3BORA

Crystal structure of the deadc domain of human translation initiation factor 4a-2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
194
Chain Sequence
EIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Human initiation factor 4A-II
total genus 67
structure length 194
sequence length 207
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3borA00
3IGFA 1YHNA 2K5UA 1VYUA 1XTJA 3V9PA 1KMQA 4NCHA 3IUYA 3WMFA 2JEOA 2CNWA 4L5BA 4X8LA 4TQAA 2WPDA 4PO9A 1F48A 3T06B 2Z4SA 4A6XA 4EKDA 1W0JA 4GRAA 1Q1BA 4DIEA 3QJYA 2FWRA 2PJZA 2FFAA 2IYZA 4CVNA 4RZXA 3KUCA 1XD8A 1G7RA 3R8FA 2ZEJA 3LXRA 4IFEA 1HT2E 1EFHA 4A0GA 2ATVA 2V1UA 3SR0A 3L0SA 2LKDA 1IHUA 1NI3A 4Q7MB 2ZR7A 1KI3A 3M6AA 4FXPA 3W3ZB 3NIBA 2EWWA 3TVTA 2D62A 2QAGC 2QE7A 221PA 3K0SA 1M7GA 1ZNZA 4ESHA 1X1RA 1KKLA 1Q1ZA 2R6GA 4LDJA 2NGRA 1ZC4A 2JLWA 4KSCA 2QU8A 2ZPTX 4PAQA 5FH9A 5CITA 1UBEA 3K09C 4DJTA 4QKQA 1BYIA 1XEWX 4XVQA 4S2EA 1BO6A 5H8WA 1XWIA 3UMFA 2WKRA 5EXXA 5CIQA 2ZU6A 4AC9A 1ZMXA 1P4SA 2HLDD 4TMVA 2GETA 3K0AB 2P0EA 1SVMA 4LC1A 4P4UA 5DHFA 1HQYE 1G20E 4FCVA 4MYHA 2JLQA 2NO1A 3BC1A 4GFDA 1P61B 3GLGA 3FMOB 3FPAA 3OAAD 1X8JA 3VFDA 1KI6A 1VDZA 4AG5A 2B21A 3PEYA 5IDVA 3HU3A 1FQKA 5DLQC 2KSQA 2RKOA 3P20A 3W34A 2VHTA 1SXJE 4LX0A 4A4DA 1XMJA 4JBXA 4EIWA 2VHUA 3ZYCA 1NBME 2FPKA 3BWDD 2CVFA 1YZUA 1GKIA 4M1MA 1D2EA 4GP7A 1LNZA 1TQDA 3VR6A 1AK2A 4CZ2A 1JR3E 1IY0A 1JECA 1UF9A 1XF9A 1EWRA 4N0EA 2WVJA 5G3ZA 3HPRA 3SC3A 4YMVA 4HZIA 3FVQA 2YYZA 1QHNA 3B1YA 5A5GA 4HLUC 2ODWA 2ORWA 2VH5R 4CEJA 4PSKA 3ADKA 1GIAA 3KQHA 3MD0A 2JIZD 5FTNA 1MO5A 4C0HA 5FPYA 4CDGA 2XOKD 2OXRA 2IS2A 5JJLA 1P6XA 2F43A 2ZI6A 2IS1A 1Q3TA 1II8B 2IW3A 4JJZA 1NVVQ 2DBYA 4DHEA 3LWNA 1S3GA 5FL7A 4FMCB 4LOAA 4L4UA 5LB4A 2MMCA 2A5JA 1RPZA 1ANKA 2GBLA 5LD2B 2OCPA 1VIYA 4YMSA 2IA5A 3GLGB 3CPHA 2AFIE 3U44A 2VP4A 3TUJC 3CWZA 4TL9A 4NZYA 3GD7A 521PA 4G5GA 1US8A 1NBMD 2AKYA 2FDCA 4XD7D 1AZTA 1QBKC 3L0IB 3ZS9A 2NMVA 2BHRA 1SULA 1KI1A 4D0LB 1E98A 3F5FA 3L82B 1KMHB 3KKNA 1KK3A 5CJ2A 1UFQA 3GJ8A 3PUVA 5AUQA 4GMXA 3TVDA 1NIPA 1Z0FA 2ORVA 4RD2A 2O8FB 2C04A 3NWJA 4XWOA 1U9IA 4Q47A 1N6RA 2XGJA 4HB0A 4OQXA 4TL6A 4O3MA 4EPVA 1G6OA 2Q9AA 4C7OB 1I2MA 2P5TB 1SVKA 1LV7A 4WIAA 2GJKA 4DKXA 1CJVC 5EP3A 2J7PD 4IOLA 4D80A 2O8BB 3C14C 1UKZA 1Y3AA 2GRJA 2GXQA 2QMUA 2FX3A 2YWGA 3N2EA 2ZM5A 1Z0AA 2CJWA 5G53C 2X8AA 1GKYA 1Q1EA 4M4SA 2OUKA 4XTCS 2HJGA 3SBDA 2ZANA 4QOSA 1X3SA 4IXNA 3AEZA 5FBVB 4WXRA 2GZDA 4H1VA 4Z51A 2F1JA 2ZRKA 5FR1A 2QMEA 4LJ9A 2PZEA 1KKMA 3DO6A 1QHGA 2JDIA 3W5JA 1XP8A 1QHXA 3WMGA 1GP2A 4LBWA 4KO8A 2HCJB 2OBMA 4NKRA 4PX9A 4F7WA 5AUOB 1E99A 4OI2A 4TTRA 3QE0A 2VL7A 4QGAA 1FP7A 2IWRA 2VP5A 4DCSA 2G1JA 2V1XA 3GEEA 3HU1A 4FI3C 2QG6A 5KNBA 4ESVA 2VP2A 1E1RD 5LPNA 2AFHE 3H1TA 2G3YA 4ZCIA 1KMHA 4I4LA 1Z07A 1E3MA 1W2GA 2WWWA 3LA6A 4LYJA 3IPXA 4F4CA 2WKPA 4Z1MD 3K9NA 2V8OA 4D81A 5EXTA 3EPHA 3W8RA 4KYIB 3AV0B 3VU9A 3NEYA 1XPOA 4QC2A 4BGDA 2ODEA 2W6JA 4V0ME 4LK2A 2GAOA 4PZZA 1CJKC 1Z3IX 2OLJA 1FTNA 3NH9A 3PVSA 1P2VA 3DOEA 4PPFA 4QGHA 1E4VA 2IF0A 4IOJA 4LWZA 2WOJA 4NYIR 3K9HA 2GJAA 3ND8A 1ZBDA 3IIJA 1QHHA 1V5WA 5L3RA 4CEHA 2V6IA 3PQCA 2ZVPX 1R10A 2JJ1D 1XZQA 3DMNA 1K5DA 1E0JA 1TEVA 2BEKA 2FFBA 3EPJA 1GL7A 1RKBA 2ZUDA 4R2IA 2O8CB 3U3KA 2KBFA 2F3RA 2C9OA 2G88A 3CRW1 4A8JC 1E9CA 1KJYA 1PLJA 2HDNB 4PO1A 4R2HA 2F3TA 4FMCF 4UNPA 4ZKDA 2BWJA 3H0KA 2GK7A 4A92A 1HEIA 4B71A 3B5JA 2BM1A 1H8HA 2J0VA 1GL9B 2BMEA 3HWSA 3T12A 5FOSA 3CRRA 4GOJA 5CLLA 5L3VA 1J7KA 4TYQA 3Q72A 1U8AA 1YZTA 1NP6A 1SZPA 4Q4HB 1M74A 1G3MA 4N3NA 1E2HA 1QZXA 1DEKA 1RRFA 3MCAA 1P2TA 2BKUA 1NVXQ 2RAPA 3BRWD 5C18A 1JNYA 3TLXA 1N0WA 4EPYA 2PZGA 3UMSA 1MR3F 4NCJA 5E95A 4JVMA 5KO2A 2OILA 2ZRLA 3AF1A 5FPSA 2J46A 2VA8A 5HCIA 2VP0A 4H9GA 2RGDA 1YE8A 4M1YA 1RYFA 4A6PA 3B1VA 2BVNA 3A4LA 4E09A 2QT0A 1Y63A 3DM9B 4DCNA 4Q48A 2YKGA 3THOA 2ZE7A 4D82A 2EFHB 2XJ4A 4WXPA 1E2FA 4CEIB 2QT1A 2ZIAA 1NL3A 5KNDA 2J0UA 1HH4A 2HCBA 5HPYB 5CB6A 5FR2A 2ZAOA 1J70A 2E87A 2QAGB 1FTSA 3FB4A 4DUGD 3OEHD 2ANCA 4HB2A 3OEEA 3C5CA 2DFTA 1G3UA 2GCOA 5IRCD 1GAJA 1OF1A 4B47A 2IYVA 1ZM4A 1TAGA 5J4YA 4LHYA 5L3SA 2JLYA 1BKDR 4W5HA 5CDFE 1N5JA 1CP2A 3I5XA 1PVOA 2OO7A 4A2WA 3RDPA 2J45A 4PC3A 2W2XA 3CR7A 4EFLA 4CT4B 3LW7A 4F38A 2C96A 3OFNA 1YRAA 4LBVA 2VEDA 3A37A 1QDEA 3KTAB 3REFA 1KI9A 4WAUA 1G4AE 1NVUQ 4BEBA 3GLGE 1U99A 1XCPA 1LS6A 4RZUA 1A5TA 4Q9HA 2F1RA 1Q57A 3WYGA 1D6JA 2CMKA 2WSMA 3UWKA 3MWYW 4YQFA 2F6RA 3IBGA 4LYAA 2GDJA 2ZUCA 2JLSA 5BYKA 2V7QA 3D6TB 3IILA 3KJGA 4MRRA 3RS0A 4TL7A 1ZW6A 2JCSA 3PR1A 2XTNA 1YZGA 4IXMA 4V02A 2KB0A 1OFTA 1NBMA 2R6AA 1OE0A 2IS6A 1P5ZB 2CL6X 4YLGA 2O5VA 3RNLA 2H1LA 3RSLA 2PCJA 2IBMA 2D3WA 5GJCA 5TMPA 3QXJA 4P0TA 1E0KA 1OYWA 3RLFA 3A8TA 3LBHA 4OL0A 5CJPA 5J40A 3EIQA 4Q9IA 5KDOA 2FPLA 2WV9A 4MYUA 1JR3A 3EZ6A 3UMRA 4UXJA 2ZI4A 3T35A 3V00A 4EQ6A 2CEAA 5CK5A 4C0QC 4DB2A 3BK7A 5BQ5A 5GVSA 1G18A 1IXRC 2ZJOA 4QHYA 2GVDC 1XJQA 1YZNA 2YWEA 3SOPA 1ZRHA 4XOIA 3HJNA 3T34A 5C46F 1I2DA 1OV4A 3O47A 1NN3A 1DAEA 1R0ZA 3B7GA 3SHFA 5E4FA 3F3YA 1SHKA 4DLTA 2ZE6A 1T0HB 5F3WB 1R5BA 2B8TA 4QNMA 3SJAA 