4ZMSA

Structure of the full-length response regulator spr1814 in complex with a phosphate analogue and b3c
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
207
structure length
207
Chain Sequence
GLVPRGSHMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEMVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Structural characterization of the full-length response regulator spr1814 in complex with a phosphate analogue reveals a novel conformational plasticity of the linker region
pubmed doi rcsb
source organism Streptococcus pneumoniae (strain atcc baa-255 / r6)
molecule tags Dna binding protein
total genus 74
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zmsA01
3NNNA 4IRXA 3UUGA 1DBWA 4F12A 2H3HA 4MS4B 2WWVD 5EWLA 4QYWA 5T3YA 3HUUA 1WETA 1NXXA 3LKBA 4WWHA 4WXEA 1ZESA 5FWXB 3H6HA 1JF8A 2KYRA 2N9UA 2PL1A 2RJOA 4RY9A 3IP9A 3Q7RA 1YTUA 1YS7A 1GUDA 2R25B 1D4ZA 1M5UA 4D74A 4MAAA 5TQJA 4CBVA 2GX6A 1MIHA 1BA2A 1JBEA 3H1GA 3H1EA 4MRMB 2P9HA 4Z9AA 1S8NA 4ETIA 1KRWA 3RVNA 4IMIB 4Z9BA 5KC8A 3CRNA 2FMFA 3KSMA 2RJNA 3RVQA 3M9WA 4W5QA 3O75A 3OQNA 1AB6A 4MS3A 5EWMB 3SM9A 1GUBA 1NXTA 1Z12A 2FSPA 3EJWA 4P1ZA 3DGFC 3O1JC 3LUGA 2E4YA 3K4HA 3F6PA 3CS3A 4JA2A 1RPJA 5E3JA 3KG2A 4N76A 3KCNA 3OMXA 4O1IA 5KQMA 4RKRA 5T7BA 3GV0A 1ZGZA 4D6XA 1A2OA 2L2QA 2VUIB 3TB6A 2GI4A 1JL3A 4MS4A 3VNBA 5IEJA 1DJMA 3EODA 4RKQA 4QPJC 3GA5A 1EWKA 4YS6A 5FWXA 3TX6A 1OXBB 3MMNA 1P6QA 4G0MA 4D6YA 1E6KA 4ZYLA 1D5WA 1URPA 2M1ZA 2PAFA 4G0ZA 4MRMA 4YWHA 1YK1A 1F51E 3HUTA 2F8TA 2CHEA 1QQAA 2PUAA 2F8SA 3IP5A 3T6KA 4Z0NA 1B00A 2L17A 1ABEA 2IPMA 5FWYA 4G0YA 2A9QA 1ZAYA 1LJLA 3H6GA 4NCAA 5EWMA 5I4CA 3SG0A 2PUDA 1FFWA 2HQOA 2PUFA 4S04A 5DLEA 3KLOA 3HDGA 4ZPJA 1BDHA 2O20A 3GWGA 1W9HA 3KTOA 3LMKA 4ETMA 3CU5A 3OLYA 1NATA 1QP0A 4JB0A 1YIOA 3BBLA 1JWLA 3CG0A 4G86A 4RDCA 5JNVA 3ROTA 2JRLA 3N8IA 3JVDA 4E7OA 2A9OA 2M98A 3C6QA 5GQSA 2RGYA 3MQ4A 1ISSA 3SNKA 2JBAB 1RNLA 4JASB 4Z4CA 3MM4A 3ILYA 1U2QA 2FMKA 2PKXA 2WJAA 3HCWA 2FEWB 4XFKA 2RDMA 4RK5A 3N75A 2WJWA 3QLTA 1EWTA 3FFWA 2FEKA 3I5AA 5D2CA 3LUAA 2WRZA 2HJ9A 3F6CA 4N0PA 5IUKC 3D8UA 1F4VA 2QV0A 2QZJA 3GBVA 1Z25A 3OO0A 4XXHA 1QQBA 4Y9TA 3R0JA 3UKJA 4KV7A 2NT4A 3FGZA 2I6FA 1E6LA 2WY2D 4RXTA 4KVFA 1SXGA 2HSGA 2ID7A 1JLKA 5JS2A 1DCFA 1K66A 3NNSA 4LX8A 2PUCA 2FQWA 3BRQA 1GLGA 2X7XA 4LE2A 4MLCA 3OQMA 5HQJA 1PHRA 1UDRA 5C5CA 4Q6WA 2DRIA 2CD7A 2JBAA 2JVJA 4FE4A 1SRRA 1BDIA 1NY5A 3LUFA 1EAYA 4OATA 4EYKA 1C0EA 1NXSA 4W5TA 4OLAA 4H60A 4KQCA 3O21A 2TMYA 3Q7TA 1BDJA 3SQNA 5KI6A 4G0XA 4TLMB 4NQRA 3OM1A 1DG9A 4JP1A 1JH9A 1USGA 3HEBA 3H1FA 2B1JA 1NXWA 1EFAA 2QXYA 1QMPA 1VPWA 1EWVA 4KMRA 2W42A 3QX8A 3CTPA 3KLNA 3JY6A 2XDYA 3MA0A 2PUBA 3C3WA 1MB3A 5KQGA 1HEYA 3HS3A 4P98A 4RK6A 3H5IA 5JNRA 2PL9A 4GNRA 1JHZA 1M2EA 1OXKB 2AYXA 4EVRA 1YK0A 3KJXA 5JNSA 4IF4A 3L6UA 3RVSA 5FWYB 3HDVA 1D1QA 3OO1A 2JCGA 3ROFA 5CNIA 4MR8B 3T95A 3O2JA 2LBPA 3BRSA 3KKEA 3TO5A 1DP4A 1JYEA 5PNTA 3QEKA 3N0XA 4M88A 3HK2A 3C3MA 1Z17A 3RQIA 5ED4A 5IUJC 4FB4A 2FEPA 3CHYA 2IPLA 1BAPA 1D1PA 3SY8A 3QX9A 1YMUA 1LBIA 2J48A 4EY3A 1MAVA 3CNBA 5FBKA 4XLTA 2JVIA 2E4UA 3NBMA 1W25A 1VRVA 2A9PA 5TPWB 3JPYA 3NHZA 1SXHA 4EYGA 1JFVA 3A0RB 3O1HB 4LRQA 5IBQA 1QO0A 4QYMA 3F7NA 3Q9SA 1BVHA 4KQ9A 1GCGA 3OM0A 5KQPA 1Z16A 3HO1A 1EHCA 2PE5A 2A9RA 3OMWA 3HV2A 5IC5A 1GCAA 2R47A 3GYBA 3IP7A 3Q15C 1ZY2A 2MSWA 1L5YA 3RVOA 5ABPA 4Z4HA 6CHYA 5BQ3A 3H5WA 4HNRA 2MYTA 1ZHHA 4MS1B 4MR8A 4MPTA 5HSGA 3CZCA 3I45A 2L19A 2IKSA 1JX6A 1Z2DA 1SXIA 2QR3A 4H3KB 1DRJA 5TPZA 1U0SY 3O74A 4F8JA 3H75A 4N0QA 1JFTA 4RU1A 4EYQA 4WXMA 1PEYA 2IPNA 5TQ0B 3HVRA 2MSLA 4RXUA 4RY0A 5BR1A 4W5OA 1DC8A 3K9CA 3N6VA 4ML3A 4MYRA 3QELB 3Q7SA 4RK4A 1YMVA 3H5VA 4IILA 4TN5A 2R48A 2ID9A 5TPWA 1DC7A 3DLBA 1K68A 4KZKA 1U8TA 4RS3A 2PUGA 3HZHA 1VLZA 3B2NA 4LDAA 3HXMA 1IIBA 3DGEC 1Z15A 5B3JC 3H5TA 3F73A 1USKA 2NT3A 2WMYA 4KREA 4LE1A 4EVQA 4XASA 4MS1A 2YHBA 2FQYA 2R4QA 3I42A 4OBBA 3OLXA 2FQXA 1ABFA 4EYOA 4WUTA 1JFSA 1DRKA 5KQLA 2FKAA 2FVYA 3CZ5A 4L85A 2NUBA 1TM2A 2PUEA 1Z2EA 4YO7A 1ZN2A 4H3HB 2GBPA 5IX8A 2PJUA 4PICA 3FFXA 1TVMA 2E4XA 5IEBA 4N41A 5TQ0A 1A04A 2CHFA 1P2FA 2IOYA 2CWDA 4HNQA 3EQZA 1MB0A 3QELA 3IP6A 3G1WA 1Y1LA 4LE0A 5CNKA 1P8AA 3EGCA 1LK0A 5JNTA 5JS1A 3JPWA 3E61A 1PNTA 2VK2A 2HQRA 3LKVA 1U2PA 6ABPA 4Z4FA 5JNUA 4EUKA 4MQEB 3LFTA 3QLVC 2FN9A 1H9CA 1LJUA 3W9SA 3IPCA 4JB2A 1USIA 9ABPA 1XHEA 1NTRA 3SAJA 1TJYA 2NZUG 3HSYA 3KS9A 3N53A 4JOQA 4HYEA 4MGEA 1R8JA 1PEAA 3QEMB 3OLWA 1QP7A 5CNMA 5FBHA 5EWJB 1D2AA 3FFTA 3NNDA 4KK4A 5IULC 1FFGA 2LIVA 1VKRA 3URMA 2QW1A 4RZSA 2HPHA 1FFSA 3LTEA 3DLHA 3OLZA 4TLLB 3JVIA 1I3CA 1TMYA 3QK7A 1DBPA 3JTEA 2QU7A 1C4WA 2MYUA 3OQOA 1RXEA 2JK1A 1QP4A 4F11A 5KC9A 3L49A 4NCBA 2VUHB 3CG4A 4FE7A 4L4UA 2B4AA 1RXIA 5HKOA 1E2BA 2ZWMA 2BGGA 1YS6A 2GWRA 5C5EA 8ABPA 1RZRA 2JB9A 3KHTA 4G0PA 4YP9A 4G0QA 4RK7A 3VNAA 3P9YA 4MQEA 3FMVA 4PE5B 4G0OA 4DN6A 3MF4A 1DZ3A 4PYRA 3T38A 2MSKA 4PEVA 3QLUA 4RXMA 2LPMA 2NZVG 2Q5CA 4GPAA 5DKFA 4RV5A 3HJFA 3QEMA 2OQRA 4OTZA 5EWJA 2PLNA 3RH0A 5GOTA 1Z18A 4YGXB 7ABPA 5DGCA 2GKGA 5BRAA 3A0UA 3BILA 3JS5A 1P6UA 1QKKA 1APBA 