4ZMSA

Structure of the full-length response regulator spr1814 in complex with a phosphate analogue and b3c
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
207
structure length
207
Chain Sequence
b'GLVPRGSHMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEMVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Structural characterization of the full-length response regulator spr1814 in complex with a phosphate analogue reveals a novel conformational plasticity of the linker region
pubmed doi rcsb
source organism Streptococcus pneumoniae (strain atcc baa-255 / r6)
molecule tags Dna binding protein
total genus 74
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zmsA01
3QX8A 3FGZA 2AYXA 1E6MA 4TLLB 4XARA 5IX8A 2JVJA 2QXYA 1DBQA 4MQEA 3RVJA 1DCFA 1FFGA 4ETNA 4EVQA 1Z25A 3BRQA 2KYRA 2WY2D 3GBVA 3QX9A 4Y9TA 1EWKA 3C6QA 3VNAA 4UHJA 3H5IA 2FEPA 2CHEA 3O75A 4MR9B 1YK1A 2GWRA 5GQSA 2A9PA 3BRSA 3CG4A 3EULA 4JA2A 4MS3B 1DBPA 2L18A 2TMYA 3LUGA 5EWLB 4W5RA 2A9RA 5TQ0A 4S04A 2JB9A 5JNSA 2PUAA 1SRRA 4N0PA 3C3KA 1Y1LA 2PMCA 3M6MD 2IPMA 1P2FA 2FMKA 4N41A 4N47A 4KREA 3F6CA 4O1IA 3LUKA 2FW0A 2HSGA 2XDYA 3W9SA 4YCSA 4P1ZA 4G0MA 5DCLA 2ID9A 5CNIA 2R25B 4O5AA 1MB0A 4G0QA 3HS3A 2IOYA 5EWJA 4D6XA 2PUDA 1D5WA 5PNTA 2H0AA 5IBQA 1ABEA 1YMUA 2QZJA 4RKQA 2FTKE 3OLVA 1RNLA 3LUAA 3H1FA 3T38A 2YHBA 3LFTA 1J56A 3CLKA 1VRVA 3HEBA 3E61A 4ZJPA 1NY5A 3Q15C 3RVSA 4Q7EA 3F6PA 4NQRA 1YTUA 5IUKC 1JHZA 1NXTA 1VLZA 5B3JC 2AYZA 4GNRA 4ETMA 4KNYA 3EQZA 3QLUC 3CG0A 4DN6A 4OLAA 1ZY2A 3Q7RA 3HCWA 3L49A 1JFSA 2LPMA 2FMFA 1TJYA 4N76A 3UUGA 2FKAA 2FLKA 1JDNA 3H6HA 4RV5A 2FQXA 1EWVA 4YWHA 3H1EA 4MR9A 4PICA 1D1QA 3T6KA 1JH9A 3KLOA 1USIA 2E4XA 3CZ5A 4MS3A 2JVKA 3G1WA 4MLDA 4RSMA 5EWLA 1FQWA 2JRLA 1Z16A 4ZPJA 1JF8A 3DLHA 3EQ2A 3H5VA 3JPYA 4D6YA 1CHNA 3I09A 4MR7B 4WXMA 3MIZA 3HXMA 1DRKA 4OG2A 1RXEA 4MQFB 5D2CA 4Z9BA 1JL3A 1AB6A 1KMIY 1YMVA 2IKSA 2PLNA 1NXXA 2FEWB 3DZDA 3H5LA 1Z17A 3O1JC 4RY0A 5FWYB 4MPTA 4GPAA 1DJMA 1SXHA 3JVDA 1L5YA 3LKVA 2IDMA 3UK0A 4KQCA 2QVGA 3BREA 4YRZA 1BDIA 1JYFA 4TMYA 1PHRA 3GV0A 3ROTA 3HUTA 4G0ZA 2H3HA 1ISSA 3TO5A 4XASA 2HJ9A 2P9HA 3LTEA 3RQIA 2PUCA 3SQNA 2WMYA 3CHYA 3KSMA 2PUBA 3KCNA 1E6KA 1ZGZA 4QICA 3GT7A 2QV0A 5IC5A 5TPWB 3FMVA 4RK1A 5JNUA 3BBLA 4F11A 1PUXA 1ZAYA 3QK7A 2MYUA 1ZESA 2QW1A 5BR1A 1BA2A 2E4YA 1WETA 4Q6WA 1CEYA 2FQYA 2PL9A 1LBIA 4Z4GA 4MRMB 3OQOA 1U8TA 1JWLA 1QKKA 1YIOA 1GCGA 1Z2DA 3L6UA 2ZAYA 2PJUA 5T7BA 4QYWA 2NT4A 5T3YA 3JY6A 2JCGA 3KYIB 4JAVC 4LZLA 3K9CA 3NNNA 5C5CA 1TLFA 4M88A 4YO7A 3EODA 3OO0A 3HO1A 4W5OA 2V0NA 3LUCA 1VKRA 2JVIA 3E3MA 4MR7A 1DC8A 5EWMB 4YP9A 5ABPA 1YS7A 1FFWA 1Z2EA 4NV3A 3IP5A 5CHYA 3JPWA 4MQFA 7ABPA 4RK7A 3M9WA 4OBBA 2PKXA 3H5WA 5JS1A 4MGEA 5IUNC 3GBPA 4W5TA 3HJFA 2FQWA 1JDPA 5FWYA 3M9XA 4EUKA 3HDGA 2E4VA 1EFAA 1DRJA 1QMPA 3NBMA 4JP1A 3FFWA 5ED4A 1P8AA 1XHEA 2QU7A 3HDVA 3O1IC 2WJWA 2WRZA 4LE0A 4RY9A 2FEKA 3OMWA 1Z13A 4RS3A 3CZCA 2R48A 4Z4IA 2L17A 2FXIA 4D74A 1BAPA 4Z99A 1D4ZA 5IEBA 2X7XA 2JBAB 2IPNA 2GI4A 3I42A 1E6LA 1P6QA 3NHZA 4IF4A 1JFTA 2LP4Y 1KRXA 3H75A 5IUJC 3HK2A 4LDAA 4MS4B 2QSJA 4MRMA 1ZITA 2CHFA 5DLEA 2PUEA 2F8TA 3N6VA 1JYEA 5F64A 2HQBA 3QEMB 4F3TA 3CU5A 4YS6A 2NZVG 3DLBA 1U04A 5E3JA 1NXWA 5JNRA 4G0XA 1GUBA 3JVIA 4HNRA 8ABPA 3UKJA 1RXIA 3EGCA 4G86A 3H5TA 1JBEA 1P6UA 3ROFA 5KI6A 4KK4A 4DADA 5BRJA 1QP7A 2FMIA 3DGEC 3MQ4A 2YHAA 2B4AA 2QR3A 3EJWA 3RVOA 4N03A 1I3CA 1PNRA 1OXBB 3O2QB 3A10A 4ZYLA 3SY8A 1XWWA 2OQRA 5EWMA 3F73A 1S8NA 4MLCA 4XFKA 4E7OA 4RK4A 4RK0A 4IMIB 1CYEA 3SG0A 3JTEA 2W42A 3OMXA 1XHFA 4KPYA 1TVMA 1ZDMA 3CKMA 4KVFA 5C5EA 2MYNA 3ILHA 5FWXB 3OQNA 1Z12A 3HSYA 3Q7TA 4H60A 4EGSA 3GRCA 9ABPA 3CFYA 2O20A 1PEAA 1K66A 4L85A 4RKRA 4RY8A 3RVQA 2QVCA 2L19A 5KC8A 1M5TA 1USGA 4DQDA 1RPJA 4S05A 3KG2A 3A3KA 3MYYA 3H5OA 2NT3A 2RGYA 1C4WA 4F06A 1M5UA 2I6FA 2JBAA 3RH0A 3DGFC 4Q6BA 3FFTA 3KJXA 1T34A 4LE2A 2FN9A 1EWTA 4H3HB 2PUGA 1B00A 3G85A 4KMRA 1ZHHA 3RVNA 3S99A 1GUDA 3CS3A 3QEMA 3LUDA 4JB0A 4HNQA 2MYTA 4MR8B 3LUFA 4EVRA 4TLMB 3VNBA 5KQGA 4KZKA 1D2AA 4WXEA 2MSLA 2R47A 3CNBA 3MMNA 4G0PA 5CNJA 3RVLA 5HSGA 3C3WA 4PE5B 3NHMA 1DCMA 1M2EA 4FE7A 4JOQA 3O21A 5BRAA 4KRFA 3LOPA 4WUTA 1LJLA 3HM9A 1QO0A 3KLNA 5B3JA 1BVHA 3O74A 1ZN2A 3QLUA 4ZMSA 3IP7A 2J48A 1F4VA 4YR7A 5JS2A 1BDJA 3LKBA 4EYOA 1PNTA 1DZ3A 4G0OA 1APBA 1LK0A 1YK0A 2F8SA 4WZZA 5FWXA 4HYEA 5KWSA 1NATA 1QP4A 1SXIA 5DTEA 1W9HA 1FFSA 3GL9A 1URPA 4MS1B 5FBKA 4ETIA 1NTRA 3H6GA 4N0QA 4RZSA 2GX6A 2E4UA 1NXOA 3QELB 1ZH4A 4KK3A 2FMHA 2P4UA 4Z4HA 2FN8A 1ZGGA 2HPHA 2RJNA 1DP4A 5JNTA 2NUBA 4O1HA 4KV7A 1GCAA 3IDOA 1SD5A 1JX6A 1L5ZA 3TD9A 2VK2A 5JNVA 4OLBA 1QQAA 1F51E 4LRQA 3SM9A 2PAFA 3A0UA 4QPJC 1NXSA 2R4QA 4ZMRA 1DG9A 2BGGA 2N9UA 1ISRA 1DBWA 3Q41A 5I4CA 2PUFA 1A0OA 3JS5A 2GBPA 3RVMA 4MR8A 5TQJA 6ABPA 1DCKA 3O1HB 4LDZA 3BILA 2FVYA 1PEYA 3KTOA 2MSWA 1SXGA 1JFVA 4WWHA 1LJUA 4IMJB 3H1GA 1VPWA 2NZUG 3DBIA 5TPWA 3N8IA 4Z0NA 1MB3A 5BQ3A 2GKGA 3CTPA 1HEYA 1A2OA 1YS6A 3T8YA 1U2PA 1ZVVA 1JLKA 5TPZA 1ABFA 4RDCA 4ML3A 3URMA 3NNSA 4LX8A 1TM2A 2IPAB 1RZRA 2L2QA 1TMYA 4XXHA 5HQJA 4TN5A 5CNMA 3N0XA 