5EE5B

Structure of human arl1 in complex with the dcb domain of big1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
164
structure length
164
Chain Sequence
EMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Brefeldin A-inhibited guanine nucleotide-exchange protein 1
publication title Structural Insights into Arl1-Mediated Targeting of the Arf-GEF BIG1 to the trans-Golgi.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2015-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee5B00
2FFAA 3ZS9A 5C2JB 4MYUA 2QGNA 5TARA 3LBHA 4PZZA 1CLUA 4M1OA 5CK5A 4Q7LA 2D06A 3W5IA 2IYTA 3HYTA 3OHMA 2FFBA 1XD2B 1KYIA 1GFIA 2AN9A 2RB4A 1YJ5A 1AJEA 4MRRA 1W46A 2R44A 2WKQA 4OQLA 4NP6A 2B92A 3CUEF 2O8DA 1KI8A 4HAZA 5EP1A 2ZUCA 4L5BA 2YOFA 2ODWA 2ZR7A 2IK8A 1EFUA 2IWRA 2P6NA 4A82A 4OYHA 4PHFA 2BCGY 5FL7D 1AKYA 1CKEA 4JS0A 1JR6A 3D3QA 4M1WA 4TQAA 4US1R 1HA3A 4AKIA 2IYWA 5FR2A 5JEEA 1XU4A 4DCVA 1EK0A 1A1VA 1TEXA 3V9PA 4HB4A 4II7A 2XEXA 4Q4LA 5SZJA 3RS3A 1WE2A 1IHUA 3AVXA 1GAJA 4LBWA 1F6BA 4DXAA 4CW7A 2GZAA 3GEIA 3U5ZB 1L8QA 3NKVA 3K0AB 1X1RA 1NN1A 1U0JA 4A1FA 3VFDA 1AS3A 2IYVA 1N5LA 4C9BA 4KFSA 4KHZA 4MRNA 1N6NA 5EUMA 5EE1A 1WA5A 3K0EA 2IYYA 5L3SA 4TYPA 4DEXA 1Q1ZA 1W0JD 4LPKA 4LJ4A 4KVGA 2FN4A 3U44B 1JEDA 3W34A 2QPTA 2RGNA 3BBPA 1HY3A 3NXSA 2R6GA 1WDTA 2VHTA 1OE0A 3FKSA 2ODNA 2XNSA 4BLSA 1E9EA 3WYGA 5FUXA 1EX7A 1LS6A 4UNNA 3TVTA 2ERYA 4EJSA 4Q00A 4YDSA 4KV9A 2XSZA 4Z8YA 4CT5A 1UKEA 2F55A 4Q48A 4JLOA 1BIFA 1P7CA 3BC1A 2QP3A 3THWB 2OUKA 4KLZA 3KDSE 2Q3MA 1GVNB 1YRBA 3L0PA 1KY2A 1U2RA 2QNRA 4IEIA 4TMTA 3RS5A 4LPSA 5FH9A 1GNRA 1SVSA 2V54A 4NU0A 4WVFA 4J0QA 5GVSA 3HU3A 4D4MA 1OH8A 2OFXA 3RVBA 2VBCA 2ZRKA 4LV5B 3GLIB 1T3HA 3OIUA 4DCNA 3SJCA 3T34A 2YVUA 4WW0A 4CDGA 1N6LA 2PT7A 3QG5A 2NG1A 2RGGA 4NH0A 2FSIA 3QKSB 4MKGA 3ADDA 2FU5C 4OBEA 5TY0A 3EZ9A 3BE4A 1VCMA 4IW3B 2DY1A 3L8ZA 1XXHA 1B0UA 3FB4A 4O0MA 1ZD8A 4TLBA 4DKXA 4Q1CA 2JIZD 3W9YA 1P2SA 3K0CC 3Q9LA 3IIKA 4BLRA 1Q1EA 1NVVQ 3MJRA 4IVRA 1NVWQ 1FTSA 4Q1EA 4P0TA 2Z0MA 4QM7A 3CX6A 1R6BX 1VG8A 3A1TA 4KJZA 4A0HA 1G3MA 5JECA 4RD6A 2HCJB 1AS0A 1K8RA 1ZNZA 2BKUA 2NO9A 1AKEA 4ARZA 5C18A 2IS2A 3K53A 2IXGA 3ZD6A 2G6BA 4BLOA 4F4IA 1GTVA 1W48A 4Q4HA 3ND9A 4EKDA 4IOLA 3A1WA 4Z1MA 1CJTC 5BQ5A 4IDHA 2FX3A 4LDJA 3DMDA 1KTVA 3W90A 5JZVA 5AUOB 1SXJB 3HJNA 3AUXA 1D2EA 1GWNA 3QNUA 3AVYA 3IO5A 1IBRA 4A6XA 5FOXA 1QHXA 3L82B 5B30A 1C1YA 1SVIA 3SQWA 1NF3A 1GG2A 5BN4A 3KKPA 2DWQA 4OJKA 3KKQA 3SJZA 3FMFA 5L3QA 4C0SA 3B9PA 5JBQA 1G5TA 1U0HC 4JLJA 1II0A 1R4AA 4JBWA 4UNRA 3GPLA 3EARA 3OESA 1FX0A 1FL9A 1EESA 1G3RA 3KQKA 2K5UA 3QUSA 3H1TA 4BGDA 5CITA 1ZNYA 2QENA 1U9IC 1O3YA 4UNPA 5HE8A 1HEIA 1P6XA 1UPTA 4DLSA 4CF7A 2BBOA 1KZ7B 4HZIA 3AV0B 5JS7A 1FQJA 4Q7JB 4HLCA 2GA8A 4HUQA 2C9OA 4ZIRB 4URXR 4MRSA 1G3UA 1OIWA 1RJ9A 4ESVA 1ZJ6A 3CX7A 1AGRA 2EFGA 5LDDC 1TF2A 1T3SA 2QSZA 4AC9A 2ZVQX 3VQTA 3AB3A 3THXA 3OE7D 3CNNA 4C4PA 2I3BA 3RS7A 4A0RA 4AG5A 5JI3E 2OAP1 2V1UA 1DO2A 1K6MA 4Q1FA 2XZPA 2QMOA 3MCAA 2ZSBA 1UBFA 2ZJOA 3QXHA 4K81B 4JLAA 3BB4A 3LXRA 4RKEA 3PCRB 4H1VA 4YONB 3TUJC 3FKSD 4RZXA 4WXRA 3IGFA 1ZD9A 2G1KA 4QRHA 3K9HA 4OK3A 2QP4A 1G9XA 3JVUA 1NMZA 2CCJA 2AR7A 1KI3A 1E2KA 2GETA 2WMOB 4OKSA 5CM8B 3IQWA 4LCBA 2XSZD 2XZLA 3U4QA 3CRRA 1QHGA 2ZEJA 5C4MA 1SKYE 5BW8A 1G8FA 3NIBA 2DFKB 1YR6A 1ZM3A 2GZDA 2Q9AA 3QKTA 5D3MA 2O8DB 1SGWA 3FYHA 3R20A 2O0HA 2RKOA 3TMKA 4M0LA 1SVWA 1NKSA 3TBKA 2WIAA 5A4JA 4Q21A 2JLYA 1UKVY 3GEEA 1M7BA 3FOZA 1XF9A 3KZ1E 4A2WA 4O25A 3CF6R 2C5LA 1MO3A 3PUWA 4QGFA 4MQBA 1QF9A 1XTKA 4GMXA 1OKKA 4Q02A 3BH6A 3LBIA 5FBLB 1KK0A 2IL1A 2F1HA 5SZHB 3T12A 5AWFC 5BXQC 4DLYA 2ZI7A 3EC1A 3MJHA 1IN7A 4US2R 4A36A 1D9ZA 2JLXA 1Z2AA 2GF0A 4DWJA 1LS1A 3VR2A 1IJEA 3UATA 1TQDA 1SVMA 1LF5A 2G88A 4Q19A 1KO8A 3NTUA 1ZM9A 2UVQA 2R6FA 4FI3C 5JWHA 3LV8A 3DDCA 4F92B 4DLZA 2RGNC 3TRFA 3K09A 4XTRA 4LOAA 4QBGB 4V0ME 2J3EA 2B6HA 1OH6A 4MKIA 1ZCBA 2ZITA 3ASYA 3DPUA 1CTQA 5JJLA 1OH5A 2CMKA 1SZPA 4GMDA 4L9SA 1Q22A 4BZXA 4QKQA 1XPRA 4KFUA 1G8YA 2C96A 2GKSA 1HQCA 4OJQA 1JPJA 4CEJA 4EJSC 1OB2A 4I99A 3VHLB 4Z1MD 3QIAA 2W0MA 2C2HA 3GMTA 1E96A 1F3OA 4BFUA 3RLFA 1G291 2FV8A 2ODEA 1KJYA 1FOEB 4B34A 4EAQA 1Z07A 2ZRBA 1XCGB 4JT2A 4EJSB 4DSNA 2ODBA 4JYCA 2J7PA 4JYBA 2I4IA 3T1VA 4PQRA 3EAQA 3V4RA 3KB1A 1XP8A 4KO8A 1QHNA 2GJSA 2W6IA 1Q44A 2EFHB 3A4NA 4Q4AA 4BUJA 1OIVA 3C7KA 3NBFA 1N5JA 4MDFA 2B8WA 4PSVA 3KX2A 2OCAA 1XEWY 4DUGA 1D2NA 4BWYA 2P0EA 1MRNA 5UKDA 3SJAA 2ERXA 1BYUA 4P31A 1W2GA 1N0WA 4IVQA 2WJVA 4P4TA 3PUVA 1N6HA 3KXKA 1RYHA 1UJ2A 1ZBDA 1LTQA 1S2MA 1J90A 3HP1A 1XXHB 4LI0A 5E7JA 3GLHA 1NY5A 721PA 4KODA 1ZM2A 2QZ4A 1Z2CA 1Z3IX 2VLIA 4IJMA 2XITA 2JJ8A 2P67A 4I4LA 4EPXA 4V0LA 3KJIA 1K5DA 1Q57A 5KDDA 3QOFA 1E0JA 2EFDB 3OZXA 1Z47A 4ARZB 4HDQB 1GKUB 4W9MC 1DAMA 1J8MF 1KO1A 4EDHA 5CDFE 4C2TA 3WBKA 2H16A 3VR5A 1J2JA 1YZTA 1P72A 4Q66C 4TYQA 3MLEA 1D6JA 4LJ7A 4Q4HB 4S35A 3O8RA 