3BORA

Crystal structure of the deadc domain of human translation initiation factor 4a-2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
207
structure length
194
Chain Sequence
b'EIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human initiation factor 4A-II
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 194
sequence length 207
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3borA00
4HZIA 1GUAA 3KUCA 3QXXA 2Z5FA 3M0EA 4MYCA 3CONA 1SHKA 2BC9A 3T35A 3KTAA 4MRNA 2P6NA 4GPTA 1WXQA 1ZM3A 1OYYA 2OE2A 5CLLA 2O8FA 4BRWA 3OF5A 2DFTA 1S1CA 4QHTA 5TXGA 1T5LA 1W47A 4Q5IA 2DFKB 1TEVA 1R0WA 3VNVA 4AYTA 1ZMXA 4ZDWA 1KK2A 2BJVA 2GJ9A 4I1SA 3JVUA 1J99A 2BEJA 3OAAD 4JYCA 3P20A 5JZVA 1GG2A 2C78A 2PJZA 3MWJA 1AS3A 3TUJC 4FXPA 4I99A 4BRUA 1DG1G 1E98A 3OHMA 3U6BA 3ADBA 1Q3TA 2YV5A 4P4TA 1NLYA 2QM7A 3EIHA 2QQEA 4JL8A 3W6NA 3TK1A 4FCTA 5KHOC 1F3OA 1Z0KA 2HLDD 3IO3A 1QF9A 1IONA 3S1AB 2YHSA 4PC2A 4QM6A 4JKYA 4HYYA 2GJSA 1KY3A 1SQ5A 2RGEA 4LBWA 4PXAA 5DGXA 4ZV4A 3FMIA 3Q8XB 2D7CA 5GADl 4TMTA 1LF5A 2WAYA 1UBFA 2P6UA 2BM1A 1XB2A 2X2EA 1N0UA 4UJ3A 2CHQA 2QEQA 1NVUQ 3TUIC 1L2TA 1BYIA 1IOZA 1T8TA 4WOPA 4X8MA 2HYIC 1BOFA 4XSHA 2YZ2A 1KZGB 4LK2A 1QHGA 2CCKA 3A1SA 3C14C 4HUQA 2RGNA 2MMGA 3RRMA 4BZXA 2PLFA 2G1JA 3RLFA 4OHYA 4LV6A 2FX3A 4IOKA 1ZD1A 3EZ7A 4IDQA 4CW7A 1T6NA 2QPAA 3NH6A 3K8YA 4WZBE 4DHEA 4DDTA 1KMQA 1W46A 5FOWA 4NYIQ 1R0YA 4ARZA 5A5GA 5BXQC 3VU9A 4OQFA 3GEIA 4H1VA 2IBMA 1E1RA 3CNNA 4TL7A 2GBLC 1NJGA 4X8HA 4BLOA 3QKRA 4EPYA 4EFMA 1KO8A 4KFSA 3BB4A 1E2QA 2QP3A 5BN4A 4TYNA 1NG9A 5CIWA 1KNQA 3NBZC 3NHAA 1MV5A 2OFOA 2Z43A 3ADDA 3AGQA 3KXIA 1L4YA 3Q5EA 5L3VA 3P4YA 1ZJ6A 1EXMA 5CK5A 3GPLA 2N42A 3CBQA 3N5CA 5LBIA 2WOOA 2X77A 5CJ2A 4RD3A 1IAQA 1P9NA 3GD7A 5C46F 1L4UA 3GLGA 1F60A 2F7SA 1G3RA 1IY2A 2A5JA 3AKDA 4AD8A 3U61B 4I4LA 1R5NA 2HF8A 2WJIA 4A36A 4Q1AA 3BERA 3IQWA 1FX0B 2EW1A 1G7RA 3E1SA 4M8NE 4S2EA 2NGRA 3MWKA 4C0QC 1R0XA 1SHZA 1YZLA 4G1UC 3ICQB 4TQAA 2NO6A 4ZCLA 5IK2A 1E79A 3CPHA 1QZXA 2QP4A 3LLMA 3EPKA 2WMOB 1XWIA 3T1OA 1F2TA 2OCYC 1G16A 3F0TA 1WRBA 2OG2A 2VHJA 3I8XA 8OHMA 5FUXA 1UPTA 1ZNXA 1OPXA 2C99A 1GVNB 4IW3B 1XTIA 3B1VA 2AX4A 1GNRA 2A5YB 3AF4A 5A0FA 2YOGA 4URYR 4V0ME 1IXZA 2WSSD 2ZE5A 1XXHB 2REBA 1P73A 2BV3A 4CZ2A 1N0WA 5FBVB 3TKLA 3THYB 2RGNC 5FUVA 3TGPA 4FMDB 3QXHA 3RVBA 2IUTA 5KYKA 1M7BA 4DB4A 1W2HA 1KSJA 5FR1A 4TYYA 1GILA 2A2ZA 1P9RA 4BFVA 4NBSA 1N6LA 1DVRA 3RS7A 3GJ5A 1JBKA 1XZQA 3U7EB 4E09A 2Z83A 3L8YA 4QFMA 5AR1A 1TU4A 2JDID 1IXRC 1IN8A 3K0CC 3NWJA 1AKYA 2QBYB 3EASA 1X1RA 5B64A 1UKYA 1WP9A 2ZROA 5HKKA 3U44A 1VYVA 3PVSA 2VHQA 1ZRHA 5GJWC 3UK6A 3E5HA 5L8VA 1E96A 3GLHB 5JWHA 5TVKA 1E99A 1NKSA 3OIYA 1VPLA 2VH5R 4YC7A 4TMXA 1Q1BA 3IQXA 2QMHA 2PJRA 4DCTA 1XX6A 1IY1A 1E9BA 3SS8A 4JVSB 1G8YA 2IYYA 2ATVA 2EWVA 4IDNA 2ZU0C 2ZRBA 2ZVQX 1L7VC 3P1JA 4TWZA 5C4MA 1B23P 1KI4A 1GKIA 3LA6A 2RCNA 3THWA 1Z28A 3PG5A 4JLJA 3CX7A 5FUWA 1GKUB 2R2AA 4LI0A 5JI2E 2QAGA 3ZVMA 1TQ6A 2LKCA 1U81A 3NC1C 1TU3A 1KO4A 4Z8XA 1GM5A 1S9DA 2OHFA 5JS8A 1QG2A 1UM8A 4YMWA 1G5RA 2ZETA 1EG7A 3R20A 1E9SA 1U8YA 3I72A 5KPJA 1VTKA 4TL6A 5CM8B 5KSPA 1G19A 1FTNA 2W2TA 1A5TA 1E32A 1Z29A 1T3LA 1G8PA 2KJQA 2G6BA 3FGNA 4US1R 3RS5A 1WBDA 2DHRA 5BQ5A 3ZLJA 1HA3A 3DM5A 2ZRCA 1DS6A 5ELXA 2VP2A 1P2UA 4R9UC 3W8NA 5DSZA 4UXHA 2QQ0A 1JQLB 3OESA 5FR2A 4BFZA 2ZTSA 1OFIA 1ZVQA 4DDWA 1OB5A 2GJKA 2FFBA 3I8SA 2IYSA 2OSBA 1EFTA 3SZRA 3HR8A 3N2EA 4M9XA 1NVVQ 3CM0A 1K6MA 1VDZA 2VP5A 4ZCIA 4F7WA 1Z0IA 1ZUHA 5J5CA 3CPJB 4DEYA 3H4MA 4AKIA 4JZKA 1EESA 1GIAA 2DYKA 3E70C 1M1YE 1R6BX 3Q7PA 4MUAA 3E2IA 3QKUA 4B3FX 4JLKA 2FU5C 4Q4AB 3TIFA 2BBOA 1IN5A 1DG3A 1G8FA 5KDOA 1RKBA 5F98A 5FPTA 4DCSA 1DOAA 2WPDA 5DYIA 3QEOA 1LB1B 3IUYA 1U90A 3PUYA 2R6DA 4IKEA 1Q44A 1G291 3A1TA 2V7QD 4OQLA 4I1VA 3RDPA 4B3XA 5KUTA 2Q3MA 4KU4A 3REFA 5F9FA 1XEWX 3U6KA 3CPEA 3DO6A 1KY2A 4QBGB 3UG7A 1M7GA 3WY9A 5CJPA 3R8FA 4A8JB 1QBKC 3LY5A 4LRWA 5DYGA 1HEIA 3KFXA 3HP1A 3U2QA 3VNUA 3B1WA 2NO9A 4WXRA 2MSDB 3QY0A 1II8A 3PENA 1LNZA 2J0UA 1W36B 4M1SA 4NCNA 1OV4A 1KK3A 1CRPA 1GP2A 1BO6A 1JNYA 3RHFA 3LQQA 2BMDA 4DLRA 1NY6A 4V0OA 2G1KA 1P72A 3AVTA 3B13B 3TVTA 2A5FA 4HLDA 3BH6A 1E2DA 1PUJA 3WMGA 1ANKA 1OHHD 4CT4B 2ZS9A 4BFTA 2ZAMA 1T3HA 3DEFA 2G88A 1NN1A 1SXJA 2H18A 3MD0A 3QPUA 2GHIA 1AQYA 3HWSA 3OE7D 2IYRA 4AI6A 4XWKA 4JYBA 4BLTA 3QKSA 5FTLA 1XMVA 1M7HA 3CLVA 2Z4RA 1M6NA 1W5SA 2EVWX 2IYZA 3D7MA 4IOLA 4MKGA 4NCJA 2JIZA 2A5DA 1XJQA 5J47A 1JPNA 4OJQA 1S96A 4LHYA 4ZKDA 4TQ9A 1X8KA 1FMJA 3B60A 3UPUA 5AJYA 1L8QA 2XB2A 4G01B 4B34A 4TSFA 1N2CE 3K09C 2ERXA 721PA 3I62A 2ODNA 4TT3A 3O8BA 4Q7KA 2I1VB 5IHPA 4AKGA 1DEKA 5FOVA 4LBYA 4TYQA 2I1QA 1TUIA 2JJ8A 1P5ZB 1WE2A 4TTRA 1G5TA 4LYHA 1E9CA 3BFVA 3GCGA 2BDTA 2V6JA 1NSFA 3ICEA 1E4VA 2FPLA 4P0TA 2F9LA 3EW9A 2GJAA 4C4PA 3BJIC 1DAHA 3EC1A 4EJSC 1G6OA 4B2LA 1FW6A 4XVRA 2GEDA 3AF2A 5J4KA 2V1XA 5JRZA 2AFIE 1PLLA 1SVWA 2CMKA 4JLMA 4OQMA 4RZXA 3KKNA 5GVSA 2SHKA 4DCUA 4XJXA 4EFLA 1R8QA 5AJWA 3OEEA 1M74A 2PCLA 2PZFA 3LRPA 3MGCA 2J0VA 2OO7A 1IN6A 1JALA 1COWD 1G1MA 4GSYA 4LX0A 4PPQA 4B43A 4MYUA 