA 1NW7A 3UBTA 1KXZA 1IM8A 1UFKA 3DOUA 4WXHA 2UZ4A 2PT6A 3UJDA 4BP1A 4FT2A 2PX5A 3FYDA 1MJFA 4E2ZA 4FS8A 2V74B 1NW5A 4LG1A 1UWVA 2LD4A 3M70A 1R74A 1VIDA 5K0BA 1SQFA 3KQVA 2A14A 5K0CA 3OZTA 3CC8A 4E2WA 3AXSA 3G2OA 2BM9A 2XBMA 5CM2Z 5EIWA 2P7HA 2CWWA 5EMKA 3KR0A 3HVKA 5LQKA 3PX3A 1ZG3A 4Z2YA 1N7JA 1N2XA 1G6Q1 3CJRA 3EMBA 3GIWA 3EVEA 1ZGAA 3RW9A 3I5UA 3UJAA 3KR2A 4RVHA 2NNWB 2YXDA 2P3LA 4AZSA 2EJUA 3GRUA 5EKXA 5HIIA 5T64A 5K0EA 4FSXA 1XVAA 1TW2A 2F8LA 2VP3A 4GUAA 4FP9A 3UA4A 5HZMA 4QPNA 4HG2A 4MTLA 5GOZA 2PXAA 3FRHA 3P9IA 4RTMA 3P9NA 3MCTA 3HA7A 4YV2A 3LHDA 4C06A 4CTKA 3FUVA 4PCAA 4KWCA 4X61A 3LCVB 2PGXA 4XUCA 4PCLA 1PRYA 5FHRA 2PT9A 5KYGA 2G71A 5KQSA 5DPMA 2ZWVA 2OKCA 1SUIA 1KP9A 2JH8A 3FRIA 1L1EA 1O9HA 4P7KA 3B89A 1KR5A 4RTOA 3O31A 2GLUA 5IH3A 3UJBA 3ELWA 3ORHA 5E2BA 3G2PA 5EHGA 5HOQA 4R6XA 3H2BA 3THSA 1JTEA 1X19A 3FPFA 3HVHA 3OZRA 2UYOA 1JSXA 3MTEA 1Y8CA 3FYCA 3DMHA 1EG2A 2QY6A 1EJ6A 2EG5A 3GRRA 3KQPA 5K09A 2IH2A 2PXXA 2VZ9A 4YUXA 3MCZA 2Z6QA 2H00A 2KW5A 5K03A 1NW3A 4DQ0A 2ORED 3HCDA 5DX8A 3HCCA 5FQOA 1I9GA 3KU1A 5E1BA 1DCTA 4GC5A 5CVJA 2CKDA 4KDRA 3DXYA 2FCAA 3KKZA 3MB5A 2CL5A 3BWMA 4PNEA 5FCDA 2AOTB 3FTCA 1NBIA 3LKZA 2BR5A 4QQNA 1XTPA 2PVCA 5DM1A 1R00A 4RX1A 4RTQA 1TPYA 2B2CA 3O7WA 4HGZA 3KPWA 4CTJA 1WY7A 5GIPE 1YFLA 3BT7A 3E7PA 2C7OA 5G02A 1TW3A 3KPVA 2XVMA 1HNNA 3EMDA 5K0FA 5DXJA 3VC2A 4HTFB 3HCAA 2C7PA 1EJ0A 4U7PB 4QPPA 5EVJA 2QRVB 4DCMA 1JTFA 1XCLA 4C4AA 1P1BA 1P1CA 2ONYA 2PX8A 3KPJA 2Y1WA 1JG1A 3G2QA 4YV1A 2AOWA 2H11A 3P9CA 4FSDA 1L3CA 4PIMA 5LQAA 3LDFA 5FWDA 3SXJA 3FZGA 2AN3A 4PGGA 1BHJA 3V97A 3HA5A 3TFWA 2B9EA 3A26A 3HP7A 4YMGA 2OXTA 1XXLA 4A6DA 3FTDA 2Z6AA 1D2HA 1JG4A 1FPQA 2HTEA 3LCUA 1P91A 3AY0A 3LL7A 1JG2A 3X0DA 4ER3A 4QQKA 5EQJB 5EKUA 1Q0TA 5FADA 3GNLA 2EFJA 1KPGA 2ZSUA 5F2OA 1WXWA 4RV9A 3I9FA 1R8XA 2YTZA 3OU6A 3KQOA 2AOUA 4RTJA 3WSTA 4HSGA 2AS0A 5DT2A 5CVDA 2XYRA 3NWBA 2IBTA 3NWEA 4R05A 3G8BA 1KPIA 1XJ5A 2GAFA 3FPHA 4E70A 1G60A 1NKVA 2JG3A 3EGIA 4KVZA 4LECA 2N47A 3EGVA 2P1DA 2AOVA 3Q87B 1HMYA 4RTKA 1INLA 3M6VA 4Y30A 3OE5A 1XDSA 2VDWA 3IYLW 3DTNA 4QTUB 1JQDA 1EQAA 4IWNA 2K4MA 4ER5A 5IKMA 2ZW9A 2PX4A 4QDJA 1RI2A 5LQNA 5ICEA 5GINE 3G89A 4BY9E 3P2IA 1QANA 3B7PA 4PONA 2ZBRA 5T6BA 3FUWA 1ZQ9A 4BP3A 4PYOA 5FA8A 4M7RA 4F86A 2UYQA 4NECA 5EC8A 4YUYA 4XUEA 2I6GA 4QTTB 3U81A 1VP3A 1SKMA 1X1CA 3HTXA 5DTMA 5BP7A 2OB2A 3PX2A 4R8SA 4ER6A 2ZBQA 2NXJA 2OBFA 5CVUA 4KIGA 3DXXA 3R0QA 3DMGA 3CJTA 5KVAA 4GQBA 2UYHA 2ZVJA 5D1HA 4RTLA 2P35A 1X1AA 1QZZA 4V0RA 4LWOA 4HRAA 4DKJA 2YVLA 3LECA 3LSTA 2EX4A 1AQJA 1B42A 2GA9A 4BLWA 3DULA 2EJTA 1ZGJA 1FJXA 3CBGA 3UA3A 3BZBA 5DRYA 3PVCA 4DM3A 3HCEA 4E33A 3R6TA 1G38A 1ZHFA 3KPUA 4C05A 5DSTA 3CGGA 3BXOA 3OE4A 4ZTBA 3C6KA 5GM1A 4EKGA 4X60A 3I64A 4PINA 3THRA 3P8ZA 3TPZA 2I62A 4X41A 4YV0A 4RWZA 1L9KA 3L8DA 1BC5A 3EGEA 1KYWA 2AZTA 1DL5A 4HH4A 3DMFA 3R24A 2OZVA 4FGZA 2I7CA 4OBXA 3NMUF 1BKYA 1VBFA 4XUDA 1R6AA 4C03A 2C7QA 5EEHA 1KHHA 4GOMD 2QM3A 1YZHA 3G8AA 10MHA 3EVCA 3C0KA 4OBWA 4AZVA 2R6ZA 4GOLD 2G72A 3JWJA 2O06A 1EAMA 5DM4A 4RVDA 5E1OA 1VPTA 4M37A 2CMHA 3M4XA 5LR6A 3CKKA 3OFJA 2WA1A 1JQ3A 3NDJA 4U7TB 2R3SA 5EEGA 3G7UA 2E5WA 3GDHA 3RODA 5DSXA 2O07A 3CCFA 3SX0A 4MWZA 4PYJA 3LDUA 5E9QA 4M36A 5C0OE 2AN4A 2GH1A 4OQDA 3FPEA 5KQRA 4R8RA 1ZKDA 5EHIA 3ERCA 3OU2A 2P3QA 3FUXA 5LQUA 5U4XA 3G2MA 4RSRA 3E23A 2HWKA 3A7DA 1G55A 2ZTHA 3ER9A 3B3GA 5CCBA 1I1NA 4KIFA 1VE3A 4RTPA 2O57A 3P9KA 2FK7A 5DTQA 4X1OA 1YF3A 4C07A 2QYOA 1M6YA 3C6MA 4GOOD 3MERA 3SSNA 4AUKA 3KR1A 2NP6A 3BGVA 3C3PA 3MHTA 1O54A 2JJQA 1G8SA 5FULA 5HIJA 3TM4A 4BLVA 2PLWA 3KQQA 3KQTA 2AOUB 5EMLA 2I9KA 4DF3A 5E9WA 2BR4A 1D2GA 3CVOA 3EVAA 3K0BA 5E1MA 3NVKI 2ZIFA 1L3IA 4C08A 3T7TA 3EEYA 2AVDA 3EPPA 4UOEA 1DUSA 2OPBA 5JUWA 4PYIA 2G8NA 3LBYA 3AWIA 3LGAA 4YUZA 3SVZA 5CIYA 1I4WA 3GXOA 4M38A 4GBED 4RTNA 1F38A 3B3FA 3FTEA 5EMJA 1FBNA 1M6EX 3M6UA 4KW7A 5E8JA 5GM2A 5HFJA 4CWAA 2IIPA 4DCGA 5GWXA 4MHTA 2P3OA 3DR5A 3NVMB 5K0GA 4LWPA 3ER8A 1X1BA 3ELDA 2ERCA 3LKDA 3NDIA 2DPMA 1SUSA 4XCXA 3LPMA 5DM2A 5ICGA 2P40A 2OY0A 4DZRA 3PFHA 3OFKA 2H1RA 4P7FA 3EVDA 2FPOA 3I53A 4X63A 3FTFA 2HMYB 1SQGA 1JSZA 2ONZA 1QAMA 2AOXA 4E2XA 4C04A 3DUWA 2P8JA 3OZSA 5K0JA 2ZZKA 2ZWAA 3BKXA 4BLUA 1D2CA 3B5IA 3PFGA 3UJCA 4FZVA 3GRZA 1Q0SA 1YZ3A 2PX2A 4RVGA 3HCBA 4E32A 3C3YA 3DH0A 3HVIA 3UJ7A 3DLIA 1YFJA 1WZNA 2PY6A 2VDUE 4PIPA 3AJDA 1KYZA 1VQ1A 3EVZA 3FPGA 5CVEA 1WXXA 3ELUA 3PLAE 1VLMA 2ESRA 3TOSA 2ZIEA 2IDKA 5C1IA 2HR1A 1RI4A 2P41A 3QOXA 5EZSA 5KS2A 3E05A 1NE2A 4EQZA 5F2NA 2B78A 3RIEA 5LQRA 4DA4A 4F85A 2PWYA 3M6WA 1U2ZA 3GRYA 5EZQA 5LQJA 1NT2A 5E9JA 5M5BA 5DTRA 5DWQA 1YB2A 5ICFA 5FTWA 3AXTA 1FP2A 1SVUA 2JHCA 2XYVA 4POOA 2ZCJA 2YXEA 3SSOA 4E31A 3UJ8A 3S68A 1Z3CA 5K8VA 4RTRA 7MHTA 1IY9A 1RJGA 3D2LA 3P97A 4IV0A 5GP1A 3VSEA 2GS9A 1QAOA 4A6EA 4EK9A 4ER7A 3UJ6A 2Q41A 2ZULA 1L3BA 2IH4A 2XVAA 4DMGA 2WK1A 3OPNA 2AVNA 3KQWA 4H0NA 4IV8A 3M6XA 2XYQA 4QDKA 3R9XB 3R3HA 2BZGA 4G56A 4GC9A 2YXLA 