3BORA

Crystal structure of the deadc domain of human translation initiation factor 4a-2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
194
Chain Sequence
EIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Human initiation factor 4A-II
total genus 67
structure length 194
sequence length 207
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3borA00
1Z0JA 4GP6A 4PQYA 3UATA 2W83A 2F9MA 3H4MA 1JALA 1II0A 1T4GA 5CDFA 4KV9A 4P4TA 4MUAA 5CJPA 3A1SA 5JECA 3PITA 2QUZA 4QGHA 1LTQA 2O8CB 4IOLA 1AQYA 2D62A 1L7VC 1Q1QA 2J87A 5BN3A 5CIWA 1CEEA 5F9HA 2WZQA 2WKRA 2VQSA 2CK3D 1EX6A 4G0NA 3T12A 4AYXA 4YMTA 2R9VA 3FE2A 3GLGB 2P6RA 3K09A 3BJIC 3VAAA 1E96A 4BEJA 2BKEA 1FQJA 4A15A 3WRYC 3QXXA 3IBGA 1X8KA 3W8NA 2ZR0A 1XPOA 2WBLC 5IRCD 5LB4A 3Q7PA 4I1OA 4OL0A 2H17A 3KB2A 3RANA 5DGXA 5IDVA 2D7CA 4M0LA 2WWHA 3I92A 2QSYA 1Z8FA 3BB3A 3R8FA 3VNUA 2HXYA 2AK2A 2ZUBA 5CYOA 3ADKA 2NO1A 4L15A 3WHLA 5JS7A 2AFIE 2QGNA 4Q9KA 1HURA 3GD7A 2GWHA 5FTMA 1FOEB 3TUZC 3GPLA 1E79D 3GJ8A 3CO5A 3QXSA 5AJVB 4W7SA 4DBLC 2G6BA 2NOAA 4PZYA 3KQUA 4V0ME 1W2GA 4URVR 3VTKA 4BPBA 2VF7A 3AVVA 4MGYR 1M34E 5JSZB 121PA 4UNRA 5C46F 1GL9B 2CLSA 3TVDA 4XSHA 2FPKA 5C1BA 2O8DA 2QROA 5JBQA 5HE8A 4GZMA 1KO1A 2CCGA 4E5UA 5BYKA 3ECCA 2WSSD 5EE0A 3SJAA 2C8VA 3EWAA 5AUQA 1EFTA 1TQ4A 2QG6A 2IYSA 4PHFA 2GHIA 1XP8A 3GJ7A 2RB4A 4LHVA 5JFGA 2O8DB 1M7GA 4DEXA 3GJ0A 5J5CA 1KO4A 2WOOA 4YDSA 4HDCA 1VIAA 3QKRA 2I4IA 2EFHB 2ZANA 3PENA 3QENA 2ZE5A 3KB1A 1G41A 2EVWX 3EARA 4YLGA 5FPYA 3SR0A 4CIDA 4TMWA 1IN7A 4CEIB 2QAGB 1HV8A 3NKVA 2MMGA 1IOZA 2OBNA 3P27A 1UBCA 1JXMA 3AVQA 3C5HA 3IIKA 3VHXA 4C0LA 4S35A 2VL7A 2YOGA 3DOEA 4MUBA 5D3QA 3R9XA 4JL5A 4P4SA 3RLFA 2XSZA 4JLVA 2BMEA 2QP9X 2W2VA 5HTKA 3W3ZB 3GEHA 1W0KA 2QA5A 3Q5DA 4LOAA 2RH5A 4PZZA 3KKNA 3NEJA 3RAPR 2YWEA 4OJKA 2Z4SA 3C8UA 1YR7A 3I5XA 4I99A 1DAFA 3B78A 5A0FA 1E1QD 3ND9A 2J46A 3LAWA 4CGZA 2X1VA 1SULA 5BQ5A 2HT1A 5LB2A 2WMNB 2WKPA 2DY1A 3VKHA 2OCPA 4M1WA 4JJKA 5TB5A 4C2UA 3EPHA 1GRRA 4DLYA 1S3GA 4NH0A 5A5GA 1OXSC 3CRQA 5K8UA 1G19A 3EIHA 1GKYA 2AWOA 4TL7A 4WZAE 2OG2A 3NVAA 2HF8A 1OH8A 2HF9A 1W1WA 3F3YA 1RJ9A 4XOIA 1DPFA 2ZAOA 3Q8XB 2BBOA 4LJYA 2C98A 2LKCA 2O8EB 3EWSA 3CM0A 3KTAA 3VKGA 4Z54A 4BFUA 3KJEA 4GMXA 2X2FA 1NY5A 1CJUC 2P65A 2YINC 2B8WA 2PZGA 3K0EA 5EJEA 4IKEA 1RE0A 4DRZA 3FWYA 2WJJA 2W6ID 3GJ5A 5EP1A 1O3YA 4QHSA 6Q21A 3V00A 2DFNA 4OQXA 5G3YA 2EYQA 2HYDA 4M1SA 5F98A 4UNSA 3LWNA 5J4HA 4HZUA 3AB3A 2REOA 2ZU0C 3TJZA 1OPXA 4DUGD 4WIAA 4HZIA 2F43B 1NSFA 4JS0A 2CEAA 1OV4A 2FMXA 2VIIA 5HCIA 4IDQA 1M74A 2WWGA 2WAXA 2IF0A 2LCFA 4HB0A 4Z51A 5G3ZA 1BIFA 2C78A 4A2WA 3C41J 1UJ2A 1GL6A 4IOJA 1XTIA 2JDID 4KBGA 4MGKR 4Y0AA 2AR7A 2GJ9A 5FUVA 4MQBA 1XCGB 2ZETA 4UKDA 4EFMA 4AKIA 3RYTC 2OESA 5F9FA 1KO7A 3VU9B 3IQWA 2WJVA 2RGBA 4HZUB 1CXZA 3GLFB 3LXRA 2AX4A 3AF4A 2XZOA 5M04A 1JBKA 4PAMA 3D7MA 1FNNA 4JLNA 2IS1A 3RC8A 2A5FA 4A92A 1G8GA 4C7OA 4LCBA 4QGAA 4AKEA 1AS2A 3THWA 2OLKA 3QJYA 3KXKA 2D7DA 2Z5FA 2W0SA 4EJSA 4PC3A 3QKSB 5AUOB 4QGGA 2Q3FA 3B7GA 4OQLA 3THOA 4D2IA 4MITA 3ADBA 1R0XA 4QC2A 5JEDA 3WBJA 3GEIA 4C0KA 4B35A 1M1YE 2UKDA 2H5EA 4IRUB 1X86B 4PC7A 4A0RA 2WJHA 3BFVA 1G21E 3B1WA 621PA 3AVXA 3KKOA 4C0BA 3GCGA 4KI0A 3OFNA 4A2QA 4D4JA 2F55A 2GKSA 4ZKEA 5HE9A 3R9IA 1QHHA 2Q3HA 1ZNXA 1IM2A 2VA8A 4YMSA 4JLPA 1OJLA 2WKQA 3L0IB 1QG4A 1FMJA 3WNDA 1G8FA 4MYUA 1FUUA 2Q6TA 3N5CA 4KFSA 2WWXA 2AKYA 4LJ8A 2GCOB 2PT7A 2ZIAA 1U90A 4QHYA 4M9QA 4AD8A 2G1JA 1KDRA 3LX5A 3ZD7A 3RVBA 2WAYA 4DLUA 3GEEA 1RYFA 4DDVA 1D2MA 4Q19A 3PUXA 2BV3A 2PMDA 1U8AA 2P0EA 1GKIA 2MMCA 3ZIAA 2QAGA 3A8TA 2ZUDA 1XEXA 3ZYCA 2DPXA 3W9YA 1G7CA 2ZE6A 3X2SA 2OAP1 1K5DA 2C77A 4MRSA 1R6BX 3QXHA 4JKIA 4RZUA 1NY6A 2JLSA 3GLHA 2NZ8A 3NIBA 2GJSA 2Q3MA 3IHLA 4HLUA 2MSEB 4BFYA 1GAJA 3IPYA 4DVGA 5P21A 4QOSA 2HUPA 1SVMA 4PHGA 2GXAA 1FMLA 5KSYA 3PVSA 3SYNA 4LC0A 1N5JA 1WBBA 1YZKA 1MH1A 4N0EA 3RSLA 1EX7A 3GJ4A 2V6IA 5E7IA 4B2IA 4KODA 1U0HC 2QTFA 2EFDB 1BS1A 3KFVA 1YR8A 5C18A 4JLMA 1NMXA 3BH6A 5SZHB 3RSOA 1W48A 1YKSA 2ZI5A 1Z6AA 2QRNA 4A2PA 3C4JA 1NLZA 2R6DA 2RGDA 4CW7A 4D25A 4DCVA 1K8RA 4MH0R 4BECA 1Z08A 4QBHA 4LYAA 1Q20A 4Q5IA 4LSGA 1Z07A 3QQ5A 1CJVC 2QMOA 3NBZC 3DKPA 3U6BA 4BWYA 3IHWA 2JEOA 1T8UA 1MABB 4AY2A 3JZAA 4QBFA 1T3HA 4OQFA 1AA9A 1E9SA 1TU3A 1U8ZA 4IDHA 1KO8A 3LDAA 3PXGA 2V9PA 3AKDA 4EFLA 1ZBDA 2JLRA 4IVRA 1F6BA 3QVUA 4DB2A 3TUJC 4HDOB 1T0JB 2ZYTX 2AL7A 3RS3A 2O8EA 1FPMA 4PQRA 3AUYA 3UMSA 3GFPA 5JWHA 3WP0A 4M21A 5E4FA 2OBMA 3ADCA 1EWRA 4PPFA 3U3KA 2ZJYA 4DLRA 2DR3A 1ZYUA 2CVFA 3O8CA 2A3RA 1E99A 2SHKA 4M1MA 1XWIA 3SHWA 1ZNZA 4A0GA 4DJTA 5GJBA 2BMDA 2J1LA 2IXFA 5CJ2A 4EPYA 1NVVQ 2F1IA 1DAEA 2ODBA 3CZPA 2RGAA 3JZMA 3MGCA 4ZCMA 3WYAA 1OHHA 1LFDB 2YJTD 4LBWA 1CULC 4BZPA 4F4JA 4JL8A 2XXAB 3PQCA 2ZJBA 2ZJOA 3HDTA 3GLGE 1H8ED 3OFND 4I1VA 2OZEA 2XNDD 3W5IA 4JLBA 1F2UB 4I1SA 4PZLA 1ODFA 1U9IC 1G20E 3IO5A 5AJZA 5DI9A 1FX0A 4PAOA 4C0SA 1PUIA 4NONA 4LBZA 2AKAB 3OEHD 4TLBA 3AH8A 1A5TA 2A7QA 4LHYA 3KX2A 5DYGA 2W6JD 2ZAMA 2WV9A 3ZQJA 4DHEA 1LF5A 1RVDA 3DHWC 3QF7A 4BUJA 1VKJA 2FDCA 3S1AA 1OKKA 3VNVA 4QJ4A 