1KI2A 1L4YA 1WCV1 2VF7A 5GJVC 5CB8A 3H4MA 2F9LA 3AM1A 3FMPB 2XTMA 4JJZA 4D25A 2VP0A 5HPYB 3ZVRA 3REFA 1L2TA 2D2EA 2OCBA 2FPKA 2W2XA 1R0XA 3OFNA 4QNMA 4BRUA 4Q7KA 2XTZA 4W5HA 3UG7A 3AF1A 2GXSA 1UADA 3DZ8A 1XD2A 1FMLA 5FUWA 3GJ7A 4IOKA 1NNEA 1E2MA 4C30A 1G6HA 2W2TA 4KI0A 2NQ2C 3ZH9B 4RZ3A 5L3QB 2BMDA 3NHAA 4C0QC 4ZCIA 1OT3A 4LX0A 5H1YA 2GJ9A 2CNWA 2D4HA 1BO6A 1F2TA 1FX0B 3OIYA 1HE1C 2CL6X 5LB2A 3RRNA 4IDOA 1OKKD 2ZS7A 3B9QA 3WY9A 4QJ3A 3KUCA 3ZYCA 3B6EA 2H17A 2PJZA 4Y0VA 3QPWA 3AF4A 1CJUC 3ZZ0A 2PZEA 5JLJA 1P75A 1D2MA 5KDOA 2ZRHA 3S1AB 4TQ9A 4C3ZA 4HUQB 1BYIA 1DAFA 1CJKC 1Q21A 4R2IA 4WIAA 1RJ9B 1OFTA 1NLFA 3J81k 4V0KA 4P32A 2REBA 5BN3A 1MH1A 4RZ2A 3CBQA 3ECCA 3QVUA 4H1UA 4B43A 2WJIA 2YHSA 1KMQA 1OYWA 3UMRA 4HB2A 5JRJA 4FMDB 3CF0A 4KSBA 3P1JA 2ZTSA 5DN6A 4NYIR 2ZRDA 3WNCA 4QNRA 3QEJA 3QJYA 2DCUA 1WF3A 5C1BA 4TZ0A 3LW7A 2VHCA 3MWJA 4TN1A 3NEJA 4G5RA 4XH9B 2NGRA 1XJQA 1MO4A 3R7WA 1QVRA 4KCGA 1W36B 2WSSA 3KTAB 2ZRIA 4OHWA 3I32A 1M7HA 4M9XA 5EXSA 1AIPA 1F48A 1GNQA 2ZRLA 4GL2A 4TMWA 5J5CA 5L3VA 1NVUQ 1XMIA 4OQNA 4JLPA 4YMUA 1VYTA 4LHZA 3JZAA 3LAWA 5FPKA 1UEIA 1NG1A 4M8NE 4LRWA 4IOMA 2Q0HA 1S0UA 4Q1DA 5DHFA 2JLWA 5JFGA 821PA 3GLFE 1FNNA 5KUTA 3O8CA 1G8GA 4LC0A 4PZYA 2OBNA 2V1XA 2W6ID 4X8LA 1YZLA 2F43B 3I92A 4GOJA 3GLGA 3FHTA 2FE4A 4MUAA 4BFSA 2P2LA 2WBLC 4UJ3A 4JL8A 1V5WA 1Q1QA 3CONA 4RVCA 5AJXA 1SVLA 4WZAE 1QG2A 1LW7A 2IEZA 4DUGD 3B1VA 1XNJA 3L0OA 3MUFA 3A6PC 3LNCA 2L0XA 1DAEA 1XZPA 2IYUA 4DDUA 2WWGA 3ZQJA 4BFYA 1LNZA 4PO9A 5F9FA 3QKUA 1RRFA 5CIWA 1E2PA 5HTKA 3K09C 2R8RA 4LJAA 2ATXA 3IEUA 3AVWA 1SVKA 5CJPA 2OXRA 2QMEA 4XD7A 4L9WA 2XX3A 1PLLA 3FMIA 1U94A 3ZVMA 4DCTA 4DT1B 2XB2A 2WWIA 4PSKA 1P2VA 4B3CA 5FTJA 1KSHA 3SHFA 3QVVA 3FDIA 3HR8A 3GJ5A 1E0KA 3NWJA 5G3ZA 4EPWA 2B21A 1G3QA 3VR3A 3A58B 1CU1A 3A4LA 5B64A 2YNMA 4LJ6A 1G7SA 1Z08A 4W5JA 2W83A 5A0FA 5KTYA 4BLQA 5L8VA 1W0JA 3ASZA 1OSNA 2QQ0A 2WICA 3MG9A 5E7MA 4CEJB 4OHVA 1C4OA 1Q3HA 1PLJA 1SHKA 3SFZA 2O8CA 2ZSAA 4ZKEA 4UJ5A 3WXMA 1A2KC 5JWOA 1II9A 4FN5A 4GBMA 1E4YA 2MSEB 2R2AA 2GTPA 2FSFA 1SXJA 1S9HA 2EU8A 2OESA 3BK7A 3OFND 4XIGS 5H68A 2DB3A 4C0KA 3LFUA 4JKYA 2QEQA 2ZYWX 5BN5A 3HU2A 2WMNB 4HLUA 4F91B 1XFAA 2QTHA 3P20A 3ETLA 2HJGA 3NBXX 4RSGA 3KFXA 2CEAA 4P4UA 4D2IA 3CNOA 3ND8A 2YWFA 2ZJYA 3OAAA 1DS6A 4MYHA 1JXOA 4H9GA 2MSDB 4Q4AB 4U7DA 2O0KA 3TUZC 4RZUA 2A30A 3AP1A 3BERA 4B2PA 2NZJA 3CWQA 2J87A 4JBXA 4UXJA 4EPVA 2PL3A 1SULA 2GVZC 3BIFA 5TVKA 2F1RA 2JLUA 3X1WA 4NMMA 1RPZA 4BFWA 5EE9A 1RRGA 1ZM4A 2V9PA 5ANRB 2YWHA 4A15A 2GAAA 1DOAA 1W4RA 4O2RA 2G1JA 2NIPA 3QENA 4NKRA 2PX3A 3D6TB 4RY2A 3CO5A 4ZIRA 2H5EA 2RGAA 1YZQA 4B3XA 1A7JA 4WAUA 1L4UA 1XMVA 3GLHB 3HDTA 1P62B 4GOXA 2BM1A 2Y8EA 1T5LA 1J8YF 1Q0UA 4V02A 2YINC 2E9SA 1XD8A 3TSZA 4OI0A 5DN6D 1ZC4A 2IYSA 3LVRE 1N6RA 5KSOA 3ZZTA 2F6RA 5KO2A 2HT1A 4PAQA 4AYWA 2VHQA 2QQEA 3PUXA 3W8RA 4B76A 3RC3A 4JLDA 3HWSA 2NOAA 2QT1A 1CEEA 3AUYA 1NMXA 2WSSD 3SN6A 5FTKA 3PJRA 2WJJA 1F2UA 4ZV4A 1U90A 2GF9A 1ZMXA 1PV4A 4M53A 1E98A 5IDVA 5JHHB 3UMFA 4BEJA 3P4XA 2ONJA 2QY9A 3L43A 4HB0A 2DBYA 2W00A 1CULC 4LZZA 4EIWA 1E79D 2GEDA 4NZYA 4IHQA 2VL7A 3LA6A 2BEKA 4ZDWA 2V3CC 1G7CA 3SE0A 2N46A 2ZE5A 2WAYA 2JATA 2VSOA 2GHIA 4IXNA 2QMUA 1F2TB 3BD9A 2ZJBA 3C15C 1A82A 3IIMA 4D0GA 2DFTA 3EPKA 2X8AA 3ZIAA 4F93B 4AK9A 2QP9X 1WP9A 3G5UA 1R0WA 4M9QA 4NYJR 2A5FA 4PC2A 3N2EA 4JL6A 4IFEA 4TL9A 4KAXA 2VSXA 2ANCA 1OLOA 1JI0A 2ZI5A 3X2SA 1RRCA 4DSOA 2NMVA 3AKYA 4EFLA 4YMWA 4XD7D 1FZQA 1A2BA 3R9XA 2FZLA 2OCPA 1ESNA 2LCFA 3NH6A 1G7RA 1P3JA 2A3RA 3CLVA 3BB3A 5CYPA 4HI0E 1D8TA 4YC7A 5EE0A 3OE7A 5C46F 1UBGA 2J9RA 2Q9BA 1ZAKA 1VECA 4CYMA 4E5UA 1U8ZA 1CR4A 1Z0JA 2IUTA 1E4VA 3AP2A 1R5BA 4TMVA 3RC8A 1YU9A 1Z83A 3DO6A 2ZIAA 4TTPA 1RFLA 3W6OA 3R7WB 2G3YA 4TMZA 3EA0A 1SQ5A 3CPHA 3NBYC 1DG1G 2FGJA 2HXYA 1ZD1A 4QBIA 2VEDA 2J41A 1VG1A 3D8BA 5FOWA 3TNFA 5DYGA 1ONBA 1XPOA 1E2QA 2V4ZA 4URUR 1SXJD 1XEFA 4BPBA 4NE2A 1JBKA 1RVDA 2IYLD 3QF4B 3PEWA 2JCSA 4DSUA 1CJMA 2QU8A 3DVLA 3C14C 4RCZA 4EPYA 5EZ5A 1G16A 4EPRA 1XDBA 1TL7C 2GNOA 3OAAD 1E9AA 2ZUDA 2CHVA 1WQ1R 3NG1A 4RKFA 3AP3A 3U7EB 4A8JB 4B35A 2OAQ1 5IT5A 3GLGB 4HLDA 1CBUA 1NN3A 2BBTA 3BB1A 4KITB 1U8AA 2WWYA 3KQLA 2ZI3A 2GXAA 4ON9A 1NIJA 4PQYA 2P6UA 1HH4A 2FF7A 4DLVA 4FMCF 1TMKA 3B1YA 4Q9LA 2YJTD 3UIEA 1P73A 4GT1A 4D4LA 3BXZA 1X8LA 3C16C 3CNLA 2WOOA 3TAHA 1TQ4A 4HEJA 3NH9A 2HDNB 1Z6TA 4TLEA 4C0BA 4RD1A 1HT2E 2FA9A 2IYZA 2WSMA 4DIEA 1GDDA 4AD8A 1W1WA 2XZOA 5TMPA 1KI6A 4B44A 4X8HA 4Z51A 3AKCA 1II8B 1OXUA 2IYQA 1P2UA 3UK6A 1IN4A 2ZE6A 1TUEA 3IBGA 4JLMA 3X1XA 5JSZA 1N6OA 4RD0A 2FH5B 2YOGA 3TSWA 4AKEA 1O87A 4KYIB 3VU9B 2ZETA 1OJLA 5KNBA 3B85A 3QE0A 1E2IA 3GJ3A 4JL5A 5DISB 3EG5A 1SXJC 1UEJA 3A4MA 4ESHA 3UMSA 4D6PA 1CS4C 2NO6A 4QHSA 1JR3A 4B71A 2BC9A 1OXSC 1DAHA 3LX8A 4URZR 2WJHA 2OG2A 3CZPA 4HLUC 2O8CB 4M1YA 2E1RA 2HYIC 1XWIA 1NP6A 2IYRA 1FP7A 4DZZA 2QG6A 1M1YE 1W2HA 3F8TA 4MYCA 