1FSPA 3Q9SA 4IRXA 4RXUA 3EDCA 1DC7A 1KGSA 5IEJA 1K68A 3OQMA 2ID7A 3TX6A 4EVSA 2LBPA 2RDMA 1A04A 4MS1A 5DKFA 5KQMA 1U2QA 4YV7A 2OENG 2WWVD 3KS9A 4IGAA 3QELA 4XLTA 1Z26A 3FDFA 4Z4EA 2IYNA 3I5AA 4HNSA 2HQRA 4YLEA 2E4WA 3EAFA 4RXMA 3OM0A 3IP9A 4IILA 4NCBA 4NICA 4RK5A 1MAVA 2RJOA 3GYBA 4Z9AA 3HV2A 4RWEA 1R8JA 3HZHA 3SNKA 1QNLA 4F12A 3GWGA 3B2NA 3QLVC 5CNKA 4E7PA 1U0SY 4YGXB 1QPZA 5KC9A 3IPCA 4EYKA 3ILYA 4EYQA 3P9YA 3SAJA 1QP0A 1QO0D 3OLXA 4OTZA 2JK1A 4LE1A 3IP6A 1AB5A 3OLZA 2PL1A 5TQ2B 3OM1A 1ZH2A 4MS4A 1BDHA 3KKEA 1IIBA 3T95A 4JASB 1Z18A 4EYGA 6CHYA 1H9CA 3IPAA 3TB6A 2ZWMA 4QYMA 1MIHA 3GA5A 2HQOA 4L4UA 2FLWA 4MQEB 4H3KB 1USKA 3KYJB 4PYRA 2MSKA 1KRWA 2M1ZA 5KQLA 4CBVA 3OLWA 2M98A 3LMKA 1QQBA 4Z4FA 2VUHB 2B1JA 4MYRA 3C3MA 3O2SB 2CD7A 4FB4A 4OATA 2E4ZA 1Z15A 3RVKA 3LUJA 5FBHA 1OXKB 4P98A 4FE4A 2WB4A 4PEVA 2MYPA 4JB2A 1EAYA 5TQ0B 4W5QA 3F7NA 1NXPA 1LBHA 3MF4A 3QLVA 1MVOA 2IPLA 3R0JA 3D02A 3K4HA 4G0YA 4NCAA 2VYCA 4W5NA 4KFCA 3RVRA 1NXVA 3FFXA 3N0WA 3N75A 2VUIB 2Q5CA 1M2FA 3I45A 3MM4A 4MAAA 2PE5A 3QEKA 3NNDA 5HM6A 1E2BA 5DGCA 3HVRA 2LIVA 2FSPA 3HUUA 3CRNA 5HKOA 3Q7SA 3N0RA 3QLTA 3OO1A 5EWJB 3MA0A 1C0EA 3KHTA 2WJAA 3OLYA 4RXTA 5JNWA 5TPZD 5GOTA 4KQ9A 2DRIA 3N53A 1EHCA 4G97A 4XAQA 1YVUA 3D8UA 3RVPA 4F8JA 1D1PA 2CWDA 5TE9A 5TQ2A 4RK6A 3LUHA 4WT7A 4B09A 4EY3A 1RZRD 1W25A 3O2JA 3C97A 3TMYA 4Z4CA 2A9QA 2LUOA 4UHKA 3A0RB 5KQPA 1UDRA 4PZ0A 2A9OA 4RU1A 5IULC 1GLGA
chains in the Genus database with same CATH superfamily
1II9A 2WILA 5JC8A 4GGOA 1CNMA 1F06A 3DZBA 3T35A 2JVJA 2RAFA 1XRJA 4AG6A 5FI0B 5BPFA 5JAOA 4MO9A 2AYYA 2QU8A 2W6OA 2WPNA 3AI1A 4WN9A 4ETNA 1FXUA 3RSGA 3G9UA 4Y9TA 5FV4A 3LT0A 2C57A 4PGHA 4PM4A 3BZWA 1L0BA 5ITSA 3A2KA 1GG8A 4HLUC 1DX4A 4JLAA 3AL3A 1JG1A 1HRKA 2GK6A 1G6KA 2R11A 4XQ9A 2QVZX 3SE7A 3KSBC 1G8SA 3FIJA 5KNDA 4FU0A 4AS2A 1TM3E 3BRSA 4B46A 2MU1A 3SBEA 4XJSA 5LZ9A 4K0KB 1QFJA 2BFWA 2D1YA 2G1UA 4G5YA 1E1CA 4UE3S 3OPVA 4XUEA 2EVWX 2IY8A 2XXBA 2YINC 4BOYA 2HLPA 4IZIA 1DWPA 4IFEA 4K3VA 2BMJA 3C3KA 5A7HA 1A69A 4H35A 1G19A 3M70A 2CJYA 1SOWA 1P1RA 1ORDA 1T2DA 2XB6A 3KKMA 3QWFA 1RZUA 2QT1A 4QUHA 2O8FB 2Q3BA 1GO2A 3CX8A 3OPQA 4GRDA 3VPCA 4B32A 4GD3Q 2DTEA 2LRHA 3N2KB 1KE1A 1E0AA 4KAFA 1BWSA 2D2FA 3F6YA 2DP4E 1C5KA 3DZGA 3RGGA 4BBZA 4PG8A 1KO8A 1WD7A 3GMTA 3ADCA 4JP3A 4S12A 3CO0S 4JEIA 4YP0A 1YMUA 3PNQA 2D5LA 2PA0A 4C3UA 1XQ1A 1VG9B 5J63A 2B4TO 2FTKE 2OILA 2O19A 2KSQA 4UNNA 2YNMC 5AOBA 2ISSD 2GN4A 4GI2A 1O5IA 2GFIA 5HWSA 4C3VA 3OTGA 5LN1A 3DDNA 2V1XA 1EVIA 1NBHA 2EAUA 4LOIA 4NZNA 4PO1A 5DZSA 2I2WA 4CM3A 4JNCA 3A4VA 1U1DA 4BWGA 3VPFA 4FOLA 1OJ7A 2NTYC 2PX2A 4Z0PA 4DYVA 4F91B 4RC9A 1KAOA 4OLAA 1WJGA 1X7YB 4MCHA 3TLXA 1YGYA 5JJLA 3DL4A 4LKOA 4A6DA 4A8JC 1NRIA 4EI2A 1ZPDA 4DW8A 2BR5A 5J2UA 1VM6A 2Z5GA 4MW1A 3KE8A 4B0PA 2DFKB 1NHWA 4I55F 5IT4A 4PQGA 4XSVA 3H1EA 5CB0A 3LE8A 3B2QA 1E3IA 4AZ0B 1VSTA 3DZFA 4XWKA 1HE5A 3DMRA 4MS3A 1CUJA 3G1WA 4P81A 2PMFA 3WA6A 4F3CA 3EUEA 2QW0X 3IGFA 4XGKA 4I1PA 3V2HA 3U1VA 1WE2A 3M7IA 1CHNA 1Q20A 2QJRA 1IOVA 2OFWA 2OYRA 4IDNA 4QASA 2O0JA 2LCFA 4ZI7B 5KNLA 4OXRA 1XCGB 4REOA 3CNEA 1SD2A 4Y2JA 1CB0A 4BPBA 2I29A 1HYEA 2CLLB 1PN3A 3GRVA 4ZGWA 5T6MA 1Z2OX 1T0UA 5GIPE 4L9WA 3RT7A 1FUIA 2BD0A 2FPUA 3DEHA 3DONA 3VR6A 4P7JA 6LDHA 2QVGA 1T5BA 3UAGA 3RK4A 3O2NA 1N75A 2XYPA 3BL5A 2HRQA 1DJPA 1YJAA 1V4NA 5CB4B 1SIBE 8OHMA 1MT3A 3RQIA 3W8NA 2H18A 4BY9E 2WZCA 3DE2X 2PUBA 4TL8A 3RFFA 2F67A 2FJPA 2Y71A 1HORA 3DE3X 4RLFA 1Q21A 3IMKA 4JYAB 2DQ4A 1W35A 4CKYA 2FCAA 3D8BA 4CNBA 1IBKB 3SJBA 4YCLA 4BTLA 3BWCA 4O2BB 1ECLA 2CUNA 2CE7A 1UM8A 2XZLA 2R9VA 3MC1A 4UULA 3RRFA 3R8FA 4C0HA 4EHNA 1CUYA 1TYBE 2O06A 1JWLA 2W00A 4B3BA 5CIYA 3C4QA 5DX0A 3JR3A 2IH5A 2CLKB 3WDKA 2MHCA 4JUBA 4QYWA 1Z6XA 3DR5A 4OK6A 4PC7A 5T3YA 1BGWA 3EGOA 4HTAA 4LZLA 1SUAA 1C4OA 1EUDA 2RONA 3MS2A 3WQHA 3Q8KA 1W36C 1A5BB 2Y77A 5K03A 1IVYA 3W2TA 4M88A 3R41A 1GR1A 4KODA 5T67A 1CEEA 3LUCA 2XZPA 3JAWA 1EDEA 3NCHA 4NTZA 4HEA1 3VO8A 4ZMBA 3BQNB 1L5MA 4LCBA 2Q3MA 1H4TA 4U7FA 3G0IA 1XJ5A 3VSEA 3DH0A 4C4YA 1IUNA 2W7TA 1SQ6A 3OH8A 3ONFA 4R3UC 1N7JA 3V2IA 3WGTA 3NHBA 2PQ0A 1Q6ZA 4CU5A 3DEAA 4B2PA 4HRYA 3OU6A 5IUNC 5AKLA 4AP6A 4BV2A 3GRRA 4D2IA 4KO1S 2XSZA 3DJFA 3WL3A 4ZD6A 3VNUA 5AICA 3BGSA 1M6HA 4JELA 1JQBA 2Q49A 2Q8PA 5FO0A 5IN5A 3U81A 1OAKA 4C01A 2ZRKA 1U3FA 1PJQA 1XHEA 2AOTA 1XZQA 2IFTA 3FWHA 3O1IC 2WJWA 1GPMA 2WRZA 3SHOA 4IVPA 3LOUA 1XL1A 1Z13A 3OMWA 4LX0A 2DBZA 3ZE1B 2NP7A 2BZSA 4QBTA 5CT5A 1EFUA 1B26A 1F0NA 2HLDD 5HF5A 2L17A 3U1BA 1HFWA 3E82A 3H86A 1LDMA 1VG8A 1ULZA 4OPMA 5I7HA 1PVVA 3N76A 1YB2A 4G07A 3JX9A 1SUIA 1UDXA 1Z6TA 2FVXA 1ULUA 2IPNA 1OTXA 4QRDA 3OZVA 1LI4A 2MCFA 4UQPA 3A1NA 3SZMA 3DE5X 1CUXA 1GUFA 4AT1A 3UB3A 3G8YA 1AMNA 5F64A 1UBSB 1WCWA 4FFBB 4PIMA 5IJ0B 2P9YA 5IK2D 2BEWB 2AQHA 2Z9CA 4GBED 4MEBA 3PLNA 1WY7A 4J9VA 4DNFA 1J24A 1Q2XA 1HH4A 2C3MA 5KI6A 3KPWA 2PEZA 3VZSA 1Q16A 5C18A 1V2GA 2VJLA 2QMOA 1P1HA 3DGEC 3LXRA 1JQJC 1XNHA 4Q66C 2QR3A 4MW4A 5JZBA 3DNFA 3A10A 3ECSA 1XWWA 1TCCA 4UUBA 4N76A 4JSTA 5I7EA 3FVWA 4I8DA 3PUVA 3UUEA 4MKFA 2GXQA 3GJ4A 4R98A 2H1VA 1XZPA 3F5QA 1L3BA 4K1LA 