4KRGA 4OQEA 4PYNA 5EMMA 3UZUA 4OX9Y 3GWZA 5EG5A 2C7RA 1NV8A 1EIZA 1RI1A 3O4FA 3SR4A 3G88A 3NJRA 5CD1A 5CVVA 2AR0A 2JHAA 3HEMA 2G1PA 2FK8A 5EPEA 3JWHA 3VYWA 3LBFA 2IBSA 2VDVE 2OB1A 1JG3A 1QYRA 1MHTA 1XDUA 3I58A 3TRKA 3V8VA 2OO3A 4CKEA 1M0EA 5K01A 4GF5A 2NP7A 4RYLA 4ER0A 2V7EA 3ME5A 4E30A 4P7GA 1IXKA 4EKIA 3QV2A 2UYCA 3DP7A 3FUUA 4MIKA 2ADMA 4YMHA 4P7JA 1VL5A 4PYKA 3UWPA 2ZLBA 5C9ZA 1AQIA 1RI3A 1NBHA 4ATNA 1KPHA 1XDZA 2B25A 2BM8A 1JR4A 2ZBPA 2ZIGA 3LCCA 2GB4A 2PJDA 2P7IA 3KQMA 3KQSA 2HV9A 3LX6A 1H1DA 3PT9A 4GEKA 1SG9A 2DULA 4RVFA 1O9GA 2ZFUA 4HC4A 1ORIA 4PYQA 3IEIA 2G70A 4PWYA 2ZZMA 2PBFA 2FYTA 5ERGB 4YUVA 3MTIA 2PWPA 3ID6C 3KR9A 1V39A 2IDJA 5LQCA 4GOND 1VP9A 3HNRA 4K6MA 1OR8A 5BXYA 2IH5A 2CMGA 2ZZNA 3FPJA 5P8WA 4Y2HA 3TMAA 3UFBA 4AX8A 3PS9A 2VS1A 1RI5A 3LDGA 5D1NA 3P2KA 5CUQA 2PXCA 3GGDA 2IFTA 4FT4A 5DX0A 1XCJA 4IKPA 2YUIA 3F4KA 3GCZA 2NYUA 2YR0A 5EIFA 3TKAA 4V0QA 4CXMA 3T7SA 4CKBA 2BH2A 3G5LA 3HA3A 5F2KA 5FUBA 5HIMA 5ICCA 3CJQA 3MQ2A 4QVGA 4PYMA 1PJZA 1NW8A 3T7RA 4CKCA 5HIKA 5FA5A 2NXCA 2WA2A 5FWAA 4O29A 4PYLA 3GRVA 2Z6UA 2O05A 2IP2A 5H02A 4YUWA 5K05A 3A7EA 5BW4A 4AZWA 4HGYA 3OU7A 3TLJA 5HILA 3TR6A 4OA8A 1NV9A 5CCXA 4L7VA 1G8AA 1R8YA 3BGIA 1RJEA 1RJFA 3GU3A 3KQYA 5EGSA 3SSMA 2AN5A 5B1SA 2GPYA 3DLCA 4RTSA 2NXEA 4EMSA 2AOTA 5DRTA 3TM5A 3E8SA 1NW6A 5GIOE 4ISCA 3NTVA 5K0NA 2JHPA 3BWBA 3FUTA 3GJYA 4FR0A 3KHKA 1P39A 2FHPA 4P58A 2PSSA 5DM0A 3P2EA 5E2AA 3UJ9A 1KIAA 2NXNA 3EVBA 5E1DA 3K6RA 3JWIA 3OCJA 5K0LA 2YX1A 4WVLA 3VC1A 5E8RA 4HTFA 3BKWA 3HCFA 5MHTA 4PGHA 1JQEA 3HM2A 4KDCA 4QVKA 3PTAA 1WG8A 1R18A 1UIRA 2QRVA 3HVJA 3JWGA 3PB3A 2QE6A 4B17A 4R6WA 3BWYA 3ELYA 5DX1A
chains in the Genus database with same CATH superfamily
5A3VA 1DFIA 1ZCAA 3PNVA 5JBQA 1I8TA 2JCVA 4B4DA 3SQXA 2IOFK 3PC8C 4F8EA 4RV5A 3USZA 3RLIA 2IGTA 1X74A 5EGNA 3SC2B 1KH3A 5LSAA 4IFEA 3C3XA 2AGVA 3PNBA 2YC4C 5A0FA 5HJ2A 4Z1OA 4XPIA 4YFYA 5BRJA 1HV8A 2RG7A 4ZQEA 3U80A 3A31A 1QG6A 1XJ0A 3A27A 4KGVA 4OHWA 3TKYA 2I6SA 1G3QA 4O5OA 3H2SA 1JL3A 2H0QA 3BMQA 3H6KA 1H2YA 5TEWA 3EEBA 4HWGA 2XW6A 5HHTA 1SWWA 3P9SA 1G20B 3B9RA 1ZUWA 3AHCA 1IHUA 4EQ6B 1S2LA 1ST2A 1Z7YA 3MK31 4HAIA 2Z2XA 4ZEWA 1RCTE 5BVHA 1Y5LA 3DXZA 2C2KA 1RQGA 3C5WP 1X8XA 1OA0A 5L95A 4QU5A 4EH1A 4GXNA 3CW9A 4CKEB 1HYQA 4ZZ0A 4LK2A 1FX1A 5BV2P 3D8NA 1Y8AA 3L06A 2A0XA 4Q4CA 3EW7A 1R74A 2W90A 4PRYA 1YB7A 4O63O 3G2OA 2PK3A 5GMOA 5EIAA 3AM4A 3GCWA 4V1CB 2CVZA 3Q8WA 4XSVA 5EIWA 1Z5VA 4PHCA 3HCPA 1KP2A 1ZJ6A 4N5LA 1GL6A 3AI3A 2FP4A 3RV4A 3MOIA 2RJ3A 4DVJA 2RH5A 1Z6GA 1FRZA 1Y7IA 3LP5A 5FLYA 3BH7A 2I91A 3KKLA 3E1GA 3AP3A 3WLQA 1BTOA 3AKYA 5JCPA 1AN0A 1U4OA 1G3RA 1YRHA 2ATEA 3Q85A 3GJ0A 5HZMA 1OREA 4MKXA 4YCBA 2YRWA 1O89A 1OMOA 4MB2A 2ODWA 5TMBA 2RSLA 3OEHD 2J6HA 4Z51A 2JI8A 3D2CA 3W4JA 1WZEA 1S2DA 2QUHA 3KVOA 4J2HA 4LZAA 5FHRA 1JHAA 2JKYA 1I5OA 3PQEA 3NRCA 2MCFA 3WGUA 5DPMA 2W48A 3ESRA 1ZL2A 3M34A 1Z2DA 2QRKA 1L1EA 2Y1FA 2HHJA 4Q47A 4RD6A 1Z8DA 1NR1A 2FR1A 3C8MA 3GROA 3NKLA 1JEQA 2QD1A 4TQUS 5IH3A 1ZAKA 1YASA 2JD1A 3D8UA 2O9JA 3IUBA 2TSYB 4AMVA 3L02A 4B3BA 3ZTYA 3RSZA 1ZD5A 2X9GA 3THXA 4LKOA 2GCOA 3MOGA 5HFAA 3KL4A 3GJQA 4OOEA 2IH2A 1DIBA 2VOJA 2QJFA 1NIPA 3IPXA 2VQ3A 4UHJA 3I1JA 4CR8A 4RD0A 2X2EA 3W5DA 3WRXA 1MH1A 2XY4A 4W8HA 4XDGA 4Q9JA 4ZHQF 2FOLA 1R7RA 2C2MA 1E3WA 4IRXA 1XG5A 1X38A 5DGCA 4EFKA 2ODNA 3UMGA 4W5QA 2G8LA 2WKPA 1NZJA 2OGUA 3AUSA 4J3FA 4KN8A 2RG1A 4LA4A 4OSPA 4R7ZA 3WNQA 3V33A 4BCBA 4Z4HA 1N75A 1XKQA 2GHRA 621PA 3KLOA 4HEA1 5IUJC 1XBTA 4B3GA 2GLXA 1FCJA 3BT7A 2E4YA 2I3GA 1Q0HA 5CU7A 3ST7A 2JIBA 3TEMA 3HDQA 1NUTA 1SBQA 3K0FB 5AJVB 3L84A 3RRNA 1OFVA 1JTFA 1IZYA 4MP6A 3RSCA 5DHFA 3KQHA 2X13A 4WI1A 1P1CA 5KKNB 1YAJA 2FN4A 1GPBA 2UUPA 3OE7A 3U3JA 4YP5A 1FSGA 3KE8A 1OAKA 2P9EA 5FA6A 4DWVA 4A0HA 2FU5C 3DQPA 1FVHA 3E48A 5LJLA 5KVVA 1LQ2A 3IXMA 4M49A 4Q82A 4QJIA 2V58A 4HQLA 1J8DA 4GPZA 4A6DA 5JZ9A 1EE1A 1F5NA 4X8LA 3CLSC 3FH0A 4F2WA 2DWPA 2D1QA 4NIMA 4ER3A 1GSOA 4X7BA 3AIMA 4NZMA 2EFJA 3K92A 1H2WA 4OFZA 2DE0X 3ZD7A 1RKVA 1R8XA 4C2BA 1U2PA 1YV9A 3JZDA 3M4YA 4ACAA 1Z83A 3OZUA 4EABA 5KNDH 3K0AA 2PZLA 3CO5A 3OSUA 4HSGA 5ESXA 4H1UA 3NWBA 3OZXA 5BR4A 1W49A 4R05A 3DW3X 2Z8ZA 3OCCA 2I9PA 3E3NA 4TSFA 1Q1BA 2IP1A 4L3VA 1Y6RA 1NKVA 3SOZA 4MQBA 5LC1A 1YVDA 2Y27A 1GGNA 1TEHA 2AOVA 3ETHA 4XX1A 2LDXA 5E6SA 3HY4A 4FX2A 1BNCA 2EDAA 3PRJA 1I2MA 3KX2A 3TXYA 3IOMA 2Q5EA 4HDMA 4IJKA 2WPDA 1MAVA 4PRZA 5F1PA 1XNJA 1QANA 1RVV1 2I54A 1JHXA 3IDAA 2ISSD 1CUJA 3B7PA 4IIXA 4MRNA 5COQA 3WMGA 5BMVB 1GEEA 4BGEA 2X3FA 4F86A 3RTGA 4OGGA 1JLLA 4Z4EA 5CFZA 3WMEA 1OWPA 4HDCA 4GKAA 3OC6A 4KYTA 1CERA 3TRIA 1KETA 2OB2A 4YLYA 2R4UA 3IB6A 4AKGA 4Z9FA 2OBFA 4OQPA 4RDIA 1F6WA 3PVSA 3OEWA 1EESA 3V1LA 1U7ZA 3QKSB 4A6EA 5BWMA 5LP6B 1SBHA 4YQYA 1XTJA 1YL5A 2DOKA 2GQ0A 4LDAA 4KPFC 4ITVA 3GVPA 5D01A 4RTLA 3NIFB 4IPTA 4GG1A 3H4VA 2WILA 2OBNA 4I66A 4QFMA 1AE1A 4JY7A 5JAUA 3RAJA 2Z2KA 3N8KA 4ZN6A 4JVSB 4ZV9A 5AYVA 5IYZB 2C00A 1WSBA 1KO5A 1H6DA 