5E7IA 2QN6A 4UNSA 2X1VA 4QHYA 3TSOA 3RYTC 2CJWB 3FMOB 1S1CA 4NCHA 3NVAA 1JXMA 4HLQB 4YMVA 3CR8A 3OF5A 4I1OA 2HLDD 2NZ8A 4E07A 1KI1A 4M4SA 1Z0FA 5FPYA 1L7VC 3SBEA 1IXRC 1KSFX 2O8FA 1KSJA 2ORIA 3ZIAD 2DWOA 3BOSA 1QHHB 2IXFA 4WZBE 4DB2A 1XXHE 2GJAA 3WNDA 1N0UA 2GDJA 2ZYVX 4X8OA 4NCIA 3BGWA 3PEUA 4G5QA 1W44A 3RSOA 1IM2A 3EZFA 3NBZC 1NI3A 3S1AA 1E6CA 1ANKA 1Z0AA 3CF2A 2B8TA 5DYIA 2RCNA 1K5GA 2BBSA 4LK2A 1M2OB 2CE2X 4TSFA 1HTWA 1YZNA 1GITA 1COWA 3MMPA 3W5JA 2GEUA 1SHZA 1U98A 1ETUA 1ZW6A 4LHVA 3H86A 3RRYA 4Q4JA 4X8MA 4ZI2A 1FUUA 2VP2A 2N42A 1YKSA 3C5CA 4NYMR 4KLNA 4GZLA 3FE2A 4FCWA 2OV2A 4BLPA 3KQUA 2HCBA 4HUTA 5DH9A 2QTVB 1KDRA 3CKLA 3QXSA 4DLTA 2BVNA 1QVAA 2BKEA 4EQ6A 1F2UB 5JS8A 2BWJA 3KTAA 3SS8A 4GDFA 1EX6A 3KKMA 3IHLA 5CK4A 1UF9A 3W6PA 4D82A 2ZJ5A 2EW1A 4ZPXA 1NN5A 3U7FB 1MO5A 2Z4RA 1OH7A 2ZRNA 2RHMA 3B1ZA 3WBJA 3VNUA 2G9NA 2PLRA 5JI2E 1OIXA 4IDNA 3I1FA 1CRQA 4B74A 1A4RA 1N5KA 1E1RD 2O8BB 1NSTA 4PFSA 3CR7A 3JZMA 2VTKA 3T1OA 2JJ1A 2X2FA 2F43A 5JJKA 3OEHD 4LYAA 5EXPA 2GRJA 4QBFA 1M7GA 4TMKA 1DPFA 2CE7A 4C7OB 5M04A 5G3YA 1LFDB 3FFBA 5FPTA 4RFVA 4IVPA 5GADl 3THYB 2VP5A 5J4VA 1KI7A 4WOPA 2VRWA 1EFRD 4N3NA 2IA5A 3CPJB 3SEAA 3QBTA 5FUVA 3GCGA 2J0VA 1FW6A 1VYUA 1GRQA 2IC5A 3IHWA 1US8B 4W7SA 2MSCB 421PA 4MDEA 4LBZA 3KFVA 2QL6A 4I1VA 4QG7A 1G4AE 2GCOB 3FPAA 4FWIB 4QC2A 1KZGB 1S9DA 3LVQE 4DT1A 3OIVA 1E2LA 5G53C 3ZVLA 3EWSA 4ACBA 1TU4A 4URVR 2GAOA 1I2DA 2J0QA 1YRAA 1Z6XA 1KAOA 2WM9B 3R9WA 2KJQA 4BASA 1JR3D 4ZDJA 2VP4A 2PZFA 3LWNA 1XZQA 2C98A 3Q5EA 1W5TA 2C04A 1G5PA 3ZVNA 2QBYB 2X19A 3E1SA 2FPLA 3IPXA 4MITA 5EUQB 1VTKA 5H70A 4ASUA 1OFHA 1WBDA 1GP2A 3ICQB 3K0FA 3TQCA 2BHRA 5GJBA 3REGA 2JLZA 3MD0A 2YC4C 2C9YA 4PPQA 1NY6A 1Z6YA 1MRSA 3DOEA 1D5CA 5FPHA 5KSPA 3LDAA 1XJCA 2MMGA 5AJVB 1YZUA 2WPDA 4ZI3A 2QT0A 2KBFA 2GCNA 5SZIA 3VR4A 3BRWD 4JT4A 3VTKA 1TNDA 2AKAB 3RAPR 3E5HA 4EFMA 2UKDA 3RSLA 4LV8B 5FBRB 3PV0A 3Q7QA 2VIIA 4R7ZA 1QDEA 3EASA 1W4BA 1Z0IA 5DO9A 3Q7PA 1G18A 5EP4A 3SYNA 5AUNB 1WBBA 1NRJB 2IXEA 5FTNA 4B75A 3BS4A 2A5JA 3U61B 1NIPA 1Z29A 2ZI4A 4I1UA 2C8VA 3A36A 2PBRA 4YMTA 1XTRA 4GP6A 3VHXA 1Z8FA 2R65A 4BQSA 1UDXA 2AKYA 4HATA 3B8HA 5LD2C 4Y0AA 3DM5A 4UKDA 3H84A 4QGHA 3WMGA 2QE7A 3B60A 3W3AA 2ZXUA 4UXIA 4TZ6A 1NJGA 1T91A 2YYZA 3WHLA 4TSFD 1KNXA 4MGZR 1COWD 1KI6B 1NVXQ 5AJZA 1KAGA 1KOFA 4A4DA 5LD2B 1H8EA 4JVSB 3ZD7A 1D9XA 4NTZA 2I1QA 1Z5ZA 2EFCB 3RRMA 1G8PA 2BOVA 3LX5A 2ZJ8A 5JSZB 1LVGA 1Q12A 1RYFA 1AN0A 4NYMQ 3KL4A 4G3XA 5EXXA 4BEBA 3BFXA 3GQBA 5CB6A 1IXSB 1OXVA 2AK2A 3EWAA 3RDPA 1IAQA 3K1JA 5CIQA 3W3ZB 1W36D 4PHTA 1E2GA 4KVAA 3D31A 3QEOA 3I5XA 2W2VA 4QHTA 1IN6A 1ZUNB 2WJYA 1KY3A 2QRZA 2PH1A 4PO8A 4N0EA 3SU8A 3RS2A 2QM7A 5B58C 4K46A 4GRAA 3T1TA 5DI9A 4IDQA 4HAVA 4MA4A 1H65A 2GK6A 3RANA 4IRUB 4CVNA 1QZXA 1S1MA 1TPZA 2G0TA 2G0NA 2NPIA 4PC7A 1Z06A 4BFVA 1ZCAA 2JJ1D 2REXB 5KHOC 2YWGA 2QAGB 4WA7A 5FTLA 3TKLA 3UWOA 1E9SA 1KMHB 3FHCB 4S2EA 2O8FB 1VMAA 3VAAA 4BFZA 4DEYA 1P2TA 1KGDA 2YOHA 4FCVA 4HDOB 3X1DA 3UKDA 2QORA 1DG3A 1M34E 2AFHE 1BMFA 2OLJA 1NKTA 2ZRGA 1KJWA 3CPEA 3TW4A 2Z4SA 4OHXA 2H57A 4EUNA 3HPRA 1T9HA 3GLHE 3Q72A 2WZQA 1E94E 1R8QA 2KSQA 2JLSA 2B7BA 2CXXA 4AYTA 2AX4A 2B7CA 4JSTA 4LBVA 4LYHA 2YZ2A 5FI0B 1T0JB 1E2JA 2Z43A 5FI1B 4G5OA 1PJRA 1SKQA 3E70C 4HYYA 4LJ8A 4TLCA 1GUAA 3CRQA 2FGKA 1ELOA 3M1IA 3T35A 3ZZUA 2RGXA 3RS4A 3UPUA 2ZI6A 4POAA 1E2FA 4OI4A 2CLDX 3M6AA 1XD9A 4PPFA 1UKYA 4XVQA 2C77A 2YKGA 1Z0DA 4B3FX 5J47A 1JB1A 1SKYB 4N0DA 4KSCA 1DVRA 2Z5FA 2R6AA 3NHBA 1J7KA 2PEYA 1JAHA 3GJ8A 2HT6A 4Q4JB 1W36C 4EFNA 1KSGA 1VG9B 1XTJA 1VG0B 4IKEA 2IHYA 1P9RA 2BEJA 2F1IA 2WIBA 4Q1BA 1KDTA 1VCNA 4EQ6B 2CL0X 2GBLA 1OFIA 4ERNA 3CX8A 4HDCA 4B33A 4ASUD 3HU1A 4O3MA 3BJIC 2CVHA 2PEZA 3PXGA 4LY6A 3IO3A 1KO5A 2OFOA 3OEEA 4P4SA 3SJBA 4XWOA 2AD5A 2ZRCA 3GP8A 2QI9C 1X86B 1IQPA 1MKYA 2ZSEA 3SQXA 5ELXA 1ZC3A 3KQNA 2W6JD 3FVQA 4PSAA 3QF4A 1JQJC 1Y3AA 3U6KA 2WPDD 5KU1A 2AXPA 4OQFA 2PMKA 2ZE7A 1VPLA 1HQYE 1E79A 2AWOA 3G82C 4LWZA 4NCKA 1KI9A 1TU3A 3KKNA 4US0R 4DC9A 2P3SA 2ZR9A 4KFTA 4A8JA 3I61A 5HKKA 2D7DA 3AVVA 1ESMA 2A9KA 1PLKA 3SYKA 2QPOA 3TQFA 5AUQA 2V55B 3W8NA 2Q9CA 2D7CA 1BOFA 2ZI9A 4JLVA 4E09A 4KYUA 3MRSA 3U2QA 2A5GA 3QPUA 3Q5DA 1XTSA 5EE5B 3K70D 1RC8A 3SZRA 5IHPA 2UZIR 4JLNA 4LUCA 5FOVA 1CP2A 2QE7D 2ZJ2A 5J4LA 2OEPA 1GRRA 521PA 4DDTA 1E99A 4BECA 1M6NA 4JIMA 2RHDA 1DAKA 4F38A 2WWWA 3PG5A 5KOYA 3VMFA 5CJ2A 1MABB 3Q8XB 3VX4A 1UDWA 2BMEA 4L15A 4BZPA 1H8ED 1LY1A 5E4FA 2RGCA 1PZNA 4OHZA 3N2IA 4D0LB 5JHGB 1II8A 2XXAA 3C8UA 3T15A 1YR7A 4URWR 3TAUA 4C0LA 5GVRA 4Z54A 3DZDA 3TW8B 3H0KA 3VU9A 3D7MA 2OM2A 4AKHA 2H1LA 3SFVA 3TIFA 1EFCA 2BJWA 2DR3A 1QHIA 3HR7A 4QBHA 3N70A 2PZGA 1NJFA 2Z6VA 1G5RA 3UANA 3K0FB 3L0SA 5IRCD 1VCOA 4O2LA 3AVTA 2G77B 2JEOA 1LF0A 3M4YA 1E0SA 3U3MA 1I4DD 4JZKA 3A8TA 4PZLA 3THOA 5EJEA 5K8IA 2CJWA 1R8SA 3QF7A 4KBFA 3U60B 4Q1AA 3CWZA 4MRVA 2PCJA 1CIPA 1FMJA 2WV9A 3K0CA 