3BORA

Crystal structure of the deadc domain of human translation initiation factor 4a-2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
194
Chain Sequence
EIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Human initiation factor 4A-II
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 194
sequence length 207
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3borA00
2RCNA 2QY9A 4Z8XA 2QT1A 4IXMA 1OH7A 2CJWA 1HQYE 1P6XA 4P32A 5CB8A 2FNAA 1I2MA 2G1JA 1HYQA 1KI7A 1QHGA 4LBYA 2FU5C 4BUJA 4PHHA 1NJFA 5SZKB 3KQKA 3HYRA 5EUQB 3VHLB 2VYFA 1LFDB 1VCMA 4KODA 1XXHE 1XMVA 2ORIA 4FMBB 4HZUB 4C0BA 2WM9B 1OF1A 4LC0A 4OHXA 3KB2A 2BWJA 4B3FX 1E9SA 2QPAA 4KFRA 3GJ5A 3MUFA 4BFXA 2C98A 1E2EA 1CR1A 1OFHA 2PBRA 1XB2A 1S1CA 4EFMA 4M1YA 1ESMA 2DHRA 4C4PA 1FP7A 3Q7PA 4CEJA 1JR6A 1F2TA 1N0UA 4S35A 3KX2A 4FW9A 4LJYA 4XSGA 3FPAA 1BO6A 1G5RA 4DUGD 4YMVA 3NG1A 4HAYA 1J7KA 4ASUD 4RD2A 1ZP6A 2PT5A 2QU8A 2XNDD 4Q4JA 5JEDA 4BFSA 4V0OA 3BAFA 2FFAA 2FSHA 5CITA 4CIDA 2OG2A 4ZDJA 3O8CA 3CR8A 4UNRA 1E96A 1VTKA 4PPGA 1E4YA 5JFGA 1QBKC 2FPLA 2X2EA 5ANRB 1Q1BA 5FBQB 4DDTA 3KQHA 1NVWQ 2P0EA 4F91B 3NDBB 1GRRA 4KXFB 1XPOA 2CJWB 4DBLC 4JSTA 2YV5A 5KOYA 5GJWC 5EP3A 2HJGA 3MWJA 3QKUA 5DYIA 3ICEA 1SHZA 3CNNA 2ZYWX 3U3MA 3K53A 3G0HA 1KJYA 4KU4A 4QRHA 1ZNZA 1P60A 1N6LA 5EE5B 2VSOA 1KI2A 2AWOA 1YZKA 1XBTA 1PLLA 3NIBA 4UQOA 4WIAA 3QXJA 3GLFE 1JALA 3BXZA 1JBKA 4OI4A 5GJVC 2ZIAA 2ZRNA 4MRNA 3V00A 3GMTA 4V0ME 5FL3A 2R2AA 1XCGB 3LO5A 2WJGA 1MT0A 1U8ZA 1XMJA 3QBVA 1N5LA 1SGWA 4HAVA 2A9KA 1TMKA 1YQTA 4PHGA 5E7JA 1UEIA 4OK5A 1CJMA 4K8OA 1E2QA 2R6AA 4WVFA 3K70C 4TLDA 1GIAA 1W44A 2IYXA 4P4SA 2Q3FA 5G40A 4HYYA 4RCZA 4CEJB 3DPUA 3NBXX 1F2TB 2FFQA 1Y3AA 1MV5A 3A4LA 1KZ7B 1N5KA 1E99A 2AL7A 2C8VA 4D4JA 1BMFA 2ERXA 4L16A 4D0NA 2I3BA 4XWAA 1KO7A 2WKRA 2EWVA 1OXTA 2OM2A 5KSYA 1S1MA 1SVIA 3U3RA 4KLZA 5KPDA 2JLRA 3P1JA 3RRZA 1XP8A 3SYNA 1QHHA 1M74A 3A4MA 3C14C 3EWAA 1KZGB 1F60A 1YZQA 1E32A 3HPRA 1T8UA 1ZCBA 2F9MA 3PEUA 2VTKA 3PITA 2P6RA 1KJWA 4CEIA 1U94A 3G5UA 1CF4A 2VO1A 4KI0A 2J46A 5KDOA 2C95A 3SYKA 4TMKA 2OLKA 4X8OA 4AURA 3GLFA 3LV8A 3KKPA 2QAJA 4U5XA 3REFA 1NL3A 1UM8A 4V0MA 2C78A 3L0IB 2HLDA 2IL1A 2MSDB 3HP1A 4GPTA 4F92B 2JJ1D 3CPEA 4ZKEA 2ZRLA 5DHFA 1KY3A 4OQFA 3U5ZB 5KUTA 1G291 3T1OA 3CIOA 3NBYC 1W36C 2NTYC 4A1FA 1QHXA 2UVQA 4L9SA 1QHSA 1ZD8A 2HYDA 3H2YA 1IXZA 2DFNA 1IJFA 1IOZA 3OE7A 4BEJA 5LD2B 1J99A 2GETA 2WKQA 5CM9C 3FMOB 4G5OA 4C2TA 4TZ6A 4P4SB 1SKQA 1Q3TA 3AF0A 1SVSA 4B76A 1G8FA 4KITB 4P4TA 1B0UA 2EYQA 1EWRA 3RC8A 4EUNA 3CONA 4I1OA 2F6RA 1UBEA 1OKKD 121PA 1G3UA 1TF7A 3UG6A 5JSZA 1QHHB 3RS2A 3LVQE 2Q0HA 1W49A 2ZS8A 4Q19A 2ZJZA 4IVQA 4PHTA 1X1SA 2O5VA 3AP2A 1EX7A 3IILA 4MKGA 2EQBA 3FFBA 3LA6A 4TTPA 1Z6YA 2GNOA 3A1VA 4CEIB 2VP5A 3TQCA 4MRRA 1EWQA 1AS3A 1R2QA 3GLFB 2AR7A 4CW7A 3IIKA 1A2KC 3MFYA 2C04A 2DFLA 2Q6TA 1P2VA 2B7BA 2A5JA 1SXJE 5JMTA 3REGA 1BMFD 2BM0A 5EXSA 4BZPA 2C99A 2HCJB 5J4YA 5JJIA 2WJJA 3QBTA 4OHYA 3I1FA 2CLDX 3OESA 3CRRA 5JBQA 3N5CA 4TZ0A 4TL9A 3RS0A 3KKMA 4DLWA 1AZTA 4DSNA 3SBDA 4QHSA 5IDVA 4BE7B 1A4RA 3DKPA 1ZC3A 4RFVA 5ELXA 4ZIRA 2WWFA 1T3LA 2IT1A 3QOFA 3C15C 1N6NA 2ZSBA 3A37A 3AP1A 3AKCA 1G4UR 2W0SA 4WBSA 5E4FA 4XJXA 1Z6AA 5LB4A 1N6OA 1Z0JA 2H57A 3AV0B 1F6BA 4DCSA 3AVVA 2D74A 2OXCA 4JVSB 1OB5A 1R8QA 4GT1A 3PV0A 4ITRC 1WBDA 2X2FA 1EFRD 3SBEA 4AKHA 1KDTA 1SKYE 2HLDD 1IN7A 1ANKA 4FXPA 4QGAA 3TSWA 4BRWA 3TW4A 3AVUA 1Z07A 3FYHA 5FI0B 3WY9A 3AVXA 5B58C 3LVRE 2DR3A 4PTLA 4PPQA 3HU2A 1JR3E 4G3XA 4Z1MA 1VG1A 2VP0A 1E9FA 2ZYVX 5CDFA 2X8AA 2QUZA 3PR1A 4G5RA 5SZIA 3I5YA 1II0A 3E70C 2FSFA 1G16A 2RGXA 2R6FA 3IO3A 1DTSA 4UNNA 3VKWA 4FI3C 4B71A 2JLZA 4XVUA 3U7GA 2OFXA 3OE7D 3I8SA 1LF5A 2ZI3A 2GTPA 4XD7D 4BECA 4TT3A 2QI9C 3NH6A 4B3DA 5J5CA 3SNHA 1NLZA 4JBXA 5A4JA 1VECA 4L9WA 1E0AA 3DVLA 1XMSA 4ZDIA 2R6DA 4MYTA 3CF0A 3QXHA 4CF7A 1I4LD 1WE2A 1JECA 2BOVA 3ZD6A 1VMAA 2G88A 1U99A 2D62A 1CJUC 2IUSA 5TV2A 2CHGA 2NIPA 4A8JC 3U60B 3QJYA 2BEJA 2ZVQX 1Z22A 1QF9A 2ZI9A 3MRSA 2JLQA 1J90A 4NPHA 4ZIRB 1LS6A 1EFHA 2JAQA 1G17A 5FR1A 2ZR7A 3RWMB 2ZRKA 5IHPA 3WBJA 4DCNA 2QG6A 3K0AA 4O25A 1FQJA 1PJRA 4Q18A 2GEVA 4ERNA 4IFBA 4MUAA 2JLXA 3T15A 3OFNA 3RRNA 5JLJA 2PEYA 1KK2A 1JR3A 1ZNYA 1M2OB 1P2TA 1OHHA 3QE0A 2BMFA 2XZOA 3W6NA 4HLDA 4IDQA 3AVWA 2CCKA 2DYKA 4W5JA 3OIUA 2HEIA 4POAA 621PA 4NTZA 1W4AA 3WNCA 1X8JA 1JEDA 4PR0A 4DCUA 4AYXA 3IBYA 1S0UA 1TEXA 3CNOA 4NYJQ 4G5QA 2NPFA 1ZM2A 3AVQA 3DL0A 1SXJB 5BW8A 2R9VA 3ZVLA 2G0NA 5TARA 3SOPA 4DEXA 2OFWA 4DLZA 1Z28A 4IDHA 2AXPA 2IYVA 5EP2A 3MWKA 1IM2A 4EPWA 3G82C 2N46A 4DCTA 2JJ2D 2CL7X 2FFBA 2EFEB 3UATA 1ZU5A 5JECA 1D8TA 2JDIA 1GNQA 4LY6A 4OBEA 3VNVA 1L4YA 3ND9A 1CBUA 1E2LA 2QTVB 4I1VA 2H17A 5EXXA 3RC3A 3KXLA 1N0WA 4QG7A 5DYGA 5JI2E 1KK1A 5F3WB 1GKIA 1XZQA 1MOZA 2G77B 3RVBA 3BWDD 1E9DA 1S2MA 4DIDA 4IXNA 1G7CA 4QGHA 2H7VA 5CB6A 4ACBA 1CJVC 2ASEA 2ZRPA 3WXMA 1PV4A 2OHFA 3SHFA 1SKYB 3VTKA 1JQJC 1P61B 4NL4H 4DJTA 3U4QB 3K0AB 4KCGA 1P73A 2BBOA 1TU3A 1IHUA 1HE1C 1E4VA 1XJ0A 3BB4A 5LD2C 4J0QA 2Z6VA 1KO1A 2J9RA 4C7OA 1XWIA 1YKSA 3IIMA 4TL6A 2R62A 