3EULA 2E4WA 4MR9B 4EGSA 4KFCA 3RVRA 1A0OA 1ZITA 1MVOA 3QLUC 1DCKA 3FDFA 4KK3A 3I09A 5TE9A 3GRCA 4ETNA 1ISRA 2ZAYA 1KGSA 3GT7A 3RVKA 2HQBA 3EAFA 3TMYA 2P4UA 4OG2A 4KPYA 1LBHA 2FLWA 1E6MA 1Z13A 4LDZA 1ZH2A 2JVKA 3KYJB 5BRJA 1PUXA 2E4ZA 3MYYA 5B3JA 1KMIY 1TLFA 3N0WA 3Q41A 2AYZA 3KYIB 1Z26A 3UK0A 4Q6BA 4IMJB 2E4VA 3M6MD 4S05A 3A3KA 2V0NA 4JAVC 4XARA 4EVSA 4Z4GA 1FQWA 3RVPA 2LUOA 4DADA 3CKMA 1ZGGA 4F06A 2IDMA 3HM9A 3DZDA 3BREA 1M5TA 1ZDMA 5DTEA 3G85A 4TMYA 5HM6A 3EDCA 3LUDA 3NHMA 1RZRD 4KNYA 4RSMA 4NICA 5JNWA 5IUNC 3RVLA 1NXVA 5F64A 4MR9A 1NXOA 4Q7EA 4KRFA 1M2FA 3EQ2A 4MR7B 2FMIA 1SD5A 3ILHA 3D02A 1NXPA 2MYPA 1XHFA 2FLKA 4OLBA 3H5OA 3MIZA 4O1HA 1QPZA 1T34A 2VYCA 1CHNA 4ZMSA 3GBPA 3IPAA 3C3KA 4YRZA 2FTKE 4Z4IA 1AB5A 3GL9A 4QICA 1ZVVA 3H5LA 4MQFB 1DCMA 1QO0D 2MYNA 1JDNA 3CFYA 3RVJA 4WT7A 4W5RA 2OENG 2QVCA 3C97A 3QLVA 1JDPA 1XWWA 4RK0A 5TQ2B 4Z4EA 2FMHA 3LUCA 4MS3B 2FXIA 3OLVA 4NV3A 4UHKA 5CHYA 4RWEA 3TD9A 2FW0A 3E3MA 2IYNA 4YLEA 5EWLB 4YCSA 1PNRA 1QNLA 1L5ZA 1ZH4A 4N03A 1U04A 2QSJA 3O2QB 3LUHA 4UHJA 3LOPA 3O2SB 5KWSA 1JYFA 4WZZA 3LUKA 4YV7A 1FSPA 3IDOA 3S99A 4ZJPA 4G97A 5CNJA 4ZMRA 1J56A 3LUJA 4RK1A 2L18A 4B09A 4N47A 2WB4A 2H0AA 4F3TA 5TPZD 4MR7A 3CLKA 1KRXA 3A10A 4IGAA 4RY8A 3O1IC 3T8YA 1CYEA 4XAQA 3M9XA 4O5AA 4W5NA 2YHAA 2QVGA 1YVUA 4HNSA 4PZ0A 3DBIA 3RVMA 2PMCA 4DQDA 4Z99A 4E7PA 4MQFA 4YR7A 2FN8A 4MLDA 3N0RA 1CEYA 5TQ2A 5DCLA 4LZLA 2IPAB 2LP4Y 1DBQA
chains in the Genus database with same CATH superfamily
2VNHA 5MN4A 4U2DA 1E6EA 1F6WA 1RVV1 4IRXA 5IAAA 4MUJA 3QBDA 3CLHA 1T36A 3IX7A 2H4HA 1CLUA 3HUUA 5CB4F 5JT1A 1I14A 2QMHA 5G40A 2D1TA 2FF7A 3EIHA 5BNZA 2N9UA 3FPJA 1EBBA 4AWAA 4RLFA 5IG2A 1T10A 2O3UA 1W87A 4EB6A 2X0FA 1GUDA 1D4ZA 1XXHB 2QORA 3DAYA 1AK1A 4MAAA 4RENA 4NECA 2NU8A 2Q1SA 1JBEA 3PX7A 2J5QA 3E3NA 2O8DB 3U09A 4EI2A 4WBNB 1W2HA 3KSMA 5HWSA 1O6BA 2RGAA 4UNPA 1RADA 3R3ZA 5JC8A 2DWOA 3P9QA 5L95A 1UXOA 2SNIE 1K5GA 4AUNA 3H4TA 3MT8A 3EJWA 1MOZA 1DL5A 4P81A 4WAUA 5H3CA 2HBZA 4J3JA 3IXQA 1VGRA 2IA5A 1QZ3A 2PK3A 1LW7A 5ISMA 1YQEA 3M33A 4EMUA 5AW6A 1ZK4A 2HYDA 4ARVA 4PZUA 2PRKA 3FMIA 2VHUA 4E5YA 2PXXA 4NR0A 3LQKA 3DDOA 3QPDA 5BQPA 4JY7A 2XYGA 3LVRE 2GEBA 4X71A 2AKEA 3AR9A 5LYJF 4I3GA 1TPYA 1U2SA 3OJCA 1PGJA 2RHCA 3MUNA 4L8VA 3UT5A 2ZCUA 4FYXA 4L4SA 1R37A 3K0FA 3N28A 3TGWA 1P1BA 4FKMA 5CFZA 3I1FA 3ZHSA 1W35A 3H5AA 3KE9A 1Q14A 3CVVA 3DE4X 4P7GA 5CEEA 4KPUB 5C9ZA 2BHRA 3MWEA 1MX1A 3HHPA 5JDIA 4WZAB 1ZJ5A 4QQNA 1M34A 2A57A 2OORC 4XSHA 1P60A 4RLSA 1O8CA 4CUKA 2VLIA 5BNFA 3IT3A 4M7PA 1FNNA 3FLMA 4B73A 3JZFA 2IYVA 1MT0A 4H59A 1GPJA 4M53A 3M83A 1A72A 5FOWA 1HE2A 4HLUC 5JMPA 1XJWA 2H5IA 2OUIA 1MUUA 4H7IA 4WXPA 2PBFA 3OLYA 4KJXA 1LGYA 1YFZA 2B21A 3GMTA 3RKRA 5EJ4A 4R8SA 4DA6A 2GETA 3IXLA 1PLKA 5AVOA 1F5SA 2BMEA 2REOA 4XPIA 3QWBA 1B6TA 4KE7A 4RZIA 2B4KA 3UEOA 1ONSA 2HHAA 1ISSA 1LPPA 2QG4A 5IC6A 4DLUA 3EARA 5E6RA 2FPOA 4D8XA 3THYB 3VU9B 3IURA 4BDSA 3HBJA 4BJ3A 2CY0A 1HTWA 2YTZA 5ER9A 1CLEA 1I36A 2VIIA 4XFKA 5FYQA 4U2KA 3WTBA 1GLVA 4JXZA 5EE5B 3QTLA 3KYDB 2FEKA 1RQPA 1TYBE 2CCJA 2JFFA 4BTEA 3ZVNA 5J1SB 4OMUA 3IKTA 3OZTA 4YAFA 5CVEA 5TVKA 2QMZA 3UVEA 1YRLA 1Q92A 3UKOA 1HUQA 3BE6A 2X2PA 2ZYIA 3AJRA 7GPBA 3WGQA 5EPUA 2VT2A 4QU9A 3JWPA 4RANA 2O7NA 3TJRA 2XUJA 5DX8A 2NT4A 2RHRA 2WY2D 1C0LA 2FU5C 1HLPA 3EZXA 3TE6A 1CZLA 1JLKA 5JG7A 3RU3A 5JS2A 3RADC 3NYRA 2H08A 4LX8A 1FP6A 2AUMA 1N6HA 4CL2A 1U0EA 4UUPA 2UYYA 1A5TA 3MAGA 2BGTA 4H3VA 3JU3A 4Q6WA 4A6PA 3JR7A 4OP3A 4GD3Q 1B43A 2IZOA 4YAJA 4JI3B 3TQTA 1QH8A 5JZVA 3CW9A 4GL2A 2JVJA 3BD9A 3ICOA 3ZI4A 1QC5B 1GUZA 5JSHA 2MJLA 1NBIA 4HDSA 2FCAA 2IV2X 3BL6A 4PLYA 4I36A 1WXXA 3ZNPA 2O2DA 1NYTA 4ABTA 1YBAA 3JQ6A 4NPCA 1H9BA 3ELDA 5G4LA 3GB9A 4E30A 2YC4C 3U13A 1PHPA 2WHRA 3OM1A 5G0UA 4Y1FA 4G65A 4H7KA 4PYQA 1GNRA 2RGDA 2X14A 3BSSA 2B1JA 3R0QA 2AT1A 3W06A 4DV5B 4YUXA 5BRNA 5KNDA 2Q1WA 3BTUA 1CPYA 3ED1A 4F3CA 3AR4A 4W1QA 1YFKA 2K5UA 3HVJA 1J8DA 1EHYA 4P7KA 3UJCA 1PZXA 1QR2A 2IS1A 2V3WA 1NU8A 2ASVA 1DAKA 4HDKB 1UQTA 4Z7NB 3LPMA 4K9RA 1G2PA 2NZJA 5EN4A 2JGFA 2R6JA 5K0BA 1QH0A 1AQYA 9ATCA 3T95A 1C1DA 1EZ1A 1GG5A 1N92A 1X8KA 4K0RA 3ZWMA 5FRDA 4C4XA 4E5KA 1OH8A 3IDZA 2PX0A 5I4BA 2JGEA 2Q49A 1GU0A 3Q7EA 3R3VA 1IAVA 1RBQA 3AHEA 1ZK2A 3NC1C 3G9XA 3ONVA 2E18A 5AMXA 4DLVA 2J31A 1W46A 2F59A 3BN3A 3HCNA 3MTIA 5E7MA 5C51B 1CDZA 1RC0A 5F9MA 3E8MA 4HFJA 2IUEA 3I05A 1HBJA 4Q9KA 5CPFA 1ORWA 2EP8A 3RS2A 3HXQA 4DMKA 2ZRCA 1EIZA 4HAVA 1UPCA 2Q9AA 1CC1S 4W9NA 2IHVA 4B8ZA 4R2KA 3QKSB 1D4AA 4Q02A 2W6CX 1UUFA 1YI1A 3WLEA 8AT1A 1EA5A 2YZ7A 2J46A 4LECA 2RAFA 1ZM2A 2OK7A 3SDBA 4GOND 3WHIA 4DCGA 4E4YA 1OWNA 1SZCA 1TAHA 4H7PA 2I78A 2I2FA 4M1WA 1VCNA 1MT3A 3RV4A 3N2EA 3WKAA 2GA8A 2HN9A 1L5YA 4B74A 5LLTA 2DWCA 1IM8A 2JPDA 2IWRA 4FI3F 1NUUA 6CHYA 4FX5A 4A03A 3LT4A 3ANYB 3GBSA 3O9VA 4ACAA 4QDJA 4KYUA 4YH1A 2B4YA 2XJ9A 2AI1A 521PA 3R20A 3FCCA 1YZTA 1II8B 2J3EA 1JNYA 4XD7A 1QJCA 3WZ2A 1U3FA 3O6VA 2KLHA 5GGYA 3T3EA 3SFZA 4S1VA 3IUMA 3ZV4A 2XEDA 1L4NA 3GGGA 3NHSA 2WSSA 3PJEA 3R7AA 3I0NA 5K3DA 1SVSA 1T5DX 3BERA 1KZ7B 1UBGA 3GU3A 3ILSA 4FWBA 1RFGE 3SXUB 2EJBA 2VLBA 1GDTA 