2J9FB 2AHOA 4EGQA 1T6BY 3ORQA 4MR8B 4PC7A 1RRGA 5KAPA 5JXWA 1Z0DA 2NADA 4MI6A 5I7RA 3S2SA 1NXPA 2HJHA 3PWSA 4A2PA 2PWAA 1IB6A 2D8MA 5AJWA 1Z4LA 2UU9B 1U2TA 4FXPA 2ID7A 4BNNA 3VNAA 1N2OA 5CX1A 1HDOA 2GFQA 2VEOA 3GLIE 3C3CA 4DWJA 3X1KA 3UBMA 5E3HA 5GAJA 4P34A 1QF7A 3SAJA 2I7CA 4MVJA 2BMAA 1J24A 5C1PA 1AQUA 1JYSA 1P7VA 1RWKA 1YQ9A 2XTJA 1NSTA 3OQJA 4ID9A 3C0KA 4WXRA 4YBZA 1WWKA 1CY0A 2R87A 1OQAA 4UUMA 3UENA 4ZDJA 2YV1A 5DM4A 1D1QA 2PH3A 1AN9A 1RJWA 3OQBA 5ALWA 4HDKA 4RMGA 5JJ5A 4NTZA 1MJGA 2F67A 3Q3JB 1RLIA 1QZTA 3LC2O 4UPDA 2X0IA 1D4FA 1VMDA 1E5DA 2NIPA 3QJYA 3ZC3A 2GAJA 2O07A 2HMSA 3SX0A 5DT9A 4FC6A 1CR2A 1W5FA 1KDVA 1EVQA 2CBZA 1CD5A 5CK4A 3FPEA 2GZRA 3GZTB 1E6WA 4I9FA 4U3JA 5EQDA 1QO0A 5BMOA 4M9SA 2BZ0A 4MHOA 2F3TA 2O3TA 2JJYA 3AV3A 1P77A 3KE9A 5JQGF 1BMFD 5IDXA 2FPWA 3IPAA 3IQZA 1IN7A 3T1YB 3KFXA 2FK7A 4ILEA 1WUIS 2UUAB 5F7XA 1DAEA 4JYAB 1FRNA 4EF6A 3A1EA 4RJTA 2B35A 1HLFA 2NAFA 1N2JA 4UNQA 1A5BB 3KEQA 4BLVA 1H22A 1WBJB 3BS4A 3KQQA 1AKNA 2I9KA 1T9DA 5ARBA 1XDDA 4KIUA 5DB4A 1FDRA 4MJ3A 4PX3A 3A14A 5E1MA 3WNVA 2VHUA 1I2AA 3D7NA 1JI3A 2HBYA 4Q05A 4DDMA 2N9UA 2EQBA 5HDBB 3E84A 2PNJA 1UKAA 2BBOA 3WKCA 3HFSA 2VDWB 5KNBD 1M6EX 3FDFA 2SKEA 1X7GA 1PQYA 3KOXA 5HFJA 2W2VA 2CLDX 2P3OA 3QUTA 3SF8B 3OIUA 2F8SA 1ZD3A 2BFFB 4D41A 4C6RA 5LCXA 4CMEC 4F9EA 4UM8B 3R6GA 1SVOA 5ICGA 1ZOOA 4ZI7B 2JS7A 4ANFA 4ALIA 3ED5A 5FPPA 2WICA 2F8TA 4BWVA 1DAPA 3EG9A 3B20A 2BHNA 1I7NA 3K0KA 3KWMA 3GY0A 3O2SB 4WNIA 4BJ6A 1QG4A 1O8BA 4GSKA 1XD8A 2J3IA 2HJWA 3GP5A 4UHKA 1G5FA 2ZRMA 3AYZB 3BIXA 3DTVB 4MO9A 3HCBA 4EGSA 3U4GA 3HH8A 4PGAA 4BNVA 4BU0A 2J48A 4JC0A 4XEUA 5FO1A 4K8OA 3VU0A 1WXXA 2I1LA 3BFVA 2ZPAA 4FMCB 2QSJA 4CQMA 3BRSA 3CZ5A 2NNLD 3IELA 2DUWA 3EFOA 5JAHA 3P32A 5LBUA 3FG9A 1XTTA 2UUCB 4YP1A 3RFFA 1J39A 5AUOB 4HPJB 3ITNA 1LA2A 1E5XA 2UXBB 4D9CA 3KQLA 1GDTA 3QVGB 4UFOA 2IA5A 2H4HA 3A9VA 4I50F 1SVUA 2HIMA 2H7XA 4YAGA 1RWNA 1AY0A 1CQPA 2ANCA 2WZBA 3O73A 3ECCA 2ZROA 3ASUA 5CTAA 4XOUA 1U0GA 3AJRA 5TPZD 3RRXA 3WK5A 1U9YA 4E1VA 4RTRA 2A5JA 3VJRA 4PM4A 2G6TA 3D0QA 3L01A 3EXHB 4QRIA 5FNVF 3EAFA 1U3CA 2QS9A 3F8WA 3GA7A 4LQCA 3W5SA 4PLVA 3ACCA 1QGOA 1H1LA 3TLEA 5A7HA 1QO9A 1QB7A 1D8AA 3K35A 4IV8A 4GVXA 3P9RA 3U62A 3ZCTA 3CMCO 1L5GB 4TMZA 3VPBA 5IK2A 1FJGB 3WDSA 2AN1A 3I0ZA 4Y1RB 4C0AC 3M4ZA 3ZK7A 3GFRA 5JH7B 1QIGA 4U2KA 5MN6A 3TLMA 3FJYA 4RFSB 5JSYA 2QAGC 5TARA 3WGJA 2IBSA 3KK0A 1LQUA 1I1OA 3FYSA 2B9VA 4RS4A 1XDUA 2C5AA 5IARA 4V2IA 3DCIA 1DWPA 4INZA 1QBGA 1U02A 2G82A 2RHTA 2LCQA 4D0RA 2XCTB 3HJCA 3S8MA 1XWWA 3AH8A 5DZSA 4YRMA 3UK2A 1DTWA 3L92A 3ZHSA 1AB5A 4BBAA 3QEBZ 1JPUA 1WVGA 4FBGA 4GE0A 2NLOA 1QE5A 3LIPA 4IDAA 4WLUA 1L6RA 3WICA 4CDNA 1VMKA 1CE8A 4B47A 4G4SP 2IYTA 1SBNE 4L4RA 4TV9A 1N2ZA 3KQSA 2HA3A 2HV9A 2PX6A 1N92A 4HJRA 4UQPA 1G8GA 3PJFA 4WUVA 1FFEA 1ZRHA 2WUGA 5F7ZA 5EIBD 3SS7X 3NVDA 3RHSA 4JNCA 4UARA 1FTSA 4FYMA 5D86A 1ZYUA 2WYUA 1XZAA 5KZMB 2XLBA 2VJAA 3L0BA 1GIAA 1SHUX 5LJIA 4NAVA 4QHYA 2QUIA 2CK3D 1VP9A 2FPXA 4N6NA 3TTSA 2B82A 2F3PA 3GMTA 3BA6A 3PXEA 2BGTA 5IVDA 5HXAA 4IG9A 1O96A 1VZ3A 2C3MA 3FPJA 2E4XA 3WO0A 2NU9B 2XMGA 3WMRA 4O4JF 1LC3A 1ISMA 4GYYA 4QAQA 2IE8A 4PAOA 4GI5A 2HK9A 3LA6A 4K2AA 1KJ8A 3VISA 3GCZA 1XA0A 4B84A 1AKTA 3C43A 3NASA 1Z5GA 4X92A 4IW3B 4MKZA 4OMDA 4YRRA 3SYTA 3WGQA 2P79A 4EI8A 3BCRA 4OGKA 2QYHA 2FNAA 2R25B 5BV1A 4NFYA 1EHYA 4JLWA 1LZKA 2X76A 4UDXX 1PJZA 1U9JA 2MINB 2QZJA 2W8BA 2GKOA 1VE5A 1AKMA 3IT3A 4P93A 5FA5A 3EZ2A 2GESA 3DFZA 3MOSA 5AI6A 5DGHA 4ZCMA 821PA 4EW1A 4MVJE 2OHIA 2C0CA 1A7KA 1S1MA 5AUNB 4HQNA 5IN4A 2EJVA 3CN7A 3FPBA 4PWZA 5EE5B 3NC4A 1GNSA 1RCFA 1OYWA 4M76B 5H80A 5IJAA 3RIXA 2KI5A 3T12A 4NMLA 2XA2A 1RJEA 1IL0A 4WKGA 4F4CA 3PG5A 4CW7A 5E7QA 1A5ZA 3OUUA 3E18A 3ZLTA 2Q2WA 1N6RA 4CV0A 3C3WA 4DY6A 4Q4LA 2BVNA 1FSFA 1CP3A 2O3UA 2LXNA 3MJRA 3DUFB 1UMDB 4IO1A 5FI3A 4EY7A 2JF0A 3DOHA 3TN7A 5E8RA 1W36C 3HCFA 4HYEA 2OBYA 3PBKA 1V6AA 1GARA 5UKDA 2DFVA 4FR5A 4MK4A 4NU8X 3V4LA 2QRVA 2XT6A 2Z5VA 1K2WA 3KLNA 5DULA 4BRZA 4DYHA 3F9RA 2QD3A 4FNMA 3NJ4A 5KI6A 5CFQA 5KJFA 1SUEA 3OBBA 5CB0A 2YVKA 2F4NA 3AESA 3AOEA 3HXTA 3M1IA 3OZGA 3QE3A 5MGNA 4G8DA 1OXMA 2WIDA 1KFJB 3Q7EA 3BDAA 3NR2A 4N03A 1KE2A 1QGUA 3CRNA 3V34A 2UZIR 2J9ZB 2X5XA 4ZANA 3TE7A 1V6CA 3U0VA 3MRXA 1YDMA 3L2OB 1CY2A 1C1DB 3EIUA 4ND6A 3NPAA 5KTNA 2PYDA 1AQ6A 1E4EA 1UBHS 3EEIA 3F74A 4NBNA 5HKBA 1K8YB 4ZGWA 5A9SB 3C7AA 1A2OA 1BVUA 1YDWA 3GOQA 4CMAA 2B36A 5SY4A 1J2YA 4GQIA 2OHXA 3B3JA 3G9QA 1AHNA 1KK3A 4PPGA 1I3OA 4TLBA 1VL6A 1IYZA 1GA6A 2ZT8A 4B6FA 4CKWB 3U4MA 2PRYA 1XEFA 2WSMA 3DAGA 3O94A 2FEPA 1T9AA 1KXZA 1NFQA 1Z4NA 1B2LA 2QJWA 3W8DA 1IM8A 4EMUA 3IUNA 1ZJJA 3EIEA 4DLSA 4JB2A 5CGQB 3MCUA 3RTCA 1C7FA 2OVFA 2WW8A 3JCZA 1VPDA 4NBSA 4KXQA 4LMPA 2Q0QA 1CC1S 1CFZA 2CMKA 2J85A 3DGEC 5A1JA 2A14A 2FG6C 4FFRA 4DHEA 5L9AA 5E0OA 5EQTA 5CM2Z 5CYGA 3WRXC 2W2LD 5BN3B 5GVSA 4R1UA 3V9AA 1TTPB 3UXHA 3NATA 4GMDA 1LX6A 3DDUA 3IBSA 2WTAA 2AI3A 1R4MA 3IB3A 3GJ4A 3N76A 2R8EA 2J45A 