1J8YF 1NI3A 1VCIA 1C4OA 4M8NE 1MO5A 4Q4LA 2ZS9A 1RRCA 4FMDB 1UF9A 4TL8A 3CW2A 4V0LA 1HH4A 1XMJA 2W2TA 4WVFA 3TIFA 1IBRA 1VCOA 3ZLJA 3AGPA 2FEOA 3N70A 4NYJR 4DSUA 3K9GA 1UBFA 2NZJA 2JJ2A 3QKUA 1G3IA 5FBWB 4DC9A 3IDQA 1GL7A 4LBYA 2QTHA 1P62B 1M7BA 3FYHA 3KQKA 3KXLA 1GZSA 1XFAA 2KE5A 3QF4B 4QHTA 2F9LA 3VR2A 2IF2A 4G01B 2IHBA 1UKVY 1UEIA 4OK6A 4Q4AB 3T61A 3FGNA 5EXSA 3B60A 1QG2A 4MRRA 3SFVA 5J4KA 4QM7A 1CF4A 1G5PA 2KSQA 3FMIA 2HV8A 1CS4C 4O2RA 1VMAA 2MSDB 5B57C 5AJYA 3G0HA 3TR5A 4RD2A 3M0EA 4IDOA 2H1LA 4A0HA 3CR7A 1EK0A 2EFCB 4WZ6A 5BN5A 1OFIA 4LJ9A 2EWVA 2WIAA 2OE2A 4NE2A 3TQFA 4ZKDA 3HR7A 2VLIA 1BMFD 1JEDA 2GCOA 4TWZA 1ZNWA 1ZU4A 4Q7KA 2BM0A 2J59A 4P33A 3U7EB 4WA7A 4GNKA 2XX3A 1HE1C 1H65A 3LX8A 5FOWA 3UMRA 1U81A 3LXXA 4G5OA 4TSFD 5JI3E 3VR6A 3B85A 1EWQA 4B6FA 3SYLA 1FP6A 1CLUA 1CTQA 1KZGB 3DL0A 4QRHA 3D8BA 2G9NA 3GP8A 3LBHA 4F93B 2CL6X 2TMKA 3OE7D 4TLDA 4UQOA 4KXFB 4WAUA 4QJ5A 2IXGA 1D8TA 3IIMA 1L4YA 5EQTA 4Q4HB 4M1TA 4BEBA 1N25A 3AKEA 521PA 5FH9A 1HYQA 3QY0A 2XGJA 2VP4A 2BCJQ 2QPOA 5IF9A 1D9ZA 3QNUA 4DSTA 2F3RA 3CRMA 4JBWA 4B73A 5KNCA 1R8QA 1TNDA 2ZE7A 3WMFA 3QEOA 3TMKA 2OV2A 2ERYA 2HDNB 2P2LA 4IVQA 1E2MA 3X1DA 2D2FA 1G8YA 3K8YA 1N5IA 1OXUA 3UG6A 2IX3A 4LHZA 2FPMA 4J0QA 3CF2A 4B2PA 5EE3A 2XNSA 3GJXC 3EW9A 3K0AB 4LDJA 4C2TA 2JA1A 5AUNB 2ECKA 3PUYA 3TW4A 4YQFA 3TUIC 3THXA 3TAUA 1L8QA 3CX6A 1E32A 4HLQB 2QEQA 4BE7B 3I1FA 1NLYA 4Q9JA 4E07A 1Z6XA 4F91B 3O8RA 3P4YA 4B2LA 1RPZA 4L5BA 2ATVA 3I8XA 4Q1DA 5FBLB 2YWGA 4QKQA 4TTPA 3NC1C 5CM9C 1X8JA 3AUXA 4I81A 4L4UA 2GJAA 5FTJA 1GUAA 4DSOA 2ZSFA 2J9RA 4TMXA 1OB2A 1MO3A 4RKFA 1AZTA 3OAAD 5KO2A 3GLIE 2VP5A 3FPAA 1VECA 4V02A 3CONA 1Q21A 3EA5A 5KNDA 2PT5A 3K0AA 4LI0A 2CCJA 2E9SA 1I2DA 2QM7A 1ZAKA 1ZM4A 2BMFA 2IXEA 2PX0A 1JB1A 3THWB 1CRPA 4JKYA 2BMJA 1B0UA 3FTQA 3OIYA 3CUEF 1DEKA 4QFMA 1HUQA 3AKCA 2QORA 1E2FA 4DEYA 1PUJA 1UADA 1OYWA 2BCGY 1N6IA 2G88A 4OI2A 2GESA 1Z83A 1TF5A 1RKBA 3K9LA 2NTYC 1WB9A 4CEHA 2ANBA 2ORIA 3HYTA 3HR8A 2QQ0A 2WHXA 3SC3A 5KUTA 4NTZA 4ZIRB 3TH5A 4A4DA 821PA 3WHKA 1NVXQ 3RRMA 5JCZA 4OBEA 4FCVA 3DPUA 2OEPA 4CZ2A 1GNQA 2BC9A 2VP9A 3N2IA 1T3LA 3KZ1E 3T06B 2C96A 3ZS9A 1IONA 3SOPA 2O0KA 3ZQ6A 4HLCA 2G83A 2GEDA 3CWQA 2ZSEA 3TSZA 1E79A 5FPTA 1T3SA 2ZRMA 1ESMA 2QT1A 3GMTA 2DFLA 4M53A 4PXAA 2KB0A 4KCGA 4B34A 1OYYA 3NXSA 4EPRA 1OKKD 3TVTA 4FCWA 2ZITA 4LJAA 1M2OB 1DAGA 1KYIA 4OI1A 3J81k 1E9RA 2W6JA 3ONWA 3P20A 3RS4A 1VG1A 1UEJA 5L3RA 3TKLA 3EC2A 1YJ5A 4ACBA 5CB8A 5FOVA 3BB1A 1P2SA 2CBZA 4HUQA 1YR6A 1TF7A 2C95A 4HATA 4ZV4A 1JJ7A 3HWSA 3WYGA 2XB2A 1Q1BA 5J4YA 2OBLA 4FCTA 3DVLA 3E5HA 2O0JA 2FFAA 4QXAA 4TQ9A 3EZFA 2QP4A 3O8BA 2FGJA 2IYYA 2Q9BA 1HA3A 4C0AC 2CVHA 1YRBA 4EPXA 3IGFA 3W5JA 3FKSA 4JLOA 4E22A 2YYZA 2OFOA 4A9AA 4I1UA 4TZ6A 4M1KA 4F4IA 2ZSDA 1E2EA 1DELA 1IXZA 4GRAA 3TNFA 1XXHB 1ZP6A 4U7DA 2AFHE 5CK5A 2IUSA 1ZJ6A 3REFA 1T6NA 5K8LA 4BLRA 1KDPA 2RGEA 1U8YA 3I5YA 3WMGA 1WRBA 3A1WA 3MCAA 4HUQB 2J0QA 1I4LD 2B92A 3Q9LA 1DOAA 3SFZA 2FSHA 1GNPA 1A1VA 2F1RA 4FW9A 2ZRGA 1JJVA 4Q4JB 2B6HA 2HJGA 1FNMA 3S1AB 2C04A 2PJZA 4HB3A 3GLGA 4C7OB 3OEEA 3CKLA 4LV6A 1KTVA 3KXIA 3VR3A 1KI9A 1MT0A 1N6HA 4IEIA 3NHAA 4QBIA 4F7WA 1ZVQA 4EJSB 1F2UA 2IYVA 4PTLA 3TSWA 2FFQA 3M1IA 3JVUA 1PV4A 1E69A 1K5GA 3MWLA 3N2EA 1NSTA 1A7JA 2GF9A 4JBYA 4HAVA 4DSNA 3CPEA 2K5UA 1EG7A 4DLXA 4URWR 4MDFA 1NNEA 4FD2A 3LNCA 4AG5A 1R0ZA 4TTRA 1P61B 1NP6A 2Q21A 1TQ2A 2FWRA 2QP3A 1HQYE 2C2HA 2RMKA 1DS6A 3ASZA 2NGRA 4Z8XA 1Q57A 3W8RA 3AP2A 2R6AA 1R8SA 4LHWA 5HPYB 4GP7A 2OCBA 3P1JA 5GJCA 4LWZA 1DBSA 4G5SA 221PA 3E1SA 4LUCA 3ADDA 2A5YB 3O8DA 2P5TB 1N6NA 5FL7A 2ZYVX 1XJCA 1DAKA 3TRFA 1XDBA 4B76A 2ZYWX 1IY1A 2VHJA 4AI6A 3A4LA 4KHZA 1RIFA 3CZQA 2OLJA 1N6KA 1NJGA 2FJUA 2BOVA 2HCJB 3I73A 4BRWA 1RC8A 2FZ4A 4PSVA 2RGNC 5L3SB 3QI2A 1E3MA 2ZRIA 2B8TA 1SHZA 5KHOC 4B75A 2XZLA 3CLVA 2J0UA 4EFNA 3I4LA 1DAHA 4WXRA 1QHHB 3KUCA 5J40A 4Q4HA 1CR1A 1II8B 3BS4A 5HZKA 2R44A 2A5DA 4X8OA 3VR1A 1NRJB 1EXMA 1S4QA 2PEZA 3VX3A 4DLZA 4Q47A 2FSFA 2QZ4A 1LV7A 1N6RA 2H18A 2PLRA 2ODNA 3LV8A 5FFMA 1BO6A 1MRNA 1VCMA 1XTQA 2PMKA 2IYQA 1NVVR 3VMFA 5EE5B 4Q1EA 1KI2A 1Z6TA 2O52A 4FWIB 1LS6A 4PPGA 2WJGA 3QPWA 1SVLA 4RD0A 1G3MA 3AVYA 4LPKA 1UDWA 1X6VA 5DISB 1P73A 2CHVA 2IUTA 4IFBA 4A8JA 4R98A 2QBYA 1W36C 4OHYA 2N42A 2PL3A 1MO4A 3MG9A 4CEJA 3CRW1 2CMKA 3MUFA 4HB2A 1EESA 2GVDC 2ZM5A 1AM4D 1P2TA 2RGNA 3HU1A 4FMCB 5FUWA 3IILA 4O2LA 4EPTA 4ZDIA 4LV8B 1KI6B 4ITRC 3CNOA 3R7WA 2OT3B 4U00A 3AF3A 1W5TA 3EA0A 1UKEA 2FH5B 4IXNA 5EXTA 5CK4A 5KNBA 4KYIB 4RD6A 4L9WA 2IS4A 1OXVA 4GZLA 3RS7A 4BLSA 5K8IA 3UIEA 1S96A 1Z0AA 3LO5A 2ZI9A 1OE0A 4IDPA 1EGAA 4LY6A 1GWNA 4OK3A 2ONKA 1KY2A 1ZM2A 2GAOA 2ZVQX 5DN6D 2V1XA 3K9NA 1E2KA 4B3XA 3DO6A 1E9FA 1S2MA 4OHVA 2V7QA 3MWYW 1NVUQ 4A8JC 3FHCB 4CF7A 2WJYA 1U0JA 2IK8A 2ZR7A 3PR1A 3NC0C 3R20A 4XTCS 2F1JA 3BE4A 4B71A 4IEEA 1E1QA 1DTSA 4Q7LA 3ETLA 4MYHA 1Q1ZA 3CIOA 1A82A 1KNXA 2YOFA 5FI1B 4LJ5A 1KSGA 1AS3A 2QSZA 2ZYUX 1QHXA 1CJTC 2YNMA 1E2IA 1SVKA 3C7KA 4GSYA 3EC1A 5KU1A 2AK3A 1W5SA 2BDTA 2ZVPX 4TQAA 1CRQA 4MGZR 1GDDA 5EXXA 4TYYA 1E94E 4LRWA 