3QQPA 4Q1CA 1GVNB 2QTWB 1BN6A 2Q5JA 4RDIA 5D86A 5F2NA 3OQNA 3U5ZB 5DX8A 3CPHA 3P7MA 2XUFA 4JQSA 4JX9A 1M1UA 3QXGA 3HG7A 1I33A 5F9FA 3ISJA 4DWOA 3T1TA 3THYA 2O20A 3SBXA 2C29D 2GN0A 4WADA 3S40A 5HUHA 1JLHA 1QPBA 4R3NA 4CZ2A 3LHSA 3C8DA 1ZC4A 5E3HA 2XWBF 4R9SA 3OFSA 2QMZA 1ZM9A 3F67A 1ORWA 4Q4HA 3MYYA 1JMVA 3I0ZA 2B34A 4E33A 3QEJA 4PC6A 1BWQA 1C4WA 1GPNA 5ICFA 1N34B 3ZV4A 2KWIA 3RAGA 3DGFC 2IOHA 3N8KA 4IRMA 3AFGA 2ATXA 5EE3A 3CSSA 2F1HA 4NV0A 4MV1A 2NU9A 3PXEA 2QTRA 3R2JA 1CY2A 5GP1A 4BNZA 4K6GA 5CFPA 1J1IA 3QEMA 1DAIA 3QUQA 2FEXA 2GDJA 2DPLA 1L4NA 2ZANA 3DBVO 4XIFA 2GEBA 3C6KA 4TLMB 1Q0HA 5AJHA 2VNJA 2Q8QA 3QOYA 3MTGA 2X0KA 3NDPA 3W7AA 4MJXA 2OQVA 2XUGA 3USZA 1LZLA 1J6UA 4BPRA 4I7EA 4M1OA 3RLFA 3HDHA 2C2MA 1B3BA 1P5JA 4KRFA 4RDXA 4ESEA 2EKBA 3IB3A 2OV4A 4K9LA 4X60A 2QE6A 2Q5EA 5B3JA 4I08A 3NHLA 4BRZA 4DLRA 4EUNA 1K7XB 2ZTUA 3QLUA 3QPUA 3SYMA 5HM8A 1PP4A 3L0SA 3EEYA 3JATB 3NIDB 4UFPA 1AF7A 4RIHA 1DIAA 1SUWA 3HACA 1T5SA 2ZUVA 2XX3A 3IJRA 3IAM6 1E5DA 3BD7A 3V2GA 3WIUA 2D5AA 3M6IA 1M0EA 3NPAA 4AMBA 4RZHA 2H1IA 5TNXA 3VGJA 4OM7A 3MGGA 1IYZA 2W48A 2QL5A 4RH3A 5FPTA 1IUKA 1W8IA 1W4AA 2GJSA 5IW8A 3U6BA 3DE0X 3N39C 2AE1A 1OUMA 1LSUA 2A67A 2O4CA 1MC4A 3A1UA 4Y1GA 3RRBA 2HF9A 2A0WA 3S2GA 2HPHA 2VXOA 1PR6A 2RJNA 3GFFA 1OI4A 2HGSA 3OICA 4UDNA 3TX2A 4EW1A 5EJ9A 2QB5A 4JXJA 2JATA 2NVWA 1H65A 3DVQX 1QMGA 2MSDB 4J4HA 2GN9A 5LP6F 3ICQB 1KA9H 2ZUSA 3WRVA 4KPUB 3CZQA 3TAUA 1LXCA 3FCXA 2X4DA 4FDVA 1JQDA 3KQNA 3LT2A 3TS1A 3Q41A 1I7NA 5A3VA 3VVLA 1A0OA 5H0IA 2A8YA 1EA5A 4URHA 1GFIA 4KUEA 4XQ0A 4RZ2A 1B8VA 1N2OA 5TQJA 1BDMA 3ZYZA 1KEUA 1M9NA 4YI3A 3Q7QA 1MC5A 2QYOA 3R23A 3DXZA 1SXGA 1JWBB 3HKBA 4E12A 3QEAZ 2I4OA 1Y80A 5IYZF 3U4AA 2BFAA 5TVGA 4F0JA 4JYZA 5HKBA 3T3GA 4COOA 1Y98A 5FR2A 3D3QA 4NY1A 5A6SB 1U2PA 2ZI4A 2OV8A 1XEAA 3A05A 4Y2YA 5A4AA 4NESA 4XLLA 1AKEA 3MAAC 3DE6X 4OFBA 3URMA 1AHPA 1T8PA 1ICEA 3HB5X 4NIMA 5KYKA 1I7SB 3I5XA 4DV6B 3KQQA 6NULA 2AIRA 3CVYA 4P2BA 2HADA 4J76A 3RYTC 3L01A 2Q5LA 3NXKA 4Y2QA 1L7PA 2D1TA 3PC7A 1VG1A 4K6CA 4F86A 2IGTA 4HS9A 4LSWA 3Q6MA 4BU0A 1N2ZA 1R9GA 3E8MA 3OQMA 2PGLA 1A04A 4IUDS 3AERA 1QYWA 3CKLA 4R1TA 2XHZA 2QTNA 2CV1A 3GNLA 4Q7KA 3QELA 1SHKA 4JLWA 1KGDA 1OLUB 2FZVA 4NHEA 4UM9B 5E2AA 3VJMA 2C59A 3IULA 4J16A 4QOJA 5FQNA 5F73A 3O4RA 2TMDA 2VJAA 2EERA 2WU1A 3NDIA 4K81B 4M8SA 3PXGA 1N2CE 4DWVA 1V1MA 4X94A 4V0OA 4I66A 3TKAA 1HE8B 5E6UB 4AUNA 4YRGA 2YOGA 1FLAA 5KB3A 2WMOB 2BCGY 3RLIA 1ZLYA 5KZMB 1PR4A 5KNBA 3U7RA 1ZWKA 5B2ZA 1P2SA 3H84A 2H6EA 3W1WA 1VCNA 3SYNA 4EYQA 4LBYA 1Z5ZA 1KE2A 1YR1A 3COZA 5LIRA 3IRUA 5AKYA 1Y42X 1F5SA 1FCJA 5FKJA 2Q07A 5D3QA 2GBLA 1GKIA 4UOZA 2CCJA 5INTA 4HDRB 5KOIA 3HYSA 1TNDA 2BM1A 1ZI8A 2WT4A 2JZOA 4E15A 1YU6A 5J47A 4U00A 5PGMA 1NW7A 1ZD2P 1L4YA 3PI6A 2RHRA 1M74A 2A5YB 1GGHA 3ZGZA 1BD4A 1E64A 1HF3A 4MS4A 1IIBA 4EYGA 3C3JA 3IVAA 4DLXA 3OQPA 1VL8A 1YZKA 2NVUB 1NMYA 3TQFA 1PLLA 4QYMA 1IZ9A 4LWZA 3UO8B 5IVKA 2HQOA 4QXAA 2QX7A 4II2A 4QYIB 1DBSA 3VR4D 1T9AA 3CQ9A 4OYYA 4UNPA 3A14A 4OVKA 4A92A 4H17A 3NDJA 3N8NA 3MGKA 4ARUA 4ZDIA 1QSGA 2RK6A 3GRPA 5GJBA 3IE1A 4WJLA 1QHYA 1X6VA 4KBFA 3UAWA 4MP6A 1UXIA 3P52A 3T41A 2XW6A 1KYZA 2JIZA 2AZXA 1XQVA 3ESAA 3NT5A 4ZP1A 1OBFO 1JAZA 3ZW8A 1FXSA 2NUPA 1E1QA 4PEVA 1GPLA 2APJA 4Y2VA 4DG8A 2WNIA 5F9HA 1TYDE 2ATEA 2C5FA 3HDQA 4HVTA 1PX2A 2PD4A 3GZ4A 3SR4A 3ZUGA 3I1IA 5ITVA 5CM8B 1BMQA 3EF0A 3Q3EA 5FI3A 4EELA 5CVTA 1W44A 4CV0A 1B0AA 1YS4A 1Z33A 1F2UA 4EECA 3OWXA 4ISCA 2Z3ZA 3I45A 3Q6NA 4QGHA 5IABA 1VHLA 3KV3O 4M89A 4W6QA 2NV6A 1WP9A 1Y5NA 4HATA 2UVPA 2VP5A 3SSMA 3CRNA 1Z74A 4YRBA 3Q7SA 5AP9A 2CMHA 1WOYA 4E70A 3MA0A 5E4JA 4OXIA 3OLYA 5TPZD 1QHGA 1P33A 1RACA 4L78A 2O1XA 5TQ2A 3LX6A 3O6VA 1NBWB 2Q5HA 4WT7A 1BW9B 1CIPA 5G4KA 1LB1B 4ALNA 1ZU5A 1DDIA 4JUCA 4Q1AA 2JI8A 4Q1VA 2RSLA 3BTVA 3E5RA 4PYNA 3SYKA 3AEXA 1E6MA 3AMVA 3QZUA 4C43A 2OCXA 4EENA 2Q2NA 5ALZA 3RVJA 1NBMA 2XUPA 3KBOA 1Z6PA 2A14A 1QHEA 1VIMA 2KYRA 1EFLA 1UR5A 3I39X 5KYVA 1W46A 3PNKA 5KTTA 1UKEA 1LKZA 1P2DA 1RJEA 2O3TA 2VTDA 4QLAA 2AOUA 2ZPUA 2C5EA 3PIRA 3WBFA 1WNTA 3HYRA 5KOJB 4FJ1A 4DJ5X 2NTNA 3DMDA 4WGFA 3CG4A 1CXZA 2BUBA 3IBFA 4UMFA 1IXZA 1J8FA 1YI1A 1KY2A 2FR0A 4HH1A 4ND6A 3HTXA 4W5RA 5F4ZA 2D54A 4Y2TA 1TJ5A 5JAQA 3QPAA 3K53A 1SGWA 3PEYA 2D0PB 3R3VA 5DM1A 1BVRA 1I3LA 1WB5A 2ZIAA 3DMHA 7REQA 4KREA 4YV1A 5AVWA 1JZQA 3QW2A 4S1WA 3AHHA 4DQKA 1XFAA 4DSAA 2R8RA 3DFKA 3TI7A 1KBZA 1L1RA 3T3HA 1TLTA 1F2DA 4KE9A 4O5AA 1ENOA 3HS3A 2B0CA 4QUIA 3F2VA 3LECA 4KBGA 3ZLTA 3QQ5A 1T91A 1WB6A 2H0AA 3CEAA 4UHCA 4G0WA 1I5OA 2DR0A 2JD1A 5C5IA 2NPFA 3UKOA 1IAQA 3ITEA 2EKLA 3NAZA 4MWSA 4QRIA 4FGJA 3ZWBA 1K1EA 1P1CA 3MQFA 1XXHA 1PFYA 2JHCA 2OVFA 2K5UA 2PKCA 3KEOA 4PAWA 4QREA 4DJTA 3W0LB 2VSXA 3RVSA 1JG2A 3VYWA 2F43A 1UK7A 3OZUA 2WJ3A 5A9SA 3K0KA 3SX0A 1DU4A 1O7JA 3HFSA 2X9QA 4ERXA 2NU7B 3A32A 1Q7CA 4ETMA 4IDFA 3KTAB 1NQOA 1KEPA 3FKSD 5KTKA 2PSJA 3IBGA 2EW2A 4M36A 4RLQA 5CR9A 3A9VA 4R84A 2J9FA 1XF9A 3A1VA 4YDSA 4CDNA 4MKIA 3T3NA 3CSDA 3R5HA 1MR3F 2FQXA 1CE8B 2HNKA 1C29B 5LFAA 5LNK1 4PICA 3A7DA 1RWXA 1VHJA 2WMDA 4RSMA 4V0LA 2Y4OA 2OCIA 1XZMA 1FFHA 3DPIA 3QFCA 