3ETLA 4DSTA 4BUJA 4LWZA 1KI7A 5HCIA 4IJMA 4LC0A 3PEYA 1IN4A 2PLRA 3U3JA 1PLKA 4KFUA 2CE7A 3VMFA 3VX3A 4CDGA 2GAAA 1E2JA 4URWR 3GLFB 4Z8YA 4BE7B 4U00A 4UQOA 1MO6A 3CWZA 5AWFC 3C8UA 1XFAA 3HU3A 3T1VA 2D7DA 3U60B 1A1VA 2FH5B 2IYLD 3L43A 4KYUA 4TLAA 4LCBA 3LX8A 4XD7A 5JFGA 5EE9A 3SBEA 2ZI3A 5H8WA 4HAVA 4JBWA 3U3KA 4O2RA 3LW8A 4RCYA 4WW0A 5CB8A 3EZ9A 1RRPA 4I1UA 2KWIA 1WBBA 5L3QA 4JMPA 2JA1A 3ZH9B 2OAP1 2ZYVX 3ZDQA 1KDOA 5L3SB 2ZRFA 4L9WA 3Q5DA 3Q9LA 2EQBA 4KFRA 2D3WA 2ZRPA 3AVPA 4Q66C 5C18A 4W7SA 5DI3B 1G20E 2BVNA 5EXPA 2IHBA 4GRAA 4LBVA 5IRCD 1H8HA 4B2IA 3VR2A 2R8RA 2Y8EA 3PEVA 3A4LA 3GJ0A 2WJYA 2QZ4A 4EAQA 1E2IA 1Y63A 1S4QA 2F43A 1CR0A 2KB0A 2AXPA 4OI2A 3ZIAA 3PQCA 2X1VA 3KDSE 2D4HA 3PCRB 3ONWA 4AURA 1U0JA 2FSIA 1P62B 4K8OA 3GLHE 4PC7A 4YDHB 3WNCA 1TADA 2QU8A 2OEPA 2WKPA 2ZSEA 1U9IC 1YR8A 2J7KA 4DBLC 2OV2A 4B73A 4GFDA 4LPSA 4MRSA 6Q21A 2CL6X 4KITB 2GXQA 3HJNA 1AM4D 1FUUA 3KKQA 4Q21A 1OYWA 3RWMB 3AVQA 1P4SA 5FOTA 4P33A 4TL9A 2XXAB 4JL5A 2XZLA 3DMNA 2WTUA 4GZMA 1T0JB 1AK2A 2CXXA 4JBXA 1UKVY 1P9WA 3CRVA 3PITA 5GJCA 4DT1A 3ZS8A 3HR7A 5JJLA 1NG1A 3UG6A 2ZJ5A 2QAJA 3BH0A 3R9WA 3QIAA 2O8BB 5EE3A 4HSEA 5KDLA 4M1TA 3WRXC 2H5EA 1XTRA 3FMOB 1YR6A 3C5HA 1Z3IX 5FBWB 4B71A 2ZANA 3GLIE 2C98A 3ECCA 1OH6A 1NIJA 3VHLB 5HZKA 4PO1A 5KDDA 2JGNA 1US8A 1G4UR 2FSGA 1RE0A 2HXYA 4DKXA 3RRYA 4US2R 3KTAB 4DB2A 4MGZR 2YWGA 3IILA 1S1MA 4JLOA 2F1HA 3BGWA 3QF7A 2NMVA 2O8FB 4L16A 2XTNA 3R7WA 1ONBA 1NL3A 2QRNA 4PZYA 4BPBA 1ZNWA 3ASZA 4Y0AA 3K1JA 5F2EA 3BAFA 4H1UA 3I73A 1YRAA 5BYJA 4LYJA 1H8EA 2WWHA 4NKRA 5EUQB 1AZTA 2ZXUA 4W5HA 2OCBA 2CK3D 2J45A 5E7JA 2E87A 4ZPXA 3WNDA 2OESA 2IL1A 2PX0A 4Q48A 1G3QA 2P2LA 1CJKC 3DL0A 2QTVB 2QGZA 3FTQA 4NTZA 4IDHA 1G18A 2V9PA 4ZDIA 1KJWA 1YQTA 5CITA 4DZZA 1G9XA 3VR1A 5JRJA 3CR8A 2IK8A 4B6EA 2NZ8A 1W48A 3VTKA 4RD4A 1EFHA 3WHLA 1AZSC 3LNCA 4AWXA 3LH5A 4TLCA 2W6JD 4ILEA 2BMEA 2RHDA 2D62A 1XD9A 3ZZUA 3CZPA 1ZM7A 2VHTA 4BECA 4HAUA 2IC5A 3A6PC 1LF0A 3ADKA 2H16A 4BQSA 4D4KA 1WB9A 2NZJA 1J8MF 1I2MA 5SZKB 3PJRA 3GJ3A 1J70A 2GXSA 2YJTD 2R65A 4D0LB 4PHHA 2BKUA 3QOFA 1PJRA 2W6ID 2OFWA 4WZAE 1YZTA 3ZS9A 4QXAA 5AK0A 5KSOA 4Z1MD 2J7PA 4JKIA 4D25A 2FZ4A 1SULA 3IGFA 2VF7A 1W0KD 2WWIA 4URZR 1DAMA 1I4DD 1KI8A 4FMCF 4Q1CA 4V0KA 3KQUA 4OHXA 4A92A 1G7SA 2C9CA 4X8OA 1XRJA 3TVDA 1DTSA 1TQDA 1EX7A 2FEMA 3B2EA 3BFKA 3M6AA 2QY9A 4YMVA 4RD1A 4ARZB 4ZKEA 3IHWA 1UDWA 4EPWA 3EPLA 3K70C 2QSYA 1IY0A 3KUDA 3PUVA 2CL7X 1VECA 3HDTA 3QKRB 1OKKD 3K9HA 4D4MA 1KK1A 2ZJYA 2WV9A 4PSAA 1W4AA 5B30A 2FZLA 1KAGA 4JSTA 2VEDA 2ZUBA 3D8BA 1XTSA 2D06A 1KI6A 2YVUA 4JT2A 5JLJA 3ZGXA 1CS4C 1CF4A 4JS0A 3KZ1E 2CHVA 4HLCA 2ZJZA 3FE2A 4GMXA 4OYHA 3WRYC 4US0R 4DLTA 4HAYA 2F3TA 5JEDA 4GP6A 4YONB 4HDQB 5FH9A 2VHUA 4NYJQ 2Q9CA 1MH1A 1XJ0A 2PMDA 1OE0A 1UKEA 2WOJA 2VL7A 1GL6A 4PR0A 1E1QA 1MO3A 3AVOA 4CGZA 3ZVRA 1T0HB 4ZIRB 2GBLA 2FN4A 5FL7A 2DB3A 3GLGB 2JLVA 4QM7A 2O0KA 4ASUD 5G53C 2QP9X 4V02A 3ZD6A 2YWEA 1AS2A 2NOAA 1NSTA 4LC1A 4RFSA 4A6XA 4CVNA 3RC8A 2ZR7A 3W8RA 3WXMA 3B7GA 1BIFA 4Y0VA 3IIKA 4MDEA 2QI9C 1X8LA 1ZU4A 2CBZA 1OXSC 2VHCA 2Z0MA 1FP7A 2GCPA 2IYTA 2ORWA 2XTZA 4D4LA 1F2TB 2C5LA 4MRRA 3UATA 2L0XA 1X1SA 2HEIA 2DBYA 2PL3A 5D3MA 4BLRA 2ZI7A 3QKTA 5KTYA 4KJZA 2XNDD 2H57A 1RYFA 4PZLA 3LAWA 5E7MA 4BFYA 2V3CC 5GVRA 1U8ZA 3NDBB 1RRGA 4C9BA 1XCPA 3WMFA 4DUGA 4TYWA 1E2LA 4CEJA 4LOAA 1RJ9A 4YXWD 3SR0A 1G64A 3HYRA 1F2UA 1K5GA 4KYIB 2PBRA 5K8TA 4C0AC 1II0A 2ORIA 4WXPA 1UF9A 2DPXA 1CTQA 2XOKA 5AJXA 4B3DA 2IX3A 2IYQA 5GJBA 1N6NA 2G0NA 4V03A 2GZHA 1A7JA 2F6RA 2OXCA 1E9DA 4GOXA 4ZDKA 121PA 5BWMA 2VTKA 3C41J 1CULC 3UIEA 3A4MA 2IHYA 2I4IA 2ZVPX 2ZEJA 1UDXA 4JLPA 4B47A 3K0SA 1EFRD 4LHZA 5FPKA 4M2LA 2BJWA 3AVUA 1KTVA 1DAEA 5EP3A 2EWWA 1AA9A 3QBVA 3OFND 4PX9A 2C04A 1YR9A 3SU8A 2P6RA 4A0HA 3LD9A 3B1ZA 1BYUA 3ND8A 3KFVA 3C5CA 2WJJA 3SEAA 1G17A 3EIEA 4ZCMA 2JJ1A 3TLXA 4KODA 1LS1A 2VA8A 5DE3A 3V00A 1QHYA 1DAIA 1IJEA 2ZRLA 3AKYA 2KE5A 1SVOA 3K0EA 4KO8A 1VIYA 2ASEA 3CWQA 3LVRE 4LJ6A 3HU1A 4XIGS 4GL2A 4B6FA 3K0CA 3SYKA 3RNLA 3THWB 3T15A 3AGPA 1KJZA 4GMDA 3CUEF 4HATA 3H1TA 1W7AA 4BFXA 4IEEA 3IHLA 1Z22A 4NPHA 2QAGB 4HLQB 5H70A 5HCNA 3BB1A 5DN6D 5LD2C 2O0HA 3U3MA 1G3MA 2CLCX 3QNUA 3B85A 2ZU6A 4CIDA 2C03A 2ZSAA 2A5GA 3AV0B 4JJKA 1OW3B 2WHXA 2AN9A 1XMIA 2DWOA 5CM9C 3OAAA 3ZVLA 3KQNA 2B8TA 2JJ2D 4EPVA 3ZZ0A 1KDTA 3GFPA 3NVAA 4ABYA 4JJZA 4MDFA 2YYZA 5IT5A 4RZ2A 1RYHA 3K0AA 4MKHA 4NE2A 4LJ5A 3AKEA 4DLXA 1P2VA 1S3SA 1X3SA 2HUPA 4FMCB 3THXA 2DCUA 3PXGA 1P61B 2HLDA 1KO5A 1WF3A 5IF9A 1SKYB 1TTTA 2ZS7A 1LV7A 3LW7A 3A1VA 1PUIA 4PPGA 1E2NA 3QPWA 2ZRAA 2WJVA 1NN5A 2UKDA 3G82C 1X6VA 2WWGA 1G8HA 3RABA 3EWSA 3UWOA 4EPXA 2P65A 1E2HA 1U0LA 5DLQC 5B2ZA 2QG6A 1KGDA 4OI0A 3B9QA 4PHGA 1IXSB 2V1UA 4U7DA 1S8FA 3LWNA 4JBYA 4HZUB 5KPDA 1D9XA 1ESMA 1N5LA 3LXXA 4Q1FA 1UBCA 3MSXA 5AJZA 3U5ZB 2O5VA 1E6CA 3D6TB 2CEAA 2CHGA 4FIDA 1JR3D 4LHWA 1A4RA 4PAOA 2G0TA 4PSVA 2PEYA 3W9YA 1TQ2A 2HDNB 2HYDA 3EC2A 3TBKA 4Q4JA 3QI2A 2PMKA 2PT7A 2REXB 1II8B 4B2PA 4Z51A 4LV8B 1P60A 1AGRA 3H2YA 4OKSA 4ZI2A 2AK3A 4N1AA 1HUQA 4B3GA 4B74A 3W3AA 2WAXA 4BGDA 