3DLAA 4DLXA 3F7TA 2J3JA 4ZYWA 1SA0A 1WUTA 4FHGA 3FTNA 1XCOA 3GRUA 4EJ0A 1FK8A 4PX9A 1DFHA 1K4MA 1NKSA 2RHCA 3C6BA 2VP3A 1NF3A 1ZJYA 2KJQA 4BMXA 1WE2A 4QPNA 3CIOA 2OESA 2PXAA 1JSCA 5EZYB 1UMCA 4NG5A 1U7PA 4NH4A 1XQ1A 4CTKA 2QVGA 3K2BA 4X7RA 3HABA 1XTQA 1VLQA 2DFPA 1O57A 1Q44A 3BILA 1ISJA 1NVAA 1ZOSA 4IAOA 3UNXA 1FFXB 3UT6A 4ZYXA 1EVJA 2B99A 1EE9A 3DC7A 3B12A 2IF0A 1O9HA 1JJIA 2HTFA 3D6NB 3ESYA 5F23A 4XASA 4ZVLA 3H5RA 2B8WA 3HJBA 4H15A 2GPJA 5FUXA 4NF2A 4DSUA 4GI1A 3LD9A 5A3QA 3U4DA 1O94A 4QUAA 4G24A 3RBZA 4RIIA 3FYCA 1Z74A 2IITA 5T57A 3AVXA 3ZGZA 5F33A 3MT7A 2LGJA 3WGLA 3OICA 1SK8A 2PXXA 1KBQA 3RUEA 4X0EA 1T4GA 2P2SA 5ALJA 1JDVA 3HCDA 5DX8A 4YASA 3L40A 1X92A 3F6PA 3ABSB 3M81A 5EKDA 1MOSA 1PK8A 4N3NA 2VHVA 1J5XA 2FCAA 2WRZA 3KKZA 5JWRA 3V2UA 3ZDXB 1U7TA 1U0TA 4JASB 2VQSA 1ECBA 2QF7A 5D3MB 3CXUA 1FUIA 4TUYA 4A0SA 5GIPE 4XYMA 1WF3A 4XLZA 1Z6XA 5A9TA 1A3CA 1JAHA 3OT1A 1NVVR 1AZTA 1GNVA 1IULA 2PMCA 1N32B 4ARZB 1AIPA 4LCBA 4MGIR 3DV9A 1NW9B 2OCYC 1U94A 5LFAA 2QX9A 1ZD9A 3B85A 5AM2A 3WYAA 3QPCA 2Q5JA 1P1BA 3GN2A 3P4YA 4HUQA 1X14A 3CO0S 1BEEA 2IHVA 3HXKA 2RAFA 3QYFA 4CV1A 1LBQA 5C52B 2ZWOA 2FFJA 4NQRA 2O7VA 3E2PA 3P9CA 4LJ6A 4FS3A 4KE6A 1Q83A 4QSMA 1XZKA 4M6WB 1EFAA 1FU8A 1LBTA 1YZNA 2XUGA 3QIAA 1BHJA 4FFBA 1MC5A 2HJVA 2JK1A 3FDZA 2HTEA 2XQGA 1M1YB 4UQOA 1SIUA 3LVFO 1KKLA 1BS1A 1TADA 1V5FA 4NK4A 2CDAA 5BSVA 3T3HA 3GNLA 4ZVQA 3DT8A 3CS3A 2W6OA 3CVXA 2DUJA 2YJ5A 3H6GA 3JY6A 1ICEA 3PQ6A 4N48A 1SKBA 1SXPA 3KYCA 3VO2A 4TZ0A 3MS4A 5CBPB 3HLTA 4WA8A 2FSGA 2Y1GA 3NIBA 4RGBA 5B6JA 2ENWA 3AI7A 1MMFB 1IQRA 1BXRB 1Y7TA 2AC7A 2EBWA 2XI4A 5G4KA 4X64B 1NBEA 4L0MA 1ESZA 2E4WA 3N6VA 4E70A 2JG3A 4EKDA 1ISSA 1HDIA 4QTZA 3V00A 2JCXA 1HMYA 4ASUD 1U0SY 3EF0A 2CVHA 4N5IX 4B76A 2D8AA 5BNIA 5IKEA 4AZ0B 3L8MA 3F3MA 4YJ3B 2QL5A 1JQDA 4CT4B 1CV2A 1SURA 2DHCA 2W6IA 1AUOA 3RHFA 2EZ8A 5D3KA 2FEWB 2QDKA 4MQEB 4CGZA 1RYZA 2IQIA 4BNFA 5CPBA 4PONA 3WGKA 1WLYA 3PNOA 4Z7QB 2R1ZA 3ZDDA 4TOIA 4BO5A 4BJ3A 4JJKA 5ICMA 3KHUA 2FWAA 1A2KC 2QLTA 3P2MA 3JWEA 2HD4A 1G4AE 4FLMA 1AUPA 1DRVA 1IDN1 2PUJA 2Q3FA 5LLTA 2PXHA 5C8YF 1OWOA 4RFLA 3HTXA 3HADA 3PPYA 1MB0A 1U0BB 4L0DA 5I7FA 5LM3A 3G1WA 5TPWB 4M7WA 3BL5A 4F4DA 3DPUA 4KQKA 1Y3FE 4JUAA 2ODEA 4EJSB 5GJWC 3ACBA 4D9JA 1XYVA 2FZCA 1PIWA 1P4GA 1Q1ZA 2PLRA 4PAGA 4PLGA 4QBGB 4RPKA 4MVCA 4UTOA 2VNJA 4BO4A 3DKVA 2V1XA 1JE0A 4MA0A 2QM0A 4HB0A 1DAIA 2YVLA 3BD8A 3LSTA 1UDCA 2GA9A 2ZWPA 3IODA 3S3TA 1AK9A 3VOSA 3FOEC 3DL4A 4K5QA 1QRSA 3BD6A 2DJ5A 3QHAA 3TXXA 1JG7A 4P2BA 2GN6A 4B82A 5AI8A 4EJ2A 2P9BA 5ARDA 1ZHFA 3KPUA 3PGLA 4LXHA 4PAQA 1UDXA 3C6KA 1JQ5A 2Y4NA 3ED1A 1T34A 1OV6A 3I64A 4UMVA 5F9MA 2I2XB 3RWOA 3O4IA 1RPZA 4X41A 1MO6A 1ZRMA 1FQOA 2VPXA 3LYLA 5JISA 2DPLA 3MJCA 2VK2A 4MWBA 4MPPA 5JCXA 2J67A 5BUSA 5EJ7A 4W5HA 4N0PA 3QGMA 4A8JB 3TUIC 1WMFA 4NE9A 4L4UA 3VKFA 3UMJA 3TNYA 1COWA 4GVPA 5AH0A 1F8GA 1Z5UA 1WCIB 2GJAA 4JGGA 5J47A 1KVQA 1HTWA 3JRXA 3BJRA 2D5LA 2F2TA 3PT5A 1G3UA 4DIEA 2H85A 3PP8A 1T13A 2XH8A 5CW1A 3ZI0A 4DNFA 3PJRA 3EPKA 3GARA 3PC2A 4LF4B 1PHRA 1T0IA 2KBEA 2VYVA 2WUWE 4MCJA 1KMQA 1W0JD 1JZSA 3LH5A 4LRWA 2QM8A 1SHTX 3K5PA 3TKAA 3ETNA 5JZBA 3SNKA 1B0ZA 4ZMRA 3CCFA 1QFZA 1WSWA 4MGHA 4KPUB 5H4HA 3LDUA 5E9QA 1IY0A 3KSRA 2EW8A 2YHUA 3VPAA 3ZV5A 3TUZC 3KTOA 1K7XB 3SYLA 5KQRA 1Q7CA 1I1HA 4QVIA 3ROKA 3W78A 1L4YA 2C77A 3ZLBA 1IY8A 5FTLA 1ZK1A 1JX6A 1DAFA 1ZW6A 4GMHA 3TZEA 4LS3A 2NX2A 3EOAI 3TL3A 5JAMA 3KOMA 3UMCA 4HN4B 1XP8A 4BO7A 2DY1A 1SOVA 4BZWA 2BCJQ 3CPEA 1HQCA 3KCNA 3MFQA 3LX8A 5FULA 1AH2A 1SPBS 4GM4A 2B8NA 2YZGA 1GG2A 1R5NA 1V8ZA 2F90A 3MM4A 4DDKA 1DC3A 2IUFA 4I8DA 1GRQA 5DLDA 1XVTA 3RF6A 1PWHA 4B87A 2ZIFA 1N6LA 2W2QA 3JV7A 3ZDQA 3DBHB 4CHTA 3JVVA 4ZAGA 2Q5OA 1E2IA 4LY3A 1WZIA 2Z8XA 3C5VA 1J22A 3EGXA 3L0SA 2C29D 4JMPA 1PK9A 3VZQA 2YZMA 4I08A 5GM2A 4KW7A 3LDAA 3EA5A 1LGYA 2C2ZA 3BERA 3ESAA 3MMPA 1JEAA 4ZVRA 4PBTA 3RYHA 4WQMA 3UGTA 1W1IA 4FOLA 4DDVA 1W19A 3UMBA 1SUSA 1PV1A 4JUIA 3EXG2 4Y1GA 3IOBA 1WMDA 4DZRA 5AVKA 3S0JA 4UM9D 1YIOA 2WIBA 2RKWA 1Z3IX 3A1VA 3L6DA 4KOEC 1SULA 2IXEA 4TS3A 3R7FA 4LF5B 1CZKA 3OZFA 4I4LA 4O4LA 3UKJA 1W0KA 3PFGA 1T0HB 1OKKA 5HE9A 1PVDA 1B1AA 4D0SA 3HVIA 4BC0A 1OUMA 3KSMA 2IZ6A 4Z7OB 4ARCA 4YAWA 1WIWA 3ETJA 1LSUA 3R23A 1PSZA 2C2OA 2D2EA 2NM0A 2CXUA 1HT3A 3GUUA 2R5WA 1W4ZA 1EFCA 1CPYA 2AG5A 1NE2A 4LJ8A 1GFZA 4LMRA 4DA4A 3FI9A 4AMBA 4C1BA 5KYWB 1AQNA 5E4FA 3CF4G 4XIJA 4BVBA 3PZBA 4ADSG 2VYNA 5K2MA 1GSAA 4FWIB 2EWVA 2OWEA 1J2JA 1DC7A 1NM5A 1VG1A 1KAOA 1NSYA 3L8YA 3BFJA 4G0NA 4UM5A 3H86A 2CXQA 5EKSA 4ID3A 4D92A 4K9KA 4DTCA 1EK0A 3UAZA 2IEZA 3IMGA 5K8VA 4P53A 3FFWA 3QUQA 3O6VA 2PGIA 4RIHA 1P0PA 4NDZA 5FUQA 4JT8A 5L3ZA 1X7HA 2XA1A 3PEYA 3KV1A 3LYHA 4JKIA 1S01A 2H2WA 5T4BA 5JS8A 2IH4A 2XVAA 1FL9A 3R5TA 2P4EA 1DC8A 1UM9A 1KQ3A 4L6IA 5BQ5A 4G1BA 2HAEA 5CX4A 4QYSA 4ZALA 5A1TA 1K9VF 4LVUA 4CI9A 4DUGA 3LQ1A 3LXUX 4CJXA 4EA8A 4DG5A 2DT5A 4YMLA 5AKYA 4LGYA 4Z54A 1RYEA 3UV6A 3JZIA 4F46A 2AQ8A 3G88A 2GK6A 