2CEKA 4BNIA 1TUBA 3E9EA 1KPHA 4RV9A 2ZI5A 4HNGA 3HXMA 2FRXA 4NOLA 3C0KA 4NVRA 2CYBA 1CR6A 4TS9A 1NDQA 5JE8A 1QQ7A 4A03A 3VZCA 1U1GA 1IY9A 1Q0QA 2QG6A 5CGQB 1O94A 1SXQA 2D8MA 1KC1A 3O73A 2Q6VA 2EFDB 1C30B 4QQNA 3WYDA 4B1FA 4CIWA 1TT5A 3CBQA 3H42B 4HNVA 1G20A 3GLIB 1EX7A 2ZRIA 4KR0A 2OLKA 3OSUA 1BH6A 4B3HA 4EYSA 3OIFA 3EOAI 1S2IA 2WF8A 3L0CA 4EJFA 1G5IA 1KI3A 4O6VA 3DM5A 1ZNQO 1W5SA 5EXPA 3V4VB 2KHZA 4YIKA 4YFYA 4CV1A 2B1RA 5FADA 4P4TA 4IPTA 5J2UF 4WXPA 1YS9A 1NVKA 4PQRA 3ZE2B 1L1EA 5LUAA 4GNKA 4OLHA 4RHCA 4RK1A 1CIJA 2VT3A 3AH8A 1SIUA 1VECA 2M32A 4LOKA 4FNGA 5BQFA 2BFNA 1TGYA 1DBVO 2RGGA 3G5AA 2GZMA 2EKDA 2PNJA 5C3UA 1LBIA 2A1UB 4QQ8A 4FLEA 4RTJA 4PYOA 3ZV5A 3URKA 2Q1YA 3WNBA 3N2GA 2CNWD 2J5RA 3GNTA 3MS7A 1P4GA 1GNSA 5EXEA 3DKRA 2COUA 2VHZA 1NW9B 2JCGA 2PWZA 1BRMA 5T4FA 2REBA 1DQSA 3STWA 1SVLA 4UE2A 1E2NA 3DQZA 5DO9A 3AKCA 4C4AA 4FUQA 3QIAA 2P6NA 3IQWA 4EG7A 5JRJA 1IRIA 2FE4A 2I78A 3TFOA 1DX9A 4TTAA 1ECBA 2O0HA 5LMUB 1G55A 2EJVA 3Q3HA 4EW6A 4BZPA 1QBKC 5F77A 4DQXA 3W5IA 4M9ZA 1UEIA 4K9SA 3H0CA 5EWMB 3DTVD 1HZZC 5K3OA 2Q3LA 3N2NA 1FFWA 3DW3X 3CXRA 3E1SA 4OBBA 3IBTA 1YKSA 1QVAA 3AY6A 3DBLA 4NQZA 3RBXA 3WA7A 3EPLA 1GPAA 3GBPA 4Q47A 4KB5A 2UUOA 3G88A 5H4GA 2ZJ2A 3DCJA 1L7QA 3IE0A 2A57A 1OYYA 2OCBA 5ALLA 1QMPA 4WA7A 4K9QA 4EH1A 1TC2A 3ZY4A 4J0KA 3SQMA 4D9HA 4DDUA 3T1YB 3LW8A 3DKPA 3V32A 1NBIA 5KSYA 5HJ5A 3L04A 4EUSA 5DN6A 4ZZ1A 1O96A 1VCHA 3QU9A 4J1QA 5LOVB 2RGEA 2WV7A 5GGYA 1DQRA 3TVDA 1CR2A 4PIVA 4X20B 5AJZA 2WSMA 4BX2A 1RRFA 1WXGA 4YRKA 1QGAA 2VCEA 1KY4A 2VAPA 3KQSA 1JR3A 1Z0AA 3C3BA 5FO1A 4ZVSA 4RD0A 4HNTA 5ICCA 1C41A 1OFVA 3IQEA 3Q5GA 4A8TA 2HO5A 3DB1A 4LDAA 4ZALA 4WY5A 4YAOA 3ON5A 5HMLA 3UMGA 1C8BA 3TXYA 1CU1A 1C9EA 2QMYA 1I32A 4OHXA 3WK7A 5ENDA 1J00A 3CW9A 4E2WA 2VJYA 1G2QA 4MW0A 1XZNA 1O95C 4MKHA 2RHDA 2R8EA 2CK3A 4RD4A 2EGGA 1ULSA 3R5TA 4ZYWA 4OI1A 3P4UA 4L4ZA 4MVCA 2X4LA 2ASEA 1EQ2A 3FTNA 1ECCA 2Z1MA 4KK4A 4WK6A 1ZNYA 4WK0B 5CP8A 4V1CI 4Z4GA 2O5CA 1NVEA 2CB9A 3EVFA 5B3KA 4BMYA 3K6SA 3A6PC 2V6GA 1HZZA 2YASA 4FD3A 1Z29A 4IICA 5CRIA 5AK5A 4CM5A 1GQFA 3OMXA 2C58A 2PFSA 3SMQA 1SU7A 2F8MA 3LA6A 1QS0A 2BHLA 3QBDA 4MROA 5B58T 4EA7A 1V43A 2DY0A 3PBKA 2OSVA 4KVFA 1E1MA 4OO3A 3SJ7A 4LYGA 3DA8A 3N05A 2GBGA 4H60A 3DFZA 3RYCB 4QOSA 1A9OA 1E9VA 4QL3A 4QU5A 3RJTA 2OXRA 1B4DA 2RMKA 1CCWA 2PV7A 3RVQA 3FN4A 2WQ7A 3L7DA 2L19A 3WJAA 1M5TA 1TK2A 2NPOA 5KOYA 2QRGA 4I1UA 2R6GA 1LQ2A 1QZUA 4HX9A 4M9XA 3A4MA 4HWTA 3H5AA 2NUAA 1RE0A 4FT4A 3OFNA 5CDHA 4KIWA 4UDOA 1JVNA 1L7MA 2IV2X 1Y4UA 1MJHA 2XRYA 3AB7A 3C3DA 3IEMA 2BDEA 2OTCA 2VP2A 1IH8A 2ZULA 2A9KA 1QLHA 3U62A 4YRCA 1XTSA 5CA0B 3B9PA 2WJZB 4MQBA 3WYFA 3KZXA 4MVJG 2YZ2A 4R9VA 2GMWA 3FMIA 2PX0A 1BX1A 4NBLA 1FJXA 3CUTA 1Z7GA 3TJZA 2IOQA 4RMJA 1J0AA 1X1QA 4FJ0A 1I6WA 3DO8A 2FK7A 3BE5A 1H2FA 1YQGA 4O5OA 1J70A 5CIWA 4RLSA 1O95A 1MB9A 4R2JA 4NOJA 5IAKA 2ODTX 3PPVA 4AZ3A 3JQGA 5D84A 3LD9A 3R3JA 2HJWA 4YT5A 1BYUA 2O8CB 2OK8A 4EKEA 2HEIA 3B3GA 3X1WA 3QXXA 2HF2A 5LLDA 4J2TA 4WUTA 2PGIA 4RTNA 3GUUA 5M7EA 1KZYC 4UTXA 2RHJA 5JANA 3GPBA 2FOIA 1RRCA 5K05A 2DFNA 3FH0A 4IJ5A 4L8YA 5EPOA 1WXHA 2ZTHA 1E9DA 4L4YA 2X6TA 3WK6A 3P5BA 2VKTA 4LTNA 1XWIA 4OMUA 3QTBA 4TXJA 2ZBUA 2XUQA 3A26A 2IYVA 3FDJA 3U49A 4KLZA 4AKSA 1BE8A 1E7SA 1N0IA 1GKUB 4HN9A 4YTEA 3TRDA 4AJHA 4FT2A 3NW9A 3GDFA 2H1LA 3M9LA 3SOPA 4CHTA 1HQDA 2I4NA 4JBXA 4I8XA 4N0QA 3KAQA 3PRJA 4EKNB 3R3YA 4JP2A 2VSQA 2ZBRA 4DARA 3RSHA 1QFMA 2J59A 2P2SA 2Y0DA 3C87A 3WRXC 2JEYA 2GLTA 4ZIRA 2A86A 4TKUA 3U17A 3BOSA 2LDXA 4RD2A 4R8LA 4IXTA 2DUMA 4Y2UA 1NN5A 3AI2A 3V8PA 4F8EA 1P18A 4BAUA 1VI2A 1MG5A 5EFZA 3F5FA 4C4XA 1Q3TA 1BU5A 2FUG1 2II6A 2YN0A 3GEMA 4PHTA 4YRAA 2AFVA 3A1TA 3UY4A 4L4SA 3QPCA 4TXNA 1E2UA 2ZSHA 4UCQA 2Q4TA 1GUYA 3PRHA 4X85A 5ECGC 3WGYA 1AGXA 3VR2A 1HUQA 3UKDA 2HHHB 1J1ZA 2VVTA 5I01A 3MUEA 3EH2A 2PYZA 4L08A 2J5KA 4DR1B 5IJZA 2YV1A 2QD3A 1XDWA 4IMJB 3OZAA 3O90A 1U99A 2V1UA 1FFXB 2YS7A 4KRXA 5JSQA 4Y0AA 4EITA 2QM8A 5TGTA 2F9LA 3OPNA 3KT6A 2VSNA 1Z68A 3JYLA 3UT6A 4F2WA 1DSSG 3HYCA 4C7VA 1ZUWA 2Q6KA 4PLCA 1TQ8A 2FSGA 4C0LA 3TOZA 5CHEA 4GQAA 2IPAB 5BN1A 3NX4A 4N4AA 1CZOA 4M7PA 4TUYA 3R8CA 2LR0A 1OLXA 3RVBA 2YWGA 5HQJA 3RYIA 3DAYA 1JHUA 1ZOSA 3ZVRA 5L4NA 4RM3A 1I01A 1SBYA 2PL3A 1I1QB 4YJ2A 4HXEB 1AHHA 2IX3A 4V02A 1FFCA 1JIQA 1TIPA 1LW7A 4B71A 2ZROA 4LECA 3GRKA 5HKKD 2VZ8A 1CDDA 3N58A 1Z26A 5TS3A 3DQPA 1ZVKA 2IYNA 4ZTBA 5EMKA 1MJNA 3OZEA 1T4GA 4G4IA 5ICEA 1JI3A 3E22A 1KIFA 3EGEA 4JFRA 5FOQA 1SM4A 1RLJA 4GAEA 3SIRA 3VKUA 3K35A 1E3MA 5AW4A 2POCA 1X13A 1PR0A 2ZAOA 4YFVA 3KOUA 1ORRA 3KSZO 3L7OA 1O8CA 1AMUA 1TO1E 1V8OA 5CDUA 1M2KA 5HXAA 2ZUEA 5AK3A 3EIOA 1M6EX 4IR7A 3BVPA 4MGHA 5LLSA 4F1WA 4BWFB 1OIXA 1LDNA 1PS9A 2YNMD 3VX4A 1EE2A 2GTHA 2V6MA 3W4KA 5HRAA 4BP8A 3QMMA 2CL0X 1RLIA 4BATA 2V0GA 1R4MB 1NVGA 2X4GA 3JD2A 2ENUA 3DKKA 3N2ZB 3FPFA 3VH1A 4UFOA 2XCRB 2FW1A 3OLXA 4KVZA 2PKRA 3P5SA 4AXXA 3LHFA 4I5EA 1R2QA 3OZBA 1GA1A 1GL3A 3GA0A 4R41A 3RE1A 3TSZA 1M1YE 1BJRE 1PL6A 2Q5IA 1ZH2A 1GPDG 2WW8A 4Q9AA 4RVUA 3UOGA 2Z04A 3GGCA 4KO3S 5DWVA 1EK1A 3RT9A 2YV5A 2C3OA 4QM7A 1J0EA 3AR2A 2WJPA 3IIMA 