4RKEA 1Z6GA 3RANA 2YINC 3U7EB 4OI0A 4GOXA 2WWGA 4FN5A 1ZM2A 4CT5A 1OIXA 4DT1B 2HYIC 1A82A 1KZGB 1W44A 4Z1MA 2RHMA 2CHVA 4C0AC 1DARA 3RWMB 1PZNA 1II9A 3BFXA 2JAQA 4M9QA 1G4UR 2DY1A 5TARA 3KJHA 4PC7A 3GLIA 3LVQE 3CKLA 4QBHA 4RD0A 1GNRA 3GLIB 3DEFA 4MDEA 4PHTA 1BYUA 1BH2A 1PLLA 3ASYA 2VSOA 1KGDA 3DDCA 2QN6A 4Z8XA 4OI1A 2ATXA 2QTFA 4RCYA 3SZRA 2X2FA 3EPLA 1X86B 1GVNB 1GDDA 3AVPA 4KODA 1W4BA 2P2LA 1CU1A 3K70B 3NDPA 1KIMA 2WSSA 1JPJA 3MWJA 2C77A 4KLZA 1L7VC 2P6UA 3BJIC 1G5TA 2EVWX 4R71A 2H7VA 2GCNA 2ZQ5A 3UK6A 4PZYA 2QL6A 4MUBA 4F4JA 3GJ7A 1E2MA 1ELOA 3C7KA 1DVRA 3C5HA 4DB4A 3A1SA 1XPRA 4JT4A 5ELXA 4M0LA 1E69A 2ZJ2A 2WAXA 1U0JA 4DWJA 2OESA 5HR5A 3NC0C 1DPFA 2FU5C 2JLZA 1NMXA 1PUJA 3L0OA 1MV5A 1Q22A 2AX4A 5M04A 4RD6A 2ECKA 2I4IA 3H2YA 3ZD6A 1Q20A 1XRJA 5L3SB 3EZ9A 1EFTA 3NTUA 4O25A 3UPUA 2O8DB 1H65A 1V43A 4ZPXA 2BV3A 3U3RA 2FMXA 5FPKA 4G01B 2ZSBA 2JLXA 1ZNXA 4HUQB 3EAQA 4Q21A 1ZCAA 2QTVB 4KFUA 2LKCA 5HE9A 2NQ2C 3WNCA 3KXIA 3IQWA 1BMFD 2XB4A 1OYYA 2ZI5A 5P21A 3EA5A 2XXAB 3UIEA 3SQXA 1NN5A 4JMPA 4Q7LA 1E2IA 3VR1A 5BN3A 2DB3A 2HLDA 1HURA 4DLSA 3HU2A 2GK6A 2IXEA 4QXAA 3VNVA 1VG1A 2CHGA 1TQ4A 2BMJA 1FX0B 5LDDC 1G64A 4BLTA 4IVRA 2IEZA 1Z8FA 5BN4A 4YC7A 1P9WA 1Z83A 4BFUA 1AN0A 2Z6VA 1CKEA 5FUXA 2P6RA 4QRHA 2EFEB 2P3SA 5JWHA 4UJ5A 2FZ4A 5HZHA 5IK2D 1NIJA 4Q00A 3DKVA 1Z22A 1R8QA 1KDTA 1VCOA 4M9ZA 4PHHA 3FWYA 3FKSA 5ANRB 3OFND 4URZR 2YWFA 1CRQA 4YDHB 4HDQB 3PEVA 3T1QA 3VNUA 2W0MA 4NL4H 3LXXA 2YHSA 1TMKA 4C30A 1R8SA 1Z2CA 2ZRNA 4JLPA 2O8EA 4GNKA 2QMOA 1VHLA 1P7CA 1LF0A 2DWQA 2PMDA 4NYMR 2IEYA 2Z83A 2BJWA 2QNRA 3HP1A 2FSFA 4JLAA 4P4SB 1M7HA 4JT2A 1HE8B 4DSOA 2PCLA 3GLFB 4JLKA 1VCNA 3OIVA 5B57C 1HT1E 2LWIA 1F2TB 1XZPA 3TMKA 3RABA 3REGA 4OJQA 4B35A 4MGYR 3M1IA 3W8NA 1II8A 4DRZA 5KHOC 4KFSA 4QFMA 2ZETA 2BC9A 4L9SA 1Z6TA 2NTYC 3QXSA 1WP9A 1VKJA 2HV8A 3K9GA 5DHAA 4PTLA 1COWA 3E70C 2H16A 3OIUA 3V4FA 2IYQA 1H8EA 4K8OA 4OQNA 3Q7PA 3KQKA 1VCMA 1G7CA 2EFCB 3QENA 3HDTA 2BBOA 1IJFA 1KSFX 5HZKA 1S96A 2C78A 1QHIA 3A1UA 5EE1A 1XFAA 4A9AA 3WBKA 4HLUA 5JHGB 3U61B 3CNOA 2GA8A 1VMAA 5AJZA 2HXYA 5LBIA 3LRPA 4G5SA 4YMTA 1R0YA 2KE5A 2N46A 2ZROA 4FWIB 1IAQA 4Q9LA 4LYHA 4RFVA 5JWOA 5H1YA 3B2EA 2JJ1A 3QUSA 1WCV1 4JSYA 2H92A 4DDTA 2GJ8A 4DDUA 4LGMA 5JHHB 4MKFA 3TUZC 1DS6A 4HLDA 2P6NA 1XMVA 1OXXK 2RGCA 3CLVA 5CIWA 4ZCMA 5JECA 3RYTC 5D3MB 2P5SA 3GJ6A 3IO3A 3QKRB 2AXPA 1KY2A 1KI7A 3PV0A 3MAAC 1PV4A 4RKFA 2ERYA 4LUCA 2GESA 4AD8A 2PJRA 2ZTSA 3EARA 1UJ2A 3QY0A 4GZLA 2IYYA 2GXUA 2ZAMA 1P9NA 5GADl 1QG4A 4JJKA 1W5SA 1OKKA 4NCKA 2A9KA 1NMZA 3BORA 3UKDA 1F2UB 2J0QA 2WSSD 3F0TA 1Z0DA 3HPQA 2AKAB 4XIGS 2CK3D 2WIBA 3K09A 3VR3A 1E9SA 1NMYA 2X2EA 3BBPA 4NH0A 1YZKA 2AK3A 3WP1B 4GDFA 2FEOA 2OLKA 4AWXA 1MO3A 3GJXC 4TLAA 1AS0A 1XEXB 4JVSB 4NP6A 3FKSD 5EXPA 2JDID 1W4CA 2ZJYA 2V55B 3E2IA 4LV8B 4TSFD 1ZVQA 1EK0A 1UDXA 2PZFA 3OF5A 5FUYA 1P62B 4V0KA 1FMJA 4AKIA 3KZ1E 5EE3A 3BIFA 4DDVA 4HSEA 2BCGY 1E2PA 2ERXA 1DAIA 2QROA 2A78A 4OHVA 4LBYA 1G8HA 3BAFA 1IJEA 2ZRPA 3PG5A 1TUEA 2WAYA 3AVVA 1CLUA 1P73A 4M9SA 1U2RA 3P4YA 2QP4A 5JEEA 4Q1FA 3CRQA 1R0WA 3FMFA 3WHKA 2V9PA 4RD3A 4TT3A 5IT5A 1W47A 2CCJA 4ZDKA 3AVUA 1GSIA 1U8YA 2QPTA 2J3EA 1X6VA 2AN9A 2EU8A 2VYFA 1J8MF 1W7AA 3TR5A 3NHBA 4DLUA 3WNBA 3T1TA 3TK1A 4D4MA 2O8BA 1JQJC 4XWKA 1R5OA 1ETUA 2Z4RA 3P26A 1G8PA 4PANA 3EC1A 3J81k 3U60B 2OSBA 3QKSB 2F1IA 2GTPA 1NG9A 3IPYA 1CEEA 4V0OA 3GJ0A 5G40A 1Z47A 3I8SA 5KTYA 4BUJA 1KY3A 3N70A 4XSGA 4FWTA 3ZIAD 3NBXX 1CR1A 1E0SA 3VX3A 3X1YA 2SHKA 4Q1DA 1W36D 4N1AA 2Y8EA 2QQEA 2BKEA 2Z43A 5TB5A 4B74A 3FFAA 2CHQA 1OHHA 4I1SA 3S1AA 3ZLJA 2YJTD 5J4VA 1DTSA 4EPRA 2H8KA 1F6BA 2RGBA 1S9DA 3FDIA 3N5CA 1Z5ZA 4A2QA 2OT3B 3AKDA 5B58C 1KYIA 3OHMA 2WWFA 3R7WB 1NY5A 1KK1A 3W6PA 2ZREA 2WTUA 3VQTA 2JJ8A 3LX5A 1G291 2AD5A 3H84A 3T15A 4F91B 4Q5IA 1N6IA 3TAUA 3OE7D 3D7MA 1W48A 1XD2B 1DAMA 2ZS8A 1Z0JA 4DLVA 5JSZA 3W90A 2DCUA 2BBWA 4JS0A 3RRNA 1N6LA 4M1WA 3AF2A 4LI0A 2JIZA 2VLIA 1XB2A 4WZAE 3FTQA 1KI6B 3KXLA 4HDCA 4MYCA 3A6PC 1U9IC 4ILEA 2RB4A 4PC1A 3QF7A 1NN0A 5EE5B 4A0FA 2FGKA 5BYJA 3N2IA 3BD9A 1E0AA 2ODNA 3K0FB 2ZYUX 3EC2A 3O8RA 3FHCB 3O8BA 2IF2A 3GMTA 2OCBA 2J9RA 2JASA 1E96A 2R2AA 3RSOA 1G8YA 4BWYA 3KQUA 2IS4A 2NO7A 3MSXA 4BLRA 5KSPA 3KKMA 4V0MA 3ICEA 4A82A 1GRQA 1WXQA 1BIFA 2ZSFA 3RHFA 5L3QB 3K70D 2GXAA 3Q7QA 3SYNA 4ACAA 3RRZA 2J0UB 2RGEA 1YR7A 1VG8A 1CJTC 3WY9A 1M8PA 2IHYA 3PUYA 4OHZA 5KPJA 3NG1A 1IQPA 5J4HA 3VX4A 2OBLA 4US1R 1FQJA 1WA5A 4HAWA 1G3RA 3AKYA 5DYIA 4CYMA 3K53A 1NN1A 3MGCA 3B9QA 2DFNA 4NHOA 1AS3A 4LV6A 4PSVA 2PX0A 2R62A 3CZPA 1OH5A 2OV2A 3GEHA 4DXAA 1TPZA 1N0VC 2VP9A 4ZCLA 1J8YF 4AURA 4AYTA 2NO6A 2XZOA 4DLYA 2PT5A 4K81B 2QRZA 3EXAA 1VG9B 3NXSA 2YOFA 4GOKA 3WYAA 2WKQA 4WA7A 3NVAA 4I1VA 3TNFA 1T8UA 2H18A 3D8BA 3U3MA 4BFZA 4DLXA 2B7CA 2QENA 3NBZC 5FTMA 3W6NA 1N6NA 4BECA 3CR8A 1UBCA 1N3BA 2PMKA 2C03A 5L3QA 2F1HA 3CB4A 5FBWB 1JEEA 1E9FA 5HCNA 2W2TA 3EWSA 5AR1A 2QUZA 2V6JA 1P60A 3BH0A 1E2NA 4B2PA 3BB4A 5FFMA 3A4MA 1UDWA 5AJYA 3RS5A 1G41A 3A58B 4C2UA 5DGXA 3OE7A 1E2EA 1F60A 2DFKB 1SKYE 1WDTA 6Q21A 5J5CA 3LX8A 