2D6FA 3A27A 3WLKX 5DP1A 1BGXT 3DMDA 2GILA 2PMWB 3BTSA 3C1OA 1GTVA 1RWQA 2AKYA 2ID9A 2CCKA 2G28A 4PTYA 5JXJA 2OXIA 3WG9A 3MUFA 2H9AA 2VUTA 4FFOA 3NOQA 1EU1A 4M2LA 1ZYUA 4WY5A 5KAMA 1GGVA 1NVBA 4FFRA 1GRQA 3MGBA 2QQ0A 3T61A 3W6OA 2PUGA 3BK2A 5EYPA 1JTFA 3RS8A 1F2UB 3O47A 4CIDA 4CKCB 3NI2A 3G0OA 3F73A 1N5JA 3L1IA 2HRCA 3KJQA 4BLQA 3C24A 4OBBA 3R5SA 1D0VA 1YS1X 2FQXA 1Z8NA 2ZU0C 3IBFA 4QGAA 4AK9A 1OXVA 2UZ3A 3CV3A 3WB0A 1CDOA 1GNQA 1VLLA 1AN0A 1XT6A 4X63A 4YONB 2I5PO 1ECFA 1H8EA 1I13A 1KOJA 4ID9A 3PEFA 4J7CA 3UOWA 2YXLA 1F0NA 1QB7A 4X1OA 1XA3A 1ZMXA 1RU3A 2I3ZA 1IZ8A 3IUQA 1TVMA 3K3PA 4I6GA 4RH1A 1EUZA 3B9RA 5AXAA 3RASA 1C7RA 4P3YA 2C96A 1DTWB 1U11A 3O0DA 5F21A 3K70C 1ZMTA 3GFGA 1CJSA 2WIDA 2IYYA 3P9PA 4HNQA 1Z6XA 3KLBA 4MVJD 2QAIA 5AI9A 1IDN1 2EJUA 1ATIA 1DWPA 1MB0A 2IXBA 1JNXX 1JW9B 2O5RA 3CWQA 3DAHA 3GLVA 1T35A 4JFRA 1U9CA 4PONA 1V6CA 1LK0A 1LSUA 5JS1A 1O6ZA 2V58A 4A8TA 1Y3CE 1OCEA 3HTXA 4F4UA 2I6SA 3HPRA 3D6FA 4GRIA 3QVTA 3GT0A 3BMQA 4B9AA 2BKEA 3ANLA 3QLVC 3FRJA 4HB0A 3PKJA 1LJUA 1SQ0A 2G0TA 4NRDA 1AOXA 3E8XA 3EZYA 1ULAA 3THSA 2WQ6A 3FPHA 5EPOA 4RD6A 1CEEA 1ECJA 2J6BA 3G0GA 3CKYA 2XECA 1G8FA 1D2HA 8LDHA 1UZUA 4JIGA 4GBGA 5EJEA 3A04A 5FBHA 1X86B 1TK2A 4YAUA 2F3PA 1XZHA 4G1VA 1VHJA 2H18A 5FAXA 4ZVUA 5BQOA 5FXMA 5EEGA 5JARA 3KKZA 2FMTA 3NORA 4ERXA 3FJYA 3C7DB 3J7TA 3T35A 1S2NA 1UDCA 2EQ5A 3PPVA 4ND8B 1PJZA 3WL7A 1ZNXA 2G1JA 4MXDA 1OYVA 3OQOA 4FE3A 2BOVA 3A6LA 2FFJA 4UM8B 4F8YA 3QYPA 5ES3A 3EGWA 2K4MA 4YRCA 4B6GA 1AK2A 2WU0A 3QF4B 5EOVA 1RZUA 3AV0B 5F1OA 2NOAA 4G0QA 4D9NA 4BO8A 2FPUA 2FSGA 2R6FA 1Y37A 2YWBA 3P9YA 1UR5A 3TBHA 1Z73A 4BCDA 4DYHA 4MQEA 5LBUA 2VEOA 2WJHA 1KDRA 3FLEA 2ZWOA 3OT1A 2DHCA 3RG2A 1IXSB 5LP6B 4TLAA 4RTJA 3EN0A 4BBJA 4CI9A 2NZVG 5DLQC 2Z6QA 1PZEA 3D0OA 4FCWA 3VH4A 2YH2A 4DNOA 2L0XA 1HOXA 1MGOA 4HS4A 1SOAA 4UU8A 1CY0A 1NUTA 1KWKA 2AFRA 3A4NA 4O6VA 5T64A 2GKGA 3SIPA 1NR1A 2PUWA 4HSEA 2ZDHA 2XKKA 1L5LA 3LYLA 4LF5B 3W7VA 1XQ9A 3KBBA 4HDNA 2YY7A 4KXLA 4LXTA 5K2OA 5CHYA 2D06A 4OHZA 3GNSA 1ZITA 2BEWB 2GYWA 2QJWA 3RIXA 1M6VA 2W48A 1W34A 1AGRA 3R7DA 1NJ5A 2GTPA 3FDFA 1WM1A 1RJGA 4KK3A 4C0AC 4DJ5X 4Q3LA 4BRUA 4JNKA 1WSAA 3NTUA 1XRMA 3ZIAA 1QIIA 4U3JB 2HQBA 2BEVA 3T5CA 2OHXA 5A62A 2P4UA 3ESXA 1OBVA 5DJ5A 1G18A 2I6UA 1WV1A 3GCWA 2R68A 4NENB 3KYJB 1YDWA 1RPAA 2VDQB 3SC4A 1Q0LA 5HUHA 3ABZA 1VJRA 1JEJA 1UBKS 2FP4A 4YAOA 4ZQCB 3BZWA 5KTYA 1KO7A 2RH9B 5JIBA 3TEFA 1COWA 2BJWA 2F9FA 1PRYA 3I1YA 3NHPA 3OKFA 4PGMA 2C5SA 3AKEA 4YCBA 1GSOA 4WGFA 5HBRA 1VIMA 4AY5A 4KNYA 1X7WA 1MIOB 5JRDS 2YN4A 3T3IA 2PMBA 1U7DA 1QDUA 5GINE 1KXJA 1PVOA 2XRFA 2VUSA 5IXSA 1D4OA 1XPOA 1CUIA 2GK3A 3L1KA 3GQVA 4ZV7A 3AETB 3DBLB 3MPUA 1IPEA 4UDNA 3S1LA 4DLZA 2EZTA 4IGFA 2B20A 3AR7A 4FEGA 5A6VA 2OZKA 4HDMB 3OE7A 3TDMA 2BC9A 2W43A 1JG1A 2XB6A 5FJIA 3NTVA 1PFYA 1QGUB 4N5DA 4BV3A 2GK7A 2VDWB 4O4IB 2C61A 3SS7X 2RBKA 2Z09A 1U2DC 3PS9A 3ZDRA 5TR9A 3F5FA 1WHSB 4AUKA 4F3YA 4XH9B 3S8YA 1Z33A 3C48A 5D6OA 4RVDA 2C2KA 1K5PA 4KIFA 2BTQA 3MT7A 4QT0A 4PYMA 3GK3A 1PNRA 1QNLA 1R88A 3F3SA 4QQRA 4UHJA 4I55F 3BB4A 3BA1A 2AD1A 2QMOA 1S2DA 2R8BA 5HF5A 3OETA 4AWBA 2JIZA 3DDWA 1FJ2A 2IFTA 2VTEA 3AUSA 3COSA 3TRKA 3VR1A 1JPJA 4ZK6A 4JR2A 1J56A 1LBTA 5LZ7A 1CF9A 4JQSA 2WB4A 3AJDA 1DRWA 4H4EA 1G7SA 2VNIA 5JXHA 4WNYA 1Q57A 1ZEMA 3U4AA 5EKSA 1E9EA 3SE0A 3DO5A 3GDGA 4AQYB 3M9XA 3JALA 4MVXA 4D3FA 4O5AA 3KVRA 4GYKA 4EUHA 4TTJA 2PRSA 4AY6A 4E5VA 4PZ0A 1RR6A 1U1GA 2FB9A 3G82C 3KR0A 5KX5A 3NBFA 5CLHA 2ZETA 4UJ5A 2BRUA 2FZLA 3G7SA 4U6SA 1IDOA 5KNDH 5HKLA 1WP4A 3WJ2A 5IC4A 2JIRA 2PBLA 1XZDA 2D1FA 2SECE 3L77A 4DANA 5KSYA 4EW2A 2WD9A 1HYHA 4B3JA 3QEJA 3COPA 5GM2A 3DBHA 3GROA 4M9RA 4MWSA 4G6ZA 4NYMR 2XLBA 1H85A 2R1VB 4P35A 5CYGA 1IBSA 4JI7B 1KI3A 4ZCPA 1EXVA 5K0SA 2LR0A 3GIWA 1D2RA 4K9PA 4WMLA 4J3FA 4B75A 4EG0A 3B5IA 1P72A 1RQRA 1G98A 1VE3A 4P4TA 1E2NA 1F2TB 3LPDA 3O94A 4I4TF 4G1CA 2V9PA 3TNLA 1DX4A 3OPVA 3FIUA 3PC7A 5U1PA 3RVNA 3F3YA 2BKVA 1KRWA 3N8NA 4EZEA 2COKA 3RWBA 3ZDXB 3A36A 3DM9B 2FMFA 2QDKA 3HB7A 5IZCC 1T2FA 4NV0A 3AP2A 3RQSA 1XDGA 1OE0A 5FJJA 4JR1A 2QW8A 4J0GA 3COVA 3KTDA 5AK5A 1YQ9A 1CQIA 3HFSA 4RPKA 1L7BA 4TROA 4BMNA 4LKRA 4OH7A 3RFTA 2KMLA 3A31A 1E1QD 5AXDA 3ZLUA 2B1QA 1G9SA 4XWKA 1OB5A 3QVKA 2IELA 1V4VA 4HFNA 4IHJF 3WBBA 1CKEA 2IY7A 4NY1A 4G4SO 5AKIA 1FOEB 3O9ZA 1RHMA 5CTAA 1K27A 3PE3A 1JE0A 3TCNA 3IAS1 1ZGZA 3PNPA 4CMKA 1UJ6A 1A2OA 1PR9A 3K2BA 4C7BA 1KZ1A 4EO9A 2IZ5A 1PJ4A 1GZ5A 3OAAD 5DRYA 1HZZC 4V0ME 4LBZA 4Y2RA 3RFUA 8ATCA 1NUHA 1XUOA 3G02A 1ZC3A 1C50A 3VKUA 3UUEA 3WMEA 1XFAA 1HNXB 4HLUA 4HGRA 4Y9UA 1ZXBA 2PUVA 2JLAA 1QCZA 1RSZA 1YO6A 4HDRA 4HQRA 1JGTA 4LQDA 4V39A 4XWYA 3U31A 2P67A 4B6FA 3VGJA 5ALDA 2XRZA 1HR0B 1H2HA 2RI6A 5CCXA 2IH2A 3OQBA 4PRZA 4DT1B 1S96A 3TEJA 2H7VA 2CLDX 1AKEA 4M0MA 4E70A 4CETA 5K0GA 1LH0A 5I7EA 1GPAA 3O4IA 1XMXA 1NYRA 5FBVB 4BZZA 5BNIA 2C2HA 2YICA 4JQCA 2B1GA 4YUAA 1ADJA 1FFHA 1HL7A 1KSJA 5DLDA 4JT8A 2PANA 1BDHA 2R62A 3NX4A 4JX8A 2PYDA 3G17A 1BKDR 5CLJA 2ZB3A 3KTOA 3WRXC 4XQGA 3W5AA 3ZX5A 4NC9A 5DIFA 3ZQKA 3NXKA 3T0IA 2N0SA 4IRUB 2H7XA 1JFRA 4CV0A 5GOZA 2G5PA 4IO1A 1U2TA 3CZRA 