4D0GA 4QJ3A 1B0UA 3L0SA 5J4VA 1XPUA 1PVOA 1W1WA 3KL4A 5JJIA 2J0SA 3LBIA 5HE8A 4UKDA 2ZPTX 4D6PA 4MQBA 4ESHA 3H0KA 1Q1ZA 2ODBA 3SJZA 3X1DA 1FQKA 1SXJB 1SVLA 2ZRHA 1E2MA 4KLZA 3SN6A 2Q9BA 2P0EA 1E2GA 5DH9A 1RW4A 1MRNA 1J90A 4IOMA 5F9HA 3QKSB 4KI0A 4TTQA 1RVDA 2XITA 3CR7A 2A30A 4MUBA 2WWYA 3W34A 4HB2A 5JCZA 2N1BA 4NDZA 4XWAA 2QTFA 3DMDA 1JQJC 4PTLA 5JJKA 1FTSA 4IRUB 1CRQA 1YHNA 4G3XA 4CEHA 3Q85A 1F5NA 2Z4SA 3TR5A 3WMEA 4O3MA 2YC4C 2IXFA 5JWOA 1KKMA 1KSHA 1TQ4A 2OBNA 4QRHA 2YOHA 4EPTA 4Q9IA 3TNFA 1NP6A 3DVLA 2OILA 4RSGA 2WSSA 3K9LA 4TN1A 2XAUA 3I61A 1YE8A 1D6JA 4JVNA 4M0LA 4QGAA 4YLGA 1OFUX 2FA9A 5FOXA 3OIUA 3AF1A 1O3YA 2HXSA 1HE1C 1G21E 1X8JA 1TF2A 3K09A 3NTUA 2GJ8A 4N0DA 1CJUC 1UJ2A 2ATXA 4KVGA 2FE4A 1Z5ZA 3PFIA 2EU8A 2J0QA 3T06B 4P32A 1XEXA 2JDIA 4D2IA 4F4CA 1CXZA 1FUKA 3IBYA 4URUR 3FFAA 2IXEA 3GLGE 4JT4A 4EJSA 4IFBA 3L82B 1J2JA 1NF3A 3A58B 1ESNA 3LBHA 3H86A 4TYPA 2IS4A 3LBNA 1UFQA 2R6AA 4PAMA 4XTRA 1GAJA 3C4JA 4GDFA 5JCPA 2AWNA 2WJGA 4WIAA 4BWYA 4H9GA 4B75A 1G7CA 1D2MA 2C96A 5LPNA 2ZRGA 3D31A 1NNEA 4JSYA 3SJBA 4D0NA 1SVIA 1E2PA 1OFHA 3UKDA 4A0RA 4QHYA 1G3UA 1A82A 1YR7A 5G3ZA 2RGGA 2QORA 2YWFA 4HDOB 4W5JA 3CZQA 4KSCA 3U4QB 4HLUC 2ZJAA 3BBPA 5AUNB 4NYJR 2IWRA 1C9KA 1HQYE 3SDZA 3ASYA 1UEJA 1N3BA 1P2SA 2GAOA 2KSQA 2VSXA 3KJIA 3IKJA 1ZM4A 2ZIAA 1CR1A 2BCGY 3SJAA 221PA 4C2TA 5TMPA 4DLVA 3AKCA 4EFNA 5EE0A 5KSZA 3AQ4A 5SZHB 5CK4A 2O8DA 1KMHB 2J46A 4TLEA 1E9RA 1IHUA 2QMOA 2F55A 4JLNA 2W0MA 1VMAA 1NY5A 2Q3FA 4KVAA 4DSNA 1VYUA 4LV5B 2QBYA 1E9AA 2FF7A 3QUSA 2F43B 2MSCB 2VYFA 2GCOA 3X1ZA 1DPFA 5KNBA 2FV8A 2MMCA 4JLBA 2QE7D 3N2IA 2FMXA 3EZ6A 3TRFA 1OT3A 2FSFA 2J87A 4GZLA 1ELOA 1KI2A 2CJWB 4PQRA 4Q4LA 3WP0A 3O8CA 3EARA 4IHQA 1ZINA 2ZSFA 3FB4A 1T91A 3F8TA 3Q3JB 3QF4B 3RWOA 2VO1A 3C16C 2EYQA 2QROA 3OEHD 2LKDA 4QBHA 2DFLA 2F1JA 5E7IA 5FOSA 1K8RA 4KV9A 3T34A 4L9SA 3BK7A 3SFVA 1W36D 2ZE8A 1E4YA 2GZDA 4B3CA 4DDUA 1WA5A 5L3RA 4DRZA 1W0JD 1FP6A 2HV8A 2R6GA 3MCAA 4DVGA 5EZ6B 1ZYUA 2C9OA 3BOSA 4DT1B 1AIPA 3UWKA 2CNWD 4E5UA 4W5WA 4EQ6A 1LVGA 1TNDA 1D8TA 3GLIA 4LJ7A 2ZI5A 1XD8A 4FN5A 1OSNA 3AEZA 2PZEA 2V7QA 3HPQA 1XCGB 3JZAA 4M1YA 3VQTA 1EWQA 1Z6AA 4JVMA 1U2RA 2OFXA 2O0JA 4KSBA 1OXVA 1U9IA 5K8IA 2Q9AA 4NHOA 3WBJA 3W5JA 2WICA 3BC1A 1JJVA 1US8B 3JZMA 1FPMA 1JR3E 3LXRA 4XOIA 5AUQA 3FKSD 1JXMA 4XWOA 1NIPA 4HB3A 1N6PA 1G6HA 3IEUA 3TSWA 4Q02A 1G4AE 4TLDA 1JAHA 3AP2A 4GNKA 1HQCA 4KLNA 3I5XA 3R7WB 1UKZA 4PHTA 3GJ8A 4LPKA 3QVUA 1Z0DA 2OZEA 4KFTA 4WA7A 1C1YA 1C4OA 1SKYE 1PLJA 4ZO4A 1IQPA 2ORVA 2PZGA 3I4LA 2WM9B 4U5XA 5M04A 5FFMA 1OHHA 4HUTA 3SQXA 2X19A 2JEOA 5D3QA 1E2KA 4A2WA 1S9HA 4BLPA 1OIWA 3OE7A 4Q4AA 1FL9A 2WVJA 3FMPB 3EZ2A 2GTPA 4QGHA 5HPYB 4DSOA 2NG1A 5TARA 2HT1A 3KKPA 3TAHA 1R7RA 1JAIA 4PC1A 4R71A 2WWFA 1R0ZA 3EXAA 4LUCA 1VG1A 1YZNA 2VP4A 5DHFA 3V4FA 1XXHE 2VP6A 3HYTA 1XJCA 1VIAA 2AHOA 1NVWQ 3MRSA 3TUZC 5TB5A 3TAUA 2YOFA 5LDDC 2XSZD 2IYWA 4IVPA 4OK3A 3IPYA 2V8OA 3QENA 5KO2A 3CX6A 3L0PA 2BM0A 4C30A 4DIDA 4NZYA 1E9EA 3BB3A 1RZ3A 4A0FA 1BMFD 3O47A 2YWHA 2ERYA 2WWXA 4JLDA 3OIWA 1NBMD 3KJEA 5FTJA 1Q12A 2E1RA 1P7CA 4TMWA 4HI0E 3VKGA 2O8EA 2GEVA 4NONA 1D9ZA 3ZQJA 5CDFE 4D26A 2CCGA 1RC8A 1NVXQ 3FVQA 2IW3A 1DBSA 1QHNA 3MUFA 4BLQA 4FWIB 3PUWA 1COWA 1Z6GA 3FYHA 2E9SA 1OLOA 5DHAA 3NH9A 1IJFA 3L0IB 1XMSA 4L8GA 2GRJA 3EAQA 4GT1A 5GJVC 1TEXA 1R4AA 5E95A 4KBFA 4NYMQ 2BIFA 1M8PA 5FPHA 2B7BA 5FBLB 2ZYTX 1KI6B 2H17A 1W44A 1MABA 4OHWA 2QSZA 1J8YF 3K9NA 1DADA 1HURA 1DO2A 3VKWA 4AY2A 3ZQ6A 2ODEA 1AKEA 1CJTC 3NBYC 1OXTA 3QE0A 1Y3AA 4URXR 1KSGA 1XPOA 2FPKA 4OHZA 3MG9A 1T3SA 3SFZA 1CP2A 2REOA 3AM1A 4RZUA 3LV8A 3K0FA 3W6PA 1Z2CA 2O8CA 4P3YA 3C7KA 2O52A 2WMNB 4ZI3A 1CBUA 1M2OB 3EZFA 4M53A 1QHSA 1RPZA 1ZNZA 4RFSB 4IFEA 4G5QA 3LQRA 5EJEA 4K46A 5EUMA 4AC9A 2ZJ8A 4AG6A 4C2UA 4Q00A 2F3RA 4BEJA 1MR3F 2CVHA 4Q9JA 1Z63A 3KKMA 3MFYA 3NEJA 4RFVA 4A8JC 4A82A 4F92B 2ZJBA 5EP2A 3B1XA 3B78A 1YRBA 1MT0A 2ECKA 1ZIPA 5HE9A 4Q7JB 3LO5A 3B82A 3DDCA 1WDTA 1W36C 1TF5A 2GF9A 1OH7A 2P5TB 1CR2A 1JB1A 4CEJB 2ZI9A 4IOJA 1RJ9B 2JLRA 2J1LA 1Z0FA 1ZAKA 1F2UB 2P3SA 1W2GA 3H84A 2GXAA 3AP1A 5JSZA 1XMJA 1T9HA 2RGAA 4TL8A 1QG4A 1Z6TA 2QRZA 4BZPA 5HZHA 2V4ZA 2W00A 1EWRA 2J5XA 2RGXA 4G0NA 2RGBA 4P4UA 2N46A 2V6IA 5JECA 4WBSA 1Z47A 2CLDX 4PAQA 2KI5A 4LYFA 3MJHA 2EFCB 5AJVB 2FOLA 3F3YA 2WWWA 4DCNA 3ZVNA 5B57C 1BH2A 4PQYA 3W6OA 1TAGA 2AWOA 4G5OA 4M21A 2F9MA 4O2LA 4RKEA 2Q21A 2ZRNA 2VF8A 1EK0A 2BOVA 4XSGA 2G3YA 1G3IA 5C4GB 4DEXA 5DI3A 4OI1A 4F38A 2EYUA 3T61A 5E4FA 1E94E 4DDVA 4HUQB 4FWTA 4M9QA 1Z6YA 1KHTA 4RY2A 1P3JA 1QHHA 2XNSA 3CF2A 3X1YA 3NG1A 1SVKA 3W5IA 3VR3A 5J40A 4CEIA 4E03A 4AYXA 5HR5A 5A4JA 1G5PA 3EPJA 3VU9B 2XEXA 4RJLA 4II7A 4RKFA 4LJAA 2QMEA 3I5YA 2B6HA 2KBFA 1VCIA 1ZCBA 3F5FA 4JVLA 3CF6R 1KI9A 4M1WA 4A4DA 2FWRA 1MO5A 2QL6A 4TZ0A 3WHKA 5H68A 3AVXA 2GVDC 1SVSA 4I1OA 3DOEA 1NKTA 3AVYA 1AN0A 2B7CA 2IXGA 5DIFA 1KI1A 1AQUA 4C7OA 2CK3A 1I4LD 5KNDA 1KK0A 3A1UA 2P5SA 2HF9A 2UZIR 1EFCA 3BFXA 5IDVA 1XD2A 1TMKA 4QGGA 1P6XA 3K0AB 4P4SA 3LFUA 1ZC4A 2OCPA 3NXSA 4YMTA 5KNCA 5DISB 2EFEB 2ZITA 1XDBA 3KKOA 4Q4HA 