4D81A 3GLIE 5KPJA 2A78A 2ZRJA 3LO5A 4PPNA 3A1SA 4GZMA 2KI5A 1FNMA 1I4TD 1PUIA 2Q21A 5DI3B 1FPMA 4Q18A 1NBMA 1AA9A 4JMPA 1TF5A 3K70C 1YVDA 2VHUA 4Q01A 2BCJQ 3DOFA 4MKHA 1GZSA 4UXHA 2ZU6A 1P9NA 3BH0A 3H2YA 1BMFD 3KJHA 3AF2A 4DDVA 3MWYW 4A9AA 1ZRHA 1QHHA 1A5TA 1UAAA 3U6BA 2FWRA 1OV4A 3EW9A 3K70B 1ZYUA 4TT3A 3EX7C 3TE6A 5F98A 1HUQA 5J4HA 1KDOA 5E95A 4DLRA 3QPVA 3MGCA 2QGZA 2JA1A 1CXZA 2GVDC 1P4SA 3IILA 2NPFA 4D80A 4JKIA 3R8FA 2ZJZA 2CHGA 2ZREA 3FTQA 3K9LA 3U3RA 2WTUA 4RD2A 4E03A 2NO7A 1P5ZB 4MYTA 1DELA 3NDPA 4B6EA 3I72A 3VKGA 3ADCA 1YZGA 1JJ7A 4V0NA 4NYIQ 2EVWX 1IY2A 2V6JA 4RCYA 4DCUA 1OFUX 3KJGA 2QROA 5HCNA 1VHTA 2WHXA 1SXJE 3QI2A 1MOZA 4A0GA 2VH5R 3PENA 2ZS8A 5BYJA 1AZSC 1HYQA 3B13B 1EGAA 5HE9A 3LLMA 3OEED 5FBWB 3BFVA 2QMHA 4ABYA 4QL3A 2OO7A 4GPTA 3CIOA 1G19A 3BAFA 2WWHA 1R5NA 2H18A 4YMSA 4TLAA 5AUPB 3IUYA 1KO7A 2XB4A 2KBEA 2ANBA 3B7GA 1ZUIA 1G41A 2V6IA 1TQ6A 3IKJA 1MT0A 2O8BA 5LBIA 5HKKD 1U8YA 3AEZA 4DJTA 2HLDA 4Q9JA 4M22A 4RFSA 621PA 3IIJA 3G0HA 3IBYA 2IT1A 1QHSA 1DAIA 1H8HA 1OHHD 3P26A 3W6NA 2ZAOA 3BFKA 2G83A 4DDWA 5AJYA 4IOJA 3THYA 3SDZA 4MKFA 2RH5A 2P5SA 5KPDA 2QM8A 4XSHA 4DRZA 4OL0A 2OCYC 3CRMA 4B3GA 4XSGA 1M8PA 3F3YA 1KK1A 2SHKA 1G8HA 2EYUA 3P32A 2GXQA 2FZ4A 1QRAA 1AQUA 1US8A 1R0YA 1ZUHA 4PAMA 3R9IA 3U3OA 1N0VC 4LV6A 2GCOA 3N5CA 4B48A 3NC1C 2MMCA 121PA 2VO1A 4IXMA 2JDIA 2XJ9A 3GLFB 4AYXA 5J4YA 1HURA 3I3SR 2GBLC 3C5HA 3QXCA 4FIDA 4Q47A 1KNQA 1VIAA 1KJZA 3EZ2A 3VKWA 4UQOA 3EA5A 4LGMA 1UM8A 4BLTA 3EIQA 5JMTA 2ZE8A 4DSTA 2ZROA 2VP9A 4G5SA 5FBVB 2JLQA 3ADBA 1E9CA 1FUKA 2V8OA 1Z22A 1RW4A 1G6OA 2REOA 4FW9A 2QBYA 1E1QA 4BZQA 3DM9B 1GOTA 2QRNA 5FFMA 1FP6A 4P4SB 2ORVA 4D4JA 1WMSA 1TEVA 3JVVA 3LBNA 4A8JC 5L3RA 4HAUA 2WKPA 2CK3A 3NDBB 1G21E 3GJXC 1Q3TA 3QKRA 221PA 3EC2A 4TYNA 2GJ8A 5HCIA 2AXNA 4PC3A 4PC6A 4RD4A 4V03A 1R10A 1E1RA 3DMNA 2F1JA 2OBMA 2GJKA 1NBMD 3AGQA 1W5SA 1G4UR 1F5NA 5JRZA 2FFHA 3GD7A 3OEHA 5F9HA 2BM0A 1S3SA 2OXCA 2CLCX 4N1AA 4W5WA 2F3TA 5FOSA 4LC1A 1XB2A 1P9WA 3WP0A 1N2CE 3ZQ6A 3T06B 4ZDIA 1HE8B 1DARA 2JAQA 1Q1BA 1RIFA 1XTIA 2X77A 2PMDA 3PEYA 1IONA 1RKBA 4TT3D 3SR0A 2BMFA 1UBEA 2R62A 4R9UC 1EFRA 1XEWX 4LJ5A 3FKQA 3QQ5A 3AGPA 3RRZA 3U7GA 4G1UC 2D3WA 4NL4H 1JECA 2D2FA 5FR1A 2ORWA 4JLKA 1KHTA 1PUJA 3AH8A 3KKOA 4WXPA 2W0SA 1TUIA 1Z28A 3K0SA 4PPGA 3T1QA 2XXAB 4HZUA 1R7RA 2R9VA 4BFTA 1KK2A 1E3MA 1E2HA 4A6PA 3LQRA 2IYXA 3WP1B 1XPUA 1G1MA 4A0FA 2VQSA 2XNDA 4PR0A 4Q9HA 4EPTA 5DE3A 2HUPA 1EG7A 4FMCB 3ADKA 3TLXA 3GJ0A 2X2EA 3ZDQA 1DTSA 2FDCA 3RNLA 1NMYA 3KJEA 4G0NA 4Z8XA 5HZKA 2A7QA 4B47A 2FPMA 4M9SA 1KKLA 5TXGA 2ZPTX 4V0OA 3E2IA 1NG9A 2C9CA 1MR3F 3DKVA 1U0LA 2FFQA 5IK2D 3LRPA 3PVSA 1YZKA 2XAUA 2FOLA 1Z0KA 4YLGA 3I4LA 2Z83A 2ZRPA 3LW8A 3M0EA 4TL8A 2ZANA 4LYJA 4ZCMA 4B3DA 1N6IA 4F7WA 2QAGA 3F0TA 4QJ5A 1T8UA 1KMHA 3EZ6A 4Q7MB 1H8HD 1XMSA 4HSEA 3V4FA 2CHQA 4GSYA 1X8KA 2HYDA 1YQTA 1W4AA 2ASEA 4NYJQ 4PAOA 4MGYR 1J99A 5F3WB 3WRYC 5JCZA 4DVGA 2ZS9A 1E69A 2HEIA 2IHBA 5JCPA 2YWEA 3U3KA 1XCPA 2J0UB 5C4GB 1FQKA 2IX3A 2VA8A 2ZM5A 1GM5A 4QXAA 1CR1A 2JDID 1EWQA 3KUDA 3CH5A 1JR3E 4ACAA 1TF7A 4PQFA 5F2EA 2DFLA 2DHRA 1W47A 3OIWA 1IY0A 1E2DA 4E22A 1G20E 1DO0A 2RAPA 4M2LA 1XJ0A 2VP6A 1P61B 2OHFA 3GFTA 2QA5A 2RGEA 3SNHA 3FFAA 5AR1A 3B78A 1G17A 1E1QD 4DLUA 3GEHA 1EXMA 3ZJYA 3T5DA 3Q3JB 2HXSA 3SOPA 2F3RA 2IUUA 4QJ4A 3SYLA 3AF3A 1GKIA 1Z6AA 2CLSA 5CLQA 5K8UA 4PC1A 2RGBA 4CEHA 3X1YA 2CK3D 2GEVA 3WHKA 4PXAA 2J46A 1P60A 2OSBA 3AVQA 1Q20A 5E3HA 2ZVPX 4R2HA 1DADA 4LHXA 3PR1A 5KDLA 3O47A 4DLWA 4L8GA 4CEIB 2GWHA 1TTTA 3CM0A 3F5FA 4TTQA 4RFSB 4DHEA 4U5XA 4V0MA 1QHYA 1J70A 1CR0A 1T4GA 2XOKA 3MFYA 2R6DA 2P65A 3SI7A 1VKJA 2P5TB 3QG1A 1VDZA 4XVRA 3KQHA 1V43A 1N6KA 2PCLA 3Q85A 2QUZA 2IEYA 3VX3A 1Z63A 2EFEB 2CCGA 4TYYA 3X1ZA 4CGZA 2FSHA 4M21A 3FHOA 1E32A 4YXWA 1HT1E 1AZTA 3AVPA 4L16A 2DPXA 1JEEA 4LSGA 4B73A 1ZINA 3LD9A 3BWDD 1YR9A 5KSZA 1N6PA 1MABA 3K9GA 4LJ9A 2ZR0A 3GFPA 3RHFA 1ZNWA 2ZRMA 4DIDA 1KIMA 3PUYA 1KO4A 3C4JA 2ZUBA 4AG6A 2XNDD 3WYAA 4GOKA 2ZU0C 2BJVA 5TV2A 4OK6A 5DHAA 2R6CA 2JJ2A 2OILA 2PT5A 3LY5A 5K8LA 3P27A 4HB3A 2J45A 2D74A 2GILA 4TLDA 5EZ6B 1CRPA 1ZU4A 4A2PA 1UBCA 1GL9B 3ZGXA 4Q5IA 2BIFA 5BWMA 1ZP6A 1IJFA 2CBZA 4U00A 2W58A 4JSYA 4QFMA 2AFIE 5HR5A 2ZYUX 2W6JA 3QKRB 5L3SB 5B57C 1E2EA 1QBKC 1TADA 1XTQA 1T6NA 1AM4D 1M74A 3GJ4A 3RWOA 1FFHA 3QXJA 3RWMB 3CZQA 4F4CA 1OXXK 2ZYTX 2J59A 4XVUA 2KB0A 2O8EA 5DI3A 1RZ3A 1AS2A 1W0KA 2XJ4A 2QPAA 5K8TA 5TDHA 5CLLA 3TH5A 2V7QA 2GZHA 4YQFA 2H92A 1T5IA 2C03A 3KXIA 1S3GA 1XRJA 2J0SA 3UWKA 3TR0A 3FWYA 4JVNA 5LB4A 2BV3A 1T0HB 2O52A 5CDFA 4B3BA 2KE5A 2OT3B 2AHOA 3A1UA 4NCNA 4XWAA 3CB4A 1JNYA 3EPHA 4C0JA 3AVOA 1FTNA 1XX6A 2KWIA 2DFNA 4PO1A 5FOTA 4ZDKA 5LPNA 2BMJA 1MO6A 2JLRA 1E9FA 1AK2A 4CIDA 3QXXA 4G01B 2BDTA 1JJVA 3LXXA 4JVMA 4DBLC 1VYVA 2GK7A 2XGJA 3WRXC 3VKHA 1QG4A 2JGNA 2IBMA 2ZQ5A 3AVUA 4HZUB 1UKZA 4MRPA 1I2MA 1LV7A 2QTFA 2FSGA 2QSYA 1SVOA 