3OIWA 4A1OA 3RPEA 4YJGB 3DWGA 2JRLA 3PC8C 2FQQA 2M98A 2VI5A 1NVVQ 3U49A 1GAEO 2J87A 4P9NA 2XV1A 1DMRA 3RODA 2FX3A 2H8KA 2CNOA 2VYND 3U62A 3EZNA 1RNLA 1L5NA 4GXTA 4PR0A 5EIWA 4LF6B 1CUJA 4Y67A 3I9NA 4WCDA 1NBOA 2CHVA 3WIBA 4A82A 3AGPA 2WJWA 3FHOA 3WNCA 3I62A 4GVLA 3CTMA 4QBTA 3MPOA 1BG6A 4RE5A 4D9CA 5B4UA 1ZVMA 1VKNA 5T41A 4NG5A 2ZSDA 2JNWA 2O8BB 2Q7DA 1EM6A 4N5HX 1LKZA 1NMSA 4P32A 2YWHA 1C9JA 3JQRA 3PKZA 3CVXA 4MWEA 4KDCA 4P8RA 4PZPA 3H2SA 2W98A 3WLRA 3IAHA 3JZMA 3N2GA 4S2EA 2PT7A 1NQ5A 1P1IA 4LGVA 1DBIA 1E6LA 4B0PA 3T7SA 3TX2A 4HJXA 1DCFA 4LFAB 1MFPA 1OA1A 1NJ6A 2VEDA 2WMDA 4C9BA 2VTDA 1NLMA 1T5OA 1UBTS 4PX2A 3QE3A 3HDYA 3QUBA 1MVNA 3ENNA 1NUPA 3WK5A 2PUHA 3CISA 3KD2A 3L7IA 3N58A 3PYXA 3I9JA 3LLSA 4MGZR 3KIPA 1FTQA 4N01A 4QOIA 5EE3A 1NL3A 1JFFB 3IO5A 3PUHA 5A5FA 3BQ9A 3H65A 1QGAA 3SQMA 5I7SA 3EBLA 2G40A 4XCQA 2Q0XA 4BFWA 1GPBA 4GE0A 3S68A 1E3MA 1EAYA 4P7FA 1O94D 2BEUA 3N76A 1IJFA 1C7IA 1M72A 2DQYA 2P4QA 3GPCA 4IKEA 4CKZA 3B2EA 1SQ6A 1XK7A 3R24A 1CFJA 4BIMA 1R6DA 4HPWA 4TLMB 4MJXA 3DAGA 5CK5A 3NUGA 1CHDA 4QTYA 1R0WA 1XZMA 5F52A 3HEBA 3KEQA 5EJ2A 4IDDA 4DGQA 1EFAA 1Y7PA 1QIHA 5EI5A 2UAGA 1QHFA 4KMRA 1NGSA 5AI8A 2O3SA 3A9WA 2W42A 2QYOA 3WYDA 1AKWA 4KH0A 4EENA 1WQ1R 1CB7A 4K3UA 4P98A 3KPYA 4KLNA 4LBWA 4Q4JA 3QVVA 5JNRA 1JHUA 2PL9A 3UC9A 4C1BA 1M2EA 2AYXA 3BMXA 1BEUB 1FYFA 2ZI7A 4OJKA 2DH6A 4MLPA 4F5WA 5IF3A 2XKBA 4Q66C 4R9SA 5ALIA 1U9ZA 3M7IA 4EGAA 1O97C 4Y2YA 4EJ2A 1EWQA 2IYSA 2ORYA 4CKWA 2P2DA 3NM5A 5JMWA 2DR2A 4KP7A 4CEHA 1KYQA 1GCOA 2R60A 3LP5A 2PGAA 3QGMA 4GBJA 2WTNA 4X3PA 3BFPA 1K7CA 5EE1A 3ETEA 5E95A 1IWOA 1YL5A 1N57A 2XUGA 1SRQA 4QBFA 1KI4A 1XAGA 3R41A 4LWPA 5CCEA 2VK4A 1U0HC 2IYLD 1XWFA 3BJIC 3IAS6 4G2NA 4WADA 4ZAGA 1C41A 3A14A 5JEEA 1DX9A 2IXTA 4JQZA 3DTNA 4C05A 1KFCB 2PQ2A 4BNYA 3KB2A 9LDTA 5DSZA 3B1YA 1I4DD 4UPEA 2AJ8A 1KZGB 4YRJA 4FYWA 1AZTA 2OK8A 3NIBA 4FOTA 2ET6A 3A0RB 2Q3JA 1ZZEA 3C7KA 3EOZA 5DHFA 4DDUA 1JB9A 3IEKA 1GCGA 2TS1A 1EXWA 3LYAA 2H52A 4OJQA 1EHCA 1Q0ZA 4ND2A 3REFA 3UMFA 2BDUA 2VSOA 4EFKA 4RNDB 1NX6A 2VKQA 2VZ0A 4W8GA 3MWDB 4B35A 1DU4A 2GOYA 2OCLA 1NHWA 2Q21A 2Z5GA 2O1WA 4EG6A 3I61A 1II0A 1OLXB 1XYGA 2R1UA 4FOLA 4PFQA 2QLLA 1KL7A 2MYTA 1HQDA 4TS3A 1QV9A 4YAEA 5BMVB 3OECA 3F7OA 5EZSA 4DQXA 5F3RA 4HX2A 2A67A 3H8JA 1KPGA 3JATB 1Z2DA 5LL6P 3RI3A 4ZCRA 4IMPA 3E7WA 2W2KB 3SMQA 3W9BA 2OM6A 2J7KA 3RSHA 5ESRA 3AR8A 4CT0A 4YT8A 4RTSA 3RTAA 3FB1A 3QY0A 2C4TA 2FI1A 4D41A 4U7PB 1YZYA 4ENVA 1YI8A 1JH8A 1TCVA 2AN1A 4HX5A 1H42A 3EA4A 2G6TA 2F3RA 2I33A 3TSAA 2YBEA 1W6RA 1W0KD 4EI8A 3MIIA 4GSKA 1E0JA 4M8LA 1C3JA 2HJRA 5FEMA 2IODA 2B6HA 5FPPA 1TIBA 4OU4A 4WKCA 3PQCA 3BA6A 3V4ZA 2OCDA 4AY4A 1SKQA 1IBMB 1IQUA 1SVNA 4YUZA 1IONA 1IEWA 1KJIA 1EINA 4YUWA 2OAGA 2YWDA 3BWVA 3VPAA 2FR8C 5LMZA 1JKJA 1DRUA 1RMYA 1CR6A 2QT1A 4X6LA 4CG2A 3OZIA 1XJQA 2NUTA 2XX3A 3PC3A 4OB8A 4RDIA 1Z2EA 4ENWA 2XOKD 1G8MA 2GBPA 2TSYB 4A23A 3ZEIA 3D6AA 1DKPA 4ZI7A 2FDRA 1X1AA 1NC1A 2WYOA 4IJWA 4ZZIA 3BRWD 4DCVA 5FLYA 4I5DA 5KSZA 3GPBA 3D4LA 4TZ0A 3EXHB 4CTNA 2CFSA 4HUQB 2HZBA 2I65A 4W4TA 3VR2D 1QDEA 1LBEA 2BBSA 1TO1E 1GJRA 1DDGA 2CUZA 1L6RA 1FP4A 1YGPA 2ZYWX 2AJBA 3JPWA 4KODA 2VATA 3LKVA 1OKKD 1RE0A 3DTVA 3HRKA 1DAPA 5JNUA 3FTFA 4Y98A 1YDEA 3TBKA 2ZKLA 4RKFA 4AF8A 2AJCA 3CB4A 3QSGA 4W82A 1FXSA 3GW8A 5J2UA 2W6NA 4ZHQA 3OY2A 1QPGA 4JOQA 3KS9A 3HSYA 1G1AA 1T4DA 3OU2A 1OSNA 3RRXA 3ZCSA 3U4QB 1GQFA 5AI4A 4GPZA 5EXEA 1W36C 4DDWA 3QA9A 3LZDA 2MSDB 1R5OA 3FFTA 4A91A 3SC2B 1BU5A 4PLHA 1DUIA 3B7GA 3F4BA 1H0KA 2BHTA 2ZUSA 5EESA 2FN3A 3WAKA 5JC1A 1QIMA 4MQLA 2VJNA 3AFHA 4MO2A 2WLSA 3QKUA 4QDZA 5EE0A 4MH0R 3IBCA 1XZGA 1ZCFA 2EKDA 4YRLA 2J9GA 1HF3A 1NVFA 4M9UA 4RSGA 3THRA 1RXEA 4FC7A 2GBLA 3FFBA 2AYYA 5GZ6A 1RS0A 1SUFA 4OGWA 2QQGA 1YA8A 3FDJA 3G0DA 1JQAA 5HKOA 4GPD1 4OH1A 5THQA 3JR3A 2VBFA 4G0PA 5C7YA 2Q6KA 1UFRA 3QP9A 4XVQA 2DFLA 4X7PA 5L8VA 1ML3A 4DTIA 4MYCA 3UPUA 3HCFA 4BKPA 4JLKA 3M6LA 1XWIA 4C89A 3MF4A 2GFIA 3HXKA 1DZ3A 1JEQA 2AOUB 2FPKA 5CAEA 1BJRE 1J20A 1JQDA 4RMHA 5KOHB 2UZ4A 4UASA 1O54A 2EJVA 4RJJA 2BM1A 5KB3A 4H6WA 3V8NA 3D2LA 1JTEA 1XRQA 3CNOA 3PHJA 3ESQA 2AX4A 4G5GA 4GZ3A 2QSZA 5JU6A 1E2JA 4ZQGA 5C5CA 2GN9A 2HMWA 4KQEA 4LGCA 4BNNA 3G79A 2NU6B 1O03A 1SCAA 1VCIA 3LY5A 1ZJWA 2C58A 2O57A 3EULA 3P8ZA 5D84A 1VKHA 1GQSA 2JA1A 1MVOA 4M9ZA 2B0CA 1SUWA 3A1SA 3DZHA 2WA2A 3I09A 2QJOA 4B2PA 1XKLA 2XT6A 3EA5A 2HLDA 4G0WA 1EDEA 1TF5A 2ZAYA 3IRVA 2OTCA 1SIOA 3RVKA 3VSEA 4CIVA 5HKBA 4DV6B 2GM5A 4LFCB 1K98A 3VU8A 4II3A 3EBOA 4QOGA 1PWEA 2GK4A 3VNSA 3ENQA 3WK6A 1JYSA 1V1MA 3Q41A 1S3FA 2HXYA 1PR1A 2CN1A 2JJ8A 3JQEA 3CSSA 2ODPA 2E4VA 4S05A 5A1TA 2RHOA 1PD0A 4O2RA 4D98A 4DCTA 1Q11A 5JROA 4Y2SA 3B6JA 3N5CA 4GKAA 4NKRA 5KINB 2C3MA 1MA0A 4U6NA 1SQFA 2NUPA 2Z6VA 3OA2A 2IOQA 4IG4A 1BN7A 4FCVA 5K3BA 3MLAA 4KPFC 1NXOA 2GCIA 1RQXA 1WUHS 4MR7B 4Y2VA 2ZAGA 2I4MA 2P6OA 3CKKA 4FHGA 3D02A 1RWBA 3MD0A 1NXPA 5E4YA 3T1VA 4CFYA 3VPFA 1UODA 2YIMA 3WYEA 3I34X 1FNSA 2P0AA 1R9NA 3DCJA 3THXB 2XGSA 3ICPA 3Q8WA 1GG2A 1JG2A 1Q1NA 4LK2A 5EIAA 4DUGD 1ETUA 2IE0A 3K9LA 1UMKA 1BJTA 2ISCA 1ZVVA 2VP2A 2MYNA 2O5VA 4W5RA 3S1AB 