4ZMSA

Structure of the full-length response regulator spr1814 in complex with a phosphate analogue and b3c
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
207
structure length
207
Chain Sequence
GLVPRGSHMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEMVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Response regulator
publication title Structural characterization of the full-length response regulator spr1814 in complex with a phosphate analogue reveals a novel conformational plasticity of the linker region
pubmed doi rcsb
source organism Streptococcus pneumoniae (strain atcc baa-255 / r6)
total genus 74
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zmsA01
2QVCA 2FMHA 3OQMA 3MIZA 5JS1A 3F6CA 2PUGA 3HM9A 4IMIB 5KQPA 4N76A 2LBPA 2YHAA 3HV2A 3CFYA 3L49A 1RPJA 2FQYA 1PEAA 3EODA 3EGCA 2LIVA 1U2PA 1A2OA 3RVLA 4W5OA 1B00A 5IEJA 5I4CA 3LKVA 3TD9A 3MA0A 4MQFB 2CWDA 2MYUA 4ETMA 1QNLA 3EAFA 3SM9A 3M6MD 4W5QA 4MR7B 3RVJA 2FQXA 4YS6A 1LK0A 1Z26A 3IDOA 4XAQA 5IUJC 1BDIA 4NV3A 4KK4A 3N0RA 2JBAA 1DRKA 2W42A 3HSYA 1PNTA 1Z25A 1ISRA 3CZCA 5TPWA 5HKOA 3Q7SA 1M5UA 1DBPA 2Q5CA 4IILA 2FEPA 3JY6A 1U2QA 3T95A 1TLFA 3CNBA 1MVOA 4RK6A 2O20A 4RK4A 5HQJA 1SD5A 1NXWA 3CLKA 5E3JA 2QV0A 3HCWA 3CU5A 4Z0NA 3I45A 4G0ZA 3N8IA 1TM2A 1NXOA 1DZ3A 1JFSA 2GWRA 1D1PA 2PUCA 4W5TA 1GCGA 4EVRA 6ABPA 2IKSA 3NBMA 2MYTA 4O5AA 4MR8B 1DRJA 4ETNA 2BGGA 4KREA 3OO1A 2ZWMA 2HPHA 2J48A 3O1JC 3OO0A 1ZN2A 2FEKA 1QMPA 3O1HB 4LDZA 5KQMA 1KRXA 4KVFA 1SXIA 3HUTA 4YCSA 1DC7A 3H1EA 2LUOA 2WRZA 1UDRA 3N6VA 3N0WA 2PUAA 4RWEA 4GPAA 4NICA 1QP0A 5EWMB 3OMXA 1ZVVA 4EYOA 1HEYA 1C0EA 3HS3A 3OLWA 4MQFA 4N47A 1Z18A 4EVSA 1SRRA 4TLMB 5IUKC 3RVOA 5IX8A 4MR7A 3RH0A 2OQRA 1GCAA 3FFWA 4EY3A 1MB0A 2LPMA 4N03A 3O21A 2PMCA 4IGAA 4ZJPA 1JBEA 2VK2A 4M88A 2F8SA 2MYNA 2FKAA 4WZZA 5C5EA 2OENG 2QZJA 1Z17A 5PNTA 1FFSA 2HSGA 3GBVA 4IF4A 4XXHA 2JK1A 5TQJA 3RVKA 2F8TA 1DCFA 2NZUG 4TMYA 1ZAYA 4MR9B 4KPYA 3RVRA 2RDMA 4N0QA 1FFWA 2QU7A 1IIBA 1OXKB 3C6QA 4Z9BA 4ZPJA 5GQSA 1M2EA 3QEMB 2E4XA 1TJYA 3H5WA 3HDGA 3KLNA 4W5RA 3LUAA 3O2JA 5JNUA 4WXMA 5DLEA 5FWYB 1RXEA 1K68A 4MR8A 3Q7RA 4YO7A 5JS2A 4ZMRA 3F73A 1ZY2A 1GLGA 3H1FA 4G86A 2FXIA 5DCLA 4ETIA 4N0PA 2PUFA 1PEYA 1JH9A 4KRFA 1U0SY 3CG0A 1QQAA 3W9SA 2HJ9A 3Q9SA 2PUDA 3GL9A 4WXEA 3OLZA 4EYKA 1QPZA 2GKGA 1JF8A 5EWLB 4JASB 3O75A 4Z99A 4E7OA 3NNSA 3LTEA 5EWMA 3RQIA 3B2NA 3KS9A 3A3KA 1ZGGA 2FW0A 3MYYA 1D5WA 3FMVA 3NHMA 2E4UA 2GBPA 2YHBA 2MYPA 3QEKA 1ZESA 1L5YA 3ILYA 3KYIB 5JNVA 4RK0A 1DBQA 3JVDA 1TMYA 5CNJA 2QW1A 4YRZA 3LUJA 2A9OA 1SXHA 2QVGA 4KQ9A 4WWHA 4B09A 4NCBA 1JYFA 3BBLA 3RVMA 4OLAA 3LUGA 1YMUA 5KC9A 3GWGA 4FB4A 3QELB 1NXPA 2L19A 2HQBA 1TVMA 4RSMA 2A9QA 3IP7A 1ABFA 3EQZA 3BILA 3HZHA 3RVPA 3URMA 4LE0A 5DKFA 4MR9A 4G0YA 2FLKA 3QLTA 4Q7EA 3TB6A 4N41A 4KK3A 1KGSA 1QQBA 1NTRA 3CTPA 3MM4A 3QEMA 3N0XA 1BDHA 3QX8A 5DGCA 1ISSA 3MQ4A 1RNLA 1W9HA 4JA2A 3GV0A 5TPZA 5FWYA 1YS6A 5TQ2A 3QLVA 4EGSA 4QYMA 3M9XA 4G0PA 1JFVA 2X7XA 3SY8A 1ABEA 3BRQA 3H5IA 3KG2A 2GX6A 5IEBA 4Z4IA 2PKXA 4Z4FA 9ABPA 4P98A 3UKJA 1VRVA 1Z13A 2A9RA 1Y1LA 2L18A 2PJUA 4MS3B 1QP7A 1CYEA 4Y9TA 8ABPA 1GUBA 3LUKA 3Q15C 4H3HB 2M98A 5TE9A 1VPWA 5EWLA 2R47A 4MQEB 4EVQA 3IP5A 1DCKA 3H5TA 1JWLA 2NT4A 3CZ5A 1RZRA 2IOYA 1JDPA 4RY9A 1JX6A 6CHYA 1J56A 1BDJA 3G1WA 1OXBB 3HDVA 4EYQA 2L2QA 1ZDMA 1QKKA 2DRIA 4DADA 4NCAA 1P6UA 5FWXB 3HK2A 3KSMA 1R8JA 2IPAB 2JRLA 3I5AA 3F7NA 3JVIA 3GYBA 2B4AA 4RK5A 3TO5A 1SXGA 4LDAA 2R25B 3RVNA 3D02A 3QX9A 3P9YA 3QLVC 2V0NA 3IPAA 3QLUA 2CHFA 3C3MA 4LZLA 5TPZD 4CBVA 1QO0A 3T6KA 2JVJA 3H75A 2FVYA 3VNAA 1APBA 2VUIB 1W25A 1P2FA 4MRMB 1YTUA 4XFKA 2WJAA 3CKMA 4MPTA 5KC8A 3OQNA 4F06A 2HQRA 3K4HA 5IBQA 1FSPA 4KQCA 1DCMA 4IRXA 3C3WA 4NQRA 2ID7A 1EHCA 4MYRA 1A0OA 2I6FA 2QSJA 4MS1B 2CHEA 2R4QA 3KLOA 2PUEA 2RJNA 4RY0A 2WB4A 1XHFA 2RJOA 1RZRD 2AYZA 2FTKE 3T8YA 2VUHB 2A9PA 1U8TA 2L17A 2IYNA 3FDFA 3MF4A 3H6GA 5CNIA 3IP6A 3UUGA 4O1HA 1AB6A 3QLUC 4Z4HA 2LP4Y 3EJWA 4OG2A 2WY2D 4PE5B 2PE5A 3FGZA 4MS3A 1ZH4A 2HQOA 1LBIA 2PLNA 3HJFA 4LRQA 2B1JA 1JFTA 1QO0D 3JTEA 4F11A 1A04A 4L85A 2P4UA 3C97A 2E4ZA 4MQEA 4O1IA 5T7BA 1KRWA 1T34A 4KFCA 1MIHA 1YIOA 2PL1A 3HEBA 1LBHA 2JVKA 3RVQA 4HNQA 3Q41A 4G0QA 3DLBA 2FEWB 4KNYA 3OMWA 4RXTA 5FWXA 1I3CA 1YMVA 3LUFA 4Z4EA 1JHZA 1NY5A 1PUXA 4Z9AA 2TMYA 1YK0A 2IPMA 3TX6A 1YK1A 1EWTA 3A0UA 5CNKA 4YP9A 2FQWA 1E6MA 3JPWA 3O74A 4PEVA 1F4VA 2JBAB 1C4WA 4Q6WA 5KI6A 5F64A 4JAVC 1NATA 1Z2EA 2P9HA 4JOQA 3SQNA 1Z16A 4MRMA 5BR1A 1LJUA 2IPNA 4FE4A 3JPYA 1BAPA 5IULC 1P8AA 1PNRA 5KQGA 3TMYA 4MLDA 3DBIA 2GI4A 5IC5A 3GBPA 2FSPA 1M5TA 2JCGA 4JB2A 3LFTA 4ZMSA 2FMIA 4D6XA 3C3KA 2NT3A 1JLKA 2WJWA 4OBBA 1E6KA 1VKRA 5C5CA 4MS1A 2FN9A 4RKRA 4YLEA 3HUUA 4F3TA 4PZ0A 4PICA 1ZITA 3HO1A 3I09A 3K9CA 2MSWA 3LUDA 5IUNC 3H5OA 3LOPA 3GRCA 3H1GA 4OATA 5TQ0B 1YVUA 3MMNA 1DP4A 3SNKA 3KHTA 3KTOA 4LE2A 5T3YA 2H0AA 4HNSA 5FBKA 3D8UA 4S05A 3O1IC 4HNRA 3T38A 4YR7A 3R0JA 1EFAA 2H3HA 2E4VA 3M9WA 1Z12A 4H60A 1Z15A 1Z2DA 5EWJB 3ROTA 3LUHA 3FFXA 5CNMA 4L4UA 4D6YA 3NHZA 2JVIA 2QR3A 3LMKA 1WETA 3JS5A 4RU1A 3H5LA 4G0XA 3Q7TA 3RVSA 3KCNA 