1L5WA 2R66A 3OX1A 4EB6A 5A4JA 3HZZA 2HQSA 1ML3A 3KJZA 4D25A 4BZZA 1RPTA 4F9TA 5BP7A 3L5KA 3KYJB 1LLDA 3PJEA 3I04A 2EL9A 1Y9EA 1A2KC 1PEDA 1OC2A 2O2SA 1EXNA 5D85A 1H5UA 2ADFA 2LKDA 3E8SA 3S44A 3FJYA 2QAJA 4XGNA 1BD3A 1OBCA 3QYFA 4GC5A 3PNSA 2C3YA 3OT1B 4HPJB 5D1NA 4BB5A 4D1YA 1E58A 1MO6A 3JCZA 4J1TC 4NSNA 4WLUA 2B82A 3FY4A 4UM8B 1ZXLA 1J9ZA 1L5GB 4KRYA 1M34B 3ROMA 4U39A 1SVWA 3RUHA 4GF5A 5B7GA 5L7WA 3R3SA 1OPRA 1X3LA 3KYBA 1NDUA 5TS2A 1RMQA 1MVOA 1TRKA 5K3AA 4G0YA 4LF4B 4L6CA 1B43A 2VOEA 2WKSA 2WAAA 2XUOA 4N5LA 4IIHA 3WKBA 2PE5A 4DMGA 2WOOA 3IFSA 3ZEAA 3ND6A 3T3EA 5CBKA 3SIWA 2ZWOA 1IN4A 1DC3A 2WUDA 3LO5A 5DNAA 2BHSA 5KPDA 1QWOA 1OXVA 5CM9C 3RCBA 3DDOA 1OAOC 2EIXA 2IEZA 1SJ9A 1QCDA 2QYTA 1MD9A 3V6LA 1I13A 1SUEA 2H31A 3OECA 3K71B 2HU8A 4YRMA 3VAYA 1SCUA 2XHEA 5FUYA 1D1PA 3SZRA 1JSXA 3FA2A 3WAJA 4DYHA 2V3CC 3D3KA 1CY0A 1SUPA 1L7EA 2DFDA 3P9KA 5HJEA 4D9BA 1UDRA 1JXMA 3SC2A 2GZ3A 2PTHA 3RVNA 1W36D 3T5DA 1PDVA 2H5IA 2C1EA 3MWEB 1RWMA 4ENWA 1RIIA 2GS9A 4NU6A 4RYLA 3MSXA 4YQYA 3VJKA 4D0NA 3WV5A 4K8OA 4L7VA 4EVQA 2QRHA 1EVKA 5A6VA 2H07A 3F78A 5IBCA 3RRXA 4WBXC 2HMWA 3KUUA 4UHJA 1YE3A 4BZXA 3GPIA 1FSFA 1RM0A 1UMDA 4S2UA 4KR2A 4EA8A 1X1SA 4LHSA 5DI9A 3VYSB 3CLHA 3QSYA 1CLUA 1XMPA 3K2BA 3W5HA 4HQ0A 2WVHA 3H9BA 3VR5A 4C04A 2OHJA 3K5PA 4ZOEA 1V45E 1FF9A 4YT8A 1H42A 4U8HA 1CK4A 1I10A 1SRRA 3AO0B 5F21A 3RREA 2PUAA 2X1MA 3H9CA 1BQEA 3P0HA 1UBMS 1T5DX 3R5JA 4NRDA 1U65A 3UT5A 3WIVA 2ZE8A 3ZHVA 1AXGA 2JFWA 2QW8A 4DDKA 2NSLA 4HDSA 5B7NA 4N65A 4O1IA 4FI3F 2XDYA 4DB4A 3FCYA 1WWKA 1T4DA 3D4PA 4AC9A 4HXFB 3OIYA 3VTKA 5BQ5A 2ATVA 4PYLA 2A33A 5LYJA 2O7VA 3JWGA 1E5QA 1PBTA 1PJLA 2FUEA 2A7XA 2HA5A 3BMXA 3BTSA 3EASA 3FSEA 3HGQA 1KDTA 3HLYA 3K30A 1BROA 4FFOA 4P22A 4Q34A 4LV6A 1U4NA 1N6KA 3NTVA 3BH0A 2ZB7A 5J43A 2GXUA 3HI4A 2QZJA 4HWKA 5CK4A 6Q21A 1ZMTA 1E2MA 2PZBA 3KKLA 4CTOA 3VO1A 1H6DA 2IXBA 3B3JA 3MHPA 3OOSA 4CCSA 2OCKA 4DIUA 1R15A 4WVFA 3LXMA 3PNVA 3FSRA 1J99A 1ZGBA 1VRVA 3MMPA 1Y8ZA 1WULS 3JQ8A 2GZSA 3G2OA 3GD7A 4TT8A 3L40A 3FGNA 4RZIA 4IG9A 4JU8A 3VGPA 3VR3A 4C6TA 1M0SA 3GDGA 1VLZA 3BJRA 1ZHOA 1FW8A 1WF3A 1Y8QA 1DWOA 2AYZA 3GHHA 4QG3A 4KWIA 1C4XA 3MLEA 4Q4AA 2IZ5A 3BA6A 3ZDQA 5LJLA 1G2IA 3VV2A 3FMFA 4HAZA 1AA6A 4DMHA 4ZOBA 3C45A 2O50A 4KXVA 4Z2YA 3P9PA 4XB6B 4CMEC 5T3UA 2H9YA 5JO0A 2MR5A 1EWVA 2WMNB 2J3QA 1XQ9A 2WDPA 3NM4A 1VIYA 2P90A 3B3AA 2GPAA 3KUXA 4TYPA 1J7KA 2VPPA 3MN1A 4H1UA 4WD3A 5FUQA 2JLUA 3KLOA 1EUCA 1NUTA 3QOXA 1WXDA 3NOXA 1FQWA 1N6PA 1JQKA 2Q6IA 3W6NA 1JF8A 3CLSC 4MUJA 9LDTA 3ETGA 2R60A 3BF8A 2XCUA 2XUDA 4D6YA 4YJGB 3P0IA 1X8LA 4IVNA 1Q83A 4G36A 3EDOA 2YJ5A 3X0DA 1LBSA 5KHAA 2NGRA 3PGKA 1P62B 3BICA 1POWA 2D8AA 3VH3A 2QYHA 2VDUE 4UVHA 5U4XA 3H5LA 4CM7A 3I76A 2PQ6A 2O2GA 1QIFA 3QI2A 4BJ3A 2AK3A 3P26A 3R0VA 4NHOA 1PHPA 2JASA 2XKKA 4QFDA 4TM7A 4BFXA 2BFDB 3TIIA 1IM5A 4QDZA 2G04A 1I2MA 4Q37A 1U2RA 4HH0A 2G6BA 4EHBA 1BDBA 1Z22A 4JJAA 4L8VA 2A1TR 4D4HA 3KCNA 5FUVA 4B8YA 1ZOIA 4HAYA 2ZBVA 1EDOA 3NHSA 4AJIA 5JVDA 1EMDA 1H1LA 3EDRA 2GN2A 2N0SA 3FMVA 3BBLA 1E9AA 1J0XO 4TYNA 2BONA 3QYPA 1IHXA 1JLLB 4MI6A 1N8KA 1Q91A 1Y5LA 2ZIVB 5GM1A 1F6BA 4ZDKA 1LVHA 1V16B 2IW3A 2IP1A 4NFHA 1RAEA 2R8BA 3D1LA 2O52A 3DWEX 3A3PA 5ALYA 3AFNA 3F4BA 1YJCA 1NRWA 1U0RA 4WCDA 4P8RA 2FQQA 4W7HA 4AULA 3AF4A 1EB9A 4WERA 5B3AA 1DIRA 1GGNA 1KERA 2YWJA 1PDOA 2XDQB 2NTVA 4LF6B 1REQA 3M5PA 3RWBA 3ZWKA 5AOAA 3P9ZA 4X71A 5IAGA 4JROA 4D8XA 2LVBA 4EGJA 1M54A 4ZRMA 3TW0A 1U8YA 4TXLA 3U56A 4IX9A 3MRTA 1ZBDA 3TZ6A 1AS0A 2ZAIA 1NVVR 1P3DA 3CF0A 5DI3A 3TCXB 1RDFA 4KYTA 2QRJA 1L4FA 1N0HA 2EL7A 4IH9A 4I3FA 2PLAA 1IXSB 2OOKA 2ZSBA 4JJZA 2QM7A 4UD6A 4HJXA 2P9EA 3UJ6A 1FLNA 1Z2CA 3BSWA 4X7MA 5IJ9B 1HFKA 2BBSA 4BQOA 4PLTA 1XCPA 2NXEA 1RC0A 4BFSA 3INTA 3OE5A 4F8YA 1DHTA 3A1FA 2GSWA 2ZXEA 4HH3C 5H83A 5ALQA 3N70A 1VQ1A 5DYYA 1T15A 2YL2A 2XVYA 3DEYX 2PHZA 2QUBA 4L28A 1TU4A 4IW3B 4JZYA 3QKRA 4YRSA 1ECGA 2JLBA 1P8AA 3I34X 5ED4A 3BGDA 4PNHA 4PSUA 2MIIA 3L4KA 1NQVA 5AWFC 4B3DA 1MAHA 3CIFA 3TJMA 3AJEA 1U2TA 4DDVA 1CFJA 1E4EB 1V8ZA 2XQJA 4IHJA 5JJKA 4F6RA 1TYAE 2R4UA 5C4MA 3UMCA 4RGYA 2GHTA 2WLTA 1E0KA 3FTDA 3FRJA 3IP3A 4N12A 3ZCSA 3IBYA 5K8TA 1AIPA 1KDRA 4DA4A 1PW7A 3VKGA 4D74A 1CEQA 4JIGA 1WHTA 1F20A 2FG7C 4JI6B 3WK8A 2JBAB 5T4HA 2H51A 3RHSA 3E8XA 4C9BA 3NHZA 4F71A 3RUAA 5DK6A 5C8XA 1TAUA 2RGWA 4KYIB 4NENB 2CV0A 3WRWA 1CY7A 4I9UA 1F0PA 1AN9A 1I7LA 5DLEA 4X65B 4AF7A 4IUBS 2C8JA 2BWJA 1TVKA 1HQKA 1T6XA 2IF0A 4AP9A 3VQTA 2NZVG 4KN5A 5CDFA 3EBOA 4DRXB 3DDWA 3OPYA 2I87A 5EG5A 2GJAA 4LGMA 1V9SA 3FLBA 4R0NA 1L5RA 4DCCA 4DMFA 3KD3A 4ZYVA 2VN8A 3B1FA 2HFJA 1FIUA 1RXYA 5CLQA 4UTVA 2BKUA 3ER6A 3R7BA 4ZV4A 3U4QA 4BJ1A 1GYPA 4J03A 2FMIA 4DEVA 3RU9A 2BMWA 2WWYA 1F8FA 2BSQA 4N03A 3DDZX 1CUAA 3ZY3A 5CH5A 1OX4A 4RFSB 3AESB 1AGPA 2X1LA 2BAGA 4R3WA 1GZ7A 3AM5A 3C48A 1AM4D 2FFHA 3HNRA 2WTMA 3JTEA 5LR6A 1T8RA 2EJUA 2DZDA 5AW8A 3NONA 3K05A 4EG5A 1TZMA 3KU1A 2XUJA 3OHSX 3HSYA 3NHRA 2GO1A 2J3DA 3Q7TA 4XZ3A 4U7WA 1L5HA 4C21A 3U16A 3C98A 2YJNA 3ZVKA 4OSOA 3IOCA 5CAEB 4L85A 5KC8A 3FNHA 1X1DA 3BN3A 4TT3D 5KAMA 4DDTA 4DR3B 3PFWO 3IUNA 3RASA 5JZMA 2GHIA 