2ACWA 1QYXA 2FOLA 1KO8A 1OBCA 2NXCA 2BKAA 1OAAA 2Y4NA 1G16A 3IOYA 3LECA 4R6XA 4F6CA 5CFPA 3DYIA 3NAZA 1M0EA 1MX9A 2EHDA 4WX2B 2JCYA 3H7AA 2WSLA 4JXJA 3H04A 5FFNA 5CDGA 1GR1A 1JZTA 4N03A 1EUDB 3G68A 4QBIA 3A1NA 1PN3A 1MF7A 4N48A 3SJ7A 2OM2A 1JJAA 3EHEA 2FETA 2C0QA 4C3ZA 1VBKA 1FUUA 4HXFB 4JXKA 3H9BA 4KBYA 5JCJA 3OIUA 3PHCA 1XPJA 1CD5A 1UZMA 4KO1S 4X66B 3ZGOA 3OIVA 3GLIE 1WR8A 3S28A 1KVUA 3NO4A 4YP6A 3GH3A 2O2JA 3WGOA 5AP9A 3TLYA 5IW8A 3T8YA 2W8BA 1UBRS 4RVOA 1E2HA 4J0CA 3PF8A 5DCWA 4AMZA 2HK6A 2JIMA 2FWMX 3IYLW 1WUYA 1DV2A 1X92A 4UULA 1X7DA 2W2PA 4R7ZA 4Q1CA 3UA4A 3G2QA 2VS1A 3W90A 5GAJA 1XZPA 1CYDA 2HC9A 2HNBA 3U0BA 4MW9A 4IDEA 1RBMA 4LTDA 4MS3A 2XB2A 2IQ5A 1TZBA 3NNNA 1HNWB 4R0VA 1W19A 3RGWS 3LBNA 4ZYYA 2OPHA 2F8TA 3IQGX 3MOIA 5CB4A 3LKBA 1UDAA 3H2ZA 2Z1NA 5B57C 1SCUB 3H6HA 3D1LA 4GI5A 4EEXA 4OX9Y 3LPCA 4DNFA 4YFVA 3GLSA 3GEGA 5ITZB 4LHWA 3OHMA 1DPFA 3JAWA 3SZMA 4Z8YA 5BVHA 4AS1A 2FSSA 1KS9A 5FNVB 4BMVA 1EUQA 3PR1A 1YNSA 4FLMA 1Q21A 5FI5A 5IJZA 1AC5A 4LF4B 2Z6UA 3KRTA 1UEJA 1EGHA 4V0SA 3GLGE 1P7YA 1W1WA 2PQ6A 3O8OB 4IQ8A 3DDUA 5EWMB 1K6EA 1I3OA 3UHPA 3M1YA 5B1SA 4GYYA 4WZBB 1Z12A 2YVAA 1XZFA 2CVPA 3HN2A 4QUBA 2DHEA 5IKOA 5EP3A 3VQTA 5AW3A 2LGJA 1PJBA 1HMYA 4M22A 4HNTA 1UAGA 4K9SA 4QFMA 3BMCB 5DFAA 4L3VA 1LC0A 3SOPA 2X1VA 5E3JA 1TO6A 1DEAA 2E55A 2CXQA 1UDBA 2ZBFA 3P9XA 3HP7A 4OQ4A 4B44A 1FP2A 2P3LA 1D4FA 3PT5A 5J2TB 1EPUA 3P9CA 4Y1EA 1Z38A 5FUWA 1E7MA 2N3ZA 2GI4A 1JL3A 3TB6A 4ER7A 3HYRA 4GR4A 3K0HA 4L4YA 5LYJA 1XTPA 2OO3A 3PGLA 3FOBA 4CPDA 4FW9A 1UOQA 1WZIA 3IB6A 5FWXA 3WWPA 1OXBB 3QEBZ 5GM1A 3PUXA 3I76A 3PL1A 4J7XA 4AJNA 2NXNA 4MRMA 4D97A 3HUTA 1F51E 4GX1A 5JCZA 5KHOC 1T0HB 2GHIA 2R6HA 2I22A 3FWZA 2PX4A 1G38A 3KJNA 3HB5X 2I2WA 4DA4A 2WJ3A 4HZUB 4KSCA 4CE6A 2AMLA 4LKOA 2CLCX 4MDHA 2I2CA 2QD1A 5EHNA 2A9JA 2J0EA 4BKMA 2PA0A 4WKPA 2O05A 1HM5A 1SXPA 2OG1A 3U7QA 4D82A 4MW2A 2O4CA 2OLKA 4D6PA 3SEAA 2H4FA 2QV7A 4L0MA 2OFPA 2RGEA 1FP1D 4MWGA 4EZBA 4JB0A 2D2VA 3DV0B 1WF6A 1YIOA 3OWOA 4HNAA 1YDMA 3AT1A 2N47A 1MXFA 3ZR4B 2P1ZA 4QYXA 4EAQA 2W2OA 3WMWA 1C8LA 2JH8A 3VV2A 4LF7B 3PUYA 2P9EA 1U3DA 3IQHX 3NYIA 5HFJA 3F46A 4PPYA 1KI8A 3RYIB 1MH9A 1NR5A 4V3CA 2NVOA 1TIPA 4X1YA 3LGXA 3SNKA 3RWOA 4CU5A 2GCNA 2BE9A 2QSUA 3HJBA 1Y4DE 4RTOA 3I5UA 5B6PA 4AJLA 2ZZNA 1LDNA 2FMKA 2PKXA 4KQHA 4KXQA 3FLAA 3RS9A 3K15A 3TZCA 3MRXA 4IOMA 4CV1A 1DWUA 1RHJA 1TVCA 4G41A 5IFLA 2HJWA 3GZNA 1GADO 2H29A 3FDZB 2VDKB 1ZX1A 2ORVA 2GNAA 1ZM7A 2WHPA 4FHEA 4UUQA 2WRZA 3S2EA 2GAIA 3CBGA 3MWYW 2IDJA 3SM3A 5JFOA 4MCHA 4GOMD 3GBVA 5D3KA 2GPNA 3RUAA 2O3TA 4QSHA 3OHPA 1FSFA 1FLDA 3LWBA 4URVR 1S5PA 5B7GA 5JJ5A 3KKOA 1K86A 5AKKA 4WVFA 3PDJA 4UTPA 5K6AC 5DU2A 3JD4A 3NVDA 1J7KA 3MJDA 2GCOB 4NATA 3C6XA 4PU0A 4EATA 3ICQB 2C9MA 2FQWA 2O7SA 4RTLA 2QUAA 1QS0A 2VFAA 2C2WA 3UM9A 4YYEA 3CVWA 5K8UA 3MB5A 4LJAA 1UDWA 1DX6A 2YV1A 1V1RA 2Q3LA 5FFFA 1K4YA 1ODLA 3NCHA 2XEXA 4WHMA 2H1OA 5CU7A 1BXRB 2Q1TA 3NHJA 3PLAE 4IIUA 1BHO1 4YMVA 4S2UA 3BX1A 2G17A 3IPYA 4GI3A 3TTWA 4AJJA 3FPCA 2DR3A 1EJ6A 2UYQA 4QHTA 2V7BA 4WV3A 4CEJB 4QOSA 4IFEA 2ZUVA 4OLAA 5A05A 3LHKA 1WABA 4ZOEA 2GEUA 3MSCA 1YF3A 5F9FA 5KI6A 3H83A 3DWEX 1VKOA 1CQJA 4KQ2A 4OOEA 4G0XA 4JITA 3OZUA 4ZT2A 4QRIA 3W5IA 4RJIA 3ZGNA 3JWJA 4GP9A 4D9GA 3LA6A 3ZCVA 5ALXA 1QMPA 5F5XA 3V9AA 1EWVA 1IVYA 1EVYA 3R40A 4RM3A 5CPBA 1QONA 3WGMA 1LW6E 5BV2P 4BFXA 3RKUA 1T6BY 3E03A 4RKEA 3SGLA 3ZV5A 1XLUA 2I4RA 2QRQA 5DBIA 1UBJS 2O2GA 2AWOA 4TM8A 2QM8A 4UC0A 2NSJA 1PQ4A 3FR7A 3KJXA 3BK7A 2P6MA 1Z62A 3V9PA 3H87A 4B7ZA 4JBYA 5L3RA 1C7QA 1GZ4A 1IC6A 2EKZA 3O2JA 2PYZA 3BRSA 3ADOA 2GHTA 1UKBA 1FPQA 1K3TA 1VG0B 2HEIA 4XOUA 3RYCA 3LPAA 5CLGA 2WKSA 1W4AA 1YWGO 4O29A 4Y9DA 3MS2A 4AG6A 5BXYA 2BUCA 5G0SA 4V0MA 1GV0A 2JARA 4PYJA 4HDOB 5JNLA 1X3LA 1D1PA 4IKPA 3I2KA 2H00A 3K0AB 3WHPA 5E6UB 3ZNNA 5C7OO 3SHOA 1GGKA 5C7LO 5GIPE 1RXVA 4XLTA 2J5BA 3SEZA 4TV8F 4CDNA 4K6HA 1TXGA 5IM5A 4K6MA 2JA2A 2ZXFA 4J90A 3JQAB 3DP9A 1JFVA 3LQRA 4LRQA 3ME5A 5ALQA 2H6EA 2RH4A 4MWTA 3OCWA 2NXJA 2WG1A 3WKCA 1KI7A 1QK3A 5F2EA 2AEJA 3MGCA 3KYCA 4KO4S 3VJMA 4ZCMA 2Z2IA 1FUIA 3S81A 1X80A 1JB1A 3T94A 6GPBA 4D42A 1WMFA 4RA9A 2VRBA 3RVOA 1M8KA 1CQZA 1FS5A 2Y6UA 3NALA 4U5XA 1L1EA 5F9HA 1CXZA 2UKDA 2GBGA 4KAFA 3CEJA 1MOQA 3QPCA 4RJKA 4ERNA 4YV0A 1GSHA 2WPDA 3ZPXA 3F90A 1P2BA 4AJKA 1G7RA 3LI2A 4AICA 5LJLA 4H3KB 3PVCA 3LP8A 2J4DA 4N3NA 4QO7A 1W93A 1ST2A 4WXMA 4C6TB 2V3CC 5TQ0B 1E1LA 1QE5A 3AHCA 4N6GA 1W5BA 1YOVB 2F67A 3ZS8A 1E2EA 1ZFNA 4CF4A 1XXHE 1JLLB 3VC1A 4RYLA 1PJCA 3N3AC 4NHOA 5HZMA 2J09A 4Y9RA 4ZVLA 3CPJB 4CLOB 1N5KA 2XVXA 2W6PA 2YWGA 4MP3A 1U1IA 1BE0A 1U8TA 3IV6A 2AQKA 3EVTA 3GLTA 4DRXB 1KH2A 3B2NA 3F6RA 1VE9A 4M0UA 1XDDA 1BEEA 2AG0A 2OCPA 2XB4A 1CRWG 2VZEA 3B1VA 3G7UA 3M2TA 4TTAA 5EUBA 3E70C 5FL3A 1ZSNA 4J8PA 1UWKA 2Q6LA 2QGFA 3MC1A 4EVQA 3REQA 2O50A 5IX8A 5TX7A 5FBLB 1AF4A 2O9JA 2V4MA 3K1TA 3LOQA 4XJVA 4M1YA 1HTTA 1HLDA 4LRWA 4DIEA 3TSZA 1QYWA 4H1WA 5KQLA 4DDHA 3OEWA 2FVYA 3CZ5A 4QBGB 5ES4B 5DHQA 5F1YA 1RWWA 2JIPA 4LNAA 4YO7A 5F33A 4HADA 4A2QA 1FDSA 5BURA 3MJRA 3DMHA 1JEDA 3EDRA 2VZ9A 3LRXA 2GCPA 2R79A 3ZXSA 4KYTA 1X0XA 