5EE5B

Structure of human arl1 in complex with the dcb domain of big1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
164
structure length
164
Chain Sequence
EMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Brefeldin A-inhibited guanine nucleotide-exchange protein 1
publication title Structural Insights into Arl1-Mediated Targeting of the Arf-GEF BIG1 to the trans-Golgi.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 50
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2015-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee5B00
1FL9A 2ZJ5A 3W5IA 1KJZA 5KNDA 3TR0A 1RJ9A 1U9IC 2HDNB 2FNAA 4BFZA 1Z6AA 3OE7D 4Q03A 4DCVA 2ZXUA 3R8FA 1PUIA 4HLCA 2AD5A 3QUSA 2YZ2A 3KTAB 3NDBB 1E2FA 2ZRHA 3IEUA 1O3YA 2ZJOA 1H65A 1AGPA 4Q9HA 4C0JA 3B9QA 2HYIC 1P7CA 4GI7A 3U44A 5CYPA 3EG5A 3GLGB 4MGZR 4BFTA 1HA3A 4KYUA 3O8RA 1V5WA 1SVWA 2OAQ1 3CNNA 3BB3A 4N0EA 4KU4A 2WV9A 4HATA 1OPXA 1S9DA 4EKDA 5AJYA 1R10A 1XD2A 2WMNB 2CVFA 2ZU6A 3QPVA 3RC3A 5EXXA 5KHOC 4YQFA 4A8JB 2FN4A 1I4LD 1JNYA 1T6NA 3AF4A 3W8RA 3ZJYA 3GFOA 4QOSA 4C2UA 3IIKA 2DFTA 3KQKA 1ZBDA 4BLPA 3LBIA 3OAAA 4QBHA 2YJTD 3W34A 4LBVA 1UEJA 1VG9B 2KI5A 4JT2A 1AS0A 4LUCA 5H8WA 1G21E 4PC3A 2OHFA 3WYGA 2XZOA 2R6AA 3EC1A 4WAUA 1Q0UA 1G7TA 2RGAA 2WWHA 1DEKA 1P75A 2WHXA 5CM9C 1F6BA 3G5UA 4A6XA 5C4GB 3GQBA 4URZR 2VSXA 1E2KA 1TNDA 2ZQ5A 1S1CA 1WF3A 1Q12A 2GXUA 4YLGA 2NO0A 2R8RA 5EZ5A 2YOHA 1AA9A 4ZO4A 1CIPA 5SZKB 1IN7A 3EPJA 1K6MA 2I1QA 2NG1A 1JJVA 1ZD9A 1EFUA 2N42A 4E5UA 3A1TA 2BOVA 2HJGA 3DMNA 1BMFD 1IJFA 3B85A 3D3QA 1Z0IA 4BFSA 5BYKA 4WA7A 3WXMA 2ATXA 1T0HB 3ZQ6A 4CT5A 1VDZA 4Q19A 1E0KA 5EXSA 4HAVA 5KYKA 1G64A 2HXSA 5F2EA 2VRWA 4P3YA 2JCSA 4KO8A 1R5BA 3K0AB 4MDEA 2RGGA 1S9HA 5AJZA 1LB1B 1MABB 1G8FA 4FMCF 1CF4A 1FMLA 2VF7A 4QM6A 2OBLA 1NLYA 4DLXA 1NP6A 1D6JA 1W4CA 2QGNA 1VPLA 4WZ6A 2AWNA 5JEDA 1F2UB 3SI7A 1W0JA 4ABYA 4CGZA 2IBMA 3SYKA 1XD8A 3EARA 3VNUA 3I1FA 3LBNA 3OIUA 4ASUD 2B7CA 1OXVA 1Z47A 4JYCA 4CYMA 4DCSA 3QF7A 4NU0A 4DDTA 2GTPA 2O0HA 2W58A 4B33A 1LS6A 4MRVA 1E6CA 2OUKA 3L0IB 3AM1A 1DTSA 2FMXA 1OLOA 4EJSA 1E9BA 5DE3A 2QMHA 2ZETA 2J0UB 4X8HA 5GJVC 1EK0A 1II8A 2AFHE 1N6RA 3HR8A 2IS2A 5K8TA 4M1OA 1UBCA 1EG7A 1H8HA 4OHVA 1ZD1A 3C8UA 3VU9B 2BMDA 4C0BA 3WP1B 1KI8A 2ZU0C 1MR3F 2W0SA 1SKYB 4BWYA 3HU1A 2GAOA 4GNKA 4BECA 4NYIQ 2WAXA 4KAXA 3SQXA 2REOA 3AVVA 3A4LA 2B8TA 3EA5A 3ZYCA 2RCNA 2KWIA 4QM7A 1GL7A 1R4AA 1NI3A 4DHEA 2A3RA 5JSZB 4AG5A 5EJEA 3KFXA 4AYWA 4S35A 4ZDKA 2CCJA 1IN6A 3KKMA 3GJ8A 4B3BA 3KJHA 5KSPA 1RRFA 3K0EA 3MWJA 4RCZA 2WJJA 3T12A 2VHTA 1JI0A 4ACAA 5TY0A 1ZM7A 1QDEA 1ESNA 1G8HA 1W46A 2KE5A 4URUR 4PHFA 4TMKA 3PUVA 1K5GA 3CPHA 2NQ2C 2QPOA 4NCJA 1NL3A 1Z2CA 4J0QA 3SBDA 3PJRA 3GLIA 4M22A 3MUFA 1Q1QA 1M8PA 4C3ZA 1UKYA 3Q5DA 4U7DA 1GIAA 2JLWA 1L2TA 2FGJA 1E1QA 4POAA 2CCGA 5KNBA 4CEIB 3IEVA 2GNOA 2UZIR 1NJFA 3OIVA 4AY2A 1DPFA 5J4VA 2O8FB 3X1WA 5IDVA 4M1YA 4DT1A 2ZYWX 2JLZA 1XMVA 3UKDA 4UNQA 4QNMA 1SXJA 4CF7A 1KK1A 1XCPA 1KIMA 5BQ5A 3GMTA 1FX0B 2O5VA 4YXWD 1Z6XA 2I4IA 3NWJA 3EAQA 1W4BA 3PUXA 3EC2A 6Q21A 1HURA 2B92A 2RHMA 2TMKA 2DHRA 2WJHA 1JPNA 3FB4A 3UG7A 3NH9A 2J5XA 2PT5A 4URYR 5FUYA 3T34A 2JEOA 2C96A 2ZIAA 4Q1AA 3RRMA 4A9AA 1VG1A 1N0WA 2RGXA 1MV5A 2CLSA 3QXHA 4HB3A 1L4UA 3N5CA 3QPUA 4K8OA 1NVUQ 2G6BA 1ANKA 1TF7A 2J0SA 1S96A 1XRJA 2IEZA 2QU8A 2X77A 1A4RA 5AJVB 2IS4A 1A7JA 3CX8A 2AL7A 5J4HA 4GOJA 4WOPA 5HR5A 3SOPA 4PC7A 4M1SA 2JLUA 4TZ6A 3O8CA 4QGGA 2XNDA 5LPNA 2VP4A 3ZZ0A 3RWMB 1OFIA 1W36C 3LQQA 5GVRA 2IS1A 1UBFA 4FCTA 4Q02A 3EA0A 1JR6A 1WXQA 3PEVA 1B0UA 2BMEA 2GVZC 3ADKA 3KTAA 4D0LB 2DY1A 1GRQA 5BN4A 2J1LA 1G7SA 1W48A 2GCPA 1GITA 2IHYA 3H1TA 2QSZA 3N2EA 2QA5A 3GLGA 1PUJA 1E1RA 1OKKD 3I73A 1OE0A 4QJ5A 2GHIA 1F3OA 5AR1A 4L5BA 1KSGA 4YMVA 5JHGB 4HEJA 2QM8A 3GLFE 5KDDA 3ND9A 3TVTA 3VHLB 4A8JA 5JEEA 2IWRA 2QG6A 4XVRA 5C46F 1QHIA 2HLDA 1N3BA 5LBIA 3ZIAA 5GADl 1G4AE 2XB2A 4DUGD 1WRBA 5JI3E 3K0SA 1J2JA 4JT4A 3NBFA 3SBEA 1MO4A 3A4NA 4BLTA 5FOUA 2X2EA 3K8YA 5E7JA 5CB6A 3QSYA 3CX7A 2F55A 2DPXA 4MKHA 1J8MF 3L8YA 2QL6A 4US1R 5KUTA 1HT2E 1GUAA 3EZ9A 1AIPA 1KI4A 3PUZA 3QNUA 3W3ZB 1YZNA 3UWKA 3W9YA 3REGA 1IBRA 1HY3A 5ANRB 4RD4A 2WJYA 4M53A 3PCRB 1E2PA 3RS4A 2ZAOA 2QENA 4Z8XA 421PA 4EPVA 3W5JA 1BO6A 2OFWA 4QHTA 4LC1A 4Y0AA 5B30A 1L4YA 1OYYA 2JASA 2ZSDA 4KITB 4ZV4A 2PX0A 1VHTA 1OHHA 4M9XA 3OHMA 1ZM4A 4NP6A 3W6NA 1KI6B 1Q20A 2Q9CA 3MMPA 4IVPA 5BYJA 2V8OA 2PT7A 3IKJA 4TZ0A 4IOJA 4RSGA 4ZI2A 3K09C 3MD0A 1NBMD 3QENA 3A58B 4DSUA 3CW2A 3IQWA 1R2QA 3CRW1 1U90A 3V4FA 2Q3HA 2CNWD 3K0AA 1NN1A 2FZLA 3CH5A 4TYYA 4D0GA 4Q5IA 5DSZA 1D2EA 2GVDC 4Q9IA 2NPFA 4B2IA 2MSCB 2ASEA 3FMPB 2V3CC 1ODFA 4YMUA 3UMRA 5LB2A 3QBVA 1YR9A 1F2UA 2VHJA 1A1VA 1WMSA 1R5OA 3FDIA 3K53A 4FWTA 2ZUBA 3W6PA 2DCUA 2OV2A 2ZI9A 4B71A 1U98A 3CONA 3C41J 2J7PA 4KSBA 3TH5A 4ARZB 1RFLA 4B3XA 2ZRFA 1Z0FA 3AVOA 4M1MA 4U00A 5FPHA 4B32A 1XXHE 3SJBA 1G3IA 2ONJA 1QG4A 2HJVA 2FG5A 2J0UA 4HDCA 1OT3A 3AVXA 2J46A 3EPHA 3NEJA 4LJ5A 4EPTA 5FI0B 1FNNA 3LX8A 1TEXA 2QTFA 3KJEA 3B8HA 3AP3A 1PLLA 4PQYA 3BB1A 3GEHA 4PPFA 3EZFA 4HAZA 1XD9A 4W5HA 3AKCA 4XTCS 1K5DA 3VU9A 