1E1RA 5BW8A 1W49A 2QN6A 3QOFA 4KFRA 4JL6A 3VU9A 1MRSA 5DLQC 3AEZA 3FFBA 2XJ4A 3PUZA 4ILEA 3F5FA 3AP1A 4TYQA 2YHSA 4GDFA 3FKQA 3T1VA 3KQLA 4BFTA 2Y8EA 2AN9A 2WSMA 1B23P 2GXSA 4EPWA 1SXJE 1X1RA 1SXJB 4TL6A 1ZM9A 1J70A 4C0JA 1I4DD 1TUIA 3DOFA 2A78A 2C9OA 2XITA 5FL7D 2BEJA 3ICEA 1MV5A 3CRVA 3P32A 5GJWC 3U3MA 4HAXA 1ZM7A 2XOKD 5JCPA 1P5ZB 3B5JA 4JIMA 3SQWA 2J0UB 3FHTA 4TN1A 1P9NA 1JI0A 4GOJA 3BWDD 3W34A 2AD1A 1NN1A 4NYMR 3SS8A 1D9XA 2PLFA 1XD8A 4ZCLA 4V03A 1E2NA 1WE2A 1NG1A 2JASA 3GLHB 4JSTA 3OEED 3RRYA 4UXJA 1Q3TA 1D6JA 1KMHB 3NH9A 1US8A 4PFSA 1XTKA 2CK3A 2VP6A 2J5XA 2R2AA 5TVKA 2V8OA 3X1WA 3FB4A 1DAMA 3MSXA 4P4UA 2IW3A 2ZREA 3NBYC 4DZZA 3M6AA 4Q48A 3LW7A 2VF8A 2OILA 1GFIA 1GRNA 1WP9A 3CRRA 1QHSA 1PLKA 3DEFA 4F38A 4HAUA 1R2QA 4BFZA 2RGCA 2CDNA 4NBSA 4M2LA 1SVIA 2FFHA 2E1RA 3OIUA 4DKXA 1P3JA 2QI9C 2VYFA 3OIWA 2WWFA 3LW8A 4AG6A 3K53A 3R9WA 1IN5A 1WMSA 2R62A 1KJZA 5L3QB 1FUKA 5JHHB 4Q9IA 3ZIAD 1YZTA 4IVPA 3IQXA 2ZJ8A 4P31A 1K6MA 2G0TA 2I3BA 2ZI6A 4AIIA 5EZ5A 1NL3A 2FZLA 4P3YA 1S1CA 4B44A 2WIBA 2WWWA 4Q1FA 4XIGS 4R2IA 1T8TA 4ASUD 3QXCA 4OKSA 4EJSC 3QKSA 1N6PA 4W5JA 2RKOA 3H84A 1G64A 1JQLB 5SZKB 4DT1B 3BBPA 1KOFA 1T5IA 1T91A 3IEUA 2DCUA 1KNQA 3D31A 3KQNA 1U98A 1VHLA 3SBDA 1TADA 2CLCX 3E70C 4PHHA 2ODEA 3B9QA 1E2QA 1ZUIA 3P26A 4AC9A 4JYCA 4IW3B 3CF6R 4GOXA 4Q7MB 1XXHE 1LB1B 4RD3A 1H8HD 2Z43A 1ZD8A 3UKDA 4DCSA 1FX0B 3LQQA 3TLXA 2REBA 5FOXA 4ABYA 5TV2A 2QE7A 5DIFA 4Q66C 3NDPA 2QMEA 4R71A 3FHOA 1P7CA 3ZVMA 1U9IA 4LX0A 1LVGA 3SBEA 4A0FA 4F92B 1S1MA 1M6NA 2YC2C 5HKKA 4CDGA 4D82A 1UKYA 1W0KD 5L8VA 2NPFA 3OHMA 3QG5A 5FPKA 3LH5A 3U60B 2BWJA 3L0OA 1F2TA 1IN6A 4ZI2A 3ZJYA 4II7A 1SVWA 1A2KC 2D06A 1X3SA 1IN4A 2VSFA 4KVAA 4ZIRA 5KDDA 4N1AA 1XD2A 3EPJA 1XJQA 5KOYA 2PH1A 4C3ZA 4YMVA 2VP2A 1ZW6A 4EAQA 1P6XA 2QRZA 1NLFA 2ZPTX 5GADl 4UJ3A 1C1YA 3TW8B 3T1TA 3K0FB 4F4CA 3LLMA 2YKGA 1YZGA 2FE4A 2GRJA 2ATXA 3BORA 3QUSA 2I1VB 3FMPB 4DDWA 3MD0A 5L3SA 2CJWB 2H57A 4LHXA 1R0YA 1FP7A 3VHLB 4BASA 1KI6A 1V43A 4U5XA 5H1YA 3OESA 2GXUA 5B2ZA 1Z0IA 1NJFA 1GNRA 2A2ZA 4FN5A 5D3MA 1DG1G 3RC3A 1RZ3A 2WSSA 1AK2A 3SU8A 1NN5A 1KAGA 3U5ZB 2MSCB 1JEEA 3BERA 1JAIA 2GCNA 2R65A 1OH7A 4MYCA 5J4LA 2A5GA 2V4ZA 3MLEA 5FPHA 1T5LA 1R7RA 2R6GA 5JRZA 1UFQA 2IYUA 1P2UA 1Q12A 1W4RA 3KJHA 1N5LA 1XCPA 3FMFA 3IEVA 4M4SA 5AK0A 4DIDA 3KUDA 2IBMA 4LC1A 5KPDA 1LW7A 1CJMA 4XVQA 1F2TB 5E7MA 4NZYA 1KSHA 1OH6A 4K81B 2J45A 1OXXK 3AF0A 3CBQA 1Q3HA 4WOPA 2WICA 4D81A 2O8FA 5FI0B 3PEWA 4QM6A 4ESHA 3LD9A 2ZRNA 1E4VA 2HCBA 5FUXA 1U0LA 5HZHA 3IIJA 2J3EA 4NYIQ 2DHRA 3LLUA 2ZRLA 4M9SA 3TSOA 4PSKA 2ZRFA 4BFWA 3UMFA 1G16A 5KSPA 4IDNA 4GT1A 5J47A 2CJWA 5EP3A 3THYA 5CIQA 3SJCA 5DHAA 2P67A 2JLVA 2DWPA 1XJ0A 1KSFX 2X77A 3H0KA 3K9HA 2AXNA 5JZVA 3T5DA 4D4MA 3QXJA 4URYR 5EP4A 1T9HA 1F60A 3EIQA 4G3XA 3WYFA 4FMDF 2NO0A 4BZQA 2C99A 2EQBA 2QM8A 2UZ3A 5B64A 3AM1A 3GLFA 2QAGC 3DM5A 2IYWA 4KVGA 2XOKA 2VSXA 1E0JA 3U44A 3EZ6A 3DDCA 4PPNA 4OQMA 1IY2A 4XH9B 2JIZD 4JVMA 4WBSA 4D0NA 5CB6A 2BBSA 1F48A 1FQKA 2H7VA 2IYTA 4JLJA 3SQXA 3CNNA 2JLWA 3U44B 5H70A 2GCPA 4RSGA 5BN4A 2ZRAA 3C5CA 1G7TA 2VRWA 2J7PA 1YU9A 1N0VC 4ZDKA 1ZUNB 4DDTA 4AKHA 2FN4A 2XNDA 4IJMA 4KFTA 5JJLA 5EXPA 4LPSA 3DZ8A 4ZI3A 2GBLA 2GZDA 1E2JA 4D26A 1E0KA 4TT3D 2H92A 1DAIA 1KIMA 1N6LA 1E9AA 4NPHA 2XTZA 4CEJB 1ZNYA 4TQUS 5FTLA 3A4MA 5H8WA 1XB2A 1T0HB 2G1KA 4M1YA 4N0DA 2ZXUA 1IXSB 1JR3D 1DO0A 2ZI7A 5LPNA 4LK2A 2GEVA 1G6HA 1XZQA 4Q1AA 4RZ2A 4PO8A 1OF1A 3GFOA 3L43A 5BYJA 1XEWX 1E2LA 2YOHA 5FTNA 3NTUA 1N3BA 1UAAA 3PEVA 5FOSA 4PC2A 3U61B 2XXAA 1R5NA 4IHQA 3NG1A 3U4QA 1P4SA 5TY0A 1RJ9B 2NIPA 2XTNA 4Q1BA 1NN0A 1ZC3A 1JXOA 4UXIA 2B21A 2YV5A 1SKQA 1XMIA 1KO5A 4L9SA 3ZD6A 1M7HA 3HPRA 1YZQA 2W6IA 4G5GA 4KSBA 3MJRA 3RRNA 3F8TA 4I4LA 3TE6A 1HQCA 1PLJA 4ESVA 1GOTA 3AVPA 3Q7QA 1YZLA 4QNMA 5FBRB 3SJBA 4B3CA 5HR5A 2AXPA 1WF3A 4Q9LA 4FMCF 5KTYA 1OIXA 2QY9A 3FFAA 4JLAA 2RCNA 4H1UA 4B3FX 2C03A 1ZIPA 2D4HA 3NHBA 421PA 5JJKA 1G18A 1ETUA 1A4RA 3BAFA 1Z2AA 3K0CA 1AGPA 4XD7A 1KSJA 1OXTA 1W2HA 2OHFA 2UZIR 1KY3A 5FOTA 1XEWY 4FWTA 1UPTA 5IK2D 2B7CA 1KJYA 2XB4A 3VX4A 5JI2E 5TMPA 1GRQA 1OH5A 2NO7A 1Z0FA 3B2EA 3ZVLA 3EZ9A 1CR4A 4E03A 2G77B 2NMVA 3R8CA 2BJVA 4M22A 2LKDA 2G0NA 5KDLA 1ZRHA 1Z29A 3TAHA 2PZFA 1DG3A 4A6XA 1FTSA 3L0PA 3WNCA 4BLQA 4NKRA 4C0QC 1ZD9A 3I62A 3EAQA 1TEVA 1GSIA 1KDTA 2VO1A 1QZXA 5H68A 4UNNA 2N46A 1SVSA 3IPXA 1YRAA 2ZS8A 5DSZA 4DXAA 3WMEA 4ERNA 4TYWA 1G5TA 1VG9B 5FUYA 2VH5R 3H1TA 3UANA 4EIWA 2KWIA 1VHTA 2CE2X 2O5VA 2ZQ5A 3I8SA 2J0VA 3ND8A 2NO6A 5TARA 1YE8A 3TBKA 3TK1A 1CBUA 5CITA 1EFRD 1N0WA 3T34A 4LJ7A 4YONB 2CE7A 2W0MA 4X8LA 1NBMA 1PZNA 2FF7A 1OHHD 3V9PA 1J90A 2EU8A 4V0KA 3TGPA 2IYLD 1HY3A 4P4SB 2ANCA 4LBVA 1CIPA 4UNPA 4YXWA 4BZXA 4G5RA 3LQRA 3VR4A 1C9KA 2NQ2C 1Y3AA 3W6NA 2C5LA 2EFEB 3BFKA 3QVVA 4TMTA 4NL4H 4A8JB 2OM2A 5FL3A 5TXGA 1GG2A 1IXRC 4PX9A 2GXQA 1HT1E 1COWA 2DWOA 2WVJA 2FU5C 4TMZA 1E2PA 1KI3A 1R5BA 2ZRPA 1NMYA 4A82A 4C9BA 2GDJA 5G53C 4JMPA 4FXPA 1P60A 3HJNA 4NYIR 5GVRA 3FKSD 3IKJA 3WP1B 1UBGA 1NKSA 2IHYA 5IK2A 3PEUA 3U3OA 3EZ7A 4JVSB 4TTQA 2BM1A 1JECA 