2BEKA 2HXGA 4X65B 2Q8NA 4O2AF 1L7VC 4UHBA 1DCTA 5DTQA 2OILA 4CMIB 2VJMB 2FW7A 2FX5A 3P2MA 1MQ8B 3G1WA 2DLDA 2A92A 3V8EA 3EGCA 1LDMA 4H4CA 4YPVA 5JNTA 3QLEA 5JO0A 1DNPA 4B3MB 1W88B 1XRLA 3ZVLA 4YQFA 5L3VA 2OMKA 2QRNA 4YB8A 4M86A 3T34A 4D81A 3L8YA 3B12A 3RSFA 5BWLA 2VP9A 2PWPA 2WUWE 4UM7A 2F55A 2V0GA 1RKBA 1CRZA 5C1IA 1VSTA 3PFCA 2C0PA 2I1VB 4QJ3A 1N36B 4OXRA 3SAJA 1A9XA 1N5DA 3L6OO 4XDZA 2NADA 4B87A 2E5LB 4KQIA 5T67A 1IE3A 1L8QA 1PEAA 2DM6A 1QVRA 2QGZA 2Y1XA 2ZPAA 1FX0A 3HKBA 4GP6A 5TRTA 4PC6A 4D4HA 3D7RA 3K31A 4B3GA 4D8YA 4I0WB 4MARA 3WIDA 1IHXA 2ZJZA 4LX0A 1UK8A 2ZRHA 2B83A 3BSFA 4QREA 3FYUC 4IJUA 4WBXC 3O8QB 3VYVA 3OLZA 4TLLB 4EEKA 4JWTA 3WNZA 1C9YA 4R6WA 5CVDA 2PFKA 4IFTA 3ZCTA 3HSKA 4FDTA 5AI5A 1WE2A 2C04A 1G5PA 4X5OA 5JDCC 1I1OA 3CEHA 1KI9A 4GS5A 2JW5A 1A5AB 2QLJA 4N54A 3WGTA 4B5KA 2CLHB 4MUMA 2XMSA 3V2IA 1EX6A 1VLMA 1GO2A 2FKNA 2Q0QA 4LVOA 4TRMA 5SV2A 3ZXXA 4A92A 1EVLA 4A0HA 5AVUA 2NO5A 2HHHB 3COJA 1HRKA 4DG8A 1EE1A 4KVGA 1PZMA 3DE6X 1Q22A 1IUOA 1RD4A 4W5JA 1DGQA 3IEVA 1KP9A 1N0VC 2DH5A 3PI6A 4D96A 5JPDA 3A6EA 1FQOA 4YQYA 3D7KA 2LTAA 3DW1X 5DNVA 1O5TA 2Y66A 2AUNA 2NUAA 5DKFA 5LXTF 3D6MA 3MQFA 4UUAA 2G5TA 2XDQA 2ECPA 3PWTA 2KPOA 3K73O 5DNEA 5BN1A 1U3WA 5EMMA 2PLNA 1QIFA 3IUJA 5AKEA 4EI9A 4QKQA 4ZGGA 2X0RA 2WKRA 4HUTA 3T3GA 1H93A 4B79A 2OWEA 1DKQA 4R2JA 1RHQA 4JI0B 1DHTA 1KDZA 1CETA 1IAQA 4GOJA 3X2EA 1A96A 1QKKA 3VO9A 2A0KA 3I9OA 5CRIA 4S1OA 2RHLA 3OUZA 3ZDBA 4BGIA 2N1MA 3K9HA 1Y81A 1M75A 3U26A 3MERA 3LO8A 1UANA 2I7TA 3DXXA 5HQTA 3LSYA 4MWBA 4MQBA 3I92A 3KQUA 1KORA 1E0SA 1SXJB 3DB1A 3SHVA 2GD0A 4AROA 5AI0A 3ZW8A 4G1EB 3MINB 1KGSA 3PHBE 5DEIA 4EMBA 2RCNA 4HGNA 4YLYA 1GYRA 1C7EA 1X7XA 2I4OA 4YAGA 4CIBA 5KNDD 1JJIA 1I30A 1YL7A 3A32A 5DO9A 1B93A 4TM7A 3HH8A 4FKBA 4LDZA 3N7TA 5FBQB 1DEHA 1U5BB 5EC8A 5B3JA 1NWHA 4YJ2B 3VPXA 1DFGA 1KC1A 3GLHE 4RWZA 5LIRA 3CW8X 5I51A 2Q9UA 3A3KA 1SHZA 3FY4A 4JAVC 4QC2A 2PKCA 1FMCA 2HRBA 5EZQA 1W49A 3FOFC 3BQMB 1FCJA 2ZUTA 1K3FA 1P31A 4PRYA 2ZS9A 2JHPA 1L4KA 2H11A 3QMPA 4NBLA 2IGBA 4GX0A 4OREX 2P9CA 3NHMA 3RYHB 4ONEA 5CVUA 3AB3A 2ZIWB 2FSIA 4ZVKA 2PU5A 4KRFA 1G5QA 4EGJA 1JHRA 4WKNA 1SD5A 1ZI9A 2WEKA 1E3IA 4R2IA 1SHLA 1VHTA 1E5QA 1GGHA 1Z82A 3ADKA 2IPXA 3EC7A 3R09A 4LRTB 4ZVTA 3VOAA 4EHBA 1QPZA 3L1JA 3ZV7A 1GFZA 4PCVA 1N4DA 1XHLA 4JS0A 5SY9A 1L4MA 1ZN9A 3FVQA 3JQ9C 4AQDA 4L8FA 2O8FA 3CNLA 4K86A 3KSUA 2EW8A 4JVMA 1N6PA 4PZ9A 1AB5A 1DAOA 1Z5GA 3Q0EA 5LB4A 4DCNA 2ZS7A 4DLKA 4QUKA 1S3GA 2Y0EA 1M83A 3GG9A 4HQKA 3MBKA 4EJSB 2YUTA 1ENOA 3JYQA 4UXHA 4CL8A 1X19A 5HOEA 3EDOA 1M2VA 1Y1KE 3O4FA 1Z3IX 2XMPA 2V54A 1T36B 1CIPA 5EZYB 1CVLA 2QRLA 3B1JA 1ZK1A 2P8JA 2PKQP 1H0RA 1ZQ1A 3LK6A 3OIFA 4XUEA 5DGXA 4I55A 4AP9A 2P6PA 2O19A 5A03A 4J6EA 1O6GA 3VHLB 3T4XA 5DN9A 4EB6B 2I7DA 1V2HE 5D86A 3S99A 4J4TA 1ZD2P 2JCSA 4XD7D 3EH1A 2Y68A 4RK1A 2RI1A 2NU8B 3WNDA 5HXAA 4BNVA 2BTEA 2JHGA 3HCEA 2H3EA 3TOXA 1KVQA 1TLLA 4AFNA 2WSSD 3R74A 4NU0A 4CWAA 5AVYA 1LK5A 1Z0DA 2GN0A 4TL6A 5B1IA 2QNBA 1TAUA 4LTNA 4NHEA 2EX1A 2BFFA 2VDLB 4IJ5A 1RACA 1E0AA 2Y77A 2H1SA 3D64A 1LI4A 2ODAA 4L50A 2I71A 4HNSA 3MW8A 2DPYA 2PMCA 4JT9A 5DXJA 5EIBC 1P7VA 4E7PA 2ZI9A 2JLWA 2CDBA 3OZCA 5EGSA 5ALPA 4MQFA 4EKGA 3SWWA 1IBRA 1SEVA 2ZVJA 1CEYA 1BGWA 3QQ5A 3IOCA 2OV2A 3BB3A 1MZVA 5FNZA 3R9KA 3OBIA 1CQPA 5LNK6 4QYWA 1WETA 2B99A 3B13B 3UT5B 2FGJA 3IHLA 3S7ZA 1JF8A 1QO7A 3K0FB 3D9QX 1MHTA 4DUPA 1L3CA 5M3BA 4NPHA 2IGTA 1BIFA 1YA4A 4I4TA 3TMKA 2LZ0A 2XYVA 3Q3EA 4DR4B 1RWNA 2X6RA 1EESA 1CDDA 5KC8A 4C0XA 1M34B 2JGNA 3C16C 4JI6B 4L4XA 5IXYA 4OM8A 4YUYA 3LBIA 4M6WA 2AG8A 4TTIA 4BB5A 4BMXA 1D1TA 1VIDA 1AB6A 3I2FA 3NP9A 3KT6A 4HEA1 4Z2YA 5JY6A 1SHKA 1J39A 1ZCZA 1E99A 3P4XA 4OA8A 3KDSE 3LUGA 1P1CA 4C7JA 2OLEA 3TCXB 5FB3A 4IHJA 3F6PA 4A2PA 3CS3A 2CHUA 1WVGA 2V6IA 5AKXA 4Q4DA 1Z7GA 3QPAA 1EFPA 1Q0RA 2GPTA 3QUAA 4ADSG 4EO4A 5KQMA 1PP4A 1X3SA 3OICA 5C31A 3HJRA 4DSZA 4DWVA 3LU1A 2ZRDA 3UXHA 4XPIB 3PEUA 3T0FA 2IHTA 1MNQA 4GXNA 1EXDA 4RKQA 3TQRA 3IDSA 1ZM3A 3NT4A 4EKDA 1Y8RA 4RW0A 3D5TA 1FFXB 4AUEA 3DFIA 5E6RB 1OT3A 4LYHA 3ZE7A 3AUFA 4AYTA 4BKQA 1B0ZA 1IJKA 5AVSA 5F35A 5AW1A 5HTOA 5MF6A 2DEUA 1E0DA 1RRVA 3G2LA 3VKGA 2P41A 5TMDA 4DZTA 1AO0A 3QNUA 4LYAA 4UBLA 5BQ5A 3A6KA 5K2MA 2QKYA 1UOEA 1CV2A 4HLDA 4MINA 4LW8A 4F60A 5G53C 5IVPA 2DWPA 2E21A 4HWRA 4R1MA 1TGVA 3EIEA 5TARA 1HNNA 1WHTA 3HB1A 5KVCA 2PUFA 3ER9A 2G9RA 4E2WA 3IT2A 3P71T 5SZHB 1SK9A 3WZLA 4EFNA 2ZWPA 4QLOA 1CZKA 3LMKA 1M2OA 3VTZA 3BHMA 5CLQA 5B3KA 4QECA 5HIAA 1KFJB 3UN1A 3G7NA 3ZY4A 4TSFA 2FE1A 2QIPA 3DP7A 5HJ2A 1L5QA 4FFWA 4GWKA 2I6TA 2QXUA 3OF2A 4LISA 4NYIR 1RRKA 1A69A 4B2YA 4K6KA 4EA6A 2K2WA 4DNXA 4UOEA 4X8MA 4E2ZA 3RTGA 3VZBA 2LKCA 1GR0A 1V5IA 1I6KA 2XOXA 2H48A 2Y71A 1JAIA 2AG6A 1EVJA 1B8PA 1ODSA 1LX7A 2GAFA 2GN2A 2HLNA 2D7JA 2PNFA 2WOOA 3L04A 1JTVA 2DPLA 3B3JA 2A1UA 2Z4TA 4KR6A 3GFOA 4HDSB 4DM4A 1U2QA 4UFPA 2DBVO 2AVDA 2VF4X 2YZMA 4ENUA 4DM3A 4UNNA 2RB4A 3ELWA 1ZZGA 3RU2A 3SR0A 3KQNA 4X3OA 3HWSA 4XWGA 3FFWA 1NAHA 2CLOB 2G3YA 5D3MA 1KO1A 1J4AA 2IYTA 3AX6A 3B85A 3EQ6A 5JXIA 3QHPA 3QE4A 1E1RA 4CRWB 1SQ5A 5U9CA 3PQ5A 4U5QA 1Z25A 1C4KA 3KR2A 