2NTYC 3AF0A 4CT4B 2A5YB 3TVDA 1X6VA 2RGDA 3P4YA 1TX4B 1EWRA 2FEOA 1N5IA 3DL0A 3A1VA 3AKDA 3L0IB 4OI2A 3B82A 4M9ZA 5DGXA 5HZHA 4G5GA 4P3YA 3LQQA 2IS1A 5JEDA 4MGKR 4XOIA 1Y63A 3PFIA 5J40A 2EYQA 4ZKDA 4C0HA 1XCMA 2PLFA 2O5VA 2ECKA 3CH4B 5FOUA 2DYKA 2ONKA 1IN8A 3L2OB 2QAGC 1NN0A 4FINA 4NPHA 4TL6A 3TR5A 1XEXA 3CRW1 2GXUA 2Q6TA 3IPYA 2ZRAA 3EZ7A 2ZJAA 4TTRA 3DHWC 1X8JA 1C9KA 4FD2A 2QAJA 5FUYA 1W49A 3IQXA 1KDPA 4AKGA 2WWXA 4RJLA 3I62A 4OK5A 2NO1A 1PVOA 4M1KA 1CF4A 3R8CA 4C7OA 1GL7A 4UNQA 2XOKD 2ZRFA 4M1TA 4NBSA 4Q9IA 1DEKA 3V00A 1E9BA 4KFRA 5GJCA 3TUIC 1JQLB 3EPJA 3MWKA 2YC2C 3K8YA 3VR6A 3T61A 2VF8A 4XJXA 1ZU5A 4MH0R 1DAGA 2E87A 5FL3A 4TYWA 4JBYA 1T3LA 5A5GA 4YXWD 1OW3B 4IFBA 1GRNA 3DKPA 4WZ6A 3NC0C 4F4JA 4ZO4A 1XBTA 4PANA 5KNDA 1IXZA 5CM9C 1ZIPA 1IN5A 1EFTA 1E9RA 1E9DA 2EWWA 2O0JA 3PITA 4FMDF 2J7KA 4AIIA 4OQMA 3ZLJA 2F9MA 2D62A 1ZNXA 1X3SA 1YE8A 2HF8A 3SBDA 2FG5A 2IW3A 3IDQA 3GLFA 2XTNA 2FMXA 2IS6A 4GI7A 4MGIR 4GP7A 3UG6A 2H7VA 2BBWA 2FNAA 4TMXA 5EE3A 4M1SA 5KNCA 2VHJA 1DE0A 2GCPA 2JJ2D 4NONA 4Q9KA 1JAIA 4A2QA 5FTMA 4CRWB 4R71A 3RABA 5DLQC 3GFOA 5SZKB 1VCIA 2C78A 3WMEA 3LH5A 5H8WA 3K0AA 1DBSA 2OBLA 2IWHA 4HAXA 4OHYA 4DB4A 3THXB 4PTLA 3BH7A 1ODFA 1G64A 2N1BA 4CEHB 1IOZA 1B23P 4D0NA 4GFDA 4NHOA 2JLVA 4I1SA 4MUBA 4CZ2A 4XWKA 4OI1A 1GL6A 3WNBA 3MWLA 2A5DA 3WMFA 1NLYA 1WRBA 2HV8A 1U99A 3LLUA 2OFWA 2WAXA 1F60A 1KK3A 4XTCS 3U44A 2IF0A 3GJ6A 1W0KD 2IUSA 4WBSA 1VHLA 1KI4A 3EPLA 2AWNA 2V7QD 2NO0A 1NLZA 1N3BA 2LWIA 4AI6A 4D26A 2AK3A 4M1MA 8OHMA 2C99A 1OHHA 1R2QA 2RMKA 5DNYB 1YHNA 4FXPA 2J7PD 3U4QB 5P21A 1BS1A 4C0AC 1CJVC 3PQCA 3T5GA 5D3MB 1UFQA 2WJGA 3NEYA 2FJUA 4LBYA 3THWA 3MSXA 2AL7A 3ONWA 2DWPA 2VYFA 4L4UA 2UZ3A 4PX9A 4PHGA 5KYKA 2CCKA 2OE2A 4KBGA 3SHWA 1HV8A 1E0AA 2WOJA 2F7SA 3PIRA 3IEVA 1E2NA 1NSFA 3EIEA 3HPQA 3GLIA 1ZIOA 5FL7A 4ZCLA 2TMKA 2WVJA 2WKRA 3SC3A 1NL3A 3C41J 3TJZA 1GSIA 2C95A 2GESA 2AD1A 3DEFA 3AQ4A 5DSZA 3QKSA 4IEEA 4TWZA 5JWRA 4GNKA 2PJRA 5TB5A 3K9NA 5AK0A 1OPXA 1X1SA 6Q21A 5G41A 3QY0A 2LKCA 4A92A 1OF1A 1W7AA 2EQBA 1U81A 4P33A 3ICEA 1GIAA 2YV5A 1BKDR 3UXMA 1S96A 1WXQA 4NCJA 1S4QA 1OXTA 1JALA 3I8SA 4QGAA 1EFHA 1G3IA 2CVFA 5J4KA 4R98A 4AWXA 3I5YA 3O8BA 1TAGA 4DLXA 3GLGE 4FCTA 5JJIA 4QM6A 4LHWA 2HJVA 4AURA 1GKYA 3EIHA 3PUZA 3TK1A 5EXTA 5B2ZA 3O8DA 3FGNA 2PX0A 4ILEA 2ZSFA 4QOSA 2VPPA 4RD3A 3TGPA 4AY2A 2O8EB 4JVLA 3QBVA 3VNVA 4I81A 1AQYA 3RS0A 4BE7B 4KXFB 1TQ2A 4B32A 5EP3A 4YDHB 3L8YA 2Q3HA 1R0ZA 5EQTA 4B6FA 4FWTA 2FEMA 4LYFA 5CYOA 2WWFA 2CDNA 1G7TA 2IS4A 2I1VB 5DIFA 3VR1A 5BYKA 2ZAMA 2JASA 4DCSA 3B2EA 1MV5A 3EXAA 1W4CA 4TL7A 2J0UA 4HAWA 4LHYA 2CNWD 5G40A 3U3JA 1YR8A 4QGGA 4IDPA 1ZVQA 4BFXA 1WB9A 1JPNA 1VIYA 2EWVA 2J1LA 3PEVA 4HAYA 3WYFA 4C2UA 3I8XA 2OLKA 4TQUS 2VSFA 1RRPA 3A37A 4U02A 1BH2A 1RE0A 5FBQB 4D4KA 5D3QA 2A2ZA 3KB2A 1I4LD 5AJWA 1U9IA 3BORA 3U7HB 2ZSDA 4K8OA 1AGPA 4LJYA 3I73A 5KSYA 3B1XA 1ZM7A 2LKDA 1Z6GA 2JIZA 1XMJA 2IF2A 3B1WA 3CW2A 4JLBA 4KU4A 1NVVR 1OB5A 1KKMA 1S8FA 2P6RA 1NBME 1GNPA 1OYYA 4FMBB 4OQXA 2CL7X 2HF9A 4PHHA 1XEXB 5FPSA 4Q03A 3QSYA 3CRVA 4BRWA 3KXLA 5IK2A 1CR2A 3AKEA 4ITRC 2ATVA 5EP2A 1LB1B 2J5XA 4CEIA 2OZEA 3MAAC 1GILA 3B5JA 4JJKA 4URYR 4B2LA 2H8KA 2Q3FA 3ZS8A 1R5OA 1T8TA 1N25A 4B2IA 4NDZA 5IF9A 5GJWC 3HYRA 1IY1A
chains in the Genus database with same CATH superfamily
4IUBS 4YJ3A 1NE7A 3UF0A 5C2JB 4Q1VA 4HYTA 4MYUA 2QGNA 5TARA 1MBZA 1NI4A 2HB6A 4Q7LA 2RKBA 3VR0A 4RF3A 2O9JA 1NU6A 3U4AA 1E8DA 2RB4A 1VHJA 2HF2A 1A8UA 3AK4A 4BLUA 1P1BA 1SH7A 4OQLA 3ZQ4A 3TLZA 4NP6A 4D97A 2F64A 2LR0A 3OMXA 2ZUCA 3TMYA 1B1CA 3IAAA 3H65A 1O5IA 2IWRA 2H5JA 1I7NA 2QQGA 3P94A 2DKFA 2R11A 4HFJA 3ZDFA 1ENZA 2A6PA 3RYCB 2RE8A 3AWDA 5E1MA 3THRA 2BCGY 5FL7D 5HG0A 5M7EA 5J4YA 1XAHA 2EJCA 4JS0A 1NMSA 3RR2A 4E11A 4AJPA 1KH2A 1C3XA 1NXQA 2EWMA 5CPFA 3PNSA 2WIFA 1NULA 5JOQA 1EK0A 1C81A 3VA7A 3VZDA 2P9YA 1QXSA 2QDXA 3OC0A 2B82A 2VDKB 2NZXA 3NBAA 5DBEX 5AVSA 1NXOA 1PWYE 1V71A 2GOYA 3SEFA 3KYCA 3WDKA 4DMRA 2XVZA 3I8OA 1Y81A 5LP6C 3AVXA 4KR6A 2R1TA 2C1XA 2GZAA 3GEIA 1DZ3A 5F9MA 3W77A 3DE0X 2EATA 1G5FA 5G0VA 4A1FA 1A9RA 2ZBQA 5FHQA 5T57A 4DQXA 3COZA 1O94A 4C20A 1RZVA 1ODJA 3S99A 2H0AA 4MRNA 4JJIA 3U39A 2WF9A 4AMVA 1E66A 4X62B 1OV6A 2CNBA 5CTJA 4ZHQA 1C0LA 2FX5A 3NHFA 5AOBA 1SHTX 4BJ1A 4LK3A 3WAGA 2ZTVA 1K7SN 3LOPA 4TYPA 1L5WA 5ISMA 4B3TB 3GNSA 4UQLA 1Q1ZA 5F73A 1W0JD 2JFUA 1AGNA 3BMQB 1R74A 4LPKA 3GIWA 4LJ4A 4KVGA 2ZPUA 2DLDA 3U44B 1RQPA 4L95C 3W34A 3FRHA 5A6SA 5B12A 4CLRA 4E2FA 4L0MA 2R6GA 1YZYA 2VHTA 3WL6A 1OE0A 3FKSA 4CKBA 2P9JA 4M8IA 3SYMA 3MXOA 1C41A 2QTRA 4BLSA 3TW0A 4BBAA 1ZI9A 2NN3C 3GGSA 5FUXA 3D3KA 4Z4IA 5LUBA 3FZGA 4MWOA 3PUHA 2Q5IA 4YCLA 5E4JA 3L01A 3ZWOA 4GEKA 3OJXA 4W7IA 2VPQA 4KV9A 2XSZA 4HN4B 4Z8YA 1UKEA 1E59A 4Q48A 1M6EX 3IOYA 1BIFA 1P7CA 1QIFA 4FVTA 2Q45A 1EP1B 2C9MA 4DOMA 4N82A 1UXHA 4CLOB 3KZCA 4LZAA 3L0PA 1C7RA 3FLAA 4RGVA 1K5HA 5ESWA 3WS7A 