4XSGA 5EP2A 4IOKA 2DBYA 3MAAC 5CLLA 5ELXA 1QDEA 3PG5A 4V0NA 1II9A 4KSCA 3THXB 1WBDA 3QE0A 4IOMA 3PCRB 4U02A 2ZJZA 3CR8A 1Z3IX 2WJIA 1KJWA 5C4GB 4TL9A 5AJWA 4JVNA 1J99A 2IA5A 5AR1A 4BRUA 2Q9CA 4BQSA 4NP6A 4W5HA 1NG9A 4KYUA 1AIPA 1DARA 1SGWA 3W90A 1AZSC 5LDDC 1FFHA 5FR1A 5JEEA 2HEIA 4BLOA 5JJIA 1FW6A 3CWZA 1EFRA 3PUVA 1G4UR 1MABA 1E98A 3K70C 3W6PA 2HYIC 1E9CA 1Z06A 1S9HA 1YR9A 1YQTA 2R6CA 3MFYA 2O8BB 5DI3A 1N6OA 2OO7A 1KMHA 2EW1A 1QRAA 1TU4A 4AURA 3WY9A 3X1XA 3AQ4A 1BH2A 3HU3A 4DWJA 5JS8A 3H2YA 3ZH9B 4N3NA 3LFUA 4RD4A 3CNLA 4O3MA 1HTWA 1R4AA 2DWQA 2JLXA 4JVLA 4W5WA 2ZRCA 3RS2A 4L16A 4Q02A 4TT3A 3BGWA 4KITB 1Z47A 2OAQ1 3MMPA 4MKHA 1P75A 2HJVA 3Q85A 2FPLA 3KJGA 4HDQB 2O8CA 2VSOA 5BXQC 4NCJA 2F1HA 1YZUA 1W4BA 5DN6A 3EX7C 1CKEA 3G5UA 3QPUA 2O0HA 5JRJA 1W47A 3PJRA 1S3SA 2CXXA 2WOJA 2W58A 3KL4A 2WWYA 1PJRA 4GL2A 1TQ6A 1NKTA 1DADA 3K0SA 2BVNA 3IUYA 4D6PA 3IO3A 2F43A 3WRXC 3UWOA 1G3QA 2GZHA 4PC1A 3OAAA 1W36D 2ZRHA 5BWMA 2FFBA 1G17A 4MYTA 1TMKA 2QAJA 4C30A 3PFIA 2F6RA 2A9KA 4X8HA 5G40A 3RHFA 4GOKA 4TYPA 1G291 4OHZA 2FOLA 1ZUHA 1ZM3A 4UJ5A 1G6OA 2IT1A 4NCKA 1XTJA 3QF4A 3B1XA 4LJ6A 4Q4JA 1IJFA 4OK5A 3OIVA 1N2CE 4HLUC 1HEIA 3B82A 4FIDA 3VKWA 2EYUA 2ZRJA 4BGDA 2JJ2D 3C15C 3EG5A 1WA5A 4POAA 4AYTA 1QHYA 2JDIA 4GPTA 2CLDX 2D2EA 1QVRA 4IFEA 1RRFA 2V55B 1GIAA 4EQ6A 1CJKC 2R8RA 2LWIA 2XTMA 3BIFA 1Y63A 3U7FB 1CP2A 1ZU5A 4AKGA 1SQ5A 721PA 1GM5A 1XX6A 4YXWD 3SNHA 2ZJ5A 4LJ4A 4NMMA 1U94A 1CR2A 3I32A 2ORWA 4RFVA 3FMOB 1QVAA 3T1OA 2KBEA 1LS1A 1ZCAA 2BHRA 3OEHA 3OZXA 2OXCA 3B1YA 1JPJA 1E9BA 1ZD1A 3LVRE 1BYIA 4PAQA 3EXAA 1G8PA 4HYYA 2GEUA 1LY1A 2IYRA 4A1FA 2GAAA 3KKQA 1NIJA 2ZI4A 2HT6A 2PZEA 4QGFA 5HCNA 2PEYA 2RGXA 2XAUA 3CB4A 4KLZA 2OSBA 4PPQA 3FOZA 2QENA 1W46A 1UBEA 1D2EA 3NDBB 1BKDR 2ZTSA 1NIPA 2ZEJA 2Q9AA 1E1RD 1ELOA 3U3JA 5JMTA 3A58B 1JR3A 2IC5A 3IBYA 3UWKA 3OF5A 1TAGA 5FBVB 5DYIA 2FSIA 5L3VA 5DHFA 3MRSA 4NU0A 4MKGA 4D0LB 1FL9A 2IYXA 4DUGA 1PLLA 4NYMQ 1P9RA 5EE1A 2GBLC 3BH0A 4B48A 2QBYB 5E95A 4NYJQ 1HE8B 2QT0A 3KTAB 3U3RA 4YDHB 1O87A 1Q22A 2QPAA 1I2MA 2PJRA 4ZDJA 3PIRA 1JPNA 3ZZTA 2ZS7A 1A2BA 4HLDA 5EZ6B 3B1VA 2QGZA 1AS0A 1R10A 3I3SR 3KKPA 2QMHA 4Q1CA 4KAXA 4Y0VA 4R2HA 1G8HA 4CVNA 1VDZA 4PANA 3ZVRA 1SKYB 2VHQA 4B43A 3D6TB 3W3AA 4MKIA 4ON9A 1KKLA 2X2EA 3Q5EA 2BBTA 2DFTA 3BFXA 1D2NA 1E2GA 1TPZA 4C0HA 3WXMA 3VFDA 4RFSA 3E2IA 2QL6A 4ARZA 4M9ZA 4NDZA 2AWNA 1GITA 1OIVA 3RABA 4MKFA 3CPHA 4RZXA 1P2VA 1LF0A 4GMDA 2JLUA 1Z28A 4PO9A 3AVWA 1J7KA 1SVOA 3QKTA 4ACAA 3RNLA 3L8YA 2WMOB 1S0UA 5KSZA 4EPVA 1RW4A 1R5OA 1Z22A 1H8HA 2FX3A 2ZRKA 1TUEA 2H16A 2IUUA 1E4YA 5D3MB 2GJ8A 4ZDWA 1E0AA 3OE7A 3BB4A 4KBFA 1XBTA 3DZDA 1KI1A 5JWRA 3ZZUA 1XPUA 4X8MA 1CU1A 3G82C 4RD1A 3D3QA 2XSZD 3SYKA 1G5RA 3U7HB 2JJ1A 4NCHA 1UKZA 2BKUA 3WBKA 1VYUA 3NH6A 4WW0A 1KZ7B 4HI0E 4QBGB 1OLOA 4B3DA 2DB3A 5B58C 4LYFA 2UVQA 1TL7C 1F5NA 1XD2B 3M4YA 5F2EA 1SZPA 2OXRA 1IQPA 4B3GA 3HPQA 4OHXA 2JCSA 1VG8A 2REXB 2H8KA 2VHUA 3SE0A 4KU4A 1DO2A 3A1UA 4B32A 3DMNA 1SXJA 4JSYA 1NVWQ 1DE0A 3THYB 1QBKC 5LD2B 3RS0A 2XEXA 3L0SA 2GK6A 3T35A 1M8PA 1OFTA 3L2OB 2JIZA 1W7AA 4OQNA 4Q7JB 2DYKA 4JJZA 3PUWA 4ZPXA 1GILA 1XD9A 1GKUB 1UM8A 1XTRA 3C14C 4KFUA 1E6CA 3QKRB 3PV0A 2P3SA 3RRZA 3UK6A 5KPJA 4MRNA 3EZ2A 4RVCA 2AHOA 3T1QA 3GLIB 4O0MA 1S8FA 1US8B 4Z1MD 3FVQA 1XMSA 4RCYA 1JNYA 1VPLA 2NO9A 4OYHA 3RS5A 1G3RA 1G3UA 4V0OA 2PX3A 1GTVA 3DMDA 3O47A 4TMKA 2Z0MA 1NMZA 1XZPA 2ZE8A 4HAZA 2O8FB 3P4XA 1FZQA 4Q21A 5LD2C 4R7ZA 4TLEA 3AF2A 4TYNA 1AQUA 3LVQE 4EKDA 1E0SA 2WPDA 1L2TA 4ZO4A 2IWRA 5CM8B 3RWOA 4PSAA 1XPRA 1AGRA 2YWHA 3K70D 2Z4RA 3SN6A 3SDZA 5L3QA 1KK3A 2ZRBA 1N0UA 1Z6YA 1VTKA 4HAWA 5KDOA 5SZJA 3B13B 4OJQA 3UXMA 4OHWA 1W0JA 3K0FA 4YMUA 2ZI3A 2CCKA 2ZUCA 4K46A 2IEZA 3QG1A 4DIEA 1Z2CA 2CNWD 2JJ8A 3HU2A 3B8HA 4M1OA 3NEYA 4JT4A 3H86A 1IY0A 2BBWA 3I72A 1ZMXA 2IS2A 4S2EA 3ASYA 1YZNA 2KI5A 4PQFA 4TLAA 3TQCA 5UKDA 4DLWA 3QEJA 1OT3A 1Z0KA 1XF9A 5IHPA 4URXR 1KKMA 4LZZA 2ZROA 5CDFE 1P9WA 1R0WA 4LV5B 3ZS8A 2PCLA 1JR6A 3BH7A 3K09C 4PHTA 1KK2A 1IN8A 3EIEA 4MRVA 2VHTA 1WCV1 2ZJ2A 3ZVNA 1X8LA 1XXHA 3QBVA 2WTUA 4JZKA 5JHGB 3NWJA 3AV0B 2FEMA 4G5QA 5EE9A 4Q9HA 3L82B 4XVUA 4B3BA 1OFHA 1OW3B 1WDTA 4US2R 3SHFA 2AD5A 2G3YA 4JBXA 1G9XA 4US0R 2N1BA 3CF0A 1TEXA 4MDEA 4OI4A 2ASEA 4JLKA 2YZ2A 4PR0A 2P6NA 2Z83A 1N5KA 5CYPA 1WXQA 5C2JB 2HLDD 3CH5A 4W9MC 2VEDA 1QF9A 3GJ6A 2GF0A 3U6KA 2WPDD 2ERXA 2X19A 4IXMA 1GP2A 4NCIA 3SJZA 4O25A 2XZPA 5HKKD 4FMBB 2IEYA 3KDSE 2FNAA 2JGNA 3MJHA 4HAYA 2FV8A 3LBNA 4NHOA 4CEIA 2DFKB 2XJ9A 5IT5A 4QL3A 1RFLA 1P72A 1XNJA 3T15A 2RGGA 4V0MA 1MKYA 4LYJA 2J41A 3NBFA 2BIFA 2JATA 3AF1A 1KI7A 4LGMA 2IS6A 3V4RA 2KJQA 1E9EA 2PCJA 4WZBE 4CYMA 1L4UA 1S9DA 1EFUA 4RFSB 1YHNA 4P32A 1NN3A 4KO8A 4ARZB 4RCZA 4C4PA 4D80A 4P0TA 4K8OA 3RDPA 4BFSA 2CHQA 3LRPA 5FOUA 1D5CA 3EPKA 5B30A 1J2JA 2O8BA 4GI7A 2GTPA 1ZC4A 2V3CC 2JLZA 1ONBA 2JLQA 2OCYC 4MA4A 2RAPA 5DH9A 5SZIA 2YWFA 1XCMA 1RRGA 4EQ6B 2FGKA 2OFWA 3CPJB 4BLPA 5K8TA 2JAQA 2V1UA 4QNRA 1BYUA 4AWXA 3A1VA 2CL0X 3VQTA 1TX4B 5JSZA 4GFDA 4JT2A 1G7SA 2V7QD 2ZSBA 2CL7X 3KJIA 3SI7A 1RYHA 4UNQA 