1WB9A 3QF4B 1S2MA 2WJIA 4YXWA 1O3YA 4TYNA 1W2HA 3KXKA 2ZJAA 4AYWA 4Y0AA 2RGNA 4XVRA 2XNDA 3B1ZA 5KYKA 1NVVR 1S4QA 2EFGA 3ND9A 3RVBA 4LPKA 1AQYA 1ZU4A 3MMPA 4RY2A 2ZXUA 1GTVA 3VKWA 1DG3A 3ONWA 1DAFA 4UJ3A 5KDDA 4PXAA 3I5YA 2F43B 5KDLA 1NSTA 3U3OA 1D5CA 3SE0A 4JVNA 4L9WA 5FPTA 2RGAA 4LJ7A 4FIDA 2XSZA 2QQ0A 2PEZA 4G0NA 1E1QD 2OCAA 4B75A 1TNDA 1Z2AA 4TLEA 2QPAA 1RZ3A 2ZS7A 4G3XA 2A5FA 1CRPA 1DAKA 4QJ3A 4OK6A 2D2FA 3EASA 1ZYUA 4QGGA 2B6HA 2IX3A 2QAJA 1GM5A 2Q6TA 1TEXA 2UZIR 2DR3A 1YQTA 3CRVA 3U5ZB 1CTQA 5J4LA 3K0FA 3FGNA 1N0UA 3CIOA 3FFBA 4JLNA 5JMTA 3TSWA 4FCTA 1E32A 3HYRA 1ZD1A 2GCPA 1I4TD 2ZVQX 2D06A 2QZ4A 4NCIA 3P4XA 4Y0VA 2R6FA 5IHPA 2D7DA 3MRSA 5AJWA 1G17A 2KWIA 1JR6A 3QQ5A 4NDZA 4EJSA 3AP3A 1GOTA 2EYQA 1NRJB 3I92A 2QORA 4N0DA 4YXWD 4NYJQ 4P33A 1UEIA 3L8ZA 3U3JA 4CRWB 4LJ6A 1ODFA 4DCVA 3GFTA 2Q0HA 2IUTA 3PCRB 1FPMA 1IOZA 4JLOA 4Q9KA 4A0HA 4DVGA 4CEJB 1AIPA 1Z6AA 3LH5A 4IJMA 3AP2A 4D0GA 1EFRD 5C1BA 3K1JA 1GITA 2FSHA 4HAYA 1FNMA 1A1VA 3I1FA 4O2RA 5EXSA 2W83A 5AWFC 5FOVA 4MRSA 4HAUA 1ZUNB 3GLHA 4TL8A 4HUTA 4Q4JA 1ZP6A 5JEDA 1S1CA 1VTKA 3U4QA 5K8LA 1E2QA 5CM8B 2PBRA 5FOTA 1AJEA 3TSOA 1XEXA 3QBVA 4X8MA 3GJ3A 2YV5A 2FOLA 4RFSB 1GRNA 3A1WA 4IRUB 2GAAA 5B2ZA 3X1ZA 2I1VB 3LY5A 1KI4A 4BLQA 4DSUA 2OAP1 1FMLA 2IYWA 1OXVA 2CDNA 3BFVA 3IIMA 2IHBA 2C9YA 3FE2A 1NVWQ 2CL0X 4US2R 5DN6A 4FINA 4EUNA 5TDHA 2DHRA 3WBJA 4OHYA 3EIEA 4TYYA 1JB1A 2VHJA 5EP2A 3TE6A 1ZC3A 1X1SA 4AG6A 3EA0A 5E3HA 3K9LA 1KOFA 1XXHA 2Q3HA 4IDQA 4JL6A 4C4PA 3BERA 3JVVA 4XSHA 3IDQA 2O8EB 2YC2C 3SI7A 4B44A 1ZM9A 4P31A 4JL8A 1MOZA 2XZLA 2W00A 2JATA 3ETLA 4E5UA 3QPWA 2ZR9A 5F98A 1F2TA 1W49A 1OH8A 2ZI9A 1W46A 2Q3FA 4JSTA 1ZUHA 2XZPA 1CBUA 4OK3A 3D3QA 2F9MA 1I4LD 1KDPA 4KITB 2A3RA 3A1VA 2PH1A 1EWQA 4IVQA 4GSYA 3UG6A 1COWD 5HTKA 3KL4A 1ZIOA 3T1VA 3FYHA 5BWMA 4AYXA 1E9AA 3LD9A 1N6HA 1CJMA 2GHIA 2JLVA 1MKYA 1FUKA 1YKSA 2FH5B 3AQ4A 2EQBA 1YU9A 5EUMA 3LBIA 2TMKA 3IO5A 5EUQB 3CPEA 4C2TA 5D3QA 1DO2A 1T91A 3AUYA 4M1OA 4ACBA 1Q44A 1EGAA 3AF3A 4ERNA 5FOXA 4M1SA 3ASZA 3C8UA 2A2ZA 2WMOB 4PR0A 2YC4C 4MITA 1XD2A 4EFNA 4URVR 4MGIR 4XD7A 2OM2A 1S1MA 3GLFE 1SGWA 4ZO4A 4HYYA 2GEDA 4Z8YA 1MO4A 3M4YA 4QG7A 3X1DA 1NLZA 3TRFA 2VHQA 5DIFA 4DCUA 1E6CA 1AA9A 2CVHA 3DVLA 1OPXA 4H1UA 4EAQA 1WMSA 2H5EA 2CBZA 1JALA 5IF9A 5JRJA 4BRUA 3QKRA 4MKGA 4MGKR 4UXHA 5LD2C 2FSGA 4TT3D 4KCGA 5G3YA 1J99A 4TSFA 3CBQA 1OHHD 1UKVY 4B2LA 1T5IA 3RC3A 4TWZA 3R9XA 3QPUA 4RD1A 2CJWB 3T5DA 4KYUA 1TF7A 2ZJZA 1YR6A 2DWOA 4B3XA 3K0CA 4ITRC 5CDFA 4LHZA 3RC8A 4DLRA 3QKSA 1G7TA 2R6DA 3AM1A 1S9HA 1G3QA 1GRRA 4B6FA 1KAOA 2MMGA 2UKDA 4GBMA 3THYA 1OH7A 3QNUA 4DBLC 2QBYA 4BFTA 1RJ9B 2OXCA 3I4LA 1EESA 1JEDA 2FNAA 4JBWA 1XPUA 4Q1CA 2CLCX 1NNEA 1IBRA 4M2LA 4A0RA 3OEED 2GCOB 4KVAA 3QXCA 4IEEA 4YMWA 4QL3A 5EQTA 1S8FA 3HR8A 3WMEA 1N5LA 1IONA 4B3BA 4PPGA 5KU1A 2R44A 5JRZA 1OB5A 3B82A 1P75A 3X1XA 4DLWA 2R9VA 3SJBA 4HUQA 5H70A 3GFPA 1AKEA 4RSGA 3ZD7A 4DEYA 1G21E 1II0A 1Z28A 3EZFA 1JQLB 4HZUA 4RJLA 5K8TA 5C2JB 1E9EA 3A36A 1HE1C 4X8OA 1OT3A 3AVYA 2DYKA 1UAAA 4TMXA 5SZKB 4MRPA 4B3FX 3I73A 5FBRB 4CW7A 4AK9A 3LV8A 2WICA 3UANA 4JLVA 1X8KA 2C98A 2DPXA 4B73A 5JI3E 4JKYA 2WBLC 3LBNA 3RWOA 5HKKA 3LDAA 1XTKA 121PA 4WBSA 4B43A 5CB8A 2QGNA 4L16A 1JR3D 4URYR 1FNNA 3THYB 3C4JA 4FMDB 1OFHA 4L15A 4PQFA 2PLFA 4OJKA 1U0LA 1FW6A 2WWXA 3IKJA 1H8HD 1W4RA 4WW0A 1YVDA 2N42A 2ZYTX 3ZQJA 3WRYC 2LCFA 4OBEA 3DL0A 4YMUA 3G0HA 2QBYB 1NJGA 4TLDA 4O2LA 4Q02A 1LW7A 4UQOA 4XTRA 3R9WA 2PX3A 3CH4B 2ZRJA 3AGQA 4QM6A 3QVVA 2FFHA 1DG1G 4AKEA 2FE4A 2QPOA 4ZI2A 1TUIA 4Q66C 4GZMA 4DEXA 2Z0MA 2VP6A 3B13B 3VKHA 2NPIA 3QF4A 3NHAA 1CJUC 1U81A 4JYBA 3H86A 4MRNA 4E22A 1E79D 3IEVA 1H8ED 1M34E 3L43A 3TW8B 3U7HB 1I4DD 4C0LA 3SFZA 1XEWY 2KBEA 1SQ5A 3SBEA 4BLOA 5SZIA 4NONA 3GJ4A 3TUIC 4M9XA 4KFTA 4IDOA 4B48A 3THWB 4AKGA 4NBSA 2RHDA 3C41J 1G5PA 1UADA 2QSYA 2VF8A 4UKDA 5FTLA 4M1KA 3PJRA 4D4JA 3O8DA 4TMZA 1GL6A 4IFBA 2XITA 2OZEA 1UKYA 4JLDA 2F55A 1A7JA 3BH6A 3QIAA 4BE7B 2PT7A 2A7QA 4TYWA 2XTMA 5JJIA 3NC1C 5BW8A 1GKUB 2HT6A 1SVOA 2EYUA 3ZVRA 4DSNA 4LRWA 2J41A 5JZVA 1T9HA 1MO6A 4PPQA 3RRYA 2ZRMA 4M53A 2YOHA 4EJSC 1OIVA 1C9KA 1DE0A 4O0MA 1BMFA 3MJRA 1VECA 3TQCA 2CE7A 2QI9C 4MDFA 3KQNA 1DBSA 1XTIA 2JGNA 3RS4A 3SJCA 4XVUA 1AKYA 2ODBA 1D8TA 1XDBA 2C9CA 4KI0A 3AUXA 2AHOA 2XTZA 4GP6A 2XJ9A 2RGXA 4KV9A 1O87A 1LVGA 3PFIA 1XNJA 1W0KD 1Q0UA 4EJSB 4RD4A 1P9RA 3Q5EA 4TQ9A 2O8DA 2OCYC 1M2OB 4NCNA 2XXAA 5DO9A 4B33A 2BBTA 1VG0B 2NO0A 1KI2A 3IHWA 3H4MA 4DT1A 2IXFA 3I8XA 2G6BA 5KPDA 3QKUA 2V54A 1SXJB 4QNRA 1T3LA 4BLSA 4B3CA 5DISB 1D2MA 2W6IA 2WZQA 2GNOA 1ZM3A 4LHWA 4DC9A 4D25A 3FKQA 5EZ6B 2BEJA 5EJEA 2WJYA 1ZIPA 3BB1A 3CX7A 3QSYA 4TYPA 4HATA 2ZYWX 3QBTA 4IDHA 4UNSA 1XXHE 1N5KA 2NZ8A 3IBYA 4D26A 2HXSA 4IVPA 3SEAA 1ZU5A 4ZDJA 5G41A 3OIWA 2IUUA 3GLIE 4NE2A 1HA3A 3WXMA 4ARZA 2D2EA 1RC8A 5JLJA 3VR4A 2J59A 2XNDD 2GXSA 3B85A 4JL5A 1K5GA 1LFDB 1R5NA 1FP6A 3AH8A 3GEIA 2ZSDA 4OHXA 1N2CE 1E9BA 4OQFA 3KKOA 2RGGA 5EP4A 5CK4A 1E9RA 3CNNA 5AJVB 3ZZ0A 3W3AA 2ZI3A 5GVRA 2VRWA 2MSCB 3VR5A 3SDZA 2OAQ1 1M1YE 3JVUA 3SS8A 