3KP1A 4IQ4A 5FEUA 3GLIA 4MQ5A 3VVLA 1E79A 5AFSA 3ZIAD 4GKJB 4GLBA 3W7BA 4FN4A 5K8VA 3MUEA 1QHSA 2FOIA 2GLXA 3KV1A 1SXGA 3HYNA 3NUZA 4PVDA 4R1NA 5EZ6B 1V25A 1VIAA 3RT9A 4KQXA 1K66A 3TCKA 1NYQA 1N9KA 1YACA 3DC7A 3N8GA 5HGJA 2PGLA 3ZHVA 4ENTA 5CVTA 1VMEA 5AH0A 4CMHA 4LZPA 4CFSA 1C1DB 1UPTA 1XJ5A 2CLFB 3EZ2A 2FFHA 2ZP1A 5J9FA 4W5HA 2XVAA 3WNVA 1D6MA 2O2SA 1V0JA 5C37A 1COWD 1XNJA 4Q39A 2VNKA 3IFSA 3ZTTA 2C03A 2BLLA 5E3HA 4C4ZA 2V7UA 2WT9A 2AF4C 1C0EA 1QIJA 2H7CA 1A9OA 5JZBA 1FVHA 1YGYA 3U60B 3K8QA 4E5SA 3MXOA 1HKHA 1LC3A 2V5UA 3G2HA 5AIBA 3EASA 3CRMA 3IHWA 3KOXA 3PNBA 2JCBA 3OUUA 4LY0A 4M89A 5CVVA 3ZWKA 1JH9A 5J3JA 4RFSB 5AW9A 4D80A 4A3SA 1CE8B 4TN1A 1IHDA 5HF6A 2XWJI 2Z1MA 1Q3KA 3CRRA 3GF4A 3O26A 3TQSA 1SY7A 4N8SA 4QUAA 2P78A 2GZHA 1Y5IA 3VJLA 4QODA 1FMTA 1HEIA 1CUVA 1V1JA 1Z5VA 5CM8B 3GLGA 1G291 1TTHA 3VNRA 4BZWA 3RVBA 4XB6B 2YY6A 4O8CA 4HDAA 3S29A 3RVSA 1G3UA 3FWHA 3CUEF 1NVEA 1O6FA 5F4BA 8OHMA 3USCS 1QX3A 1SPXA 4HEA6 5AQEA 1LPMA 1F8XA 5HKAA 3VX3A 3LT0A 5B3LA 1I3MA 4QOHA 4BNZA 1J0EA 3FVRA 4YEDA 1MQAA 2IE8A 1SBHA 1IJBA 3GXBA 2C29D 2C9YA 3ZS9A 1Z17A 3I9LA 4BQEA 4RMJA 3W8NA 1GKLA 5DM4A 2JIZD 2O2ZA 4L4RA 4BVBA 4F8EA 1NQVA 1ZEJA 4OM7A 1J1IA 5ALNA 2FEPA 1VGVA 3CHYA 4OYRA 5AW4A 1I4TD 2J48A 1QHXA 1C9KA 3IQXA 4EYSA 2ZTLA 2JZNA 4JJ6A 2I99A 4RZHA 4TVKA 4JYZA 4GU5A 1B23P 3E4DA 4IV8A 4K6GA 2VAPA 1UBFA 1VSUA 4U7FA 1A9TA 1AMNA 4TX1A 3GLFE 1UJ4A 3HR4A 3L93A 3MMXA 3O1HB 1SBCA 2BR5A 4CG3A 2MTBA 1D2GA 2P27A 3O3NB 1DBRA 5BSMA 3FTEA 4RVCA 5A6SA 4W7IA 5EYPB 4PTZA 5ITVA 2K87A 1TUEA 1Y1QA 1VE7A 2AQ8A 3CUTA 3HB4X 4FGJA 3L92A 3LDGA 4QXPA 4EFDA 5D7NA 5ARBA 1P5RA 3I1JA 1J7JA 3WIUA 4BO5A 1CZOA 3SR4A 2EKBA 3SJUA 4MPTA 3URKA 4OGFA 1WB9A 1W30A 3FX2A 3UMVA 2NP7A 3W2EA 3ZJ5A 4E07A 1XO1A 5H83A 2WVHA 3IPLA 1OGJA 1G63A 5B64A 1VMAA 1E63A 4WCVA 4BV8A 1GN8A 3O74A 3R0IA 4I50F 5L53A 3THWB 4F93B 3RS0A 3VPSA 4NCXA 1N2SA 1YCFA 5EJGA 1A8IA 1X8LA 3QWFA 1QNFA 4RXUA 1KXZA 2ZUCA 4TT3A 4UE3S 4XWAA 4DREA 4ZZ0A 4W5OA 4J94A 5IAGA 3F1LA 3Q9LA 3BGIA 3ZWNA 4D44A 1CUBA 1B7GO 1RWOA 3SHQA 1PBNA 4EBFA 4GW3A 5I5EA 2GZSA 5ADUS 1D2MA 3DO8A 2GT1A 1ORIA 2P4EA 1JR3E 1DC7A 1H0SA 1PS9A 3L4EA 5EQJB 5GPBA 1I5OA 1UWVA 4QTZA 3IO3A 3L7KA 1L1FA 5F1KA 5FPTA 4BRZA 4C0QC 4LEIA 4HB4A 2QTVA 4MWOA 1ULUA 1X1CA 1BDBA 1AIPA 3BMQB 4REMA 3WFIA 3WP1B 4G0NA 2JDIA 5FKJA 3EE6A 4EF5A 1WKBA 3OIDA 5LP6C 1OYOA 1SZJG 2PFGA 4DIFA 1HORA 1JHOA 2H1HA 3AL2A 4MUGA 4O2BF 4FD3A 4G26A 3VPBA 2G25A 5TNXA 1XTVA 1Z2OX 2UUBB 2OFXA 3DOJA 3QYFA 4LC9A 1Y89A 2F6RA 1BFDA 1MV5A 2GPYA 3K1AB 4FNOA 1FDRA 2ATCA 4DLWA 2QL5A 3M81A 3H1TA 1TEHA 3NBYC 4YFYA 3I8SA 1Z4PX 3Q11A 2O23A 4H0FA 5JJKA 4CF6A 4RTKA 1EJBA 4UATA 3SZRA 4R9VA 2PX6A 3WK7A 3DV9A 1X39A 2QL9A 1Y1TA 4B32A 4E15A 5L3QA 3OPYA 3IP6A 4Y7DA 5LC1A 3ZLJA 3ZD6A 3EDYA 3D3QA 3EB9A 3C39A 4A4DA 2D13A 3HNRA 5A5DA 1ZL2A 2IYRA 2DTEA 2XTJA 2B2NA 2PQMA 2PZEA 5CT6A 1WTAA 5FWDA 4BEWA 2APJA 4KI7A 2DT8A 2N75A 4MQEB 3WGHA 1FZQA 4B1FA 3MVEA 3HKCA 3MS4A 3KKQA 1LY1A 2NO4A 3GLKA 1H9CA 3W9SA 3OT1B 1KVTA 3WLOA 1USIA 4MKHA 1VGQA 3B7PA 4G5HA 4QSMA 2Y76A 1SA0A 2C5BA 2RARA 4S0ZA 5C4IA 3ZWDA 5CDTA 2XRMA 4L27A 1QH9A 4AKEA 1GPYA 1OAOA 1WZNA 1H2RS 3OEHA 4H9GA 3VISA 3H1AA 4A5SA 1J90A 2PM8A 2W2LA 2OD7A 3LO5A 5E8JA 5CFNA 2QLNA 4O0LA 2HPHA 2PSJA 2BI4A 2XGGA 3IDFA 2IVZA 2JIOA 1IRIA 4HDNB 4BS9A 3BXHA 4NCAA 2Z30A 5F51A 1C4WA 5DNCA 2WTUA 5KWVA 3N7AA 4IDNA 1KAHA 1V11B 4MEBA 4B9EA 5FTWA 1R15A 1VLJA 2BGGA 5C5EA 4P38A 1Z56C 2BEVB 2BZGA 2QUBA 3LA8A 2ZYSA 1OYYA 3PDCA 3TR5A 5G1NA 3IAAA 4LJSA 4MQ4A 3X1JA 2XVYA 3ZHQA 4MIOA 4PHTA 5ICSA 4ACBA 2CVZA 3OJOA 1IN7A 3COWA 3KOYA 3H2GA 4MX8A 1P0PA 2W2XA 3D3WB 4BVGA 4K2AA 3I3SR 5E6SA 4HLQB 1NV8A 3TZ6A 3OFVA 4B3FX 3LC2O 4JBWA 4WZ6A 2QTHA 2XW6A 3M1AA 1KQPA 5AI6A 5KS2A 1VKZA 1YAHA 4MV8A 5LBTA 4TKVA 4FXOA 5ED0A 1VI6A 1X7WB 4JLSA 2DJIA 1KMQA 1NP6A 4QOFA 5AUOB 3QFTA 4WEQA 5TGTA 3ISJA 2YJ3A 3IAXA 5ALJA 5ALMA 4ZU1X 5HDQA 1Y9ZA 4D4GA 3QI7A 4F9TA 2EBHX 5KSOA 5JSZA 3EJ6A 1C9EA 1S8FA 4BNLA 2IYAA 4OAQA 4DVJA 1ZUIA 2IIVA 3AKZA 3G49A 1UMDA 1G6HA 2D4HA 1CY1A 4R5MA 1UBHS 1IOVA 2DPGA 1A27A 2V6MA 4TYQA 4V24A 4KPYA 5JISA 1ZP6A 4IW3B 3QTBA 2CUKA 3RUPA 1HNZB 1VJ1A 1ZH2A 4PN3A 1MVLA 3OJLA 4XDYA 2H06A 5B6IA 3N2NA 2UZAA 5H3LA 1Y82A 5DCUA 1S2OA 1GV1A 2BTQB 2LCFA 3M6MD 1LWNA 1R0BA 1RAIA 4NCIA 5L6MB 3TZEA 5C3MA 3MELA 3T1TA 5AM5A 1PK8A 2C4NA 2FZVA 3RVPA 4KKVA 1L7MA 4G9BA 3AG5A 4B6JA 2BLNA 5EQDA 4PS0A 2IDMA 2ZUWA 2GBFA 3BGSA 1A7JA 2QD5A 1N32B 4C5AA 2VAMA 5AVTA 5I7AA 2YS7A 3TQFA 1U6KA 1YASA 5I8PA 5JNWA 4GDMA 1R1DA 1EZZA 3ENKA 2YZNA 5JAUA 4AKGA 1WDLA 1P4HA 3EGEA 5K8CA 5CH3A 3MOSA 1N5OX 1ZCBA 2CL7X 3I6IA 4I1IA 3CRQA 2VUUA 4XCXA 1G8KA 5B12A 3JALB 2O8NA 1ZHFA 4ZOQI 5SYMA 3D4BA 4IHAA 4LYEA 1HX7A 3CMCO 3W4JA 3IPAA 5IMSA 3FUWA 3LLVA 4BLWA 5KX5B 1T29A 4IXDA 3TL3A 3LM8A 5I9NA 4D4LA 3GL9A 2D5LA 2YJGA 3H5LA 2WYUA 4C88A 2C54A 2IOHA 3IV9A 3NWEA 4GI2A 3OTQA 3IP8A 4CM5A 4EOGA 5JMTA 1JDPA 1A71A 1YUMA 3LDUA 3W6PA 4KPUA 1E8NA 2C5EA 3P2IA 3BXOA 3DBHB 1P29A 5DNYB 3L7OA 6LDHA 4GQIA 2JEZA 2IYNA 3MS7A 4WJKB 5K4AA 5BUQA 3I0MA 2XR1A 1AMUA 1U0BB 4RLHA 5EIEA 2X5NA 3GRFA 