1H8EA 3QIAA 1G7RA 1QHNA 4WXPA 3JVVA 1AKEA 4BFXA 2NPIA 2J7PD 2QU8A 3BD9A 4AYWA 1OB5A 3A1TA 1ANKA 1KI8A 3GFTA 3CX7A 4EUNA 1KI4A 5AUPB 3R7WB 4RZ3A 1SHKA 2VPPA 1VCNA 3SZRA 5ANRB 4L8GA 4URUR 1JR3E 1TTTA 5FTKA 2GZAA 4BFVA 1SKYE 4EDHA 1E2HA 4MGIR 1G4AE 4YMWA 3KFXA 2FA9A 4GBMA 4TMVA 3A37A 1KAOA 1IHUA 1UDXA 4JLDA 4URZR 3W6OA 2VBCA 4B74A 4Z8YA 2W00A 1QHIA 3GJ3A 5AJXA 2QMUA 4TLCA 3B9PA 3WNBA 4DCNA 3DM9B 1Z0DA 2FSGA 4D0GA 2A30A 3UPUA 1KHTA 1TQDA 1JQJC 2F3TA 3BXZA 4Q03A 2IL1A 1IAQA 2IWHA 4D4LA 2RHMA 3K1JA 5KSOA 1DVRA 1KDOA 1MOZA 4HUTA 1G1MA 1Z5ZA 4Z1MA 3GLFE 3NBXX 8OHMA 3KKMA 1COWD 1XTSA 4A6PA 3RWMB 2ZRDA 3MWKA 1U2RA 3ZZ0A 1VIYA 3LY5A 2QPTA 1SXJC 2C9CA 1KK0A 2ZU6A 2QNRA 4DLTA 4DLSA 3A6PC 4NCNA 2ONJA 3A36A 5FR2A 4JYBA 1JAHA 5G41A 3V4FA 5JLJA 5KYKA 2ZSAA 4TZ0A 1KK1A 4E09A 3AKYA 1CR0A 1XMVA 2WM9B 3AGQA 4PO1A 4XWOA 4CT5A 3A4NA 5C4MA 3KQHA 2I1QA 5E3HA 1XU4A 2ODWA 4DLVA 1Q0UA 1MR3F 2J7KA 4UXHA 2OUKA 3EPLA 1OFUX 3SEAA 1WQ1R 2ZJAA 2GVZC 2RHDA 1W4AA 2VP0A 4LYHA 2VHCA 5J4VA 2A5JA 4HB4A 1J8MF 1MO6A 4G1UC 2OCAA 2BJWA 1ZIOA 4CT4B 4MRPA 2PBRA 3K70B 2FG5A 2JJ1D 1KMQA 1XEFA 3ZDQA 5GVSA 2GETA 4Q18A 4TSFA 1GVNB 4QG7A 2P5SA 4CRWB 3GLIA 5AWFC 4RJLA 1NBMD 2E87A 1Q44A 3HYRA 4KJZA 2B7BA 2W2XA 3L8ZA 3AP3A 1IJEA 2P6UA 3T5GA 5JWOA 4OI0A 2GK7A 1Q1EA 1E9DA 2KBFA 1BMFA 3EASA 3FDIA 3K0CC 4RY2A 3UG7A 3C16C 4ZCIA 4XTRA 1SXJD 3Q3JB 1W0JD 2ZR9A 4H9GA 5EUQB 4AK9A 4H1VA 1XRJA 4XWKA 1EFHA 2GILA 3CX8A 1NF3A 1X1SA 2X8AA 4QJ3A 3ICQB 4KLNA 1ESNA 5F3WB 4B47A 4FI3C 4A36A 3GQBA 1LNZA 1FTNA 3BRWD 4DB4A 3BK7A 3X1YA 2L0XA 3QSYA 3AVTA 3B1ZA 2GNOA 4DCTA 2C9YA 3DKVA 3U4QB 1W4CA 2QQEA 2R6FA 3U7GA 3BOSA 2ORVA 4Q4AA 5DE3A 4DCUA 2F7SA 3LBIA 1W36B 1AJEA 3AVOA 1E2DA 2OFXA 1VG0B 1OIWA 3F0TA 4DT1A 2BEKA 4RKEA 5DI3B 1II8A 1KGDA 4Q01A 2V54A 1W44A 2D3WA 3HP1A 4HEJA 2IYZA 4R9UC 4BLTA 2QE7D 1RRPA 2QTVB 1QHGA 5CLQA 4XD7D 1V5WA 3U2QA 3VR5A 3PEYA 4XWAA 1OSNA 1AKYA 3CH4B 4Q00A 2JLYA 4YC7A 1I4TD 2Z6VA 3TR0A 4XJXA 5GJVC 4HSEA 1YVDA 2GJKA 4PC6A 5EUMA 2VTKA 2HLDA 3BC1A 4B33A 1F3OA 1PVOA 3AVUA 5DNYB 2V6JA 3Q72A 2YC4C 4XVRA 3ZGXA 5A4JA 4D4KA 4CEHB 1AN0A 4FINA 1HT2E 2Q0HA 1VYVA 3B6EA 5FPSA 4ASUA 2EWWA 4US1R 1XEXB 1Z6GA 2CNWA 3REGA 4DDUA 4B6EA 2YVUA 5TDHA 1Z63A 2HXSA 5DO9A 1NBME 2NG1A 1BOFA 2EFGA 1ZCBA 4M9XA 3GLHE 3LA6A 2CHGA 3QPVA 1ZINA 5E7JA 3X1ZA 3I61A 1EFCA 1VYTA 2WWIA 3QBTA 1U99A 2D74A 5LBIA 2J0SA 3MWJA 1TF2A 5FBQB 2GA8A
chains in the Genus database with same CATH superfamily
2YQ5A 1OLSA 4W4TA 2C4UA 2WTEA 2C7GA 1YHZA 2VNKA 3PHJA 5GM1A 2AZ4A 5CLFA 1Q7RA 2W83A 3WAKA 1G5HA 1II0A 3N5KA 1T4GA 3QYJA 3TM4A 1BVHA 1M6VB 3UK7A 1NTOA 4WRRA 1P33A 4C21A 3UAYA 2F48A 3KKKA 4B7AA 1IZ8A 1N7IA 5JECA 4L08A 4AF8A 4QGHA 2O8CB 4KE9A 3KDPA 4OBBA 4PF1A 1AQYA 1FDIA 4KH0A 4RMNA 5G4KB 1DV1A 5BT8A 3ICVA 3PDWA 5BN3A 4PRKA 1E2UA 4D9KA 1SY7A 2CXUA 1I4EB 5EOVA 5CAEB 4YMTA 3PDHA 2NTVA 4RHYA 4YECA 2R9VA 1NURA 3H18A 3GLGB 5DBOA 1HRKA 3VAAA 2DBRA 1D07A 2BKEA 1FQJA 1VJ0A 3IOYA 2BMVA 3KB8A 4PLFA 5G4KA 3WRYC 2J48A 2XCOA 1T8YA 2IY8A 4BNNA 1X8KA 2X22A 1DRKA 2CY0A 2SCUA 2ZR0A 4EG0A 4M89A 5I7OA 1XZAA 3KB2A 1AXGA 2PFKA 3HSKA 5DGXA 2D7CA 2VAPA 2LE0A 1I7PA 2WWHA 1XMQB 5LZ8A 5CEFA 1Z8FA 2L69A 3VNUA 3TYXA 3ZE2B 5MDHA 2AK2A 1VSQA 2NO1A 1U2EA 3C8MA 3OCXA 2PS3A 2P2DA 3DD1A 5JS7A 5FUMA 2P75A 4Q9KA 3IHKA 4EJSA 5FTMA 3QE9Y 4K9NA 1E79D 4F04A 2QAIA 1GGKA 1P7PA 2W90A 3QXSA 3EMDA 3CTMA 3CE6A 1NX6A 1D6MA 1XGKA 4V0ME 4XCXA 4UTRA 2ZT6A 3FUWA 5L4SA 5LDGA 3KU4A 1PT9A 2EW2A 3CCBA 3FWNA 5T41A 3GT0A 4UNRA 5C46F 4XGQA 2R68A 2WJ4A 4TVOA 1MIHA 2QROA 3GOQA 1IB0A 4WZBA 4WGGA 4DILA 3ETEA 5JBQA 2IYNA 1C29B 1ISJA 1A5BB 2H48A 3LSYA 3TOVA 1TZBA 2WSSD 5AUQA 4KPUB 2XMZA 2QG6A 1ONOA 2IYSA 2X0IA 1K6XA 3OICA 3T52A 3VZPA 3C3YA 1CW2B 4B45A 1CDDA 1M7GA 3QLUC 1M2HA 4P34A 4MXDA 3LPAA 2WOOA 1B3BA 2VBGA 2J3JA 3COYA 3QKRA 4F8EA 3HVHA 1OBVA 1EP9A 3PENA 4H1WA 1E7YA 5AVOA 3ROQA 3VNAA 5DTQA 3AUKA 2VNIA 4IIYA 1ECFA 4WBXC 3V2UA 4IICA 3TSAA 1B42A 4YLGA 1NLMA 2V59A 4YB8A 5FPYA 4RYDA 2ZSJA 3F71A 4H3KB 5CVUA 4BPRA 1Y98A 2BZ1A 3BQ9A 3CW8X 4CEIB 1W0CA 2QAGB 4DIBA 1TTQB 1HV8A 3NPMA 1PG0A 3UV6A 5JNRA 1ZHOA 3P27A 1UOEA 2DGDA 1GVHA 1LDBA 3DNFA 4LY0A 5AKGA 5JAHA 1T29A 3AVQA 1K8QA 3IIKA 4EI7A 3EGDA 2VHZA 3T54A 4C0LA 1XYGA 3EZNA 4L4XA 4TKVA 3J7AC 1J0BA 2H3HA 5AI8A 2XMDA 3DOEA 4Y6OA 1UM9A 4MUBA 3C24A 5BOSA 4P4SA 3L7AA 2ZBUA 3B36A 2QP9X 3GDOA 2GK3A 2W2VA 2XHZA 3HS3A 3RLFA 4LOAA 1PU2A 3RIYA 1EXVA 1BU8A 1B0PA 3S2UA 3GA5A 3WGJA 4PZZA 1DFIA 3RAPR 5IS2A 5BR4A 1G4HA 1DO8A 1N7JA 2JEYA 1YR7A 3I9V6 4IG9A 3SMQA 2HNKA 1WY7A 1E1QD 1OROA 3HA3A 5AW9A 2X1VA 2VZ0A 4MS4A 2HMYB 1IWPB 4LW8A 1UMCB 4EHKA 2NZXA 2WKPA 3KWMA 2DY1A 3VKHA 1GCGA 3FVTA 3ERCA 1FDOA 4W6QA 4RW0A 5L6LB 3OZAA 1GRRA 2D1RA 5K3AA 5A3RA 5HUHA 4C2UA 3C3AA 4Z3OA 1HE4A 5CW1A 5K8UA 3ISVA 1GKYA 2EOAA 3S6JA 5JW6A 1U0BB 5A3QA 4BMCA 3NVAA 1SUWA 2CSUA 3QPAA 2GARA 2HF9A 1K8ZB 2UAGA 1PR2A 1QYRA 2SECE 5LYYA 3UT0A 3WKCA 2ZAOA 3Q8XB 2JZOA 4GMHA 3VR6H 3WFJA 3EEOA 1XU7A 1Z4QA 3EWSA 1Z3CA 1QKIA 3MMXA 1M5RA 4NVRA 1Q16A 2Q07A 4NQRA 3GD5A 1CJUC 3WGOA 2IE0A 3K0EA 1YQDA 