1RRCA 1J2JA 1G16A 4OQMA 1YZQA 3HYTA 3V4RA 4RCZA 5GJBA 3OAAA 821PA 1LY1A 1WRBA 4MQBA 1EFRA 1EX6A 2NZJA 3FHTA 1Q21A 1WBBA 5FI0B 4XJXA 4EPXA 1N25A 3LFUA 4WVFA 1W36B 1NSFA 5JJKA 3EZ2A 4C0JA 2WHXA 4XWAA 2ZSAA 3Q9LA 2J7KA 3W5IA 5KOYA 1QG2A 1VPLA 3GFOA 3ECCA 2XB2A 1FFHA 4POAA 4Q01A 2OE2A 1MABB 1CR4A 3CW2A 2MSDB 3RS2A 1T3SA 3ZVMA 1QHYA 2C95A 5AK0A 1M6NA 3CM0A 4Q4AA 2V4ZA 1EX7A 1FOEB 1E4YA 4NU0A 4HI0E 1QHSA 2XEXA 3SQWA 3AVWA 1JI0A 2B7BA 2QY9A 3IHLA 4ON9A 3E1SA 3SNHA 1KSGA 3WNDA 1N6OA 2E9SA 4BQSA 4HB4A 1CR2A 1G8GA 1SXJC 1JJVA 1T4GA 421PA 4LHVA 3SN6A 4DZZA 3U7GA 2NO9A 5EE9A 2CLSA 2X77A 5FI1B 4R7ZA 5FBLB 3NKVA 1XXHB 3ZZTA 3DZDA 2FZLA 1NG1A 3THXA 3MJHA 3THXB 4I99A 4F4IA 4P4SA 3AKCA 4AY2A 1E94E 2ZR0A 3P1JA 3Q8XB 4QGFA 5CYOA 1YJ5A 2G1KA 5A4JA 1Q12A 1TQ2A 2J87A 4BFWA 1IXZA 1G1MA 4NYIQ 4TMKA 4I1OA 1AM4D 4LSGA 2RCNA 4URXR 2ZJ5A 1TQ6A 2YWHA 2QTHA 4URUR 3DHWC 4M21A 4U02A 4A2PA 2D4HA 5GJVC 1UBFA 4U7DA 2QGZA 2ZJBA 2OBNA 2VPPA 3KUDA 2WJGA 2AWNA 2VSFA 1RJ9A 3CX8A 4Q4JB 8OHMA 1Z0KA 3W9YA 1KO8A 2OG2A 4HAZA 2VF7A 1E2DA 2CCGA 4PQRA 2B92A 1CIPA 5F2EA 3WRXC 1L4UA 1G3IA 1R2QA 1VHTA 4KU4A 721PA 3HR7A 4IHQA 2NOAA 1PUIA 3LQRA 2FF7A 4C0SA 5KSYA 5L8VA 3NBFA 4B32A 5JCZA 2W6ID 2GF0A 1QRAA 4HAVA 4M22A 4V0NA 3GLHE 5CLQA 3Q5DA 4A15A 3RS7A 3BS4A 4ABYA 5TVKA 1US8B 2OEPA 2G83A 2ASEA 4JZKA 4JLJA 5DI3B 3OEHA 2AXNA 1NJFA 4S35A 3BB3A 2WJVA 1KTVA 1HV8A 1LTQA 4HZUB 3EPKA 1FUUA 3I72A 3KTAA 3CX6A 4QHTA 1AS2A 2F7SA 2L0XA 1G8FA 3MG9A 4MUAA 2J0SA 4D6PA 3NDBB 1E79A 2C99A 3QPVA 1AGPA 1JAIA 4L8GA 4PHGA 4MRVA 2BMDA 2ZRCA 3KFVA 1J90A 1Q1QA 2EFDB 3ZVLA 3RAPR 1W0JD 2O0KA 1R6BX 2Q3MA 1ZINA 4FW9A 3CF0A 3MWLA 2O0JA 5JWRA 2WOOA 2VQSA 4BFSA 1DELA 2ZUBA 2OFXA 1CXZA 2GILA 1YZLA 4PO8A 3TJZA 3B8HA 4A8JA 4ASUA 1KSHA 5TXGA 3LLUA 1SVLA 4BZQA 3B6EA 3KB2A 4C0BA 4P32A 3ZVNA 3EG5A 1RE0A 1OH6A 4ZV4A 3MUFA 4CEIA 5AUPB 3GP8A 4TZ6A 3R8CA 3LNCA 1RVDA 1JJ7A 3AVOA 1KJWA 2R65A 1IN8A 1KAGA 4OQLA 2ZRFA 1G7SA 1YRBA 2GWHA 2N1BA 2REXB 2WM9B 1DOAA 1ESMA 3R20A 2PEYA 1D9ZA 4Q1AA 4DCTA 4EPTA 1B23P 4GPTA 1IN6A 1KK0A 2IC5A 4KVGA 1MT0A 2ZRAA 3CF2A 2B8WA 1CS4C 4FMBB 4JIMA 4HDOB 3T61A 2GKSA 4G5OA 4OYHA 1ZAKA 3AGPA 3AF4A 3AVQA 1S0UA 3MFYA 2YNMA 5DE3A 1ONBA 4BFYA 1NKTA 3KB1A 5FTJA 1OXSC 4PHFA 2GZAA 2RMKA 1TX4B 1TADA 1BS1A 4DDWA 3K0AA 2DFLA 5F9FA 4QM7A 1X8LA 4KJZA 4CGZA 3A4NA 3U2QA 3UXMA 4AKHA 4TMTA 1XTRA 2QAGA 1IN5A 3ZJYA 1AZSC 3KDSE 4WZ6A 4HEJA 1UPTA 4AI6A 2Q21A 4OHWA 1Q3HA 3SJZA 4LJYA 5E7MA 4ASUD 1UBGA 1XBTA 2XSZD 4C9BA 5FTKA 1E2LA 1KDRA 1MRNA 3DM5A 2A5GA 1P3JA 3W6OA 5E7JA 4PAOA 3I3SR 1YR8A 3D31A 5LB2A 4PPNA 1QVRA 3JZMA 2BJVA 2NG1A 4US0R 5EE0A 2NPFA 3TBKA 1UKEA 2VSXA 4BLPA 4EDHA 4Q9JA 3I32A 4Q18A 2ZE8A 4UNNA 1OW3B 2X1VA 2GEUA 4URWR 1U98A 3KJEA 4YONB 3CO5A 2R8RA 3AVTA 1ZNYA 1R4AA 4TLCA 3T5GA 5KNCA 1QVAA 2HF9A 1IN4A 3TSZA 1GZSA 2JJ2A 2JJ2D 3PEWA 3ZH9B 3ZS8A 2CCKA 1F5NA 4GL2A 1B0UA 3B1XA 3R7WA 3P32A 4ZDIA 5KSZA 2GF9A 2OHFA 3B60A 1IY1A 3QG1A 2J1LA 1VYTA 1WF3A 2VHCA 1K6MA 2QM8A 1RRPA 2IT1A 1FX0A 4Q19A 3I61A 3PITA 4BEJA 2J5XA 5FPHA 1CULC 1Z08A 3G5UA 2AWOA 4D4LA 1TL7C 3CUEF 3PXGA 3QG5A 2ZSEA 3BE4A 3SYKA 4I81A 1KDOA 2AK2A 2CNWD 3CNLA 2XAUA 2WJHA 2WWHA 1DAHA 3JZAA 3BFKA 1EXMA 1Z0IA 3CH5A 2GEVA 1TF5A 1M7BA 2P65A 4BRWA 2W0SA 2QM7A 1TF2A 3ZZUA 2VTKA 2IUSA 4PAMA 4DLZA 2W2VA 3U6BA 3ADBA 3DZ8A 4MA4A 2GZHA 4QBFA 3TKLA 1WE2A 5JS8A 1OFUX 3BXZA 4HLQB 1E2GA 4Q03A 5DI9A 3NH6A 4QBGB 3QI2A 1W5TA 1DADA 1RRGA 1KO4A 3DOFA 4FD2A 2KJQA 2GBLC 4MKIA 4NPHA 1JXMA 3IIKA 4FMDF 1R0XA 4KBFA 3QKTA 4R9UC 4KAXA 4RVCA 1W36C 1LB1B 5DSZA 3LQQA 1MRSA 4W9MC 5IK2A 2IL1A 2BIFA 3EWAA 4NYMQ 4CIDA 1XJCA 4B3DA 1KHTA 4B3GA 3RS3A 1MABA 4KLNA 3EW9A 2FN4A 2PLRA 4IDPA 5AUNB 4LV5B 2C2HA 1SKYB 1SVSA 4OK5A 5KUTA 1VYVA 3QEJA 4IKEA 4LZZA 2RGNC 1PLKA 2XX3A 2H17A 1RYHA 3GPLA 3THWA 1RW4A 1N6KA 2NIPA 4EFMA 2QP9X 3MWKA 3NEJA 3Q85A 1XTQA 5FUVA 5H68A 1Z63A 4G5QA 1NY6A 1RIFA 4DIDA 2REOA 5TV2A 1RFLA 3VHXA 3GQBA 3AVXA 2FJUA 4EQ6B 2Q9CA 1MH1A 1GFIA 3B9PA 4NYJR 3PEUA 3UATA 3DPUA 1T3HA 4ARZB 3LLMA 3K0CC 4OKSA 1Z29A 5AJXA 5BXQC 2AD1A 4E07A 1NLFA 1IN7A 1XCMA 5JBQA 4LC0A 2IYTA 3CWQA 1TU3A 2ZU0C 2ANBA 2DWPA 4G1UC 2O8FA 1OKKD 2FA9A 4PSAA 4MYTA 1KSJA 2JA1A 2ZRGA 3FMPB 1UEJA 1U94A 4K46A 1ZM7A 1G9XA 4TTPA 4P3YA 4M1TA 2ONJA 4TMWA 1SVWA 1OFIA 1NF3A 1E2KA 3NBYC 2FEMA 4HAXA 2CE2X 3WYFA 3K8YA 1XMIA 5HKKD 2G9NA 2WMNB 2BDTA 4W5WA 4BFXA 5JS7A 1KNQA 2I1QA 4KXFB 4PC6A 3LO5A 1KI8A 4W5JA 2QA5A 4R98A 4PFSA 3GCGA 4ZDWA 3GLHB 4II7A 4IOKA 4EPWA 1A2KC 2G0TA 1P72A 2W58A 3F8TA 3IEUA 4Q7KA 3Q3JB 4JLBA 4B2IA 1ZNWA 3KX2A 2O0HA 5FOUA 2IK8A 4NTZA 2J7PA 4G5RA 4ZKEA 3FOZA 4DUGA 2G0NA 4TLBA 4UNQA 5F9HA 3AKEA 2FPMA 3FHOA 1FZQA 2V7QD 4TN1A 4TZ0A 3ZGXA 4F93B 4UXIA 5J4KA 4QBIA 3EZ7A 4BASA 2ZYVX 3CPJB 2WWYA 1GNQA 1SVIA 3FMIA 4V0LA 5FUWA 3O8CA 1E9DA 3CZQA 5SZHB 3OIYA 3GJ5A 4LBZA 4NMMA 5A0FA 3TQFA 3B78A 2IYLD 1IXSB 1P2UA 1KNXA 1NLYA 1KO5A 2I3BA 1K8RA 2PL3A 1JPNA 1N5IA 1HQCA 3RRMA 3L0PA 2IYRA 1OXTA 1WQ1R 3QXHA 3VU9B 2WPDD 4YDSA 2ORIA 4P4TA 1IY2A 1XMSA 2G77B 3SYLA 2CXXA 4A8JB 1OSNA 3ZQ6A 2O52A 1ZJ6A 2HF8A 1YR9A 3KKQA 4IDNA 