1ZDMA 2JHAA 1OZ0A 3ETDA 4DM7A 4UHCA 2W2XA 4QEZA 3ZJTA 2QMEA 1DU4A 5AW6A 1SC9A 3QMMA 4I5EA 3MVEA 3RC8A 1BXGB 1MUUA 2ONKA 2D0PB 2VDRB 4RKFA 3EQ9A 3Q88A 5KKCA 2H5LA 5HMLA 1PZMA 2GRAA 3QPBA 3JTEA 4XGNA 1SVSA 1W5SA 4QOFA 1DDOA 1KOFA 4FZ5A 3NXKA 4ENQA 3E4CA 3DC2A 3ZGNA 1LBIA 1XCGB 1C5KA 4TT3D 5JCOC 1XHLA 4P7JA 2G80A 1L5ZA 3U9TA 2ZUUA 3QMVA 3VH1A 1VOTA 1EFRD 3AR2A 2C9OA 4REOA 3SHQA 4NV0A 4GX2A 4XGKA 3E61A 2WFLA 3HJNA 3ONWA 1LJ8A 4MPDA 4AFNA 5A6SA 1C3EA 4E7PA 1LW7A 2RHLA 3L0CA 4BFXA 2Z8YA 2VRWA 5IG2A 3L8ZA 3H9EO 4XJSA 1L4FA 4LZLA 2H1SA 3BQMB 3UB3A 1VYVA 1YT5A 1Q0QA 4EENA 3GFVA 4J07A 5CLGA 1V8OA 5DN6A 3HNOA 2IYEA 5KYXB 3OPMA 1XDBA 3FXAA 5CB8A 2WD7B 1B6TA 2YIDA 1NGSA 1SCBA 1XB2A 3MRTA 1LEHA 3RPEA 2O8EA 2VS1A 3GN1A 3LDGA 3GRCA 1ZJ4A 1KNQA 1E1CA 1W52X 3B52X 3QE4A 5F4BA 5JSQA 4KQ6A 1ZCZA 3QEAZ 1T1IA 2WFZA 3V80A 1KC3A 3AOEC 3ISJA 1P4HA 1SR8A 1QHYA 2FUG1 1G21A 3AIOA 2OCLA 3F4KA 3NNDA 2VP0A 5CITA 1XCBA 2IHBA 4M3NA 3T9FA 5I51A 3ZCRA 3ASVA 2H06A 4BJHB 1ZK0A 2QA5A 3JD4A 4ZQBA 1AZLA 2ZTMA 1QK5A 1Z9BA 1B3RA 1ZUIA 1LBHA 2Q62A 3BTUA 3EA4A 3HCNA 4GLLA 4OM7A 1EUCA 2X1HA 3D6VA 4HGRA 4UCWA 4BVFA 1CNEA 2QN1A 3VZCA 5AVJA 3R6LA 2ZU6A 3O4RA 4I50A 3RNLA 3TR6A 5TS2A 5CCXA 2W0SA 1TF5A 1PQ4A 4MQLA 1YB6A 3RARA 2AX3A 1NUSA 4RK4A 3EK2A 4IQGA 4MW1A 1H8HD 5HTKA 5F76A 2W42A 4L1KA 3KUXA 4DREA 1FFHA 5FNVA 2R85A 4Z3OA 1G5QA 3H2JA 1C1XB 2XVZA 1H4QA 4IDPA 8GPBA 1N7HA 1UJ2A 1URPA 3GJ8A 3KHKA 4J94A 4ZCSA 2ZJBA 4JBXA 2HBRA 3K6RA 2KWIA 4YB8A 8AT1A 2WMOB 5BSUA 1GV1A 4HYYA 2PMWB 3SBEA 3UHJA 4ZDKA 2DKFA 3WBBA 2BEVA 4NMHA 3U61B 1PEYA 2CNKA 3EZFA 2XJ9A 2PKCA 1CVRA 3BWYA 3H9CA 4R6WA 2AUTA 3AI1A 4TXJA 5DH9A 1BMQA 4BP9A 3BVPA 4BNWA 3D3WB 2PKXA 5CTJA 2ZUCA 5BUZA 4WFJA 3RM3A 1JIQA 3B7WA 4B85A 3C6QA 2H17A 2XZPA 4ND8A 2KQUA 3HRIA 3DE1X 2RCYA 5CGZA 2J4FA 1KDOA 4QFCA 3HL4A 3QFTA 3SKVA 5KWSA 1EFHA 3ITEA 1K08A 2NU6B 3CRMA 5HZGA 1DKLA 1N8NA 1Z6TA 2D3TA 3WIVA 2J07A 5TLSA 3FHTA 1PJSA 3F46A 4Q34A 4B3XA 3K3PA 2Y1XA 3NETA 4NV3A 4RZIA 4TM8A 4ZPXA 3ANMA 4LYHA 2FSVC 3V4RA 1BFKA 3ZWCA 3OCWA 1RWBA 4J3JA 5CVCA 5SYAA 2XWJI 5EL0A 3BB1A 4PPQA 2FRXA 3MZ0A 1FJ2A 5DFAA 1LTKA 1CBUA 1X2EA 4J0FA 1GTRA 1K9SA 1Y4DE 1CUZA 3W1VA 3BJMA 2BDEA 3NP7A 4WFIA 3ZI7A 1LSOA 2J30A 1WXIA 4QT0A 4DIKA 1T2DA 1CUBA 5C3MA 1Y48E 4HGPA 1P9LA 2ZYAA 4E12A 1XLVA 2GM3A 4O4JA 1FDWA 3OBIA 3M6IA 3OH8A 1ZMOA 3PHJA 1A5TA 4EA6A 1WNFA 2KS6A 1FUEA 4LJYA 4MMYB 2CHVA 1ZM7A 3TQFA 3RS0A 1FFSA 3JR3A 1PWXA 4MVJH 3PX3A 5LQKA 1FFAA 121PA 2QXTA 1N2XA 4B6OA 4FYVA 2YY6A 3U2QA 2QW8A 1FFBA 4YRIA 5BW8A 2HYIC 1NL3A 2R7LA 1P62B 2B5WA 4MINA 1KRXA 3NBUA 2R2AA 1OAAA 4KL8S 1F5SA 2QMOA 1RJ9B 1GYQA 1SUAA 3IALA 3PQ7A 5JFTA 2HLDA 1H4VB 3EBPA 2EL9A 3IVAA 2ISQA 2YHSA 3LT0A 3ZY6A 1AGNA 5EESA 3UJPA 4ETMA 4FDAA 3MCTA 3ORYA 3QEMA 3HA7A 4DLYA 3FA2A 2JLSA 5EYPA 4A0RA 1KDTA 3LVBA 2IV2X 1TM4E 2OMEA 2WABA 3HG7A 1T6NA 3WL3A 3UMYA 5DTJA 4C21A 1ZONA 2HU5A 1RHUA 1RKBA 2ZI5A 3CX6A 1WUKS 3FZNA 5DU2A 4BMVA 3E53A 4L2IB 4LY6A 4XM0A 2OGSA 1OXTA 1QG2A 1YCGA 3HLYA 3Q0EA 4P7KA 3RS4A 3FCEA 1R0RE 1ZN9A 2WG2A 2WSBA 2O1SA 1F60A 1NYTA 3AY6A 3CTMA 2ABWA 5CA0B 4R6XA 5BW6B 1GA1A 2V4UA 2ZB4A 2CXRA 3HKCB 3H9UA 3TFQA 4ETIA 3N2KA 4BKQA 4G81A 4XQ0A 4N5MA 4IVPA 3GRRA 3CEHA 2DLCX 1E6CA 4MW0A 2Z58A 4XLTA 2HREA 1E6MA 2H2GA 3GT3A 1QJ4A 3G0OA 3UYKA 1TCBA 4LNAA 1OB5A 3WJAA 3FYUC 4MZXA 4HUJA 4IRUB 3A06A 4DABA 4U1RA 1N5JA 1E7YA 3MB5A 4PNEA 2IPMA 1V95A 4GW3A 3HXQA 1ZITA 4QQNA 1HKUA 3SP1A 2ZCVA 1TIKA 1VCHA 2H4WA 4LX8A 1CJVC 4YJHB 3SZMA 3DEZA 5I7WA 2XHEA 3H19A 3W90A 1M2NA 1E9BA 2FKNA 2IIVA 3DZFA 1A8SA 1VSBA 1ZSVA 2G09A 3AF5A 1T5DX 1Q15A 3EMDA 3HWRA 2WJZB 1QFJA 3QUBA 3TOVA 3V7YA 3QXXA 4C6SA 5CT9A 3A1FA 3KKMA 3A1CA 4PVDA 5JDIA 4OX9B 5ENDA 1QC5A 2XWSA 1O97C 4JLMA 4RA9A 3NBXX 4XM2A 2H1LA 2YICA 3KPJA 2C42A 3EIOA 4MPRA 3W2FA 2DTDA 3FCXA 2D4HA 3BWXA 1KJQA 1O0SA 3C74A 4EUSA 4XM1A 4H16A 1CRLA 1D3AA 3CG0A 3CY6A 3KIPA 3OTHA 3K16A 4OF4A 4XVCA 1RAEA 3NHPA 1E2BA 3O9MA 3O3CA 2QXUA 4Z0PA 3CG4A 1Z8NA 4UEJA 5JTTA 1P91A 4BAUA 1CEEA 3S2GA 4MGYR 3N74A 1FP4B 4YBRA 5E6SB 4D9IA 1OYYA 4K9MA 2CGEA 3RTDA 4YRNA 5BVGA 2CXNA 4EG5A 1H4TA 3QUCA 3WLEA 3ZJ5A 1HQDA 1R0CA 4DT1B 2ZTUA 1SKYB 1DZIA 1YS7A 4QLBA 3G8YA 2PJZA 1S3IA 3MWYW 5BYKA 8LDHA 4W5OA 1Z22A 4G25A 4DGQA 1D9ZA 2GUWA 2W6JD 1G21E 2AQHA 3ZOZA 2NAPA 2HCJB 4BMPB 1L8LA 4H7FA 2V8BA 2BKLA 1CJTC 1C9KA 3GIDA 1ETHA 3H5IA 5HKLA 4DMMA 4DNQA 5HKKA 4CEJA 2FFQA 3TDKA 4XUGB 3O1IC 4M8SA 3DDOA 1D6JA 1PL6A 4LSWA 4EZIA 4WBXC 1O5OA 2Y1KA 4IFIA 5CM9C 2RHDA 1DKMA 3AHIA 4NENA 2FVXA 2JEOA 2DG2A 3P0EA 4YRLA 3U1VA 3FIJA 3KLMX 3KEGA 2L82A 3AF6A 2E3JA 1TTQB 1UJCA 5L4SA 1AVTA 2XEXA 1F51E 3JASB 3ORRA 2UYQA 4QJ5A 4OYHA 4HY3A 1SFRA 2QAJA 4GO1A 1RZVA 4HL6A 3P5SA 4B7ZA 2GF0A 4MUAA 4WESB 4CTMA 1KI4A 2P2LA 1LFAA 3QLTA 1WDWB 3DB2A 1E6UA 3FDJA 3Q0IA 4C30A 4HBGA 4WRRA 3DBOB 4I4IA 5DTIA 3ZQ6A 5H8WA 4D8VA 5C5DA 3LQ2A 4GQBA 4LOAA 1QHNA 2L42A 3UICA 3D4PA 4QBKA 4BXOA 5KX5B 2GEDA 4P6VF 3I34X 4ECEA 3VZSA 4HRAA 2RB4A 