3DKVA 5FUYA 2GF0A 4XH9B 3U3RA 2DWPA 5FPYA 3ZD7A 4C0SA 4R7ZA 2W6JA 3KJGA 4ESVA 3KQLA 3RYTC 4G5GA 1E1RD 2QN6A 2V55B 4DIEA 1VYTA 4V0MA 4DCVA 5JS7A 2C9YA 1J7KA 1JI0A 2ZUCA 1T8UA 4M1KA 4EPRA 2JATA 2ZM5A 2BHRA 2ZE7A 2W6IA 1U99A 2CDNA 5SZJA 4AKHA 1P2TA 3SOPA 1O87A 1YKSA 2GA8A 3GLFE 4R98A 1CU1A 1Q21A 3MAAC 4QG7A 4DC9A 2JLZA 4Z1MA 5CYOA 1RIFA 3QG5A 1NBME 1W0KA 1OIVA 4IVQA 3SBDA 5J4LA 3WYGA 4KBGA 1T5IA 2A78A 4Q03A 2WKQA 4HAZA 2EFGA 4Q4JB 4DLSA 1Z83A 4EKDA 1GWNA 3QBTA 4KHZA 3OIVA 1QHIA 3I32A 1JPJA 2PH1A 3KB1A 1OKKA 4LJYA 4B76A 1Z06A 2IS2A 3U44B 3WNBA 5EXTA 3GP8A 2VP0A 3SYNA 5IK2D 2DY1A 1VHTA 1E79D 1A2KC 1GRQA 3RC3A 1ZU5A 4UNNA 3P4XA 1CLUA 3VX4A 1EX6A 3VHXA 4TTPA 4Q1BA 2RHMA 1XZPA 4IEIA 3RRNA 1XTJA 3UMSA 1XP8A 5FTNA 1U98A 4R2IA 2RGCA 1Z0JA 3NKVA 5J4YA 5JHGB 1N5IA 1CJVC 2AKYA 3PIRA 5BW8A 4AK9A 2ZJ2A 2G83A 2C8VA 4ASUA 1GDDA 2BBSA 3D3QA 1KAOA 1OF1A 3CRQA 3I3SR 1NN0A 2ZJOA 1CJMA 1AS0A 2IA5A 2WZQA 1ZUIA 2G9NA 4TMZA 1E0KA 2RH5A 4LJ8A 1Q1EA 1DAGA 4OI4A 3I92A 4PC6A 3SNHA 4F4JA 1II9A 2WKRA 1GRNA 2ZRJA 2CE2X 2K5UA 4NL4H 1XEFA 3TR0A 3BXZA 2GDJA 2EFHB 3LLUA 3W90A 4CEHB 3B1YA 3G0HA 4YMSA 1G7TA 1K5DA 4AIIA 3FDIA 4YDSA 1FMLA 1N6IA 1SZPA 2Q3HA 3FMFA 1Q3HA 4JLAA 5C1BA 3AF0A 1YJ5A 4MITA 1YU9A 2XNDA 5HKKD 3A8TA 2CLSA 3A1WA 2JLXA 5DO9A 2W83A 4FINA 3MJRA 4YXWA 4NH0A 3RSLA 2OBMA 3FOZA 1NMXA 1CIPA 4TZ6A 1JEDA 2A3RA 2EFDB 1OB2A 3DPUA 2GVZC 4OK5A 4GOJA 1VG8A 2FGJA 1HV8A 3IBGA 3PUZA 4BASA 1WQ1R 1KDPA 1BKDR 4ZIRA 2IYUA 2WIBA 3DHWC 3L8ZA 2AL7A 5FPSA 3QXSA 4UNPA 4A6PA 1LS6A 4G5SA 2V54A 5EQTA 4PZZA 1XEXB 1TPZA 1EFRA 1D5CA 1Z6XA 3GJ4A 5DI9A 521PA 2ANCA 4F93B 3O8RA 1IBRA 1KKLA 1N0VC 3A4NA 2NPFA 4EJSB 3P26A 4IXMA 1NLZA 3BE4A 1DAFA 4XTCS 1XU4A 3OFNA 3VR4A 1IN7A 1N5JA 5CYPA 2BKEA 3UANA 4QKQA 4R2HA 2ZI6A 4B33A 3HU2A 1RRCA 4NYMR 3AB3A 1N6RA 3VFDA 5H1YA 1N5KA 2VSFA 5CLQA 4RVCA 3T5GA 2PEZA 4E07A 3NBXX 3M1IA 2GCNA 4DJTA 2W0SA 3IIMA 4Q18A 4PPNA 2QM8A 2J0UB 2AK2A 4B3BA 5E3HA 2IF0A 2ZUDA 1F6BA 1SGWA 3T1TA 3FFBA 3CRRA 3S1AA 5HTKA 1TF7A 3NBFA 2FDCA 5JWRA 4HAXA 1FFHA 4LZZA 5DN6A 2JCSA 1ZD8A 5ANRB 1RRFA 1ZBDA 2FPMA 1R8SA 3KJHA 1OFTA 5KOYA 4BFSA 2O8DB 2X8AA 3N70A 5K8LA 2DR3A 2GWHA 5FI0B 1GKYA 1H65A 2JJ2A 1LW7A 2D74A 4CF7A 2QA5A 2OUKA 2AFHE 4J0QA 2GCOB 4HLUA 3DM9B 1YZQA 2WPDD 4Q9KA 2ZR0A 2XJ9A 3TQFA 4NCKA 2F1IA 4M9ZA 2GILA 4MGYR 2P67A 5SZIA 2ANBA 2GNOA 2AD1A 3KX2A 5FL3A 3K53A 1HT1E 1QVRA 4O25A 4JLVA 821PA 2OT3B 4FD2A 4F91B 4D82A 2FFQA 4LYAA 2HCBA 3EWAA 4UXJA 2ZSDA 2WBLC 3QPVA 1KO1A 4CT5A 1N6OA 4A0GA 2Z6VA 4URVR 3LX5A 3CW2A 1TUEA 1ZIOA 3G5UA 3CKLA 4LSGA 4C0BA 3AUYA 3RS2A 2BWJA 2KBEA 4ON9A 4MYHA 4KAXA 2ZAOA 3Q72A 2VLIA 2NTYC 5P21A 3SHFA 4EQ6B 1XNJA 1E2FA 3REGA 3GLIB 1DE0A 3U3OA 3AP3A 1R2QA 1KIMA 2R6FA 2ZYWX 4D81A 1VCNA 2JASA 4BFUA 5DNYB 3X1WA 3CB4A 3R8CA 4OJKA 2GEUA 3PEUA 1FNNA 3B8HA 1SXJD 3T5DA 1ZP6A 2QPTA 4DLZA 1JR3A 1U8AA 1UEIA 4C0KA 2B21A 3VR5A 1HH4A 3FWYA 4UNQA 4IDOA 4HDCA 4KCGA 2H92A 3QJYA 3PEWA 1WCV1 1N25A 2D2EA 4QHSA 5J4HA 3IDQA 2JLSA 2RAPA 2W2XA 3GEEA 4UNRA 2CVFA 3AUXA 2W58A 2JIZD 1FX0A 3EG5A 4QBIA 4TMKA 5EP1A 3SYLA 2ZE6A 4GBMA 1XEWY 5TY0A 2VIIA 3GFOA 2YINC 2IUSA 3U7FB 3ND9A 4TSFD 1KYIA 4Q1DA 3GFTA 2H1LA 3PUXA 4TT3D 4TMVA 1VCMA 4OL0A 3NC0C 3CH5A 4N0EA 1VG9B 3M4YA 1JXOA 1GNQA 4XVUA 2OXRA 4ITRC 4PQFA 4AG5A 1DAKA 3L0OA 4L15A 2HT6A 2J59A 3CH4B 4BEBA 2XGJA 5JEEA 2OCAA 1N6HA 1DARA 2IYVA 2YKGA 1SKQA 3EA5A 3PV0A 1Z8FA 2CL0X 4V0LA 4HZUA 5L3QB 1PV4A 2DWQA 3NDPA 3TE6A 1ETUA 1XXHA 5AUPB 2PCJA 1NN3A 4ERNA 4MKIA 2HJGA 3QSYA 3THYA 3GMTA 2LCFA 3OEED 2GESA 1W4BA 1UBGA 3UMFA 1AJEA 1Z2AA 5UKDA 1SVMA 1NRJB 2RKOA 4MH0R 2RB4A 1OJLA 4Q1EA 3RS0A 2C95A 4NCIA 2QT1A 4B35A 3P32A 4Z54A 621PA 3CNLA 4A9AA 4OHVA 1MRSA 4QL3A 2QAGC 3FHCB 2OBLA 1QDEA 3RS4A 5F3WB 2IS6A 3FHTA 3GLHA 5CDFA 1A2BA 1V43A 1OH8A 1GITA 2TMKA 3B6EA 2O8EB 2WJHA 4PPFA 1R10A 4XD7D 5TDHA 2QPOA 3RSOA 3ZZTA 3SE0A 3ZYCA 4UXIA 3NEYA 3SI7A 2ZS8A 1XTKA 3GQBA 2ONJA 5LB4A 4OBEA 4BFWA 2XZOA 4L5BA 2A7QA 4A15A 3LDAA 1FZQA 4FCVA 3AVWA 4OK6A 2BMJA 3ZJYA 4QJ4A 1NLFA 2FSHA 3JVVA 4YQFA 4PC3A 1NI3A 2QT0A 5C2JB 1JJ7A 3DZ8A 4GP7A 2RMKA 2VQSA 4GI7A 2FJUA 3KQHA 1EFUA 3UMRA 3B5JA 2B92A 1ZM9A 1MABB 2I3BA 2RGDA 1ZC3A 1H8HD 2VP9A 2WIAA 3K9GA 4WAUA 5CIQA 3J81k 3IIJA 4Q47A 2QTHA 2QUZA 3KB2A 4N3NA 1EGAA 3GJXC 1ZCAA 2VPPA 2ZRKA 4W9MC 4Q19A 1I2DA 3K70B 4DSUA 3T12A 3Q7QA 5BYKA 1E3MA 5JHHB 2UVQA 3K0FB 3ZIAD 1CEEA 2BBTA 5FBRB 3SQWA 2O8CB 3UXMA 1HY3A 3AVVA 1DO0A 2R9VA 4HB4A 4B44A 4A1FA 1M34E 4QJ5A 4NU0A 4UNSA 3BD9A 4WZ6A 4LHVA 2JLUA 3TW4A 1QHXA 3FKQA 3A37A 1I4TD 5EXSA 5B58C 1Z08A 3QG1A 2OAQ1 2XJ4A 1TX4B 5G3YA 3RAPR 4OQNA 4X8LA 3B9PA 1OIXA 2F1RA 3AF3A 4B32A 2ZYUX 2ZRDA 1VHLA 2NPIA 2WSMA 4M4SA 4NYIR 3GJ6A 1N6KA 1KSFX 1ZUNB 3BH7A 3DOFA 3C15C 2QE7A 1ZW6A 2YC2C 5G40A 5JSZB 2QNRA 4IXNA 3KXLA 2J3EA 3RANA 2R6CA 5EZ5A 4MGIR 2ZREA 1NMYA 4C0HA 2GK6A 4WVFA 2J41A 4AYWA 3TQCA 1Z07A 4A2PA 4A8JA 1SXJC 3EIQA 1W49A 3LVQE 1JEEA 4D80A 3K70D 3IPXA 3OEHA 4D4JA 3BORA 1KNXA 5EXXA 3U4QA 4MRVA 3WYFA 3O8DA 4NCHA 3WP1B 1IM2A 2OM2A 4DLWA 1XPRA 4RD0A 4CYMA 3FHOA 1NMZA 1W0JA 2H7VA 3MLEA 4Q7MB 