4KBGA 4LJ8A 5K8IA 1D2NA 4LYFA 2FV8A 5DNYB 1F3OA 2FSIA 3KKPA 4MKHA 4LPSA 1PJRA 1L4YA 4IEIA 2WWIA 3ADCA 1WBDA 4JKIA 2WJJA 2ZS9A 2AL7A 2ZRHA 1L2TA 4C0KA 5C4MA 3U4QB 5TY0A 1U0HC 2EW1A 2GJSA 3IQXA 3AB3A 2IYXA 2ZRDA 4D0NA 3GLFA 4MH0R 3B1WA 1CR0A 2X19A 3TGPA 1UM8A 1ZD8A 3QVUA 2ZI7A 3U44B 2BM0A 4RZ2A 1GILA 3PUWA 1A4RA 1OJLA 2O8CA 3OESA 1E1QA 2Q9BA 2R6CA 1LF5A 3K0EA 4D2IA 2KI5A 3ADDA 3I62A 1ZCBA 2YOGA 2QP3A 3CRMA 5J47A 1KO7A 3QOFA 1XEFA 3PENA 3C15C 5DI3A 2OFOA 2VO1A 4RFSA 5D3MA 1G5RA 1OIWA 5BN5A 5JSZB 2QMHA 4Q4HA 2BOVA 4IOMA 1U8ZA 1ESNA 4KSBA 5UKDA 2ONKA 4LCBA 3X1WA 3SU8A 3SHWA 4ZIRB 2MSEB 4Q1BA 2Z5FA 1HTWA 1C4OA 4I1UA 4M8NE 5JFGA 3LAWA 1AGRA 3ZIAA 1ZUIA 1A2BA 1D9XA 1TTTA 2F9LA 4F92B 5GJWC 1JXOA 3VKGA 2ZJ8A 2IYUA 1P2SA 4Q1EA 3EIHA 3L8YA 3WP0A 2XNSA 4C7OA 4GMDA 2GJ9A 5JCPA 3VAAA 5DYGA 4QHSA 1U90A 4ZIRA 4ZI3A 2C8VA 4LY6A 2VIIA 1GNPA 5FL7D 3TR0A 1XCGB 4BFVA 1QHHB 4U5XA 4CEHB 2A5DA 3PIRA 3BH7A 4FCWA 1W4AA 3DKPA 3L2OB 5C4GB 3EX7C 1G6HA 3P27A 4XH9B 621PA 4LJ4A 5DH9A 1Z6YA 1CF4A 4Q7JB 2CL7X 3TW4A 4Z54A 5JI2E 4B6EA 3QXXA 2YVUA 4B34A 3E5HA 1XD9A 2WIAA 2BMFA 1IM2A 2XOKA 4C3ZA 3TH5A 1Z06A 2ZE5A 2OFWA 1F2UA 1SHZA 3CF6R 1T5LA 1KZ7B 3T1OA 2HYDA 1KJZA 2IWHA 4UNRA 2P67A 2EWVA 2W6JD 2A5YB 2IXGA 4Q4AB 1EFUA 4JBYA 4JVLA 3OZXA 4LHXA 3C16C 1ZD9A 4U00A 2HUPA 5CYPA 2HT1A 1VCIA 2GVZC 4QJ4A 3S1AB 3VHLB 1VIAA 1DAGA 3VR2A 1OB2A 2FG5A 3BOSA 3ICQB 5DN6D 1E1RA 1TU4A 3R9IA 1JBKA 1GG2A 1T8TA 1S3SA 1LS1A 1XTSA 1Z6XA 4RZ3A 1FL9A 1R7RA 2JLRA 4X8HA 1C1YA 3X2SA 1SKQA 2HJVA 4JYCA 3M0EA 4BPBA 1BOFA 1DO0A 2IYSA 1GWNA 2CLDX 4KHZA 2CK3A 2V3CC 2QSZA 3TAHA 4BZXA 3PUXA 3AF0A 5B30A 1GUAA 2BBSA 3QEOA 5EP1A 1XX6A 3SFVA 5CM9C 1HYQA 4W7SA 3VMFA 4LJAA 3KFXA 5FOWA 2QRNA 2FFQA 3ZDQA 3U6KA 1XU4A 2VBCA 4IW3B 4E03A 4HLCA 2H57A 4TTQA 2E1RA 1G19A 5E7IA 3VTKA 4MGZR 1E2JA 1EFCA 1OXUA 5FL3A 1SXJD 1HY3A 5HE8A 4KFRA 3UWOA 2RH5A 2UVQA 4A36A 4BZPA 1W1WA 5EZ5A 1QF9A 4PC2A 4V03A 4Q4LA 4D4KA 3DMDA 1EG7A 1OLOA 3TIFA 5K8UA 4PZLA 1XJ0A 4GT1A 4J0QA 2D7CA 2C5LA 4WOPA 2A30A 2QE7D 4QJ5A 4DSTA 2REBA 3K70C 5FBQB 2BCJQ 3KQLA 3G82C 4A1FA 3U7FB 2ZITA 3KJIA 3MLEA 1NKSA 1KK2A 2QEQA 3LW8A 2FGJA 4PQYA 5SZJA 1T6NA 2AR7A 2D74A 3WHLA 5KSOA 5B64A 2UZ3A 2HEIA 4JLMA 1HUQA 3A1TA 1N6PA 4CF7A 1SXJA 3BGWA 4B76A 4OI4A 3PUZA 4TQUS 1W0KA 2ZRBA 3CONA 2JLUA 2ZRIA 1L8QA 3UG7A 4LJ5A 2YZ2A 4HB3A 1AQUA 3LVRE 4GI7A 1JAHA 1T0JB 3AP1A 4WZBE 4AIIA 1KO1A
chains in the Genus database with same CATH superfamily
3K05A 2YHAA 4HXEB 4YP6A 1N1DA 3EVBA 3NGLA 1DQPA 3PIIA 1KMQA 5JAIA 1XQ1A 4JBLA 2CNWA 1SOAA 1F17A 1GPDG 2HJHA 3P4UA 4MLCA 3P2OA 4XDHA 2V6MA 1R6AA 2Z4SA 3IXQA 1VHQA 3IR7A 4GBJA 4GRAA 3P9YA 3KKLA 4BQOA 2M9MA 4DIEA 3CX3A 3CG0A 2FFAA 4EGAA 1JJBA 3VHXB 1QCDA 2PRIA 2YHUA 5BNIA 5JD5A 1VGVA 3MLBA 1J1IA 1Q11A 1JB9A 2OV1A 3D7NA 3ENQA 3I6YA 3KEGA 3LY7A 1JWLA 1YA6A 4G1VA 1VSQA 2NACA 3HJHA 4NDNE 3OC0A 3DWGA 1N2BA 2I4MA 1Z74A 3MINA 1U3UA 2K2WA 1NI3A 2ZR7A 1KI3A 2MSWA 4M1ZA 2AI1A 3DTVB 4UU7A 3X1JA 3PI6A 2D62A 2XMZA 4MAFA 1J8VA 3KVYA 3VAYA 4H6PA 4CM7A 2WDZA 1MO2A 4MS4A 1KORA 3QWFA 3ULKA 4X64B 4LDJA 3CYFA 1YFKA 3CF4A 5GINE 4XOUA 2VTVA 1AF4A 3FUXA 5GMOA 1RZRD 2ZSHA 4E6PA 5L6MB 3K09C 4DJTA 1CEQA 2P2GA 3IERA 1XEWX 1F06A 3AIIA 4S2EA 2JGMA 1LVUA 4E5PA 1RKUA 4HEA1 4TSRA 5C37A 3L8MA 2WKRA 3QVGB 5KB3A 1QCYA 5E9JA 1X7ZA 2HLDD 4TMVA 2DM6A 1OXKB 1QB8A 1L8AA 1PQYA 3D4BA 4BKPA 4H0NA 2P78A 2E4UA 3K0KA 1XIVA 2CUNA 5DHFA 3QLJA 3VDNB 2JLQA 2Q6IA 3M89A 3OAAD 1Z2OX 3Q9UA 1ZIYA 4CN9A 3AETA 3B5EA 4OVKA 4AG5A 1BC5A 2B21A 3PEYA 5KAPA 2QVGA 5IDVA 1CRZA 4WNCA 5DLQC 1DQNA 1SBIA 5CVEA 4QICA 2FPGB 3IDZA 2WSLA 1XMJA 4NS4A 3TPZA 3IR5A 3ZYCA 3IA7A 1NBME 2FPKA 4Z4GA 2IHVA 3AXTA 1M6VB 3BWDD 1V7CA 1YB6A 1GKIA 1PGQA 2HBQA 3ESRA 3H4TA 4GP7A 1V8PA 1P31A 2PLAA 1Y7IA 1O5OA 1PR4A 1TQDA 1YI8A 1YQDA 2ESRA 3BEDA 1YZFA 2JEZA 1QE5A 2C5HA 4L8WB 3PTZA 1IY0A 2HIMA 1J07A 4G9GA 4AMGA 1O94D 6AT1A 4AB1A 1A8HA 3E9EA 3OPQA 4N0EA 3AR9A 1X1EA 3GY0A 4XQ0A 3WO0A 2BM8A 3HGMA 1LKZA 3EULA 3SC3A 4CHTA 3FWHA 5C7OO 5K3OA 1NI5A 2NW6A 5ICGA 1CLEA 3MD0A 2JIZD 3TPCA 5FPYA 2H2HA 2P6PA 5CAEB 1H6DA 5GPBA 1JYSA 1MTOA 2OXRA 2EKZA 1P6XA 1JMKC 1U7DA 1E1CB 1GCGA 3NB0A 4YRDA 2ZWAA 1W19A 1ZEMA 3DQQA 3MRVA 1NT2A 3O9VA 2IW3A 3CZRA 2QLMA 4GI3A 4O4LA 5AM5A 1ONOA 1RXCA 2QN3A 3TI9A 4BQPA 2VTBB 4JN6B 3EGXB 4EQZA 2N75A 3TNYA 3EFBA 4JASB 2PUVA 5FL7A 5EHZA 4LOAA 3HQ4O 5AK5A 3DEHA 2XXBA 4L4UA 5LM3A 5REQA 2PKCA 4NFYA 2A5JA 4P4LA 1RPZA 4KR2A 1PL7A 2OCPA 3GLGB 2NV2B 2XHEA 1H85A 4O6VA 4V2UA 1M8GA 5E1OA 3GRZA 5SY4A 3TUJC 3U44A 1HNXB 2X9GA 2W8BA 5JAQA 4WBNB 1CP3A 1JKXA 4NX2A 1VLQA 2AKYA 3HZZA 5CXSA 4GYJA 4XD7D 2FLKA 2FDCA 1RP7A 4JHXA 1PG0A 5DT9A 3ZS9A 4AZ3A 3T8YA 3FYDA 4QJBA 4RPKA 1E98A 3L82B 4FS3A 1I5OA 1G59A 4GVLA 3T1HB 2BFFA 3GJ8A 1Y3CE 1AXEA 2WFLB 4RESA 5AUQA 5C7IO 3ZV7A 4EHIA 4G8CA 1MG0A 2B34A 4XE5A 3GZTB 1GYRA 3EMBA 3HVJA 4GR5A 4DPKA 4Y6LA 5GIPE 2YH2A 2YYYA 3GUZA 5LZ2A 3UAZA 5KWVA 4O3MA 5KREA 1ABFA 2YRFA 4NFSA 1G6OA 3EXHA 2E5WA 1R9JA 2PQMA 3GJQA 4GU5A 3AO0B 3CCCA 4R68A 2AN3A 4CLRB 3E7PA 4RTQA 1Z88A 4F3KA 4ND5A 2DBZA 4EP1A 