4JLAA 3FPAA 4PX9A 3SYNA 4XTRA 1T3SA 3LBHA 3OIYA 4PZZA 1XTIA 3KZ1E 1LV7A 3SR0A 3PV0A 4MYTA 1IXZA 1IN8A 2H92A 2OLJA 1N5KA 2CL6X 2QPTA 1XB2A 4II7A 2JJ1A 2GA8A 3LLMA 5KSOA 2OG2A 2KB0A 1KOFA 4OBEA 4DCNA 4PO9A 2EFCB 1AZTA 4OI2A 4JLNA 3V9PA 1YZTA 1TU4A 5FL3A 4MUBA 2NOAA 3Q9LA 5JSZA 1HQYE 1KSJA 3V00A 3GEEA 4GBMA 1X1SA 4D80A 1V43A 4G3XA 3UIEA 1D9XA 4D81A 2ZEJA 3OAAD 2VQSA 5F3WB 2CXXA 4JZKA 1VCMA 3AVYA 1IAQA 3TUJC 4GL2A 1GKUB 3QPWA 2EVWX 2G77B 2PJZA 4CZ2A 2XJ4A 2XNSA 4PAOA 3UG6A 4PHGA 1T0JB 2WWYA 4AWXA 2CJWA 4HYYA 1U94A 2QE7A 1GDDA 2ORIA 4OHWA 3TUZC 1RE0A 5DISB 1U0HC 4FXPA 4DLSA 1VCNA 4LK2A 1Y63A 2G83A 1XU4A 1AKYA 1ZM9A 4IVRA 3VHXA 3B1VA 5E3HA 4CEIA 1BIFA 2XTZA 4HB2A 4JLVA 4LYHA 2DWPA 4WZBE 2A78A 5FBLB 1W44A 4NYJR 4V03A 2IUUA 2QORA 3REFA 2ECKA 2ZANA 2P5TB 1JEDA 2B6HA 5K8IA 2FZ4A 4KFTA 2G1JA 2OLKA 4D4LA 4BZPA 1FX0A 4U5XA 3NHAA 2GDJA 3I61A 3NTUA 3NBYC 4JYBA 3HYRA 1MRNA 4P32A 1WBBA 3AP1A 2EFEB 3IILA 3O47A 2L0XA 2CBZA 2GCOB 2WWFA 1A5TA 2AXPA 5KPJA 1XEWX 2VSOA 2MSEB 3I32A 1KDPA 4B3DA 1XEWY 3SDZA 1DVRA 2D7DA 4C9BA 1XTQA 1FFHA 3QKSA 4PAQA 1AJEA 2BBTA 4HUTA 3OF5A 2WIAA 3EX7C 4CRWB 2CK3A 3CWZA 4JIMA 1T91A 2YNMA 3RS7A 1LFDB 2NIPA 4JBYA 3U6KA 2NO9A 4TL6A 5HCIA 2UKDA 1W0JD 4LJ6A 2ZJAA 2YV5A 1E2GA 1FMJA 1WCV1 3B1YA 3D31A 3P27A 1CTQA 3SE0A 4OHYA 4DC9A 4D2IA 5SZJA 2H17A 1NLZA 2JIZA 3IPYA 3I3SR 4IKEA 5EUMA 1CXZA 5FPYA 3SJAA 2FSFA 2FU5C 3TW8B 1JBKA 2Z5FA 5JECA 1AN0A 2IYRA 4A0RA 2ZE6A 4G5GA 1TTTA 1YR7A 2Q3MA 4RD2A 3QG1A 5JCZA 2VP9A 2W2TA 2VHUA 2QMOA 1W5SA 4L8GA 4EAQA 2QP4A 2BBOA 3Q72A 2WBLC 5CITA 3OIWA 3GLFB 1X8KA 1MO5A 3U4QB 3LXRA 1XF9A 3NBXX 4JS0A 3CRMA 1HE1C 2IC5A 2YC2C 4PSAA 3L8ZA 1TQDA 1RZ3A 2C99A 4JVMA 4I1UA 2E87A 2OCPA 3ZD6A 3SFZA 4HLQB 4MRRA 2QBYB 4BPBA 2Z6VA 3CPEA 1AQUA 4C0SA 3KDSE 1HQCA 3ASZA 2ZITA 4N1AA 3L2OB 3HU3A 1RRGA 2GBLA 4HZUB 3K70C 5HKKA 3C7KA 4QKQA 2BMJA 5CYOA 1ZINA 4OQLA 3T1OA 2RGNA 4O3MA 5SZHB 1KDOA 5J40A 1YR6A 4PQFA 2IS6A 4AI6A 4M2LA 2C5LA 4CDGA 2QAGC 2C03A 2ZS8A 3FTQA 4EUNA 1KNQA 1WQ1R 3A37A 1U9IA 2WTUA 4C30A 5L8VA 3C5CA 1W36B 4A0FA 5CK4A 1VIYA 2ZUDA 4TYQA 5KTYA 1E1QD 4G5QA 1EFRA 1KI6A 3QEJA 2BIFA 1KZGB 2BJVA 2ANBA 4NYMR 3K0FB 1T8UA 4BFYA 2SHKA 2YWGA 2UZ3A 3AUYA 4HDQB 3EIEA 5JWHA 1P60A 2GXSA 4RZ2A 3BFXA 3FHTA 2KBEA 3CB4A 2C95A 3OESA 3W3AA 5DIFA 2O8BB 2D74A 3AKDA 3QBTA 1ETUA 1T4GA 3X1YA 3FMIA 1CEEA 2E9SA 1ZAKA 3LDAA 4JSTA 3H0KA 3GCGA 3AQ4A 1SKQA 1II0A 2FSIA 4RZ3A 3U6BA 4D6PA 2DWQA 1ZP6A 1IHUA 3QVVA 1QHHB 4JJKA 1E0JA 4LHWA 3SNHA 2J59A 4AIIA 1U8YA 5A4JA 1Z83A 4L16A 1UKVY 2ATVA 3EPLA 3KKPA 4ARZA 4OHXA 4H9GA 4TMXA 2I3BA 3TSWA 4JKYA 4Q4HA 4E22A 4I4LA 1KAGA 3MGCA 4LI0A 4NCIA 2ERYA 3P4XA 1CJVC 3L0PA 4ILEA 4V0OA 1XXHB 4XWOA 3WY9A 5B57C 1NY5A 1QVRA 2VTKA 3LQRA 1ZCAA 1SVOA 2QQEA 2XNDD 5JWOA 4TL9A 3K9NA 1Q44A 3EWSA 2FFAA 4ERNA 3IBGA 3HP1A 1WE2A 4LJ4A 4C4PA 2A2ZA 2QEQA 5EP3A 3W6OA 2XGJA 4AKHA 1VCIA 3D6TB 5CIWA 1RRCA 1N0VC 3B1XA 1GKIA 2LKCA 3FVQA 5EE0A 4AD8A 2PMDA 2GXQA 2DYKA 3NH6A 4B3CA 2QROA 3NEYA 5FTJA 1E1RD 2A5JA 3DL0A 2C98A 4LV6A 1CKEA 2H1LA 3T15A 2A7QA 5GJCA 2YWFA 4B73A 4OQMA 3K9GA 2R2AA 1E2EA 4FIDA 4BUJA 4F4CA 2YWHA 1XTJA 4MYCA 2HLDD 4QGHA 2VP0A 3ZIAD 4JLJA 5UKDA 3RC8A 4MRSA 2GK6A 1E2HA 3AH8A 3KX2A 4EFNA 1NKSA 1FP6A 4EQ6B 4TYWA 4BLRA 4ZCMA 4X8LA 4M0LA 5A0FA 4IDQA 4IOLA 1E79A 1F48A 4ZIRB 3CIOA 5BW8A 2ZVPX 3VR3A 5JRZA 1XBTA 3KQNA 3WMEA 1EXMA 2QRNA 2W00A 3JVUA 2IWHA 4M9SA 4Q1FA 2ZS9A 3DDCA 3IGFA 3TVDA 3GEIA 1G8GA 4B3FX 1TPZA 3PFIA 1KO7A 3SEAA 4CT4B 2BCJQ 2ZS7A 3CLVA 5CDFE 2XZLA 3CNOA 2Y8EA 4PZYA 4R98A 2G0NA 3KKOA 4IRUB 4BFWA 5LB4A 3B78A 1P62B 3ECCA 2NMVA 1BKDR 4JBXA 4FCWA 1R5NA 1T9HA 1W2GA 2ZRJA 621PA 5JJIA 1DOAA 1M1YE 2RKOA 4R2IA 5CJ2A 2HF8A 2OT3B 2JLQA 2W6IA 4OK5A 1P2TA 5IT5A 1G3MA 2JJ8A 1OFHA 3T5DA 2ZM5A 2Q9BA 3TLXA 1OHHD 4KLNA 5JLJA 2XX3A 3BFKA 2MMGA 1YZKA 1GRRA 3QOFA 4PO8A 2V4ZA 4QC2A 4JLKA 2VO1A 4M4SA 1OH8A 3TKLA 1XJQA 4W7SA 5L3QB 5EQTA 4H1VA 2KBFA 1Z5ZA 3LY5A 4ZCIA 1R8SA 1QG2A 1VTKA 1JR3E 3DKVA 3B7GA 4PPNA 3VX4A 1J70A 1ZNXA 2BDTA 2D2FA 4NZYA 4ZI3A 3THWB 3DKPA 2AN9A 3RS0A 4HAUA 3QKTA 1Q1EA 1D2NA 4TWZA 2BC9A 4BEBA 5FTNA 4URWR 3ONWA 3RNLA 1CR4A 4D25A 1G4UR 2FPKA 2ZRMA 1IXSB 1Z8FA 2NTYC 1NG9A 1XZQA 2N46A 2ZRDA 2XZPA 2WOOA 5EP2A 2GEDA 2BEJA 1UFQA 1ZIOA 2J7PD 4B74A 5IHPA 1VCOA 4C0LA 4FMDF 4BQSA 2CLCX 1CLUA 4MDFA 3NC1C 3OEEA 3H86A 2OFXA 1UBGA 2Z4SA 5B58C 3KB1A 1TUEA 1EX6A 3OFND 4OI1A 1AGRA 1GP2A 2RB4A 3T61A 5EE9A 4I81A 3WHKA 2GEVA 5CLLA 1KI2A 2WSSA 5FTMA 2FFBA 3SC3A 1KJYA 3GLFA 2PBRA 3H84A 3LFUA 3U4QA 1OJLA 4C0HA 2FX3A 4B35A 2ZE5A 4DB2A 2X2FA 2NO7A 2ZYTX 1RYHA 4Q7LA 3FKSA 1W5TA 2FH5B 1SULA 2R6GA 5G53C 4KCGA 3KFVA 1R8QA 2QBYA 2XXAA 4Q47A 2VF8A 3AKEA 3QF4A 4LY6A 4PSKA 4RD0A 4TLDA 4F92B 3MWLA 4LOAA 3TUIC 4P31A 5P21A 1NMYA 3LA6A 2OBNA 4AKGA 1E94E 1ZUNB 4HZUA 3Q7PA 1SGWA 4MRNA 4TMVA 2ZRGA 3ADBA 3LAWA 5C1BA 5HPYB 1KMHB 2F1JA 2NGRA 2XJ9A 3IHWA 1M2OB 3QJYA 4P4TA 5GJWC 4DBLC 1PV4A 2GAAA 5H68A 1M34E 2DBYA 2CCKA 1UDWA 1UF9A 3B60A 1US8B 4PQRA 3X1ZA 2BJWA 2IT1A 2XITA 2OSBA 3K9LA 3UXMA 1E98A 2IK8A 3GJ0A 3CKLA 1HV8A 2V9PA 2ZSEA 2IYLD 2QE7D 1JEEA 4YC7A 3GJXC 3B82A 