1GTVA 1KO7A 4E22A 1VKJA 5KU1A 2MSEB 2Q0HA 3MMPA 2HCJB 2VBCA 2C77A 4FI3C 4TQUS 2ODWA 1W5TA 2CNWA 1KOFA 4IVRA 4PHFA 1H8ED 5FOUA 1KMHA 1PZNA 1KI3A 2D2FA 1R5OA 2ZQ5A 4L4UA 4BZQA 4RZ3A 5BN5A 1YVDA 1QHHB 4PO8A 2NQ2C 4KXFB 1U0HC 4LHXA 4AKEA 4C0LA 1NJFA 1QVAA 4MGKR 3VKHA 4CEIB 3DKPA 5FTKA 2CCJA 4M9SA 4O0MA 1G41A 1BS1A 1FNMA 1SXJE 1YZGA 2XTMA 1FOEB 1GSIA 2ZI4A 1LFDB 3NIBA 2NO1A 5FI1B 3DZDA 5EE5B 3FKSA 4HEJA 2CJWA 4HAWA 3THOA 1F48A 1S3GA 3CF0A 4PFSA 4MA4A 1ZM2A 1S0UA 4DWJA 3ADCA 2YNMA 5JMTA 1UBEA 1TL7C 2NO7A 3U7HB 3U7GA 1R5BA 1E69A 2J9RA 3QF4A 4I81A 4RCZA 4EDHA 1T4GA 3QQ5A 1ZD9A 4B48A 2OLKA 3SC3A 3QVVA 4MKFA 4TLBA 1UADA 1GL9B 2AXNA 4C7OB 2JLWA 4DLUA 4QOSA 2FEOA 4QNRA 3PR1A 3TSZA 4POAA 2OLJA 1XD2B 2ONKA 2QMUA 1KJYA 421PA 2FFAA 4PO9A 3HPRA 4P31A 4P4SB 2VRWA 2AR7A 4FCWA 3KQKA 2AKAB 1MOZA 2ZRIA 2J7PD 3V4RA 2JAQA 4Q9LA 4Q4HB 4GOKA 5LD2B 2Q6TA 3OZXA 1GOTA 2ZSBA 2UZ3A 4QBFA 1W4CA 4K81B 4U02A 5G41A 3SHWA 2IEYA 1D2EA 2GXUA 4XVQA 3SJCA 3W3ZB 5JBQA 4FW9A 3QEJA 4LBZA 2XSZA 3RRZA 2IYXA 5KSYA 2QENA 5D3MB 1E0JA 3CRMA 1HYQA 2XZPA 1FQJA 4HB0A 1HE8B 3IEVA 1JR6A 5FBQB 4QGFA 3GLFA 2PT5A 2XX3A 1BMFA 4C0JA 1E0AA 2XB4A 4UJ5A 5LB2A 1NBMA 5FTMA 5K8UA 4V0NA 1G8GA 3TW8B 3WBKA 2H8KA 2FG5A 2X2FA 1JECA 2GK7A 1U94A 3CO5A 2NO0A 1Q0UA 1X86B 3BIFA 3EA0A 3TJZA 4LJ9A 4G5RA 1E1QD 1VG0B 2R44A 3P27A 4M1OA 1DELA 1Z0AA 2NIPA 5FL7D 4A2QA 4LDJA 1E9FA 3QXCA 2BMFA 1HT2E 4MYTA 1V5WA 3NHBA 4QC2A 4RD6A 3KXKA 1OXUA 3BWDD 1W4RA 4RD2A 2FFHA 5L3SA 4C3ZA 2GETA 3A36A 2ZR9A 3IO5A 2IF2A 1WMSA 2BCJQ 4BLSA 4IDPA 3R9IA 1QRAA 3WYAA 3X2SA 3AH8A 5EP4A 4YMUA 4PANA 2LWIA 1YZUA 2A9KA 4JIMA 4S35A 5JI3E 3EPHA 1OH5A 2W2VA 3R9XA 1NVVR 1Q57A 1XCMA 1AGPA 1CR4A 1XBTA 4DUGD 2QGNA 2IWHA 3QXJA 1HTWA 4QNMA 2GZAA 1XTQA 2IUUA 2BBWA 2GKSA 4PSKA 4LGMA 4EIWA 4LY6A 2G77B 2JLYA 1RFLA 3VAAA 3BS4A 1VCOA 1GRRA 2XOKD 1LTQA 2IT1A 3TH5A 2FGKA 2HJVA 4EUNA 3L2OB 5AUOB 1S2MA 3I1FA 2IEZA 1UAAA 2JLQA 3CIOA 4DLYA 4ZDJA 4OQXA 2FNAA 1E2EA 1Q22A 5BN3A 1KZ7B 1LY1A 1P75A 2B8WA 3V9PA 5EE1A 2R62A 1GNPA 1Q20A 4ACBA 2BEKA 3X1XA 3MWYW 1GFIA 1Q1QA 4M22A 2XXAA 5TV2A 4NP6A 1ZNYA 1GZSA 3BRWD 3TMKA 1KDRA 3CX8A 4F4IA 1D2NA 2DFNA 2ZRMA 3GEHA 3GJ7A 4M1MA 3CRW1 3THXB 4NMMA 3RS3A 2O8BA 1MO4A 5CB6A 1CKEA 4CRWB 1YZKA 4ACAA 4Q9HA 1XF9A 2JJ1D 4LJ4A 1E0SA 1GL7A 2C2HA 4FMBB 2AD5A 3EX7C 4MRPA 3FPAA 2VSOA 4Q7LA 3T1QA 4JL6A 4Q01A 3CNOA 1OXXK 3MWLA 4FMDF 2IS1A 3VR6A 3TSOA 1MKYA 4DXAA 2PX3A 1ODFA
chains in the Genus database with same CATH superfamily
3WGLA 3ZBTA 1GUAA 3KUCA 2WZDA 2Z5FA 3GVPA 4IJQA 3CONA 3QGMA 1WNFA 2JIPA 4ZYUA 1DCMA 4A27A 2P6NA 1WXQA 4NBRA 5JY1A 2AJTA 4MVCA 1PNQA 5E2AA 4H3VA 3OF5A 2EKPA 5TXGA 1J42A 1W47A 3QV2A 3WJ7A 2ONZA 3BGIA 2V6FA 1ADFA 3N2GB 5H3HA 3D3JA 1U0FA 4AYTA 2YV2A 3JWPA 3ACDA 2AB0A 4ZDWA 1AGNA 2JAWA 1J99A 3KLNA 3OAAD 3B9RA 5MHTA 2FETA 1VKHA 2R6R1 3Q3VA 3G8AA 3ZWAA 3D3KA 3CKKA 2JAOA 3KT6A 4WT7A 3MWJA 3Q41A 1AS3A 4NBUA 4OB6A 4I99A 4S1WA 2NU8B 4IH4A 5GAJA 3PUJA 1Q3TA 1UMDB 3VVMA 4BNTA 1J21A 4YRSA 3EEYA 4BP3A 4DSZA 1WB5A 1RRMA 1Z0KA 2RHGB 2WHYA 2Z3WA 3HJRA 3HSKA 5DHRA 1QF7A 1ZA1A 5DWVA 4C5CA 5TEVA 2GJSA 1B41A 1SQ5A 1W30A 2VJQA 2ZVJA 1S2NA 5AYVA 3GEGA 5CVUA 4BWVA 1Y6QA 1IC6A 3I9NA 3Q8XB 5AHRA 4POOA 1AE1A 5I4IA 2WAYA 3AONB 5KWJA 1N3IA 2Q1YA 1UBFA 3BIXA 4GD3Q 4ZAWA 7MHTA 3FVVA 2BM1A 1PS9A 1UXIA 1BRMA 1N0UA 2X2EA 3BMCA 5IEBA 3WK7A 3HU5A 1KQFA 4GXTA 4EY6A 3N59A 3OU2A 1QZUA 3C1UA 1H66A 1JWBB 1QNLA 1T8TA 4NG5A 1OXKB 1PR4A 1XEAA 1PW5A 3NHSA 4X8MA 1HLFA 3N8GA 1E5TA 5HF9A 2PX2A 1KZGB 4LK2A 4DGQA 5BW5A 4M36A 1H6CA 3IC5A 4EMUA 1Z26A 2Q1SA 2ZUWA 3GCDA 4P8RA 1DJQA 3DE3X 4HUQA 2NU9A 4BZXA 2PLFA 2G1JA 3RLFA 1N9GB 1V8OA 2FX3A 1I01A 1SIUA 3BMQA 3LLSA 4IOKA 3EZ7A 4IDQA 3D0KA 1PJCA 1GQSA 1PDVA 1T6NA 3R76A 2P91A 3WTBA 1YBHA 4CMAA 3AUFA 4DDTA 4V1CB 1YA6A 1C41A 2Q4BA 5FOWA 1LNSA 1NF9A 1U0TA 2FMUA 4D3SA 3C5VA 1B3BA 2IY7A 2QJFA 2ZFUA 4M9RA 4WSOA 4ALJA 4OQFA 2G08A 3E53A 3NUGA 5DLDA 2PUAA 3AYXB 1E1RA 3EXFB 3K9CA 1NJGA 2I6QA 2GNPA 4X8HA 3TKYA 2ZBQA 3CZRA 3VYVA 3UXYA 4EGCB 4AQ7A 4EPYA 4A91A 4EFMA 1R9GA 3SQMA 3H0CA 5IKEA 4FDAA 1TAUA 7ADHA 5DOVA 2ZBFA 1E2QA 1GZ7A 1QANA 2QP3A 4X7PA 3FSRA 5DJ5A 4HGNA 4DV0B 2AC4A 4K9KA 4Z4EA 3U3XA 4BNGA 1K7EB 2AOXA 2ISSD 2A9OA 1M0SA 2OFOA 3NHAA 2JH8A 4HADA 2VXCA 1MO2A 3L49A 4YO8A 3IKLA 4RYDA 5HA5A 4YP7A 2X6TA 3H9QA 4MQ5A 3P4YA 4NY1A 3AWIA 5J5AA 5TNXA 4RPCA 3UHOA 3T4XA 3AESA 2AG1A 2H59A 3N5CA 5DKFA 3T3IA 1IM8A 1P6QA 1M66A 1P9NA 4U2EA 4F45A 4BAUA 1CUGA 1F60A 4AD8A 1IY2A 3AKDA 3BL8A 1THZA 1MB0A 4K6GA 1UDRA 3M5PA 4G9EA 4I4LA 1R5NA 2HF8A 4YP9A 1B0ZA 2E82A 3M70A 1G7RA 3CC8A 5CG2A 2ZJ3A 3MWKA 2WYHA 4MUKA 4MO9A 4C0QC 2IXBA 3TFQA 1T26A 2JKYA 4TQAA 4BLVA 1BW9B 2EF0A 2NO6A 3QSGA 4G4IA 5IK2A 4WJZA 2YTZA 3MJEA 2A59A 1O89A 2CSUA 5IVIA 2AF4C 4MIYA 4FC6A 1A9XA 1P1RA 2WMOB 2WKSA 4DZTA 3HMKA 2OCYC 2PT9A 4HTFB 2YFQA 3I8XA 8OHMA 4F9GA 4HWSA 4LEIA 1LNQA 1UPTA 1FE8A 2H1IA 1O4VA 2Z8ZA 1YJCA 2CMGA 4EB6A 5A3QA 1MV8A 3LT0A 3E3OA 1NQVA 5KX5A 1L4NA 3SHTA 4MS3A 2P9CA 5A0FA 2YOGA 4V0ME 3HVUA 2C5SA 5ALOA 1AOXA 2WSSD 5I9NA 2EKLA 3BEDA 4UCFA 4QUEA 2W93A 