2XSZA 2IC5A 1G7RA 1JB1A 3W3AA 1K5DA 3UKDA 3X1XA 4MRPA 1BH2A 2AWNA 4S2EA 2QQEA 1EESA 2GA8A 4IFEA 3H1TA 4QJ5A 1QHYA 1XRJA 2FWRA 3AF4A 4NYMR 2K5UA 4FMCF 4HLQB 4M9SA 1W4RA 4WXRA 2X77A 5JJKA 4TYPA 8OHMA 3JZMA 2BHRA 3GJ8A 4QM6A 3SZRA 2BMJA 3D8BA 3MD0A 2J0UA 4B44A 2FFHA 1I4TD 3K9LA 1TL7C 1XNJA 4RSGA 4Q9KA 3SDZA 4Q7JB 1R0XA 1DG3A 3Q7QA 4RKEA 5E7MA 4LSGA 4E07A 2IYWA 2QMHA 2V9PA 4D0LB 1TPZA 1YU9A 4NCJA 2FEOA 2O8BA 5GVRA 5G3ZA 4NBSA 1VCIA 2J45A 4HAWA 2UKDA 2OCPA 5B57C 4FINA 1NLFA 4F4JA 4G0NA 1F2UA 3FHOA 3SJAA 3RSOA 2ZETA 2QA5A 1D5CA 1ZBDA 2GJ8A 2ODWA 2WOOA 5AJZA 1MH1A 1Y63A 2YINC 2FMXA 1MRSA 3ADCA 1H8HA 4M2LA 3UWOA 2IEYA 1GSIA 4IKEA 5L3SA 1RRCA 3EPHA 4R98A 2XTZA 4UNSA 4QL3A 1J8MF 4NONA 4C0LA 3I72A 2RH5A 2JLWA 4C7OB 1M7HA 2GAOA 2PJZA 1ZUHA 2P5SA 3AVPA 2B7CA 2GKSA 1TEVA 3B1YA 3R9WA 3DMDA 4URUR 1G7TA 4Z54A 3KQLA 4KAXA 1C9KA 2GF9A 1E2IA 4R7ZA 2XGJA 3OEED 1JXMA 2IX3A 2QEQA 1GKUB 2ECKA 4G5SA 4JLNA 4M21A 2F3TA 2B92A 4PC7A 3ZH9B 4B6FA 1TTTA 1TADA 4V0LA 1NVVR 1SVKA 1U8YA 2W00A 2D4HA 5DE3A 4JL5A 3BGWA 3K70B 2AFIE 1S3GA 4YDSA 4US0R 3Q5DA 3QIAA 1K6MA 3M1IA 2J0UB 2NGRA 4RD4A 1G5TA 3KFVA 5FPHA 4FMCB 3AB3A 5C46F 3RS5A 1W48A 1GL9B 1AIPA 4HEJA 1KNQA 2VPPA 2CHQA 4ON9A 4LHWA 4IDOA 4WZAE 4JVNA 4EPRA 5L8VA 2IS2A 2O8BB 2WIAA 4LV8B 4PC1A 5A0FA 5JJLA 1C4OA 1L2TA 3I3SR 4Q4HA 2RMKA 4FCWA 2V54A 4XTCS 1X86B 5L3VA 2D7DA 2NO0A 2O0JA 1G4AE 5BYKA 1F2UB 4DSTA 2B8WA 1WDTA 4TWZA 2HXSA 2WPDD 5EP4A 1H8EA 3PG5A 3TUJC 4BFUA 3KQNA 2J0SA 2NMVA 5L3SB 1W5TA 2ZU6A 4JT2A 1VPLA 2EFCB 3W34A 2NO6A 4JLBA 1HEIA 1XDBA 4AWXA 2ZUCA 4RY2A 1EFTA 2NO7A 1IN4A 2V1XA 1KDRA 3W8NA 2ZI6A 5KNDA 3B9PA 2PZFA 3SJBA 2CCGA 1UJ2A 1GNRA 4N0DA 3LRPA 2PLRA 5EE1A 4QBIA 2XJ4A 5IRCD 2L0XA 2EFDB 5KSZA 2VA8A 4NHOA 4Q9HA 4WW0A 4DC9A 2GEUA 3C7KA 1ESNA 1OB2A 4Z51A 1YR6A 4BFYA 3E2IA 3QEOA 3H84A 3GEHA 4AKGA 2AK3A 2NO9A 1NG9A 3K9NA 3FDIA 3KUCA 3PUWA 3TGPA 1A7JA 4BFTA 1W36B 4URVR 3LH5A 1Z06A 2OBNA 3VR3A 1MO6A 1XD8A 221PA 3F3YA 1Q44A 3KUDA 4QFMA 1I4DD 2AKAB 2IYRA 1L7VC 4XVRA 4A9AA 1BKDR 1WF3A 1YZTA 3EA0A 4OHZA 3RS7A 3ETLA 2C9CA 1XJQA 4DLSA 4QJ3A 1D9ZA 1KO5A 4LYHA 1SXJC 5EZ6B 1TNDA 4DIEA 4IVPA 3GJ6A 1UBCA 4B74A 2XJ9A 2CVFA 1GP2A 1KI1A 3W90A 1UKVY 2OZEA 1XTKA 5EXPA 4M4SA 2IUUA 1XD2A 3ADDA 1NVUQ 2YOGA 1T8TA 1G3RA 2JLYA 2AKYA 1C1YA 4LBVA 3WMEA 4D6PA 3OEHA 3ZVRA 3VKHA 3X1YA 1E3MA 1NKTA 1DEKA 4LGMA 5FPSA 3CBQA 2GCPA 3K0EA 1MO3A 2F1JA 1OH8A 4JVMA 4YMWA 1CRPA 1ZM9A 5CK4A 4PAOA 3ND8A 3VKGA 3RRYA 4F7WA 4DXAA 4FN5A 4ZKDA 2Z43A 4Q1EA 3BORA 2BMDA 2ZJ2A 1KKLA 5GVSA 2A5FA 4UJ3A 1JNYA 1KI6A 4XWOA 4GDFA 1Q57A 3QSYA 2ZJBA 1CIPA 1P7CA 4URWR 3K09C 1TF2A 1KI3A 3RHFA 3CZPA 3W9YA 5EZ5A 1E79D 5CLQA 3VR5A 1Q3HA 1S96A 4II7A 4A8JA 3T61A 1YHNA 2EWWA 2WSMA 1ZAKA 3DZDA 4HB4A 4Q1DA 2F1RA 4D26A 1NJGA 4I1SA 1H8ED 1W7AA 4LJ9A 2RGGA 2KBFA 4ZI2A 2Q9BA 2CK3D 1ZNXA 5J40A 4G01B 3F8TA 1LB1B 4A0RA 3UK6A 3LX5A 2ZM5A 2R8RA 4NCKA 3S1AA 4L15A 1YR7A 3B1XA 5C2JB 2GAAA 2P6UA 3WNBA 1VYTA 4TTQA 2O8EA 4MQBA 2BV3A 4OK6A 3SYLA 1ZD1A 2D2EA 2FF7A 4M8NE 3T5DA 1XD2B 2CNWD 4QGGA 3QG5A 3KDSE 1XMIA 4KSBA 3OIVA 1E0KA 2JEOA 3NKVA 2HDNB 3H0KA 4CT4B 4Q01A 4I81A 4IOMA 1KAOA 1RYHA 4DHEA 3HPQA 3VR6A 4UNPA 2JA1A 1MKYA 2FH5B 2V55B 1W0JA 3IGFA 3L43A 5DHAA 3SEAA 1P2SA 4Q02A 4AYTA 2QM8A 4ZPXA 2R6CA 2I1QA 1W5SA 2KSQA 4JS0A 4LPKA 3B85A 5FPYA 1Q20A 2IF2A 3B82A 4Y0AA 3RYTC 2G1KA 2KWIA 2G3YA 1IY1A 1IAQA 1KI6B 1HT1E 5DN6A 2BKEA 3M6AA 1DVRA 3KB1A 3LXXA 3HYTA 4TLCA 2OSBA 2QL6A 4BWYA 1KSFX 1R5BA 1XXHA 4G1UC 1E9RA 1FW6A 4OJQA 1E69A 4MRSA 1JPJA 2ODEA 2CL0X 2H5EA 2FN4A 5C1BA 4A8JB 3O8DA 3CUEF 3A1TA 1P62B 4GZMA 4GSYA 5AUQA 1RVDA 4BASA 4TSFA 3RS3A 4MGKR 1Z6GA 2P67A 2EFHB 3A1SA 1AN0A 1OXXK 2OUKA 2GEDA 2QE7A 3NEYA 4D4LA 1CJKC 1DAGA 1OLOA 2PMKA 3VNUA 3CX7A 4IVRA 2IBMA 3SQWA 2GVDC 5K8TA 1YZGA 1BYIA 4ZI3A 5BN5A 1ZJ6A 3T35A 1R5OA 2HT6A 3S1AB 3EARA 3CF6R 1LY1A 4OK3A 2NG1A 4MGYR 2WAYA 1E2GA 1R0ZA 3RNLA 3WMFA 3IPYA 2QTHA 3LBNA 4B2PA 2O8EB 3KTAA 3RABA 4D0GA 2GK6A 1DO0A 1OIXA 2ANBA 3EC2A 2YKGA 1H65A 4KBGA 3RWOA 4UXHA 2MSCB 4CYMA 3AKDA 4QHTA 1KSHA 3U3OA 4UKDA 2ZUBA 4B3GA 5D3MB 3BIFA 3PCRB 5LPNA 3ZLJA 3I4LA 4PHFA 1U90A 5FOTA 3FHTA 4HAZA 3C16C 3JVVA 4NE2A 2BKUA 4IOJA 821PA 2QMEA 3UMSA 2R6GA 4NDZA 1CR2A 5BYJA 3SE0A 1U2RA 3B2EA 1R5NA 2GESA 5FI1B 1RKBA 1G9XA 5KPJA 2IXFA 3PUXA 4KJZA 1KK0A 1OYWA 1TUIA 1E98A 2C5LA 2NO1A 2X19A 3V4RA 3WHKA 2ZRMA 1XCPA 1XXHB 4AKIA 1CU1A 3TLXA 3QF7A 2BDTA 3Q85A 3CRMA 1N5IA 4P31A 2WBLC 2E87A 4B3BA 2AFHE 2PL3A 1G5PA 1GRQA 1P9WA 3MAAC 1X8LA 4LPSA 4JJKA 4QM7A 1XZPA 5E3HA 1XTSA 1HE8B 5JI3E 4Q21A 4C9BA 3HDTA 1RZ3A 2RGCA 5JZVA 2VF7A 2ZYUX 4PAMA 1FZQA 2PEZA 5GJBA 2CCJA 3E1SA 3HR8A 1CS4C 1ZCAA 4LOAA 4XH9B 2IYSA 4KYUA 1T5LA 2QBYA 1Z6XA 1ZD9A 4AC9A 2ZYTX 2QRZA 4M22A 2CLCX 1CKEA 5DN6D 2ZXUA 2IA5A 1UF9A 1IY0A 2G0TA 4X8LA 4M1WA 3FKQA 4P33A 3KTAB 2XOKA 3FE2A 2V6IA 3QPUA 3R8FA 1KAGA 2OESA 4B43A 3SJCA 3EXAA 3W8RA 4HB2A 2JCSA 4LDJA 2WKPA 3LLUA 2Z83A 4OKSA 3CF2A 2GJAA 4A2QA 1OE0A 3FWYA 5F9HA 3M4YA 2VP9A 3GLGE 2O8FA 1JJ7A 4V0NA 3K8YA 4F38A 2A5GA 1VYVA 3KXIA 3QF4A 2I1VB 1CXZA 5A5GA 1ZM7A 3KFXA 