3LUJA 1W25A 5REQA 5JNSA 3IQFA 1A8UA 4RKQA 3GC6A 2W6ID 1RCFA 4GQBA 1U4SA 1O3YA 4QHSA 3EC7A 3V00A 1A9ZA 4RULA 1JI3A 4XX1A 1TMGE 3BEDA 3JYHA 5DGIA 2O4UX 3EDRA 5JC8A 1DFHA 5G3YA 5F98A 3EQ7A 3HI4A 4M1SA 1VL5A 3LWNA 5J4HA 1I2ZA 3H8JA 3MTIA 4YAOA 3VBEA 3AB3A 1OZFA 1WCIA 3TJZA 1JFTA 1OPXA 2G5CA 2NU6A 2YY6A 3JYQA 1UXGA 2OECA 4RL6A 4HZIA 3TBFA 3D6NB 1UZLA 1MOPA 2IBTA 2R6ZA 5MGNA 4OGWA 1SPBS 2QLNA 1UFKA 2HLNA 2WIJA 1X7YB 1KERA 2ZJ6A 2HFJA 1JZSA 3A32A 3KE9A 2WWGA 3KOOA 4RMGA 3GCXA 1XPJA 3T7SA 4CMAA 2WAXA 1JG6A 5GZ3A 3MBOA 5DNAA 1I2AA 4AZWA 2H1SA 2XDQA 1U0EA 1L5KA 4ENUA 5AQEA 1BIFA 1VHWA 2C78A 4AMUA 1DC4A 2OYSA 3PRYA 1H66A 3FA2A 5CNMA 1A50B 1V47A 3DQZA 2EKPA 3GG9A 3NIGB 4UM5A 1UJ2A 1GL6A 2I5PO 3SMVA 3N0VA 2JK0A 3EGCA 1G2PA 5IU6A 2I4NA 2ZYIA 1A8SA 5IBPA 2AMFA 4FHCA 1XCGB 3UAXA 3OX2A 3L40A 5LQJA 3K8QA 4G63A 3ODPA 4UKDA 5B3KA 1EXDA 4ZT2A 1ISHA 4TV8A 1EIZA 5F9FA 1QE3A 1X19A 1CXZA 4HS4A 3QYPA 2AX4A 2QVLA 3DOHA 4LRXA 1Z2DA 2XZOA 3ZDAA 3KBOA 4COOA 3H87A 3Q6IA 2P35A 3LRTA 6ABPA 3ZY3A 2FEAA 4OY3A 3KXDA 4UPVA 1YXMA 3ILSA 2PO7A 1RWQA 2C83A 4RKRA 3TRKA 4A92A 2I6FA 1G8GA 2NACA 4A73A 2NM0A 4ZI7B 3QLJA 2GGSA 2E2WA 4QGAA 4ZN6A 4K6CA 4JDPA 2UZ4A 3X1MA 2OLKA 3O2JA 3QJYA 3EJWA 3G6WA 3KXKA 4XASA 4O1IA 4DGSA 3DDUA 3UEOA 3KYDA 3CPSA 3ETJA 3DH0A 4A5OA 1KFBB 2O2CA 2GQ0A 2Q3FA 2WFMA 3E9YA 1UBRS 3KT8A 3RI3A 4ZHQB 2ON6A 4KRGA 3THOA 4LMBA 4D2IA 4DDHA 4MITA 2RH8A 4N6NA 4K5QA 1C4XA 1UUFA 2X6TA 3MAGA 1E8NA 1EZ4A 4LEIA 5JSYA 1X86B 3RU3A 4W8HA 2Q7DA 5AJTA 3UJCA 1QQTA 1H0KA 2IHZA 4BKMA 3WIUA 4QIHA 2XQGA 3B1WA 4TV9A 621PA 1IPEA 4FE7A 4C0BA 1FF9A 1UC8A 4EGAA 3GYBA 3K9WA 1R6XA 5T3UA 5F5XA 1J0AA 2K2QB 1R6TA 1GDTA 4LF5B 3DWFA 5CHEA 4MAAA 1IM2A 2OGZA 5CJJA 4YMSA 2BGGA 1XXLA 3IJRA 4OATA 3WWCA 4B2YA 1Y0BA 1QG4A 1BDBA 3GWZA 4MYUA 1EJ6A 2HF2A 4LISA 2OYCA 4UDYX 3T7IA 4ALKA 4CKBB 5BPHA 5AM3A 1FDRA 3DR3A 2PT7A 1ZJ5A 1Z5GA 2O1SA 1U90A 3TD9A 3H1BA 1MFZA 2VNJA 3L4BC 4C2AA 1C2YA 1O9BA 2X14A 4W8GA 4GP9A 3WQHA 4E4TA 2P9EA 2WAYA 3GEEA 1RYFA 3MW8A 2Q4EA 4DLUA 4WBNB 4Q19A 2PDAA 4IIJF 4QD3A 1BXRA 2ECFA 2P0EA 3FCUB 3M81A 1OJ7A 1RS0A 2VJKA 3H9EO 3ET4A 4D9IA 2QAGA 2AG0A 5HKBA 3OUTA 2EX0A 2GAFA 3FPGA 2EJCA 3I34X 1RXVA 2DPXA 2V7BA 2BYTA 4M76B 2D1SA 1G7CA 4CXMA 9LDBA 3O84A 3AR4A 4KK3A 5LBTA 3F4BA 1MF7A 2OAP1 2C77A 2I55A 2PKXA 4MRSA 4RZUA 5HG0A 2JLSA 1V26A 4P3XA 5IMSA 4ZVTA 1Z7GA 2C2YA 2NZ8A 3E53A 1EMDA 1P0IA 2CBGA 1E4OA 2Q3MA 1H0SA 3DFMA 3JQFC 4HLUA 2MSEB 3EDMA 3FYCA 3TLZA 3ZK9A 1PEDA 4FC6A 5P21A 1ORRA 2L19A 4UUBA 1C4WA 1FLVA 1FMLA 1NC3A 4BP3A 3MXOA 1N5JA 1LLUA 4RSRA 1YZKA 2X0DA 4C3VA 3F47A 3IE1A 4RPIA 3TXXA 2O5EA 1JHUA 5E7IA 3IT1A 1U0HC 4KODA 3WICA 5EUBA 2EFDB 5JATA 4DOMA 3OLWA 1YR8A 4QYMA 4DIMA 5C18A 1NMXA 1HQDA 3BIJA 2GR9A 1YKSA 1TO2E 3NBMA 1TB4A 2ZI5A 1Z6AA 3A3NA 3HN7A 4P4LA 4H60A 4HMOA 2B0JA 1P19A 4LOHA 3HVKA 1NLZA 5KYVA 4CW7A 1G38A 4DJFC 5AD1A 5IVPA 3DE4X 1VI2A 4ERXA 4DCVA 4PU0A 1K8RA 4MH0R 1XP5A 1P8AA 4BECA 2UZAA 1Z08A 3TCXB 3LT4A 4DANA 4YR9A 5ALZA 3VHXB 4X7PA 1BEUB 3H9GA 3NHZA 5AHOA 3OUZA 3DHVA 2OGSA 3UN1A 2HRDA 2O2EA 3QQ5A 4WLNA 2C1ZA 4XYEA 2IS4A 3DKPA 3JYPA 1ZN2A 3IHWA 2W42A 3JZAA 1P7WA 3OZTA 4GYJA 1VHJA 4J1SA 5J5VA 5BOVA 1ZX1A 1TU3A 1U8ZA 3BCUA 3TGLA 3PXGA 3LI2A 2B30A 3HV2A 2VJMB 4NFYA 2D1QA 1CDEA 4Z9XA 4FDUA 2JLRA 4OU5A 4YY3B 2QN1A 1IU9A 2IDKA 3QVUA 4DB2A 5ITWA 1P4RA 4M0FA 2AL7A 2IHJA 1DUSA 3RS3A 2CMDA 1OBCA 1FPMA 3PGJA 1XAGA 1NFQA 2MWMA 4KEAA 5JWHA 3OWOA 4M21A 2HHJA 4R2XA 4YRDA 5I9TA 4D9BA 4I14A 3KUUA 1XRNA 2ZJYA 3WK4A 3T7DA 5C1OA 3ZJUA 3JQ8B 2DR3A 3H2IA 4FYKA 1ZYUA 4KE7A 3PICA 2A3RA 4AUKA 3RD5A 1WZ2A 4QTUB 4FONA 4RO0A 4OHUA 3SHWA 1VSTA 1QHEA 2BMDA 2WHPA 3BMOA 2J1LA 2IXFA 2PRSA 3JQ6A 3NGMA 3TRHA 3JZMA 4UUQA 2I4LA 3MGCA 3RS8A 4LIPD 3A4IA 3IJPA 3DKKA 1D4OA 3GIWA 4GMGA 3B2QA 1LEHA 1H2RS 5GONA 3P9NA 4DMCA 2X7HA 3HDTA 2XGSA 3CUUA 4YMGA 1YGPA 5JYCA 1H8ED 3ZKWA 5ADUS 4I1VA 1QFSA 1CF9A 2JAPA 1RMTA 3FWKA 2VK8A 2Q4RA 2QTGA 5CT5A 1DIAA 4GVLA 1B41A 5F7ZA 1FQOA 4N48A 2X5KO 2PZLA 3DE0X 5AJZA 1LPNA 3F8SA 3DFKA 1XZEA 1QGAA 2LIPA 1KYTA 4LSWA 3DFFA 5TVGA 4B5KA 4CF3A 1PUIA 1O1YA 3AW9A 4LBZA 3UMYA 1O58A 1NVKA 3EIUA 1GTJ1 2A7QA 4LHYA 3KX2A 3THRA 4FNOA 4ND7A 1V41E 5HRCA 1LF5A 3W1VA 3R75A 1OKKA 2R47A 2W2LA 3OZBA 1NI3A 3VSDA 3GRFA 1C4OA 5G0WA 4M8NE 2P9FA 1XZ8A 1ZIYA 3H2ZA 2AR9A 2ZVJA 3H1PA 4FZ5A 2GCGA 2WJ3A 5LLDA 2XMGA 4RY0A 2JFWA 4MIEA 1T2NA 1YQ9A 1EVQA 4C76A 4EH1A 1PEYA 2O07A 2Q3EA 2JCBA 5I4IA 2IDMA 5D1HA 1MJGA 4YRGA 3WI7A 1JE1A 1PR1A 3IDQA 3WADA 4FFVA 3ZCUA 1KH2A 1SBQA 3EGXB 2X1MA 4UC0A 5K0BA 4HOYA 1RWBA 3FYHA 2FZGA 3PC8A 3KQKA 1QAMA 4XYLA 5FO0A 4GW3A 2P9GA 1XFAA 2KE5A 4QX6A 4RTQA 3BT7A 4WNCA 5ERXA 4I1PA 3QW2A 2IF2A 1NI5A 4FSXA 4G01B 4XM0A 3BVPA 3Q3GE 3RK0A 2HU5A 4ECAA 3OJWA 4OK6A 3T61A 5C5IA 1T26A 1UDCA 3R5SA 5EXSA 1K8XB 3PVZA 4FUTA 5I48A 2M6KA 3SFVA 2Q3CA 3C3KA 4LFAB 3R41A 3FMIA 2Y6VA 1MXHA 1VMAA 2MSDB 1IOWA 2OO5C 3GCZA 5B57C 3TIIA 3G0HA 1K8YB 2G8NA 4KDCA 4EATA 3M3DA 1SMKA 1W35A 4DIKA 1EK0A 4LJ9A 5BQFA 3GARA 3P9CA 2Z3ZA 3TQFA 1C7ZA 4Y6SA 2J32A 4GGMX 5L7YA 5E9AA 3KLNA 4KL8S 1E3WB 1JKJA 