1LJLA 1RXIA 2M1ZA 1MAVA 2FLWA 2VYCA 1ZGZA 5ED4A 1D4ZA 4RXMA 1CEYA 3VNBA 3ILHA 2AYXA 4JP1A 2E4WA 4D74A 1U04A 2NZVG 4LE1A 3KYJB 2CD7A 2PUBA 1EAYA 1ZH2A 3OLYA 3IP9A 4RK7A 4TN5A 4GNRA 5BQ3A 4FE7A 4ML3A 3LUCA 4RK1A 3DGEC 4W5NA 1AB5A 4DQDA 3L6UA 3CHYA 1XWWA 1JDNA 1EWVA 3NNNA 4MGEA 2FMFA 3E61A 1ZHHA 3EDCA 3HVRA 2JB9A 1NXXA 4G0OA 4Q6BA 3QELA 3O2SB 3KKEA 2MSLA 4RXUA 5TQ0A 3BRSA 2RGYA 5KQLA 2QXYA 1M2FA 5B3JA 3QK7A 3SG0A 4F8JA 4HYEA 5FBHA 1D2AA 4YGXB 5CHYA 1USKA 4UHKA 7ABPA 4MS4B 3H6HA 5HM6A 3O2QB 3N75A 1EWKA 4H3KB 4ZYLA 5EWJA 1FQWA 5JNRA 4E7PA 1DC8A 2IDMA 4DN6A 2PAFA 2FN8A 2MSKA 1NXVA 4WT7A 3OLVA 2PL9A 3NNDA 4G0MA 4KV7A 2WWVD 4Z4CA 1S8NA 2KYRA 2N9UA 2R48A 4OTZA 5DTEA 4RY8A 3EQ2A 1DJMA 3SAJA 1GUDA 3DGFC 4JB0A 1URPA 3DLHA 3OQOA 1JYEA 2ZAYA 3EULA 5KWSA 5ABPA 1K66A 1L5ZA 1VLZA 4RDCA 3LKBA 4RV5A 4YWHA 5B3JC 1D1QA 4G97A 1BA2A 4QICA 5BRJA 3OM1A 3GT7A 2FMKA 4RS3A 2XDYA 4XLTA 1F51E 1KMIY 3BREA 4RZSA 4P1ZA 4S04A 3FFTA 1QP4A 1USGA 1CHNA 3OLXA 4LX8A 1NXTA 4UHJA 1DG9A 3UK0A 4TLLB 3A10A 3CRNA 3DZDA 3E3MA 1XHEA 3ROFA 2ID9A 3G85A 5D2CA 1JL3A 3I42A 4YV7A 3KJXA 2E4YA 5TPWB 1NXSA 4KMRA 5TQ2B 4WUTA 3S99A 1BVHA 1MB3A 2IPLA 4MLCA 5JNSA 3F6PA 4OLBA 1H9CA 3CS3A 4IMJB 5GOTA 4EYGA 3N53A 4PYRA 1DBWA 1E6LA 4RKQA 4XASA 5HSGA 3CG4A 1PHRA 4MS4A 4Z4GA 2WMYA 4KZKA 5BRAA 5JNTA 1USIA 2NUBA 4EUKA 3HXMA 3IPCA 3H5VA 4F12A 1YS7A 4QPJC 4XARA 3OM0A 1E2BA 5JNWA 4MAAA 4QYWA 3A0RB 1FFGA 3GA5A 1P6QA
chains in the Genus database with same CATH superfamily
4DR3B 4OOFA 1ZMOA 4ND6A 2NYVA 4GOJA 4NP6A 4R2XA 3MW8A 1QPGA 3MIZA 2X5NA 2W2PA 1ADYA 2C9CA 2OO7A 3MQFA 1ODFA 2ORVA 2OXFA 3LC7O 4P86A 4I6JA 4PR3A 5JPCA 4OX9B 4C21A 2VJYA 4JUBA 1KO1A 1W0KD 3V8PA 5KVSA 4BY9E 1N2ZA 1NE2A 3EGCA 3I6MA 2B36A 1O8BA 3DBVO 2AEMA 4XWKA 3HQ4O 2AMJA 2V97A 3ZJTA 2YIMA 2O3JA 1RD4A 1DTEA 2IWRA 3TEJA 2JIOA 3ESDA 2CMFA 2DQ4A 3GUHA 3ISTA 2WKRA 3K8YA 4DMCA 4QQNA 2EKDA 5E6UB 4E6PA 3IQDB 3PJFA 3V7UA 4BS9A 3J81k 5B7GA 1KF0A 1PNQA 1LKZA 2F3RA 1OFUX 3VDQA 1T3ZA 2IYRA 4TV8F 1CZNA 1GFZA 1BDIA 5DYGA 1ZZEA 4M6WA 4NU8X 5KSYA 1IXZA 1A27A 2XITA 3RC8A 3IXLA 4RQTA 2CDCA 4MVXA 3J80A 1RJ9B 3SZUA 1MEOA 2CVPA 3AL2A 4BDSA 1QHNA 3G2NA 3PTAA 1EUQA 3AGQA 2VWQA 1AN0A 1SUFA 1ENYA 5A02A 1S7GA 3QSGA 3FYUA 4GOKA 2VJCA 4BECA 4XKJA 2ZTMA 3DWEX 5CX1B 2ZT8A 3ZDBA 4UUAA 3ISVA 4K88A 4KTTE 4NZZA 1J8FA 2EJWA 2YNMC 2P6PA 1KXZA 1I4WA 3KKOA 4O2BB 3QU4A 1BA3A 4NE9A 3T5TA 1ONNA 4N8DA 2Z5GA 1GL9B 1GKKA 5A3VA 1JVBA 1F2VA 2VHYA 3DLAA 3PUZA 4L28A 2W8BB 4UZSA 2OCPA 3UAOA 5TXGA 3UICA 3I0ZA 4UNSA 3ZKWB 1US8A 3NBYC 1DZIA 1PS9A 1QS0A 2HWYA 3VBCA 3OO1A 4KREA 1QDLB 1VZ3A 2F00A 1DDOA 3D3KA 1WMFA 1WUTA 1ESMA 2HH9A 3Q3HA 3Q88A 4O02B 3RUEA 3W05A 5LKRA 3WRYA 3CEPB 4LGVA 1BDBA 1E59A 1OBHA 2CNBA 3RJ9A 3ZDQA 1C1HA 5DEOA 5LLTA 1QCZA 2Y0DA 2CJWA 4BVHA 4EJ0A 1ANKA 4B48A 9GPBA 3CEJA 4RTOA 2CV1A 4BU0A 4AO6A 4G67A 4EDFA 4LV5B 4B3XA 1V11B 4P4GA 4B8YA 5DSZA 2O2JA 2B94A 4I8IA 3BGOS 4F5YA 5M2QA 2DFPA 3LYUA 5AOVA 2ASEA 1RFLA 2ON6A 4PHCA 1RTTA 3SF0A 3ZK7A 4QGSA 4RTQA 5BWNA 2QRNA 4FOPA 3OG9A 4DIKA 1OX6A 2NACA 3PS9A 4Q03A 3M33A 3B9PA 1NNUA 1VMKA 4LXYA 3V5NA 3IHWA 3FUTA 1QK4A 1GG2A 1SNYA 2QTLA 3BULA 3AI3A 4P80A 1B16A 1CF9A 2YRFA 4ODIA 1JBEA 4ZJPA 2CC2A 4CJXA 3ODGA 2WIJA 1SUPA 4E2YA 4BLWA 3E1SA 3OWHA 1VCIA 1G20A 2FFRA 3O0TA 3Q1KA 4JJ8A 4KBYA 2RKWA 1YULA 3PGLA 4DA6A 4XGKA 1NN1A 4M7RA 4ENWA 3WISA 5K8TA 2IOFK 4Q1VA 2WHRA 2ODTX 3LPLA 2B8WA 2LZ0A 1CETA 1E7YA 3QE2A 1TCVA 2RDMA 1XZAA 3QPUA 4YT5A 4KNVA 2IH2A 3B1VA 4EUSA 1W1IA 3P5BA 4RD3A 1X9HA 3RT9A 3TIVA 1T6XA 4LDNA 1HORA 5I8WA 3OZAA 4MW1A 4DNXA 3B1XA 3LP8A 3KE9A 3KYCB 2QUZA 2WMOB 1I3OA 3MTDA 4YHBA 3O9VA 2CZQA 2WE8A 3CNHA 2XVYA 3ELBA 4INZA 4O2LA 4RESA 4CM9D 4JJEA 1HZJA 1RWPA 1FFBA 2OZLB 3GP5A 3E03A 3HRKA 1NNI1 5KCMA 2ZI3A 4OHXA 3D5QA 2PEYA 3MS2A 5EOVA 3TW0A 5BN1A 2BN4A 1BH6A 1C9KA 5AUNB 1L7DA 2ZS7A 3N6RA 2VF8A 3O4VA 2XHEA 1G8HA 2M6SA 3KBBA 3MJFA 4LHXA 5TLSA 1MX5A 3ZHVA 5H82A 2GJSA 4Q1BA 3WGJA 1P62B 3SYMA 4JUCA 4ZI7F 5EIEA 1XTIA 2Q6KA 1DG3A 3CNOA 4NONA 5LNK6 4ZCPA 2OUKA 1JHYA 3C6KA 1JEYB 1NPYA 4P54A 4BC0A 4MROA 1TUEA 3LTEA 4MVJG 4HTFB 3DAYA 5FNVF 3FTFA 1W0CA 4YRKA 4D44A 4MQLA 5BVHB 4GPIB 4EKEA 1S2LA 3GVHA 1L5YA 2BGMA 3HY4A 4P34A 4S35A 5CHEA 3MMPA 2IGTA 4DLVA 3ZIUA 1OFTA 1VHWA 1TM5E 3L1IA 4AP5A 1TMYA 3D4OA 3GRZA 3PE4A 4FBMA 5CNJA 1K75A 4HB0A 5LQNA 1JYFA 1LTHR 5EUCA 3DKIA 1LQ2A 1N2CA 2I1WA 2XKBA 3SKYA 4DQXA 2B78A 3I01A 4IIHA 1EWQA 4MKHA 3QXHA 1ABFA 1J9EA 3WJ7A 4RIEA 1KO5A 3UAXA 3KUKA 1FSGA 5BUZA 1NI4A 4KR0A 1GZVA 4OFXA 2XTJA 2W7TA 4GC9A 4GLLA 5JAOA 5JZOA 3K70B 2ZRBA 4ZAZA 3AW9A 1M6YA 3DCNA 1EZZA 1P8JA 4F2PA 1MDBA 1Y8RB 4EGSA 4F2DA 5IJ0B 5IFLA 1B6RA 2JHCA 5ECGC 1DAIA 4DAEA 5KZMB 1BEZA 3BFPA 2GM3A 4PLTA 4XYBA 1DLIA 3R0QA 5EE1A 4P98A 1JFFA 3PJGA 4H08A 4D7AA 2PJUA 4BNNA 2QL7A 5JI3E 1GNPA 3TVTA 4JT9A 1GGVA 3OKCA 4J0EA 3DONA 4PC3A 5EESA 3QV2A 4DNOA 4IGKA 4BQFA 2NT4A 4C08A 4ALLA 3ULKA 2IV3A 5HZMA 4YUZA 6CHYA 1C81A 2FQ1A 4LXTA 3G1WA 4AJNA 1JDJA 2O8BA 2FWJA 3OTGA 2ZI9A 3I5UA 1CUIA 3TD6A 4ALNA 2ODNA 3RABA 3HXOA 1OA1A 1TQDA 2G67A 2QZPA 2ZSHA 3ICOA 1VE3A 4CKEA 1UPXA 2JZNA 4NU0A 