5L3SA 2IH4A 5HZGA 3HGTA 3VMMA 4D3DA 4EHIA 3ETNA 1BSVA 1I7QB 3KSAC 2ZRLA 4N82A 2PGJA 1GPNA 2DQZA 2WWGA 4R98A 4EJMA 1R0CA 3LD9A 4ZOCA 4Q4CA 1PAUA 4CQNA 2PJRA 1YI0A 2BP7A 3SP1A 4F3TA 5BWOA 2NV0A 2PVSA 2DCMA 2YXEA 2YFQA 1SKYE 1V45E 1FLNA 1VYUA 4JIMA 2OA0A 5JCOC 3EG5A 1HLGA 3KB8A 1P45A 4NZMA 3AUJB 1JECA 3TUZC 2E87A 2HRZA 4INOA 2QNIA 3IEIA 1ZD4A 4M1KA 5D3ZA 3M6WA 3UG7A 2R7LA 1RTKA 1YVUA 1JPNA 4D3ZA 2YUIA 1QRSA 3OEYA 3B6MA 5EJFA 4DGSA 1XQ1A 2V7WA 4FGKA 1U0OC 1HDXA 1KQFA 2QDXA 5EQTA 2YQ5A 3CF4A 3TK1A 1CZNA 3AGQA 4REOA 2F1RA 4LZLA 1IXYA 1H6CA 3C98A 3IIEA 4A15A 3BFKA 1HL3A 1WDKA 5DWQA 3N05A 3G9ZA 5TC4A 3UUGA 1XZAA 4F2HA 3NMUF 4AXBA 1S3SA 3LXXA 3U4CA 1PX0A 4QDUA 1V3QE 2HGSA 3DHEA 3KPJA 3EFOA 3Q3GE 3UHOA 1YTLA 4RD0A 5HIJA 5B36A 3K70D 2ZQ5A 1J8VA 2RHWA 2AVNA 3KPWA 1NQWA 3H13A 4GMFA 3HCPA 3PE6A 4IG9A 1KMHA 1Q0QA 2DKFA 5E4FA 2ZAIA 3EHDA 3V4LA 4JLDA 2BT4A 1Q84A 4PXSA 2Q6IA 3THOA 4D74A 2HSZA 3GEPA 5BOVA 1G20E 1Q2UA 4G5QA 4QJIA 3OQHA 4RSRA 5D85A 1OV6A 4DAOA 3BEOA 5SZKB 1E62A 3NKLA 1H2BA 2ZTHA 2OHHA 4QUIA 4YBRA 4JC5A 4OQZA 3L0IB 5FULA 1XTIA 5K1ZA 4CF7A 5HK9A 2FRDC 1U8XX 2Z5FA 4Q9JA 1NNEA 2DBZA 1W4BA 4L2IA 3O1JC 2GAJA 2I8AA 3TIFA 3AZQA 1ZBDA 2E4YA 2Y05A 4BVKA 4ALLA 1VMDA 3HRIA 1KEZA 1U1DA 2EU8A 4Z4QA 1JUDA 1K92A 2XOEA 1VPVA 3DTVD 2OC9A 4MEJA 2HA6A 4KQ1A 1O9GA 4R1TA 3DBRA 3UJNA 2ZYHA 2BVNA 5KCMA 1YXMA 3PITA 4X84A 2QLFA 2QTWB 4M1ZA 2VHCA 1ZJYA 3A9VA 1D9XA 4EQZA 2OGUA 1Y9JA 3GMSA 2BGUA 3H2KA 4ZYLA 2FWPA 1UOOA 5LMNB 1E1CB 3GLHA 4KQKA 4UNIA 1TW2A 2HPVA 2C7GA 4FFSA 4JX9A 1ZU5A 2C4KA 4L5BA 3KU4A 1DXQA 1SCKA 4HDKA 2H4WA 4OX9B 1HLFA 2Q4RA 4K7JA 2IUSA 4ND5A 5EEHA 1VXOA 3RK4A 3WGVA 1NX9A 2POQX 3CLUD 4G0YA 5A5EA 3MRTA 4UTNA 2JHAA 3I9MA 1N25A 2Q2VA 2R5FA 4ZZ3A 1KAMA 1P39A 3N8HA 1O95A 1VFNA 2H57A 2WUVA 4M9SA 4AX4A 4N7RA 3QVMA 1OHHA 5DOZA 2NSHA 3DOOA 1QVWA 1UQRA 2HO5A 5JS8A 3WV5A 2OHFA 4AJHA 4F4FA 1K8XB 2IYWA 4PG7A 1B8NA 3P0FA 3R3HA 3AUUA 4ATNA 1PK7A 3QBJA 4WXHA 1KPHA 1U7OA 4LG1A 4Q3KA 3G8CA 4D3SA 4K87A 1R4NA 4FLEA 3TKYA 3L8MA 4CV2A 5CH8A 2VHXA 3LWDA 4ESEA 2QRVA 1PEDA 4FFPA 3RSOA 2P69A 4JUDX 4A27A 5JMOA 5C7IO 2V7QA 1DS6A 2BFCA 1K5DA 1KERA 1X2BA 4L5IA 4P3PA 3K20A 4YJ3B 5C18A 3NEAA 1HYEA 2HSEA 3PUJA 4G1UC 2WJAA 4DJEC 3HQ4O 2A94A 1KMNA 1TGYA 2BEUB 1DBSA 5TMBA 1KOLA 4C14A 2X3YA 3L82B 1W581 3QIVA 1JDUA 4YY3B 3GN2A 3ROKA 4JI5B 3QKRA 4FYKA 5AICA 4EG1A 4P5PA 2G0AA 3EZ6A 4EH1A 1BD3A 1IEXA 2W93A 2ZJOA 1C30A 3ASZA 1O6CA 3GQBB 4IDBA 4N0PA 3S2YA 3KVYA 2AHRA 4O4JF 2JJYA 2QV0A 2VH2A 3IS3A 5EKXA 5F5NA 1XOIA 5IN5A 3SKXA 2IHJA 4XXHA 4OQYA 1XIVA 2HLDD 3KT0A 1II8A 2PSFA 1OREA 3LYHA 3OQIA 3FCAA 5KPJA 4Q4JB 3DR5A 5A06A 5L7WA 4TYYA 1QGYA 1JSZA 3SD7A 4BZQA 3LW7A 4XVHA 1TK3A 2C9DA 2G7MC 3UKDA 2WNHA 2QY9A 4C3OB 4PHHA 4CMEA 3QX3A 1YU9A 2R8PA 3Q6NA 1U0LA 4LIPD 1MJFA 1UDRA 1SVOA 4CDGA 4CEHB 1VOTA 1GSAA 2XCTB 2Z8YM 2HF9A 4H6XA 2H2WA 3PUKA 4MROA 3HBLA 1WL8A 1NG9A 5E7QA 2I3AA 2J6CA 3ST7A 4BFSA 4EYKA 3EUFA 5LQCA 4G24A 1TD1A 2WM3A 5CCDA 4PTLA 1F2UA 4OXIA 3SIRA 2G7ZA 1U8UA 5M2QA 1E92A 1Z6AA 3B5JA 1L7OA 3LL4A 2O2IA 4P22A 2WQ7A 2CB9A 1W76A 3GRZA 2IEIA 4F9EA 4IUYA 1ZRMA 2V98A 1XAIA 2X0JA 3HCCA 1SU8A 4WK0B 5IAJA 4YWJA 5JVDF 1VPWA 3QUTA 2DUWA 2XUPA 1IVNA 1ECGA 1VIVA 2H92A 3QNMA 1CIVA 4RAQA 3TZLA 5KOJA 4MRPA 3FUXA 4BQIA 2ZR0A 1M8PA 1YR3A 4RK6A 1SVLA 2YCBA 2WSBA 4QUHA 4XKJA 3MTQA 1Y4UA 4Q9IA 3CZ4A 1IMJA 4P7BA 2AC4A 1I3KA 4LWQA 4XGNA 4F5YA 1FSSA 3H3FA 4YIKA 3WYGA 3WLNA 1EG7A 1HO3A 1NRJB 2JCGA 1KY4A 3N74A 5I48A 2PIDA 3UOGA 1MJNA 3LW8A 4LS3A 1Z36A 2DBQA 3U6KA 3QFCA 3NW9A 4KIGA 3FTPA 3HK2A 3GRYA 1MW9X 5COAA 2BEJA 2HCTA 2GZDA 2F62A 2NZYA 2AMVA 2QUZA 2REXB 2Y27A 1RRFA 5JCJD 4FYJA 5ECDA 4D8UA 5A0VA 3OE4A 4ZVPA 3C5VA 1QVAA 2IHNA 4JA0A 4JU8A 3EXHC 4X54A 1V9SA 2AI3A 2RGBA 1SNYA 3DAPA 3KXIA 4TV8A 3T41A 4IJKA 1KIAA 1X1RA 4HP8A 4OFWA 4AU1A 2P9JA 3Q9SA 2ACEA 1ZG3A 2JGDB 2XZTA 3BC1A 4KQ9A 4LZJA 4UM5A 3U3KA 5HS4A 1C3LA 2GAOA 2H5LA 3IAFA 4UVIA 3INNA 3ZKAA 1BQ4A 3HLTA 1ADYA 5IC5A 4A0FA 1KJWA 2R47A 3R6DA 3FPLA 3JZIA 3MD9A 3KELA 1H23A 4I99A 4NCKA 3VSDA 1FS4A 2ERCA 2OCGA 4MKGA 4OHOA 4B3IA 1W96A 5BQ3A 1A4IA 2XXJA 3N2YA 5ERYA 2XXAA 1NU6A 1N1GA 1B1CA 1JKJB 3L0CA 4PF1A 5EXTA 2HWUA 3C45A 4N0EA 2OP0A 2Z2KA 2WJ6A 2YX1A 4LBYA 3T7AA 1AV6A 2NUTB 2PZBA 3QF4A 2QR3A 4DJFC 1PL6A 1MNAA 5JFTA 2JFBA 1XDBA 5EJAA 5TPZA 3I4CA 3GP8A 1NTOA 1SB9A 3NAGA 4Z3OA 4ZI7B 2CL0X 3B51X 1BKSB 1GCUA 4HFRA 1CX9B 1VE5A 5FI0B 1TU4A 1NW3A 1O0CA 4QT4A 1KZ6A 1PEKE 2H2AA 2Q0HA 3NVMB 4L9AA 3N6VA 1IN1A 5LQMA 4ZT5A 4Q5IA 4PR3A 2XLCA 1F2DA 1N8NA 1MPTA 2ZRQA 2ZIXB 3KXPA 1T26A 2E6KA 1C2TA 1EGQA 1LU9A 2R48A 2EERA 3LSTA 4I1RA 3ZV6A 1FP4B 2R97A 1KO4A 1N0UA 4JSYA 5CEJA 2H4YA 2UDPA 3DTVB 2DT5A 4JJ7A 4AJ9A 3OLCX 3E7PA 4R1QA 3C1UA 4GH5A 4WZBE 4QRHA 1JEAA 1NVVR 1RXCA 3NTXA 1E9RA 2WU8A 4FZVA 5J2UB 1CUEA 3ECSA 4X92A 1LI5A 4I14A 4OQXA 1MJ5A 1J09A 2R4QA 2YHBA 5IBRA 1PGOA 3U3ZA 3TVYA 5B55A 1QRAA 1VPDA 1LPOA 3UHJA 4RZ3A 1G2QA 1Z37A 3G88A 4LJRA 2BJHA 1JKIA 4HOYA 3NFRA 1QGDA 4UE6A 4II7A 3PQ3A 4MKIA 5HRUA 1FFYA 4K3VA 5D1HA 2HJVA 3V8VA 2Z04A 3HFRA 3I0ZA 1XDZA 5IEBA 1ATZA 2LW7A 5K3OA 1FFCA 1QFYA 1TJ4A 4O2AA