5HK8A 1LCIA 3GRUA 2G5GX 1N0WA 8LDHA 3TKLA 2C1EA 1VSVA 5KVQA 4CNBA 1MRZA 2E3JA 3A11A 4L07A 2M32A 3Q6IA 5JPDA 3MAGA 3TKAA 4ZYXA 4FMDB 1JRLA 2OZPA 1W2HA 3KNZA 3OZVA 4I9HA 4TYYA 1QOZA 1WPXA 2R1TA 2RAUA 4GPAA 5E0OA 5E8RA 1YB7A 3LLCA 2C7VA 3KZVA 5G1NA 5G4KB 3LZ6A 3ZBPA 2Z83A 3L8YA 4RPGA 1T6BY 2W37A 3OOSA 1J20A 1F9AA 1TU4A 3ZNPA 4Y2RA 1N2HA 2JDID 1IXRC 5HW0A 1IN8A 1VI6A 2W2MA 4RWZA 4UC0A 5KKNB 1AKYA 2DERA 3IE0A 1X1RA 4Q16A 1WKVA 3BDIA 1WP9A 2XMCA 2ZROA 2J08A 1Y42X 4YAUA 5DBOA 3PVSA 1FMFA 3BE6A 5I51A 1N3LA 4I5GA 5GJWC 3RF7A 2XQGA 4AZVA 1B1CA 1GTZA 3K20A 5JWHA 4CL0A 1E99A 1RBQA 3OIYA 4IUDS 4CIVA 3COJA 1RWPA 1DTEA 4JEHA 4NOKA 2UYQA 4DCTA 2IZ0A 5ER6A 4BC1A 1QSGA 3UJ7A 1E9BA 2JK1A 1G8YA 2QTZA 4I6EA 1W76A 2ATVA 2VCHA 1OV6A 1A88A 3GB9A 2WT4A 3GGJA 1HO3A 3UYKA 3ER6A 1INLA 2JI4A 1L7VC 4TWZA 2BGJA 1KI4A 4GM1A 2RCYA 1GKIA 2I4NA 5E9AA 3R7LA 3R9KA 1VE9A 1MC1A 3USCS 3RBVA 4OXKA 3RKUA 1P7VA 3THWA 4JLJA 4XLLA 1H2AS 1EXDA 1GZ4A 1G38A 2R2AA 4LI0A 4IUBS 1ZH2A 3O8NA 3JYPA 2LCQA 4RJIA 3NC1C 1L4FA 1DEAA 1TU3A 2OLEA 1SWWA 3H1EA 3M4ZA 2P1RA 2FKNA 1CX9B 1G9SA 1P2BA 2G17A 3D6JA 4WK2B 1JHUA 4EG8A 2ZETA 4S05A 1E9SA 3WIBA 2PLAA 2V3WA 4UE2A 2QVYX 1TK3A 2W6CX 5HDBB 4YPVA 2YBEA 2Y93A 3CUWA 2OXFA 1A5TA 2RHHA 1O95A 1NJ1A 1WF6A 3PC6A 4ZI7B 1NDHA 3OD5A 1DV2A 1G8PA 1M8FA 2G6BA 3FGNA 2WUFA 1ZMBA 3IIIA 3N58A 4KQJA 2DHRA 4PSUA 4RX1A 5BQ5A 1U1EA 1UWKA 1XLVA 3IQZA 3DM5A 2ZRCA 1GZVA 1M34A 4INJA 4D8VA 5ELXA 1NQ5A 3T3GA 2PR2A 2HAEA 1NPTO 1JQLB 1PJ4A 1C4WA 1QFXA 3L1UA 4N5IX 4ENPA 4DWVA 3AEYA 2AXEA 3VISA 2BKVA 4YCCA 1OB5A 3FR7A 3PX3A 4RIHA 2GJKA 2XMPA 1TRHA 4OSPA 4P4LA 1RXIA 2CXQA 2IYSA 3OLQA 1EFTA 3UMGA 4DNXA 5BMVB 2UXBB 1EEXB 2P3LA 4M9XA 4P5DA 4NCAA 2VJMB 1QV9A 4HNRA 5ES3A 3WI7A 2DAPA 2G7ZA 2VP5A 4PRYA 3A9UA 4BWFB 3E7XA 2DT5A 2QW0X 1KEPA 4H0CA 3CPJB 4AKIA 4YREA 4JZKA 1V95A 2DYKA 3NFRA 3DEZA 2IOFK 1CJSA 3JW8A 4A6EA 4ETNA 1LVUA 1ZLYA 4PFQA 1QFYA 1UP7A 4LAFA 2B83A 4GH5A 4F5EA 1YVRA 2PSEA 3F4KA 3AHHA 1N36B 5FPTA 4G0MA 3WJAA 3C85A 4YRMA 1DOAA 1ZCZA 4MLZA 5FF9A 1Y89A 2QDKA 5AK4A 1YQDA 2R6DA 4IKEA 5DHQA 3V7YA 1TLTA 3B48A 4ARAA 2H9IA 3RDPA 4B3XA 4U39A 3U19A 3M8KA 1IUNA 3U6KA 3AILA 4QBGB 1C8VB 1M7GA 5LWHA 4X90A 4HN9A 5CBPB 3A27A 2ZR8A 1RWBA 3F96A 4LRWA 4PZCA 5DYGA 3L7DA 4DIOA 3HP1A 1VFPA 1XHEA 2P2ZA 4FQ5A 2NO9A 5J63A 2W71A 4WWHA 2TSYB 2MCFA 4Y30A 2MOKA 1W36B 5KYWB 5HZGA 3ETEA 3UKOA 5L7WA 2FKAA 2JANA 4HWPA 2HSGA 1V9SA 1Y1KE 4H7IA 1WV1A 1T9KA 2BFMA 1BO6A 2GD2A 1XQ6A 1L5NA 5BV7A 1RP1A 5KYXB 1P72A 2JLBA 3MJ4A 3V42A 2CFIA 2DSNA 2W11A 4QD3A 3ESDA 1E2DA 3OQJA 3U4GA 1PUJA 3WMGA 1ES9A 4CKZA 2Y0CA 2ZS9A 4FFMA 2GRUA 4BFTA 4KPUA 2PFKA 3AETA 2PGLA 2YRXA 4EB3A 4L75A 4R6WA 3MD0A 3QPUA 1O95C 2GHIA 1AQYA 1Z34A 3OE7D 2I55A 2IYRA 3QPCA 5LNK6 1QTRA 3OCZA 4FPXA 1XA3A 4G97A 4JYBA 4BMSA 5LVAA 1UBNA 4KOAA 4AI6A 5BSUA 1I6MA 3PA8A 5BR7A 4RVHA 2R3SA 2HPAA 3G2KA 1BH6A 3C7TA 3LT1A 3NYIA 2WR8A 1M7HA 3IT1A 3RT9A 3VDMA 4K6FA 3VAZA 3CLVA 5LKAA 1W5SA 2EVWX 4MKGA 5BW6B 3HFSA 3PX7A 1Z68A 1N33B 2JIZA 4YALA 2GBFA 1WTCA 1V7CA 1E1YA 2HA3A 1QIDA 2R7LA 3H99A 2R60A 2P9JA 4LHYA 1FMJA 1K6XA 2X7XA 1Y9JA 3B60A 3M3PA 2BTQB 4GMGA 1L8QA 3LG2A 2IYFA 4O2BB 4XE5A 1GKKA 3GGSA 4YA6A 3ZWPA 3TJMA 3VH4A 5HRCA 3I83A 4U7FA 3TO5A 1PF7E 1IB6A 2BDUA 4Q7KA 3NATA 4AKGA 4X92A 4E5VA 1TCAA 1DEKA 1V71A 2YQ4A 3E9QA 4JIGA 5FOVA 2I1QA 1KZHA 1TUIA 5KQLA 2JJ8A 3N0RA 2O2CA 1DQZA 5TPWA 3U4AA 4WOBA 2B4TO 3ZUGA 4I1YA 1E9CA 1JHYA 3H7AA 2Q8QA 3TYXA 3O4HA 1GQRA 1RHUA 4P0TA 4MW9A 5EHNA 3EW9A 3OQNA 1R0KA 2J3IA 2EZ8A 3BJIC 3COVA 3TBFA 2CLMB 3TGLA 1G6OA 4B2LA 3ORFA 1BGVA 1NUSA 1A9TA 2GEDA 3AF2A 2V7UA 5ABPA 2I6TA 2QM0A 2CMKA 1FSSA 3P0IA 2W4QA 1E1CA 4RZXA 3KKNA 2PO5A 3DW3X 1HDCA 1TVCA 5DTRA 5BSHA 1JJFA 3RAJA 5AJWA 2YYAA 3DZGA 3MJSA 3TSCA 4Y1GA 4CU2A 4DYDA 4O8ZA 1CFZA 5AJUA 4M0FA 2J0VA 2NSDA 2OO7A 3F7MA 4QUBA 4Y18A 4L9AA 4QRIA 1HFEL 1QH0A 4B43A 1Y5IA 5HX7A 3NHPA 5GP1A 1V37A 4XOUA 3FTFA 1O94A 3MRVA 4F3NA 1DBPA 1BXRA 1SB9A 1X7XA 3PEYA 3ZCSA 5DWDA 1RC1A 4KFUA 2PQ0A 1CUHA 2VDKB 1PJTA 1Q0SA 3FBTA 1IZ8A 4ZYTA 3QELB 1ZISA 4PYJA 5KWIA 4BE7B 3FZNA 3KVOA 4JX8A 5BOSA 1DIBA 3GD5A 2ZGVA 1MO6A 1CQJA 3T1VA 2D7DA 1A2QA 3TZEA 1EZ1A 4QG3A 2ZCUA 3I9FA 3H11B 3VM6A 4YP5A 3IP3A 3LX8A 1JHQA 1VFNA 1XWFA 4XD7A 3WZ2A 5EE9A 3SBEA 3TNYA 5H8WA 4JBWA 1KARA 4ZAFA 3ECSA 2Q45A 4MIOA 4EO7A 4TM7A 1BJKA 1XU9A 3H18A 1DIOB 4WW0A 1BDJA 3C3WA 4DA7A 1TYCA 2OGUA 4FD3A 3Q9SA 3N8KA 5L3QA 4JMPA 3HFJA 4N47A 3T7IA 1U6JA 2JCGA 2ZYVX 3BICA 1T5BA 1J9GA 2YJ4A 4UZFA 5CW2A 2HSDA 1C9MA 1YSCA 2UU9B 3ZDFA 5BSVA 4Q66C 2R0QC 3NPMA 1SG0A 4CE6A 5A7FA 3C97A 1N2GA 3BMNA 1HDIA 2WWTA 1H8HA 3A0RB 2Z2XA 3DEKA 3IQEA 1BDHA 4YCMA 3PE6A 1ZJYA 4RHFA 1CEQA 3D43A 3I9MA 3PWKA 4CUKA 1EP2B 2WJYA 2QZ4A 1W52X 1P44A 2X5XA 4C76A 2OHOA 2BFBB 2F43A 5CVCA 3VPAA 3SQDA 3GVIA 5HF8A 1JDSA 5C8YA 9LDTA 1PZEA 3ZIAA 1D7AA 3LP6A 3O82A 5CT4A 4HXFB 1LTHR 3AIKA 1W9HA 3KDAA 2UUPA 3V8QA 4C5AA 2ZTHA 3C8HA 4KR6A 1E7MA 2ARKA 4M0DA 1DBWA 2WA1A 4GG1A 2PVSA 4YDHB 4PC7A 2V65A 4E08A 4Y6PA 1A9YA 3AFNA 1E89A 1YULA 2WKPA 4UNIA 2ZSEA 4EG3A 2Q4TA 2PL1A 4KRGA 4RNCA 