3SZLA 1KAHA 4V03A 4AVYA 3D3QA 4I9NA 1WCYA 1CD5A 1WUJS 3E7PA 3NTQA 5D3KA 4DRYA 5IFKA 2POQX 1R9GA 4QTYA 2FVYA 1HPLA 5AM2A 5IKPA 3O1LA 2NZXA 4B31A 2FW7A 4RUKA 4HRAA 4YUAA 4MPTA 1GPNA 1EA7A 1YQEA 4WNIA 1FQJA 2QIPA 2JI7A 3LDFA 5DYIA 3WLIA 3W06A 4E08A 5JFOA 2ZSAA 4B82A 5AJVB 1F8YA 1W9MA 1YKGA 3HCBA 4NQRA 1GZDA 4L9WA 4R2LA 2W2XA 4DHEA 3AF0A 1DAHA 2QRHA 5DYNA 1GJRA 2B7LA 2CHEA 2C9MA 2VA9A 2RJOA 5IKEA 2W2NA 3AYXB 4XPIB 1ZRSA 1SZCA 2VUHB 2L17A 1U8TA 4Q66C 1FXWA 5AHKA 3UOWA 1VJ0A 3PQ8A 1KP3A 1VMAA 2D59A 4Z9YA 1NVTA 3UJBA 3ZHOA 3VV2A 1IQRA 1AB6A 2Q6OA 3GT4A 3ZDDA 3NPMA 4TYQA 4X7MA 3QTTA 1XA3A 4IM7A 4HAVA 1FW8A 1I6KA 4P83A 4XQ0A 1JQJC 5FLEX 2JH3A 4JU9A 3FRIA 4B84A 2KWIA 3HJFA 4WE3A 4L74A 2EFDB 3HFJA 2PSHA 2XPCA 2C3MA 3KVYA 4FVTA 1M2JA 5CFRA 3A1SA 3QVKA 5UKDA 4REOA 4EHHA 3I73A 1R9JA 4KFCA 5E4YA 4YJ3F 3A9WA 2W5UA 1JN0A 1KNXA 2PL1A 1FQOA 3SIXA 2OWDA 1X1EA 3FB1A 1F6WA 3AFIA 4DA9A 3DLBA 3ESCA 1TOAA 1JVNA 1KXJA 4W6QA 2NNWB 4H7HA 5DSTA 5F4BA 3MVEA 4KR6A 2IBTA 2PUVA 1P7PA 4EHLA 3SLRA 2QXTA 3V3TA 5CAEA 3VR4D 4M0DA 1AN9A 3WLMA 4YIHA 1BMFA 1EKXA 2IDZA 2QG9A 1Z0ZA 3OQ1A 4NFLA 2H4WA 4YY3B 5DISB 4C5AA 2Z1DA 2I6SA 4KE6A 4S1OA 4WERA 1SCKA 2QMQA 4LJ7A 2QN7A 3CRW1 2AK3A 3A1DA 2NPIA 3JQGA 5CVEA 2AUTA 3ZGOA 2RFLA 3TRHA 3KAJA 3JPYA 2AFHA 4F4CA 3KQWA 1M2OB 5L3RA 3TMYA 1VE6A 3F74A 1W29A 3KSAC 1A77A 2FSUA 1W1UA 3PX3A 4LXIA 1TB4A 3C3XA 3UCFA 4N5IX 3NWOA 4WTOA 4JLSA 3FHLA 3WX0A 1MX3A 1JA1A 4I4TB 1JKIA 1GQ2A 3FIJA 3OZWA 4YLEA 1HI9A 3PHGA 3M6FA 1JQ5A 3Q8WA 4K05A 4QJIA 5L45A 4NCKA 5H81A 3ICEA 4BMPB 3NDIA 1T1EA 3F1LA 4KFRA 1XQXA 2HJVA 2I7CA 3TLBA 4ZEVA 3VM6A 5G4KB 1KZ9A 1ZRHA 3JD4A 4YRJA 2WP0A 4ZALA 3SR0A 6PFKA 5ALTA 3IPXA 2CVHA 3NEAA 2CXUA 1BVUA 1AHPA 1OZ0A 3D8UA 1Z0JA 4ABYA 3QE9Y 1ZH6A 4LEIA 1PZGA 3PEWA 2YCLA 1QDUA 2H3HA 3EGDB 2AMVA 4FU0A 2QI9C 1VGVA 4JLOA 4NQZA 2V6JA 4PCUA 4H60A 3AEXA 4AZVA 4H6PA 1SXJD 1Z15A 2F3UA 3L0YA 4QEKA 4WEOA 3PQ2A 4C5BA 1N57A 3ROTA 1SOVA 1XD9A 1YWGO 4GXTA 3T3HA 3O4HA 4ER3A 1LBSA 3VYRB 4HAZA 2WSBA 1PGPA 3AUJB 2LWIA 5AVUA 3P1JA 3S5UA 3DUFA 2A2ZA 5DCWA 3FYSA 1ENOA 4LBVA 4AG5A 1Z5PA 3N2EA 3WNDA 3AL0C 1MAVA 3EPLA 3PWSA 2NU9B 5CBPB 3U1VA 3GT3A 4W1PA 3CF0A 3D59A 2J3QA 3HDTA 3WYCA 1Z8NA 3QJ5A 4JBNA 1FIUA 1E6CA 1SHUX 3H19A 3WYAA 2J32A 4CCWA 1Z7WA 2O8DA 4V3CA 4JYAB 3AHGA 2XVAA 1RMQA 3M7IA 3HUDA 2DU8A 1MAWA 3DV0A 5ITWA 2XMBA 5AWFC 1QIJA 2QYTA 3RBAA 3AHJA 2YWBA 2GZDA 1X3SA 2VJNA 4DBVO 1T0IA 4Q9LA 3VU1A 2G9VA 5KHLB 1UQTA 2FN4A 4TSRA 4CTKA 1GTSA 2NU8A 3R5SA 5B6JA 1P1JA 3UJNA 1L7RA 3DEHA 5L3QB 2CXNA 5EJAA 4G0OA 2RHDA 2QLLA 3QI2A 3MLAA 3VX4A 5BOSB 2P9JA 2C2YA 3LT5A 3QBJA 4J9UE 3AF3A 4YGYA 3QVGA 4IUDS 1GN9A 1I4OA 5IS2A 2RGXA 4BJ1A 1K86A 4NJMB 3FCSB 4ZEMA 1U8UA 1XD2A 3I01M 3IP1A 4JDPA 4KLNA 1U99A 3MGBA 4OMDA 5LNK1 3EZLA 1U6KA 2MHCA 4GOMD 5KX5A 2FFBA 2XA1A 3ORSA 2H48A 4EMBA 2PJRA 1I3NA 2AW3A 2WJJA 5DHTA 3HI6A 2IWHA 3TQOA 3TSWA 2X0DA 4MS4B 3TZEA 1P5JA 1UBUS 4YRRA 1E64A 1QH8B 1T8RA 2ZB2A 3LY8A 5AMXA 4DJ5X 2EBUA 3EWIA 4JLPA 3DXYA 1FFXB 1YGYA 1K63A 2RHOA 1T5TA 1T4MA 1O0SA 3EIFA 4QTTB 4CCYA 4D79A 1ZGJA 2IYUA 3DT9A 3KXKA 3O90A 5D3MB 5AM1A 4PX5A 5DNYB 3I6ZA 2YV5A 2OBLA 3FWHA 4MQBA 4RY8A 1MR3F 4NS1A 1ZEJA 1QH0A 2OHJA 4KYUA 4D92A 5IASA 4JLBA 3N87A 1NVEA 4KCGA 1VZ2A 2FHSA 5IXYA 4KN8A 4XB1A 1IN5A 1L5ZA 3BRCA 3QIAA 3ZW7A 1V8PA 2HUPA 3ABOB 1M54A 4TKMA 4CNBA 121PA 4J16A 3EK2A 1Y6RA 1KC3A 5T64A 1CRQA 2REOA 2YJ4A 4KDFA 3WLFA 2JD1A 5IJXA 1EX7A 1G19A 1I3KA 1A5BB 2B98A 3S29A 1BN6A 4LOHA 3OLXA 4RKFA 4ZO7A 2BZSA 1ORIA 4FZRA 5IW8A 2RB4A 4LZZA 4ZODA 4OHZA 4DVGA 2X9NA 3SP1A 1ZSNA 2BD0A 1FLNA 4ZVSA 1QGDA 5HWSA 3B3FA 1FC0A 2EKLA 3BGVA 1KI2A 2XGSA 2XMDA 5H70A 1V47A 4QZVA 1PJQA 4IOLA 1VHDA 1BVHA 4MP3A 5E1OA 2FFAA 3EVAA 4WZ6A 1CCWA 5AW2A 2R6DA 1B73A 2WJ6A 4FUTA 4P92A 4XD7A 3LWZA 3IIMA 3RC2A 2UZ0A 4I50F 4MITA 3K16A 5T5QA 1Y3FE 2BAGA 4UU8A 4OQMA 4EY4A 4Z4GA 2SNIE 4KRXA 1JNYA 3W90A 2DERA 2XAAA 3JQ7A 4G81A 2NUAB 3OPQA 5GIPE 1LDGA 4CT4B 3UY4A 5LZ9A 4GGMX 1HDCA 3ICPA 4QYWA 2ZJ5A 5BY2A 5ECDA 2H06A 3L7MA 1CS0B 1JKXA 3BMQA 2Z9DA 2BUBA 1T8PA 4QUGA 2BFEB 3QVLA 4LZWA 4Y6SA 2YKGA 1SOMA 4GOXA 1N3BA 4JVNA 2GZSA 2IOHA 1PJRA 4J1NA 1L4EA 1GWNA 3FB4A 3FETA 3PENA 1P5FA 2EHDA 2HMTA 4KNWA 4X85A 3VO1A 3W7AA 4WCFA 4AIRA 2P6RA 1FRQA 2LIVA 4RLFA 5EYPA 1J1IA 3DLTA 4UTNA 3EGIA 1U6JA 2O48X 3C1UA 1V43A 3OQBA 2CDNA 3TS1A 4W5OA 3FUVA 2EQBA 4L1KA 1VL5A 2JFPA 2WNSA 2FOIA 4LYEA 4OM7A 1AGPA 4PS0A 4BO5A 1M66A 3DV2A 3VKGA 4E88A 2PX6A 4UQPA 3TDNA 2FQXA 3KZOA 3RR2A 1TTQB 1THZA 3AUYA 5ESXA 3FY4A 1O3YA 3PNPA 2E9SA 1AHIA 4HY3A 5FBZA 4ZVUA 2EBFX 2COKA 3HA7A 2JLRA 4FYPA 4DR2B 4F7WA 1Y6FA 3BXPA 4MVJE 5ARBA 5ICEA 2DF8A 2ZBUA 2VK8A 3UPTA 3GUUA 4EEZA 3WFJA 2QM7A 3H8WA 3GJ3A 3RWMB 3KUCA 3HZRA 1COWA 2WOOA 2X0FA 2CHUA 1UPBA 4KWHA 1WXGA 1BWRA 1PQPA 3IMEA 2XBUA 1D1PA 4R6WA 4Z51A 4ZVRA 4RULA 2YNMD 1N7JA 3GZNB 4MUHA 5ENDA 2Y67A 2EF0A 1MEEA 2C2OA 3L9XA 3V4RA 4IMPA 4ARVA 4BNHA 4OEHA 2W2OA 2X3UA 1IE3A 4QVGA 1DQNA 1J8DA 2IZ7A 3KM0A 3PJEA 4A73A 1JBQA 2DHDA 5HDQA 1CDZA 5B55A 1ZK4A 2CNKA 4OYYA 4HZUA 4LI3X 821PA 2EG5A 1CXZA 3OX4A 4C3OB 2CFOA 5AJHA 1JIVA 3PUKA 2A7XA 4G2NA 