2VIIA 5KHOC 5B64A 5G41A 2GJSA 2E1RA 3KKQA 5E95A 2IS1A 2QZ4A 3B1WA 1VIAA 4NYIR 1XX6A 2QPTA 3NBZC 4HSEA 1T3HA 4BQSA 1K8RA 2Z4RA 1VIYA 2W6IA 3O8BA 1A2BA 1Z0DA 5JS8A 1G8HA 2WWGA 2IHYA 4M1SA 5AUOB 4BEBA 3LLMA 4A0HA 1UBGA 1G8YA 4ZCIA 1EFUA 4HB3A 1N6RA 3VFDA 4BFWA 3HU3A 2V7QA 5TXGA 3ICQB 3ONWA 5DI3B 5TB5A 2RGDA 2Z0MA 1WRBA 2FX3A 2EFGA 2ZRFA 3VMFA 5FPTA 2GXAA 4KFUA 2QBYB 4HAXA 5BN3A 1ZW6A 2QGNA 4Q48A 4Y0VA 3KL4A 3BH0A 3NH9A 2IYUA 1Q1EA 3CPJB 4QJ4A 1U0JA 3CRW1 5HE9A 4KLNA 1PLKA 3K9GA 1VG9B 4P0TA 5H8WA 1MO5A 2IYYA 1YVDA 3ZJYA 4B3CA 3UANA 2FEMA 3OAAA 1Z3IX 2DPXA 3KZ1E 5EE3A 2WWIA 5DO9A 1PZNA 1U9IC 3GLGA 1R4AA 1E9AA 3AVTA 3GJ0A 3PXGA 2REXB 2X1VA 3AQ4A 3TSOA 2AD1A 3DEFA 2W58A 1RE0A 4KO8A 4TMTA 1ZMXA 2QORA 4PPFA 1U0HC 4RZ3A 3B78A 1OFUX 2JGNA 4O2RA 1PVOA 4Q9LA 4P4UA 1RPZA 2O8FB 1M8PA 3SFZA 1SXJA 3LQQA 1G7SA 4HZIA 5L3RA 1K5GA 3KJHA 3QF4B 2CL6X 1EXMA 4D4MA 4E5UA 3T1TA 2D3WA 4TLEA 3KKOA 2HUPA 1HT2E 2CE7A 3AM1A 2XOKD 4CT5A 4R9UC 2GILA 1G1MA 3L82B 2ZSAA 4RD3A 1OPXA 3GPLA 4B47A 4JKYA 4GP6A 5HE8A 2W2TA 2FOLA 3AKYA 1UDWA 2QP3A 2Z4SA 4A6PA 3AEZA 4B2IA 1VG8A 1NBME 3EZ6A 2WAXA 1ETUA 2H16A 5M04A 3KJGA 1M1YE 4C0QC 5CYOA 3ZZ0A 1G6HA 1WCV1 5KU1A 1YR9A 5FFMA 5J4LA 2VHCA 4MYCA 2WWHA 4Q66C 4A4DA 3GFPA 3QXCA 5FBLB 4QC2A 2ZU0C 1XEFA 4JZKA 2NQ2C 3KJIA 4US2R 2QP9X 3U4QA 4RZXA 2PLFA 2ZSEA 1E6CA 4LUCA 2JLVA 2BCJQ 2GJ9A 3A1WA 4Q9JA 5HCNA 3U7EB 2C9OA 2AN9A 4US1R 4NYJR 2VH5R 4TMZA 3K09A 5J47A 3EZ2A 3PUZA 1NVXQ 2WWYA 3KQUA 1XF9A 3KKNA 3BFKA 1U8AA 2J1LA 2ODNA 4K46A 5TVKA 4AG5A 3ECCA 4BLPA 4OL0A 4PO8A 2ZRDA 4MA4A 3GLGB 2RB4A 5HKKA 3GLHE 5DNYB 3I61A 2OO7A 2RAPA 1G21E 1IN8A 1XJCA 2RHMA 2GK7A 2GWHA 4GFDA 4N0EA 2KJQA 1CULC 3HU1A 3T06B 2YOFA 5CYPA 3BB1A 3VR1A 5C18A 2YWHA 2REOA 3A36A 1DOAA 4HDOB 4URYR 4C0SA 4NZYA 4C0HA 3UMRA 3IHLA 2WSSA 1DG1G 1L4UA 2N1BA 4W7SA 2AHOA 2C2HA 1NBMA 3E5HA 4EPXA 2FA9A 5KSPA 3BJIC 1S4QA 3LD9A 2IYZA 2RHDA 2WMOB 3J81k 3OAAD 2QROA 3KJEA 3R7WB 3K9HA 1G8GA 1OFIA 3N70A 5CLLA 3R20A 4HLCA 3LW8A 4HUQB 4A0GA 4URXR 4O2LA 4Z1MD 4R2IA 3LBHA 2YOHA 5FOXA 2V6JA 3BBPA 2FPMA 3MGCA 2BMEA 5UKDA 2WJIA 1FNNA 1W0KA 2YZ2A 3A1UA 1SXJD 4HATA 1II9A 2IWRA 1NY6A 5JS7A 2B21A 1DS6A 1XCMA 1LV7A 4TT3D 1AM4D 3CX8A 3K0SA 1E2JA 4I1UA 1FL9A 1AJEA 1ZVQA 1Z83A 2A3RA 2HXYA 5K8IA 3L8YA 4PXAA 5HZHA 2HYIC 2J0VA 3MCAA 4R2HA 1P2UA 4GMDA 3WRYC 2AK2A 2BBSA 2YWFA 1QVAA 3NWJA 4L5BA 5CJPA 2QTFA 3ZDQA 2ZR9A 1CRQA 3WHLA 3P20A 3WP1B 3MMPA 4YMTA 4H9GA 1R6BX 2HF9A 2ZS7A 1VHTA 1IQPA 1HH4A 4L4UA 3TVTA 3U3KA 2OV2A 1R7RA 2DY1A 2GDJA 5FUYA 3QVVA 5FBVB 2FJUA 3FFAA 5HPYB 3PENA 4JLKA 3OFND 3THWA 4PC2A 3AVYA 1NIPA 1WQ1R 1T9HA 3GFOA 1JR3D 3QNUA 4PSVA 3B5JA 4CZ2A 1OHHD 2GZDA 3DM9B 3M0EA 1KO4A 4DVGA 2WZQA 1KYIA 1XTRA 4IEEA 3C5CA 4OQNA 1GKYA 3OIWA 2G6BA 1A82A 1TQ4A 1T91A 3WMGA 1AS0A 4UXIA 2A2ZA 1XEXA 2Q3MA 3DOFA 1DE0A 1OT3A 1P5ZB 4HI0E 2CXXA 2VP6A 3OHMA 5FBWB 521PA 2CHVA 1LS1A 3TE6A 4CEHB 3TUIC 2UZIR 2XNSA 1R0YA 4JLVA 4HAUA 5DIFA 1OV4A 2YVUA 1J8YF 2QMUA 4MKIA 3B1ZA 2JDID 1RIFA 4AKEA 2BCGY 3FHCB 5AJVB 5KO2A 3QI2A 1V5WA 1QG4A 4YLGA 4PQFA 1WA5A 3W6PA 4MYUA 2QSZA 1FPMA 2BM1A 3OF5A 2IXEA 2ZRJA 4O0MA 3FMIA 3TJZA 1HA3A 2PH1A 2WJVA 3B8HA 3MSXA 3BRWD 4MUBA 4ZDWA 4URZR 5AJXA 4RD6A 1ZINA 1TU4A 4B35A 2ZJYA 2Q9AA 1XTIA 4YQFA 1COWA 4ZCMA 3NVAA 1UPTA 2MMGA 4TL7A 3TAUA 4E09A 4QNMA 4TMWA 1KIMA 4EJSA 4R71A 2VQSA 4F93B 3MJRA 4YMSA 2UZ3A 4OQMA 5BN4A 3BH6A 3THWB 2VBCA 3ASZA 3D6TB 3W3ZB 2HT1A 2XITA 1RFLA 2XSZD 4TMVA 3PEVA 4O3MA 2FSGA 2YNMA 1RRPA 2BJVA 2DFTA 1IONA 1E2KA 1YR8A 3ZS9A 1SVOA 4A2PA 1G3MA 2IF0A 1Z8FA 2F9LA 3L2OB 1ZC4A 3CZQA 5FUVA 1R8SA 1M7BA 4XWKA 1EG7A 4OHVA 4E22A 4BGDA 1HUQA 2OFOA 1XPUA 1G64A 1R10A 4ZCLA 4IEIA 1XEXB 1GFIA 5AWFC 2PZEA 3I5XA 2CLSA 2QAGC 3CWZA 2WICA 1D2EA 1RYFA 2C96A 4K81B 3K70D 3GD7A 1T3SA 2DWOA 4IJMA 2OCBA 2GBLC 2A78A 4BZXA 2FSIA 3P4YA 1LW7A 2E9SA 2GF0A 1NVVQ 1Z0IA 2QNRA 4L8GA 3SFVA 1QHIA 3CWQA 3OZXA 4NU0A 4ZV4A 4JYCA 4QHYA 3A58B 4NCHA 1Z08A 2YC4C 3CLVA 4LRWA 3SJZA 4CVNA 4W9MC 1GNPA 2FDCA 1VDZA 4HDQB 2VEDA 2QPOA 5AJYA 3X2SA 3WBKA 5KTYA 4JLJA 5JHHB 1QG2A 1DO2A 3Q3JB 2BVNA 2CVHA 1OSNA 4RFSB 4LV6A 3DMNA 1FX0A 2NZJA 3TNFA 3ZVNA 2GVZC 2IXGA 5DLQC 2A7QA 4BLRA 1IN6A 4V0KA 2MMCA 2ZS9A 2R65A 5IF9A 3P26A 3VU9B 4MKFA 2ZI4A 3RANA 2O8CA 1CTQA 1ZM4A 1H8HD 2ZSFA 1Q12A 1X6VA 4FD2A 4PZYA 4YC7A 4EJSB 2W2VA 2AD5A 3QVUA 5AJWA 3VX4A 1WBBA 1FMLA 4JMPA 2WVJA 1NMYA 1UFQA 1NSTA 3GJ3A 1BIFA 1FMJA 1RJ9A 1U81A 4NCIA 4PQYA 5IT5A 3EPKA 4DUGA 1N6KA 4DRZA 2A5DA 1IXSB 4C3ZA 4ASUA 3BD9A 1FQKA 1OFTA 2ANCA 3C41J 2ZITA 3U2QA 5H1YA 4LX0A 3P27A 3GJ7A 1DAKA 1VHLA 3CO5A 4XSHA 5JRZA 1NNEA 1U9IA 1VKJA 5FUXA 2AXNA 3CRVA 4B75A 5J4HA 2Z5FA 5B30A 2I4IA 1JI0A 1E94E 1P3JA 1W36D 5G53C 4LHVA 2ZE5A 3SU8A 3IPXA 4MDFA 1OJLA 1D9XA 4DWJA 3T1QA 1AA9A 4AI6A 1NN0A 1ZUIA 4TL8A 4KHZA 4F4CA 2EW1A 1M6NA 3EX7C 4IHQA 1EX6A 5FPKA 2IHBA 3BFVA 1NMZA 2P2LA 4DLTA 1YZNA 2NZ8A 4TYNA 5KNCA 3SQXA 2Q9CA 1Q1QA 2MSEB 4ESVA 1TF5A 2IK8A 5FR2A 4A6XA 2IEZA 2LKCA 2O52A 3Q72A 3CM0A 2JASA 2NPIA 3F5FA 4TQ9A 3AGQA 3BK7A 4DEYA 2J3EA 1XEWY 3IBGA 2H18A 1IN5A 4MGZR 5SZHB 2ZE8A 1ONBA 