2YHBA 2WLTA 3KVYA 4MAAA 4QXQA 5C4IA 1U8FO 1KSFX 2HIAA 2Y0EA 3QENA 4ZYYA 2K5UA 1PTJC 1IG0A 2JJ8A 4AUNA 4I5FA 1Y8RA 5JAPA 2DB3A 3JQQA 1JQAA 3K5HA 3DLBA 5AXCA 1HMPA 2Z4RA 1ONOA 5DP2A 1W8IA 1N0VC 4X60A 1WUHS 1Z38A 2YFKA 3A6EA 4ZVSA 3WKDA 2Z5LA 5CXSA 1DXYA 3PGA1 5D85A 2QP3A 4KQXA 3CFYA 4QYIB 2OC4A 1G66A 1PEAA 4H7IA 4G37A 1VI5A 4HH4A 4OCZA 3V7WA 2OZVA 3UXMA 4G86A 4JEUA 1VBFA 2VT6A 4J4HA 3MTJA 3I9V6 5F1KA 1H66A 4DLWA 5BN1A 2QRLA 3I6QA 2DECA 5F3DA 4N3BA 4JXXA 4L5JA 4OBWA 1GY8A 4RACA 2N1BA 2GFIA 3E5MA 5AMXA 2QIOA 3NPMA 3R7DA 3TB4A 4HAOA 4WGGA 3RYTC 2NSYA 2XUOA 4FC7A 4O2LA 3VC3A 2VXBA 1ILEA 5LR6A 1VMAA 5JD4A 4XYLA 1J21A 4ZU3A 1Q16A 1TJYA 5ECYA 3VVCA 2I4OA 5JSZB 2F55A 3GDHA 1K3UB 2ZT7A 2WHPA 5H3CA 4XWWA 3VJMA 3RUCA 4BVLA 2P6UA 4IOLA 4F4HA 1WVMA 2AN4A 3FWPA 1IN4A 4QU0A 1ZX1A 4TVBA 5C53B 4LZJA 4BTLA 3WNZA 4IINA 2P3QA 3WOVA 2RGCA 2YIJA 2CJWA 2R47A 1H9AA 2IYNA 4O8CA 4QPZA 3G0DA 5C4GB 4E94A 2GNOA 2ODAA 1XYGA 3AF1A 3BGWA 3HYCA 4HGOA 3RS9A 2AKAB 5I9IA 5IZCA 4X1OA 2D7DA 2QYOA 2C04A 3ZBUA 3IIJA 5IXJA 1M2VA 3DBRA 1MIOB 1RQ2A 4YDHB 5IEBA 3TTUA 1RS0A 3ZWVA 3WIUA 2G3YA 3LT2A 1MQSA 2VJOA 1AS2A 1XEWY 5EWLA 1T8WA 3GUHA 5FLEX 1RD4A 4QO8A 3NVKI 1X94A 1HRKA 3OA0A 3OTOB 4Z2AA 2VJNA 1LK7A 1LNSA 3GMSA 1S4MA 3AR4A 4GI2A 2PPVA 1U8AA 4D3XA 4EUNA 4W9MC 2JIZA 1NRWA 2W9XA 3AT1A 3QU5A 3W9BA 2XGJA 1ZXLA 1US8B 2HZ7A 4U5XA 1L5FA 4ZQHA 2D0OB 1V9LA 4BO8A 1M33A 2A58A 4CIWA 4E5VA 3MJTA 2Y9MB 3CLUD 1I32A 1GRVA 1MEOA 3G7NA 2JIDA 4F3CA 5AW7A 4WLFA 1Y9ZA 3IRUA 1OXKB 1FIUA 1GYPA 4L8FA 3EUAA 3IPLA 4XDYA 4JSYA 1JXMA 3ZGYA 3K9WA 4LJ4A 3TGLA 3N6RA 1Z5ZA 1IN8A 4RVNA 1HFJA 5G0UA 5AK3A 3ZCPA 3SHFA 1IHXA 4DXHA 3L1JA 3BX1A 5CCEA 1BA2A 1CRQA 2RGAA 3TECE 2AOXA 1WTAA 4KQHA 4C04A 1MABA 1Y8QB 2XKKA 2ZWAA 2GF9A 3EJ6A 2E89A 1D2CA 3D4NA 3E9DA 5TMDA 4UTZA 3VSAA 4CBVA 3HZHA 3IQFA 3N0XA 3EW9A 5FPHA 3W3AH 1YIAA 4MYRA 1EBFA 3G17A 4KN5A 2QR3A 1I10A 3L6UA 4QOGA 2AFIB 1QTQA 2VP6A 3QIVA 3ESBA 4MI3A 1YJCA 3NHSA 1VLMA 3CX4A 3ZPXA 1Y1RA 3OOYA 1KAEA 3HYSA 3OMXA 1TYDE 3M6LA 5DYNA 1F0KA 3UGJA 4YJGA 4B32A 3M6WA 4I46A 3REGA 2WB2A 5DWVA 1NT2A 2G9ZA 5K3FB 1E1YA 5IM5A 1RPNA 2JHCA 2F1OA 1WQ4A 3NM4A 2BFBA 4RSHA 5DNWA 1XRLA 5KMGA 4XVRA 1FNNA 3N3BC 4QEDA 1NJ6A 1JHUA 5FFFA 3VKUA 3KHSA 4M1SA 4NFSA 3MB8A 3QKWA 4GHWA 2H4XA 3VSEA 2JH3A 4B9AA 2EQAA 4IOJA 2FDRA 4KQCA 1QZ3A 1GUAA 2JGAA 5KQMA 1YB4A 3L6CA 2JHFA 3UCFA 5HGXA 4K8RB 2O59A 1VJTA 1TK9A 1YS9A 2HCRA 3BD9A 2PQMA 4KRGA 3LX5A 1RIFA 3H4IA 2O0KA 1UH5A 3DT9A 4MW5A 5A5FA 3T5MA 1PQWA 1L4KA 3AUJB 2ZKIA 3H8SA 3RVRA 4I9HA 1H69A 1TDJA 2G40A 3HEMA 1NOKA 1X7ZA 4K7JA 3BSFA 2FN9A 2GKGA 3QNUA 4NC9A 1ZGCA 2NVOA 4ZAVA 4IQFA 4LHYA 1KMMA 2Y2VA 3VVLA 1RTTA 3OEHA 1N36B 2M1XA 3T7DA 3EBOA 3WKBA 4DMRA 4I3HA 3QVOA 5HM6A 1DKPA 3VHLB 4E30A 4FBLA 3J81A 1ILWA 4GLFA 1S2IA 3DAOA 3WGGA 3CVYA 1G2OA 3HZZA 2PKQO 3PLNA 1TQDA 3DYVA 1E4YA 1TX4B 1AQIA 3UXYA 4ATNA 1UKYA 1X39A 2B25A 1NOIA 3JQ8B 2AW3A 4KNVA 3SS8A 4CMKA 2AYXA 4URYR 5I7HA 3ZDCA 2J9RA 2P4HX 1FW6A 1G3MA 1F17A 3IP1A 5HKOA 1F0YA 4B4OA 3NYIA 1W2HA 4JBWA 4C78A 1WZUA 1AKVA 2Y0BA 3AR7A 5E3JA 2VAXA 3BEDA 3EFEA 4FLFA 4CG3A 3TK1A 4P7BA 5C2JB 3GHYA 1JHPA 3FGOA 3JAWA 9LDTA 3PK0A 2Y68A 3OPYA 1X13A 5HW0A 3JD0A 1Q11A 1RBMA 3R1IA 4Y2QA 3T52A 1H8ED 2B2NA 3QXHA 4HQ0A 2AC2A 1HT2E 3E22B 3I76A 3F2VA 3OWOA 1VHQA 2PU5A 1NDHA 2XUPA 4LNUB 1QFMA 2PS3A 3G1UA 4RL4A 3TINA 4MR7B 4O5AA 2OMKA 2Y99A 1QVVA 2D5AA 1IIRA 2R9VA 4H7DA 2EFGA 3KXPA 2YUIA 5HZHA 2AR7A 3LP8A 1RAAA 4FI3C 1FEZA 4V2UA 3OIFA 2YR0A 4X94A 4MJ7A 4ITUA 4GNKA 1RT9A 2GBIA 2OQIA 1VJGA 4EMBA 1EP1B 2YY5A 3DW1X 4FQ7A 3CLTC 2CDCA 4QVGA 1AGXA 2A0YA 4Q4HB 4S1NA 4CEHB 2J33A 1RM3A 5SYNA 1P2GA 1A8PA 1ZK2A 2O2YA 3GFGA 3OJOA 3U4QA 3THYB 1Z12A 3GLTA 2YVUA 4OGFA 3D6AA 3ZH2A 5BW4A 3FDIA 4TWIA 3KWJA 2FDCA 4JEIA 2BJHA 2XGMA 3RYIA 4ZK6A 3MUEA 4PRKA 4FBMA 1Q0RA 4NJEA 5IBPA 1J07A 2FSFA 3BGIA 3KYDB 4OP1A 1A2QA 5HFNA 3SSMA 1G2IA 1FX0B 2VNSA 4JT4A 1YUNA 2HF8A 2O2EA 1CG6A 3OTIA 1A9YA 3Q7SA 4D4GA 4N1AA 5DNEA 4NZZA 1FLAA 3D3EA 1UZUA 1XKTA 6GPBA 1FUUA 4P58A 4D3YA 3JD2A 3HJRA 3MPOA 1GU0A 1R50A 1T1EA 4LBVA 1KC1A 2XKJE 5K0LA 4F38A 1USGA 2JJ2D 4YPOA 3I2KA 5B7PA 5J2TB 1UIRA 5EP3A 1C41A 4FCVA 3S1AB 1WXFA 1XZBA 1MQ8B 1V3TA 2NWQA 3DEIA 2OCDA 2A30A 2Q4BA 4QUDA 3R7AA 3UHAA 3KZ1E 4PZ9A 1XSEA 4B3FX 2VR1A 5A4MS 1OZFA 3VBCA 3A1SA 5JNUA 1CJCA 1GUDA 2OWDA 3AB3A 3R8CA 5K51A 4B6JA 1LFDB 1QCYA 1ZO8A 3C2QA 2D62A 1E0JA 4BO9A 1S7CA 4PLYA 2ECKA 4BFSA 4J3NA 2Y0DA 2VRCD 3SGLA 3D4OA 3L0PA 4RH1A 3U4AA 2WM2A 4NR0A 1E5TA 1EDEA 4MWDA 3TLKA 4E22A 4YMSA 2XX3A 3UUWA 2AUMA 1NBOA 2J0QA 3OQIA 3I72A 2AJBA 4BRSA 1QUEA 1C2YA 3JVDA 4I55A 1EYZA 1DKNA 3A37A 3LPLA 4JI8B 2EL7A 5J4HA 2BCGY 2HU7A 1PJQA 4LWQA 4Z99A 5EMHA 1NBMA 2EFHB 4RQTA 5ELMA 2ZUDA 3T9CA 1UFKA 2OQRA 1MOZA 2BI4A 3DBVO 3A6FA 2PT6A 3IQHX 5ED4A 3IDQA 5MFPA 3WWOA 1GJRA 1RE0A 4K6KA 3RSSA 1HFWA 2V9PA 1Y8ZA 1S3SA 3RU3A 1U1IA 2OV4A 3M3PA 1RZ3A 1VCIA 2FW6A 3PHGA 2V4ZA 3B6MA 4KQMA 5A4IS 5BWLA 1B8NA 3CKLA 3RVNA 