5F23A 4IOLA 3WK6A 1Z75A 3C14C 1Y3AA 4KBYA 1Z4KA 2PMEA 3S27A 4N5LA 4TWBA 4TUYB 4FFBA 2P90A 4N48A 3T7RA 3N7UA 2ZM5A 4U7FA 1E5DA 2X8AA 3QPBA 5C1DA 1OX4B 1ADYA 2XCIA 2PJUA 3QGMA 4XTCS 3DHEA 3ANYB 2Q07A 1T9ZA 4RQUA 2FHSA 4MUHA 4ZHQF 5LUAA 3RT9A 2J9FB 3JRXA 4H1VA 4WK6A 2CLEB 4UZFA 1NXWA 1O97D 1KJNA 1TLFA 1GRVA 1QFYA 3D6UA 4HBZA 2QMEA 4X84A 3T9EA 3RC1A 3DO6A 5IJZA 2QXUA 3PT5A 4GX5A 2REQA 1LV8A 4N49A 3ZK9A 4XEHA 4KQHA 4F7WA 4X97A 4BNTA 4KUGA 4PIPA 4BO0A 4F5WA 5JW6A 4JUAA 3IEPA 2VL7A 2VP5A 3L9WA 3O26A 4DCSA 2G1JA 1NSYA 2W8ZA 4FI3C 2QG6A 1YCDA 4AG3A 4MDHA 4BS9A 4OUKX 3H1TA 3CUVA 2WF5A 3LPDA 1T25A 1ADFA 1K3UB 1M8FA 2EKPA 1Z07A 1PFVA 2C2BA 3DD5A 3JQDA 1LBHA 1FU4A 3LT0A 4TV9B 4LYJA 4BTEA 3Q7TA 1E6UA 3ZCSA 2EEPA 3I6QA 4Z1MD 5IKPA 4D81A 4RF4A 4WFJA 5C8ZA 4KYIB 1GQQA 3CLSD 1E77A 2XUAA 2VNHA 3E0QA 4FHCA 1FZTA 3NEYA 3MYYA 5IBQA 1Q0QA 1AMOA 5K45A 4RVDA 5I4IA 4PZZA 3FWZA 1HG1A 2ZSJA 3FR7A 1CJKC 3OU2A 4II3A 3PD7A 2OLJA 4BIIA 4JA0A 3V55A 1CYEA 2LXNA 1L3IA 4IR7A 3PQ4A 4RDIA 1M0EA 4G24A 4LXYA 1XCBA 2FK8A 1E8MA 1IQRA 1YL6A 2A1UA 2OSVA 1N36B 4G4IA 3UHPA 4A82A 4B9EA 5JH7F 4FE7A 4LF7B 4K86A 1XP5A 2WOJA 4N65A 4NYIR 4IF4A 3N39C 1K08A 1A5ZA 1QYCA 1P29A 2IYOA 3ND8A 1ZBDA 2JKYA 3L6EA 4KPEC 3O3OB 4RZSA 2F8MA 1P33A 3IBTA 4AZ0A 1R10A 1ZONA 2ST1A 5FNVA 1BXGB 1CQJA 1EFVA 1XZQA 2BEKA 1DC5A 2WYHA 5A4KA 3PHGA 4UAJA 5ADHA 1UZAA 4YNBA 5JNWA 2C9OA 1JIJA 2V7VA 1DJLA 1E9CA 1PLJA 1XAJA 4R2HA 2CXHA 2H11A 5IJAA 1JLKA 3H0KA 4HH3C 3PUHA 1DLJA 1HEIA 4HVAA 2OO3A 3GWGA 4Y2TA 3WB9A 2WZBA 3DBHB 2CYCA 2JIMA 4LC9A 4AWAA 2QTNA 4HNQA 3HWSA 2AMFA 1O6CA 4GPZA 1EXVA 5BXYA 4OLJA 4C6TA 2CXUA 2UYYA 3Q72A 1L5GB 1I1QB 1NP6A 1MV8A 2Z9BA 3R0IA 4GXRA 4EYGA 4F8JA 1E2HA 4G09A 1TKBA 4IRXA 1IU9A 2H3HA 4I8DA 4KH0A 5JMWA 1XTTA 2RAPA 3BRWD 4GWKA 3LE8A 3R09A 4MW5A 4AJKA 4EPYA 9ATCA 2O6HA 2PZGA 3UMSA 4Y2RA 3ZBQA 5HKAA 4JVMA 4DV6B 2JI6A 3A1CA 3RLIA 2EQAA 5SYNA 2HQBA 1RD4A 4HDKB 4TTJA 4D0RA 2ACWA 3ZDEA 5CYFA 2IIPA 4FEYA 1YE8A 3EFOA 1B2LA 4CKZA 4E09A 2PTGA 3ND7A 1CNFA 2QJTA 1ZK4A 3V8PA 4DR7B 1BE0A 3UWDA 1QCCA 1E7MA 2XJ4A 3PNYA 4OMUA 3HDVA 5JLAA 2O7NA 1NUSA 5HRUA 1XDGA 4U2EA 1KIAA 5BY2A 2A9VA 2JVIA 2J3HA 2NSDA 4INAA 4Z9AA 5FR2A 1O57A 3EUAA 3U3DA 5K4HA 1J70A 1P7VA 3DLBA 4G0ZA 1FTSA 3BMOB 5DTJA 3HKBB 3IVGA 4WKOA 4ML3A 4C20A 1EWYA 1RWWA 3NJ4A 5FBKA 2PIDA 3AVWA 3C5CA 7MDHA 2DFTA 1AO3A 1AXRA 1G3UA 2C2MA 1M1NA 4CQLA 1YR1A 1OF1A 3C6XA 4B47A 3IUSA 3OZ7A 2VYVD 4IXTA 1PFUA 4WLNA 5L3SA 2JLYA 3IXMA 4IPTA 4W5HA 5CDFE 1U8TA 1N5JA 1FVXA 4EG8A 2OO7A 5TE9A 3OPXA 4EY6A 2BFCA 3E8XA 3G9UA 1DKRA 4L5IA 4CL2A 4EUHA 1EKXA 5B1SA 3LW7A 3WKDA 4F38A 2VZEA 4YMVA 4C7MA 4LI3X 4GEGA 4H3HB 3OFNA 4MS4B 1YRAA 5BO5A 2GNPA 1XU7A 3HXMA 3GLGE 4FYWA 1XCPA 2JGLA 5BMOA 3JQAA 1CUBA 2NU7A 4Q9HA 1Q57A 4DY4A 1QH8B 1D6JA 2WSMA 5KQSA 3OLVA 4RE6A 4YQFA 5JDCC 4BNZA 4MWOA 4OGWA 2QV7A 4R31A 1U1FA 3TR6A 2A9RA 1ZD2P 3V7FA 5BYKA 5CA1F 5JH7A 2V7QA 1EMDA 1ECBA 3TNJA 2MSNA 4QFBA 4H0CA 1Y7HA 2YRWA 4V02A 2WT4A 1BTOA 2XTNA 3U40A 3UCXA 3VZBA 1U0NA 4P8RA 3N8GA 2GPAA 3NHJA 4O29A 1P5ZB 2CL6X 5KJEA 2FJ0A 2DZDA 3M6FA 2H1LA 2OO5C 2IEGA 3PFCA 2HW8A 1FDIA 4Y9UA 2ZBEA 3BCHA 1RRMA 3ZZ1A 2D3WA 5GJCA 3H16A 1Z4PX 4P0TA 5KDOA 4Q9IA 5K0FA 5IH7A 2FPLA 1IB6A 1YULA 3FJOA 4XPIB 2PKWA 3UMRA 3WA7A 3WQQA 2J9GA 2JIOA 4MSUA 3KL2A 2EV9A 1ZGGA 4QHYA 3PCTA 4B09A 4B80A 1RXIA 3DBIA 2DPHA 3HXPA 4C88A 2O1XA 2KLBA 2GEFA 5E6SA 3TLBA 2GYVA 5HGJA 3ER9A 1L5ZA 3FUUA 3L49A 3VOSA 4PZUA 3G2NA 4UUOA 4P98A 4ZT3A 2BFFB 4RHEA 4AY5A 1OV4A 3O47A 2CF5A 3BQMB 1ONPA 1RRVA 1E3JA 3HLTA 3WO1A 3B7GA 3HNPA 4FGZA 4GPAA 4OATA 1PYGA 3N86A 5E4FA 1TE2A 1JG7A 1SHKA 1TA4A 2JG3A 1VHDA 1N32B 1T0HB 1R5BA 4ITUA 4UD6A 1P8AA 3SJAA 1Z6GA 3RANA 4XJTA 1QP7A 2E4YA 1X74A 4GOXA 1QOZA 4E3WA 2WWGA 4FN5A 5EC8A 4CT5A 5FO0A 2WUWE 1G5QA 1KZGB 1TCUA 3QMMA 4JJEA 5C8YA 4TVBA 1DARA 4QDJA 3SJ7A 1ZK1A 3D6JA 1A97A 3VVLA 3IP6A 3CCFA 3KJHA 5CNJA 3SKXA 1OX4A 4MW6A 3STYA 1GNRA 3DEFA 4RJJA 4EB6A 1BH2A 1GCUA 2OCGA 3PXEA 1PLLA 2OHGA 2XA9A 5TQ2B 4EA6A 1SC9A 4UOQA 5F1YA 2W8BB 4P36A 4OI1A 3ZYZA 3B52X 1OOEA 5I7AA 2Q3JA 2QTFA 2EJTA 4RCYA 2QLFA 1XQXA 1UMDA 5AT1A 3BWXA 3KP1A 3Q3IA 5FO1A 5CA1A 1RWMA 3G0GA 1GVNB 1GZUA 4A0QA 1CU1A 4K6HA 5CHEA 3NDPA 1JE0A 5JAZA 1JPJA 3H5AA 1GR1A 3K96A 2C77A 3ZE2B 3NUZA 2GN2A 3BJIC 1ESEA 2YVKA 3FI0A 5BNFA 5CA0B 3B12A 2FKAA 4R71A 4PY2A 4ARUA 1XRRA 1J8FA 4L6IA 1PEKE 1TGYA 1C9EA 2ZQ5A 1QF6A 4PZYA 1N33B 2QL6A 2QV0A 4F4JA 3Q9SA 1XCJA 3GJ7A 4O08A 4WZAA 4R0VA 4S24A 2WWVD 1BW9B 3UAVA 3A1SA 1N7IA 4BX0A 4JX9A 4QG3A 4X65B 5ELXA 3DPSA 2VDJA 2WAXA 3AUUA 4DWJA 4UVDA 3TCNA 2Z2XA 3HBMA 3NC0C 4WINA 3HWRA 3R7FA 2SBTA 3OX3A 1ISMA 1HK7A 2XA1A 3PE3A 3QW4B 2AJLI 4MINA 3B89A 2JLZA 4NESA 8ATCA 3L0OA 3NBKA 5LDGA 5D3KA 4AIIA 1Q22A 3V32A 1MJFA 1MC4A 2H0RA 1HFEL 2I0FA 1Y1RA 3WMWA 3HDHA 2ECKA 2IXTA 4FFPA 3AERA 1H3NA 3EZ9A 4I55F 3TLKA 1EFTA 3UPUA 3QWHA 2O8DB 5AP9A 4DPLA 4RDXA 1YBAA 5FPKA 4FTWA 1ZNXA 2Q41A 2YIVX 4HUQB 4O4LB 5IARA 2P41A 3ZTYA 2HBZA 2QTVB 1J2EA 1WVMA 3EGIA 4KFUA 4KUHA 1XMPA 3ZWCA 3KDPA 2QTTA 5H80A 6PFKA 1B1AA 3KXIA 2W70A 3ZU3A 4C6RA 