5KNBA 4LJAA 1VCNA 1S9DA 2QENA 4W5WA 4EIWA 4LJ5A 4AY2A 1FX0B 1TQ2A 1OW3B 5TMPA 4MYHA 3WP0A 3FTQA 3VQTA 1WP9A 2F7SA 3VR2A 2YWGA 2O8CB 1W2HA 1WMSA 3TBKA 3AKEA 4HUTA 3PQCA 3RRMA 2ZRCA 2ONKA 3BE4A 4IDPA 2HJVA 1E1RA 2ZROA 3A4NA 4DSOA 1RJ9B 4QKQA 4EFNA 4GOJA 4Q1FA 2PJRA 1GAJA 3H4MA 2BBWA 3EZFA 4EKDA 3CPHA 3QG1A 5H68A 4DLRA 1QZXA 1GL6A 2CE2X 5G3YA 4ZO4A 1JAHA 3KXKA 4C0AC 1NKSA 2H8KA 3MWLA 2WWXA 4PSAA 4BRUA 3AP3A 5D3MA 5EE0A 5AR1A 3PEYA 3K0CC 2F55A 4OI1A 4GL2A 4LJ8A 3CB4A 4U7DA 2RGNC 2IS4A 5DH9A 1QRAA 4G5GA 1N6IA 2JIZA 3AF3A 1NLYA 2IYLD 2JJ8A 4LC1A 3FVQA 3DDCA 2V1UA 1E9EA 1D2NA 4FCVA 5K8LA 1PUIA 3LFUA 2R44A 3QQ5A 4UNQA 2BC9A 1NG1A 4YDHB 1NMXA 1UBFA 1TQDA 2GCOA 2C77A 1KMQA 3RSLA 4HLUA 2JJ1A 4QGFA 3ZS8A 3ZZTA 1KY2A 2J87A 1XD9A 2DWPA 2D06A 2WOJA 4ZDKA 4C2UA 2P3SA 3OEHD 5FOWA 2FPKA 3SR0A 4ACAA 5KYKA 4C30A 4PSKA 1Z47A 2BBTA 2OBMA 2ZE7A 2ZI5A 4DB4A 1A5TA 3N2EA 4LHZA 1SVMA 2OCYC 3PJRA 2KE5A 4U02A 4B48A 4JBWA 2ORWA 5HR5A 3WYGA 3CNLA 4Q7LA 3LAWA 4QXAA 5JWOA 3QEJA 421PA 4BPBA 5CIQA 3I62A 4AK9A 2XB2A 1F5NA 2Q3HA 2RGBA 1BS1A 1T4GA 3I32A 3IO5A 5KDDA 1Q0UA 4PZLA 2CBZA 1JAIA 1CP2A 1FTSA 2OT3B 1OKKA 2F43A 2OILA 2O0HA 4M9QA 4Q9IA 1HQCA 4N3NA 1KHTA 3UWKA 1ZYUA 3MJHA 1J2JA 4WXPA 2KI5A 1X8KA 4B3XA 3GJ4A 3U7HB 5FBRB 4OI0A 2V8OA 3TIFA 2ZQ5A 2ZRIA 1OXUA 4M1KA 3OIYA 4LBZA 3QENA 4NKRA 3DZ8A 3WNDA 2F3RA 1SULA 5FUWA 2QM7A 2GZHA 1SVWA 5D3QA 1KSJA 4A2WA 4KYIB 2W6JA 2F1IA 1HURA 1F48A 3NEJA 2VRWA 2EVWX 4KFTA 1E1RD 4MRVA 1E2HA 2PX3A 1N6PA 1ZM3A 3TR0A 5FTJA 2TMKA 5F9FA 2GCOB 1DAFA 3MG9A 3IEUA 3I92A 2OE2A 1E2NA 1NN3A 4JBYA 3W6OA 1US8A 1G19A 2J59A 4Q4JB 5C4GB 2P5TB 1KI4A 1XU4A 1OXSC 2XEXA 4M1OA 4TQUS 1ZUNB 5HCIA 4HB0A 1OH5A 3SHWA 4B73A 2QMOA 4LWZA 1AKEA 1G3QA 1JXOA 3X1WA 3HJNA 1UDXA 2PT7A 3DOEA 4M9ZA 1W0JD 5KDLA 4PZZA 4ARZA 3ZVMA 3ZGXA 5DI3A 2JIZD 3C8UA 3AF1A 3LDAA 5EE9A 4EPVA 2Y8EA 4RCYA 5K8UA 5F2EA 3TSZA 2A30A 2PZGA 3PFIA 1EFRA 3D3QA 1I2DA 3EWSA 3JZAA 3QUSA 4EJSC 4PANA 4RZUA 4JL8A 4TQAA 2J0QA 3TH5A 3CRQA 1N25A 4DB2A 1DAHA 4LK2A 4U00A 1SZPA 3I8XA 3K1JA 4QBGB 1X3SA 5FTMA 2F43B 1E2MA 2PCJA 2VHUA 3IQXA 4DLYA 2ZRBA 1CJTC 1E2PA 2ZUDA 4LBWA 5EUMA 1NN1A 1YRBA 3IDQA 3U7FB 5FL7A 3UPUA 4TLBA 5LBIA 4M53A 3TKLA 3FOZA 1S9HA 4TSFD 5DGXA 1ZIPA 4A82A 4OQXA 2FZLA 2QE7D 4B34A 4BLQA 4XD7A 4EQ6A 4JVLA 1RW4A 4DLXA 1UADA 4LZZA 1S8FA 1DELA 1GTVA 3R8CA 3T1VA 1R0WA 4B6EA 1FTNA 5AK0A 2KB0A 1W4BA 1AS2A 1CLUA 5JCPA 1E0SA 1T5IA 3GQBA 1XPRA 3UXMA 4F4IA 1LF0A 4PO9A 1OH6A 5JWRA 4D4KA 3AH8A 4N1AA 4NCNA 1US8B 3UIEA 3DO6A 3B6EA 1GZSA 1O3YA 2Q21A 1GDDA 2ZTSA 4JL6A 2IWHA 4CRWB 5TDHA 5EJEA 3GJXC 3IEVA 2BJWA 4EAQA 1QDEA 2G9NA 4EPTA 2QAGA 4H1VA 4BFZA 4ARZB 5CDFE 3ZQJA 1TUEA 3BERA 4C0KA 4GZLA 2W6JD 1N6HA 1A1VA 2GBLA 2GXUA 1SQ5A 2LKDA 2QRNA 4GI7A 5FTLA 4Q4LA 3DKVA 5L3QA 1NSFA 1LVGA 1DAIA 5JEEA 3IKJA 4PO1A 1MO4A 1GOTA 4RD0A 1NY5A 3R9IA 3L0OA 4QOSA 4OYHA 1Z29A 4AIIA 5LDDC 4JLMA 4PQRA 4WA7A 3IUYA 2J41A 3CW2A 4DKXA 4EPYA 1L8QA 1NRJB 1YJ5A 1MR3F 4ESHA 1MABA 1W2GA 1X1RA 4JT4A 4FMDF 4D2IA 4Q7MB 3EG5A 4LCBA 4IOKA 4EQ6B 4NYIQ 4MDEA 3R9XA 3QY0A 1UKYA 4KFSA 3RDPA 3SC3A 3GEIA 4DT1A 2GCNA 4GOKA 1NP6A 5BWMA 2DBYA 3TQFA 2JJ2A 1KDPA 5DISB 4TYQA 3DM5A 1DAMA 1JQLB 1NN5A 2XTMA 3O47A 3SN6A 3VX3A 3PVSA 4D82A 1J70A 5BXQC 5JCZA 1GUAA 3TUZC 3P32A 3DHWC 4UJ5A 4FWTA 2F1HA 4M0LA 3ZD7A 5JSZB 3U3JA 3IIJA 3QKSA 2ERYA 2CEAA 3FMFA 1FOEB 5FL7D 3A6PC 3NC0C 3R7WA 1CEEA 2VSFA 3MWYW 2JATA 4HUQA 2OAP1 1KJZA 4OI2A 2QAGB 4WAUA 1AQUA 1FFHA 3H86A 1YZUA 1XTJA 4JIMA 1AK2A 1P72A 2ZI7A 3C5HA 3QKTA 3ADBA 1JPNA 1OXVA 2CMKA 1P9RA 5L3QB 3IHWA 4Q1AA 5TY0A 2OBLA 2FGJA 4GBMA 4Q4AA 3PUYA 1M7GA 4TYYA 4WZ6A 4LYFA 721PA 2EYUA 2GZAA 1Z2CA 1IXRC 4FWIB 1P9NA 4YMUA 1ZRHA 2OAQ1 3LBIA 1Q22A 4Q47A 2NOAA 1AQYA 3FGNA 2WTUA 5J4KA 2VHQA 4Q00A 2XZLA 2W6ID 3AUYA 2ZRGA 2ATVA 4DZZA 1MABB 5LB2A 3EW9A 4A0FA 4GNKA 4H1UA 1E9BA 2V7QD 1Z0FA 2VLIA 2FGKA 4TLAA 3T5GA 2XX3A 1KKMA 4B2LA 4M9XA 3TVDA 1W47A 4LJ4A 3B13B 4PC6A 4TTRA 4DT1B 2OLJA 1SVLA 4FMDB 3GEEA 4A36A 4D80A 3WRXC 2GHIA 1Z2AA 4JJZA 2G83A 4JKIA 2LWIA 3VHXA 5FH9A 1AZSC 3RLFA 2V3CC 4LYJA 1QHNA 1FP6A 5DSZA 1TAGA 1UAAA 2OCAA 2WWWA 3QXSA 3T34A 5IK2A 1BYUA 3QKSB 2XAUA 3BOSA 1N5JA 4LHXA 3TRFA 1N2CE 1NF3A 1VG0B 2ZE6A 3L8ZA 4HLUC 2J7KA 3ASYA 3B60A 3NDPA 4Q1BA 1MRNA 4QBFA 2WV9A 1QVRA 3THYA 4X8MA 3K0CA 3V4FA 6Q21A 3PEWA 4TMXA 3U61B 2RGNA 1T6NA 3TMKA 2OXRA 2YWEA 4LI0A 1O87A 4Q1CA 4OQLA 2DFKB 2QSYA 3TR5A 5J4VA 4A15A 2ZANA 3NXSA 4BLTA 1ZNWA 2VHTA 1RRFA 4MH0R 2O8DA 1FUUA 3B7GA 4Q4AB 3GP8A 4CGZA 3VR4A 3W5IA 3F0TA 1U0LA 4DLUA 4CEHA 1CR0A 3AUXA 3NHAA 5HTKA 3EPLA 2J7PA 3N2IA 3X1ZA 2XXAA 2RKOA 4WOPA 4PAQA 3WYFA 5H70A 3OEEA 2VF8A 3Q5EA 1F3OA 3GLHA 4V03A 1G6OA 3CH5A 4Q7KA 4LHYA 2N42A 3K0FA 4IRUB 3FB4A 4BZQA 4TN1A 5KSOA 2ONJA 2CDNA 3LWNA 1GRNA 3I73A 3BFXA 1UEJA 2JLUA 4GOXA 3VAAA 1KO8A 1GM5A 2ZRHA 4MITA 3AGPA 4JLOA 4MKHA 4D25A 3ZQ6A 3GLIE 1ZIOA 3LNCA 2VL7A 1VCOA 2ZJ8A 1DPFA 3JVUA 5HZKA 4KBFA 3O8RA 1G8PA 2HV8A 1S3SA 2DCUA 1KGDA 5FTNA 2ZREA 1Z63A 1W4CA 3CX6A 4M1TA 4YXWA 2ODBA 2FV8A 4XVQA 3BH7A 1ODFA 5FOUA 1KSGA 2EU8A 1Z0AA 4JLPA 2YC2C 3EA5A 