4CEJB 2P2LA 2VL7A 3CRRA 1HT1E 4G1UC 3M0EA 2ZRLA 4TQ9A 5JRJA 5JHHB 5AJXA 2EYQA 3U60B 3MAAC 2DWOA 5DHAA 3K0FA 3K0CC 4MITA 2NZJA 3ZVLA 4B6FA 1Q3TA 1E9EA 1GRNA 2F7SA 2PL3A 3KJIA 4LJ8A 4UNPA 1W2HA 2ZPTX 5TDHA 4NONA 1GNQA 4PHTA 1CS4C 4A15A 3VMFA 4RVCA 2O8BA 2ODBA 4Q21A 3W8NA 1HUQA 1GTVA 3PG5A 2GESA 1OW3B 5FH9A 4DJTA 1W49A 4YDSA 3I5XA 1P4SA 4F4IA 3QKRB 4MYUA 3I92A 4AK9A 1MKYA 1QHHA 2F9LA 3QI2A 3TSZA 2HUPA 3OZXA 4Z51A 1BYUA 1GNPA 4QHYA 3R9IA 1DS6A 3CUEF 2AKYA 3RS3A 4WVFA 4ACBA 2WJIA 5SZIA 3TQCA 4F91B 1FNMA 3FYHA 3TK1A 2CDNA 3BAFA 2HT6A 1WBDA 3HPRA 3C5HA 4IOKA 3IHLA 5E95A 3WBJA 1VG8A 1XXHA 3WRXC 2JLSA 4KHZA 4HI0E 4O25A 3NIBA 4HAWA 3K70B 1GOTA 4LYJA 4MUAA 2C8VA 1MH1A 1C4OA 5FOXA 3U3OA 4QG7A 1LVGA 3ZLJA 4PHHA 1JECA 2OESA 3Q3JB 1I2DA 4GZLA 1RVDA 4LV5B 4NYJQ 2Z0MA 1IJEA 5H1YA 5K8LA 2J45A 4GT1A 4GPTA 4MGYR 4M1WA 3ZS9A 4A1FA 1Z6TA 3QIAA 5FI1B 1G6OA 3LXXA 2QAGB 1T3LA 1DADA 4W5JA 4JL6A 4BE7B 1DAIA 2F1RA 2JJ2D 1Z29A 1P73A 3MWYW 4KVAA 1LTQA 1G3QA 2O52A 2ZR0A 2P6NA 3FE2A 5E4FA 3U2QA 1LF5A 3K09A 3AVUA 3HU2A 5G3ZA 1XMSA 2RGEA 3PENA 2XB4A 4MKFA 4UXIA 1KK3A 3R9WA 1YJ5A 4GFDA 3BH7A 1KTVA 1TAGA 2W83A 4EQ6A 1FQKA 2FSHA 1JQJC 2OCAA 2GCNA 1SVSA 1S0UA 2IL1A 2O8DB 1G5RA 3THXB 3GLHE 1JXMA 4ZIRA 4BLSA 1QHNA 1TMKA 2A30A 2QY9A 2JAQA 1YRBA 2OBMA 2ZI4A 4Z8YA 4BFUA 4LGMA 4DXAA 1GM5A 2WPDD 3VR5A 3WYFA 5J4LA 3UMFA 1ZIPA 5HKKD 2CE2X 4C0QC 3IPXA 2GJ8A 1EWRA 2PZGA 4Z54A 1KO8A 1GZSA 3AP2A 3B2EA 3R7WB 2IYUA 3U3RA 3PITA 3A4MA 4DSOA 4LHYA 2GJ9A 1C1YA 3A1UA 5HE8A 3RSOA 3ND8A 4HSEA 2WICA 3FHOA 4TN1A 1KDRA 4KBGA 2W6JA 3QEOA 2R6CA 5BN5A 4KFUA 5DH9A 821PA 1P2UA 2XEXA 4AURA 4LYAA 2ORWA 3I62A 1TQ6A 1QRAA 4PSVA 1VHLA 1G19A 2EU8A 4GDFA 4D0NA 2WKQA 4DLWA 5J47A 5JJKA 4LBWA 2ZJ2A 1MABA 3BFVA 3F5FA 3SQWA 3OEHA 3HWSA 2IYVA 1OF1A 1WP9A 3RRYA 1N5LA 1ZMXA 2BM0A 5B2ZA 3EZ7A 4M1KA 1J90A 4XOIA 2FWRA 1GWNA 2CMKA 3EZ2A 4LHXA 1JALA 2Q9AA 3FFBA 5KNCA 1ZVQA 2ZSBA 2ZYVX 1NJGA 2FSGA 4D4MA 5A5GA 1XPRA 5FUVA 2J87A 4E03A 2VIIA 4KJZA 3U61B 1Z63A 3A6PC 2NO1A 2WIBA 3GFPA 1NF3A 4XVQA 1YU9A 1R6BX 2GZAA 3B13B 4R7ZA 1ZCBA 5FPSA 2BHRA 4S2EA 4TLCA 1H8EA 2C9CA 4BLOA 1TADA 2WWGA 4D26A 3ETLA 2WM9B 1CULC 4MA4A 1G7CA 1GL6A 5IRCD 2K5UA 3FKQA 2RGBA 1F5NA 3DVLA 4IDPA 4FN5A 4RKFA 5IK2A 1Q57A 3C4JA 2LKDA 1E9CA 3PR1A 4JJZA 4US2R 4QHSA 1W4AA 3WNBA 1D8TA 4NYMQ 3DOFA 2V6JA 2YYZA 3BB4A 4LPSA 1XCGB 4QGAA 4JVNA 2H57A 1AZSC 4FMBB 4V0LA 4KFSA 1GKYA 2YKGA 2V54A 4TSFA 3V4RA 4WIAA 2AWOA 5DGXA 2VLIA 1S8FA 5BXQC 1N6PA 4PXAA 3LRPA 4M9QA 3U44B 4JSYA 1DO2A 1ZNWA 4B3GA 2WZQA 2H8KA 1G18A 2HF9A 2O8EB 2WWWA 4TT3A 5HTKA 4M1TA 2OILA 2XSZA 2AX4A 4G01B 3QY0A 1NN5A 3KXLA 4NDZA 2PZFA 3THYB 5J4KA 1VYVA 3LV8A 4Q48A 4XH9B 1Q22A 5FBRB 1XD2B 4YMSA 2P6RA 3PXGA 1KMHA 2QP9X 2ZJYA 3E70C 2AXNA 3BC1A 2O8CB 5F9HA 3TQFA 1US8A 4RCYA 1YKSA 4HLUA 3IIMA 5FUXA 2JLVA 5FTLA 3R20A 3WHLA 1TX4B 3LWNA 3Q85A 3AF3A 1XEXB 2C78A 3LO5A 2DFKB 4LBYA 4NCNA 3SJCA 3CF2A 4CEJA 3IUYA 2O8FA 3RAPR 2QM7A 3T06B 2IXFA 1JQLB 1AK2A 1P6XA 4TL7A 4A82A 2IEYA 3T5GA 3CRQA 2WJVA 2PJRA 2BWJA 4Q18A 1KK0A 2EFGA 1NY6A 2ODEA 4PZLA 2CLDX 3BOSA 1JAHA 3LW8A 4NHOA 2ANCA 1KYIA 1X6VA 4EFLA 2BM1A 2RGCA 3SYLA 1EFCA 2W6ID 4NH0A 4JLPA 1TUIA 1ZW6A 1COWA 3QXJA 3RWOA 2OM2A 3MJHA 1RKBA 4UNSA 1Z0DA 1Z0KA 2YOGA 3F0TA 3QKRA 1FTNA 2O0JA 1CR0A 1M7HA 2CL0X 4GP7A 2HCBA 3F8TA 3VKWA 1UBEA 1VIAA 4LZZA 5AUNB 1FZQA 1KI7A 4D4KA 4ZDWA 1XTKA 1Y3AA 3GPLA 1NSTA 1OYWA 3CNLA 2EFHB 2AKAB 4QJ4A 1N25A 2PMKA 2X8AA 4IDOA 4LRWA 4JVLA 5KU1A 1WDTA 2YHSA 2ODWA 4DDVA 2FJUA 4FMDB 1U0JA 4AKIA 2REBA 4MRPA 5DHFA 1CJKC 3D7MA 3AGQA 4NCKA 3FMOB 2WSMA 1EX7A 4HLDA 3M4YA 5DYIA 3ZVNA 4AYXA 2I1VB 2GILA 2ZSAA 4EFMA 3RYTC 3T35A 4QNRA 1C9KA 3CBQA 1J7KA 1U0LA 2R44A 4JL5A 2AK3A 4Y0VA 3EXAA 3NXSA 3OEED 1SZPA 1QHSA 2GK7A 2QAGA 3U5ZB 1H8HD 1U8AA 2P6UA 2ZROA 4IDHA 4R9UC 4R71A 5B64A 2OO7A 4P33A 4XWKA 1G8YA 4LPKA 4OK6A 4MH0R 4N0DA 1L7VC 1RIFA 3CF6R 2WSSD 3WNCA 1XPUA 2ZRKA 2D3WA 3AVWA 3LD9A 4F38A 1GSIA 2WAYA 2BMFA 5CK5A 1J99A 3HYTA 1KY2A 3FKSD 4L4UA 4XWAA 3SU8A 3MCAA 4BEJA 4KI0A 1XX6A 4G5OA 4QJ3A 2GJAA 3LVRE 4LX0A 4XSGA 2QUZA 5FOTA 4ZDIA 4RFSB 1ESMA 2GETA 1KZ7B 3RABA 2O8DA 3ZZUA 3THXA 1SHKA 2V1XA 3AVPA 4A92A 3S1AB 3TMKA 2KJQA 4FW9A 3VR1A 4PC2A 4FD2A 4UKDA 3GLHB 3ADCA 4GOXA 4TTPA 4JKIA 3C16C 3TGPA 1KKLA 4ITRC 5ELXA 1EFHA 3PEWA 1S1MA 3DOEA 4V0KA 1UJ2A 2G3YA 2WMOB 1OB5A 3VX3A 2QQ0A 3R7WA 4UXJA 4HUQB 2CVHA 1KGDA 2R6FA 5CDFA 4C0AC 4RD1A 1MO3A 5D3QA 3RSLA 1G291 3IIJA 1NN0A 1N6OA 2ORVA 3IQXA 3RRZA 8OHMA 4CIDA 4LSGA 1ZJ6A 3EIHA 4CEHB 5F9FA 4UNNA 2XOKA 1NIJA 4JLDA 1J8YF 3PUYA 4IW3B 4UJ3A 2REXB 2QPAA 4Q4LA 3VR6A 4ESHA 4ESVA 1S2MA 1E32A 2J3EA 3AF2A 3IO3A 1QHGA 4MKGA 1IONA 2C2HA 3SHWA 4IDNA 3CM0A 1SXJD 4I1OA 3E1SA 1GFIA 2YWEA 2WOJA 4ZKDA 2QN6A 3DEFA 3RLFA 4OJQA 4TYPA 2OXCA 2H18A 3RS5A 5JS8A 1HH4A 2F3RA 1PVOA 2YC4C 1E4VA 1GG2A 1GL9B 1S3SA 5JJLA 2B7BA 4NKRA 4OJKA 1JR3A 2IYWA 4WXRA 4M21A 2F6RA 1EESA 1Z6YA 3Q8XB 2OFOA 4DLYA 2ODNA 2OZEA 1P2VA 3EASA 2RAPA 3TE6A 5KDOA 2A5FA 1DARA 3CO5A 3QQ5A 5FL7A 3ZDQA 1L8QA 4TL8A 5EE5B 1BH2A 1K8RA 4URVR 1ZUIA 1ZYUA 3GJ5A 4EPXA 1NVWQ 5TARA 3RRNA 1KMQA 2CHVA 2ERXA 