3VMFA 2X0JA 3O84A 4QFCA 3E15A 3AVVA 4BKMA 4WNIA 3K9FC 3TAXA 3HPQA 1GG9A 2NT3A 2GT1A 3L8ZA 1S8OA 4DF3A 2OO5A 3QTTA 5TRTA 2R96A 4RZXA 3C16C 1NVFA 1T34A 1UIRA 2XD4A 4X84A 3SJZA 5JJBA 5JS8A 3P0FA 1CQIB 2NO7A 2OK7A 3GRAA 2WWHA 3G49A 3GLQA 2FLVA 3IQFA 2C9OA 2B1GA 4FNMA 4U2GA 4CMHA 1UPTA 4L22A 4O33A 1T2FA 2JFYA 1NVUQ 4TV9B 1PD0A 1KQPA 4RVHA 4LMAA 4MR8B 4W1PA 3LTNC 2ADMA 2WM2A 5F1KA 3T9EA 3VHXA 3MT8A 2MSLA 4B4OA 3TW6A 3CGWA 4TWIA 1N2GA 1NM5A 2W6IA 4H15A 3RHZA 1PIWA 3R8XA 1QHHB 4EG8A 4LVCA 4OQ4A 3L6BA 3KWLA 2V6JA 3IO3A 3MT9A 2TS1A 4CM6A 3VDNB 5BRAA 5KS2A 5LZ5A 4KXXA 3N59A 2EARA 5K20A 2CFIA 4FPXA 5A0VA 5BYJA 4D0SA 4UJ3A 1RYNA 3MINA 4ZVMA 2ZYGA 3EK2A 3ISVA 1QCZA 1OI2A 1VKJA 3CBGA 1N5IA 3IP7A 2VG8A 5BN5A 5EHXA 1PR1A 1D8AA 4N39A 1IEQA 1OBOA 1DE0A 2L0XA 2EW1A 2PGXA 3FOCA 3HYLA 3L1UA 5EC8A 5AM5A 2Y6UA 1U0GA 1UM9B 3H1AA 4V0MA 1NATA 3DL7A 1VXOA 3G0GA 5LDGA 2QQFA 3ROKA 3OIVA 3HBJA 2WIDA 3OF5A 3GJQA 4MS1B 3GRUA 4KVGA 1NTRA 2WINI 3R0ZA 5DHRA 3RS2A 3WLQA 2I6SA 4LMPA 2FMHA 4D3FA 2ZWVA 4RJJA 4E3ZA 4B4UA 1ZGGA 1ZM2A 5F9MA 4DCNA 1DP4A 2DHRA 3EQ7A 4JJ8A 1R5BA 1PVDA 2F3UA 2EOAA 2I67A 4O4LF 4W8HA 4BO2A 2Z56A 3WTBA 2B0JA 4IZOA 1DAHA 4N49A 4KTTE 4A0GA 3UJNA 1A72A 3UEOA 2BYTA 3E2MA 1Z35A 4HAXA 1ISMA 4ZO6A 4ZFNA 1L7RA 3ND7A 1M7GA 1P9RA 4QOHA 1XK7A 1H9AA 2O3SA 2N9UA 1B15A 2Z08A 2QX4A 1HI9A 4GFDA 3OSZA 3JQRA 3X44A 4JLUA 4HAWA 4M0FA 3RVMA 2FFRA 2BZ0A 2HDHA 1ZISA 3V4FA 5LL6P 2IS4A 3B78A 1U4OA 821PA 1MB4A 2CHVA 3O1HB 3N5CA 2VNKA 4B35A 1HQYE 1HFEL 1KI9A 4YDHB 5L4LA 2ZSKA 4MK4A 1ZS9A 2BH9A 4UUOA 1PCXA 1PK8A 1Z5UA 3A9TA 3OX3A 4ZO8A 5LA6A 5BSTA 2YW9A 3NU1A 1RM5A 3ORHA 1U5BB 5K6RA 3LW7A 3BX1A 1HEYA 1W59A 3VYTB 1A2OA 1B2RA 4YALA 1GTRA 2JGEA 4YAEA 1T13A 1QH8B 1UMCB 3LNCA 4JB3A 1KZ4A 1OFHA 3HMQA 2I4TA 2HN9A 3ITKA 4M1KA 5K8IA 2WUWE 4CLHA 3A04A 2OL4A 3HBAA 1YSCA 5DMXA 4PAMA 5ADVA 1VE7A 3L4JA 4GE3A 5AIAA 5DM70 3GEPA 2W9XA 3UAVA 3UK1A 1XPUA 3LYAA 3S3TA 1IZ8A 4BQIA 2FOXA 4YJHA 2VEOA 4HBGA 2PT5A 1C9MA 1G3RA 2FPIB 3L4SO 3LC0A 4Y6LA 3F8SA 3JRWA 4OHVA 5B1IA 2I5PO 4FEGA 2FFJA 2XV1A 1TC1A 3FDFA 4QG7A 1JB9A 4DCOA 1JR2A 1V5WA 3UGKA 3LH5A 1NNI1 3UHJA 4HDNA 4U9HS 1JHVA 4WLEA 3PQEA 4TS1A 3KOZA 5DHFA 3IKTA 3RBAA 1KPGA 2NNLD 4BU1A 1KP9A 1U3VA 2QAIA 3QVJA 1ACJA 4RK5A 3WDSA 3FWYA 3ZWPA 1NPTO 5ENVA 2OECA 2Z5LA 3UG6A 1QCYA 3RQSA 1AKQA 4XWAA 3NVMB 3ETLA 1BQ3A 4J91A 2PX4A 5ES3A 1X7WB 1U4SA 3MB5A 4B6QA 3Q0IA 4DTIA 2Z5FA 2POQX 3UWOA 1EXDA 4MQ4A 4F21A 3BHNA 3GMSA 4HYYA 3UFXB 4H6WA 4WOBA 2ZUFA 1SD1A 1FUYB 3KXIA 1FQJA 3L8EA 4QHTA 3H13A 4LVUA 1NYLA 3WP0A 5L3SA 5EYPB 1MENA 4Y18A 1V4VA 1QYIA 2Q4RA 5DWQA 1HO3A 5D7BA 1YBMA 4TL9A 1AGNA 2X0FA 1SUCA 3C6BA 2REXB 3PNOA 4ACAA 1W5BA 3S1SA 4CEJA 1QYXA 3GEIA 3EC7A 3R6GA 1TGVA 1C3OB 4KYUA 4D9FA 2ZITA 1PWHA 3HBMA 4G5QA 4KFTA 1JH8A 1PL0A 1RHRA 1XWFA 4GM1A 3T9CA 5DNWA 3INRA 5KSPA 1NLFA 5JCJA 4D9MA 2PRZA 3G23A 4R7TA 1NXQA 5CEFA 4HQOA 4GT1A 3FWZA 4BEJA 3IELA 1I4OA 1KQOA 1BMTA 2DE0X 3VPGA 6AT1A 3EVDA 3KV1A 2LZ0A 4QYXA 5KYWA 1Y1TA 1G4AE 1RJWA 3KZNA 3PKIA 5CT9A 4F4FA 5J4HA 1H1TA 5EQDA 3RDPA 2WC1A 3R75A 5IZCC 3ONVA 1QNFA 3M4ZA 2YHIB 1NKVA 1CR1A 3AGQA 4UHBA 1GAXA 3SHTA 1GY8A 4PZLA 1C8VB 4ZVPA 4QVIA 2ZVPX 4PNPA 2VQEB 1UQRA 3DLPX 1XUOA 2MYPA 1IMOA 2ZBEA 4C5AA 2HYDA 4EMSA 4EZIA 1MOSA 2O8VA 2R7AA 2XZTA 4IQ8A 3IEIA 1T8TA 3IXLA 1VJ0A 1U8CB 4P3PA 3AIMA 2C4HA 4AMVA 4M8LA 4ZVLA 2OV3A 1KORA 2WSYB 4POOA 5HA5A 1SY7A 4KQFA 1NBME 4TSFA 5CU7A 5AVXA 1IWOA 2Q5CA 3MM4A 1YFJA 2J1LA 1D2RA 1S9DA 4IVRA 5K5EA 4ADSG 1QORA 2DERA 2Z0MA 4V0NA 1YB5A 3IEUA 1R0KA 1QR2A 1YFKA 2WUEA 3L8HA 3IERA 2FB9A 1FNBA 1TM5E 3GJYA 3ABRB 3LKZA 4XYGA 3VOAA 1J2EA 1UXGA 1X39A 4P34A 2G25A 1WMSA 1ZRMA 4NJEA 2QXUA 2NQ2C 2YUIA 4NMWA 4NZZA 1YOBA 3WGUA 4YY3B 5TE9A 1J07A 2ZM5A 1X9HA 3DS8A 5EJIA 3IV9A 4Z4CA 4KQKA 2VUSA 3PIDA 3STYA 2G1AA 2Y1KA 3QIVA 2ZPAA 1PUJA 1EP1B 4DOMA 4C7MA 4HNAA 3VBEA 2Z2JA 3IOMA 4XFDA 3ACDA 3KZVA 2WYIA 1U1FA 1ID8A 5J58A 1TEZA 4PHCA 3NTRA 5CFQA 3L7CA 4MAMA 4DLTA 2GPJA 4KUHA 3BHJA 3NFRA 2RH5A 4JJIA 3FPCA 3PS9A 5F5LA 3ZHBA 3PDIA 1JDBB 3VAZA 5IZCA 2JLSA 3A3OA 4PZPA 1PFVA 4MUXA 2O5RA 3JARA 3REGA 5IFKA 1ZQ1A 3GJZA 5GQSA 2IHBA 4RL4A 1YZTA 1KBOA 1GDHA 1KJQA 1XXHE 2QNIA 3H4TA 3KHKA 3MZ0A 4CKZA 1HR0B 2I66A 3TQTA 1X7ZB 3OWHA 1AGYA 3OEWA 2Y92A 2CZCA 1THZA 2GAFA 4GX2A 4JP8A 3EWSA 1NN1A 4LDPA 4ONEA 1VBFA 5HTKA 1B0PA 3C6ZA 3E7PA 1DFIA 4E6EA 3HHPA 2QPTA 4INZA 3ZZNA 2X23A 1RXWA 4DNXA 2CDRA 3UGTA 1Z4KA 3HCDA 1DO2A 2QLNA 2YWXA 1RMYA 3LHIA 3LI2A 3M6MD 4QDJA 2Q45A 5F33A 5HILA 3OOWA 2ZB3A 1RMTA 2E5FA 5AKIA 3GAZA 5THKA 4RZUA 4U6SA 1A9RA 4N9QA 1XALA 3RG8A 2ZWIA 3LY8A 5DYTA 2Y1CA 3MRSA 3ZEIA 1S2MA 2YW2A 1SA0A 3QMPA 1G18A 1OXTA 3W6PA 4L27A 4MARA 1BIFA 1ESNA 5IBQA 3V8BA 5JH7B 4FXPA 3Q9NA 3MS4A 2PKQO 3ZDZB 1Z4PX 2FAXA 2REQA 4IGFA 3V8MA 2FMUA 1YT5A 2WM9B 2AI3A 2YC4C 4IZHA 3Q7PA 3L6EA 4O0LA 5HIIA 3E9QA 3LZCA 3U44A 1M6NA 2PRJA 3FUXA 1EIWA 4TQ9A 4UAJA 1QVVA 4RPIA 1VPTA 1Z4QA 2WHYA 4Q7EA 3BFKA 5COAA 5BW4A 5KTYA 2XAAA 3V8EA 2F3RA 3RU2A 4YJDA 3QF4B 2YFQA 4ETWA 2IE0A 3HNOA 4D98A 2DWPA 4EMUA 1E2DA 1O03A 4WXRA 1QV6A 5A04A 3GU3A 2Q6TA 5EGSA 4L4XA 4UM9D 5IAOA 3QPVA 