5EPEA 2OV2A 3FROA 4DBLC 2B6NA 6Q21A 2CL6X 3HJNA 3WISA 1AM4D 1QMGA 1EK1A 1Y8QB 3WWEA 1PG5A 1RZRD 1O94C 2I1WA 3NETA 4MLDA 1NXSA 2OWDA 4G0WA 4INOA 3KR1A 3BWVA 3KYCB 1WKBA 4P33A 1QPBA 3IVCA 3CTMA 3P0EA 3DMNA 1T0JB 2XF2A 4I50B 4DV6B 2DC1A 1FP2A 1N2XA 4H3KB 4OBBA 3ZS8A 3HR7A 3A06A 1WD7A 4MA0A 4BYMA 5KX5F 3BH0A 3QIAA 2O8BB 4EM6A 2H2WA 2PX6A 4ZT5A 4JXZA 3GZJA 3V33A 1XYGA 3FMOB 1FXWA 1ULAA 1DB3A 1YR6A 3JASA 1C1XA 2GS9A 4X63A 5CVEA 1U7TA 3BE8A 1XWWA 2HQOA 3DOJA 4CL8A 3KB8A 3UHJA 5ED4A 3VC1A 2VHYA 4HHEA 5CYGA 1RD4A 3IA2A 2NUPB 4MI9A 3V3TA 5KDDA 1DKUA 1US8A 1O97D 2C2MA 2JBAA 2JGDB 1N75A 3NORA 4DKXA 3RRYA 4US2R 1EQ2A 1RPTA 4HEHA 1KY5A 2PZKA 1QH1A 4MGZR 2XGMA 4B31A 2OQ2A 1G98A 3QFRA 4R1LA 4BJ5A 3QF7A 4PG5A 5H83A 3WWPA 2PLNA 3B12A 1UC5B 2VRCD 3OCUA 4QU5A 1VLJA 1NL3A 5JQWA 3KTDA 1RXVA 1JIIA 3CVJA 1KYXA 4JJ6A 4OLBA 3GW8A 4XM2A 1QS0B 1QH9A 4BX3A 3HCWA 4LYJA 1PT5A 2WWHA 4C5BA 5DZSA 3JY6A 4QPCA 2OQIA 1AZTA 5EUQB 1A5ZA 5IXSA 4ND8B 4W5HA 2RHRA 2PUCA 1RI2A 5E7JA 3TOZA 5KNDD 4U7PB 1CPYA 3SF8B 1A7UA 1TW3A 4P92A 2DBVO 2PX0A 4Q48A 1E7RA 3OX1A 3SEZA 2QD1A 1DBVO 2IY8A 3FBWA 3QFFA 1MIOB 3FTQA 2V9PA 4ZAGA 3ZE8A 5JSFA 4YT2A 3AEKB 4FNOA 1XAHA 4RU1A 4JI3B 4YR9A 4P86A 1D07A 1YQTA 4O4JA 1Z4JA 1KU0A 3OQVA 4CM7A 4B6EA 2BFAA 2BY4A 3VTKA 1SUIA 1X7ZB 4YEDA 4AWXA 3FCYA 1JHDA 2W6JD 5LP6A 2X15A 1HRKA 2RHDA 2VNIA 4JASB 5E2BA 4O29A 5KKAA 4B3SB 5T5QA 4H77A 2ADFA 2VRBA 5JV5A 4PCLA 5F51A 5TQ2B 1ZY2A 4AX4A 2WU0A 1J1IA 4M6WA 3HVRA 2HC9A 2AFHB 1TCBA 1WB9A 2NZJA 1Z4MA 3NWEA 1T10A 1QH8A 1UKCA 5EEHA 4I14A 4BZWA 3PJRA 3GJ3A 3K1AA 1J70A 4HGZA 2CVOA 1MX1A 1EDEA 4B79A 3ROQA 2NVUA 2E6KA 4E31A 3G2HA 5M5BA 1FRVA 2GLTA 2JZCA 2YWCA 3B6MA 4QXAA 2QB5A 5E3IA 5AK0A 3RSZA 2BEVA 4RF4A 3NAQA 2J7PA 4JKIA 1XPJA 2JRLA 3KQQA 1FCJA 1RJWA 2I2FA 4LPKA 4URZR 5K0CA 5MF6A 1KI8A 3H3XA 4FMCF 2A0UA 4OHXA 1EE1A 2EKZA 3AFMA 1NZFA 2QVXX 4EB0A 2V7BA 3B2EA 3M6AA 4ZCRA 2PVCA 3OTIA 1PJ2A 4J1SA 1E7WA 2HIGA 2Q3LA 4ZKEA 3ENQA 3IHWA 3EPLA 2J3JA 1K06A 3KUDA 4R69A 2ZYGA 2CL7X 3QKRB 1OKKD 4DPLA 3TTSA 3A9WA 1NGSA 1JG4A 2RSLA 2ZJYA 4BN0A 5MGBA 4KQ1A 4QARA 4B3IA 4JP2A 2VJLA 1QGZA 4JCCA 1JDPA 1OX4A 3VR5H 4BDSA 3HR4A 1CQIB 2H11A 1KI6A 3FNRA 4HNUA 8GPBA 3OM1A 1XK6A 3ZGXA 1CF4A 2XMBA 4G8CA 4KDEA 3ILVA 1R8YA 3L46A 1VIDA 2W9XA 4GMXA 2A1UB 3C6QA 2NVWA 4YJHB 3IDFA 5HCUA 3ECAA 5JEDA 1A96A 3OLCX 1K8XB 2PS1A 1MH1A 4HDRB 3ZWYA 3FOAA 1K9VF 1FUIA 1ZEMA 1K9SA 2GVNA 4CGZA 1MO3A 2X7HA 2C4VA 1MOQA 3ZVRA 4CG1A 5I4KA 2FN4A 3DD5A 4FGUA 3RH0A 3WA7A 1UPBA 4ASUD 3K0HA 5K6AC 2YWEA 4TV9B 1LDNA 4DJAA 1ZGCA 1C9JA 1DBIA 3DBLB 4RFSA 5J58A 3RC8A 2WNIA 3W8RA 4DLAA 1BIFA 4AVYA 2QTGA 4Y0VA 4KQ9A 1W5BA 1NDQA 2GASA 3FWHA 4WLNA 5KC9A 2CBZA 1ZU4A 3KEFA 3B89A 3QVXA 4OQQA 3UYLA 1FP7A 3OCYA 2IYTA 2XTZA 4X20A 5FAKA 1F2TB 3A9VA 1D4ZA 2C5LA 4KI7A 5EIBD 4AY3A 4EP1A 5J2UA 1QGAA 5ELLA 1IZYA 1R4MB 1X70A 3QKTA 5FOQA 4PZLA 2RBKA 3LAWA 1JKJB 1T4BA 2LP4Y 2XH8A 3FA2A 3AXSA 1KOLA 4C9BA 1QBGA 1VJGA 3JQFC 4PNHA 4ZICA 4LOAA 1RJ9A 3MJDA 4QREA 1G64A 3T95A 1PP4A 1A5BB 3OICA 4R83A 4KYIB 1YQWA 3GVCA 4BJ6A 3JQRA 3OCXA 5EQFA 3TW8A 3HB5X 4ONEA 2E4UA 2F8MA 2XOKA 2CXNA 2WKWA 3D5TA 1XL0A 3LJKA 3KBBA 1T5SA 2FSSA 2JLCA 3IJ5A 2IYQA 3HB9A 4K9DA 4Z1OA 2IX3A 1CWUA 4BNDA 3J7TA 2X41A 2NSYA 4IO1A 4R3UC 1JWAB 1NLUA 2GZHA 4FI3F 2F6RA 2OXCA 1USIA 3GMDA 1V41E 5JCOC 4ZDKA 2HY7A 1VOTA 5C5DA 2GSDA 3C41J 1CULC 2BR3A 3PQ3A 1OAOC 1PWHA 3R5SA 4NESA 3FZEA 1WD5A 5HF5A 1O97C 1YR3A 1YCHA 3DCJA 3GROA 4GXRA 5CR9A 4LHZA 3U1VA 3VPXA 5FPKA 3K0SA 4BBPA 1R4ZA 1KTVA 2OQRA 5EFZA 4A5SA 2QBYA 3STUA 4HKTA 3CNQS 3UJ3X 1Z4PX 2EWWA 2J3LA 3I12A 4RETA 1KQOA 1UEXC 2C84A 3OFND 3BRWA 1G42A 4PX9A 1FK8A 3HVHA 1YR9A 3LD9A 2FN3A 2UZ0A 5B1HA 4NOLA 1AUQA 2WJJA 2IJGX 3KUUA 1ZI9A 3HY3A 4JOBA 4XM1A 3SEAA 3AU8A 4ZCMA 1N57A 2JJ1A 3R6LA 1HYEA 1IMJA 2VA8A 4H60A 4EG5A 2H4JA 1W581 2V7TA 3MXOA 1OY1A 2Y1GA 5REQB 4Y2XA 5CVTA 1XDSA 2KE5A 2W6ZA 3K0EA 3SWWA 1TEZA 3CWQA 2AMLA 2O0LA 3HU1A 3JYLA 1W9MA 1F8GA 2YVKA 2JS7A 1NMSA 3KSZO 2Q2OA 1H6AA 3LGXA 1FFXA 3FRJA 3KHKA 3MPUA 3QWFA 5CXXA 1RE1A 2DTXA 2H2IA 2QLJA 1VE7A 4CL2A 5JAOA 1Z22A 3DMYA 2QAGB 4RF3A 2Q49A 4YDQA 3IMEA 1V5EA 2NWQA 4YRNA 2F8SA 3B85A 2IXTA 3IBFA 4JJAA 3EPRA 4JJKA 4YR7A 1OW3B 5C1OA 3ILSA 4DM7A 1NNUA 2AN9A 3PFHA 3RS9A 3EFOB 3W2TA 1XMIA 2DWOA 2P2DA 3TRIA 4ETIA 1OQAA 2KQUA 2B8TA 4EPVA 1OOEA 3UWDA 3ZIUA 5LQNA 1DUVG 4C07A 2J3QA 5CA1B 1Z5WA 4M3NA 2NZYA 2DLCX 1YQQA 2FRXA 2REQA 1IVSA 2X22A 1VGQA 1RYHA 3JALB 3JWGA 1CIJA 1T36A 4XARA 1BN7A 3R75A 3OIFA 4DLXA 4RJTA 1RWNA 1BRTA 3THXA 4ZAVA 3I5MA 3OJOA 2DCUA 1RM5A 1JXQA 2PRJA 4I9GA 5GGYA 4W8OA 3S27A 4WJKB 5BUSA 2HLDA 1Y6GA 1ECLA 5IF9A 2IDJA 4MQFB 1LA2A 2R1UA 3OU6A 4Z0NA 1I4WA 3HXLA 3AFIA 1JG6A 1PUIA 1ST3A 3LW7A 1P7WA 4YQZA 3S44A 2DR2A 1E2NA 1U9ZA 2VPWA 4UAGA 4EA8A 1KEKA 2JFFA 2W6OA 1X6VA 4M46A 3ROZA 2WWGA 3RABA 3EWSA 1EVLA 3TIXB 5CGZA 3ZHRA 2JCVA 1Z4QA 1E2HA 3GHHA 5EIHA 5DLQC 1E8MA 1R6VA 3ZHZA 4EGSA 3L4KA 3GN1A 1KGDA 3OO1A 3B9QA 3W7BA 1BMTA 4HDMA 4F5DA 2NU6B 1Z7YA 1C7JA 1K92A 1NNSA 5TR9A 5AVYA 3LUKA 4LSMA 5LXTA 5B2EA 3JQCA 4O1MA 2P9QA 1S8FA 2AOUA 3FI9A 