2EWVA 2AK2A 2VP5A 4PAMA 4TLEA 1YVDA 3J81k 3TR5A 3Q7QA 4MGIR 1OH6A 2YINC 1I2MA 1YZQA 2QTVB 1CRQA 3KUDA 1UEIA 2OE2A 5KSZA 2A9KA 2VYFA 1DAFA 3A1SA 2F3TA 2OXRA 4V0ME 1PZNA 5EP4A 1E2MA 3C15C 3KQHA 4QRHA 2HCJB 2B8WA 2QRZA 4GZMA 3B9PA 4RJLA 1LS1A 1FOEB 1ZU5A 4BASA 4NBSA 4GOKA 2O0KA 3FWYA 3KB2A 5JCPA 4M9ZA 1NVVR 5FBVB 1DAKA 5KDLA 1X1RA 3FMFA 1OV4A 5CIQA 3UANA 1E9DA 4B47A 1XDBA 3AB3A 3O8DA 1OXSC 4TLAA 2FEOA 2O8EA 4V02A 2D62A 1XJCA 1Z22A 3BWDD 4W5WA 3TAHA 5FTKA 4Z1MA 5F98A 1N6HA 3THYA 1RPZA 1CRPA 2Q3FA 4DZZA 1KDTA 3VKGA 4DWJA 3E5HA 1OH5A 1G7RA 2W0MA 4LJ7A 3R9XA 5DNYB 4HB4A 4MYHA 4WZAE 1LF0A 2OEPA 4B34A 4BZXA 3CPJB 3I4LA 2O8CA 1GNRA 3AGPA 1EFTA 3NC0C 1HTWA 1O87A 1KKMA 1N2CE 1TU3A 2J41A 4OI0A 4M8NE 4JLBA 1YE8A 2PCLA 4Q66C 4L9SA 3I72A 1GVNB 2AD1A 1XEXA 3SZRA 3GJ3A 2ZRBA 3LNCA 1XFAA 4MGKR 1E9RA 1W1WA 3LLUA 4BRUA 4DKXA 4Q9LA 1UM8A 1SVLA 5TV2A 3SHFA 4IFBA 3AVQA 2VSFA 4YMTA 1EWQA 4KSCA 4TMTA 1VYTA 1AS2A 1S3GA 4IXNA 3ZH9B 2JDIA 1XNJA 2NO6A 4AG6A 2NPIA 2ZR7A 3ZS8A 2BBWA 4IJMA 1P9NA 1ZD8A 3VR2A 1D2MA 1UKZA 2C9OA 2ZJZA 3CX6A 1Z08A 4P4UA 1NBME 3PUWA 3BD9A 2W6JD 2Z43A 1OH7A 3AVTA 5EUQB 4PPGA 3R8CA 2GCOA 1W7AA 2ZI7A 4DSNA 1Z3IX 3L43A 2P65A 1XP8A 1LY1A 4GMDA 2IF0A 1VKJA 4IXMA 5G40A 1NIPA 4PR0A 4DEXA 4G5RA 3OEHD 3VFDA 2IF2A 2LWIA 2F1IA 4Q1CA 5FOSA 3KXKA 4DB4A 4GSYA 5LD2B 1KI9A 1ZNZA 4EDHA 2EQBA 4DDWA 2IW3A 2C04A 2C77A 2GJSA 4PTLA 5FUWA 3FFAA 221PA 4E07A 3O8BA 5HZHA 3GJ6A 1YR8A 4XSHA 5DN6A 2YOFA 4WBSA 1GAJA 1W0KA 4Q9KA 1G17A 2GWHA 3LVQE 1MT0A 4RD6A 4LJ9A 1KSHA 2ZSFA 5J5CA 4B44A 4ZDJA 4EPWA 4KBFA 3KL4A 5GJBA 1PJRA 4DRZA 1H8ED 1BOFA 4CVNA 1G8PA 2ZAMA 1W47A 4IEIA 5KOYA 3QG5A 2XTMA 3RS2A 1SHZA 1N6IA 2D06A 2P3SA 1E9AA 4OK3A 2DR3A 3EZ6A 4C2TA 2ONKA 5IK2D 3KQLA 1VG0B 1DELA 1UADA 1M74A 1OSNA 4NMMA 2IYXA 3M6AA 4QBGB 1S4QA 3K0CA 1Q3HA 2IXGA 3A36A 2JJ1D 3U3JA 5KO2A 4JLOA 4K81B 1E96A 2D2EA 4TSFD 4URXR 4XVUA 1Z07A 4K46A 2Q0HA 1D9ZA 3BRWD 4OI4A 1G5PA 3U7EB 3X2SA 4RFSA 5CJPA 2JATA 3Q5EA 3LH5A 2GKSA 2BEKA 3SFVA 1ZC4A 1KK2A 3MG9A 3QE0A 2A5YB 4TT3D 3S1AA 1E2IA 3DM9B 2XSZD 4IVQA 4OYHA 2FOLA 1JAIA 3PVSA 2EYUA 3TIFA 3GLHA 1OFUX 1X86B 4TQAA 4LV8B 4TLBA 3T1QA 4NTZA 1T5LA 5L3SB 1G1MA 4C7OB 4LWZA 1YZGA 4HUQA 4W9MC 1XWIA 3JVVA 1N6KA 2RGDA 4IEEA 4EJSC 3TW4A 1JB1A 3NDPA 2BKUA 1AKEA 3DO6A 5JI2E 5K8UA 1Z0JA 4QBFA 2IYTA 3BIFA 3RDPA 1IOZA 1UPTA 4CEHA 1N6LA 2CJWB 1VYUA 4DLTA 3MLEA 1U81A 4P4SB 1KI1A 1R0XA 1G41A 2RMKA 3B6EA 4NCHA 3KUCA 3TSOA 4XD7A 2DFNA 3L0SA 3AV0B 5CM8B 3T1VA 3HDTA 2X19A 1TL7C 1E2JA 2R6DA 2V7QA 4JVSB 5FOWA 1OIXA 1T8TA 1ZM2A 4BRWA 1U99A 3K9HA 1P3JA 4Q00A 2VP2A 1G9XA 1E99A 2IYZA 3AKYA 3F3YA 5TXGA 4QGFA 1COWD 2LCFA 4BZQA 3TAUA 3U7HB 1ZRHA 3I8XA 1RRPA 1R7RA 121PA 1IN5A 2VHCA 2VBCA 4KLZA 2DFLA 1N5JA 4JBWA 2D7CA 3U7FB 3BS4A 3NVAA 4X8MA 2CEAA 1F2TB 3CR8A 2OAP1 5D3MB 2QAJA 4B76A 2H5EA 4GRAA 2CK3D 4OQNA 1CU1A 4V0NA 2JLXA 1AQYA 2FGKA 2PZEA 3P32A 3WP0A 5DI3B 1DBSA 4Q4JB 4Q1EA 5AJWA 3PEYA 2ZRIA 1IN4A 4Q1DA 4PC1A 3QKSB 4AYTA 3OE7A 1LW7A 2D4HA 4ZCLA 2A5DA 3K70D 3P26A 2MMCA 5AUOB 3H2YA 2JIZD 1HE8B 2F9MA 1PLJA 3BH0A 2IUTA 2WJGA 3KXIA 2QZ4A 1VECA 2JA1A 1U2RA 4DCUA 1KHTA 1QVAA 5DO9A 5BWMA 1Q1BA 4BGDA 1DAMA 1D5CA 2Q21A 4DIEA 1SXJC 1P2SA 2HV8A 1E9SA 1E2QA 1IM2A 3GP8A 1CJMA 2QMUA 5HE9A 3WBKA 3AF0A 5H70A 3KQUA 1II9A 1NLFA 4EPRA 1P61B 2PX3A 5KSYA 1DAGA 1ONBA 3B1ZA 4L9WA 2FE4A 1IQPA 4RD3A 4DSTA 3PQCA 1E0AA 1DG1G 4FWIB 4TMWA 1G3UA 1A82A 5JFGA 3GFTA 4Q9JA 2VPPA 1FPMA 3U7GA 5KPDA 1HEIA 3SN6A 5GVSA 2PH1A 2PEZA 1P9WA 3ZZTA 4DCTA 1MO6A 4LC0A 2VH5R 4OHZA 3PEUA 1NVXQ 3BK7A 1E69A 2IYSA 3UPUA 4HAXA 3BBPA 2FFQA 4RFVA 5FR1A 4YONB 4A0HA 2F1HA 5FBQB 3AUXA 4QFMA 1ZC3A 1I4DD 1Z28A 1KO4A 1FUUA 1OB2A 2ZVQX 1XEFA 2RH5A 2WWIA 3M1IA 2IUSA 4LDJA 5E7IA 3CZPA 2YVUA 1FQJA 3GLIE 4FCVA 4JL8A 4YDHB 4U02A 1GILA 1PLKA 1JJ7A 3UMSA 4CW7A 1UAAA 2HXYA 3I8SA 3MSXA 1Q21A 1BMFA 2ZRCA 1RW4A 2R9VA 2PLRA 2IA5A 4TTRA 4F4JA 2H7VA 1N6NA 2PCJA 1NKTA 1EFRD 3EW9A 1NRJB 4HZIA 1OIVA 1FP7A 5G41A 2XOKD 3K1JA 1ZUHA 2J9RA 4TYNA 1Z2AA 1KNXA 2OCBA 1ZM3A 5L3QA 1SXJE 4I1VA 1IY0A 4A8JC 4GMXA 1E2LA 3D8BA 1KI3A 3WRYC 1OIWA 1MRSA 4PPQA 3RANA 4KYIB 3X1DA 4DLUA 1NMXA 3THWA 2GXAA 2BKEA 2PLFA 2QI9C 3QKUA 4ZKEA 4UXHA 3LX5A 5DI9A 3DPUA 4UNRA 3I5YA 2GZHA 4I1SA 2IX3A 3VKHA 1G5TA 1CR1A 2ZYUX 2OCYC 2FFHA 4NYIR 1ZNYA 1X8JA 4OQFA 1KJWA 4JLMA 4NE2A 4B2LA 1BS1A 1OXTA 1JR3D 2ZE8A 5FBWB 1IXRC 1TF5A 2GJKA 1IY2A 3EIQA 4LBZA 3MWKA 2UVQA 3L82B 5FL7D 2N1BA 4ASUA 1XTSA 3AF1A 3ADDA 2FV8A 4R2HA 4ON9A 1KO1A 3FOZA 1FW6A 5TVKA 5CLQA 2NZ8A 1Z6GA 3FHCB 4Q4AB 2F43B 4D82A 5EXTA 3C14C 3ZD7A 4AC9A 4D4JA 2VEDA 3CF0A 5EE3A 2CL7X 4ZPXA 3N70A 2CHGA 2HT1A 1MOZA 2QP3A 3B5JA 5DYGA 4F93B 4Q7JB 2WVJA 1A2KC 4PANA 2V55B 2FA9A 3P20A 1DE0A 2QT1A 4Q4HB 5FPKA 2E1RA 1RJ9B 4NL4H 521PA 2JGNA 5M04A 2ZR9A 3OFNA 1P9RA 1XCMA 2AHOA 5AUQA 3GLGE 2B21A 1UKEA 2FPMA 3CR7A 1T3HA 1TF2A 2CHQA 1SQ5A 1M7BA 3P4YA 5FFMA 3EPKA 5HCNA 1XPOA 2WKPA 5LD2C 3IBYA 2IYYA 3JZAA 2P0EA 1OXXK 4QBIA 3TRFA 3BGWA 2JLRA 2H16A 4OQXA 2FF7A 1XZPA 4KXFB 4B75A 2P5SA 2G1KA 4XIGS 1TQ2A 1ZU4A 4EIWA 1OXUA 3ICQB 4LCBA 1IY1A 2IHBA 5TMPA 2QTHA 3VAAA 2ZI5A 