1G21B 2ECOA 3NJ4A 1F8GA 3FSGD 2SBTA 2WABA 3H1EA 2A35A 2JLZA 4TYMA 4TTTS 1FRFS 1E4OA 3PC8A 3SEFA 2BGTA 4CEJB 3S2GA 4I66A 3Q8MA 2R6JA 1EPUA 4CN9A 4F2GA 5EUBA 1R6XA 4HX9A 1HEYA 1UBSB 1RC0A 1W75A 2EJBA 2W2VA 4MV3A 3U62A 4EH1A 3QA9A 5JRZA 1OXXK 2A14A 3B1KA 1B76A 5E6UA 1AKNA 4JBXA 1SELA 1VJCA 4Z6KA 3IPRA 4PVDA 1OT3A 1YDMA 2G3YA 4WHMA 3RM3A 1MZPA 2JKVA 1RJ9A 4K6FA 1H5QA 3GG2A 4QXQA 2QNIA 5KNCD 3GLIB 4JQSA 4NCNA 5CB8A 1KBOA 2E4AA 3L0OA 4W7SA 1U31A 4J7CA 1OTYA 2PMKA 1TGVA 1XLVA 1JAYA 1FFSA 3NRBA 1O7JA 1E1QA 1UBHS 2QMHA 3IAS6 3IMGA 4GBED 4PLVA 5L95A 2CNOA 1KEWA 2BDTA 2NZUG 3CXRA 3M4ZA 4RJKA 1N6IA 5CX1A 1PDWA 4DUPA 2ZR9A 3VZSA 4D0LB 4ZEXA 4FSHA 1HDIA 4X63A 2XLBA 1SK9A 3AUKA 4U7HA 2UKDA 5AXAA 4CMIB 3K6RA 1C7EA 3NOXA 1W46A 4A23A 5JY6A 2JIPA 3K0CA 2PSFA 1G5PA 5HS6A 2VK1A 5FWYB 2W8BA 1TYDE 3ZKWA 3KJGA 4UOEA 2H2IA 1KYIA 4Q21A 2VHXA 1HTBA 3DTNA 3IDQA 3QTBA 4N0PA 3IEVA 3A6GA 1PL0A 1PEYA 3OSUA 1NRWA 2IA5A 1AKEA 4JHLA 4OLHA 3SHVA 4XLLA 2HM7A 4BP1A 1WZCA 3SC6A 4WLOA 3JRNA 3ERCA 4L73A 5A3JA 4ZT2A 1GCOA 3D6UA 3L4KA 1U3GA 3M3HA 1XFDA 2JFYA 3QXXA 5AUOB 1FX1A 3W34A 4O4IF 5BW8A 5H7XA 1UQUA 2R8RA 3K35A 1BTOA 1PQ4A 4FJ2A 1DFHA 1L5HB 1SMKA 1Z88A 1V11A 5CH3A 5FR1A 2BKXA 3NG1A 2L42A 1E3LA 2QQ5A 3RYTC 3A3KA 3FYHA 2A30A 2LXNA 4L0DA 2E4UA 2X77A 4XWWA 2FSGA 3O8BA 2E1RA 2CF5A 3EHDA 4ZVOA 2EJTA 2P4EA 1BX3A 1U7HA 5K0NA 5LU9A 4MNTA 4EHJA 3LDUA 1Y4SA 1MP0A 5JJLA 5FOQA 2QRLA 5DNAA 1L3CA 3EDOA 1TVEA 1ZN7A 4WKBA 1D0IA 2O5RA 1H22A 1L5WA 1WXFA 4N7RA 4F3CA 1G8FA 1CEEA 5AK0A 3HCPA 4RQAA 3TTSA 4EB0A 1N25A 3BZWA 1XRNA 2UYOA 4BMOB 5KC9A 2PGNA 1AXRA 1NLMA 3H9CA 4H15A 3V8RA 1O58A 4D4HA 1H2WA 1U2SA 4MV5A 2WT9A 4H7KA 1N0VC 4XWAA 3RHSA 5JIBA 2J8ZA 3E82A 3NIGB 2VBGA 1NN0A 2AFRA 3COWA 3VOTA 2GMWA 1JXAA 3GQBB 1PUJA 1M8JA 3BUSA 3MMXA 4KK3A 1QAQA 3MJEA 4NY1A 4Y6OA 1C9MA 1BDHA 3OQHA 4WK4B 2IEZA 3Q5DA 1IATA 1ULSA 3FKQA 3KYCA 3K92A 3LZDA 4I9FA 4EB6B 3GRAA 4DV2B 5C37A 1I6WA 1M7BA 5F7OA 3HJCA 1VJTA 2OZLA 3A1VA 2D3WA 4XUDA 3GJ4A 1WOYA 2TMGA 2FRVA 3U3MA 5L51A 4TQ9A 3PCTA 4NARA 3WK8A 3TNYA 2A78A 2P1DA 1X8JA 1C3OB 4KKXB 1E3SA 2IGBA 3C1TA 4QLAA 3DM5A 4JR1A 4Y2UA 1N4AA 2DB3A 5ALXA 4QODA 3WGLA 3NVDA 3TTWA 1RBZA 2JJ2D 4BAZA 2BFPA 2H92A 3ZHUA 4E14A 3DVAB 4E46A 5AICA 1JEYA 1JEQB 5TGTA 2FW1A 4FYMA 1OF1A 3MSCA 2IOYA 2WTXA 2XE4A 2MTBA 4HTFA 3LRPA 1J56A 3BH6A 4YH1A 5BVHA 2C99A 1QCCA 5CTJA 4EFDA 5EHXA 5MN6A 1P6UA 5E3HA 3JVIA 4F93B 1P2DA 1M7GA 3LKDA 3VC1A 1PR1A 4X8HA 1XCGB 3WV4A 2CT8A 2W4IA 3D02A 4FMCB 1E89A 2AWNA 1E1RD 1NI5A 3QX9A 4DM7A 5JXHA 1S1CA 2C3PA 3Q8KA 2VNKA 3DQZA 3TZBA 4ZP1A 1FUIA 3U61B 3ORQA 2B2CA 4G5FA 3LCCA 4IFIA 4ZVMA 3TINA 5JRDS 3L41A 3VNAA 4WK6A 1WBDA 4K9MA 5BNFA 3RJMA 2CBXA 2YV1A 3LLMA 3R3HA 1GNTA 1MW9X 1RHMA 2B30A 1K97A 5FTJA 1WVMA 5FFNA 1N0WA 2EZ8A 2XEXA 1N2JA 5FPKA 3WIVA 4TXLA 1Y9AA 4FZVA 3HVIA 4URWR 4EENA 2R5NA 4KH1A 2R44A 3R0IA 3C3CA 1A7JA 4LQLA 5K45A 3MT9A 3HR4A 3NALA 5KREA 3OETA 1GTMA 4EYSA 3FAKA 1WRBA 1ILEA 3CUWA 3OH8A 1JMVA 4TOIA 3ZJUA 2EIXA 1IPFA 4BMXA 1OWPA 3TN7A 4POAA 5JAIA 5KVCA 1JR4A 1T2VA 1QTQA 4QXMA 3REGA 4A2CA 1N6HA 1H5NA 2XGOA 1Y8RA 1KQFA 1E9EA 5G1PA 2PX3A 5IJ0A 2BTQA 2JIBA 3ENKA 1QQ5A 1WW8A 3NT5A 3PSAA 4O1HA 4LOIA 4P8RA 4YROA 5BO5A 4EPXA 3TTXA 1QJCA 3PGVA 4E3WA 1Q1ZA 1NVFA 1XMJA 1WXEA 4PF1A 1O5OA 4UTZA 3PXEA 4WLUA 2NQTA 1LVHA 2JFHA 2PLNA 1TX4B 4NAVA 5E9AA 5LP6C 2EFHB 3W6UA 1PWXA 4OA5A 3AUUA 3M83A 2X5KO 4WZAB 3WB9A 4F11A 1G66A 1XN1A 2V0CA 2DR0A 3TTVA 2IX9A 1YB2A 3UCXA 4RPIA 4MYDA 4DRXB 4YAGA 5A1JA 1IOZA 1M34B 4X1OA 5F5NA 3H3XA 3RS2A 2BJWA 2K5UA 3UMGA 3OZSA 4KDEA 4LHYA 5EMKA 1T9HA 2TMDA 2NVUB 3U7RA 4JWTA 4X3PA 1JI3A 3ZGYA 2JGFA 1N5RA 4GI1A 1SVNA 5KHOC 2J0SA 1NY5A 2C0CA 1VSBA 1N5MA 5CYPA 5BNIA 3PFHA 2I7XA 1ORHA 2HEIA 4LOLA 1JKMA 1FJHA 1E5TA 1R74A 1XEXB 4OHRA 4FYWA 4MARA 1QHIA 1W0KA 3EGVA 4A26A 1V4NA 3GEHA 2EJUA 1X1TA 1SCAA 3CVVA 4I3GA 4BZWA 3N05A 1ONOA 1V3QE 1WZEA 4FYYA 1WPQA 4V0NA 1J70A 3O3OB 4ASUD 4ZYVA 1D6NA 2W2LD 2IYEA 2GDJA 4DEYA 5LP1A 2GK3A 2WM8A 3E8SA 3EZGA 1FLVA 4I0WB 4W4TA 1V3VA 5JEEA 1LBQA 3MWYW 5EZYF 1SC9A 2WV9A 2FNAA 5EXTA 4Q4JB 1PR0A 4ZJZA 1EDEA 4RC9A 3TLKA 5AOCA 1S9DA 2FMIA 2O4UX 1XVLA 4GZ5A 1WWKA 3CT6A 3UXMA 3RRBA 1S2IA 4DCPA 1JLKA 2WJWA 4DKXA 3HSSA 1E6KA 1H2RS 2YZMA 5SZIA 2PGIA 5U4XA 1LGYA 4CL0A 3USES 2I4IA 3HUUA 1Q2UA 4L8LA 1AG9A 1ENPA 3TQIA 3LECA 3B1ZA 3HL4A 1I7NA 3P9NA 4YT8A 4J0IA 5ELXA 1FQKA 3FPCA 1FTQA 3EB9A 3IULA 2ZIVB 3ZXIA 4JI8B 4MGHA 5REQB 5A0TA 2DPHA 3BHIA 5DI3B 1N0UA 2AF3C 1YU6A 3T7KA 3L6DA 1NBIA 4YA6A 4BQIA 3C39A 1Z36A 1I3MA 3PC4A 1SCNE 3QGMA 2AN4A 3QFTA 3QEBZ 4JSTA 1Z73A 3C5VA 1Z12A 4A0FA 1NR7A 1ULUA 3PEUA 2ZJFA 1U8EA 4HNTA 1BCRB 4M8LA 3LUHA 4ZMBA 3D8HA 1YQDA 2BHTA 4M0MA 3A4TA 3M89A 3MCZA 5AW9A 1XNQB 2GA8A 1ZD8A 1Q7EA 3DWFA 4G0XA 4BZZA 2NO4A 1H1LB 5ECWA 1T5BA 1S5PA 5CLHA 1Y33E 1SBZA 2O05A 2V9ZA 3BIJA 4KXLA 3S8YA 5D7NA 2GF2A 1N34B 1FX0A 6Q21A 4FYJA 5LMNB 1PFUA 3IAS1 5HOQA 4TS1A 3TLYA 3TLGB 4EG3A 4XCVA 2H9YA 3FUWA 2O3UA 3OCUA 4QSHA 2YMLA 5JSYA 1YFLA 2GN8A 1WL8A 2EW2A 3A2NA 1M2OA 4HLDA 5EIAA 1U1EA 1IZ9A 1GDHA 5AKJA 1TMGE 1NUHA 1CY7A 2FX2A 1NBMD 3D31A 3T99A 3GEMA 