4LPSA 1UK9A 3RTAA 1SVSA 1I1NA 2QUHA 2V54A 3HXLA 4WVFA 3UTDA 5J2UF 4J0QA 5GVSA 1U2GA 2DQ4A 2BTQB 3EVEA 3S2SA 5JCXA 1V2GA 4KMOA 4BY9E 1EAMA 1AQLA 2ZRKA 3QX9A 4LV5B 5BVGB 1T3HA 3OIUA 1XWWA 2J3HA 4CF4A 1H2EA 4B8YA 3SJCA 3T34A 1I3LA 1SQGA 3NTLA 4AS3A 4BAGA 4CDGA 3PDIA 5LOVB 2P9BA 4NH0A 4PV7A 4UAJA 2NUAB 4HPXB 4KH0A 5KWIA 2YXLA 4OBEA 2E5WA 2Q8NA 3JW8A 2PSFA 4GBED 5CCBA 3A4VA 3HFRA 3OE1A 3SIRA 2W6MA 3EW7A 4H16A 1Y9DA 1VCMA 4LSWA 4P7JA 3D6NB 4TLBA 2YMPA 3LRXA 3JX9A 4FYYA 1IUNA 2CLIB 3R41A 1VE3A 2CHFA 4B80A 4M3NA 1FZTA 2HIHA 2P9QA 3LHSA 4ZRMA 4Q1EA 2HRDA 4QM7A 1YAJA 1R6BX 1VG8A 1RHRA 2AUTA 3JD1A 3QVTA 4KJZA 2J4CA 4P34A 4RKRA 4OXXA 4G8CA 2BKUA 1ZNZA 2YMQA 1ULZA 2AUNA 1AKEA 1I3MA 2WUFA 5C18A 1B8OA 3K53A 2IXGA 2KS6A 2YZGA 4G81A 4U7TB 4ZJPA 1NLMA 4GRIA 4BLOA 3FBGA 2AG0A 3VH2A 1EWTA 3KQPA 1YA6A 3BXFA 5A3QA 1G59A 1ZKMA 2FETA 4Q4HA 3W1EA 4EKDA 4DR7B 1Y33E 3IUQA 2HRZA 3IQHX 3PF8A 1QCDA 3V8RA 5IAEA 1JHZA 3F71A 2WTMA 4ZA2A 3W90A 1OYOA 4ALMA 4FMPA 2PSSA 3KVRA 5IU6A 1BFUA 1D2EA 2YH2A 3EF3A 1RJDA 3NZEA 1RQ7A 4UZFA 2B61A 4A6XA 1AB5A 4O8CA 4HWPA 1G60A 2FXVA 3S29A 3V2GA 3PDCA 5KJEA 5IXJA 2DWQA 1E3DA 1B00A 1GKKA 1VLMA 1CUHA 3DVQX 3KKQA 4R6WA 2BF7A 1UH5A 3WRVA 4LNAA 5HIKA 1DFHA 3B9PA 3O1HB 4EY6A 4MX8A 1II0A 1I7PA 3C97A 3CUTA 3NHMA 1N32B 1YVUA 2IZ5A 1FX0A 1M5UA 3HJGA 4U9HS 1EESA 4HX5A 4FLFA 1QGUB 4TMFA 2A67A 4FQ8A 3BGOS 3H1TA 1B93A 3CISA 4UNPA 3K2IA 1P6XA 3AY7A 1WDMA 3V7WA 4DLSA 5AVVA 2FPXA 2GHRA 2A59A 3P0EA 5JRDS 2BBOA 1JB9A 1U3DA 1ZZEA 3G68A 4HNGA 4I2VA 3UBMA 3IB6A 4ZFNA 5K0FA 2B34A 2AOXA 3DZHA 4ZQIA 3NX4A 3ZEAA 3TR6A 2I0FA 4HUQA 2C9OA 4G56A 4H4EA 4ZIRB 4EW6A 4AJOA 1B43A 2ZBFA 1J56A 1G3UA 3EF0A 3IVRA 1PP4A 3AIIA 3CLTD 2G5CA 3ETJA 2DPHA 2ERCA 4H60A 4J75A 1ZW1A 1BXZA 4UW9A 5LDDC 1T3SA 2QSZA 4AC9A 2ZXEA 4QEKA 1T9DA 2NXEA 3X43A 2V1UA 3ERCA 5DK6A 4AP5A 4PSUA 4IFIA 4GX0A 1FVOA 2ZBVA 1NBIA 2YX1A 1GQFA 1K6MA 4Z9YA 1C0IA 4LQLA 5JE8A 3I12A 2PKWA 3HUTA 3M1YA 4FX2A 3OLCX 2IU3A 4G0MA 4J2OA 2PU5A 4YAUA 4E1VA 3F96A 4PZDA 5T4BA 4U7FA 4J29A 5JMWA 3IQFA 5E4TA 1BVHA 4LF4B 3LXRA 4HAOA 1J0EA 1AHIA 3DF9A 4UEOA 4YONB 1A5SB 5TPWB 5B5SA 3IGFA 4FGUA 3G2LA 1ZD9A 3RADC 4NULA 2PIDA 1G9XA 1GD1O 3JVUA 1SUFA 1VGVA 1RMTA 1E2KA 5CLIA 1ISGA 3WFZA 1JMKC 2O8VA 5CM8B 1JG4A 2I7DA 3CBGA 3H2JA 3IQWA 4LCBA 3L4JA 4K6OA 4KPGA 3U4QA 3ZE2B 1L6RA 1HOTA 2GK3A 1QHGA 4OKIA 4XRGA 3BL8A 1ECCA 3NIBA 4NK4A 1JI3A 2DFKB 1ZM3A 3R24A 2XBLA 2O8DB 2XPCA 2P2CA 3R20A 3ZBPA 2EX0A 3FWPA 1A9OA 1SVWA 5EL0A 3HSKA 3SZGA 3RODA 1UKVY 3FOCA 3GEEA 5F4BA 2ICAA 3FOZA 2M9MA 4KGZA 4RQAA 4A2WA 4CCSA 3DOUA 1K8XB 3USZA 4QGFA 4DHWA 4HGZA 3IQZA 4TT8A 1XTKA 3WO1A 2H4HA 5CP8A 1OKKA 4U7WA 3LQ1A 1ISSA 4MJ3A 4ZQCB 2C7QA 1KVQA 3AR4A 2J9YB 4RFLA 3QWHA 3T12A 1JQAA 4UBKA 1O94C 4B81A 2JIRA 4AS1A 2WMYA 4US2R 4A36A 3TW6A 4DWJA 2D54A 3IESA 2VYQA 3U56A 2P3LA 4IGIA 3EIXA 2OBXA 3UATA 5JY6A 4X84A 3BKWA 1LF5A 1VJTA 2G88A 1U11A 1J39A 2H3HA 3E0QA 1MJFA 2E5FA 1PJ4A 5JWHA 3RUPA 4NPCA 1WETA 2Y9MB 3P4UA 1K2WA 3QKWA 4LOAA 4QBGB 1H2ZA 4V0ME 4FHZA 2ZZKA 1B0PA 1LPSA 1ECPA 1OI7A 3ZHSA 3OBIA 4IIHA 1XPRA 4IY1A 2A0FA 2QW1A 5IJ9B 1G8YA 5AICA 4E0BA 1M2WA 2X0IA 4U1RA 1HQCA 2C3MA 3D6JA 1Y3HA 3FF4A 1JPJA 3HV2A 4G1FA 4X3PA 4YS6A 1SOWA 2UVPB 2AKEA 4Z1MD 1YL6A 3GMSA 2W0MA 4ENUA 1YCGA 2YHUA 3MCUA 1HE3A 1LDGA 5FWYB 5LZ2A 3RLFA 3DBVO 2C54A 3T3EA 1G291 2FV8A 2WUDA 4ZO6A 1EVYA 1KJYA 3OCWA 1ICEA 4DSNA 5SICE 4R1TA 5GPBA 4JYBA 2A9PA 1U2GC 3KOUA 4I6JA 3M6MD 3P19A 2RD2A 1E6MA 1XYVA 4OXQA 4G4SO 1VB3A 3ZCSA 1GGEA 1V7PC 2GJSA 1ORTA 5AOAA 1FJGB 1Y5MA 2ECOA 3DCJA 4RNCA 3KG2A 1FU4A 1V8BA 4HNUA 1Q7BA 2XH8A 1OY1A 4U2DA 3AU8A 4F1WA 1ZJYA 4X71A 3NBFA 2B8WA 4V3CA 2ZB4A 1W34A 3HEAA 1AKMA 2QUBA 3KQMA 2QG9A 4X94A 4ZPJA 4YMHA 1VMDA 4DUGA 3KT8A 3O0TA 2P0EA 2GZ3A 1JFLA 5E1BA 3BMXA 4IMPA 4R31A 1JYFA 1JR4A 1Z74A 4P31A 4PLWA 2WJVA 5H0IA 3LXUX 4D9IA 3PUVA 3PE4A 1N6HA 4R3UC 3CVUA 5IKXA 1RYHA 3RF6A 1WUKS 1ULAA 2JAWA 3NU1A 4ZU3A 3RBXA 5CCEA 2HSJA 1M34A 1UP7A 2BGUA 2ZWPA 1PT9A 1EDOA 4WZBB 2Y4NA 1XXHB 5JAOA 1JHRA 4QLOA 1UXKA 2ILTA 2XUOA 3FCXA 5BR1A 1UKCA 2XIJA 2RGUA 1SWVA 5I8ZA 2VLIA 4RMJA 3PDWA 4I4LA 1GUFA 1FS6A 1XYYA 3KJIA 3REOA 2BFEA 4YUAA 1Q57A 3NIFB 4FQ7A 3HJCA 1W8IA 4OSEA 3QOFA 1Z2DA 4FOOA 4QVKA 4RGYA 2NM0A 1JMYA 4HDQB 1GKUB 1PBTA 2HQ1A 4RH3A 3UC9A 5IULC 2WU8A 1QE5A 3Q41A 1YZTA 3GX1A 3ABIA 1WNTA 3O9VA 4XYGA 3LHDA 1KQOA 2HHJA 3QWIA 4NIMA 4WNAB 4C89A 1H5QA 1RQRA 2P75A 4E5KA 1DBQA 2X9GA 3DMTA 3F4BA 2XCUA 2F9LA 1RXIA 3I09A 3L8HA 5A6VA 1GZ7A 3WX0A 4BV8A 2W2XA 3MF4A 4IHKA 4UE6A 4ZI7B 1R0XA 5I9IA 4Q7KA 2XTZA 3QUAA 1WUYA 1Y1SA 2F3QA 2GXSA 1A9PA 1UADA 2WD9A 3DT9A 3DZ8A 2WG2A 4MP6A 3PJEA 2QTCA 5D6NA 3GJ7A 1XP5A 4A73A 1U8FO 4FR5A 4R1PA 3V1MA 2OV3A 2QTBA 3RLIA 3ZH9B 2GKOA 2IODA 4JROA 5BQXA 2VPTA 3MJ4A 4HDMB 3NHAA 1AF7A 4PZAA 1HQDA 1NPTO 1A9SA 2A1TS 1M33A 3IAXA 3ZV4A 4C78A 4F4UA 1F2TA 2IPMA 2JH8A 1AKQA 2WPNA 3OIYA 4OHRA 1DBIA 