4HDOB 4Z1MD 3ZVRA 5CB8A 2Q6TA 3G82C 4X8OA 1Z0AA 1QZXA 1R0WA 1XMIA 3RHFA 1P72A 1E79D 4MKIA 5L3SA 4C7OA 1TEVA 1N5IA 1WA5A 4UJ5A 3BERA 4RZXA 1SVKA 1NN3A 3QXSA 3GD7A 1E9FA 4KVGA 2R65A 721PA 2ZI6A 4GP6A 4DLVA 1XJ0A 3WNDA 5C4MA 2BBSA 1YZLA 3A1VA 3CRVA 3CWQA 2QT0A 3E2IA 5LDDC 5JS7A 4P4SA 1CJUC 1ELOA 3ZVMA 3GJ4A 1NMZA 4FI3C 1DG3A 1X8LA 4WXPA 4A0GA 4PFSA 3VR4A 4L15A 5JMTA 1NVVQ 3ASYA 3P1JA 3QXXA 4A2QA 2JDID 4PC6A 4B2PA 4KODA 1OFTA 4Q1BA 2CE7A 1TQ4A 4DIDA 3IO5A 1SVIA 4YXWA 3UATA 2A5GA 1SVMA 1T5IA 4WW0A 3RVBA 5EP1A 1E2DA 5TB5A 1I4TD 3TJZA 1DAEA 3KKQA 2IYQA 2GRJA 2ZTSA 2ZRPA 4RZUA 4BFVA 3WYAA 2ZI3A 1F60A 2GF9A 4FINA 4KV9A 1Q1ZA 3WMFA 1JPJA 4H1UA 4DEYA 2HYDA 4MQBA 5JWRA 3A1WA 3ICEA 3N2IA 4FMCB 1CBUA 1F2TA 4Q7KA 5J4YA 1P5ZB 1G16A 5D3MA 4TMZA 4DDUA 4OKSA 2G88A 2QSYA 3JZMA 4DLZA 2AFIE 4RKEA 2G9NA 4BLQA 5DI3A 3HPQA 4Q4JA 1YZUA 1NNEA 1YHNA 3BORA 4I99A 1FTSA 1VMAA 4IHQA 1E0SA 4HLUC 4B43A 2J0VA 5DN6D 2ZJBA 2C9YA 4DVGA 1AS3A 1AM4D 1W0KD 5HZKA 1CR2A 2WKRA 2WWXA 4A6PA 2EFDB 5C18A 5DLQC 1FUKA 3ZQJA 2GF0A 5BN3A 2JLYA 5FOVA 5EXPA 3VNVA 1E4YA 4JMPA 4QXAA 4HAYA 4V0MA 3U3MA 1W4RA 4EJSB 2PEYA 4Q7MB 1QHXA 1OKKA 2W2VA 1II8B 1E3MA 1HYQA 3H4MA 1R0ZA 3BE4A 1LNZA 2BVNA 3HJNA 3QXCA 3BXZA 4LJYA 5C2JB 1B23P 2BV3A 2EW1A 4EPYA 3EWAA 4YMWA 2MSDB 3NKVA 3NBZC 4E09A 4F7WA 2JJ2A 5AWFC 1SKYE 3BJIC 3CH4B 1QF9A 1G20E 2ZRAA 4LYFA 5FPTA 4DUGA 4XJXA 2GZDA 2VP6A 3TNFA 1DAHA 3KKNA 3W90A 2R62A 3THOA 4TQUS 4US0R 4Q01A 1NSFA 1NG1A 3MJRA 1YQTA 2X1VA 1U8ZA 2V1UA 3DMDA 2FDCA 5G3YA 2XXAB 3VTKA 1EGAA 2FPLA 3QF4B 3BH6A 3DZ8A 2ZREA 5L3VA 1XTRA 3DM5A 3PIRA 4IOMA 5AUPB 1M7GA 3AEZA 1G3RA 2G0TA 4AKEA 1JXOA 4PO1A 3TBKA 4LJAA 2V6IA 2WPDA 2ZE7A 3WMGA 2ZJ8A 4G5SA 5AK0A 4DLRA 4TTQA 1UDXA 4O2RA 2QGZA 3IDQA 3DZDA 3VQTA 4UQOA 3T1TA 2DB3A 4N3NA 4A36A 1X3SA 1W36D 1M6NA 1N0UA 3FGNA 3MRSA 5L3RA 3GLIB 3CZQA 2GEUA 2ZUCA 3UK6A 1KO5A 2QNRA 5JZVA 1RYFA 1R0YA 2KSQA 4A2PA 4A2WA 1E2NA 1XMJA 1YRAA 4DT1B 1KAOA 3DHWC 4IFEA 1KSFX 1NBMA 4XD7D 2HEIA 4B6EA 4A4DA 2VHQA 2J0QA 3QVUA 1SXJB 1KY3A 2V7QD 4C0KA 3G0HA 2CNWA 4KFRA 3LW7A 3U3KA 1A2BA 1BYIA 4QL3A 4LHZA 4RY2A 4NPHA 2XAUA 1CP2A 1Z06A 1G6HA 2Z4RA 3HR7A 1WB9A 2Z83A 4O2LA 4LHVA 5E7MA 3SJZA 5EZ6B 3MFYA 3UWOA 5IF9A 1QBKC 2VA8A 4OL0A 2XTNA 3NG1A 1CJTC 2GBLC 5FR2A 4B48A 1QHYA 3GJ7A 2P67A 1RC8A 4BFXA 2J7KA 4HB0A 2IXEA 4O0MA 2ZRNA 3NHBA 3KJGA 2EWWA 4Q4AA 4G0NA 2F43A 5JBQA 2QMEA 3B1WA 2RGNC 2BCGY 3L0OA 3A8TA 2AR7A 4P0TA 3X1XA 2W2XA 3SS8A 1DO0A 5EE1A 2RHDA 3ZGXA 2FEMA
chains in the Genus database with same CATH superfamily
1PFKA 1RWVA 2IDKA 2QXUA 3L7OA 5DHTA 2F59A 3OE7D 4Q03A 1YOVA 3VC7A 4EF5A 1PUIA 3MJVA 3WNVA 2A9RA 1NU6A 2HDWA 3LUHA 3ZWDA 4M1ZA 5SY6A 3G8DA 2YZ2A 4G8JA 4GI2A 2PSEA 2ZRHA 4QZVA 3SVTA 3VZCA 1O3YA 4PGHA 5IYZB 1SCDA 4ZCQA 2MWMA 2A9JA 2HYIC 3U3ZA 3A1NA 4GI7A 4BX9A 2R1ZA 2C4TA 4YMHA 3R09A 4G4IA 1IB6A 1HA3A 1X42A 4AVYA 1A0OA 3EGXB 1SVWA 3BB3A 4GC9A 4OKIA 2O6LA 3TZHA 1OPXA 3JAKB 1XL1A 1T5BA 4L0CA 4FT2A 5FBKA 2JLBA 4N0PA 1EJBA 1VKRA 3MFQA 1XD2A 4PR3A 3PKJA 3MWDA 4GVXA 4OA8A 3UJHA 5ABPA 5KHOC 4LNUB 4YQFA 2HFKA 3G9XA 5GOTA 4QBTA 1JNYA 5FLYA 3ZJYA 3PUJA 2ZUFA 1QG6A 4C2UA 3KQKA 5F33A 1TYCA 2QN3A 2JK0A 1R0RE 5IVIA 3W34A 3I2FA 4LUCA 1ZXBA 2GZ3A 5H8WA 1GUFA 1D4AA 3NXKA 1BWSA 3F7OA 3ILVA 4OREX 3OUUA 3WA6A 4WAUA 1JFFB 1JXAA 1N2JA 5F51A 2G5GX 2RGAA 2W2QA 3L77A 3OC0A 2GF2A 2OLEA 2BKAA 3GQBA 4ND2A 3P9CA 4WXRA 2VSXA 4B7XA 1T0BA 1LVHA 2GXUA 4I4CA 4YLGA 5K1ZA 4E5PA 4ONEA 1JEYA 3ZDXB 5EZ5A 1KU0A 4B17A 3O2QB 4QDZA 5G2OA 1CIPA 2VPWA 5SZKB 4AP5A 4Q39A 1SNYA 2NG1A 5CNKA 5LUAA 2BPOA 4E5UA 3A1TA 4JP1A 3H9QA 3AHHA 1ZN9A 4O6VA 1ZR2A 1BMFD 2LVBA 5ILGA 3CB2A 1SBIA 1Z5OA 1GYRA 1J24A 4MI1A 4Z0HO 2ACKA 1WLYA 4EHLA 5KINB 2I5PO 4BKOA 1YFLA 1WSWA 2PA0A 4LXIA 4WZBB 3SZMA 2ATXA 1T0HB 1TYBE 2G40A 1E0KA 2G25A 1Y5NA 2H0AA 5FEMA 4HZGA 3L6DA 2JGLA 4Y2GA 4F6CA 6CHYA 1LWOA 2VQFB 5KYKA 1DJLA 4MR9B 4M0EA 4I55A 4D7AA 1P2GA 1JDJA 1Z5VA 1F2DA 5EINA 2UYCA 4P3YA 4B31A 2CXPA 5KIAA 4X20B 4AY6A 1WXHA 4KO8A 1B8OA 2H5LA 1ZI9A 3K0AB 3DLAA 2RGGA 4QYXA 3RVDA 1K9VF 1S9HA 1ADJA 2GZ2A 4XYBA 5FDFA 1LB1B 4I2NA 3GC6A 1DUSA 3LO8A 5CFOA 3VOSA 1CF4A 5U4XA 3A3KA 5DP1A 4KIUA 3RFCA 3RC9A 3LG2A 4IL5A 2BN4A 5EKDA 1F2UB 1C7ZA 3RKRA 4RANA 4ABYA 3SYKA 1DRWA 4LY9A 4EUEA 2BONA 3G5TA 1T2NA 4HR7A 3LBNA 3OIUA 4II2A 4JYCA 1BN6A 1VL8A 5JNVA 3ZWMA 2W58A 4EEZA 4GR4A 4MRVA 1K7XB 5ALPA 3PKIA 3V5NA 2PDAA 1AUOA 4FC7A 2OMEA 3T7SA 1SOVA 4EJSA 1E9BA 1EQ2A 2QMHA 2ZETA 5FOQA 5FAKA 1II8A 5IULC 3WAJA 1O03A 1AXRA 2EGUA 2IKQA 3EZNA 1SUWA 1X1AA 5G4KB 5ALQA 5FA8A 4DJ5X 3R6WA 2GZ1A 1RKXA 1EG7A 1CUSA 2DKFA 4OBXA 1KJ8A 3O3MB 4Z0NA 3TDNA 3WK8A 5ALMA 2OYRA 3WSTA 5KB3A 4J4BA 1NW6A 1QH1B 3DLHA 1SN7A 4HWGA 2JFOA 3MB5A 3QX9A 1VRWA 2IEGA 3KO8A 4L5CA 5CDTA 1K5PA 3TTTA 1DEHA 1MR3F 4NAUA 2LTAA 4I5GA 2W0SA 2BFNA 1SKYB 3HU1A 4N9WA 1RM0A 3GGSA 3ZJVA 1G20B 3B51X 2I6UA 4GNKA 4NYIQ 3SK0A 3N0WA 2WAXA 4KAXA 3AFNA 3TMYA 3ZBPA 3SQXA 3KSDO 3AVVA 3PJFA 2B8TA 3EXFA 2GNAA 1CNEA 3EA5A 3P94A 4Z0PA 1B6GA 4NXMB 1NRIA 1GL7A 1R4AA 1U5AA 1NI3A 3TMAA 1XN4A 1ZL0A 2A3RA 4O29A 4ZXPA 4DHEA 3L7IA 5JSZB 1CYEA 3VRHA 