1WVMA 1ZNWA 1ZU4A 3F78A 4EWLA 1N2JA 1PE0A 4Y0NA 4WA7A 1AB5A 4WNIA 1HE1C 2W6OA 2VDWB 1H85A 5ECGC 2EIXA 1U81A 3LXXA 4G5OA 1BGXT 1PYDA 4AF7A 3D64A 1P2GA 1Z7YA 1FLNA 2WHQA 2ZQYA 3FBGA 4B6FA 3ZD8A 3WAJA 4KTVE 4RETA 2DHCA 4R2LA 4B79A 1L7NA 1T4DA 2OCXA 3MCTA 1MD9A 3OBBA 4RACA 4F93B 4YACA 4TLDA 1YL5A 3PR3A 2H2AA 3MWDA 4QJ5A 2IXGA 5EQTA 4JNKA 2MT9A 4C06A 1GT91 1DZ3A 3LQ1A 4BEBA 3BILA 4EO7A 1HYQA 3UT5B 2XGJA 2V5AA 3CBGA 1ZJ4A 4O4IB 1BQ3A 4BNGA 3T7RA 1XCBA 4U2FA 3V8PA 2VAWA 3QNUA 4DSTA 2NU9B 2EGUA 2ECOA 16PKA 4UMFA 3HXPA 4JBWA 4E12A 1R8QA 5KNCA 2ZE7A 1P5HA 4NZ9A 2FMIA 3PPIA 1RYDA 1D7AA 3CY6A 3WL4A 3WMFA 3TMKA 2OV2A 3SE7A 1K0UA 4R41A 3HU5A 2YV2A 4O33A 2P2LA 1JT2A 5CM2Z 2D2FA 4D43A 4FN4A 5LA6F 3NWBA 3JX9A 3F6SA 2IX3A 1ARZA 2BE7A 2XYRA 3DAOA 3OH8A 4TXNA 2A5LA 1QTIA 4B2PA 1V7QA 4XDYA 3AWIA 2PS0A 1I6MA 1EUDB 1L4LA 4LAFA 1M10A 2JA1A 2Q1TA 4IQGA 2WK1A 5AUNB 5F7OA 4YQFA 3THXA 1QE5A 1BRTA 1C7JA 2QR3A 1L8QA 3CLRC 3M7IA 3OPYA 3TAUA 1JU9A 2QEQA 4BE7B 4EITA 1O4WA 3N53A 1NLYA 4RXTA 3VDMA 4E07A 4F91B 4YCBA 1H42A 4B40A 5EHGA 4MVJP 1RVV1 3P4YA 1RYEA 1BN7A 4B2LA 5G0TA 1JQEA 1KMIY 4CIYA 1Y4AE 3ZDEA 3CMMA 2YWGA 3RBZA 3EQZA 1HKHA 3LA8A 4YCAA 3QMWA 2BI7A 1MV8A 2E48A 1X8JA 1OCEA 1VSVA 3A7EA 4I81A 5A9TA 1ISGA 4N82A 1JTEA 2ZSFA 1GPKA 4WKOA 2BR4A 4EHDA 3FCYA 4O4LA 3C6QA 2HLHA 3LS2A 3OAAD 4MUNA 2XNCA 2VP5A 4BQRA 1UQTA 4IIFA 3CONA 1Q21A 1V11A 3EA5A 3ME5A 4J29A 4N3AA 5KCMA 5KYYA 2VWGA 4IYRA 4C88A 4NAUA 3T3OA 2CCJA 1PWXA 2E9SA 1I2DA 2RIRA 4RY8A 1T8RA 1ZAKA 2IXEA 1JSXA 4N7JA 3RIEA 5T7BA 3THWB 1JU3A 3HGTA 4TMFA 3T5BA 2VFAA 5TT1A 3HBLA 3FTQA 1OV6A 1MAWA 2OWEA 2RKBA 3OIYA 2OFFA 3RFFA 2IH5A 1DEKA 1XKTA 3TL2A 1I4WA 1NVTA 3JD0A 3KKLA 2ILVA 4QFMA 5JSHA 3LC7O 5BYAA 3AR2A 1U5BA 1GTSA 4FR2A 3W4IA 1M6YA 1KMCA 1N6IA 1T1SA 1YUNA 4MOWA 2H9YA 1JDBC 2Q5LA 1Q95A 3K9LA 4EK9A 3NBUA 1WB9A 4GXQA 2ANBA 3EFOA 3DDSA 2GSDA 4F86A 3HN6A 3C7CB 3TPCA 4FZJA 4BFLA 1TMOA 2IYAA 4A4DA 4WACA 2FFRA 5K3EA 3VDQA 3WHKA 1SFRA 1KR5A 3RRMA 4HP8A 4DA6A 5JCZA 1QH8A 1DHRA 2OEPA 3NBQA 5K45A 3N2LA 3ZNQA 2WWVD 4FYYA 5JNWA 4IL5A 1EVKA 2HGZA 3A2KA 3E5RA 1C3OB 1YCHA 4MW6A 3T06B 3ENVA 4CHTA 2W98A 5TGZA 3K2QA 4TLMB 1FFXA 4ARAA 2O0KA 4WWHA 2WVAA 5EN4A 3C48A 2WHRA 2G83A 3IKMB 3DE1X 3ZDXB 1I94B 5I5GA 1PL0A 3MCWA 2ZRMA 1M54A 1R9MA 2GPTA 4ND2A 3RU9A 2UYHA 1XCLA 1WZUA 2QT1A 4LQCA 3RSGA 2EFYA 5AVTA 1JMVA 2QVBA 3QBDA 4B85A 1JDTA 5A71A 1Z36A 3SBXA 3I23A 3I5MA 1OKKD 3TVTA 1EE2A 2ZPUA 4YK7A 5FWXA 4KOEC 1SUIA 1ZS9A 1DAGA 1GUFA 5KJ1A 1XWFA 3GROA 1E9RA 2W6JA 4BCBA 2IEIA 4IF6A 2A0WA 3G0GA 5L3RA 1O6ZA 3BM5A 3OQJA 5EMHA 2J6CA 4KQWA 5K3FB 2JI9A 3BZUA 4RLFA 3ICOA 4PZ0A 3SDBA 4RAOA 4ZV4A 3KQMA 3DEZA 4KGDA 2XUFA 1N33B 3A4TA 3DVLA 1IWBB 1VKZA 3NATA 4B5LA 1PZMA 3O95A 4OHMA 1EEHA 1TFUA 1X80A 2QRKA 2F1KA 4C0AC 1JEAA 4JOCA 1YRBA 3KJXA 1GKKA 1AHNA 1PHPA 1NV9A 3KPYA 4FHGA 4GE0A 5IVKA 3OF2A 5DF1A 2OFOA 4M1KA 3WZLA 1FYVA 3P45A 1QIFA 3WBFA 1SIBE 2VDJA 3ODGA 4HFMA 3R2JA 4JZYA 2AFHE 1WHTA 3DA8A 4G81A 5CK5A 3REFA 3U9SA 3ZI7A 2YFQA 1D5WA 2QKYA 3FXAA 3FPBA 4MA5A 1EDOA 1ODJA 4HXFB 3I37X 3WMGA 1J9ZA 3A1WA 1LCIA 2DT8A 3MCAA 3QVSA 4G41A 3LKZA 1I4LD 1SR8A 4KK4A 2UUCB 1L5YA 2FSHA 2OV8A 2PMWB 3PFBA 4F2GA 2PPLA 3GZ4A 3N1UA 1N3YA 1EDZA 1ZD4A 2F1RA 4FW9A 3RW9A 1A1VA 3LDFA 3NYIA 5EUCA 3M89A 1JEOA 1UOOA 1TC1A 3H8SA 3V2HA 4DNXA 2GH1A 2B6HA 4KOAA 4EMTA 5JYDA 3DG9A 3MQ4A 2C04A 3NORA 3FSEA 1CY6A 4G1MB 1JG7A 3NXKA 3OEEA 4GF5A 1KTVA 4Q39A 5IM4A 4CMBA 1KMMA 1CSEE 3FWZA 4FZVA 4KZKA 4R2JA 3S44A 2HNAA 4EJSB 2C42A 4RM3A 4KPFC 4EG5A 2FFQA 5KINB 1XT6A 1KWKA 2WT4A 4PQEA 3LCJA 4ND3A 2X86A 4YV0A 1PV4A 4LNUA 3I0ZA 1K5GA 1VL2A 2FPUA 3E48A 3GUCA 3AW8A 3MWLA 5G0UA 4A1OA 4JBYA 1O4VA 1UZMA 5ITSA 3SM9A 1RR6A 3PPWA 3OQ1A 4HAVA 4E7PA 1EG7A 4PLHA 4YMIA 6YASA 4P93A 1JVBA 4DLXA 1SWWA 1S02A 3QHPA 3HO1A 2OGTA 4F3CA 1VKHA 3LNCA 3U3ZA 1J8QA 4AS3A 3A2LA 5CG2A 1P61B 1L4MA 1NP6A 3OJOA 1H2ZA 4FDVA 3W06A 1TQ2A 3F46A 1W88A 2FWRA 3LF1A 5JSUA 2OBFA 1O6BA 4YBRA 5IYZB 1TJPB 1UKCA 2WJWA 2O14A 2OHJA 1TO6A 3DEHA 4R8LA 4M8SA 4F2PA 2PRIA 1EA7A 1YOVA 4KWCA 2PM8A 2AOVA 1BXKA 1FMFA 3ROTA 3HB1A 1DMSA 4QYXA 3W8RA 3VI4B 4E4YA 3BDIA 3OLXA 1F0NA 2BKLA 4N01A 4ZAVA 5JAOA 4MLDA 1E58A 1GUBA 4O1HA 4U2BA 5DOZA 4D6XA 4XM2A 1VZ2A 4ENRA 3C74A 3DVAB 1DBSA 1F38A 3UH1A 1RLJA 2AJDA 5BQOA 4ZYLA 2VAVA 3OU6A 1F14A 4X1KA 221PA 3ADDA 3CINA 1RHJA 4XX0B 5C5DA 4JB3A 3PX2A 4C1BA 4BY9E 2ZYVX 3JCZA 1XJCA 1HMPA 3JATA 1XDBA 1EUYA 3Q10A 1SOWA 4KC0A 2DJIA 3WHIA 4HVLA 3WIVA 4H7FA 2NAFA 4NBTA 3ST7A 1MA3A 2P1DA 2Q2WA 2H0QA 1N6KA 4MQUA 2HCJB 2VNSA 1V5GA 3FZQA 4OHPA 1RC8A 1N2HA 1HOXA 4XB2A 2ZRIA 4TS9A 2YIJA 3DMYA 4OH7A 5HQJA 1SHZA 3Q98A 3ROGA 1Y8CA 5KHOC 2O4CA 3CLVA 2J0UA 3FBWA 5IDWA 4DN6A 5KYXA 1AMNA 1DAHA 1WUKS 4M7RA 3GRYA 3KUCA 3CVYA 4JCOA 4L22A 3KSAC 4WD3A 4Q4HA 4TRJA 2YCLA 3HCDA 4V0SA 2OZVA 2R44A 2VUHB 4X8OA 1S4QA 5CP8A 3VX3A 4DLZA 4Q47A 1B1AA 1B2LA 4QUJA 1S8AA 3QKIA 2OA0A 4KVZA 4YRLA 2Q5QA 4EA9A 2RHHA 3ZD9A 3HB4X 5FFMA 4YJGA 5E2AA 3RC1A 1IZ9A 1V48A 4FS3A 2IYQA 2V03A 4I9FA 2OV4A 4L3WA 4D74A 1IQ0A 2QRHA 4PLCA 1YJ8A 1SVLA 5JBNA 