2CDBA 4Y6SA 3FFWA 4HZUB 3LYLA 4K6KA 1DRKA 4Q6BA 4LF5B 1ESMA 1GFSA 4OH7A 1N5LA 3VI4B 3IT3A 4GBED 2IV3A 4F2DA 3ELBA 3RROA 1AO3A 5C8YF 1ADCA 4RF5A 1MPTA 1RQRA 2R47A 5KOHA 3MSXA 1UDBA 5AJZA 1VLHA 1FYWA 5DBHX 1WCIB 2JGAA 3EVFA 2QRLA 4OUDA 5HNKA 1B8PA 3E9YA 1NUQA 1SBTA 3PPVA 1CY7A 1M67A 2G0TA 2PEYA 2XADA 4PSVA 1TQ2A 2HDNB 5CT5A 2NU8A 4MI1A 1M8KA 1WVGA 3HCDA 2W90A 1REQA 2PMKA 1I1HA 2PT7A 3F6RA 1SFRA 3RM3A 3T0GA 4CTNA 3RUFA 4UZSA 3SY8A 1UMDA 4YX9A 4LWPA 3HRHA 4CUZA 2HSEA 3WLNA 1L7XA 4B3GA 4B74A 1W4ZA 3GMIA 1Q0RA 1TK9A 4BGDA 4COOA 4C88A 4XDHA 4QJ3A 1NC3A 3L0SA 1RLUA 2OHHA 2YS7A 4IX9A 5J4VA 2QHXA 2H63A 3KL4A 1UZUA 4MICA 2ZJ7A 5IYZF 1KE1A 2G4VA 1DC6A 3MBKA 5HE8A 4EG7A 5E6UB 2C1XA 3EEIA 4MAFA 1QDUA 2C5FA 5JMWA 5SYMA 4EY5A 2ODBA 3GQBB 3MWDA 3X1DA 3KOUA 2ZRHA 1FXWF 4JH0A 4KLZA 1NQOA 1E2GA 4RL6A 2YWBA 4IOMA 4Z0HO 1S01A 4W99A 2NX2A 2FZGA 3V97A 3RQIA 3CR7A 3HUDA 2XQVA 1CQPA 4L78A 2WWYA 2HA4A 1W5AA 1GUDA 1B43A 4QIHA 2CNNA 2RB5A 4Q3EA 5EJ2A 5IDWA 5AI4A 1XOIA 5BRJA 4NDZA 3DMDA 1R3DA 1JQJC 2B1GA 3KJXA 3DE6X 4JN6B 1L1EA 4IFTA 3O8LA 4PTLA 5ALJA 4YP6A 1NC1A 2PYZA 4C2BA 1TM7E 3NAZA 4YUXA 2CZGA 4YS6A 1J25A 3DVAA 2VUHB 3BE5A 4ZOAA 3H4VA 3JD1A 5K0GA 3WMEA 1KZ4A 1UBUS 3WLAA 1VPVA 2MTBA 1EVQA 2QDXA 2OBBA 3D2LA 3N2ZB 1KKMA 1KSHA 1GL3A 2A1TR 2B61A 2JAPA 2JI7A 4EI8A 2ZZNA 1VMDA 3A70A 2OILA 2XDQB 3K30A 3WYBA 2H7CA 1EIWA 4TN1A 4U63A 3ZU3A 4I08A 2ONCA 3RJMA 4ZP1A 4QUKA 5KAMA 4G63A 2P1DA 1L4BA 4Q9AA 2EJVA 3QRWA 2XRMA 4O4JF 4RDHA 3OLWA 2X9QA 3L1JA 1AV6A 1NJ2A 4CLDA 3DB1A 4GR4A 4OX9Y 2GJ8A 1X92A 4ZMSA 4OYYA 1DPGA 2E4VA 3FWPA 4D8XA 4BAGA 1CJUC 5IJ9B 5LP6F 2VHZA 1XLTC 2ECPA 1R6TA 2GK4A 5K0LA 5IF3A 3GFFA 3EXG1 2CVPA 4GP9A 4ER7A 3PFIA 5BVHB 2XCUA 2JCBA 1DKMA 4FFWA 2J0QA 1CEXA 1SKBA 3Q7EA 5DNAA 4J2HA 1RM4A 1OASA 1FUKA 3C3DA 3L5OA 4URUR 4CM1A 1K88A 2IXEA 1IBSA 1ZK2A 2IHJA 3I2YX 3JYHA 4UPEA 2P77A 5FULA 5KWEA 3L7YA 4UTZA 3WIUA 1QU3A 3FCAA 2FEXA 4JI5B 3E5RA 1GAJA 4DA8A 3T1HB 3C4JA 3ZY3A 5JCPA 3K9FC 2AWNA 1AB6A 4RSHA 5FWNA 1G7CA 1D2MA 4ZVVA 3D31A 2ACEA 4HTFA 4L5CA 1E2PA 1U4SA 1OFHA 1N1EA 3UKDA 4GX1A 3IE1A 1G3UA 1TA4A 3KALA 1T43A 1A2OA 2XYGA 4MVJI 4TLMB 5T4FA 1A82A 5G3ZA 1QRTA 4EUSA 2G70A 1PHPA 2QG9A 4GC5A 4BVHA 4MS4B 1C0IA 5DNUA 2V6BA 2R87A 3PDWA 3A32A 4KSCA 4UQPA 3F6YA 2ZJAA 3BBPA 3PNLA 3A1CA 4HLUC 3WLMA 1P1HA 1QX4A 3LCMA 1BQ3A 5EIAA 1UEJA 3K92A 1M1XB 1AN9A 3KJIA 4F06A 4CQNA 4NXNB 3AHFA 1YKGA 4F72A 2BSXA 4EYEA 1ST2A 2PTGA 3MINB 5EKSA 4C2TA 1PYGA 4M87A 4G37A 2FZVA 1MVNA 5IJ0B 3AQ4A 2N3ZA 5SZHB 5TMPA 4HPJB 2VDLB 4TGLA 5JMPA 4YAFA 4AUEA 1HG0A 4O4HB 4NPAA 3CEMA 1Q0PA 1IHUA 2F55A 4OOFA 2JIOA 3NOQA 2W0MA 3RFFA 1V3VA 4NJEB 3UWPA 5CGQB 3LPAA 1J7JA 1S3IA 2Q3FA 4DSNA 4EHDA 3HUFA 4LV5B 2Y99A 4FFOA 1MP0A 1XZAA 1E9AA 2FXVA 2XWSA 3QUSA 1N2SA 4RKRA 4J16C 3X1ZA 5EJ7A 1S8OA 1SC4A 1UBMS 3G0OA 1SPXA 2QE7D 3AO0B 2YXEA 3N2IA 3RVDA 2H29A 3NUQA 2AFVA 4EMBA 2EL7A 3NNDA 3EGVA 4D8UA 1OT3A 2J87A 3NCHA 2QZZA 4NCXA 3B6KA 4GZLA 1ELOA 2CJWB 4F86A 3L9XA 4MOWA 2E6UX 1VLMA 3WDSA 1XLUA 1UZLA 1T91A 3GARA 4MUJA 3HJUA 2HLHA 5AI5A 3ILXA 2FVXA 5CJJA 3OEHD 3U39A 2DQSA 1ZGHA 2DFLA 1AQ6A 3LHIA 1R0CA 1ODCA 4IBOA 1GCOA 4KV9A 4L9SA 3T34A 1HSOA 1PZFA 1E6EA 1W36D 1WU7A 4O33A 1E4YA 5CB4A 1QCDA 2OYSA 5GONB 5J2UF 1IHOA 4DRZA 3OY2A 3LUJA 2HV8A 3COYA 5IC6A 5CCDA 4RTLA 1OZGA 1XE3A 3MCAA 5EZ6B 1ZVVA 2C9OA 3BWCA 4U5QA 2YWRA 4OV6B 3R5XA 3A28A 2XVMA 3VR6H 3VZDA 2CNWD 4HXEB 1NLMA 3DZJA 3L6CA 3L8EA 4I5EA 4OHBA 4M55A 2ZSJA 2IE0A 3CISA 5CFZA 5DVZA 1XD8A 4FN5A 4WECA 3RKSA 1OSNA 3AEZA 5GTDA 4ZA2A 3K70D 1U7UA 1FNCA 2XWPA 5JJCA 4M1YA 3INRA 3E58A 4F8EA 4BB0A 1Q16A 2LNDA 3JQGA 3PL5A 2WICA 3VZPA 5BSFA 2G36A 3AUAA 4ZO8A 3V4ZA 2RC6A 5IH7A 4HJXA 4MVXA 1GPWB 3JZMA 1JR3E 5AW2A 1SG6A 1GY8A 2HFKA 2X0IA 4XOIA 2CNBA 3G49A 4PO3X 3QLTA 5AUQA 5DCLA 3TQTA 1V96A 1J07A 1WKCA 1MNQA 1N6PA 4Z0TA 1IXKA 1M1NA 3SM3A 4QLOA 3ETDA 3E1KA 2OCLA 1G4AE 2DLDA 4DLBA 1QK4A 2Y1XA 4PHTA 4BVFA 1XKQA 1ZGBA 2HBZA 1SC6A 5A9SB 2AVDA 2PQ2A 2GPTA 4KV7A 1Z0DA 1J5PA 5IAAA 4GI5A 3T94A 5C37A 4BV2A 1C4OA 2VNHA 2BGMA 1PLJA 5ECWA 1IQPA 1JDBB 3I34X 1MB4A 3S29A 4U4AA 5THXA 1N3YA 2RGYA 4L08A 4RSRA 1OZAA 1V25A 4EW6A 2WAOA 5D3QA 5SYNA 5AXBA 2O7QA 3K5HA 4BLPA 1YQ9A 3ZY6A 1UFOA 2LXNA 2RHTA 3BWBA 1FL9A 3KCQA 3FMPB 4EVIA 2NG1A 3BRQA 3CLTC 5B37A 3TAHA 4MVJP 1K5PA 2J8ZA 4YCJA 5DX1A 4FP9A 1DX4A 2J9YB 3U49A 4CF5A 3EXAA 4DR4B 2OYCA 1YZNA 2VP4A 4GVLA 1RQ7A 3EXEB 5CVDA 1F8YA 3IBTA 1DUSA 1XQYA 3JZFA 4J4BA 5ALXA 2G5CA 4RMJA 2PA3A 3A4YA 3LHKA 5I4CA 2Y92A 1I3KA 3QU5A 3EFHA 4WGFA 4HD8A 1ML3A 3HEBA 1MAVA 3HABA 2YHAA 4JJ8A 3CX6A 2SNIE 3A3OA 2X4DA 1P91A 1WPQA 3KAJA 3QEKA 5B53A 4C30A 2HQBA 3CLSD 3SQOA 3TCKA 4DIDA 2NTNA 1DX6A 1KBZA 1SD1A 5AT1A 1RZ3A 2DBZA 3E22B 2YWHA 2ERYA 1X8XA 4YLEA 3UHFA 1E1KA 2PSSA 4NABA 3WC4A 3VC3A 1NBMD 4DEVA 3NANA 1M33A 2CEKA 1GA1A 4XI9A 4Y7CA 3WA6A 5TGTA 2E1RA 1D4FA 4TMWA 3A7DA 4HI0E 3DLHA 1FLNA 4WZBB 1KOGA 2K7ZA 4HFNA 3AZQA 4NONA 5CG1A 5CDFE 4JODA 3KIPA 1RC8A 4RHYA 3R6TA 5AXCA 1DBSA 3FSEA 5M34A 1D7OA 1MH9A 1AKRA 4R84A 1F14A 2X8WA 3RK0A 3FOFC 3L07A 3L0IB 2FWNA 4BO9A 2ORYA