1Q1ZA 3X1DA 4IDNA 1UKEA 1KOFA 1IJEA 1YRAA 1NI3A 2P6NA 3T12A 4C0JA 2YHSA 3BC1A 1V43A 1XEWX 3FKSA 2H1LA 4X8HA 4DCVA 3C4JA 3THXA 4HDCA 2ZPTX 2KBEA 3AVOA 1JJVA 3SI7A 3TK1A 2WPDA 3THYB 4ABYA 3HR7A 4V02A 2BEKA 3GCGA 1II8A 3QPVA 3WYAA 5HKKD 1BOFA 1EK0A 4JLDA 4DDUA 1GILA 2HCBA 5E7IA 5CK5A 1IBRA 1Q21A 3U44A 1RC8A 3BS4A 2YJTD 3LW7A 4IW3B 1EFCA 4GP7A 4BLSA 4ILEA 1U98A 1WB9A 2O8DB 5C4MA 2W2XA 2XB4A 5JRJA 2ORVA 1W46A 1YZLA 3B1VA 2WSSD 4B33A 1B23P 3QXXA 4BLOA 4NYMQ 1LNZA 1NBMD 2PCLA 2XXAB 3U6BA 1N3BA 5EQTA 4P3YA 2P65A 5BQ5A 4IOLA 1E1QA 2QN6A 3PIRA 1KK3A 3GLHB 5IK2D 3QKRA 4LYAA 5FOVA 2FE4A 3GLIA 1SHKA 3K0FB 3ZIAA 3EZ7A 2OEPA 2RGEA 2GJKA 2WHXA 1FNMA 4GRAA 3RAPR 4RFSA 3UMFA 3NBFA 2BIFA 4JSYA 2GRJA 1HTWA 5EP1A 3CH4B 4DLVA 1Z5ZA 2DB3A 1W0KD 1KMHA 1N0VC 4RVCA 3P4XA 3VU9A 2H92A 2PX0A 1T0HB 2C9YA 5B2ZA 2D2FA 2WJHA 2B6HA 2WJYA 3GFTA 4OJKA 1DADA 3L0SA 4M1MA 4YONB 2IW3A 4PX9A 4QBHA 2J7PD 3EIQA 2PMDA 1VYUA 4PFSA 1E9CA 1CR4A 3LQRA 3Q9LA 1LTQA 2J5XA 4JYBA 1NIJA 4RD1A 2W0MA 4RKFA 1GG2A 1RRGA 2D7CA 2IUTA 3LX8A 5CJ2A 5JWHA 3THXB 5F98A 1GL7A 3EASA 1PUJA 3IQWA 4KSCA 1KTVA 2GXSA 4WZBE 3EPJA 4Z8YA 1D6JA 2WIBA 1II8B 5CM8B 2SHKA 1PLJA 2IYQA 1GITA 3HWSA 3U44B 1G3IA 1OIWA 2ZAMA 4PC3A 5CIWA 4TYWA 1D2MA 2AX4A 1XFAA 4CDGA 3A8TA 3BB3A 2ZJOA 4OHWA 1ELOA 2IS6A 1G20E 3RS4A 3EIHA 4UXJA 4JLAA 2LCFA 4YXWD 1TX4B 3EZ9A 4QNRA 1G18A 1KI9A 3W5JA 1GVNB 1E79A 1XTQA 5GADl 1P4SA 4NMMA 4D81A 4EFLA 2RGAA 3AF2A 2QQ0A 5EXTA 1E2FA 5P21A 3QKRB 2QT0A 3GLIB 3FKSD 4LJ6A 3ADKA 2ATXA 3PUVA 2A5YB 3SS8A 3FMPB 2HF8A 5DI9A 4B32A 5JHGB 1FUKA 3NHBA 4Q03A 4RZ2A 3Q8XB 4NP6A 2GXQA 5AUNB 4KVAA 1T0JB 2CK3A 5GJCA 4XIGS 4AG6A 1HV8A 1KMHB 4LJ7A 1HY3A 4LV5B 4PPNA 4W5HA 4DDVA 4FIDA 1DARA 2XTNA 4E03A 3QPWA 1KNXA 1E2DA 3MLEA 3LXRA 3NTUA 3CKLA 1DAEA 2CNWA 1AGRA 2ZVPX 2WMNB 5AUPB 1AKYA 2ZEJA 1E1QD 1TQ6A 1ZU4A 2ZR0A 3L0PA 2FG5A 5SZJA 1WXQA 1Z6TA 4HZUA 1DBSA 3EIEA 3NC1C 3ZIAD 2XNDA 3THOA 1G41A 3EC1A 4DSUA 5FTKA 4DDWA 2ZSDA 2VSXA 3TW8B 2VP2A 2ZRAA 4MGIR 1AGPA 1KI8A 3B9QA 2DWQA 2REBA 1W1WA 2C03A 2VHJA 1YE8A 4XTRA 4AYWA 4XOIA 1COWD 2ZJAA 4A92A 1KDOA 2VP4A 4I99A 4KV9A 4I4LA 1UKZA 4GMXA 3V9PA 1Z0KA 3ZZUA 4Q5IA 3EAQA 2IYTA 2ZJ5A 2QGZA 1OYYA 4NH0A 4RJLA 1P75A 3TAHA 3D7MA 2QP4A 4Q4HB 4KVGA 4FCTA 1E0JA 1JEEA 1M34E 3U6KA 3D31A 3LY5A 2FZ4A 2V4ZA 2B8TA 3ZYCA 1OIVA 2W83A 2O0KA 3CR7A 4BFVA 5FOSA 4AD8A 2JLSA 4EDHA 2ZAOA 1EGAA 3UG7A 2YYZA 1IY2A 1GWNA 2XZPA
chains in the Genus database with same CATH superfamily
2RCNA 5LQRA 2VT7A 5IWAB 5B3JC 2XCRB 4H77A 2M6LA 4DY6A 2FZGA 1XDSA 3HEBA 3A4TA 4X00A 5CHEA 4RXTA 4RKQA 2CJWA 4DSAA 1P6XA 1Y1QA 2VDLB 3ZCTA 3ZDDA 5LZ7A 3I8OA 1K68A 1LZLA 5LDHA 1UIMA 3CEPB 3ISTA 2GAIA 3IJRA 1HYQA 1KI7A 2CXHA 4J49A 3CTMA 4JB3A 2RSLA 1EP9A 4LBYA 4P2BA 1Z2EA 4BUJA 3CR3C 4WNAA 4OA8A 1NJFA 1NKVA 4UTRA 5SZKB 3GAZA 4BMXA 5F7XA 1MBZA 4KODA 4RZSA 1R0KA 3PXXA 1XMVA 4KQWA 4MUKA 4C0BA 2A6PA 5CFLA 3U4AA 3BIWA 2W5UA 3JYQA 4C4TA 1OF1A 2Y1WA 1FP4A 4AF8A 1TYBE 5FQOA 2HK8A 1YIOA 1K6EA 3MUFA 3LBYA 2G17A 4BFXA 2ZB4A 5K51A 5ETJA 4KR3A 1XB2A 1S1CA 2H0AA 3HYLA 4KXWA 3T95A 4QXRA 3UAZA 4Q93A 4M9UA 4A10A 2DHRA 2IZZA 4WY5A 4C4PA 3HQ4O 3WRXA 5BOVA 3OLQA 3HDGA 2LNDA 4JI6B 1C2TA 2OOSA 3O84A 4JB0A 2VK8A 4S35A 3KZNA 1WSDA 2XUPA 3IP1A 1PFUA 3EGWA 1ABEA 3KCNA 3KX2A 3LHDA 2GD6A 5K6AA 1ZWLA 2H9YA 1TA0A 1NZDA 5AVWA 5E9JA 4K6CA 2AFVA 2WYHA 2ZB7A 1ZP6A 4U0KA 2PT5A 1VPVA 5ADUS 3UAYA 3UXYA 4GH5A 3RODA 3FWKA 3BAFA 3DCYA 4MVWA 1ZUNA 4WESB 1C9DB 3MN1A 3I76A 1LRKA 1Z35A 3CR8A 4B3MB 1A8HA 3AI1A 3E48A 2JIMA 2HIGA 3BBLA 1OI3A 3FR8A 5JFGA 4DV0B 1YQWA 5F12A 1SQSA 2FPLA 2X2EA 5KWIA 5DCYA 1DEHA 1DFIA 1L0BA 2MWMA 1A9RA 3F6CA 3PR2B 3WTBA 4BMCA 4F91B 4KXFB 4PCLA 2C07A 5FEUA 1XPOA 3NVKI 2CJWB 4HQOA 4JSTA 4GX2A 1QR6A 3ICEA 1JFFA 2E85A 4FKBA 3P9IA 2O3UA 1EJ2A 3E9MA 5I7VA 1D2CA 3K53A 3PUIA 1XCOA 3MPOA 4L51A 4OATA 4CMGA 2AZXA 4DOMA 3LDGA 4QRHA 1TKCA 2QW0X 5CURA 5IS2A 1OR8A 5FHQA 1SXHA 4ZTBA 2AWOA 3R3ZA 4J29A 1XBTA 3NIBA 4UQOA 4WNAB 4WIAA 3QXJA 1JALA 1JBKA 2PX5A 4OI4A 2ZBUA 5DBGA 4F3YA 3H4IA 3H5OA 4MRNA 3V00A 3TI9A 5IU6A 2FUEA 3HGTA 1YUNA 4DA4A 2R2AA 3QNMA 5KNBD 1FP4B 4I50A 1U8ZA 3QBVA 4TRJA 2OBYA 3V8NA 1YR1A 5JY6A 2B35A 3B3QA 4EYGA 3TLBA 3X1JA 4PHGA 3X1MA 1Q0HA 1WO8A 4W1SA 8ABPA 3DTNA 5FNZA 1TT5A 2R6AA 4ME6A 4W5RA 4BQEA 1GIAA 1H69A 3WJ7A 4JJFA 3I04A 4BYMA 3M4NA 2Q3FA 2P2ZA 5G40A 4HYYA 3G5LA 3R3JA 3DPUA 2Y2UA 1KDVA 3O3MB 4B0PA 2G1UA 5IFKA 3A4LA 1KZ7B 4IIYA 5IKOA 3VA7A 1W25A 1F3LA 4L8VA 5GY7A 2X0KA 4D0NA 3N0XA 1ULAA 2GN6A 4R68A 3NOVA 1V1RA 1S1MA 1DIGA 3N74A 1VA5A 1Y5LA 2OCDA 2PFKA 3IVAA 4KLZA 5KPDA 1QHEA 3QLVA 3RRZA 1XP8A 1YZFA 2WD9A 4ZOBA 2H7YA 3C14C 3EWAA 3SYNA 5IVPA 1F60A 2JD0A 4HWPA 3AL3A 1H9CA 1CUSA 4WMLA 2Z3ZA 3KOOA 3PEUA 3WGNA 3BDIA 1I51A 1SHTX 4WGGA 4XYEA 2VC2B 2D3TA 4LGVA 1EP3B 3CO0S 2PD6A 4QU0A 1U94A 4I1YA 1FBTA 2JCGA 3TMAA 2VJQA 4CMKA 2C95A 1G8AA 3O03A 5IZ4A 1QMPA 2JIQA 4X8OA 5AM4A 1JSLA 3LV8A 1FLDA 5ICEA 4N9QA 3RUIA 3T38A 4WK6A 3LWBA 3VPDA 2YW9A 1RQXA 1UM8A 2VDWA 5DKFA 5H81A 1DQZA 3VR6H 4HHEA 4GPTA 4KRYA 4ITUA 1WDMA 1RE1A 2X0NA 1QUFA 3EYWA 