3NEPX 4IJUA 5K0FA 3EIOA 4HYTA 3M6LA 5I8ZA 4R98A 1W36C 1MO4A 1NDUA 3L7CA 3FH0A 2CMKA 1ICEA 3HVRA 3ILVA 1CNMA 1I7LA 1RCUA 2I29A 1TJNA 1WS6A 1E3QA 2H5JA 2Q6IA 2RGNA 2ENUA 4FMCB 4JJAA 4R2MA 3GGSA 2M32A 3IILA 2CMGA 4EPTA 1OWLA 5A4IS 3RVDA 4MI6A 1U2TA 4P8RA 4ITRC 1E6MA 3R7WA 2PA3A 3FOWA 3JQEA 3MLAA 3OWXA 1EM6A 4JOQA 4U3JB 1C9YA 3UUGA 2EKQA 4I4CA 1UKEA 5AM1A 3C3DA 1WD5A 5LZ7A 1OQAA 1GPYA 1QOPB 3MF4A 1W9HA 4Q05A 2XYQA 4E2FA 3W3AH 3EVNA 1HG0A 1FP4A 2VDNB 4GZLA 2HK7A 4Z7JA 4ZXFA 1Y4DE 3UIEA 4AMYA 3PHLA 1Z0AA 3LO5A 2HZBA 3WYEA 4OFXA 4PG4A 1DDGA 1Y7LA 4ZOLA 3DBLA 3T8YA 4C20A 4FYHA 3P7MA 4U7JA 4GPD1 1ZM2A 3GNSA 3AI2A 2ZUUA 3R3HA 1E2KA 1VLHA 2RHJA 3PGLA 5ALJA 4OHVA 1S2MA 2V7QA 4KWEA 4ZWNA 5IAGA 5AI9A 1VMEA 4Q82A 2WJYA 2IK8A 3PR1A 1IG3A 1P0MA 5TR9A 4YV2A 3K9FC 3EDCA 4X64B 3UM9A 3INRA 4UULA 3CVWA 3IQZA 1ACMA 1BOOA 2Z8YM 1RZRD 1UH5A 4IHJA 4N54A 1AS3A 1UIMA 3NHKA 4BN4A 1AGNA 1CJTC 2Q3BA 1SVKA 1W85B 1OXBB 3AEKA 3KK0A 4ENPA 5LP1A 4RMJA 5KU1A 4N3GA 2BDTA 1W5SA 2ZVPX 1PX2A 3BE8A 4X90A 3GZJA 5JZMA 4MGZR 3RSCA 5LZ2A 3WLIA 1P2BA 2P6OA 2Y1LA 4U8HA 2QN6A 2OYRA 4DJ5X 2IOFK 3D1LA 1DC6A 3Q6MA 4ZD6A 1R9GA 2AE2A 2OBXA 2Z5GA 4FUQA 5HA5A 5K51A 1N8SA 2WAMA 3E0QA 2Y1DA 3F5FA 4ILEA 3RTCA 2YHSA 1OC4A 2ZP1A 3I01M 5FHQA 3UWDA 3ZTTA 3ZV4A 2JD1A 5CBPA 3KQLA 2GRUA 2Y8EA 2JK1A 2WSMA 2VDQB 3AEQB 5D8DA 3RYFB 3WTBA 1SXJE 4QU8A 3X2EA 1SXJB 2WIKA 1E1MA 1NOJA 1ULBA 4HX5A 1I4DD 1TUIA 2JFUA 4TL6A 5ALRA 4DR2B 1WB4A 5B5SA 5BRAA 4N12A 2QUBA 4B0PA 1KAMA 2OG1A 3ITEA 2XITA 3H5IA 4MW9A 5IJXA 5FL7D 5KTKA 5DSXA 1DMRA 3ADPA 4UQPA 2WD7A 2O50A 2G5GX 3BSWA 3CRVA 2VHYA 5EVJA 6ADHA 1E62A 2I6XA 1VRWA 1E3JA 3O8OA 4KI7A 1VLVA 1T9KA 5E8RA 1IRIA 2XT9A 5LOVF 3B5JA 1I10A 3J7TA 2QF7A 5E0KB 5ICMA 3RVNA 3LQ4A 3PF9A 4HGQA 4DA8A 3QVGB 4I5EA 4ZRNA 4P7FA 2WWTA 3CLHA 3MN1A 3MMZA 5DJ5A 1E7QA 1XD8A 4EP1A 4AFNA 4DV4B 1DB3A 5AVJA 4GH5A 1E2NA 4JSTA 4E5MA 4ZQCB 3RRYA 5F21A 4LFBB 3IVXA 2PH3A 4PFSA 5FLEX 5TX7A 4GRIA 2AYYA 1Y7HA 4X1YA 2NUTA 2E4XA 2Y05A 4RCVA 4R0NA 1DAMA 2GO7A 2QLBA 2EGHA 3ZK7A 4EG3A 5LWHA 2IW3A 2O5RA 4R69A 1NF2A 2Q29A 4MARA 4FBMA 3IS3A 4Q48A 1M66A 1VMKA 1VYHA 3LW7A 1OT5A 2PG3A 2JAUA 3MOIA 1U7XA 4RSHA 1TZ2A 4AS1A 1R66A 3DEFA 2A57A 2NUPB 4Q9NA 1SCNE 4FHDA 4HAUA 5FI5A 5B1DA 3RO7A 3I6YA 4F38A 4R1MA 1WPGA 3O90A 3GCDA 1SVIA 1AD2A 3I3OA 4FFSA 4M2LA 5E6RA 5TJHA 4BZQA 5EJ8A 4NK5A 1KF0A 1P3JA 2QI9C 3DXZA 3N8HA 4XPIA 2AC7A 2NSJA 2FW9A 1FYEA 3BF7A 3HZHA 1SG0A 3PFCA 3UWMA 4N5DA 3DFIA 4L95C 3S8YA 4EABA 2YFYA 3E9RA 4W5TA 2AQHA 4C2TA 3PWTA 4MWZA 3IQXA 1TCUA 3LTEA 4DBZA 2I3BA 4AIIA 2JJQA 1PEKE 1EDEA 4OX9B 2YHUA 3ITKA 2WFLA 4B44A 2WWWA 4G86A 4DE5A 3GGPA 1MBZA 3VJRA 4EJSC 1W96A 5FX2A 5JARA 4BYMA 4E2WA 3QA9A 4BGEA 3BBPA 3TZQA 4N41A 1KOFA 1NDHA 2DCUA 3LWZA 3CS3A 4RA9B 1VHLA 1XRSB 3LT5A 3PC3A 4PHHA 4URHA 4FFMA 4WV3A 4JYZA 3P26A 2GPAA 4RHEA 5IH7A 4GPAA 4IW3B 3W2HA 4FFOA 3CF6R 4OAPA 3O4JA 1H3NA 3CKKA 4NENB 4AM8A 4EHNA 3T9DA 5A6SA 1DRVA 2A84A 3IP9A 3NR2A 2Z5LA 3GPCA 5IARA 1A4IA 3CURA 3UKDA 5CPFA 3OLZA 4K9QA 3ZXIA 1FX0B 1E77A 1Y5IA 4FDAA 3UBMA 3CA8A 4FGWA 4D9GA 4Z2AA 2PYIA 5B3JA 4MDYA 1WMDA 3GEDA 4LF6B 4AL4A 4OSEA 3KZMA 1AE1A 1GARA 1C7QA 3T9AA 2AR0A 1RXYA 1L1RA 1VMIA 3MIIA 3OOHA 4YCJA 4CKEB 1ONPA 1PL7A 3VVBA 1HZZA 4JT9A 1ZCZA 2EHJA 4LX0A 1ISSA 2HZ7A 1NP3A 1CIJA 2PUHA 1S1MA 1M6NA 4LE1A 4UHHA 1HDZA 4HQLA 4ZO9A 3RH0A 5A2QA 1CK4A 1W0KD 1U0OC 1H2XA 2NPFA 3D6HA 3GP3A 5CB4F 2RK6A 3HRIA 1QUEA 4GBGA 2QIPA 1Y6ZA 4CCYB 4XXHA 4IINA 1ESCA 2C2KA 2XBUA 3U60B 3ZWYA 4KQEA 5EIFA 3ZJYA 4XVHA 4DR6B 2AW5A 3K2BA 1A7UA 4BKOA 1RXCA 3MWEA 2D06A 1EVJA 5C7YA 1KC1A 2ZB7A 2V7XA 4KXMA 2K7ZA 1UFRA 4ZIRA 4YO8A 1BW9B 3X1JA 1JEJA 1XD2A 3EPJA 2H65A 3G13A 3I9NA 1QPBA 4M87A 2VP2A 5DYTA 1EVIA 2FN7A 4S3MA 1NNLA 2M6RA 3UHOA 2PRZA 4IGKA 2GHTA 2P9YA 3C45A 3KZOA 1RBMA 3LLMA 3NHYA 3HG7A 2DZDA 3AV3A 2YTZA 1DLIA 4M49A 4ZT3A 3FMPB 5KQMA 3U16A 3GUHA 1N5RA 4KXUA 3QOXA 2CJWB 3QTBA 1R0YA 1FP7A 2RARA 2Y77A 4AY5A 2FDRA 3UHAA 1PV1A 1T5TA 1V43A 2FWJA 3A1NA 3OESA 4RE5A 1EJBA 4YJKA 3L6BA 5EWLB 3TCKA 2FYTA 2IU4A 1Z16A 2V7PA 1A88A 4ZGWA 4W9NA 2B1IA 3TSCA 2P69A 4KQGA 4CR7A 4GKAA 1VHQA 4CBVA 4CU5A 2MSCB 3I2HA 3RFCA 3JU3A 3B3QA 1YRHA 3EIFA 1RQLA 4YCLA 1CQJA 4D0RA 2NTJA 4TWIA 5EXDA 2X0EA 1JGTA 1VBKA 3UQYS 2ID4A 3K5HA 2QRPA 1NV8A 1UFQA 2FX2A 1P2UA 4G9EA 2WDZA 1DUVG 2IYFA 3MJCA 4RV4A 3H1FA 3NC4A 1XCPA 3FMFA 3MJEA 1RTKA 5F2KA 5AK0A 4DIDA 3KUDA 4NEHB 1O94D 1EFVB 4DXDA 3FR8A 4P3OA 2XXBA 1DC8A 3CE9A 3VOAA 4RJJA 5ELMA 4Q16A 1NUUA 2J45A 3IAM6 5ALPA 5LQNA 3CBQA 4FX5A 1XOIA 3T7JA 3DLAA 3QWAA 5COBA 5T8KA 4JI4B 2O8FA 1H5NA 5A05A 3SXJA 4QM6A 3X43A 3U7JA 2HQBA 3DE7X 4Y1FA 1C0EA 2HCBA 1IWOA 1U0LA 2EJUA 3LLUA 2XCUA 2CMHA 4BFWA 4CQMB 1PJ8A 3STYA 3DOUA 1Y1LA 3RTAA 3S2ZA 1YFLA 4IDNA 4TS4A 4GT1A 4OMCA 4XDHA 1CRWG 2CJWA 5EP3A 3U62A 5DVZA 1MN6A 1R8YA 1QB7A 3HDQA 2HOQA 1IUKA 5AOAA 1WR8A 1KSFX 2P6MA 2W8BA 1ADBA 2D3TA 3H0KA 4UU1A 3M6WA 4EUKA 4DLNA 2PUDA 3LPNA 2FEWB 3T5DA 3DF7A 1N2ZA 1SIWA 1ADGA 2JHGA 3EIQA 3QMMA 1OD6A 1S7GA 4FXOA 2VUSA 3VM6A 5B64A 1G66A 1XLVA 4MVJM 2PX8A 1SC4A 2Q0XA 1U02A 5F2OA