4DY6A 4RIHA 3R5SA 2OV4A 2ZS7A 3B9QA 1LPOA 4I5DA 4KXMA 1UJBA 3QMMA 4JOQA 4J7UA 5HVNA 1YNOA 4XB1A 3B38A 4LY3A 1EIWA 2I4NA 3EGDA 3ZHQA 3O75A 4OQEA 7ABPA 5AMXA 1KQNA 4M88A 2ZRHA 1O7JA 3S1AB 2BHSA 3SEQA 1Q50A 3VR2D 4Y2PA 3WLRA 1CJKC 2ETVA 4R2IA 1MJNA 1RJ9B 1S6YA 4WIAA 1PJAA 4PR3A 4YJGA 1OX6A 4P32A 4JT9A 4H7HA 1J0AA 3FSGA 3TSAA 3C4QA 3IP6A 4BC1A 1ZHFA 4ENTA 3UGQA 2D0PB 4CM9D 3AXTA 3UMRA 2XXJA 4UU7A 1YE3A 5JRJA 4GMGA 2OR3A 4FMDB 3CF0A 2WTNA 3P1JA 4K1LA 3TTUA 3E6AA 5DCWA 3CQ9A 4HNRA 1V1MA 3R3SA 5K3FA 1WV0A 5JSKA 4N9QA 4XH9B 4TN1A 4NS4A 1XJQA 5CFZA 1JLSA 1FUIA 1HC7A 1OBVA 2KYRA 3HMKA 3IXQA 3L79A 2WSSA 3NAQA 4E30A 3M49A 4IXDA 3WWOA 1W36B 2HW8A 1M7HA 3QELA 2ORED 1E9VA 1F48A 1GNQA 3AERA 4GL2A 1PGQA 2EEZA 2HN9A 1RAGA 4PG4A 1JYSA 4MVJG 4BLVA 1UJMA 1U0RA 4D9HA 1DEHA 1MN6A 4JLPA 2MDTA 4FBMA 4U9UA 4LHZA 2BFCB 5AYVA 1NG1A 1QB8A 4OJYA 1ORDA 1FVXA 1EX9A 2JNWA 2Q0HA 3BEDA 2MOKA 4GF5A 3PHIA 3G2QA 5DHFA 4RHFA 4D9GA 1YQGA 5JFGA 821PA 1DKMA 3IELA 4OBWA 1FNNA 4P92A 5KUTA 4CIAA 3CZCA 1IRXA 3I6BA 2OBNA 2WFZA 4X1YB 4X8LA 5FPPA 3VJRA 5FP0A 1IG0A 1VL0A 4S3MA 1ZGBA 2F43B 3MWEB 4DMMA 3GLGA 3FHTA 5IJWA 2FE4A 4MMXB 4BFSA 3T1YB 4UJ3A 2WBLC 3CT6A 4RVCA 3CONA 1Q1QA 4L5JA 3G9QA 2HOQA 1SVLA 5JPCA 3T5CA 2V7UA 4W1QA 1LW7A 2IEZA 4FPXA 2VKQA 2B36A 1O0BA 1SFRA 4ETIA 4ZK2A 3AR2A 1Y7LA 2CZCA 2WWGA 4ONEA 2XWQA 1D5WA 4UAUA 4NMHA 3PRYA 5E38A 1K9SA 2VBFA 4BFYA 1C1XB 1T8PA 1B7GO 1VSUA 1YJQA 2Q3LA 2V03A 1YIDA 5TRTA 3RU3A 2WJWA 5FAXA 5EJ7A 1P1FA 4AP9A 3C7TA 5HTKA 3FFXA 1KRXA 3OEWA 1T6XA 2ATXA 4DEVA 4BO7A 3UBTA 1MJHA 1SVKA 3I6MA 2XX3A 4KWCA 4K8RB 1SPBS 2HO5A 3C70A 4P2GA 5ALLA 3P9KA 5CMLA 4DCTA 1OX5A 1PO7A 1S5PA 2GEKA 3ACDA 5FBHA 2WWIA 2DTDA 1FPQA 2PKYX 3VU1A 4IIUA 2XB2A 1KZHA 2VTVA 3BICA 4EVRA 3ETGA 2ZIZA 3HR8A 3GJ5A 1XQ9A 1IDOA 1MB4A 1YO6A 3N53A 1S3IA 5FO0A 5G3ZA 1G3QA 1PR3A 4QEDA 4CQJA 4EBFA 3A58B 2AJDA 1RYEA 2J9GA 2MIIA 3QX7A 3KTOA 4MPRA 1EFPB 5B64A 1NR1A 3VJLA 1G7SA 5A0FA 5L8VA 4BLQA 5LYJB 3ASZA 1OSNA 1EFAA 3AR8A 5LQUA 1U65A 4YQEA 3S3TA 2BM8A 5BP7A 2HWKA 1Q3HA 1XN1A 3KEOA 1BX1A 3WXMA 3G89A 4UBNA 4EGQA 4FZVA 4FN5A 4MPTA 1LVUA 4MW7A 4GBMA 5F76A 5F2OA 1IUOA 4OXNA 4H7EA 4I1IA 1CNEA 2UDPA 3LXMA 4L57A 4XIGS 3QYPA 4EO7A 4ETMA 4CV3A 2DB3A 2Y0EA 3R7LA 3DTVA 5FLYA 4JKYA 4Q9AA 3HU2A 3E7DA 3KJZA 1BHJA 3KAQA 4HLUA 2DUJA 1R9JA 2EGHA 1F9AA 3NBXX 2EBUA 1JQDA 1OLUA 4D2IA 3CNOA 1LDMA 1Z34A 3D1LA 3GAFA 1WB6A 2ZJYA 3EVAA 4MYHA 2FCAA 5KX5B 4H9GA 2N75A 3EIFA 3CTPA 5IAJA 3OKAA 1HDRA 3C8MA 5CA1F 1Y1QA 1XDWA 2IBSA 1RKVA 3BERA 1RRMA 3Q1LA 4RETA 3CWQA 1WEHA 1XZDA 2FAXA 3EMKA 4UXJA 3TRDA 3IUEA 3ZDBA 2XXBA 3A70A 4DQDA 1CG6A 3LRTA 4PLYA 4BFWA 4RU1A 3WWYA 4E5DA 3HJAA 3E9NA 5ANRB 3DEHA 3F5SA 1IZ0A 2G1JA 3HHPA 3QENA 4KMMA 2PX3A 1T35A 5KJ1A 1RLMA 1TXGA 4E2ZA 2B9VA 2CXNA 2EJBA 4ZOBA 3SC2A 3V8EA 4KE7A 5DPMA 4N65A 1A7JA 2WNSA 4FSHA 2UUAB 3HYLA 2SNIE 3HDTA 4RPKA 4GOXA 2V8BA 2BM1A 2VNJA 4AZ0A 4YCDA 1NOJA 2ZUEA 1QGDA 4IIGA 4MVJM 1W76A 4BQEA 4OI0A 3PQ5A 4GQBA 5A3RA 1TD1A 3C87A 1ZC4A 2IYSA 1Y4UA 4BPRA 1GA4A 4RSRA 2B35A 3DMTC 4O1MA 3GQBB 3MIIA 3UJPA 4AYWA 2FEXA 4KQMA 3TRHA 5KQPA 3RC3A 2QT1A 4CV1A 1JHAA 1WNFA 3RK0A 2CDBA 5FTKA 2IUFA 1Z68A 2X0NA 2H4YA 3MMXA 4E5PA 4ZV4A 4QDUA 3IL2A 3D2BA 4WFQA 3FRIA 4C4RA 1E98A 2C3YA 2IIPA 2R47A 1LK5A 3UMFA 5JHHB 1MU0A 1TZKA 4BEJA 3JATA 1U5AA 1MEOA 3PWKA 4M6WB 4K3VA 4C4AA 2FEWB 3D6VA 4MV7A 1OLXA 2QY9A 4ME6A 3TQTA 1ULBA 4HB0A 2W00A 4GXTA 4PAGA 3LCVB 2BTEA 1QFZA 2HTFA 1RXEA 4EIWA 1DQZA 1E79D 4XX0B 4HNAA 4MUIA 2G7MC 1OZFA 1RRKA 2JJQA 1B26A 4B87A 3GBPA 4Y0NA 2VL7A 3E3OA 5HFJA 5BOVA 1G7CA 1BVYF 3SE0A 4LF8B 2WAYA 4BS9A 1U28A 4U0JA 4DMGA 1QC5A 5IYZF 2GD6A 4IXNA 5THKA 4GX5A 4UU0A 1R16A 5DWDA 4ND8A 3IIMA 3WYDA 4F8JA 3GDWA 3BWEA 3KQOA 4AK9A 2QP9X 4CM4A 2QKYA 1R6UA 5DHQA 1R0WA 4P54A 4PF1A 2RCYA 2G8NA 2AH5A 3NOQA 5A71A 3X2FA 1EDEA 4JL6A 4ZVQA 2IOYA 1NAHA 3CZMA 1L4NA 1P5JA 2ANCA 3DBHA 1OLOA 2HU8A 4KAXA 1DDGA 4EEZA 4EX6A 5AXCA 3HA2A 3ORHA 5HK8A 4EKEA 2ZT6A 1QO0D 2WZDA 3X2SA 5B4UA 4I55B 3UJDA 3F3SA 3LUKA 3PQDA 3BCSA 4XD7D 1CYEA 4IDFA 2C4UA 1RT9A 2GJ4A 1E3JA 5D51S 1M2FA 1N36B 3T9DA 2OCPA 2ZP1A 2LCFA 3IPAA 1G7RA 3N2ZB 5DHRA 2A3RA 5CFMA 3V6MA 3CLVA 1J0CA 2ZIVB 3H5LA 5CYPA 5EE0A 5AXDA 2IP2A 1IY9A 10MHA 3AR6A 1NSYA 3ES9A 1UBGA 2AE2A 4JP1A 1ZAKA 2OGZA 3KE8A 4CYMA 2O3SA 2ZB2A 1KQPA 2AG8A 1Z0JA 2VJLA 4H6VA 5ALFA 3H2BA 3TIIA 1VYHA 4DMKA 1H1DA 1GSAA 2AFRA 2XDQA 2F8TA 5L51A 4U2EA 3TBHA 5HP4A 1Z83A 4TTPA 4MR8A 1JSCA 2A0WA 4NZNA 2MTBA 3VI3B 4XQEA 2JKYA 4RJJA 4TMZA 1F2DA 2QX4A 3NTQA 2UYHA 4G37A 5B7GA 4CQMA 3PGLA 2HXYA 4XB6B 3DYBA 4QBIA 4LXYA 1C9NA 3WA7A 3D8BA 1GN9A 4UD6A 4GZ3A 3AIMA 3O8NA 2PV0A 3KE9A 2WWRA 3MA0A 1XHEA 5EMNA 3MGAA 1PT6A 3WLEA 3HKCA 2QRMA 2IYLD 3PEWA 1T4CA 2I1WA 1W2WB 1XROA 5FF9A 4DSUA 1X3LA 2VJNA 1W5BA 2NP6A 4UM5A 4CMHA 2RARA 2WE7A 5HZKA 3MJEA 4CMEA 3CGGA 4EPRA 1BKYA 2EF0A 1FDOA 1D1SA 4GX2A 2JARA 3OAAD 4HP8A 4A8JB 