4FZJA 4L6AA 2YXEA 2VJPA 2FHSA 1D9XA 1UQTA 3TQOA 1EDDA 2LPMA 3UBMA 4G8CA 1L9KA 3CR8A 4LGYA 2AG5A 1FA9A 2CLFB 4IL5A 1JPNA 2J87A 1A1SA 3O3CA 3JQFA 5G0VA 1F0KA 3BGOS 3T6KA 1SHLA 2O1EA 5MHTA 3PHLA 2DBVO 2H16A 4JODA 4URFA 4BNYA 1ZM3A 2CY0A 1C0LA 5JRZA 3U09A 5JZOA 4M0LA 2OHGA 4W8GA 4X54A 2IIVA 1Z16A 5EWLA 5G1PA 2MINB 4P80A 3WKEA 2PCJA 3GGOA 3X1MA 5C8YB 1JKIA 3A4NA 3DTYA 3JPYA 3P96A 1FDVA 3TZQA 4US2R 2AE2A 4WFJA 2O14A 3HVUA 1F3OA 2IP4A 2P4QA 3H9JA 3HXKA 1ISJA 4OG2A 3WGLA 5KYUA 4AUMA 4TN1A 1T36B 1XGKA 1NNLA 3JZFA 4ZVKA 3NYQA 4NV1A 5KYYA 1I7DA 4JI7B 5FWYB 3DZDA 1WUJS 3AQ4A 5EXXA 4I5FA 1U8ZA 3IDAA 3R6WA 4XIYA 2VO1A 3C5HA 2J85A 3M4NA 4RHTA 3DMTC 5D3ZA 3UK0A 2CMGA 1NV8A 1HG0A 5E3IA 1N6HA 3LLSA 3EBLA 3V1LA 3TO5A 3JQPA 4XYEA 3MVEA 2WMYA 1VOTA 1J9GA 3U7QB 3LY7A 4PFSA 4XJVA 2Z57A 1X1CA 1XTQA 3PT9A 4NPHA 3IQDB 1EK5A 4EL5A 1PJ2A 3HKCB 5TPWB 4DLUA 4F11A 1Y3BE 1ZK3A 3BE8A 1K5HA 3UNXA 3WBJA 2CFRA 5BR1A 3H4IA 5DWDA 3IEKA 3ET5A 3KVYA 1NVXQ 5IAJA 2CKMA 3U4IA 5DVZA 1K88A 2B7BA 1FFYA 3ZXXA 2WKWA 3R9XA 1JG4A 2DHQA 1AZWA 3OFJA 3OD5A 1WMEA 2R85A 4JQOA 3KOWA 4KIJA 4MGKR 4ZREA 3A31A 4BJ5A 1SELA 2GK4A 4LWQA 5AVUA 2FSVA 3O94A 1RWKA 2FXVA 4DY6A 2JDID 1P1KA 3FYCA 3HL4A 3PWZA 4LC1A 5HTOA 4D9IA 3VUEA 3QNWA 5DB4A 1JA0A 4IFIA 4NMHA 1OLSA 3F3KA 2HIAA 1W1UA 4RIEA 4X8OA 1IHDA 1RAGA 2G0NA 1MW9X 2ZJAA 2H2AA 1QB7A 2Q4EA 3EVNA 3GW8A 3L92A 4AKEA 1DC8A 2XUKA 4B6EA 3C1AA 3BB1A 3HFRA 2VJNA 4MQFA 5BSGA 1CZRA 3CIOA 2DLDA 1Z82A 4UZFA 4YCJA 2XGSA 5JALA 1IBCA 1D04A 2ZI9A 3HC7A 5JVDF 4U2FA 1RYYA 1UZUA 3NBMA 2X42A 1OXMA 2IQ5A 4Q3BA 5JLAA 1FUKA 3KQYA 5BSEA 2BM8A 1FTQA 1XEFA 2QU7A 3ME5A 3OPYI 5E9QA 1FMJA 1N0VC 1VE5A 1NMQA 2W2PA 4ENSA 2ZUBA 3C3EA 3L82B 1SR8A 3SMVA 2JCXA 4Y2RA 1RS0A 5K3DA 3G0BA 2EKZA 2R97A 4D6PA 4JD5A 3PQ5A 2WB2A 4Z4IA 1L5QA 2FXIA 2YFKA 1XO1A 2PS1A 1RHKA 4LHZA 4PIPA 3DZ8A 3SDBA 1BAPA 2P5TB 2HRBA 2V7QA 3AF1A 3B7WA 2OESA 2CVHA 3QTLA 1UANA 4JYPA 4M76B 1TI7A 3WYNA 5AVRA 5JYDA 4Z53A 1A71A 3FBGA 1UBGA 2LP4Y 3FWNA 5CFRA 3ZKAA 3KHUA 3O8QB 2IHYA 3IDFA 3WKAA 1K0UA 5EJMA 1Q7GA 1DAEA 1ZN7A 2EQ5A 3E81A 5SY4A 3VTFA 3UMJA 1FP7A 2JKYA 3D6VA 5H1YA 2I1VB 3Q5EA 2EHDA 4D4KA 4ZTZB 3QVUA 3W8FA 5K3FA 4MVJH 1F1JA 3C8UA 3WRYC 3JZMA 2O8BA 1TAQA 3D4OA 4IDGA 4FOTA 1ZXBA 1IBRA 4MPPA 1DXQA 2PRYA 4OYRA 5AUPB 2REOA 5JY6A 4A5SA 4ARIA 3MTQA 4CLEA 1FX1A 2VJMB 3M82A 3PWKA 5KWIA 5HOQA 1RJ9B 3TLMA 3BIOA 3RFXA 4YRLA 3P2JA 3HRIA 4X1YB 5JD3A 2HTFA 3UAZA 4ZYLA 5JLJA 1HRDA 4XKJA 4PRYA 1OPXA 2W6PA 4A6PA 2GAOA 2ODEA 4LBVA 1P2GA 2QP3A 4R31A 5H3HA 3SG0A 4P5EA 2WWGA 1UEJA 3AW9A 4U5XA 2NLOA 4US0R 2VA9A 3G2NA 4DLVA 4QUGA 3G6WA 3MNFA 1ENYA 3QEOA 4OJTA 4LY3A 1DKOA 4TX1A 3ILHA 4S1PA 4E4YA 3IAHA 3X43A 4TYQA 4CFYA 2A94A 3CR3C 3GLUA 5AI6A 1PEAA 1QGOA 4RKRA 1CUFA 4U6QA 1I4WA 1W0JA 4ATNA 4RTOA 2JFFA 4O2LA 1U81A 5BN3A 2H92A 4QX6A 5J4LA 3R77A 4CTMA 1DKNA 5E8JA 1B1CA 1L7OA 1KH1A 221PA 3THRA 1KQGA 3IESA 3WJ1A 4FYWA 1KDOA 4PZDA 1C2TA 1JSLA 2ZP1A 3I83A 1UP7A 1SKUA 2WUGA 4IEEA 4DLPA 5CDTA 4KR6A 4LRXA 2ZG6A 3F7TA 5DYGA 1A9ZA 1L4BA 2Q4OA 2BTEA 3KKNA 2CL6X 4QQKA 1KO7A 1PT9A 5GVRA 1R8XA 3BB4A 4KMRA 4R5MA 5EJ7A 3OQ1A 3R0IA 3VYVA 1H66A 3UXHA 4BKRA 5BNWA 3O3MB 5F7ZA 3SXUA 1SCJA 4HUQA 4U7JA 5DF1A 3WLAA 4BUJA 4BE7B 5CVCA 5KMGB 3HB7A 1VE9A 2ZCVA 3HZRA 1QF9A 4I6JA 1X7XA 1FU4A 5HIMA 3DXYA 3T61A 2G06A 2JHAA 1PU2A 3QUCA 4N40A 1RBZA 3RYHA 1NFQA 4HOYA 5EHNA 5I9MA 5ALIA 5A5DA 4ID3A 2AG6A 4MW5A 4FINA 1YUMA 1UC9A 1LZKA 1N6NA 1OIWA 3LDAA 4ZMSA 1K5GA 1ZJJA 1R6XA 5B1EA 4UBMA 3MLAA 3IHKA 1TJNA 4IH4A 1A9XB 3MFYA 4I4IA 4RMIA 1UH5A 1YB6A 4Y3UA 3EZFA 1WB9A 2PKWA 4KFUA 1JNYA 2E9SA 3CNQS 5TB5A 5FWXA 1VRWA 1YKFA 3OUZA 2CXQA 2XH8A 3ZS8A 4S1TA 4F93B 1T6ZA 2WHXA 1TF5A 1JEOA 3E3AA 3AIKA 1M1NB 2JJ2D 3QMWA 4MYSA 1FJHA 1QC5A 2QN3A 4GYWA 5B6JA 4IUYA 3CRMA 2G88A 1MAAA 4MKXA 1ZI9A 3GGJA 4J9UE 1W1IA 2DQZA 1XP8A 3CVOA 3IOEA 2I6XA 2JIDA 3Q87B 2D06A 1EP2B 4QAJA 1XHLA 4YLYA 1T4CB 4QTUB 1VKZA 2YVLA 1XLWA 3NC1C 3GFPA 2DM6A 2VQFB 1B41A 4O4IF 2O2YA 4B76A 3O3NB 2EJWA 4BQSA 2I55A 1IK4A 2PGNA 2VK2A 2X8JA 1OILA 2GZAA 4Z3OA 4TWRA 2OCPA 1FFEA 2IZ0A 1YRWA 2V98A 2VHXA 3A9SA 1QE3A 4QFBA 5EE5B 3FE2A 4QPJC 5IH3A 3MUFA 2FPPB 5IYZA 3LIIA 3AV0B 2IUFA 4ZEXA 1D0SA 1P9NA 3X1DA 1F60A 1KRHA 4FNAA 2AJLI 1NFRA 3TEJA 1IPFA 2UDPA 5CB4A 5SICE 3GIDA 4FDMA 5C8VA 3DAGA 2LKCA 4CHGA 4EJ2A 5A5GA 4GGPA 4ZZ2A 1YVDA 4IOKA 2XVAA 5K4AA 3VKHA 1ECPA 1OQAA 2G63A 4NJMA 5JY1A 1WG8A 1H8EA 1UDBA 2IC5A 5C80A 1GP2A 4YJ2F 4R2KA 5HKKA 2W5UA 4G56A 4O2RA 4HUTA 3GLHA 3EW7A 4FFPA 3GGPA 4E21A 3PLAE 2F3QA 1AUXA 1NULA 2BGJA 1EGAA 2RHCA 3T8YA 5JSFA 1OMOA 5JCOC 4L07A 4CM8B 2R00A 1RU3A 1NONA 1E59A 3ZNOA 2OCDA 1OI3A 2R8OA 3SNHA 5I47A 5M2QA 4X41A 4AECA 2B9EA 2DUNA 1AF4A 4WPGA 1HYQA 3Q9SA 3ILXA 4PY2A 2O2XA 4RHEA 2ZBDA 1MQ9A 2W2TA 2VK8A 1ZX1A 4BUCA 1VJ5A 4MWTA 4O1MA 2B9VA 3WWOA 4LRWA 3M34A 1Z39A 5HQ3B 2IWRA 1Z0FA 1UJCA 1IEXA 1NBEA 1CS0A 1H93A 5B1HA 1NFFA 2B4RO 3DG9A 3IILA 5AKZA 2AC2A 3PC8C 2UAGA 4TVBA 3AF3A 2RFLA 4HH4A 1K6JA 3QE3A 4J0IA 4MV4A 4U6NA 5HZGA 3SZLA 8ATCA 3U26A 4WJZA 3X3HA 1M7BA 1HMYA 1OBVA 1P8JA 2IIQA 1B0ZA 3MSCA 3GLGA 2DLCX 3IUQA 4L75A 1W85A 