4QBFA 2ZIFA 5K3SA 1GQSA 1MB4A 1KMMA 1WDWB 4EG7A 2WZBA 3CRMA 1XJ5A 4P3OA 3A6ZA 2H8GA 4I4TA 5FI1B 4YRLA 4MEAA 4MGEA 4W5HA 1QOZA 5B30A 5J63A 2PJDA 3G5AA 3H18A 2XOXA 3M5CA 4L51A 2WOJA 1VHJA 2FEXA 4IWNA 4LMBA 1ZW6A 3B52X 3W7BA 2X3YA 1MN6A 3RK0A 1EXMA 5G4KA 1TADA 2WTAA 2X9QA 3IS3A 3FZQA 3PL5A 4RKYA 1JB9A 1RVV1 3UHJA 4S2EA 2ZATA 3ZLVA 5HKKD 1D2AA 2WWHA 3BE6A 1G5QA 1D2MA 3EFHA 2FG6C 3N75A 1Q7BA 4ZVQA 3OZVA 4PNZA 5A0VA 3H1TA 5K0SA 1SR8A 3GJZA 5EP4A 3L1UA 5A6VA 4JLMA 1M0WA 2H0QA 4Z0HO 3DZCA 5HA5A 4JJFA 5JD3A 3I9FA 1XZIA 3GLGB 2AZMA 2GD2A 1MNAA 4L02A 1RWNA 2FN8A 3ZJYA 1GRVA 3E5RA 4WFJA 5DX8A 3WLPA 3FH0A 3ZWBA 5A1TA 4OTZA 2JG3A 3VSDA 3ZV6A 3KB2A 4L27A 4HMOA 5DV9A 3VDNB 2NU9A 1YO6A 3HYSA 5CBPA 1HLPA 2IZ0A 4MUJA 3GMSA 4PPNA 4BGDA 5ES4B 2ZRCA 3P0FA 4L57A 5T4HA 3Q98A 1Q22A 4GECA 3DOEA 2YY6A 3KDAA 4MRAA 2PU7A 3WIBA 5JXGA 3EQ9A 4GR4A 2V7EA 4F4UA 2VSOA 2B92A 3MAJA 2FAXA 1SQ6A 4P7BA 4KR9A 1FXUA 1QP4A 1N8SA 5LB4A 1CT9A 3BGIA 4YJ2B 1ORRA 3SFZA 1UAGA 2HB6A 5I8ZA 1PAUA 2OV3A 3CRNA 1R4ZA 3AOEA 4E51A 4PCAA 3G85A 1YNOA 5CXUA 1DKRA 1A71A 5L3QA 2AXEA 2F3TA 5BOSA 1NM5C 4RQBA 3ZBUA 2YUTA 2Y05A 2COUA 1ORVA 3AUAA 1CUYA 5DWDA 3S99A 1EJ6A 1TQ6A 2BZ0A 2ZYWX 2JIDA 4JUFA 3ZU6A 1L7BA 3F6PA 4X6YA 1RAFA 5IDQA 1G20E 2R9VA 5HIAA 3AVQA 1HFWA 3DDZX 4AX8A 1TO2E 1IBRA 4JBLA 1CC1S 2PVSA 4XASA 4AJIA 1PU2A 3WZLA 5H8WA 1P75A 4ZOBA 1Q7CA 5CVTA 3O7MA 4MS4A 5L40A 2BI7A 2FZ5A 2EWWA 4RETA 1QH8A 4HEJA 4OSOA 2AN5A 3TNDA 3IPCA 4XE5A 1VE9A 3RD5A 4F12A 2H11A 1VIDA 5JCPA 3ZE7A 1PNOA 1FFXA 3D7KA 3ADOA 1EJ0A 3A3OA 3BFVA 4NABA 1NJ8A 3TCKA 3M6VA 3Q8LA 2Z08A 5D3MA 2WKPA 4CLDA 4CDGA 4B6FA 1JQBA 4RADA 5FP0A 1O9HA 2FCAA 4EMUA 4GKVA 1M6EX 4MO9A 2ZTVA 2WF5A 2I33A 2UZ3A 4M60A 5AQEA 1BE0A 3LF2A 5CU7A 4R8KA 3WGGA 4ZZ0A 4TS3A 3CE9A 2PS9A 1EVZA 1PD1A 2H5IA 3D54D 1Y63A 1D09A 2WSLA 4FGZA 1WZNA 2PWBA 3GUCA 4AJ4A 3LY5A 3RRXA 4C0JA 3AVWA 1M5RA 1GY8A 1QYRA 1GEEA 4CLXA 4OYHA 1RADA 2GA9A 1JAHA 1R18A 2ICAA 2X2EA 4GOLD 4PLGA 3RRMA 3NXSA 3IDOA 4JP8A 4FJ1A 2YFYA 1TL7C 1XZCA 2E1PA 5LQKA 3D3WB 3AINA 1YQTA 2HK6A 2IXTA 4KQ2A 2DUNA 4QEDA 4FCTA 1CF2O 1FSFA 3TKYA 2IFTA 3AONB 1ISRA 3EXIB 3U17A 1KU6A 1TK2A 1VI2A 2J3HA 3PQ4A 4UVGA 1KIAA 4E5DA 3HXTA 5IDWA 2I65A 3A4MA 1V6AA 1MVOA 4OGWA 2ZKLA 5JYDA 1MA0A 1P81A 4GBMA 2OYRA 2NU7B 4Z0NA 1UFKA 1L5KA 3SQLA 2QZ9A 2JAWA 1TM2A 4CR6A 1Y8QB 4I5IA 2AVDA 2YXEA 4FOLA 4RZUA 4PSUA 4AICA 4MPDA 1FB5A 1JFSA 1GAXA 1PFYA 1EXDA 2XMCA 2O2CA 5I6DA 3G1TA 1JLHA 1T6ZA 1M1XB 2PD6A 3FUCA 3OC6A 4KQEA 2NUAA 4H1VA 3A6LA 4UUNA 3TQCA 1RHQA 1W6UA 5HKLA 3ZE9A 2P69A 1WP4A 4D9KA 3CW8X 4K2AA 4RZXA 3ZS8A 1QHYA 4QA9A 3EPJA 4RD6A 1Z2OX 1X8KA 1CS0A 5C1PA 2QD5A 3ET5A 2VF5X 4OBEA 1E2NA 4HC4A 5BWMA 3MOIA 1QU2A 1EP9A 2BFEA 4OAOA 4MWOA 3BRWD 2WZQA 5FOWA 4UUBA 4KVFA 4MUAA 3WWDA 4D9BA 2Q6VA 3B3QA 1Z5OA 3BKWA 1Z8DA 3CPHA 4PSAA 4MUEA 1P2GA 2A5JA 3T5AA 1OIXA 1P2TA 4Q5IA 4YPOA 1UDRA 3INTA 1XMVA 3AETB 3CCFA 1YRBA 3EPKA 2RK6A 2J6IA 4Y6RA 3I5XA 1XQWA 1T4BA 4C6SA 1CPYA 4IGIA 1S4QA 3E3NA 3PI6A 1Z18A 3NHAA 4K8OA 3WDMA 2DY0A 4KN9S 2RGCA 4KLZA 3LO5A 1H8HD 4J2TA 3RTCA 3ZDAA 1JVSA 2P11A 4NMXB 5BSKA 1MFPA 4DG5A 5IMSA 3FHCB 3VBEA 1HE1C 4TZ0A 3VR4A 3HNOA 3ITKA 4IGAA 1QORA 2ZJOA 3A3PA 4OYLA 4D4JA 3UGJA 3F5DA 2ERCA 4PHHA 4G1EB 4HGPA 3L07A 4Q24A 4F8YA 3MC1A 1YVEI 1WQ3A 1OR8A 1IOWA 1CLUA 5AHWA 2ZUVA 4DT1B 2QD2A 4HAUA 3OFNA 1V45E 2CMKA 4NC9A 3Q87B 4MR9B 2CL7X 2D8AA 3RVRA 3FPLA 2IE0A 4FBLA 2EVWX 4GQBA 2QU7A 5D84A 3R7BA 4RAQA 3TQSA 4BB0A 2JLYA 2XUPA 2AFIE 3LI2A 4IJ5A 4RH0A 4BZXA 4CEHB 1S2DA 4J3JA 1N5OX 3GZNA 3Q12A 4LVOA 2VAWA 1K68A 2QJTA 4N39A 3SR4A 4IIUA 1GT91 2A58A 5E8JA 2N3ZA 3DEAA 3OY2A 4WXYB 3KHSA 2IZ1A 5CD1A 3SC4A 4PZYA 1ONSA 1JH9A 4IG9A 3VSBA 2ERXA 1B8PA 5C4MA 1FUUA 1I94B 1EE2A 1G21A 1UJ4A 3KXLA 1TM7E 3RSOA 1KMNA 3PI7A 4IEIA 3U13A 2C9YA 4RHYA 1XPRA 1DO0A 2OCAA 2G70A 3PNQA 4TV9F 1OI4A 4U7JA 4EI2A 2OESA 2OCLA 2X5JO 3MJCA 1QH1B 3AWDA 3ELUA 2JD2A 4D02A 3R8CA 1IBLB 1D5WA 2IYYA 1I3LA 3AH8A 1M6HA 2GO1A 1U2GA 3KYIB 5FYQA 4PHGA 4F84A 3KDSE 1BOOA 3ZCQA 5HRAA 3JQBA 5FA8A 1YZHA 2BV3A 2QW1A 3OI7A 2QVGA 4KQXA 4TS9A 1M8FA 1R4MB 2FRXA 2J45A 4WL0A 3VR5H 1RMTA 3ZWDA 2NYUA 1E69A 1KAMA 1YMUA 5F9MA 4ARZB 1GKUB 1O54A 3E4DA 2PH3A 3L01A 4RHFA 3V6LA 2OE2A 4LVUA 4F91B 5I7OA 1WX1A 2VLBA 4IZHA 3BE5A 3DOJA 3WL5A 4DCJA 1LSJA 1V96A 1ZIYA 3URMA 3RPEA 1GADO 5JAMA 2PZLA 4ZVNA 1PKXA 3TB6A 1WEKA 2I87A 4U2EA 2P3LA 1E7RA 1E7WA 1GQRA 2B83A 2C9BA 3D7SA 1V7QA 4CMIA 1IZ8A 1C9EA 1QLWA 5EJ8A 2OUIA 1GSAA 2O2ZA 1OFHA 1RNLA 3IA2A 3ETLA 3R3WA 5FWYA 2XSZA 5FULA 3VH2A 3ZGZA 3ZOZA 2DBQA 4JBWA 2ZR0A 3LHDA 1WPRA 4A27A 1HY3A 1TKBA 1EUYA 3H5IA 1WCWA 2P5SA 5C0OE 4ZHQB 1XRJA 1XP5A 2PKXA 4WLNA 3RC9A 2YFHA 5L7WA 2NPOA 3GHYA 5AJXA 1J1ZA 3H84A 4DJJA 3W78A 1W1WA 2C2MA 5EL0A 3CR7A 3HB1A 3WL4A 1AGYA 2R8ZA 3C7AA 3N8KA 4H3HB 2Y71A 1F17A 4C4PA 4NE7A 4TRJA 2YYZA 3SX0A 1LLQA 4D0SA 4MICA 2HR1A 4WX2B 3RUDA 1L5HA 4EMTA 3H5TA 1KFCB 2EBHX 1Z62A 2Q2QA 1PTKA 3EVGA 2RHTA 3MUFA 3PD1A 4L8YA 1WD7A 4RVUA 2V6GA 1OXBB 2IXEA 2B4KA 1I36A 2L2QA 2Z57A 4MULA 4GMGA 1PZFA 1GG9A 2J7PA 2XVXA 1EG2A 5FWXB 3AFOA 4MIKA 4DPLA 2JRLA 5AM0A 1FMFA 1KH1A 4GDFA 