3QYJA 4LDAA 1X38A 4B80A 4LGCA 2IDZA 3ZNQA 3DZHA 4P08A 4LJSA 5KSPA 3COJA 1RRFA 3DXXA 1JMVA 1KFEB 3K0EA 4JGBA 4E2WA 2Q1XA 2H4JA 3T12A 2E4YA 2VHTA 2Y0PA 4ACAA 1ZM7A 1DX9A 1QDEA 2KE5A 2JCBA 3KWJA 3Q7RA 2MSNA 1NATA 4REQA 5ALTA 5BT9A 3WLFA 4JYZA 3W5BA 3CPHA 2NQ2C 2YY5A 1YIAA 4Y6GB 5C5EA 2RH4A 3TZQA 1FLAA 2FMIA 3V1MA 3FM9A 4GO1A 4ZQGA 4C3VA 4EB0A 3KKKA 4B83A 4JUFA 3MUFA 1Q15A 1M8PA 2M6SA 1UKYA 4C3ZA 2FLVA 3GYGA 5FBHA 3K6SA 1B15A 5EIXA 2CCGA 2YX1A 5KNBA 1IVNA 2GNOA 1IY8A 3ONFA 1NJFA 2VF2A 3HB5X 3OIVA 5D01A 4E31A 4ZI7A 3RIXA 2ZJ7A 3DUWA 4RXMA 4UW9A 2VT3A 5IDVA 1OX4B 3O74A 1XMVA 1SXJA 1Z4PX 4J7XA 2VR1A 4JOBA 2BZSA 2XMDA 4CF7A 3ZDZB 2O3RA 1USGA 5AVQA 3GMTA 4FX2A 4PFJA 5FWAA 2HJHA 2O5VA 3ZGVA 1Z6XA 2I4IA 3OZBA 5BR1A 1YBHA 3H2IA 2P91A 1NONA 3EC2A 3LOUA 4JQCA 3OZEA 5DPMA 2VK2A 3EIOA 2RHMA 4ZEXA 1C30B 1QV7A 2DHRA 1JPNA 3PQ5A 3UG7A 3FA2A 4AMBA 2Z5VA 1RYBA 3EVBA 2XGSA 4URYR 1MPTA 2C96A 2FSUA 3LKBA 4H17A 4Q1AA 3UB3A 3R2JA 2WU4A 4NENA 1W8DA 1EHIA 3BKWA 1I1HA 4UE6A 1MV5A 1UJMA 3TOXA 1BWQA 1L4UA 3QPUA 2WP0A 3U3XA 1NVUQ 1ANKA 3EQ9A 3IEXA 2W8BA 5A2GA 2IEZA 2QU8A 1SXQA 1Z4NA 2X77A 5AJVB 4B7AA 4JGGA 5CVCA 4V2IA 8MHTA 1A7JA 1SUEA 2H29A 3BZUA 2AL7A 3IOEA 3T3DA 3WGKA 1VPEA 3D3JA 5C31A 4WOPA 4RS4A 4DQKA 3KETA 5EHIA 3JTMA 4DC1A 4PE5B 3L18A 5LPNA 3MTDA 1PL6A 1QYVA 4H3HB 4KWHA 1FBNA 3QOXA 2WDPA 5AKXA 3RFVA 2YH2A 3KKLA 3QBEA 5GVRA 1V6CA 3RWMB 1IHYA 3UAYA 3AJAA 4TQGA 4UFNA 4UDXX 3KQVA 4DCPA 1IEXA 3EAGA 1YHYA 3OQHA 3T3IA 3TPFA 2DY1A 5IYZA 3PB3A 1QRDA 2VWQA 4RQBA 3IBSA 2V9ZA 2I9PA 3NYWA 2GCPA 3H1TA 3N2EA 1U6JA 4GKKB 3PF8A 1PUJA 3EGXA 4QJ5A 5AR1A 1OE0A 4ER5A 5EJIA 2BMVA 2AOUB 5NLLA 1M1ZA 5JCOC 3JAKA 2OZPA 3OA2A 4MWOA 5ITZA 5JMOA 1CYDA 2H1HA 5I9BA 1SC1A 3K92A 2NXJA 16PKA 1W34A 4MCJA 5BSUA 2JG3A 4LNUA 4S1WA 4GE3A 4KI7A 3FPHA 2BF7A 3WRYA 3MJFA 4UM9B 4YWHA 3ZIAA 5DCWA 2XB2A 3OZAA 4C4SA 1B8UA 4C6SA 4IWXA 4JLUA 2GN9A 4JT4A 1AMOA 2OV6A 2QI9F 3D8SA 1MO4A 2HPZA 4RS3A 3U3DA 4MYDA 5MFPA 5E7JA 4M83A 2WSBA 3L7YA 1SBQA 1FU7A 1JFFA 5I45A 3UOGA 4GMFA 3OCYA 3IE0A 4P54A 5G1PA 3OQ6A 2QL6A 3CCCA 1AN9A 1N2GA 2GYVA 3GGOA 3ULKA 3OMXA 3CUVA 5E8JA 3PC4A 3UHJA 4F1KA 4DV7B 1GQRA 3DDSA 2QLLA 3HYSA 3PUZA 5JAZA 3A4YA 5I9NA 4WY2A 2IIBA 3W2FA 5C7IO 4NQZA 4FLEA 2PIDA 2P9JA 4OQZA 3FNHA 1QGUB 2EW2A 3REGA 3UWKA 3U9SA 2PUJA 4XFDA 1TVMA 3CSDA 3AY7A 3NB0A 1B76A 4EDFA 2EJVA 3IAFA 3IVAA 4M53A 2GN8A 3B52X 3KM0A 5C1IA 3UA4A 3ROTA 3H2JA 421PA 2QTZA 1Y48E 3AM5A 3KSMA 4OHRA 2VJDA 4XGQA 2PO5A 1ZCJA 4LC1A 5B30A 4U8GA 3RWBA 1DCMA 1S5PA 2Q3LA 1R0BA 2EL9A 4MKRA 1XO1A 4ZV4A 2PX0A 1J1IA 2LV8A 5DSTA 1KFCB 1XJ5A 1JG3A 4MI9A 4XRGA 1NMSA 4QVIA 2Q9CA 3MBKA 1ZG3A 2C5GA 2V8OA 2ZJ4A 3IKJA 4MR9A 2C3UA 4IOJA 2PNJA 4CNBA 2B6NA 3EXHC 1AHNA 1PWHA 3HVIA 1GRVA 2GLXA 3QENA 1FMTA 4DSUA 1FU4A 1RC1A 4X20A 3N39C 2C31A 3I09A 5LKRA 3V4FA 2CNWD 3K0AA 3PT9A 2LIVA 2FZLA 2CVQA 2JK1A 4TYYA 1B41A 5AOVA 4AJ2A 3UF0A 3KQSA 4D0GA 1REQB 4BKMA 2C4NA 2Y4NA 2MSCB 2PX2A 2Y68A 1R4NB 3KPJA 3MM4A 2I6FA 4LC9A 5KC9A 4YMUA 3BA1A 3BAZA 3UMRA 2VAMA 4Y9RA 2ZIWB 4F4DA 3QBVA 1G55A 1F2UA 1ST3A 2VHJA 4JC8A 1ISJA 1R5OA 2WVGA 2Y6UA 3FDIA 3K53A 4PLFA 4NNPA 5LCXA 4ECAA 5CW1A 4B71A 4Y6LA 1U98A 4I1PA 4C3UA 1T0IA 3SHQA 3T1HB 3V6LA 2JKVA 3BE6A 1P5RA 3OTGA 2PGJA 1L7MA 1RFLA 4B3XA 2Q5OA 1CUGA 2R4QA 1Z0FA 4U00A 1UDBA 3SJBA 1G3IA 2NU6B 2ONJA 1I7QB 2DM6A 1X87A 1C0EA 4HDCA 2BFCB 1YIDA 3JWIA 3NEJA 1LPOA 4MV6A 2E6KA 4NVRA 4NK5A 3TXAA 3EJWA 3FTEA 2XWQA 3HUTA 1HQDA 1FNNA 5G4KA 3F73A 3CCFA 1PSZA 2DT5A 3KJEA 3LKVA 2Y1WA 3NGMA 3SHTA 8ABPA 4I5EA 1J0XO 4PPFA 2AJTA 1VLZA 3KQWA 4XTCS 2YDXA 3BGOS 1NLUA 4HDAA 4EGJA 3NWBA 4IIVA 2X1HA 3SYNA 1QH1A 2ZKLA 3SLGA 4XTRA 3WLOA 2Z6AA 5KTPA 1KVSA 1NTRA 2GN4A 2OZVA 2VNJA 3KPUA 2GZRA 3PV0A 4XQGA 4S05A 1P1FA 5C7OO 2H92A 2OLJA 2QN1A 4CUKA 3LLMA 2I3GA 1U3VA 1G20A 4RK0A 3JAWB 5A62A 4GBJA 3HWRA 1KOFA 4DCNA 3IALA 1DFGA 4OGGA 4PO9A 4ZOQI 1AZTA 2ZAIA 3RQIA 4LFAB 5HS4A 2ET6A 4QPZA 3X2FA 2B8JA 2AFVA 3GFFA 4D8UA 4C7JA 1RKUA 4E0BA 1O6BA 4MUBA 4FKBA 2IHZA 2NOAA 3TRDA 4A23A 5JSZA 3HTXA 1AQLA 1I36A 1HQYE 3RFFA 2RK3A 1BJKA 1UBOS 1QQ7A 2Z08A 1V43A 4G3XA 3WA7A 3O6VA 2C5BA 2VTDA 4DE5A 4GL2A 2PFGA 2G9ZA 4ZOEA 1XQ9A 2OXFA 1D4ZA 1O95D 4BCBA 2RHBA 2AJ8A 1Z7BA 2PJZA 4J43A 4OLJA 4UHBA 3UK7A 3HCRA 2C5EA 2H1CA 4QEKA 2ZB4A 3DCJA 1GDDA 1D2CA 2ORIA 3EY9A 4LOIA 2GR9A 1VCNA 4JEIA 3RU2A 3KD2A 2Q5QA 2G83A 4N8SA 2O2GA 4CI9A 1AKYA 2YUTA 3BXEA 3ZK8A 4BNYA 2WPNA 4IVRA 3B1VA 3HNOA 4IG4A 1CF2O 5E3HA 4F60A 4YUZA 4JLVA 1GLNA 1VL1A 5JOQA 1KS9A 2A78A 4NYJR 5JFTA 2FPPB 5KVQA 4FQ8A 3REFA 2BRUC 2ECKA 3IR5A 4FE3A 4INZA 4AIRA 2WNSA 5EXEA 3LDUA 4HEQA 1O8BA 1VPTA 3JRNA 4QOIA 3UK1A 2P3OA 4CIAA 5K8IA 2FZ4A 4G8DA 2G1JA 3R74A 2VAPA 2B0JA 3NHAA 4D0RA 3GEBA 3PNQA 1E3DA 5BV0A 3LUFA 5AM0A 2CUNA 4YA6A 3WL7A 5L3ZA 3UYLA 1L5QA 4CF6A 5LQAA 4UVDA 1AGYA 3JVIA 3SQMA 3A9TA 3CZAA 3ETNA 1OREA 4GBED 2OXTA 1WJGA 2VDLB 3RVSA 1M2FA 3IC5A 3L4SO 3GUUA 1UK8A 3H17A 3ZQ4A 4DZTA 1HLPA 3TCKA 3TINA 4MIKA 3PYLA 3UMJA 1D2AA 2CBZA 2GCOB 4YRSA 3OJFA 1A71A 3F67A 5KI6A 1P8AA 4MVJA 1ZGCA 3ESQA 1PZHA 1WMFA 1EINA 2ZDQA 2HA4A 3BN3A 5JD4A 3QKSA 3GO4A 