2NUTB 2X2PA 5CNKA 5T8KC 2RHLA 2Z2XA 4E7PA 5LA6F 5E2BA 1W0KD 3B53X 1HOTA 4XDHA 1O8BA 1RRPA 1XN1A 1O57A 3HA3A 2C9CA 1T2EA 3TQSA 2DCUA 3JQCA 2VYNA 3SAJA 4J0HA 1Y37A 2V7XA 2FWNA 4IOJA 4ZO7A 3DBHB 3W05A 1QP0A 521PA 2OY0A 2AVNA 4NNJA 3ZLJA 4GR5A 1ELOA 3ELUA 4PTLA 1N9ZA 4YP5A 4CLXA 4NG5A 4EHFA 1SIWA 1OBHA 3ZD8A 3FPKA 5GINE 1XDGA 2ADOA 5F1PA 4DMRA 4QDKA 1A50B 4I46A 2B69A 2VUTA 2WTAA 3A4IA 4QDXA 2X8AA 3LBIA 1R4NB 3N2LA 3NWOA 4P53A 4UDYX 3T5AA 1I4TD 1BDHA 1UZNA 3ICPA 4RTRA 2YKGA 1EFVB 3AETB 2WU8A 2YV3A 1YRYE 4QOFA 4WFQA 1YBHA 2PVPA 5JEDA 4BKOA 1GZDA 1XA0A 3FNGA 1UMKA 4FHGA 5AHRA 1D6SA 5BYBA 3RS5A 3ROQA 2QLJA 3JQDA 4DPKA 1EFPA 3ZHZA 4HZIA 4NPAA 3TLYA 1B73A 1Z45A 1KAQA 3CLSD 4R2XA 4WOJA 1GKLA 5LXTF 1D2CA 1PJSA 3CINA 4TLBA 4OOFA 3VC7A 1PR2A 2W37A 1CG6A 2P7HA 3FCCA 1SC4A 3OZ7A 4MWDA 2BF4A 4ND5A 2QN2A 1ILEA 4URVR 3UM9A 3CX4A 4BNLA 3RWMB 4FB5A 3IAXA 3MGCA 1Z15A 2UUBB 3A9WA 4YXWD 2WT9A 2HWKA 5JQGA 2HJRA 3FRHA 1AQNA 2G4VA 3CGGA 1P9OA 4IIJA 5I7WA 1RCFA 2BHTA 1M75A 2EU8A 2Z3VA 4NONA 4B8ZA 4DMUB 3RC1A 5L3QA 1WVIA 5D3KA 3CR7A 2NO0A 4N54A 3D7SA 5EZYB 3WLKX 3IAS1 4BNXA 2PXAA 2ZU6A 1Q7TA 2V54A 3IT1A 1S2OA 2QLMA 4MIEA 3W8RA 1JILA 2IYOA 1E61A 3C6MA 3U9TA 3BWXA 3I04M 4ZWNA 3P4XA 1R0RE 5MDHA 1FLDA 1E63A 2FV8A 3CYFA 1NLMA 1IC6A 1X0XA 2PEYA 3QLTA 5JAIA 1E2PA 1MTOA 4D8TA 2OAQ1 4OH7A 3HEAA 2Q2OA 4MUHA 4NFSA 3FROA 4Q4LA 3ROXA 1M2HA 1LDGA 5B6PA 1H4QA 1OWOA 2D2EA 4NFYA 4R01A 1Q0TA 3GCZA 1LDBA 1K92A 1WCIB 5ESRA 3KR1A 5DHPA 2AEEA 3O2JA 3D0QA 2VPTA 3ZGLA 1DUIA 1R6VA 1JUDA 3OZXA 1AV7A 4H77A 3PU6A 4KHZA 5E1MA 2ISCA 3UH0A 2OQIA 2NACA 2P7IA 1H0KA 3EIQA 4OU5A 4PSVA 4A5OA 1U6IA 4B3XA 3ZE7A 5K9ZA 2Y76A 4RORA 3U80A 1EQAA 2UXBB 4DTCA 2VZLA 4NC9A 5A7GA 4CKWB 3VI3B 3OP1A 1Z6YA 4MQEA 2IDZA 1CQZA 4LY9A 4ESOA 1GV0A 3RU3A 4C3ZA 2VUUA 2ONYA 4GXNA 3P2YA 3IBSA 4RQTA 5L9AA 3HJCA 1YE5A 3GIWA 3PT5A 4O8ZA 3L84A 4M1YA 2QZ9A 4FGZA 2IU6A 2JNWA 4D8YA 2PSHA 3BIFA 3RIEA 3IPLA 1GUAA 2C00A 2IXTA 1DO8A 1T25A 1Y1QA 3KB8A 5TEVA 4CMIA 3GUVA 1ODJA 2TMYA 3EFOA 2QAGB 1CJUC 3VDMA 3PGA1 2GVNA 2QTLA 2RKWA 3I53A 5EKDA 3IO5A 3CVJA 3DVAB 4K3UA 3NB0A 3C1OA 3DUWA 5EOVA 4CF5A 1JEAA 1IBMB 3G13A 4R69A 1QHNA 1YA8A 4YPOA 4JSRA 4E0BA 3DL2A 4WUVA 4C7JA 3K32A 3LVRE 1SCAA 5ELMA 1E3WB 4G0MA 1AQYA 3CCCA 3H65A 3NRJA 5CNIA 5HEKA 5MGBA 4W1RA 5TX7A 2R5WA 4YRFA 1J5EB 3BWVA 1MHPA 4GYYA 1JEDA 1Q77A 3DV2A 3GQBB 4KIGA 1U2SA 1TK3A 3D2CA 3RC9A 1JV2B 4DIBA 1OU0A 4L9RA 2XWSA 2BDUA 4WNAA 2QPLA 3WNVA 3HN7A 1FP1D 4UBNA 1GG2A 1YB7A 4EO7A 2W2OA 4URXR 3IKMB 3K0FA 1KJZA 1GTSA 2O5EA 3PXAA 4BFLA 1VL2A 5DNEA 2PIDA 5J40A 4ZOLF 1CY8A 1N8NA 4W9NC 1G0OA 5TDHA 1YZHA 3QE2A 1E4OA 1C3XA 3R20A 4QIHA 4YDRA 1RQLA 3UJ9A 4E5DA 3DAOA 3WHPA 2VNSA 4H27A 4HJRA 4ME6A 4TPKA 1D5CA 1L7BA 3RAJA 4AMZA 1DKLA 4ITUA 4CF4A 5BVGA 1RZ3A 1Y3IA 2OORA 5EVJA 3UUGA 4CR6A 1PE0A 1RWBA 1H8HA 2VBIA 3OCVA 2C2GA 3AHIA 3AIIA 1PR9A 2RAUA 4MICA 2YZ7A 2VYVA 1CUWA 3PTZA 5FR1A 4L5BA 1MDBA 1KMHB 4IGKA 3EQ2A 5G02A 1T1JA 2A92A 4CDGA 2VP4A 3QG1A 4TTQA 4WQMA 1G6Q1 5EIBC 3WAKA 1HC7A 3UMBA 3DYIA 1QIDA 3LQ1A 4C2BA 1OKKA 1E94E 2VRBA 2IDJA 1KI4A 4KIUA 1JE1A 1AB6A 1H22A 2ZYTX 3HU5A 4KU4A 4UMDA 1E3DA 2K6GA 2QGZA 1JJFA 4GPAA 4HB0A 4PFQA 3VDRA 4X61A 1L5VA 3L6CA 1WZEA 4EG4A 2W6CX 4YRZA 3VU8A 4BO8A 4JDUA 3QX7A 3IMCA 2ZLBA 4NBVA 3GV0A 5HGXA 3W2FA 2H3HA 3D6HA 1N1GA 5JFTA 3A28A 2C8KA 2QA5A 3FCSB 3KYDA 1BXGB 4M60A 4P4SA 1Y5RA 4QICA 1HDZA 1MEOA 1EWQA 5B2FA 1SQ0A 2YZNA 5DTQA 5LBIA 3K92A 2NU8B 1GIAA 1QRAA 2GM5A 4TWJA 2FF7A 1AE1A 1N5MA 1E20A 4MWBA 4EHJA 3ZWOA 1SXJB 3DD5A 3UWPA 2HK9A 3TAHA 2O05A 3KXLA 4JFAA 4AICA 1X8XA 5J1SB 3D3NA 4ZAVA 4CQNA 1M6VA 3M1AA 1HWYA 1TPZA 2ZYIA 4LXYA 2Y9PB 1AV6A 5KSZA 4OQEA 3QH4A 3VZDA 3Q0TA 1Q0SA 1XMOB 4KQMA 5JCPA 1ORVA 5K09A 1TMOA 2SICE 1EP3B 2Z8YA 3DZIA 4ND1A 5GONF 2AQKA 4XWOA 3NGXA 5D8DA 4AJLA 1TLFA 1U0NA 5ULLA 1LA2A 1JDTA 2X0RA 4RETA 1AHNA 2NVUA 4DZZA 4GYKA 4HGYA 4WKGA 4YROA 5LJIA 1H1DA 2R1ZA 1NUQA 3DWIA 1K8YB 5A05A 2WWFA 4NX2A 3QMVA 1H2ZA 3AWIA 3ZWDA 4YAJA 1PQYA 4OQNA 3W1VA 4BL5A 2N42A 2HB6A 1J8MF 3TTUA 1Y8RA 1UDCA 2C9ZA 2FQWA 4PTZA 1WKVA 2EBFX 1KKMA 3M9XA 5AHKA 4B4DA 3LT5A 1RVDA 3WFZA 1OV4A 2FPLA 5CDFE 2ZE5A 3HZOA 5CLLA 1M0WA 4DLSA 4H1HA 2A5GA 4B2IA 4JLBA 2F9MA 3M3PA 5F3DA 1LU9A 3PXBA 2Z8XA 4IH1A 4H7FA 3EXFB 3FDZB 1QYCA 5T41A 3HDVA 3AEUA 2WJJA 1JECA 4NU0A 3ZWYA 2WR8A 2ZRHA 3I6YA 2OLEA 2C2OA 2ALJA 4L51A 4D0RA 1WO8A 4O4JA 4OGGA 3FWKA 4DMCA 2H2GA 3ECAA 5A3RA 3WKCA 5HMMA 4EQ6A 5CBPA 3E7FA 5EJ4A 4B87A 4GHWA 4UXHA 4C29A 1DRUA 1KFJB 4BGIA 5I9LA 2GLUA 4Z99A 4OCZA 4CT5A 1BFDA 4QE3A 4AP5A 1ZK0A 2J30A 5CVVA 3SVTA 2PX6A 2PU5A 2QQGA 5BMVB 1NI4A 2AHRA 3C8MA 1NMXA 4FWBA 5JCZA 4UOEA 1ZO8A 2QVYX 4A2QA 4DL9A 2TMKA 3HPRA 2BMAA 3AZPA 5BSKA 2IELA 3MTAA 5HR5A 3L7KA 4FILA 4NJOA 3TLGA 3KXKA 5DLYA 3V8NA 4GX1A 1GEEA 1XTKA 2XMRA 4EW2A 2WU3A 3JVIA 4HNRA 2YMLA 5JCJD 2FPGA 3OKPA 4I4TB 3VR1A 3EDYA 5C1PA 1P1JA 3NGLA 3ABZA 3GVIA 3PD7A 3FHCB 2ILTA 1AUOA 1V26A 5E6SB 3VO2A 4C4TA 2GWHA 3PX7A 3OC6A 3SY8A 3FUVA 4X92A 5K0ZA 5ANRB 4JT2A 4EI7A 4EK9A 4BHTA 4RPLA 1LWOA 4J75A 1U9YA 3QVGA 4PX2A 1S96A 3R40A 1V37A 3DO6A 1TEHA 5BW5A 1I30A 3QITA