4QTXA 1Q91A 2YW9A 3P9YA 5EJ7A 2FGJA 5TF4A 1KY5A 1NZDA 4J1QA 1U2DA 5EQFA 2PX2A 4QDXA 1GZUA 3RU2A 3PT9A 3L0SA 4MQMA 3OCYA 3FE2A 1XZKA 3FKSA 2XWJI 4XFKA 3S1SA 4E94A 1QXSA 1VJ1A 3WTCA 3CZAA 3ZY2A 3IAXA 1KTIA 3F9IA 3AR4A 3I9OA 3VR3D 5F3RA 3VMFA 3VA7A 3HKEB 2VPPA 3LSYA 2GUWA 3C3WA 3HDYA 4MPPA 5B3AA 4GM0A 3GQBA 1E9VA 1N2EA 3DOHA 4BBZA 3MWJA 4QBKA 3DJFA 2P68A 2QSJA 4OMUA 3WMXA 4IJVA 4JS0A 4YMSA 3ZU3A 4I5DA 1PSWA 3IODA 3WDLA 2ONYA 3SPXA 2D2FA 1CQZA 1VHQA 2WKWA 4JX8A 4WH0A 3RI3A 4RPLA 4LJYA 5C8DA 2H2FA 2ZVJA 4BFWA 4IOJA 2GZAA 2NO9A 2EG9A 4QBTA 2H18A 3ZD8A 2GK7A 1HT2E 2IE8A 3ZXYA 2G1KA 1CZRA 4R9SA 1KDZA 4INAA 4HK4A 1C3OA 2CZGA 4FP9A 3TLCA 3O9ZA 4XLZA 1O6CA 3OD1A 4QQ8A 4BZPA 4ARAA 2AN3A 4DCGA 3LE8A 4KN5A 5JCZA 4RL6A 1AK1A 3DVAA 3JU3A 1WY5A 3O26A 2FK8A 2Q21A 3DEYX 2P4UA 3MUNA 1V71A 1JEQA 2CHGA 5K0ZA 2XXJA 4XDZA 2HU5A 3F6BX 2FWMX 4FHDA 4DB2A 1YIOA 1ZMRA 3VU9B 3PRHA 3KJHA 4IAOA 3U37A 1Y3IA 3U44B 3ND8A 4DA4A 3PPWA 4F3NA 1PV1A 5EZQA 3U56A 1H6CA 1VMEA 5CB4B 2DOKA 2BDUA 2C4UA 2IPMA 1CY6A 2NV6A 4KVGA 4NG5A 1MTZA 3SHQA 4UATA 2I4TA 3CZQA 2ZAMA 4UKDA 4ZKDA 3MQ2A 2PH1A 2QLBA 3KHUA 3QPDA 3KJEA 2I2FA 1K6IA 1OYYA 1DPFA 5TEVA 3VSAA 4MZDA 1X0XA 2NQ2C 2OEPA 1HO3A 4I5FA 1CR1A 2VG8A 1LLUA 1ZK3A 3OEED 2C5GA 1BXGB 1VECA 2JHFA 4DMHA 3HH8A 1I5RA 4GL4A 3NRJA 4YREA 5GWXA 3ACBA 4FB5A 4O5OA 5KNLA 3NVMB 1M1YE 4BWFB 2Z6UA 1AA6A 3TCNA 4DLBA 1U4OA 4X1KB 1HNXB 4E2WA 3RTAA 4M1TA 1A8IA 4YHHB 2IEIA 2EV9A 3OM9A 5C31A 3L06A 1EVJA 1XKLA 3N2ZB 1X2EA 3RV4A 4YRBA 4KAXA 1NNEA 4OHKA 3SS9X 1KJWA 3G2IA 1XQ6A 2ZYHA 4PX2A 4X71A 3MRXA 1MPXA 4OA8A 1X13A 4S1PA 4JQCA 2C4HA 4M0KA 4TTJA 4JELA 4Q9DA 3JV7A 3CKYA 1NW6A 4MV1A 4N0MA 4Q9AA 4F4JA 4WZAA 3WK6A 4PLPA 3V1YA 1RYYA 2YS7A 3GU3A 4EWLA 3I8SA 5EWJB 2VXBA 3EX7C 5E9QA 2GJ4A 3LWNA 3TQFA 3NT4A 3FFXA 5CNMA 5EJ5A 1N7HA 4FKMA 1RRPA 4BNZA 2GEFA 2FOXA 5KIAA 3IO5A 4HZIA 2NVUA 2YWCA 1SZJG 4K6OA 3G8CA 4MJXA 3BKXA 4QYSA 1JE1A 4RVSA 4YJDA 3ZXSA 5JD4A 2FV8A 3A1NA 2OAP1 4KMSA 5K05A 3DG9A 3KC2A 1PR9A 5SY9A 1KAQA 3P9KA 4U7DA 1XZMA 1WMBA 3STWA 2VP9A 1XEXA 2X14A 5IH7A 3E2PA 2PCLA 1VCHA 3OPVA 1CRLA 2JZOA 5DK6A 2VSYA 3SZRA 1P4HA 3UW3A 3ZWCA 4FS8A 3QMPA 3CVOA 3IKMB 5EEHA 4QGGA 3KSBC 2CD7A 3IXMA 1KDPA 4ZOQI 3L8ZA 3LBFA 4IIEA 4JUIA 1Z34A 4LRTB 4PN3A 4CU2A 4L95C 3LTNC 5K09A 4GP9A 3MJRA 3WP1B 5HYVA 1T8TA 2A88A 2WT8A 3IUQA 3QBTA 4MCHA 2BGJA 5CJ2A 5AXCA 3ZQ6A 4EA6A 5EIXA 1LWNA 2WTMA 4G25A 4E03A 3L7OA 4YQZA 1XWWA 4OQPA 2GBGA 1V3TA 3G68A 1X7WB 1U1DA 4R1QA 5CLQA 2FMFA 3IVMA 5BSMA 1GPJA 3HLTA 1PX2A 5FR2A 3TLJA 4MJLA 2Z1NA 1A4XA 4MTCA 4E32A 1E4YA 1QQ6A 1WCXA 5KNCA 5WRFA 2QQEA 3S7TA 3FSRA 5CCBA 1ND5A 1RPTA 1BGXT 3OAAD 2JFVA 4AXBA 2W8ZA 4B6PA 3CH5A 3J81A 4GLJA 3H2SA 1FPMA 1PRYA 4WK0B 5REQA 3SZMA 2Z4RA 4JODA 3D8TA 4XQ9A 5DI3A 1R5JA 4ZN6A 5BN3B 1PHPA 3AVYA 4DQKA 3HNPA 3OVMA 1LV8A 3IIEA 4MVJP 2QGNA 1NA5A 2EWVA 4IHJB 2AFVA 4L4SA 3SHOA 4N5NA 4R4JA 4EL5A 5HM6A 3OFKA 5LSAA 4B3RB 4DL9A 1YL6A 2BHRA 1PJ2A 4N9WA 1Y48E 4TKUB 1AZLA 1Q0ZA 3LOQA 2HJRA 3WKCA 2PAFA 4RMNA 3HABA 3QXGA 2FFHA 2WSYB 4DV3B 1NHGA 1O03A 1VRCA 2I4OA 2YVLA 3F8TA 3IVGA 2AG0A 1FDIA 3GELA 3UHAA 3PPIA 5BV2P 2M6RA 3Q9NA 2EFGA 2NSYA 1H1LA 3IA7A 3K8QA 5BUSA 1SG6A 3EA4A 3GBSA 2UUAB 4FDMA 1GN8A 1TEVA 2WFAA 1Q11A 2B1RA 3RS0A 2Z2IA 4TGLA 5KWSA 1R5OA 2IYZA 1X8XA 2R66A 5HEKA 5BN5B 3K09A 1ADBA 3TLGA 1ZCZA 3AM5A 3Q2KA 4NDAA 1LB1B 1ICEA 1KNQA 5GV8A 1KJQA 3C6XA 1X2BA 4A6PA 4Z8YA 5D01A 4OQEA 1S3GA 1N6LA 3EEQA 3WGIA 4MX8A 5MN4A 4KHZA 3UK0A 4YPVA 4HLUC 4ZT7A 2XW6A 2ZT7A 4O0MA 3JD3A 2M9MA 5L7TA 1ZN9A 3NKVA 3PR2B 4CN8A 3JQEA 2ZXEA 1KL7A 3KDPA 2FFQA 2OB2A 4KMRA 4E5PA 3R9XB 4MLCA 3UKDA 5AW5A 4ZOCA 4BGIA 1F48A 4QG7A 4KWTA 3UA4A 5IT9A 1R0LA 4LF7B 3M49A 5DWQA 1KMCA 3VJKA 4ZGBA 3TFQA 4DM3A 1X70A 1SO8A 4H4CA 2DG2A 1VE5A 1P1RA 2OZPA 3FOWA 3ILVA 2DM6A 4RDHA 4DPMA 2M6LA 5HGXA 3MTGA 4S2UA 4RVFA 5EIBC 4ZZ2A 4UM9D 3DL4A 4AUNA 621PA 1G7TA 3KV3O 4CTNA 1L7VC 1W47A 4RMHA 1YS7A 2ZSFA 4LQDA 4LMRA 1P7YA 3OOSA 3VO9A 4V1CI 1XLTC 1U8FO 5JNWA 1F6BA 4J3NA 1UWKA 1U02A 2ODBA 1HFEL 1P91A 3QMMA 4GQAA 1GGHA 2ZYGA 5G1NA 5IVHA 1F5SA 1FFGA 3A6HA 2HLHA 3EZ7A 4HQ0A 3V8MA 1E2MA 3CF2A 2G82A 3SZGA 4DLXA 2R7MA 3KNZA 4FFPA 1Y4ZA 3L7BA 4HFNA 4O2BF 4XUGB 1SKYB 2VAMA 4H7EA 1H4SA 2QT9A 3LY9A 4Z9FA 4JLNA 1S3SA 3EEIA 3RIYA 1LC3A 3S2ZA 2JJ2A 4XVUA 1CJKC 1KYWA 5JMWA 2HSJA 2F43B 5TJHA 4BJ5A 3SYKA 2HWKA 1P19A 1NUQA 1U7UA 3V4ZA 4ACAA 3IJPA 3FWKA 5EIFA 4TVSA 4YCCA 1TI7A 2EKPA 1Q0QA 1FMLA 2MYUA 3AU9A 3MRTA 4FGLA 4FQ8A 1L7NA 2RGEA 3C7DB 3M6MD 1D7AA 4GSLA 4MR7B 4CHTA 4YJ2A 4MRNA 4MOWA 4B4UA 1XMQB 3U4QB 4L2IB 1CY2A 3MGCA 1ZUHA 4KK4A 5KS2A 1DRKA 1E1RA 3AVTA 2QMYA 2H1OA 2XE8A 3D4LA 4INOA 4WGFA 4M1YA 2CNDA 2UUBB 4Z3OA 4RVCA 4RFVA 3I6IA 1T9KA 3WLTA 1JEJA 4RK6A 2ZS9A 4KR2A 1NVKA 1Q57A 2VZEA 3K0AB 4B7CA 5EA2A 4LYYA 1NXWA 2B1QA 5E3JA 3EMKA 3R5HA 4DLLA 1L6IA 2JCBA 1ZM7A 3S7ZA 3H13A 4ZYXA 1T8YA 4LHZA 2AD1A 4FLMA 3U48A 2FGKA 4OK6A 1E20A 3RUCA 4YQYA 4QELA 5A4MS 3BBPA 4NBSA 2WF9A 3OUZA 4BNYA 4NMLA 5T4FA 4BMCA 5K0LA 2SECE 4LXHA 3UMSA 3BE8A 3RAEC 3IDFA 1OU4A 2HPHA 1J22A 1STOA 2J41A 2Q5OA 2QY6A 2YZ7A 2R62A 2BH2A 4BRZA 2G77B 1V35A 