3VGPA 3DOCA 4D45A 1RZRA 1IBLB 4Z4EA 4LRSB 2ZRLA 5DHFA 1KY3A 4ZKEA 4OQFA 4RDXA 2BH2A 4U7WA 3NBYC 2NTYC 2OAGA 2UVQA 1PJLA 1QWSA 4G1MB 4LIPD 2P6MA 2NWQA 1MGOA 3PGA1 4YRSA 3WGIA 5LD2B 2CXUA 5E2IA 2CMDA 3H2ZA 2GETA 4DWWA 1FW8A 3GHYA 1GO2A 1NXSA 1TT5B 1SPBS 3I05A 4RULA 4R83A 1TKBA 4GEGA 1SKQA 1V41E 3DF7A 3RHTA 4I4TF 1YOVA 2FWIA 2FZKA 2WNIA 1FTQA 1GTL1 3AF0A 1HT3A 3ZNQA 1Z8DA 3KE8A 1ZEJA 2OV4A 2Z3VA 4UAJA 1B0UA 3GR6A 4N49A 4TZTA 1UBLS 3RK1A 3RC8A 6GPBA 4F3NA 1IUNA 2G8NA 1AN9A 1IPEA 1C8LA 1SC3A 1KMNA 1O08A 1SK9A 2OHGA 3DAHA 3R6GA 1V1RB 4KG7A 1U3VA 3JWPA 4D5EA 1V0JA 4TWJA 4EYSA 1O58A 5A4AA 5JSZA 3NNDA 2Y3IA 4HWGA 3AESA 3AR6A 1IBCA 5AOVA 2X6QA 1C4KA 4U7PB 5DNDA 4ZVMA 4CIYA 1EVQA 2Q0HA 4ZVRA 4JDUA 2QTWB 4AJNA 2Z08A 4MCJA 3U5TA 3NUGA 2I6UA 4C6SA 4EBBA 4PHTA 5IJAA 4IHJF 1R74A 1X1SA 3AP2A 4KO1S 3AF5A 4MKGA 3R7LA 3FFBA 3LA6A 1KKUA 1V3UA 4F72A 4TTPA 2H1HA 2GNOA 5FLKA 1WMBA 3RTAA 4EBFA 3IEKA 5DWDA 4IIEA 4L27A 2C1XA 1KFEB 4RLQA 1YMQA 3TQCA 2O48X 4TKUA 3ER9A 1IMJA 2J30A 1QDLB 2PBZA 4M89A 2VYVD 1V37A 1J25A 1A2KC 1L3CA 2C04A 3BRCA 3OF3A 2QLBA 3GYBA 2A5JA 2VJAA 1USWA 3GVIA 1BMFD 4N0QA 2BM0A 4YP5A 5EXSA 2C99A 2M1ZA 4MUMA 3JATA 3RKSA 3F74A 3KIPA 5J4YA 5F52A 2PU7A 3NHMA 1KS9A 3PA8A 4MPDA 4MPPA 2NZVG 3RQIA 5EJ7A 4Z4GA 4INZA 4OHYA 3I1FA 4KQEA 1TECE 4FEAA 5CLGA 3KKMA 4E11A 1JLLA 3MVEA 2W2OA 3DZIA 1A4RA 4RFVA 1X7ZA 4BAUA 4HAIA 5ELXA 4ZIRA 1E2BA 1TD1A 4IILA 4GYKA 4XQEA 2V7PA 4YCBA 1VKRA 3QVTA 1QZ3A 1G6KA 1ID8A 2JCXA 2NXCA 2ZSBA 1B42A 4OLHA 4Y7DA 1R64A 5CLIA 2RDMA 1U02A 5LQNA 5LB4A 1JHPA 1DEXA 3Q8MA 2H57A 2MT9A 4WOKA 8GPBA 4JODA 1QG6A 1R8QA 1YOVB 1ZSYA 4GT1A 4ZARA 3H2IA 4RSRA 1JDBC 1WBDA 3Q7SA 4UVEA 3TQHA 4BNFA 5ED0A 1GGFA 3SBEA 3O6VA 3V7UA 3C24A 4EJMA 4QVGA 4C7KA 4YIHA 2ORYA 3CB2A 3T1YB 5GAJA 3FYHA 3O4GA 1PVDA 2VVTA 3QVMA 2BKXA 3LOQA 5FI0B 3NJRA 4EI9A 2Q8QA 5IKMA 1Z7GA 1J2EA 1WCXA 2Q5FA 1IVNA 3C6ZA 1DQYA 1BCSA 3BJMA 3IBTA 1JR3E 4PTLA 3AESB 1VG1A 5CDFA 4BAZA 2WE8A 1KFBB 4HJRA 4FE4A 5KX5F 2HWWA 1PL6A 3PR1A 5SZIA 5TGZA 4ZQIA 5AVYA 5HRUA 3VKWA 1NW3A 4OHBA 4FI3C 1D2GA 3RFXA 4RVUA 5E1OA 2OFXA 2WMDA 3IC5A 1FF9A 2HIHA 4QDJA 2JF0A 3AXTA 1F1JA 1XNHA 2HQOA 4XD7D 1RD4A 4AXXA 3FWZA 2X1LA 4PSUA 4TKUB 4BECA 4E13A 1VLMA 3VI4B 5A4JA 2FQYA 4ZGWA 3OHPA 2QJWA 3DVLA 1E0AA 1HT0A 2ZJ1A 4JT9A 2Q8PA 2QW1A 5J2TA 1BD3A 2I87A 3CF0A 1GLVA 3DV0A 3P2YA 4W8GA 5DTEA 3JATB 1XZCA 1WE2A 2NT4A 5AKGA 4YT2A 3F6PA 2R8BA 3ZD6A 2KM1A 4EFLA 1LI5A 4W5TA 3FCUB 4YUAA 5ESRA 2IUSA 2NIPA 3L7DA 3ADPA 5ELLA 2DTEA 1OX5A 5D5HA 1R6XA 2ZI9A 1SCJA 2X1HA 4JHXA 4ZIRB 1J90A 3WE7A 1EFHA 3AHDA 1CS0A 2B94A 1G17A 3GUVA 1GL3A 3EDCA 4LHSA 4CI0B 1FQJA 2OCXA 1FFDA 4QT0A 2GEVA 2OHJA 4ERNA 3MIZA 4R31A 4Y6LA 1KR2A 2LGJA 4IFBA 1ILEA 1Y4ZA 5EKXA 5TC4A 3T7EA 4HR7A 2PVPA 1PJ3A 5CDUA 5JLJA 3ZU5A 1PZMA 1J97A 3V48A 4OQYA 3LGXA 3HI4A 2O2JA 1M2OB 4KGZA 1LGYA 2BF7A 4BP9A 1QGDA 4PX2A 3N07A 3ZCRA 5IDQA 3LWZA 1CETA 1Q84A 1Z88A 3W6NA 4E15A 4IDQA 5KTTA 4FB4A 2Z95A 4LVNA 3IDSA 2P41A 3OIUA 4R2MA 4W5JA 3WGYA 4AZ0A 2H52A 1SMKA 4OYRA 5GOZA 3GMIA 1BCSB 4HGRA 4POAA 4NTZA 5FWXA 4UFPA 1QRDA 1JEDA 2IPOA 1JN0A 3K9QO 2XUIA 1VHQA 3EVTA 1TEXA 5EUCA 5IAJA 3TZ6A 3ZU2A 1W34A 3DL0A 4AX8A 3NYIA 5FORA 3CH6A 3LQFA 1SOWA 4G2NA 4I9FA 5C4IA 2EW2A 4L28A 1GTSA 3ZX4A 3SOPA 3SOZA 1U63A 1I1OA 1V7PC 3O1JC 3T52A 2I76A 3N53A 4CKWA 3JW8A 3PFKA 2Q2QA 1RZUA 3F98A 3PUKA 1O5TA 1Y3FE 3QLUA 5J2TB 1W4ZA 3DV0B 3I39X 3R2JA 2PRJA 2NQ8A 5AIBA 1I7PA 4D9EA 2V74B 3VNVA 4LDAA 2O3TA 1CBUA 3RC3A 4I1VA 3KVNA 3Q5GA 2D5IA 4HF7A 4JSRA 2JJYA 4K86A 1C7QA 1KP3A 3L06A 4E1BA 1XZQA 3R7DA 2ZGVA 2G77B 3K35A 3EZYA 1OBOA 1ZI6A 2EZTA 3BWDD 3BRWA 2AI3A 1XZFA 4G23A 2C9MA 2DR0A 5BSGA 2H7VA 2O2EA 1CS0B 2GI4A 3HJRA 4K6HA 2ZRPA 2ASEA 4RDIA 3TPFA 2QD4A 2OHFA 1SKYB 1HLFA 2CY0A 2J09A 2OFPA 2YS7A 4NL4H 1Z5UA 3TQRA 3U4QB 4C0WA 2OC4A 1DWQA 3WAGA 2Q62A 2PMCA 4K2HA 4YROA 4ECEA 4ZI7A 2EGGA 4BGVA 1E4VA 3NVDA 1KARA 4J0QA 1QP8A 1ARZA 1CR6A 2PUTA 1HL7A 3P96A 1IB6A 2EW8A 4DA6A 5FWYA 1H6BA 5HUHA 4K0KB 3MNFA 3V2HA 2R62A 2XQVA 3GJSA 2IC5A 1JB1A 3UKDA 4FYPA 3NFRA 1BH2A 1ZR2A 4AZ0B 4HGQA 1RI3A 4QOIA 4S2EA 2QQEA 4DXDA 2DT5A 2EBUA 3AI3A 1EESA 4ARCA 2NTNA 3PF8A 3E7FA 2D0DA 4YP0A 3RRXA 5FWXB 1VCHA 2FWRA 5A3RA 3IQFA 2IZ1A 4BL5A 2K5UA 1UDBA 2PPLA 1GCAA 1W4RA 2D8AA 2OTCA 3KT0A 4M9SA 4RBNA 4TYPA 1JHOA 4L07A 2B36A 1THTA 3A7EA 4F3CA 2Z5VA 1BHJA 4DJJA 2FMFA 2BMJA 4PZUA 1SXQA 4ZRMA 4B5LA 2M9MA 3KC2A 4B44A 3EDOA 4CKWB 5DM2A 5CM2Z 2HHAA 3EPRA 1PZHA 1WZNA 4LY0A 4RADA 4WXEA 5ALGA 5E7MA 2WFZA 4CTNA 5HF8A 2YMLA 1IG3A 3WL5A 4WADA 5D3ZA 2Q7DA 1VJ1A 3SM3A 3JD0A 1TPZA 1YU9A 4GLLA 2X5XA 2O8BA 2C8LA 3DB2A 3U4HA 5A5FA 5K01A 5TY0A 3QHPA 2J45A 1E4OA 3ONFA 1KVUA 1LC0A 4BKPA 2GPJA 2AMYA 4QQ8A 2PX6A 1ZGCA 3ESYA 4B8YA 4FEYA 3DV9A 1MC4A 4G0NA 1IEXA 4WLFA 2DWCA 3OFJA 4YK7A 3P9RA 4W8HA 2QA5A 2QF7A 2XQIA 1MH1A 1QIJA 4Y6QA 1QR2A 2IVFA 2VAPA 3QUAA 5KAPA 3ADCA 3HN6A 3UWOA 2H85A 1GSIA 2VEOA 3KLNA 1CZUA 4IKEA 4ZI7B 3UGJA 4JUBA 4R98A 4FDMA 2XTZA 4UNSA 4QL3A 1J8MF 2Q0XA 1WUTA 3DA8A 1NXPA 2X4GA 2ZCVA 3I72A 1AQIA 2GMWA 1F4VA 1FU7A 2PJZA 5FWYB 1ZUHA 4JU9A 