4LJ9A 2YV3A 4PC6A 2GVZC 1QO7A 5JPIA 1IZ0A 1CIPA 4FFSA 4MR9A 1S9HA 1RBZA 1ORWA 2P69A 3HVKA 4J2TA 4PPNA 4QJ4A 1Z13A 1HZJA 3DDWA 3PUKA 1X7XA 3WDLA 1UBLS 1ZA2A 1QFSA 2FPPB 3N2EA 4ND2A 1IN6A 1XZHA 3AC0A 4DSAA 4IIUA 4OXQA 2CJXA 1Q74A 1XQVA 4H18A 2PD6A 4DW8A 5KJCA 4MWCA 5LYJF 1QRAA 3GQBA 3R0ZA 5JDIC 3CVJA 1FLVA 1ODSA 5BR7A 5KQLA 3DM5A 3LXMA 1NAHA 4G41A 1MO4A 3K71B 2OGZA 4NS4A 1P74A 3PDIB 3W05A 5BQXA 1P5ZB 1R6TA 1E2EA 2OCIA 2IHJA 3H7IA 1DBIA 2JLWA 1BD3A 4UUPA 4CIBA 2ZE7A 1PX0A 2O2DA 3KELA 2J5BA 1M73E 4HLNA 4OIMA 4WKOA 4E1BA 2OVBA 3NX4A 5HK8A 4EPXA 2XMRA 5L3SA 4RTOA 1TGVA 1HQYE 1KI3A 4PZDA 4P36A 2DAPA 1HDCA 4LGCA 4N9WA 4MV3A 1H3FA 1CY1A 2E1PA 2RIRA 4JI2B 4UULA 3K4HA 4Z4CA 1VJ5A 2YWDA 3I04M 1XHFA 2VZLA 3SK0A 1PVOA 3DDHA 3H8WA 4CCAA 3UH0A 1H2EA 4YR7A 2CNOA 4IXWA 5GJVC 1RKQA 2B34A 3MCZA 1BMTA 1N5IA 1L5WA 3TLYA 4UCXA 4Z9XA 2VAMA 4DUPA 3EGDA 3TOZA 2HA6A 5CAEB 3OZ7A 3DXYA 4RZHA 2X6RA 2R97A 5A4JA 4KODA 1FU4A 2HSWA 4GS5A 5TGDA 5TJHA 3E1KA 1E9SA 3HU3A 1ENYA 2ZBEA 1R00A 2Z2JA 3NCHA 4FMPA 3STYA 4CG2A 1NFFA 5HTOA 2A94A 1A88A 2HA5A 2YMQA 4P81A 5J4KA 5CXXA 2CEAA 2B5VA 1QS0A 1LS6A 1A8HA 2PBRA 1EJ0A 3BTVA 3OP1A 3OURA 1S5PA 4FHZA 4OHBA 4EG1A 3GRPA 1B8UA 1QYWA 3LPAA 4KQ1A 2DCMA 1GCAA 4TKZA 2GXQA 3DV0B 4JGIA 1SY7A 1UBEA 1A72A 2ONYA 4IOKA 3V2IA 1A98A 3BFXA 4MW7A 1QZXA 3B6JA 1B76A 1XO1A 1UZNA 3C24A 2H11A 1L3CA 1ZGGA 3ONFA 4IS2A 4MUHA 2O50A 5JJIA 5KNBA 3BJIC 3MBOA 1LV7A 3A26A 3FYUB 5JI2E 4EPTA 1PLJA 3G23A 5E6UA 3MIIA 5LOVF 4TS4A 2R7MA 2O2CA 1DIRA 2B21A 3KDPA 5CLFA 2JEYA 4QREA 3SXUA 4F56A 3PGVA 1A04A 1BRMA 4X3PA 5ER9A 1F8YA 1LI7A 1YKFA 3L41A 3LKBA 5KHOC 1GLNA 5F3RA 3NONA 1KY4A 4HH3C 2KYRA 5FL3A 2JIPA 3N8IA 5ESRA 3TBHA 4G4SO 2IBTA 5DK4A 3RIMA 1M54A 1NTOA 3GEIA 4UNPA 4EF5A 1YRBA 4KVZA 4UFNA 3WS7A 1Z75A 4D96A 1H5QA 2W58A 4HNAA 1QP8A 1QHHB 2IU3A 4RBNA 3VR0A 3K9NA 4IJMA 5JY6A 1JAXA 2A9KA 4DRXB 1T9ZA 1RI2A 5BWOA 1ABBA 1A4UA 3KB8A 1QK4A 3MUOA 5GINE 4YLGA 6REQB 5J4VA 4YQEA 2GPTA 3LO8A 3ZR4B 2WHRA 1L1FA 3SFZA 5JYEA 2ZM6B 1SBYA 3ND6A 4X6YA 2O20A 4HP8A 1I4OA 2EKZA 1DFGA 4WBSA 1TQ4A 2WHEA 3AEQA 4RS3A 2NZYA 2BN4A 2PRJA 2VBGA 4OG2A 5A62A 1U0EA 5TPZA 2ODQA 1F9AA 3C1OA 3ROXA 4CMBA 3AR9A 5ALYA 1HQKA 3R0QA 5EXSA 5KNLA 2OO5A 4FFDA 1DIOB 1OIWA 2RAVA 2ZDQA 4MKIA 3SHTA 5IVIA 1SCNE 4BMOB 1QTNA 1TPZA 4XQGA 5TVKA 3EG5A 1TD1A 3RAGA 1A9QA 2RONA 4E4YA 2FRVA 3MD9A 4G26A 4Y98A 1UFRA 4QOHA 1MCZA 4ZO6A 1CQJA 2Q0HA 2CMFA 2NPOA 2IODA 5TR9A 3NOQA 3V1KA 3RE1A 4JIGA 1VZ2A 1Z18A 2I2DA 3PV0A 3A6KA 3B1FA 4GR9A 4YP7A 4DV2B 1ZFNA 1B14A 3KUCA 4YAEA 4Z8YA 4Z4GA 3PHHA 3KUDA 1O1YA 3AFOA 1CUUA 2IEAA 4WW0A 3V8BA 4KR6A 3WWEA 1CCWA 3O21A 4URFA 3OOSA 1WEHA 2P68A 3TVTA 4FYXA 1OJ7A 4DYDA 4DV1B 4H9GA 1M8GA 4KLRA 5IZCC 1GPAA 1JR6A 3PQ5A 4L8GA 1M6VB 1OA1A 1O6GA 1XF1A 1DRKA 3ZHCA 1D2RA 3MHPA 4GZMA 1FUKA 3DEKA 3UGKA 3UT0A 1VE1A 2FZVA 4D02A 4H7PA 4MS3A 4C4XA 2NSHA 3H2HA 1UOQA 4G1FA 2C7BA 2Q4RA 2V59A 3FTQA 4PPYA 2RJNA 4BQNA 4BV8A 4C0XA 3NUQA 2DWUA 4KV9A 2W11A 5BXQC 1ZR4A 1YBFA 4BVAA 3M9WA 2P2GA 2VDKB 2F3RA 1PU2A 3A6LA 1OWLA 4BX0A 1NBME 2QLMA 5L53A 4N7RA 3E9NA 5SZKB 1IEQA 2OV8A 1EDZA 2YZNA 4Q3BA 3TLGB 2DVMA 1P6UA 1MJNA 2VHZA 5HF9A 3KSDO 1UP7A 4L8WB 2CK3A 2JGNA 3EH1A 1OXXK 3SVLA 1GVHA 1H1TA 1KFBB 2J32A 1G0NA 3RODA 3VQTA 3EC7A 1SQSA 2JVIA 4MWZA 1GPYA 1N8TA 1ODJA 1ZH0A 3CWQA 1FDOA 4YAOA 3UTDA 5IF3A 4N5HX 3QK7A 1QRDA 2PGAA 4FDMA 4I6GA 1P7PA 4EKYA 4RV4A 1H2FA 2H51A 2RHHA 2PH7A 3L79A 5F21A 5U4XA 3G2MA 3BREA 3IBGA 3TVYA 5D5HA 3LQQA 4U7JA 5AWFC 3ZN2A 5AVQA 2W6ZA 3VGPA 2R44A 4UU8A 3L6OO 2O7SA 3FMPB 2FWRA 4MUBA 5LL6P 2AZMA 3VZRA 1JECA 5H9WA 1UT8A 3HN2A 1QH9A 5A02A 2OAGA 3FVTA 1MOPA 2JFXA 5EXTA 2HCBA 2YUTA 5CLHA 2ZQ5A 1CB0A 2FOIA 3K0BA 4R83A 3EPRA 3TUJC 2VP2A 4EHBA 4C08A 1EUYA 2RK4A 1GPJA 3EPPA 2G7ZA 3BXGA 1TL7C 3LP6A 4XJTA 4F11A 1NUPA 4IWXA 3LBYA 4JAVC 1EX9A 1UDRA 2R7KA 2V65A 1I4WA 4AC9A 4CL0A 3GAZA 1D8TA 3J80A 4IZHA 5KJ6A 1UPFA 1Z62A 5E8JA 3UAYA 1PNQA 3Q3IA 4I3GA 4QUBA 4CWAA 2BTQA 3C8UA 5EJGA 3GELA 4TSRA 3THWA 3CZRA 2I99A 1J0DA 3NEAA 1V48A 4ZOEA 1XD2A 3E2MA 1YRWA 3KD3A 3MGCA 2H1RA 4X63A 3WHIA 1V3VA 4XX0B 4B3MB 2VH1A 4WNCA 3R75A 1R4AA 1JSLA 1O0CA 4BX3A 1GAWA 4CKXA 1C3OA 2ID9A 2X22A 1GVNB 3WR5A 3R8FA 4UBIA 2WTEA 4K81B 4TN1A 2PX2A 1J0BA 2NU8A 1P0QA 2Z2IA 1WETA 1KMCA 2WWVD 3UJ7A 3USCS 2PZGA 3UIEA 2JGJA 1W8DA 4WN9B 3AJ8A 4ZXFA 1TUBB 1VA4A 1KYZA 1SUDA 2FFHA 3PNLA 4RO0A 1GUYA 3ZGVA 5CDSA 5JJBA 2WG1A 3JALB 3TOSA 2VO1A 4NZNA 1TZCA 1GPH1 3FDXA 2P5UA 4GP6A 2YOFA 3SIXA 3WY9A 1I7LA 2C2HA 3FNBA 4YLEA 4YONB 4L4ZA 3ZHVA 3E05A 4GMXA 4BN0A 4EHKA 5KYTA 3HI6A 2MHCA 1YI1A 4D42A 4ARVA 4RMHA 1BXKA 2V1UA 4MV5A 2UZ1A 4X1YB 3LLSA 3ISVA 1KZGB 1FRVA 4Y18A 2E5LB 1YZFA 1SU7A 2R8PA 4BPRA 3G5UA 2X40A 1YR2A 4R54A 4GUDA 5DIFA 3AVYA 1LDEA 4MW6A 2Q9CA 2HDHA 1PUIA 1XZGA 3HL0A 3O38A 4DLZA 3TEFA 1O5IA 4HATA 4ZRDA 5K8CA 4ZI3A 2E18A 4RIEA 1OILA 4DKXA 1OE0A 2W2LA 2IZ1A 4R9VA 2IEGA 1QF9A 1PO7A 1XLTA 1YKGA 3ETLA 3OIVA 4M1KA 1WKCA 4WHMA 3R3HA 4JOCA 