4J0KA 1J7KA 5ADHA 5C8XA 2GPYA 3CINA 4FMDB 4JP2A 5FTWA 3RODA 1EVQA 3OPNA 1Z6XA 1NVBA 3IKLA 2J3LA 5EGSA 3N0WA 1JYSA 2QX8A 1HYEA 3B82A 3OOYA 4IOMA 5LMZA 3CUKA 1XZJA 3OMXA 4QDOA 2ABWA 1XB2A 2FUKA 1P0QA 2PT6A 2HRZA 2Q0XA 1UJMA 3R9WA 3IEUA 2P2ZA 5D5QA 5DM1A 1CEQA 3RSHA 4R01A 2GS9A 2IHTA 3WGZA 3HPQA 2WICA 3RH0A 1QK5A 4EIWA 4JYCA 4ID9A 4KWIA 2ECKA 3B3AA 3V1TC 3V97A 1LPMA 3D3WA 4ARSA 2H0RA 4L07A 3RK1A 1MOPA 4GP6A 1RYDA 4XB6B 4F6LA 2ETXA 1FFCA 2JLCA 1F2TA 3EXIA 2QAIA 4Q1DA 4UEQA 2NN3C 5DBGA 1X9GA 5F52A 1U0LA 4AJ9A 2ZITA 5C5EA 2QDKA 4PGFA 4WA8A 5AHXA 1OMOA 3OZRA 4HNUA 1I1QB 5JANA 2NU7A 2CEAA 1NUPA 1X38A 2BEJA 2OCGA 4K1XA 5JZBA 3ZCXA 3WAJA 5KYYB 2PGOA 4CFZA 5EG5A 5G41A 2ATXA 3F49S 3MCAA 4OJMX 1V8DA 1VIVA 3CX6A 5AW0A 3ISJA 1TJYA 3IERA 5BT9A 3OHSX 3G7NA 3BXFA 3CKKA 4WMLA 4C14A 3EFEA 1YA8A 2LVBA 3EVTA 2CLCX 4LW8A 1GLGA 2MR6A 4M0UA 3H1FA 2E3JA 4RY9A 1VPVA 2OHGA 5EFOA 5CTAA 4KO8A 1EGVB 1XQVA 3RUAA 3BFKA 3LDAA 4HQFA 5KTOA 1WMDA 3AQIA 5CDFE 5KKCA 3U5ZB 4HN4B 2FYTA 1U3FA 1J24A 1NW7A 4HVCA 2XYGA 2E49A 3BT7A 1P5ZB 3SU8A 1HYBA 1YR3A 3P96A 2PGLA 2O0KA 1SCJA 3F7MA 1ZLXA 3NNSA 3VNRA 3UC9A 3AETA 4P0PB 3GCZA 5KTYA 2WWTA 3EOZA 2C92A 1RJWA 3L7KA 4ARCA 1XZPA 5JQGF 3RQIA 2AI3A 5BV8A 1ONPA 3X2EA 1Q19A 1XL0A 5IVDA 5C2JB 3I6BA 3BE4A 3ZUGA 3R23A 1C7QA 1SQFA 3QVXA 3DCIA 1TF5A 5JAZA 1I7PA 3LLSA 3I9LA 3QH4A 1FLAA 5ALWA 1FFAA 3G23A 4IEFB 2FSFA 3SVZA 2PA3A 4ZI5A 3QI7A 4WWHA 2WZCA 3KKQA 3H9GA 2RHCA 1E1YA 4MQ6A 4N12A 3T12A 4BNMA 1Z0KA 2I2BA 3FBWA 5GOZA 3GWGA 3L93A 1NURA 4WFQA 3WWYA 1NXPA 2L19A 4L08A 5F12A 5JJ5A 3OZFA 5C8YB 4UNRA 2YVAA 1TVKB 5BW4A 3G5MA 1QZZA 5K1ZA 4MR9A 4D9JA 1MJHA 2XOKD 3T1TA 5ADVA 3UAVA 2P2GA 1AGNA 1WAMA 3W5AA 2GM9A 5EP3A 4N41A 1V9SA 2OZKA 3NEPX 4LCJA 2K6GA 4DSOA 3IEIA 1T4CB 5A5VA 4KPUB 4HQNA 2B7CA 2VJPA 1XCJA 4RV4A 5FBVB 2QK4A 4R54A 3SNHA 3K94A 3DBLB 1YS6A 1J6UA 1VYUA 1PG2A 1XD8A 2H9IA 2P5YA 1ZCAA 1MTOA 2RCYA 3IB6A 2GX6A 3IAEA 4PG8A 5LPNA 2IJGX 3PA8A 4L22A 4NOMA 2Z6AA 1I2ZA 3OIWA 5JECA 1N32B 3BSYA 4XJVA 1ZM2A 4MS3B 5HZHA 1WXWA 4Y30A 2Y66A 5EQDA 1PSZA 2B1GA 4KQIA 1L5OA 4UUOA 3L7IA 1BJRE 2R47A 2QRQA 4S1NA 5DO9A 4UM9B 2JAUA 5FA5A 5GZ6A 2J6HA 3W9BA 2AJ8A 1QH1A 1P0PA 4JJIA 4P38A 4M53A 2VAPA 2QX6A 3JQFC 5ALOA 4P32A 4YRNA 2F9FA 1KORA 1I4DD 3WKEA 5FOTA 2Q3EA 3PR3A 1KVQA 4QPDA 1UEJA 4M7WA 4CLRB 2ZREA 2GN9A 2IU6A 3EVDA 2GD1O 2OZVA 3IOCA 4J90A 1Z5GA 1R4MA 3MERA 1YASA 2FG5A 3MUOA 5CMLA 4QDTA 4ARZA 2C07A 1R0XA 1AKWA 1N4DA 1JIQA 4BVJA 3OF5A 1HQYE 3D0KA 2BKAA 4UMFA 3UMCA 4DXAA 2CXSA 3EARA 1KJYA 5IBQA 2A5FA 1FSPA 4QHSA 4FTWA 1OLXB 2RIRA 4J29A 5KJ6A 1O89A 4RGQA 5KVVA 4C2BA 1Z0UA 2DT8A 4F86A 4O0LA 1OB5A 4D8TA 3P5SA 2OXIA 4MUKA 3VNSA 1ZNWA 1PJTA 1AA9A 3T5GA 1KETA 1TT5B 2R60A 2VWHA 2VXYA 2QD3A 3G2KA 1EQAA 5DU2A 3MF4A 5CNIA 5J23A 2D8MA 2FA9A 1F5NA 1JSCA 3PQ5A 1GCUA 4TL6A 5I9NA 2W6JA 4ZHQA 1B2LA 1AKTA 2BGRA 3CO0S 2ZQYA 4U39A 4PPQA 4LIPD 4E6EA 5C51B 4Z4QA 3K2BA 4CKWB 2Q9UA 3F5QA 5CB0A 1ZUIA 2VP4A 4JBYA 4M9XA 4I4TF 4RJJA 3NWJA 4D9GA 4EZIA 3JAKB 4Z49A 3COVA 4YASA 2QYOA 5DX1A 4EP1A 3GEIA 1VBKA 2RHHA 4TUYB 4Q00A 3WHIA 5KPJA 4M54A 3A70A 1PW7A 4H7PA 4N82A 4CF3A 4OK5A 3HEBA 1YAHA 4LF8B 1KPGA 1UDBA 5JALA 1W0JD 1G3RA 2CLIB 4WFIA 4AKHA 3C3YA 4RHEA 3ORHA 5FWXA 4TKVB 3C16C 3LUFA 3TRDA 4U00A 4P93A 1UH5A 1JJFA 1KJJA 4H6WA 1A8SA 4D5GA 1ZLYA 1QV9A 1D2CA 2W98A 3BDIA 1G41A 3AHFA 4DIFA 4EUFA 5HJ7A 2FSVA 1JUDA 1YK1A 4BN5A 1E6MA 4YRPA 3JPWA 3PC3A 3RSZA 2ZJ6A 4HJRA 3C85A 3T3MB 4FFRA 4ZO9A 4P84A 4RTPA 1ML3A 1E3WB 1RXYA 4BQEA 4F38A 5A62A 1AKUA 1IJEA 2IPNA 1R0RE 1X1QA 2Y1GA 3NGXA 4FE4A 4LWQA 3R74A 1L3IA 3MUEA 5DHPA 3RLIA 4B9EA 1TCUA 1V5WA 5DBOA 4Y1FA 1K92A 1NSFA 2PYZA 3HKEA 5K51A 4F8EA 5IM4A 3GBPA 4PGGA 4XD2A 3OCVA 1FDRA 1IBMB 4FFNA 1QB8A 2G76A 2ZPUA 2GPBA 2XXAB 2FZLA 2XUAA 1O94C 5DNWA 1HQCA 5DRYA 2Q4TA 2NTEA 2XUIA 1GNSA 1NP7A 1T9DA 2R8OA 2VFAA 3BCRA 3DTYA 1BCSB 3G02A 4GU5A 2ZIWB 5DM2A 4DIUA 2FWAA 3URKA 2TYSB 1BD3A 1Y0BA 1I6LA 4HWRA 3EGOA 3AP3A 3NTXA 4HCJA 4MWEA 3EEBA 4UE6A 5K6TA 1N0HA 4BUJA 2Z43A 2B4QA 4LRUA 1N1GA 3RSSA 4Q4HB 6YASA 4TMFA 3G79A 1A8UA 3E3LA 2V3CC 1UBTS 3OJEA 1NVGA 2PXHA 3OKFA 4A3SA 4GXRA 3TI7A 5JXIA 3JX9A 2ZWVA 4RO0A 1Z22A 4DLKA 4D6YA 4K7JA 5A3RA 3OT1B 2R5FA 2ZJ7A 4KQ1A 3U44A 2H59A 3OD5A 1OJ7A 1KPIA 4IS2A 4RU1A 4AG6A 4I8DA 1T5OA 1MO6A 1LTQA 2GGSA 1Y5RA 5CB4A 1OTXA 3GCGA 3FJOA 4AROA 4D99A 4NEHB 3H86A 5E4TA 4PC1A 2XMGA 3ZPXA 5F2NA 4JGIA 4B73A 1E5LA 2OMKA 4IPTA 3WRWA 2AYXA 4G5QA 3S2FA 1OD6A 1CWUA 5E7JA 2IPOA 3NYQA 1PTJC 2BVNA 3WB0A 3LCVB 4U9IS 1XNGA 1T9AA 4HB2A 5JJBA 4A8TA 1REQB 4MJ3A 4B40A 4CE6A 1QFZA 4K1LA 2GNOA 4Y3UA 5K3OA 3OFJA 1QGOA 4HXYA 3HU5A 2BKEA 3MAAC 4GMKA 5EERA 2QYHA 3FDIA 3AJAA 1DE0A 2VDOB 1EGHA 2HK9A 4GVLA 3U81A 2Z04A 2VDWB 2V65A 1E2LA 1YQXA 3B60A 3E61A 4OL9A 3TSYA 1ZHHA 4WUVA 3VVBA 4EHDA 1NXXA 4J0QA 1ZCBA 1I4EB 2BYTA 1PUIA 3M6WA 4GWGA 3T7CA 2O54A 4OSPA 1HDRA 2RH9B 2I3BA 4X1KA 3UV3A 5HHTA 3CCCA 4AY3A 3K0FB 3O9MA 5B3JA 5HZKA 4NV1A 4DFDA 2K2WA 4RF3A 3ZEAA 5HS4A 5CIYA 5FTKA 3I2IA 1DO8A 4F8JA 1BXZA 2MR5A 4GBGA 2BGKA 3UWMA 3K72B 4YGXB 1YZYA 1RWKA 2OBFA 3P0JA 1OLSB 4PZ9A 3FX2A 5D1HA 5JHGB 