3IQWA 2ZI5A 3SF8B 5CD1A 4ARBA 3JZDA 1T0BA 2I62A 2DMRA 4HDRA 5ARCA 3SQXA 1P74A 2VT3A 5BN3A 3CWCA 4E7OA 4RETA 3ZHCA 4L8LA 1KEZA 1HURA 3DVAA 1RU3A 3HU2A 2HIAA 2IXEA 2FJPA 4UVIA 1H2XA 2BGRA 3OU7A 1DB3A 4ES6A 4BV2A 3AY7A 1VG1A 1QONA 1T5SA 1XRMA 4NEGA 2CHGA 1TQ4A 2BMJA 3AM3A 3PDJA 5HIJA 1J7JA 5K0BA 4IVRA 1ZH4A 2IEZA 2P3OA 3CMCO 4YJ3A 3TD9A 3GZNB 4EHFA 2AN5A 5HM6A 5AOAA 3KZVA 2G9QA 1QKKA 1R8JA 3ITDA 4EUEA 1ZVJA 3O75A 3GBPA 4H7JA 1A9OA 4ZXPA 3SDSA 3PNSA 2SNIE 3DMTC 3HGQA 5CXXA 5K3FB 1H2ZA 4UJ5A 5MN5A 3FMVA 4EG0A 3H1FA 2JHAA 1FTQA 3NRJA 3G2PA 3M6LA 4ROTA 3T52A 1AHIA 1PWEA 2GHRA 3DKVA 3L6UA 1R8QA 3VJKA 4M9ZA 5ALSA 4DDMA 2P30A 3AHFA 5AHRA 4BB9A 3PEVA 3T1QA 3HSKA 4Z4IA 3VNUA 3MJCA 1Y7PA 1TMKA 1DP4A 5AKKA 3BKXA 5FQNA 1Z2CA 2ZRNA 4KK3A 4IJVA 1VHLA 3IURA 1DUIA 1MX9A 1P7CA 2OCDA 4QARA 2PMDA 2Q28A 3ZV4A 4JLAA 1UOOA 2FSFA 2EIHA 4TZKA 1GGNA 2EX4A 4Y6OA 3VNRA 1BROA 1EEHA 1PWZA 4ZQEA 3ESQA 1VCNA 1XDUA 1Y89A 2CXQA 2QS9A 4MWZA 5B57C 2G76A 1OFGA 1F2TB 3D2LA 3DUFB 3TMKA 1H05A 2C4VA 3M1IA 5GWXA 3W8NA 1YOBA 2JZCA 4EF6A 5A4MS 2PSFA 1J39A 3MSCA 4DRZA 1Q0TA 2PMCA 4PRKA 1OX6A 4QFMA 4QU9A 2BC9A 3WYCA 4L9SA 3QXSA 1WP9A 1VKJA 1MX1A 4HX2A 1ZO8A 3L0YA 3OIUA 3E70C 4M37A 4RA9B 3V4FA 3KJQA 1AGXA 5IMBA 4K8OA 4OQNA 3Q7PA 3KQKA 1VCMA 1GPBA 1G55A 3S8EA 2BBOA 4E2XA 1JYFA 2C78A 1JU3A 1QHIA 4K0KB 4KR6A 1XFAA 1U28C 4G2NA 3CH6A 3WBKA 1PJAA 4A9AA 1SD5A 3EVEA 4WEOA 1U2TA 1VA4A 2GA8A 1M0WA 4YTEA 4A8PA 1DINA 2JBHA 3Q0EA 3WKAA 4MVJG 3HFJA 4HQKA 5EUBA 1V39A 4CMAA 1DAPA 1O0BA 3BD6A 3K4HA 1QVVA 2N46A 2ZROA 4GNRA 1IAQA 1Z3CA 5K6TA 5JWOA 4P5PA 1SD2A 1MTZA 5H1YA 5AW9A 2G8LA 5ECWA 2JJ1A 2W37A 1JLLA 4JEHA 4JSYA 2H92A 4ATNA 1W25A 1XRNA 4NJMA 3YASA 2RHGB 1YFZA 1A5SB 5DWVA 5F9MA 1ORWA 4XA8A 1XMVA 3ORHA 3DGEC 3CLVA 1PGJA 2WU1A 1AC5A 2DUJA 2ZBRA 2XGSA 2UV8A 3H11A 3OICA 3C3BA 3NPAA 4L27A 2AXPA 5IUKC 1YDFA 2VZ8A 3S0JA 2XVAA 2G1PA 1KI7A 5TEWA 3H5WA 3ACCA 1VE5A 1UP4A 4Y1GA 4AUMA 4FSHA 1PV4A 2PUHA 2ERYA 3TRIA 1I01A 2AOTB 4QU5A 5HX7A 2PJRA 4OOFA 1HNWB 2FSVC 4CMCA 1UJ2A 5AKGA 4GMFA 2IYYA 1N57A 1IMJA 1W5SA 1NUHA 4J3NA 4BGEA 1NMZA 3K9WA 3UB2A 3BORA 4AKTA 5D85A 2Q3CA 3UKDA 3Q8LA 4QDTA 1POWA 1Y4UA 3AM4A 1N2EA 1ORIA 4TKUA 3F0TA 3O8QA 1Z0DA 3NO4A 3HPQA 3I8OA 2ZTUA 5KKNB 3MS2A 5K0CA 2AKAB 5HA5A 2FSUA 2XQFA 3CUSA 1NMYA 4PCVA 3BMQA 2WQZA 3NGXA 4NH0A 4CV3A 3BGSA 1UMBB 1RJFA 1XKLA 1MPTA 1GGVA 4ENUA 2I67A 3CKKA 3GJXC 3PL1A 3TLMA 4Y2VA 2G72A 1V8ZA 1AS0A 2AZ4A 2VK4A 3FWKA 4M6WA 4PSUA 4RY0A 1O9BA 4FGJA 2WQ6A 1DFIA 3L18A 2PKRA 4EGCB 3DBLB 1FFXA 3E2IA 3PWTA 4EF4A 4TSFD 4PSCA 5CLJA 5D01A 5FUYA 5T3UA 3Q7SA 4O2BF 1TZCA 4X5OA 3E18A 1R74A 2PLNA 2IUFA 3CNEA 4LEIA 3RVJA 4PICA 1F0KA 2V6FA 1BFUA 2I71A 1Z8NA 4HSEA 3F5MA 2GEJA 1EUCB 2ERXA 3GI1A 1MAVA 3G2KA 4OHVA 1Q7RA 3U7JA 1SIBE 4FHFA 3O83A 5KYYB 1JDZA 3QMVA 4PG4A 1TUEA 2WAYA 2Q0XA 3QUCA 1CJSA 1JSRA 1EP2B 2BH9A 2C0PA 3BHNA 3KG2A 4M9SA 4XGKA 3WICA 2VYVA 2QP4A 3JQ8A 3ZY4A 4NZNA 5HYVA 2WNIA 3OG9A 5DF1A 4KWEA 4DM7A 4EK9A 1PKXA 4EJ2A 3AUFA 4LYDA 2QE6A 2JGIA 2CCJA 2D2IA 4JY7A 1MFZA 1RCFA 1U8YA 4UE2A 4D4GA 4G9BA 4HSGA 1Z7GA 1KGSA 2GN4A 3L4BC 1N5OX 2COKA 4B31A 4BQNA 4CXMA 3OY7A 1W7AA 2D59A 3NHBA 4DLUA 3SKYA 2WP0A 1PO7A 3BTSA 4R51A 5A71A 2VUHB 4RIEA 3V8RA 4D4MA 4PWYA 3KDAA 1E5LA 2JGRA 4BEWA 1PV1A 5BWBA 1ETUA 4FDUA 2PR7A 2AOXA 1B8VA 4L5YA 4C87A 4H6XA 1S2IA 1VKNA 2GTPA 1HL7A 3MCZA 4FYVA 4S1TA 5G40A 3IPCA 5KJFA 1B00A 2P4EA 1EIZA 1S2NA 3E5MA 5IKXA 4HG2A 4RS3A 4L5AA 3RJTA 3UPTA 5LIPA 2X8JB 3S8MA 4FWTA 4C14A 3ZIAD 1XVLA 2NQ8A 3NBXX 2GASA 2W2KA 4Q6WA 2O2SA 2H1IA 3NXKA 4PLFA 3WGIA 3G79A 2Y8EA 4PYJA 4ZEMA 4EELA 3AMVA 1U1IA 5TB5A 2IDJA 3PLAE 2BHSA 1O08A 2JIBA 4Y2PA 2EW2A 2J67A 2VYNA 2WWTA 3A32A 4ETNA 5J4VA 2WF7A 3VYWA 3V9AA 4DA7A 1D1QA 1EM8A 1F6BA 4WK4B 1FRNA 1D0SA 1DI0A 2RGBA 5C1IA 4A2QA 2NLOA 3OTOB 5I6DA 4QYIA 2WWFA 2BFEA 1W9MA 3R7WB 4YA6A 4AMYA 1NY5A 1KK1A 3NX4A 4F5ZA 1YRWA 2ABWA 4BLWA 1G291 5DWQA 3T15A 3ZGNA 2P40A 4NSNA 5ALTA 3TAUA 2HUNA 2HRQA 1G4HA 5CPFA 5JSZA 3C7AA 3G1UA 3UMYA 2C9ZA 2DCUA 4J3FA 2BBWA 1P44A 4QOIA 3ZU4A 4CF6A 1QH9A 5TQ2A 3I30X 4L73A 2ZVJA 5JU6A 3GGCA 3PR3A 1P5JA 1MQ8B 3QFHA 1YJXA 4ZT6A 1QS0B 4PZPA 8MHTA 1KI6B 3JQGA 2EP8A 3U3ZA 5FBZA 1U9IC 3BFJA 3O4RA 1YIDA 5EE5B 5BYJA 5HNKA 5M5BA 1M2GA 2ZYUX 1QJ4A 4EI8A 3W2HA 3O8RA 3PDCA 4D7AA 1D6NA 3CEPB 1A72A 4RPLA 3FWPA 1AZWA 5LQKA 4LF5B 1N8NA 1QNLA 3BD8A 2ET6A 4BWYA 3KQUA 4Y2QA 1FP4B 3KQLA 3L93A 1FRZA 2CJYA 2NO7A 5PGMA 4YUZA 3F5QA 3EIOA 5A0VA 1LLUA 1WXQA 3WK4A 1BIFA 1DRJA 4UUNA 2VSQA 3DE0X 5FJIA 1ISSA 4AJJA 3SYNA 4NPCA 2IBTA 4JZYA 3R5SA 5IAEA 4ACAA 1I3LA 3DEZA 2J0UB 2RGEA 1N3YA 1Y1QA 1YZVA 3CHYA 3S3TA 4AUNA 3K6SA 1Y37A 3WY9A 3PB3A 1M8PA 1AKQA 1I3KA 4OHZA 3DZCA 1Y98A 4D3SA 5KPJA 2WU0A 1NASA 1PJSA 1T13A 3NC4A 3ZHTA 4R5MA 2GD1O 4US1R 1EEXB 5EJIA 5BPHA 1G3RA 2I99A 5DYIA 1H9CA 4RSRA 2DFNA 2JEYA 4QXQA 2ZYIA 3S99A 1QQ5A 2HM7A 2Z5LA 4LK3A 4BN5A 4TTSA 3CZPA 4CKBA 4MCIA 2JAHA 1IK6A 2VP9A 5FHRA 2OM6A 5JAHA 5KX5A 2XWBF 3K30A 1QLHA 3U4GA 3FJYA 4NU8X 2OZLA 2Y05A 2RCYA 4K81B 3ZR4B 2YOFA 5BMVA 1JEYA 4WLUA 3V34A 3WLMA 1BFDA 4I19A 