6AT1A 5KB3A 1CQXA 1YQQA 2JZCA 3ESQA 4RK0A 3C97A 3MMSA 1L8XA 1C30A 2WHYA 1KQNA 4E07A 1MO5A 3K53A 4RESA 4OX9Y 2ORIA 2IF2A 3E0QA 4ZT2A 1BS2A 4Z4IA 3AIIA 2AR0A 3E0XA 5LIRA 4Y2YA 1BWSA 4FWBA 3GG2A 1TUIA 1PL7A 1SU4A 4J4BA 4UAUA 2I3AA 4ZCQA 4EF4A 5IS2A 1ML3A 4DLVA 3C5HA 3GLRA 4FPXA 3OVMA 1KSHA 3TNJA 1UKVY 2ADFA 4PN3A 1Z0UA 2GTIA 2VXYA 3UQZA 3S27A 1TA4A 1U80A 4LBWA 5GY7A 1HPLA 4REQA 1J2RA 4RU1A 1F7VA 4QBIA 3QV2A 5I7UA 1ADFA 1K7FB 4RLQA 4AJLA 2GJ9A 3QRWA 3G2HA 1C0IA 4JSRA 4Q9HA 3TYXA 4HWOA 4ZVTA 1JR4A 3H1BA 4S1OA 1TFUA 4BGUA 1C7QA 2JLZA 1M67A 3DEFA 3ROFA 3AM1A 4LJRA 1LPNA 3M8KA 1X8KA 3AVOA 3CR3C 4HC4A 5C34B 2G77B 2Q9UA 1SXQA 3BZWA 1U2QA 2JFVA 1DOAA 2A3NA 3QSYA 1N7GA 3PKIA 3N5KA 4C0QC 5ERGB 2AF4C 2QU8A 3GNQA 2B83A 4OIFA 2H1CA 4YUVA 2DMRA 2EFDB 4ZZIA 3KETA 2J41A 5IJWA 3FYTA 4LDZA 3GRFA 4LXYA 1V6SA 1I2CA 3GBSA 3RTBA 3GLFB 1AGRA 4XSGA 2XOEA 4EY5A 2VIIA 1NQWA 2GBGA 4HXEB 4N4AA 4CU2A 2XUZA 4EG7A 4GDFA 3ZE2B 4A23A 5BMVF 1H0SA 4LJLA 2ZIAA 3V8NA 2CLMB 2X8JB 4OQQA 2XTMA 4RHYA 1ACLA 1X0XA 1UUFA 2IXFA 2JIRA 5ALIA 2C20A 3UGQA 4HKTA 2LDBA 3ICQB 1DC5A 1T4CB 1NW8A 1AKRA 2D2FA 1KEUA 4J03A 1LBEA 2WTMA 4P86A 4IDHA 2ZB8A 4OHZA 5LZ9A 2E4AA 1GITA 3M3HA 3UJ3X 5LP6F 2XUKA 1E9RA 2IPLA 5A4AA 4ZJUA 1CWUA 4OLAA 3WLOA 4RY8A 4FYWA 4IIDA 3A6HA 3A9SA 1JH8A 3GU3A 3V6LA 5LWHA 2J3HA 1ZJ5A 2FTKE 1CEXA 1YJAA 3DLCA 1G63A 3JSXA 4H08A 1T10A 2Z04A 4JUCA 1T0UA 1CT9A 4KI7A 1PN3A 2XOKD 5L45A 1KEVA 3L07A 1F8FA 5DI3B 1OWNA 5AICA 5JE8A 4GECA 4V0OA 3EGWA 2FH5B 3HFRA 3W06A 2V03A 2FMKA 1IBLB 3CE6A 4JDPA 2CXPA 3ULKA 2GYUA 4UU7A 1FTWA 4AQDA 1ZD4A 2QZPA 1L8QA 2E4UA 2FRDA 1ZOIA 1H93A 3GMDA 1ABFA 5AKGA 1S4QA 3NW9A 4U7HA 3V2GA 4ASUA 3BJZA 2YW2A 2NYRA 2VBCA 1D0IA 1V4NA 5K3DA 1T91A 4TXNA 1CLUA 1DO0A 1T1RA 2EKPA 3LC1O 2A7XA 1VA5A 5G0VA 3F4BA 3A25A 3OLYA 2MYNA 5FORA 2PKWA 4EA7A 2OHGA 1KQFA 2Z1MA 4ZQIA 1V5IA 1QAQA 3M33A 4KZPA 1GL7A 3X1DA 9MHTA 1VRVA 3ZWXA 2C8KA 3I9KA 4ETNA 1Z37A 4R1LA 1EKXA 3HUEA 3WBKA 1AF7A 3PQDA 5ES4B 1SCAA 1V7PC 2H0AA 5HX7A 4IMPA 2PUFA 3O92A 4ND1A 2AHRA 3GCXA 2WQZA 4LVOA 5ENVA 2XWQA 3VNRA 2P6OA 5GQSA 4JQCA 3HUDA 2DFNA 3EXIA 2IYRA 2HJGA 3AERA 1A97A 5ETJA 1N4AA 3T3GA 4BNUA 3CF2A 1L5QA 4P4SA 4WXHA 3AF0A 3JAKA 2PJUA 1ZJZA 2Q99A 4ZRNA 3STTA 3K73O 1LKZA 3VHXB 2QUBA 5JXIA 5DHRA 1J7JA 2I1WA 3PSAA 3EPLA 3MJDA 1SD2A 2VWGA 1QIDA 1BFUA 2AXEA 2WM3A 5K0BA 2CW5A 2ZJ3A 3KM0A 1X9HA 5LXTA 2QRGA 3DHYA 1KGDA 1RXUA 2VTBA 4DLPA 1HI9A 3HN7A 5IT9A 3R3WA 1NASA 2V9ZA 3UPUA 3I6BA 2HFJA 3DEJA 1MG0A 4GYWA 4OYLA 3QSGA 1P7WA 4KAFA 4L6AA 5IW8A 3TCKA 4PLWA 3ZQJA 2NW6A 3WJ2A 2BRUA 4A8PA 5LMUB 4CEIB 1ZM9A 4E46A 2WDPA 1KEEA 2P3LA 1C3LA 1YC2A 1E9CA 1TO1E 1YL6A 1L7RA 1TIBA 3PNPA 3O26A 1XVAA 1XEXA 4OOFA 1ICIA 1V41E 2FWBA 4HQFA 4M1ZA 1KAMA 4TV8B 5HA5A 2ECFA 4O2BA 2C1EA 5FNZA 5CURA 1WU8A 2OFPA 1EFPB 1CUCA 1SZDA 2ZYUX 3DDZX 3K1AB 3NHWA 3WLMA 3B1WA 3IP3A 2BY4A 5C8XA 4KJXA 1EBUA 2J0EA 1JMVA 3OF2A 4I2VA 1PQUA 2GEFA 3ZWNA 3DE4X 1UF9A 5KQSA 4A2QA 1V47A 2OKCA 1N5OX 3FR7A 3UAVA 1T3ZA 1IUNA 3I73A 3IP9A 3P0RA 2NG1A 1TVKA 4GRIA 1YOVA 3Q6MA 4ZI7F 1E4VA 2C5LA 4FMDF 5HQJA 2W6CX 3HMKA 3ELWA 2G25A 2XRMA 3UJBA 4F3TA 3NMUF 3FR8A 4J49A 4C14A 1USWA 1DZ3A 1W0JA 1YRAA 4U39A 1VBNA 1NW4A 3PA6A 5A6VA 4AY5A 1KBZA 3VPXA 1DBSA 2GN4A 3II6X 3LM8A 3LS2A 3ZX4A 1Z56C 3DMHA 4C9BA 2H1OA 4IF4A 1Q19A 3AUUA 3QA3E 5DTEA 7ABPA 3N7TA 1JYFA 2NTJA 5KQPA 2PMBA 1F0NA 4G9BA 2E49A 3HCCA 5F51A 3KU1A 3PUXA 1DAOA 1EFVB 5JPDA 4FMCF 3J7TA 1TJNA 1HYBA 3MXOA 2CLLB 1UMKA 1I7PA 1WV1A 2AF3C 2R6AA 3LWNA 3PDUA 4PE5B 4R51A 5FCDA 1RE1A 4RYDA 3VR6D 2BFWA 3LUDA 3SEAA 1GPNA 2FE4A 2QRJA 4LHVA 2XNCA 5JD5A 2EFYA 5CNMA 4R2XA 1YFLA 1W96A 1B0AA 4QZVA 3G0GA 2P9YA 4JYPA 5JADA 1QGED 3IQEA 4M0PA 5K0FA 3HXMA 2V0GA 3KHTA 2WJIA 2EZ4A 4EP1A 1T5OA 2FPMA 1VHWA 3IAHA 4KDFA 4E3ZA 5C7YA 1YTLA 1GUFA 2XADA 3EF1A 4PSAA 1F2UA 3VDXA 2UKDA 1Y3DE 3RRJA 2VKTA 2OUIA 2DEUA 4Y2JA 3OFVA 4YAJA 3ZDZB 3WV4A 4MWGA 2OE2A 1E60A 4B1FA 1O3YA 3E5RA 5LQAA 1NT4A 1TLTA 4D56A 4FGSA 4TSKA 3V97A 1V25A 1W75A 3A4VA 5EJ8A 2XQKA 1V11A 4HHEA 4ILKA 4EY6A 1J99A 3RYFB 4MLCA 2BT4A 4CUJA 1NJ5A 2ZUVA 1V1RA 5JH7F 1UJBA 4LFBB 1LVGA 3SZOA 2REXB 1Y1SA 4L15A 7AT1A 5IHPA 1QH1B 4J0IA 1VIAA 3L8EA 2BMWA 2IPNA 3GRAA 3TF5A 1EP9A 3LRXA 5MF6A 2H1FA 5LQSA 4AB1A 1U90A 3ND9A 4CFYA 5LLSA 2GAOA 2XYRA 2PZEA 3GVHA 4KXFB 4J1SA 1BG6A 2O6LA 4XWGA 1NXQA 4CFZA 2XB4A 3KVRA 3R7WA 1ODCA 2CZCA 2P1DA 4M0CA 4ZCIA 9ABPA 1TM5E 4RTKA 3NFRA 1MB3A 1RXCA 3M6VA 2NO1A 4MVJM 4URUR 5AW9A 3ZYCA 5A3SA 1PCXA 2YV5A 1UC9A 4ECAA 3EC2A 4K1XA 4MQFB 3QV1A 3VDMA 2WTNA 3JVUA 5IKMA 2HH9A 4L51A 3QNWA 1X87A 1KF0A 1P61B 3LTNC 3G2IA 1W29A 1RWWA 1MNQA 4RAOA 1X7WB 2OFOA 4R1NA 1IQPA 5ADWA 4RKRA 4S3MA 1IFXA 1MJGM 1PR6A 1RVDA 1UWLA 1ZQ9A 4BJ1A 2OV2A 3F6CA 1JWBB 3KWLA 1I6WA 1UZMA 5EIBC 3CZCA 3R2JA 2PSJA 3QJGA 2EZTA 5BORA 1T2CA 1VPLA 3UOGA 4FIZA 5DBEX 2DWQA 3CHYA 4GKBA 3FB4A 1G8FA 4X85A 5CVUA 5FTJA 4JLUA 3ZBPA 5BY2A 3RAEC 1NDUA 4RVSA 5DW3A 3W2IA 2F43B 1XF9A 3GFQA 4B6QA 3IMEA <