2B7CA 4HH1A 3TOCA 3DMDA 4YMLA 4RHTA 1QIFA 1YL6A 5FI5A 1C9KA 2D59A 1E2IA 1HEYA 2GF9A 2NO4A 2QNIA 3EDMA 2QYHA 1JQEA 3IOEA 3ITKA 1C3OB 5EJIA 5ARDA 3TMYA 1NQTA 3QUCA 5ES3A 1JXMA 4MVJA 1D03A 3E8MA 1ZA2A 4TWIA 4BV2A 1VYHA 4G5SA 5BT8A 1TTTA 4M21A 3MJTA 1ESZA 1MOQA 2B92A 2W6NA 1T4CA 3FYUC 3PGXA 4OAPA 3ZH9B 4V0LA 1NVVR 1SVKA 2JGEA 1QG0A 2WG1A 4GM4A 4M0KA 7YASA 2D4HA 4XI9A 5EJFA 1M1ZA 5DE3A 1JZSA 3TW8A 4JL5A 3G9ZA 4Q4DA 4G1VA 2UUPA 3LUBA 2AFIE 1YHYA 2ZDGA 3V4SA 2Y0CA 1V1MA 2WWRA 5I3ZA 4KGXA 3TLCA 3NRBA 1K6MA 3M1IA 4A8TA 2NGRA 4RD4A 1PBTA 4Q3LA 3OJFA 3UICA 1WLSA 3AB3A 1MQAA 4BQIA 4JA0A 5C46F 2XXJA 1SK8A 3NAGA 4V0RA 3RS5A 2J9ZB 3AEYA 1R8YA 3N8HA 1AIPA 1QYXA 2PSJA 4MQEB 2V7WA 4EG6A 2YYYA 4JAVC 4K6MA 3TJRA 1KNQA 2VPPA 5M29A 2AOUB 2FEWB 2WF6A 4HZGA 2W90A 2J67A 5AKIA 4IQGA 4JVNA 5K7SA 1JHYA 1OTYA 2O8BB 1MB4A 2WIAA 4LV8B 3KM0A 2QTGA 2Z2XA 3BCSA 4FCWA 1GQSA 2V54A 4DG8A 3D3NA 3MTGA 2VWPA 2WHPB 4IICA 4NI5A 1DQNA 3RVSA 2D7DA 5LWQA 3L6CA 1MX9A 1MZVA 3DMTA 3PBKA 4FYIA 4DSTA 1FCJA 4JXZA 2G63A 1XQVA 1JMYA 3CXRA 4HL6A 3T3DA 4LDQA 4EJ2A 3TM5A 5JH7B 3KSAC 2BEWA 3OZEA 5ECWA 4IO0A 1VE6A 2H2AA 1XDBA 4AWXA 1B26A 2ZIZA 4FWBA 2BYTA 1EFTA 2NO7A 2NU7A 4RVOA 2NN3C 4YS6A 4OAQA 2ZI6A 2VDKB 1LDBA 3B9PA 5KNDA 1O6BA 3OU2A 1UJ2A 2BJHA 4BNIA 5H3LA 4ZYTA 1JKIA 2GZMA 4QBIA 2XMZA 3RVQA 2P4QA 4K40A 5IRCD 1Y9ZA 1SEPA 1E64A 2X3FA 4NHOA 4R3NA 2GEUA 4FONA 1KZ4A 4BFYA 1XKTA 3QEOA 4R7GA 3GEHA 3VBCA 5AVXA 4JOSA 1NG9A 1EE2A 3C3JA 4TOIA 1K8YB 1IXKA 2EG9A 2UVPA 1A7JA 1L6RA 3PUWA 3L77A 4NU8X 3VPAA 4BFTA 3LH5A 3TGPA 1Z06A 1GDTA 1XIVA 1T4CB 1O9BA 1PKXA 1XD8A 3WRVA 3F3YA 3GFVA 3VO2A 4K0RA 1WXGA 2AKAB 3LZ6A 1VKOA 4A9AA 4E31A 2C2MA 3GARA 4YQZA 3EA0A 4FOTA 5AHRA 3TPCA 3IUEA 1V1MB 3ZU3A 4DLSA 2PNFA 4M86A 4DMUB 1LZKA 4TV9F 1SXJC 4I6EA 1KOJA 1EZ1A 2Q1SA 2NUAB 3NMUF 4IVPA 2L17A 4IIUA 4ROSA 3D3JA 2Z1DA 4U4AA 2WU3A 1LLQA 1GP2A 3C43A 4OLFA 1KI1A 3SMQA 3UV7A 3ENQA 4JEUA 4C76A 4M4SA 3ADDA 5TPWA 2CUTA 2YOGA 4O8CA 1WXHA 5BO5A 3H99A 3WMEA 3R24A 2J08A 1VHJA 1PG5A 4UUOA 3UW3A 1E3MA 3IPCA 1ILWA 3V1LA 2O2IA 4KQGA 2OPBA 2PJUA 3K0EA 2JBAB 3HSKA 1OD6A 3GN1A 4G1CA 4LOHA 3VOSA 3LBAA 4JVMA 2P2GA 1ZM9A 3WLAA 2BEWB 1IYZA 3C6BA 3VKGA 1ZCJA 3KZXA 3KWFA 2OECA 4FUQA 5AVJA 3SICE 4IP0A 2G4LA 2ZJ2A 2NU7B 2OGTA 3KZVA 3AR7A 3I01M 3ZV7A 4ENUA 4XWOA 3W2HA 2OHIA 2QLLA 3N0VA 3SEFA 4NFYA 4KZPA 4URWR 3K09C 5AM3A 2Q6IA 1U2ZA 4S1NA 1E79D 2J3HA 1XTZA 4M7RA 5AXDA 3VUFA 5DTIA 4ZYXA 3CRZA 3ZNOA 1NATA 4R0NA 4A8JA 4IDCA 3IKTA 5KYNA 3T61A 2UVPB 2XVMA 2EWWA 4PZPA 1Q19A 2WSMA 3DCJA 4S1WA 5G2OA 3R8XA 3RTCA 5K2OA 2FMHA 3MTEA 1F8GA 4QOJA 5CVTA 3HSSA 3HEMA 5CDGA 4D26A 1H8ED 2ID9A 4L72A 3D0RA 1Z62A 1I94B 5IKXA 4OUDA 3HA5A 5J40A 2I2BA 1MJGM 2O0LA 4YBZA 1YR7A 1V6SA 4TTJA 1U3WA 3JYHA 1TTPB 4QREA 2GAAA 4L02A 4ZANA 1YA6A 3ROZA 5BW5A 3TNJA 1VYTA 3G0GA 1BGVA 3LCUA 4KN9S 4MQBA 1QWOA 2JS7A 1YDGA 4B1FA 2O8EA 4JUCA 3I2GA 3ASVA 2QY6A 3IESA 5TPWB 3HB7A 3KDSE 3GC6A 1JP7A 2QN7A 2W6CX 1N4DA 4EB0A 1T9GR 2P2SA 3H0KA 3RSHA 2VJLA 4DV7B 3EQ6A 4OM7A 1GYQA 1KAOA 1SFRA 2A14A 2CYAA 1V4VA 4B7AA 3OY2A 4PX5A 2CZGA 5K2MA 1MKYA 5CGQB 1IQ0A 2XRFA 1O6FA 5EESA 4A0SA 2W6MA 2QM8A 4AYTA 1X7YA 4O2AA 1CYDA 2OP1A 4J94A 3EY9A 5E1MA 1Q20A 2IF2A 3B82A 4B8ZA 5JVDA 2KPOA 3ABOB 4UHKA 1HG1A 3KV1A 1IAQA 1GU7A 5KAMA 4MZDA 4UUAA 3TR6A 2BKEA 1U5AA 4GQIA 5A71A 4ZMBA 1CUJA 2QL6A 4BWYA 1KSFX 3PHLA 5B1IA 5H59A 5BQXA 5BSMA 5LZ4A 2EQ5A 3C7CB 5BWLA 4RY0A 5KYTA 1R0CA 2O6HA 3OJEA 1H93A 4YBRA 2XF8A 1JPJA 3CFYA 3PTZA 3JTEA 4QOFA 2M6KA 2PKCA 1AUQA 3VO1A 2FN4A 5C1BA 4A8JB 1VDMA 4HPWA 3HK2A 4KO3S 2ZULA 1U1FA 4GZMA 1O6GA 4N7BA 1GQ2A 1KPGA 4GSYA 3H0CA 4J2OA 1QU3A 1RVDA 1XA3A 3EUEA 4BKUA 4G4JA 2A0YA 2P67A 2JVKA 3A1SA 3PB3A 5CEFA 2GEDA 5JANA 4D4LA 1V71A 3OPMA 1OLOA 3BFPA 1Y82A 3VNUA 2YJ5A 3LCVB 3I6YA 2CUZA 4OUDB 2AN4A 1T29A 3RUEA 2VNAA 4MVYA 4CG1A 3SQWA 1BYIA 4ZI3A 1I3KA 1ST3A 1ZJ6A 2GUGA 4RWZA 4TN5A 1J2YA 1R5OA 4CUZA 5A5VA 4RH0A 5SY4A 4DQXA 3EARA 1XFDA 5AI6A 3IBFA 2NG1A 2OHOA 1VE1A 4IFTA 5JCOA 3WMFA 4ZYUA 1R0ZA 3RNLA 3HBMA 3WL8A 2R1VA 2QTHA 3IPYA 3LYUA 4YRAA 1ZK1A 2O8EB 5HGJA 3VPCA 3OM1A 3A2LA 4OLJA 1OBVA 1BDBA 5FNVA 2JFGA 4UE2A 1GQFA 5C34B 1DO0A 1QE5A 4EOGA 1IB0A 2OYRA 3RW9A 4ZFNA 5KJ6A 1R9GA 1H65A 1PR4A 1RM5A 3RWOA 2MSCB 4IZOA 2J3JA 3AKDA 2AC7A 1KSHA 2FW9A 3K2BA 3MILA 3MWDA 3OG9A 2PANA 2BM9A 4IGEA 5JSHA 4MINA 1MZPA 2JGJA 5LPNA 4EL0A 4RMNA 3CVXA 5JDCA 3CVVA 1B0PA 2OC9A 5GM2A 3ZE2B 4ZEXA 1VP3A 1ZD3A 4OBXA 2PYZA 4X7BA 1XKXA 2ONZA 1JKJA 4IOJA 4ZO7A 1P1BA 2QMEA 1XNRB 1X7YB 3IV6A 4O2AB 4OF4A 5FJIA 1AZWA 1SIWA 2OZPA 5BYJA 4BCCA 1O54A 1QYWA 1SRQA 5EIHA 4EGCB 5KWSA 3S2YA 5B55A 5JVDB 2BF4A 3GZTB 1O96A 3PRHA 1Y7PA 3ZX5A 1A8UA 2CF6A 2RHRA 1OU0A 5KPJA 1OBHA 4MWDA 3MSCA 3TECE 2C5LA 1E98A 3V4RA 2WYWA 2Z8ZA 1BN7A 4C08A 3V2GA 3D4OA 4AKIA 1MXFA 2YMPA 1F4LA 3ICWA 1V5EA 1MEJA 3KYCA 5A4KA 1LPNA 4YRLA 1KRWA 1FSSA 1ZY2A 1G5PA 1ATIA 2H1SA 4DDMA 3I3OA 1BROA 1EVEA 1L4GA 4CIVA 4QM7A 4RQTA 4Y67A 1BMDA 3OX3A 5DX8A 5JALA 4L5YA 1Y7TA 1D1TA 1WQ3A 2H07A 2YRXA 2ZTMA 4ZREA 5F7JA 3SR3A 3PD0A 4C9BA 3HDTA 2OQ2A 1KDYA 3UT6A 3LTNC 