3UUGA 5CCXA 2FZVA 2H18A 2C07A 1BS2A 3C39A 1MMFB 3ZGYA 3CUTA 2Z6AA 3CLTD 2QUHA 2YN4A 4BFZA 4DLXA 3RHTA 5MN6A 1PZMA 3QI7A 2C3OA 3NTVA 5HXAA 2D2VA 2BGUA 5FTMA 4JYZA 3ANTA 1FFEA 4WN9A 1PF7E 4X24A 5IJ0A 3W0LB 2RD2A 3OFSA 5E9WA 1JZSA 1UBCA 1K98A 1SEVA 1F5SA 2YYAA 3R3WA 2PMKA 5L3QA 3GRFA 3JWPA 2WTXA 3LKZA 4G67A 2BTEA 2L17A 1E92A 1U4SA 4LWPA 4IFIA 1XL0A 3DMFA 5JE8A 3GEGA 3WG9A 3ZU5A 1P60A 1K7YA 2A6PA 2V8BA 2QJFA 2Y0EA 1E2NA 3HUFA 4TXLA 4Y18A 1UDWA 5AJYA 4G0YA 3TOZA 4YIHA 3RS5A 3GEBA 5DGXA 1UZUA 3OE7A 3QZUA 1E2EA 3LUFA 4CI9A 2B5VA 3HM9A 3KV1A 3UA4A 3VNQA 1FFGA 4EYSA 1WB9A 3K7EA 1T4BA 3ZKAA 3HJBA 2FSSA 3D3NA 3IL2A 1S2MA 3C8HA 1UOQA 4YXWA 1O3YA 3CKMA 3OUZA 4XGRA 1HOTA 1JQEA 2C5BA 4Z99A 3KXKA 4ACBA 2ZJAA 4C78A 5J2UA 4Y0AA 5K5EA 4XVRA 2XNDA 5KYKA 2F4VB 1WV1A 1S4QA 2EFGA 2Z8XA 2ZJ1A 3PFKA 3Q15C 4R8VA 3O38A 3F2IA 4RY2A 2AG1A 2ZXUA 4CIWA 5E4TA 1DG3A 1LH0A 4WKNA 3TZKA 2A7XA 5JNUA 3M8KA 3L5OA 4PXAA 4ZOAA 4Z0HO 2JH9A 3ZCVA 1ZLYA 5AVYA 4BVKA 4MV8A 1W4LA 3B6KA 3BAZA 2WMYA 1CVIA 3CLSC 5FPTA 3L05A 5KQLA 2W48A 1QKJA 4LJ7A 2P9BA 4PFKA 2QM0A 4KMRA 4A16A 4L08A 2R84A 1PNQA 3HMQA 4LHEA 2LP4Y 2JLBA 4NI5A 3JPWA 2OCAA 4QU8A 4B75A 1CNEA 4TLEA 1RZ3A 3FY4A 1EDDA 1ZH8A 2ZJ0A 1CRPA 4QJ3A 2YNMC 3A3NA 4OK6A 1BFKA 4QGGA 3SEZA 3ILYA 4ENQA 2IX3A 5GQSA 4ERXA 2Q6TA 1FQWA 1E3LA 4PLTA 4HXGA 2UZIR 4ER0A 1LDMA 3SQDA 2WIKA 1GCAA 1KR5A 1YQTA 3GZNA 3BSYA 3V8QA 3U5ZB 2VDOB 2J31A 5J43A 3CIOA 1SUBA 2RK6A 4OX9B 4JLNA 4WA8A 4I50F 3AL3A 3TSWA 5JMTA 4FCTA 1NP7A 3OURA 4BMVA 4WOCA 4HNHA 1ZMOA 4LXTA 2ZVQX 3UAGA 2D06A 1L4KA 4Y0VA 4YP7A 1U4NA 1WSWA 3P0IA 3ZNPA 3E1GA 4BNWA 1VI5A 4KRFA 2H31A 5AJWA 5J58A 1JR6A 1ESDA 2J6HA 2Q49A 3K1YA 2JFUA 3N2GB 4U2FA 3TZBA 4EJ0A 5D6NA 4N0DA 1T1RA 1U3FA 2NZWA 2PQ0A 4MW9A 4NYJQ 4YXWD 4LF4B 4QQKA 3U3JA 5FWXB 5DW0A 3DAHA 1TM1E 4FYJA 4WBNF 3KYDA 1AXGA 2A1UB 1FPMA 2EEZA 4JLOA 4CEJB 4DVGA 1AIPA 1VI2A 3NOVA 5C1BA 3PSAA 5LNK1 4HAYA 5A4AA 4DAEA 4IZ6A 4O2RA 3DDHA 2W83A 1P2FA 3MK31 4WY5A 5AWFC 2JIRA 3CTMA 2C2ZA 4N3CA 5C3MA 2YICA 3OQOA 4KXVA 2JKZA 4JOCA 4JI1B 2H8GA 1WSBA 2DH5A 2MR6A 1C50A 1ZP6A 2QX4A 2P3LA 1VTKA 4Q34A 5C81A 5IUNC 4GL4A 3ZX4A 2MWMA 3LOPA 4UCQA 4C4RA 4A91A 1U5BA 4JI4B 4YHBA 5KTKA 5CM8B 4FSDA 1AJEA 4S1VA 4QVIA 1SH7A 3ZDAA 5EL0A 1J5PA 5GONF 2O2DA 2WDPA 3GJ3A 2ONCA 2I6SA 3II6X 2FRVA 1DDIA 3P9KA 4IRUB 4JQYA 5KYXB 4DSUA 2I1VB 1P2GA 4M8SA 4RBNA 2OAP1 4G0QA 4HNVA 1BQEA 1OXVA 5EMLA 4J0FA 3R7DA 4CCSA 1E6LA 3FJ1A 5KTRA 4EUNA 5TDHA 3TINA 3WBJA 1FLNA 1W59A 2IEDA 3W77A 5BSVA 1JB1A 3L1VA 3TE6A 3K9FC 1VGRA 3FYUC 2K87A 4AG6A 5BSWA 2Q1SA 1M2VA 4Y2HA 3EA0A 5I4KA 1DAOA 4YV7A 4PLCA 4R01A 1IUNA 1R6TA 1TB4A 2JC3A 4IDQA 5HBGA 2ONZA 4ZAZA 3WLEA 4NJMB 3AOEC 1S6YA 3EQ7A 1ZM9A 3QFRA 3E7FA 3N8DA 2XZLA 2ZIUB 3OLWA 1BMDA 1P1RA 1V8FA 3ETLA 4GP9A 4E5UA 1OZGA 5ICCA 4WOBA 1G38A 1F2TA 1WAMA 3DUFA 4MQFA 3UMGA 3CSSA 1KU0A 2JBAB 2MYUA 2O8VA 3TX6A 1W46A 2O3TA 3SSAA 1DT3A 1CBUA 2VRCD 4OK3A 3GA0A 3S40A 1D1SA 3UWSA 2B5OA 1I4LD 1Q0ZA 3MTAA 1O2DA 3PQ5A 2HSWA 4LDPA 3THRA 4F84A 3RAEC 1IDOA 3A1VA 2PH1A 3AFOA 4Z0NA 1C1XB 1BHSA 4GSYA 1COWD 1K1EA 2ZBUA 3D4OA 3KL4A 5HTKA 4IX9A 2VDKB 1SK8A 3LD9A 4K9QA 3T3PB 4BNKA 4DVJA 2NTNA 5DKFA 1FUKA 2FH5B 3OA2A 2EQBA 2CDBA 2YDYA 3D4IA 3LBIA 3KLPX 1Z62A 3LU1A 4OOEA 3EQZA 3SZ3A 2Q4BA 3JQ6A 3PPYA 4ANFA 4B6GA 4KGXA 3DD1A 4EHKA 4C2TA 4KXYA 4TROA 4UUMA 2O06A 4ECAA 2IFTA 2FEAA 3BULA 4HQ6A 1EGAA 4R7TA 4PV7A 5FOXA 3I9V1 4EARA 4E88A 5KWIA 3N0XA 3H2JA 4JI3B 4NPAA 1JXQA 1HGXA 1EWTA 5DYWA 1CG6A 1WQ4A 3IBSA 4XD7A 2OM2A 3QVMA 1S1MA 1Z4IA 3CLTC 3KLOA 3QUQA 4ZO4A 2GEDA 4BPRA 1MO4A 4QG7A 3WGMA 1U9CA 2OZPA 5IZ4A 5BR1A 5JTTA 2I6XA 4DCUA 1MB4A 4H1UA 7GPBA 2C0CA 3KVRA 4HQRA 4XARA 4F06A 1WMSA 1GQRA 2CBZA 2AGVA 1JALA 3RGWS 4D57A 2P1DA 3T3MB 4IHJF 4EECA 4ZFNA 4BRUA 3QKRA 3CUKA 1MIOB 2CV1A 4K88A 1L3CA 1I6KA 1UK8A 4LG1A 4EY8A 1UKVY 3M6XA 5F2KA 4J7XA 3RC3A 3ZBUA 4PINA 4E94A 3R5XA 2XZDA 2OQRA 1IRXA 4B46A 4DA4A 1QRTA 2P0YA 2DCMA 3T5DA 2I55A 2F90A 3Q2KA 1TF7A 4KYUA 3DZIA 2AFHA 4IMIB 1WB5A 1YR6A 1QQ6A 2J8ZA 3H17A 3OUUA 5JD4A 3GN2A 3CLUC 1V1RB 4ITRC 5CDFA 2BKLA 2JVKA 4OL9A 3QKSA 2W6QA 4ZQIA 4G56A 4EJFA 3PHIA 1YVPA 1WDKA 4RK5A 5IYZB 1N2CB 1UC9A 2UKDA 4GBMA 4QUBA 3ESDA 3FZYA 5HF5A 3H4IA 1YDHA 2OV3A 1W581 2OXCA 2B7LA 1JEDA 1NZDA 1UJ5A 1R3UA 5KOHB 2CLLB 2O2JA 3PQ7A 2CLCX 2Y27A 4Q1CA 4WOKA 3IKLA 4A0RA 4KK4A 3D5TA 4X3OA 2GRUA 3ROFA 3RIXA 3T7KA 4QL3A 4BC1A 1ZGBA 1S8FA 1VPEA 2EC5A 1YBMA 2GN9A 2CZGA 4PYLA 3RC2A 3N59A 5F2OA 4NS1A 5KC9A 1YB7A 4Z1OA 4KTVE 5KU1A 2RJ3A 1OB5A 2VAPA 1P75A 3MTEA 4TOIA 4DLNA 4DPMA 1AUVA 5H70A 3RFXA 5CX1A 3RH0A 4BLUA 2I4LA 4DEYA 4ER7A 2NXNA 1Q6ZA 1I33A 4XW2A 1SCKA 1T43A 1Z28A 5HF6A 3UWMA 4ZEOA 1MCZA 3QVTA 3SS9X 4CNQA 5K3AA 2PZKA 3GEPA 5C2JB 3H8VA 3GFBA 4Z9XA 1HE1C 3K5WA 2Q2VA 4X8OA 5C7YA 4MQEB 4RLSA 3CVUA 1MVNA 5JQGB 2PH7A 4H31A 3WLJA 1P9LA 3PICA 3AVYA 2C7QA 5SZKB 3ORSA 5IAKA 5JCOC 2H2FA 4XM2A 1X8KA 2DPXA 3OJFA 3DKIA 3PGLA 3DHVA 3RWOA 5HKKA 5BQXA 1HEYA 3GVCA 4EYEA 2ADOA 4H15A 2EBFX 5B2FA 1JR3D 4M7WA 3HK2A 1DFHA 1T2CA 3H9CA 4MVYA 3ANMA 4URYR 3FPGA 4FMDB 3VOBA 1GPKA 4PQFA