1AJEA 3ZK7A 3H5WA 2H0RA 3EX7C 2HDHA 4JIMA 2RHWA 3CWZA 4CRWB 2YNMA 1Z4LA 3UAVA 3KJQA 3FR7A 4WCFB 4F45A 1Z8HA 3COZA 2X3YA 4IMJB 4JBYA 2NO9A 4TL6A 4OBWA 4BZWA 1NQ5A 5DN9A 5ICMA 1YI8A 1E2GA 4AZ3B 1WCV1 3B1YA 3P27A 3SE0A 4GF5A 3V8PA 2GBFA 4ZEWA 3RJ9A 3L7BA 5HFJA 5SZJA 2O2EA 3V4VB 4D2IA 4DANA 2H17A 4DF3A 3RTDA 1WKVA 3IPYA 1RU3A 2F3UA 4JP8A 4XZ3A 4HT3B 4F72A 3SJAA 2PQMA 1FW6A 4N8EA 3MIZA 3AEYA 1D5WA 2GFHA 3R3UA 1KYTA 4QLAA 2IYRA 3DYVA 4G5GA 2AOUA 3RT7A 3WJ1A 1YR7A 1LUAA 4RD2A 3SG0A 2VSNA 3A6LA 1N32B 3QBJA 2M2IA 1LBTA 3RVJA 4ADSG 3HZRA 1W5SA 1F1JA 3IDFA 4L8GA 2CMDA 4PBSA 1XRNA 2BBOA 2B2CA 3FPEA 3Q72A 4I0WB 2WBLC 3JV7A 1SK8A 4P5PA 1ZK0A 1CZOA 1JDBB 2J32A 1DJPA 1WQ3A 4PS1A 4TKLA 3SX4A 2UXCB 1JS1X 4U7FA 1TQDA 2CXUA 2C99A 3QTBA 4JVMA 1OGJA 4WNYA 2I6XA 4I1UA 3TQIA 1XMQB 2WR8A 1E4EA 3FCCA 3I6IA 1UPUA 1BX3A 1SU7A 4BNMA 4AF7A 4HLQB 4MRRA 3ISJA 2PFKA 3I0ZA 4JDUA 1DV2A 4G5HA 5ENVA 4OB7A 1R6AA 1FF9A 2AJDA 3CPEA 3HWWA 1NQVA 2D7JA 4RKYA 1HQCA 1OBCA 4LGVA 4Q1VA 5MN5A 1YDMA 1D7OA 3K15A 4IV8A 3N2GA 3BWXA 1X7ZB 3WXBA 1I30A 1WUKS 1FJXA 1IIRA 1D4FA 2YRWA 4GE0A 4LRXA 2H85A 4FZ5A 2YCLA 4G2TA 1FY2A 3TNLA 4G0OA 2P1RA 1QGUA 2C2ZA 3VO8A 3C7KA 1L7NA 4M7PA 3M5CA 4OQLA 2J9FB 3PHIA 3NGLA 2VJKA 3KK0A 1AZLA 3HA3A 5JR3A 4O3MA 1CZNA 1YBAA 4PQFA 4O1IA 1KY4A 1R5JA 1WPRA 1KGSA 2XA1A 4J16A 3SNKA 4CDGA 2XKKA 1MJFA 3EW7A 2M1ZA 1GRCA 3C0KA 4IQ0A 4L7QA 2WTUA 1WW3A 3PVCA 5L8VA 4ZZ2A 4CFZA 1V95A 1VIYA 2BR4A 3FCOA 5KTYA 3WJ2A 3HUDA 4ZC8A 1GGEA 3N0VA 1E1QD 3EDQA 3HJAA 1EFRA 5DGDA 4AF8A 1R16A 4K6CA 2Y1EA 3QEJA 5EEGA 3FHLA 1EHYA 2BJVA 2ANBA 1N1MA 3K0FB 3P9KA 4ER7A 1UJBA 2UZ3A 5CNMA 4KE9A 1ODCA 1P60A 4PINA 5EIEA 1DFIA 4RZ2A 1X7GA 3DW3X 1RJFA 1P18A 1ZX1A 3UFXB 4NESA 4R16A 1OZ0A 2G9VA 1M6HA 3OESA 3W3AA 4H0FA 3D2AA 2OCXA 1JE1A 1T4GA 4K1LA 5FO0A 5HEKA 1KE2A 3X1YA 1TZCA 4FK8A 1REQA 5KWVA 4I9FA 5C8YF 1R4NA 1G2QA 4W8GA 5T7BA 2GM5A 5T8KA 1YRWA 4UMFA 4W1QA 4YAWA 1PJ8A 4D6PA 4ZGGA 3QVVA 4X6LA 2FUKA 1E0JA 4JJKA 1PEAA 3TOZA 4AIIA 5AVSA 5IVKA 3C8DA 1U2PA 2CHUA 1QFYA 2R68A 4Y7DA 1BEEA 1TAHA 5HJ5A 4ZC1A 2A0FA 4ND7A 4OHXA 4YEDA 3LPLA 3MUEA 4YASA 2Z58A 2LCIA 3O90A 2NU6A 1CLEA 1JG7A 1PZMA 2APJA 2DT8A 2JLCA 3L92A 3MGCA 3P4XA 1CJVC 4LI0A 4NBRA 3TR6A 2BFCA 3KE8A 1MHPA 3JWGA 3MGAA 3QWIA 4XWOA 2FPXA 5HF8A 1QO7A 4X66B 2GPNA 3LQRA 3KEQA 3IKTA 4GNRA 3OIDA 4BNZA 2FSVA 1Q44A 2FFAA 1UK6A 2AJLI 3MAGA 3D0RA 3G9ZA 1WE2A 4LJ4A 4C4PA 5ERYA 5EP3A 2ZIVB 4IGIA 4AKHA 1T0UA 3D3KA 3P97A 5CIWA 3MT8A 5A71A 1GKIA 2I4NA 2LKCA 2WZDA 5EMJA 3STUA 2PMDA 5A3SA 4B82A 1CUAA 1KEWA 1JU4A 3NEYA 3QFHA 1E1RD 1A4XA 3JAWA 5FQOA 2W2KB 2H1LA 3FNEA 3TLJA 1ADBA 4TWAA 4EATA 5GOZA 1BDBA 2JIRA 3O3NB 4U6SA 4CM9D 4DPLA 2Y9MB 2GN0A 1XKLA 2R2AA 4CKBB 2H1VA 3LTEA 2ISSD 4FIDA 1LJ8A 3VZBA 1QCZA 2YWHA 3U1TA 1XTJA 4P8RA 3RIMA 4MYCA 3WYDA 3RC8A 4BCCA 4JLJA 4Y98A 2QVZX 1PL0A 1SCQA 1JEAA 3QA9A 4U7PB 4OJTA 1QIGA 3L41A 5G0WA 3AC0A 4LJKA 4JBIA 3A2KA 3OJLA 1KJ9A 3T52A 4H4EA 3CRZA 4J07A 5A0FA 4BB0A 1PT6A 5A0VA 2C3YA 3MERA 1E79A 1F2VA 1RHKA 1SIBE 4FR2A 5DU2A 3WGLA 3NYIA 2ZVPX 4D3FA 3UUGA 4QFCA 5KCMA 2OV4A 4W8OA 3TQHA 1H9AA 2QRNA 2W00A 3JVUA 3WMEA 4KQGA 4BATA 2SNIE 4IQGA 4M9SA 1R12A 2RG7A 2XADA 2ZS9A 2JD1A 3DPIA 5T4EA 1TPZA 1KO7A 3SEAA 2BCJQ 2Y92A 2UVPA 4KR7A 1LU9A 5JO9A 5CDFE 2G0NA 4AQDA 5M5BA 3ECCA 4BVKA 2FPPA 2XKAA 2WT4A 1UC8A 4MGHA 4KR0A 4AFNA 4L3VA 1A72A 1DOAA 2FK7A 1JX6A 1QGAA 2PU5A 1E7SA 2GB4A 2OT3B 1A4UA 1U0FA 3AL3A 5IFLA 4KNWA 2VNIA 1PV1A 4ROSA 1EK6A 2I6QA 3T5DA 3T9BA 4B6OA 5M29A 5KWIA 1QPGA 3IJPA 4E15A 1OHHD 4KLNA 2O3QA 1RM5A 5FP0A 2XX3A 1U2GC 2ZSIA 1FRZA 4R40A 5EMMA 2D0IA 2MMGA 2QD3A 3Q15C 1GRRA 2B5VA 1TW2A 1PFQA 5LMUB 4ODIA 3W4JA 2VO1A 1OH8A 3TLCA 5L3QB 2CHEA 2ZVDA 4W7SA 4BWGA 5EQTA 4ZCIA 3BQ9A 5CLGA 1JR3E 3B7GA 5B12A 1T4CB 1J70A 3STXA 3IKMB 3T5BA 1ZPDA 5CRIA 1PL7A 3RSHA 2Y67A 1CX9B 5BPHA 3EE6A 3V1YA 1AHHA 4RH3A 2WHRA 5EA2A 3RS0A 5AVWA 2C92A 3QE9Y 4YJ2F 3X3HA 1FTGA 1D2NA 5JBNA 2BC9A 4D43A 1RZRA 2CFOA 3ONWA 4UEQA 4URWR 4WCFA 3RNLA 2XOXA 1Z2NX 1G4UR 1ZJ5A 2ECFA 2FPKA 4YCJA 2ZRMA 4PGFA 1IXSB 1AKQA 1HTTA 1EEXB 2NTYC 4L8WB 5AW8A 2C5SA 1YTLA 2N46A 1WXEA 4MW6A 4B79A 2WOOA 4DWVA 1JWBB 1NVTA 1PDVA 3MYRA 5IHPA 2Z57A 4ZPJA 4RMNA 5ALKA 4ENWA 2CLCX 2WP8J 2K7FA 2L2QA 3URKA 2ADFA 3OM8A 1J20A 1I7SB 3UJBA 4UUOA 5BQ3A 1DQZA 3MB8A 4BZZA 3R3JA 1B93A 2PQ0A 2E4AA 2JBAB 1Z39A 3WQBA 1BROA 4OI1A 4FFWA 1E66A 4XJSA 3ZNOA 2RB4A 4DXHA 2X6TA 4CG2A 2GEVA 3C6MA 3MIIA 1KI2A 5CLLA 5A6SB 3GNLA 3I2IA 3OP1A 3QMPA 4NEQA 4NG5A 2PBRA 3H84A 1RVV1 3I42A 1JYFA 3O38A 2EGHA 5FWXB 5IKEA 2FKAA 2Q6VA 2ZYTX 1TT5B 3BEOA 3P0IA 3I4CA 1RI3A 3F96A 3FKSA 3O31A 4Q7LA 5CPFA 5IH3A 2FUEA 3MEQA 1C50A 1HYHA 5LVAA 1XZCA 2R6GA 5G53C 1WNFA 5AXBA 3I2JA 5BV8A 2CV0A 5K0EA 2VF8A 4IHAA 5F64A 1H1DA 4LY6A 3DFIA 4RD0A 1SHTX 3MWLA 4LOAA 3FCSB 1T8RA 1SIOA 4KE8A 1X7ZA 1ZSNA 3OPMA 5JARA 1AX9A 1R0LA 4L78A 4AKGA 3HP4A 3OIGA 2GZMA 2ZRGA 3ADBA 2DTEA 2PMEA 1OTYA 2XLCA 4C6RA 2H52A 4ZHSA 5C1BA 1KMHB 4QREA 1M2OB 1QLJA 1NWHA 1Q11A 3LZ6A 4P4TA 3GDFA 5DYNA 2KX7A 5J2TF 4BQOA 3AHDA 2J9FA 3HLTA 1T35A 5HFNA 3S6JA 7MHTA 3B60A 1UF9A 1EP3B 4PQRA 3IUJA 3F7TA 