3VTKA 2FPGB 4CM4B 5EWJA 3SJ7A 5JCJD 4KGVA 5CA1B 2CVZA 1EIWA 1MX1A 3RWBA 2EZ4A 2MSKA 3BTVA 5LUBA 1ST3A 1RJEA 3M4NA 3OLVA 4R8RA 2VJOA 4PAOA 2IYSA 3OHMA 3JALB 1T2AA 3FW1A 4DLRA 4E4RA 1ISHA 1RLOA 1IHDA 4HBZA 1KEEB 1XRRA 2VQSA 3JQ9A 5DLPA 2DR2A 1UWVA 2WILA 1VLZA 2OYCA 2X7HA 3U7FB 2Q3HA 3WTBA 4HPJB 2C7VA 2QUHA 4M8NE 4L5BA 1VLLA 2R97A 1CIJA 3BD9A 3GT7A 5FD8A 2ZUTA 4ILEA 3SSOA 4D8WA 1UKVY 1QOQB 4BNTA 1ZOIA 2FWIA 2QRZA 2G28A 2YTZA 3H4VA 3CH7A 1VKJA 4RDXA 1YCFA 3ZDRA 2RHRA 4OKSA 1G8SA 4KXUA 4KV9A 2ZUBA 4BNJA 5KNBD 2VSQA 4DLSA 1E6EA 1XZQA 3VR6A 3E3MA 4C4OA 4DILA 3N2GB 1R10A 5G0TA 4QDZA 1X7WA 1GU1A 3A6DA 2FMUA 3I42A 3R20A 5IN5A 2A57A 1NVDA 3X2FA 3IT3A 4F4IA 3FOFC 3A4VA 3AKYA 4LGYA 5KYNA 4MI9A 3OFSA 3BMNB 4BVFA 5BURA 3E5HA 2QYSA 3VR4H 2XR1A 1G9TA 3L7LA 1T43A 5FADA 1U0TA 5K0EA 1QZUA 4QWWA 1MBZA 3TEFA 2A0FA 1LPOA 2E87A 3K5IA 4F72A 5BN3A 3HP7A 2Z8ZA 1OXUA 3RRNA 2H17A 2YXBA 3RBXA 5SV2A 5CYGA 3GUYA 2YW2A 4IHJA 1IY0A 5HIMA 2EW1A 2ZGVA 4UTXA 1C3LA 1M2KA 4WXRA 4PYMA 1QBKC 3I37X 2H1WA 4TKUA 1PKEA 2M1XA 2OHXA 4G07A 3WLEA 2HSWA 3N7TA 4G5OA 4DDMA 2VRBA 3N6XA 4MAAA 1XNHA 3AOGA 3HKBB 3TOXA 2AXPA 1E2UA 3G13A 1GZ3A 2G7MC 3KQVA 5C3MA 4UAVA 4US2R 5K3EA 1K6MA 1QTRA 2ADFA 3WNBA 4R2JA 5JS1A 4KUHA 1FZQA 2FZVA 3T7JA 1PV2A 1NX9A 1ODKA 1LS6A 2FQYA 1HL7A 4CIVA 4OSEA 2Y93A 2QAGC 3V80A 3DE5X 3TVDA 5BN5A 2CXPA 3EW7A 3NKFA 1SVUA 1HOXA 5DGDA 2GVZC 1BVYF 1DHTA 2HIAA 3FUUA 3IFSA 4V2IA 3VU3A 5CFPA 1U1GA 2WIAA 4EI8A 4YQFA 3AI2A 3FWPA 4FR5A 1PDOA 4G26A 2ADOA 2F59A 1E0JA 4WK2B 3U3ZA 2GXQA 5KPDA 4N65A 2PCJA 1EFRD 4XAQA 1WU8A 4R71A 3USCS 5LZ2A 3ENQA 1FSSA 5IKOA 1KOLA 4INJA 1KY2A 2PS3A 3UMYA 3IDZA 1M8KA 3WMFA 3HHPA 4ND2A 3ZQ4A 4W1SA 1VL0A 2AL7A 3MIIA 1DBPA 4GX1A 2FZWA 1K27A 2YFKA 3NRCA 4URVR 1RRGA 3RANA 1U2QA 4X8MA 2IYFA 1JR6A 3R9XA 3GMTA 4URUR 2GUGA 2O20A 5HQJA 1E7MA 2ZR7A 3ZHRA 3NXKA 4G63A 1SD5A 5TNXA 3P32A 4NATA 2W6NA 3Q3CA 5KJFA 2VKQA 2IOQA 2VOJA 4HXEB 2HRBA 2WD9A 3KVRA 4TVKA 3RIHA 3SQDA 1GYRA 3VYVA 1P44A 3DEZA 2HPZA 3H2HA 2KBFA 3MMZA 1ACLA 2IL1A 1QFJA 3A6JA 3RKUA 1LI4A 4MR8B 5IYZB 3PBKA 1Q1EA 3AEKB 2HCBA 2HRRA 2ORYA 2WI8A 2Z2JA 3EFBA 4HDSB 4JMLA 4LHVA 3V4PB 2A0KA 2O0JA 3QW2A 5FFFA 1W7AA 3ZHCA 2QBYB 4O4HF 4B0OA 4ZREA 1WSWA 4WKGA 2GEJA 4Q7MB 4N8SA 3FZYA 2JIZA 2C42A 3W4JA 1B43A 1P29A 1T10A 3AF1A 4J2HA 4LN1A 4MMXB 3FYUC 5FRDA 3RSLA 4B32A 5CW2A 3C5WP 4AZWA 3W1VA 2TECE 4MWBA 1ZD9A 4NZYA 1LF0A 2IYAA 3C5CA 3HBLA 3ZDYB 2PUAA 4F4HA 1Z07A 3FTEA 1JEAA 3WXBA 1VJ5A 1ECLA 2HQ1A 2ORED 1D3AA 2P0YA 4DMLA 4PO3X 3OESA 4AZSA 4LBYA 3HVHA 2IYOA 4QPNA 4ESEA 2FHPA 4EATA 5E4FA 4GG1A 4MR7A 3DCJA 1ISMA 2IUFA 2CNLA 3F97A 2Q4OA 4P4SB 1NQXA 4L2IA 5SY4A 1E94E 3A4YA 1XCBA 3U4QA 2MSNA 3DT6A 1GZ4A 1NZJA 2GN2A 2PMCA 4EG1A 4RQUA 3SMQA 1EUCB 4R83A 5CT8A 2MYNA 3LRXA 4BNXA 3K0BA 3TYXA 1B0PA 1M8PA 1GO2A 2EATA 4HH3C 3TRJA 1E6UA 2XNHA 2AHRA 3H2GA 3QYFA 4L0CA 1CUWA 3F0TA 3CZRA 2WA2A 3F98A 3K0AA 2V7QD 1QIMA 1Q0TA 3FLBA 2PH7A 5B1HA 1N33B 4FD3A 4JJ4A 2P3QA 3LVRE 4FN4A 3FKJA 3I9V6 1OROA 5DLDA 4UJ3A 3AZOA 3K2IA 3WGVA 3ND7A 1BMQA 1KVTA 3I30X 3H5WA 3IRUA 3QV1A 2OBBA 1A8HA 3AKCA 2RAVA 1M10A 2R4TA 4BMVA 5IJ9B 3A06A 4K0RA 1KRHA 3N58A 3C3PA 1JQ3A 1OWNA 1TW3A 4ZCRA 3FPSA 4WSOA 4FI3F 3NJ8A 1QQAA 3THRA 3HRIA 4JCCA 1HGXA 1KJZA 2ZXFA 2FPXA 3ITDA 4O6VA 5CPFA 5EWLB 3BGWA 4GMDA 4MQ4A 1I4LD 2JLQA 3JWJA 5AUQA 1MHTA 3NWBA 2JFXA 3DHEA 3ONVA 4HN9A 3OF2A 4N7BA 4R1OA 4P31A 3R7WB 3KS9A 1CUAA 4AM8A 5C35A 3UMVA 1WKCA 3PSHA 3QE0A 1Y5NA 4Z53A 2GBPA 1KI1A 3PHHA 3RREA 1F7UA 1RPAA 4WVLA 1Z83A 4QTZA 2XYVA 1NBEA 4CRWB 4AZ0A 4XX1A 3I2GA 2YMMA 3PFWO 4RSRA 4XB2A 5AVXA 2PZ8A 3CY6A 3I61A 1C30B 2I2CA 3U80A 4KQ9A 1PQUA 1YFZA 2WPNA 4DMMA 1FP2A 4RSHA 1D4OA 3LUGA 1FYVA 3LF1A 3W3AD 4X41A 2DLDA 3DFUA 4R84A 3UAWA 2QG4A 3WO1A 1KS2A 1N2SA 1YNSA 2RGWA 2RSLA 3G0GA 1X7YB 3KZNA 4JSYA 4G01B 2Y1DA 2VPIA 3LGXA 4G0YA 1KOFA 4UFOA 4AZ3B 5KYYA 3RQSA 4WBSA 1EGAA 4PSKA 2RHBA 5KEIA 1PBTA 4G0UA 1GSHA 1M2HA 1ZSYA 2FEMA 2RJ3A 3N0XA 3U31A 4CKCB 2Q8PA 1J5PA 2FDRA 4D8VA 2WU3A 2WLTA 5ERXA 1IEWA 3JZAA 4PO1A 1QRUA 3D4BA 2X15A 4JI2B 2O2HA 4NCHA 1R00A 4WV3A 7MHTA 1R4NB 1Z37A 3I92A 2WWWA 1RS0A 4MWZA 5A2GA 5FWDA 3SY8A 2H1VA 1FFHA 3OAAA 1C9DB 2GYWA 4BX8A 4V38A 4L9SA 3KKMA 3K1TA 4E11A 1GVNB 3REOA 1MAAA 1PL8A 4IXMA 5GADl 3DMHA 1Q0RA 4O63O 1EFDN 1QP7A 2R1VB 2UYHA 3FCCA 1CNFA 4GI5A 1FTWA 4MVJD 1C41A 1Z47A 2P7HA 2VTKA 4QAJA 1TJ5A 2ATCA 3ZU4A 1FPQA 4ZOLB 3UF0A 8AT1A 3GY0A 3L0IB 1AXEA 1J2RA 3HO8A 4BCDA 1EUDB 3FCYA 3SHWA 2CGEA 2P41A 4UD6A 4BRSA 5K7SA 2B6HA 3TQTA 3RYCB 4FDLA 2QP3A 2Y0EA 3FCOA 3HGMA 4L5YA 5BMOA 1A9XB 1VA5A 3ORRA 2PTGA 3ZBQA 1TYZA 4F5WA 1KBQA 2ZU6A 3HCAA 3OE5A 1HRKA 4KGZA 2VXCA 3H6KA 4DUGD 1FYFA 2B9VA 4OPMA 3IUSA 3OU2A 3G59A 2UYYA 4R2KA 4TL7A 4NNOA 4UC0A 2R86A 3VYTB 4TKZA 2EC5A 2YV3A 1NW4A 4BFSA 4IGEA 4XR9A 2YWFA 1APBA 5KYXA 1NBOA 4V0LA 1XVAA 1DUVG 1YTUA 1SPXA 1TU3A 2J87A 5FOXA 1Q6ZA 5C8YA 1XMPA 1TVKA 3K4HA 4C7JA 2GPWA 1VSTA 4G37A 1WVIA 5JXWA 2Y27A 2QXUA 4WDRA 2QQGA 4ZAXA 1PJSA 1T4CA 3MWKA 4KPUA 5DE3A 1I0LA 1N78A 2A1TR 1D0SA 1QHGA 4HF7A 3FJ1A 1L1EA 2HMWA 5I7VA 2IYTA 5GJWC 3T8YA 3DBLA 2ZPAA 4PZZA 2R2GA 8ATCA