2O6LA 3U7QB 4DLNA 1EPUA 1Z36A 3KG2A 2A33A 1F17A 2RGCA 2EX0A 2WF7A 1FZQA 2PUFA 2EL9A 1WQ4A 2FK7A 3QLTA 1L5KA 1ZCAA 4BZQA 4XH9B 1VSVA 2C54A 1T5LA 2IYSA 1Z6XA 3K31A 3LKDA 3MBKA 3PNLA 1O6ZA 4M22A 1LTHR 3NB0A 1VGRA 2DT8A 4PNEA 5BN1A 2ZXUA 2X76A 3PKZA 1Z15A 5I7FA 4EK9A 1FDTA 1OTHA 1Z18A 2CMGA 1TZKA 2R1VB 2WZBA 3HMQA 1IDN1 3FKQA 4P3OA 4P33A 4E12A 1RNLA 3EH1A 1PL8A 2XOKA 4JC5A 2PZMA 2PUCA 5FNVB 5K1ZA 1UPAA 1LBIA 1PZGA 2V6IA 3QPUA 4WZZA 4DQUA 1RYEA 2OESA 3MB5A 3S8MA 3MWDB 1QZUA 1DRUA 3HUEA 1AUPA 2CHFA 4HDKA 3JQBC 4LDJA 1IHYA 3FPCA 2Z83A 1JKJB 5BMVA 3WL4A 2IJGX 2DKOA 2GJAA 1CUUA 2WNHA 3H7IA 3AEQA 3OOHA 4GI5A 1NYTA 3WK5A 1PFYA 1QOQB 3M4YA 3N6XA 1AGYA 3GEBA 1REQB 2O8FA 5FV7A 1JJ7A 1MPXA 3G88A 3K6RA 3WLEA 1EUZA 1QAMA 2BL4A 1O96B 5JROA 4A6DA 1KP9A 2A5GA 1MG5A 1ICEA 2X0IA 2XA9A 3IOYA 2I1VB 4GVXA 3FAZA 5AKHA 1L8OA 4RA9B 1EE9A 3ZHZA 2C31A 3EA4A 1WULS 3K9WA 1AHIA 3I9JA 3MFQA 1SA0B 1FJGB 5E95A 4CWAA 1LNQA 1BEZA 2QZ4A 3KYCB 1VIAA 4XR4A 2XWPA 4DR3B 4AY3A 1T3HA 3L6EA 3AUFA 4FYYA 5A4DA 2ADOA 3RK0A 3CURA 3H8SA 1UDRA 2W6IA 3O8BA 2Z5GA 2WT9A 4RDHA 3AU8A 4BEBA 5FUQA 3K5HA 1VGQA 4UBKA 3RFCA 2GPAA 4ZCIA 5GIPE 1YRQA 2PMWB 3ZH2A 3PCXA 3S5JA 5I45A 2B8NA 5TB5A 2Z0MA 6PFKA 3VMFA 3HFGA 5FPTA 2AJLI 3GCZA 4IHKA 4CTJA 3HUDA 4P58A 3FSJX 4HAXA 4H1HA 3CVUA 4NULA 3KL4A 4LX8A 4EHKA 2CXRA 4JOBA 4QATA 2A92A 1NZJA 3CPJB 1M1NA 1RADA 4EB6A 3HDJA 3BX1A 4JVOA 1XWWA 4EB8A 3LRTA 3HEAA 3EB9A 3A04A 4WOBA 4AS2A 1FYXA 4EHIA 5BW6B 1MO5A 2BEUA 1YASA 2IYYA 4OIMA 4B3CA 3UANA 1LX7A 3PT9A 1Z3IX 3DWEX 3HJAA 5EE3A 2PQMA 1PZNA 1WMDA 2QIOA 3WVNA 2JKVA 1E9AA 4HDKB 4YRPA 1ODJA 3GJ0A 3AQ4A 5IVDA 1QCDA 3U17A 4J3FA 1BX0A 4FFWA 4K9MA 1LKZA 4HGYA 4RVSA 3DLCA 4KO8A 5AH0A 4PPFA 2QORA 4F7DA 5BMVB 2RE8A 3AEQB 3IVXA 2YV2A 1LPOA 2H2DA 4MW2A 3PYMA 4QE3A 4P4UA 5EQJB 3NBQA 4CMBA 2O8FB 1G6Q1 1NOIA 2H2WA 4RY8A 2C7OA 3LUFA 2N3ZA 4C05A 3N0WA 4ZQHA 2W6OA 2A3NA 3QPAA 3TWOA 5BUSA 3KKOA 5MN5A 5HKLA 4OL9A 2CE7A 5BV0A 1H1TA 5ER6A 3Q6IA 2GILA 4R9UC 1U8EA 1A76A 1NYQA 1OROA 4BU1A 9ABPA 3DGEC 1A1SA 4R8RA 4CF5A 1PAUA 1XG5A 2W2TA 1UBJS 2QP3A 2Z4SA 1OUMA 4JI2B 1TW3A 1Y6GA 1NBME 3EZ6A 3KU1A 4HNSA 3MBOA 4IXDA 2WAXA 4CQMA 2VPXA 4MUFA 1X7WB 1J0EA 5M04A 1T2DA 2VJDA 2JHAA 3ZZ0A 1G6HA 4WK0B 1R66A 2GZSA 4MQMA 1P29A 1K92A 2HF2A 4MW4A 5JAQA 1M6YA 1NM5A 5IM4A 2CV2A 4MYCA 1FFYA 2DERA 3QXCA 3TQTA 1XVIA 1ZOSA 1PIWA 2B5WA 3NWOA 2NV0A 2R6JA 2C20A 3I0ZA 3KJIA 4JASB 4C04A 4G0OA 4RZXA 1NV9A 4US2R 5CBPA 1Y5MA 1E6CA 1XYGA 1VZ3A 2BCJQ 5HCNA 2JGMA 3HXLA 2QW8A 5LSAA 1L8LA 1QGZA 5IT0A 1JZQA 4KK4A 1B8NA 1M75A 2AN9A 4PGHA 3FF1A 4US1R 1NU8A 1Y9JA 1KAEA 3ZR4B 4A3SA 4EB6B 2VH5R 4GPIB 1JTVA 1NTRA 3PUZA 4KRFA 4GUDA 3KVVA 1HKUA 1RHRA 1WAMA 2WINI 4I8XA 3KQUA 2ZCUA 3BFKA 1U8AA 2HK7A 2J1LA 2QR3A 1K75A 2BEUB 1IEVA 3OWHA 3UJBA 1P8AA 2Z8YM 3BXPA 3TXAA 4UPDA 1ZZGA 2O8VA 3H1AA 4B4DA 2LP4Y 4PO8A 1OA1A 2ZRDA 2BGJA 2HA6A 2AB0A 3AJ8A 2AQHA 5CA1F 4S1PA 5FTWA 1XV5A 2NVOA 4IINA 1T8WA 2H4YA 5ALJA 1J23A 3KVYA 4PRZA 1ADJA 3ZWNA 1G21E 1XJCA 2E18A 2GK7A 1UBMS 3RTGA 3ZLUA 3T06B 2KJQA 2QRJA 3HU1A 3VR1A 3WDLA 4BLVA 3R76A 1RHJA 3DZBA 3RLIA 1XLTA 5LMUB 4NZYA 3O91A 5B1YA 3BEDA 4H31A 5KTMA 3HU5A 1YK1A 2WSSA 2A5LA 4YAJA 1LPPA 3ZCPA 2AHOA 4L76A 5AOCA 5JT1A 1OLSB 2FA9A 2OV6A 1RSZA 3ETDA 3FBGA 4UZEA 4X61A 1M1YA 2IPNA 1JUDA 3BMCA 3IA2A 4JBNA 4P6VF 4PAGA 4V39A 5FT9A 2R7LA 4A1OA 3WBFA 4Q3AA 3DT6A 3R7WB 3CC8A 3U19A 3K9HA 5DSXA 1C4WA 3PJDA 1I32A 5F73A 4HLCA 2HKIA 1QHFA 5AO9A 4A0GA 1BDJA 3E2MA 2OGWA 4JIGA 3EVFA 4CQMB 4Z1MD 3O3OB 2VTBA 1PR1A 4R2IA 1MU0A 2YOHA 3BGIA 4GM0A 4KQKA 2V6JA 4ALMA 1SKBA 1E1KA 1K8QA 1HORA 2R8OA 4XE5A 3T8YA 1YRWA 3MGCA 2BMEA 5UKDA 3DTTA 4RIIA 1PSWA 1QF7A 1SXJD 1ORRA 2IWRA 2FPIA 4Q39A 3ZCQA 1XRMA 2B21A 2PTHA 1DS6A 5CBPB 1R00A 2YY6A 1AM4D 1SIUA 3CX8A 3BQMB 4MRMA 4BIIA 3FLBA 4CQLA 4DNXA 4DA0A 4RUKA 5DGTA 1OAAA 5FI3A 3GFBA 2FZWA 4IVNA 2VJBA 2YDXA 4Y9TA 1CF2O 3LP8A 3S2FA 3TRDA 2HXYA 3A4VA 3UT5A 3WK7A 2HYIC 5HZHA 2A9OA 3VR0A 4AICA 3MCAA 3LMKA 1U2DC 3IRVA 3R4CA 4R2HA 1P2UA 3CMMA 4GMDA 3WRYC 3WWCA 5HS4A 3R5TA 1U28A 2FG6C 4ZVUA 2VDQB 2B7LA 2R25B 1SD5A 4F9TA 3QE4A 2RCYA 1T1JA 3F5MA 4NZOA 2PKRA 3PXDA 1ZD4A 1QNFA 4PLHA 5HKOA 3KT6A 1UJCA 1SU7A 1OQAA 3EJ6A 4EFDA 5E0OA 4YY3B 4H9GA 4D02A 1I01A 2YXEA 2GFQA 1N2EA 1JLRA 1R6BX 2OCKA 2YZ7A 2RHGB 5HEKA 4D9IA 4P3KA 1IQPA 3BGVA 4HDRA 1J49A 3P0FA 4H18A 2OV2A 4JLWA 4EO7A 3R7FA 1VIVA 5FBVB 4J7XA 1GRVA 3ZTTA 5HPYB 1EU1A 2NT3A 1SO8A 1VBKA 4B6OA 3GFRA 3H2KA 3M82A 4F5YA 1SAYA 1MRZA 4BKRA 4KL8S 3WL7A 4S04A 4UAUA 4JC0A 5J5VA 3QNUA 2K6GA 1JIIA 4FDLA 4PSVA 1M1YB 3BMCB 4F1WA 4YCLA 1PFKA 3EHEA 4CZ2A 1YCDA 1OHHD 3WXBA 1F6WA 1KO4A 3DAGA 2WZQA 4QARA 1E5QA 1KYIA 1ACLA 3CNQS 1GRCA 1XTRA 3QPDA 4NF2A 7MDHA 3BHNA 1GG5A 4EX7A 3O9ZA 4Y1FA 3GT3A 3ZJVA 4RIEA 1VHWA 5CXSA 1FYEA 3AETA 4QIHA 5ALRA 3E1GA 2PD4A 3IAHA 2YV4A 5B7GA 7ABPA 3TSYA 2VFAA 1GTG1 1A9SA 3THRA 1T9GS 1P5ZB 4MHTA 1O8CA 1IK4A 2CXXA 2VWHA 2FPIB 4UTZA 3LUDA 3EMBA 4RF3A 4CQLB 6REQB 3O9MA 4MRMB 1OLXA 4ND5A 521PA 1P31A 1LS1A 3BXOA 2VJNA 4BVLA 1EM6A 1R0YA 5SY9A 1NXTA 2HU2A 2I78A 1I6WA 4ZZ0A 1RMYA