4O8ZA 2VPZA 2OSBA 1XPJA 3UXMA 4YV2A 4RDXA 1E98A 2GCGA 1ZWKA 5KJEA 1O89A 2V9PA 3FOFC 5K0TA 1WP4A 4QIHA 2QE7D 3AI2A 1JEEA 1P29A 3REQB 2VQEB 1I5OA 5KQPA 1WTAA 1CIJA 2P3LA 5DOZA 3ZV4A 4CEJB 2HI0A 2P2LA 4WCVA 1RMQA 3CRRA 2HSZA 4U2KA 5JAPA 3LPAA 5GAJA 5JRJA 2VXBA 3OU7A 1UWVA 4JHXA 4QVKA 5JHHB 1G9SA 1JE0A 2XODA 3MAAC 5HQ3B 3U60B 1RJDA 1L4KA 4Q15A 3V6MA 5E3JA 3ANMA 4G9EA 3C6YA 3K0FA 4HGQA 1XZHA 1PR2A 2NZJA 4MITA 4M7OA 4TSKA 2GPWA 4KR3A 4LJ8A 4O8CA 3DMFA 4H77A 4FOSA 4MWZA 1W2HA 3UFXA 4B6QA 2ZPTX 5TDHA 3WFZA 4G36A 5CLIA 1CS4C 2O8BA 3VMFA 1VHQA 3CKMA 1PK8A 1MC1A 2I22A 4Q21A 4PN3A 5F35A 3LWZA 5I47A 5AM5A 5FH9A 4CU2A 3I5XA 4INOA 1JTEA 2IP4A 3GLVA 3SQLA 3G0BA 1OILA 3B36A 4ZMBA 2H3HA 1ZD2P 3B2NA 4M54A 4AK9A 1MKYA 5EJ8A 2CLLB 3P52A 4G9BA 4R3UC 4V0RA 4P53A 4QHYA 4XUCA 3CKKA 1EQAA 1DS6A 4JR2A 3AJ9A 3L7CA 3VJKA 4RY8A 3CUEF 1MX1A 1U9CA 3UTCA 3RS3A 1DKLA 4AN1A 4CKWB 1KXZA 1HDGO 1MNQA 3MVEA 2VJYA 3F1LA 2WJIA 4Z4IA 1BHJA 1A96A 1Q19A 4E14A 4ZQIA 4OJYA 2CWDA 2R1UA 4NATA 3FYHA 1SRQA 2QTRA 3BAFA 3TG8A 1WBDA 3LQYA 4IO0A 3QPCA 3C5HA 3FYUB 3UPDA 3JQFC 3WBJA 3F4LA 4HI0E 5HP4A 3K70B 2A1IA 4LYJA 2CYCA 3QZUA 5M34A 4MUAA 1MVLA 3EGCA 2I3AA 3C3KA 3FF1A 1H5NA 4QG7A 5EWLA 4BHTA 3K8QA 3CH7A 1RVDA 3LK6A 4UEKA 3TD2A 2JIDA 2Z0MA 4YAKA 5AM3A 4E88A 1PW5A 3EK2A 3G85A 2XCTB 5K8LA 2J45A 2D0PB 2J6CA 3A28A 4BEWA 1Z4KA 1YCGA 4ZOAA 1Z6TA 3EMVA 3RSGA 3TSAA 1PS8A 2AXEA 2H11A 1QFMA 2P0YA 4ALMA 1JLSA 2H3EA 3FPGA 1JLLB 2X76A 4Q3NA 4JYAB 2Q5CA 2W48A 4J7CA 1DADA 1C7QA 1XKXA 3AM4A 1JHMA 4PVDA 3FSEA 4BE7B 2VWHA 5AIAA 2J3QA 2BGGA 2JJ2D 2WA1A 5IUJC 4PG7A 4TV8F 4XIJA 1WD5A 3PQ7A 5C34B 1RWMA 3QEMB 4DA8A 1EFVB 4WUTA 4E4YA 4YT2A 3TE7A 4CKBA 1GUYA 2WHYA 3H5VA 4KACA 5EJ9A 5ED0A 4QYTA 3M5WA 1VC2A 1Q7CA 1N92A 2OTCA 2P9YA 1L5VA 1XMSA 3ELDA 3HU2A 3Q8WA 3QLUA 5G3ZA 3II6X 1E3SA 1JB9A 1XHFA 1KK3A 3GF4A 1QONA 4F11A 5A4FS 3R9WA 2ZUEA 1YJ5A 1T9CA 1T9DA 4F85A 1DIGA 1KQ3A 5BN1A 1P7YA 3PXXA 5JXGA 3C3YA 2R8ZA 2VJQA 3E5RA 1Z4IA 1S0UA 1XRRA 1JXMA 2VBGA 3KBOA 4QU8A 1QHNA 1B6TA 1Z7YA 4Y2SA 3STYA 3NONA 2QMQA 4KQFA 1YRBA 5FWYB 5HF6A 2G4LA 1Z88A 2ZI4A 4YCSA 4BFUA 3K30A 1PWZA 5AHRA 1ZGHA 3GA7A 5D3ZA 4U8HA 3VR5A 4D99A 3UMFA 4EVRA 5MF6A 2WYUA 4RH0A 3KZNA 4IRMA 5E9AA 2GJ8A 1H9CA 4LYGA 2PZGA 3I9LA 1KO8A 4UDOA 4W6QA 5E1BA 2IE8A 3B2EA 3E0QA 1M2VB 1K7SN 3DMPA 3R7WB 3WNQA 1LQUA 3A4MA 1FDIA 3NTQA 4O2AB 3A1UA 2HTFA 5HE8A 2O1WA 3LY7A 4UBMA 4YROA 5B1HA 3RSOA 4YRRA 1WM1A 3CH6A 3QW2A 2C9ZA 2WICA 5AVRA 3X1MA 1IU9A 2CVZA 3NRCA 3FHOA 3FUXA 1M1UA 4JR1A 1VSQA 1KDRA 3QMMA 2K2QB 1SURA 3JYOA 3O3OB 3G2LA 4KFUA 2J5RA 4YPFA 2I0FA 2XEXA 3BXOA 4EI7A 2VFAA 2VRBA 4LYAA 4ZV7A 1QRAA 1YI1A 4X61A 2CNNA 3EQ2A 4YFVA 4ALNA 4DLWA 1F6WA 4U7TB 5BNIA 4CHGA 1RKVA 2P35A 5TVGA 2NZVG 5J47A 4ZCPA 5BSFA 5C8YB 2LZ0A 4JT9A 3UMBA 2J3HA 3BFVA 4CG3A 4XIIA 4X84A 4RIFA 4TXJA 1DRUA 2ZUWA 3F9RA 3HWSA 3I2GA 3QU7A 3H75A 1BFKA 1N5LA 3AF6A 1ZMXA 4HCJA 1NMQA 1Z6QA 3I34X 4YBZA 3UY4A 3ZLTA 2C5FA 1R18A 1J90A 4RIGA 3WIOA 2FWRA 1VL5A 2HK9A 2XUDA 1NRWA 3FFBA 3G0GA 1ICIA 2C8LA 2X7JA 3HJUA 4GI5A 1CUUA 2Q4OA 4IRXA 1VE3A 5LU8A 1ZK4A 2ZSBA 2ZYVX 3E23A 3R5JA 1SG6A 2OGTA 2PH5A 1BEZA 3THRA 2OORC 2J87A 3U61B 1W0CA 3LSTA 4RTQA 2I62A 4QPNA 4WKPA 4WWHA 2NO1A 2WIBA 5DMXA 4EUFA 3A6PC 1NF3A 3WMWA 4GG1A 2GZAA 4S3MA 1UEXC 4RWEA 2BHRA 2CSXA 1OZHA 4S2EA 3GH3A 4H6WA 5JZMA 4BLOA 2C9CA 2QDXA 1K06A 1UBLS 4D26A 3ETLA 1P5HA 5F3DA 2HDOA 4ZJZA 3D81A 2JBAA 3ME5A 3IDAA 5DMHA 3GBPA 4IDPA 1F5NA 3CV3A 4TMFA 2HH9A 1D0VA 1LSJA 3KYJB 1HZZC 1E9CA 2EGGA 2XD4A 2I7XA 1Y1KE 2EJWA 1WF6A 4JJZA 4QHSA 1XI2A 3A9SA 3KV3O 4BNJA 1GTG1 1VIDA 3LBAA 5IC6A 3SR3A 4ETWA 2V6JA 1Z5NA 2WKSA 2YYZA 4UTXA 1XCGB 4DG5A 4QGAA 2CVPA 5FWXA 1AZSC 1JKJB 1JQAA 1TT5A 4FMBB 1PKEA 1PX2A 3QYPA 2V54A 4TKZA 3TAXA 5JCJA 2VLIA 3LDFA 4KO1S 4HXFB 4ID9A 4RC9A 4PXAA 2Y3IA 4YV1A 5L7TA 4JSYA 1DO2A 1PK9A 1RBYA 4ZYVA 5JROA 4QUAA 2ZW9A 3DL4A 3NDIA 1DXHA 1P81A 4S04A 4AULA 4B3GA 2H8KA 2XI4A 5EEHA 4RY0A 3EULA 4Q3AA 1B26A 4M1TA 1TC2A 4RCVA 4TT8A 5HTKA 1UXOA 4RLHA 2DERA 3Q87B 4G01B 2JGFA 3QY0A 4LECA 2QL7A 2G09A 4GPD1 2WYIA 3LV8A 5FBRB 1HG1A 2TS1A 3KUUA 4CQLB 3HACA 4YMSA 4DLAA 4G6ZA 2P6RA 1PFYA 3R9XB 2E5FA 3PXGA 2OHOA 3L6OO 2R00A 4D9EA 1KMHA 1M2OA 1YNSA 4PLZA 2AXNA 1P80A 3BC1A 2AG5A 3L5OA 4FBLA 1BDIA 1PNQA 1C0LA 2AJCA 3TQFA 4WBXC 2FFJA 2WUVA 1EVKA 3FYTA 1P4HA 4RCYA 4QLBA 3INTA 1MEOA 3PFFA 1A2OA 3N2ZB 4AX4A 2ISCA 5FTLA 3WHLA 4NK4A 4MWDA 1DXYA 1JPVA 3ZU3A 3VR3D 1XEXB 2C78A 2DY0A 3LO5A 4JELA 3TGWA 3REQA 3PQDA 4LBYA 4NCNA 5K0BA 5EAIA 3SJCA 1IQ0A 3CF2A 5EKTA 4CEJA 4HNHA 3G89A 2O8FA 3NIGB 1DRVA 5M7EA 4NZOA 4W5TA 3V8NA 4BIIA 3CLKA 3IMEA 3K73O 3FD8A 2Y77A 4Q18A 5HQ3A 4EL0A 4YUVA 5CUQA 1NNUA 4ZAGA 4AP9A 2CN1A 2ODEA 3N2NA 4PZLA 2CLDX 4C5BA 6NULA 5GGXA 4NHOA 2ANCA 1I9GA 1KYIA 1X6VA 3EFBA 1VA5A 4QVGA 2RGCA 4BV2A 1JZTA 2AZ4A 2DUMA 1QTRA 1ODJA 2W6ID 3D6JA 4JLPA 1C8BA 1A98A 3NHJA 3IBFA 3MA0A 5EHZA 3NVMB 1JJFA 1SD1A 4KIGA 3MJHA 3LFTA 4G1VA 2BSQA 4KVZA 3O1LA 2XBMA 1HFWA 1Z0DA 4XGNA 2G4VA 2ZOSA 2CMFA 2O0JA 3L1UA 3RHTA 3U4CA 2XB6A 4QSMA 4YJ2B 3FRIA 2O8BB 3VKWA 3UK0A 3GUCA 2R96A 1VIAA 2XY4A 4CTOA