4BJ3A 5BMVF 3OLWA 3ZE6A 3S28A 1GSHA 1OPRA 1V16B 2OAQ1 2PKEA 4QASA 5IT5A 1UZAA 2QLLA 1OWNA 2PQ2A 3KXDA 3ST7A 3GN2A 2V7EA 1RP1A 1HDYA 3HCBA 1NN3A 2BBTA 2FPIB 3B6ZA 3L7IA 4B09A 2C2YA 1NIJA 1R6XA 4LHSA 3TS1A 4PQYA 5DJ5A 2WWVD 2Z6AA 4UQPA 1XMQB 4HN2A 4DLVA 4MEJA 4F6RB 2OV8A 4IIJB 1HTTA 1C7JA 4L0CA 1E7MA 1GG5A 4XLLA 3W5UA 2K7FA 3UIEA 4N76A 2P6MA 3GPIA 3MHPA 1F4PA 5GP1A 2HA6A 5F5LA 3G6WA 1JTVA 1JJIA 1R27A 1XZMA 3WMRA 2BI7A 3CNLA 2WOOA 2YL2A 3H9CA 3KAKA 4FWBA 4G0OA 1Q83A 2HDNB 1Z6TA 3QHPA 4LDQA 4MQEB 4RD1A 2Q1UA 2WSMA 4XDYA 3T8YA 3ZU2A 3LUFA 4RIFA 1RHJA 1XZFA 2GK4A 4K03A 1X77A 2VRCA 5LZ7A 4B44A 4Z51A 4KRYA 2JBAA 5DTIA 5EWJB 1OXUA 5B6PA 2IYQA 2G5PA 2OGWA 3AETB 2HADA 2WZBA 3LLVA 4TKLA 4RS3A 2AI2A 5FQNA 1TYAE 4RD0A 2EL9A 1GZVA 4AKEA 1O87A 3VU9B 5FA5A 5JYBA 1SNYA 3AUTA 1EB9A 3FNGA 4JL5A 1JWBB 3OZIA 3GWZA 4QHSA 3ZE0B 2I2DA 2BC9A 2QSUA 3KJNA 5I7FA 3QY9A 3I42A 2WJHA 4HLUC 4LDZA 1NP6A 1Z82A 3VYUB 4O1IA 4PPYA 4E46A 5LIPA 2IYRA 4BCCA 1QBGA 4ZD6A 4B9AA 4DZZA 2I54A 4MRAA 1W2HA 2GSWA 5SYMA 5E7IA 2OC4A 4PAWA 2VATA 1L4BA 3RYTC 3FMOB 1ZJJA 3UJCA 3COYA 4NCHA 3EGWA 1U8TA 2WQZA 2TYSB 1ZQ1A 4AMYA 3A11A 2PFSA 2I87A 4I1OA 2HLDD 3BGSA 3HKEB 2JGMA 3LP8A 3BRWA 4O2BA 1GARA 3ILHA 4R5HA 4R51A 5EMMA 4EKIA 1YI1A 2D2VA 5FPYA 2O07A 1Y8ZA 4UATA 4BQIA 3UMYA 3L8GA 4PWYA 1T34A 1WXGA 3K8QA 2CT8A 1UDAA 4MEBA 1QOZA 4AJNA 2BISA 4NRDA 5CH3A 5DLDA 5I45A 1ILWA 1PFYA 1QHHB 4NJEB 3D81A 1J22A 4BXOB 2GDJA 4XASA 3BGWA 1X7YB 2WAMA 3AY0A 4GPZA 4G5QA 2FSPA 3I9MA 3OKFA 2UU9B 2KW5A 4XSVA 5HUQA 4G4JA 3PNYA 2SKDA 4J9UE 4OSOA 5EPUA 1H05A 4QAJA 2R6JA 1DPGA 1Q92A 1XZLA 3I39X 2WVHA 2Y6UA 4AY4A 5IBCA 2JGJA 5DYIA 1FTYA 4DV5B 1JDZA 3L0CA 2W48A 2BBSA 1M2OB 3LC0A 4ND1A 4NWIA 4U7HA 4ER6A 1YZNA 1PK8A 5K99A 2JFPA 3MMPA 4V38A 3BWXA 2CWWA 1SHZA 2OK8A 5C7OO 1SG0A 1U98A 2YHAA 3JPWA 3INYA 4LHVA 4KOEC 4A0QA 4H7PA 2X5KO 2VP2A 1X7GA 1XDUA 2RAVA 5AW2A 2HJRA 1U6KA 2BMWA 2PS1A 5KTTA 2Q3EA 3MPOA 2PLWA 4GZLA 1IJKA 4G25A 4F85A 2HHLA 2QX7A 3EGXB 1AD2A 3SVTA 3KQUA 3HY3A 4UUAA 1MUUA 1DCFA 3OO1A 4Z9XA 4BFLA 2BKEA 1F0NA 1OI3A 2H0RA 2LD4A 5EIOA 4EHDA 1F2UB 4KRXA 1WIWA 3RUHA 3L3BA 4E3ZA 5HKBA 2V9ZA 1EA5A 1O0CA 3KKMA 2R1VB 4J1TA 5J2TF 4F11A 4LHEA 5BR4A 3ZCRA 2X7HA 3W6PA 2HR1A 4R1SA 2OXEA 2HBQA 3A32A 3N2KB 4ZPXA 4FS3A 1M83A 1OGIA 5FNZA 3RV3A 5BURA 2RHMA 3HG7A 2PLRA 1UZNA 1U28C 1X70A 3EXFB 4MZXA 3K9FC 2W6QA 3I1FA 3ITKA 3TGWA 2CVQA 3CINA 2AOWA 2C8LA 1L4FA 3ZGLA 1L7AA 1NSTA 2FG6C 4PFSA 5EZYB 4WCVA 3T1OA 4E4YA 3BG5A 2TMGA 3FGPA 4OAPA 4BVAA 2O05A 4E5VA 4P22A 3CSDA 3BK2A 2X2FA 1G2PA 2QRLA 3F9IA 3L0ZA 4MW4A 3OEHD 4ZT5A 5JJKA 3A1DA 1RLTA 3V8MA 1M7GA 2FLVA 3OQJA 2QZSA 1DPFA 2CUZA 3VR4H 3JRNA 2XW6A 3MTBA 2P0AA 5EAIA 2Y93A 4IVPA 5PNTA 2R7LA 4GX1A 1VJ5A 4KIGA 3UMJA 3PL1A 2XIQA 1ODSA 3TNLA 4NU8X 1EFRD 2E6KA 3ULKA 4L74A 1W35A 5ERGB 2XVAA 3GCGA 4BKMA 1H2FA 4CM8B 3BM5A 3H5VA 4LWQA 3IHWA 2AQHA 3DAGA 3EQ7A 4LCJA 4M36A 1GY8A 3MW8A 2YZKA 3KFVA 1QQTA 4I1VA 3DMFA 1X1TA 3H1GA 3H8WA 4UASA 1KZGB 4KYVA 1S9DA 4ZODA 1GNSA 4B4OA 4ILKA 4EY5A 2PZ8A 3K4PA 3HUDA 2D8MA 3NVKI 3I83A 3IAFA 1ZZGA 1GNTA 3E0XA 5BV8A 1CF9A 2GAOA 1I2DA 5A06A 2CXQA 4L5YA 4QQKA 1MX3A 3VO8A 4YR9A 1KAOA 1NW6A 5D3KA 1JR3D 3NHZA 4LDRA 4YI5A 3LWNA 1H4QA 1E7WA 1XZQA 5GAJA 3AJDA 1W5TA 2Q6OA 5I7EA 4RKYA 3K6SA 1G5PA 5EJ9A 4QODA 4X9XA 3E1SA 1XVTA 2FPLA 3E35A 4MITA 5EUQB 5H70A 1WBDA 2I4MA 2YW2A 4CMEC 3TQCA 1VZ2A 2HA0A 2JLZA 4ETWA 4L6AA 4S04A 5H3CA 1K63A 4MVYA 5KJ6A 4BVHA 3ENQA 1NFRA 2Z04A 4ZC8A 2HDHA 3VU0A 3MCZA 2QLJA 4UOEA 4FDLA 1QLWA 5KMGA 2G1PA 4L02A 3GFVA 1NBAA 3L04A 4JT4A 1V5EA 1D6MA 1U7WA 2X9LA 3IDAA 4PLTA 5FJIA 1EZ4A 1P1KA 1PL0A 4J0DA 2AKAB 3E5HA 2UKDA 2ZAGA 4BIMA 3FFTA 2I3GA 4KAFA 3PV0A 2Z2YA 3Q7QA 1HDZA 3RFCA 1QDEA 4YACA 5L45A 5DO9A 5LQMA 3DE2X 5AUNB 4X20A 1NRJB 2BP7B 2AMLA 2IDZA 1NIPA 3DZGA 2ZI4A 4K88A 3FMVA 4I1UA 4MQ4A 3RM3A 1QH0A 2R84A 1Z7EA 3O0DA 4NK5A 2IXBA 5B6JA 5LD2C 1D09A 1ULUA 1E0DA 2G76A 1FQWA 2QLFA 3JARA 3JQRA 4KGDA 4KUGA 4OJNA 3G5TA 1UK7A 3NWPA 4UXIA 1GRVA 2EKQA 3FVVA 5I8WA 3UN1A 1T91A 2Y71A 1QK4A 1SHLA 4TSFD 1KNXA 1DKOA 2YVQA 2YYSA 1COWD 2B1IA 1NVXQ 2VUTA 5DGHA 3ZJUA 1J5EB 2IHJA 4FJ1A 1KOFA 3PJFA 5EJMA 3UAZA 1TA0A 3RD5A 2PN1A 4A4DA 4ESEA 1I1QB 5BNZA 5KHLB 4OFXA 4AJJA 3HZZA 4UM8B 2AW3A 2P11A 4HH1A 5HEKA 1UMBB 5JSZB 1G8PA 4N54A 3G2KA 3C6ZA 1V26A 3JAKA 4CDRA 4YT8A 3RAEC 3KL4A 3WGHA 3SMVA 2H2GA 4G3XA 1FFXA 4FC6A 4UOQA 3CLRC 4DIMA 3PTAA 3GHYA 2AK2A 4H0CA 3BXGA 3NONA 4J3FA 4RUKA 3K1JA 4YV1A 1W36D 4PHTA 1E2GA 3P71T 3H11A 1BC5A 4KVAA 3ZX4A 3D31A 4ZI7F 2QYTA 1WMBA 3MCWA 3QEOA 2W2VA 2YJGA 4QHTA 3SLGA 5AVZA 3FUWA 5TT1A 1ZUNB 2V7BA 1YZFA 3IEKA 2FW8A 4G4IA 5GOTA 2AOTB 3ZDRA 5KYYA 2QRZA 2PH1A 4N0EA 2Q29A 5JPIA 5GIPE 3RRXA 4E4RA 3MHTA 3LY7A 4CPDA 1Y42X 5B1YA 4PRKA 5AJHA 1OTXA 1REQA 3GOQA 4E08A 1Z33A 2PH5A 3FYTA 4MW0A 4YCMA 4OLAA 3GC6A 2QDKA 5EJIA 1HYBA 1QZXA 3UOGA 1CF2O 1S1MA 4NBLA 2AUMA 2G0NA 4DE5A 3AR9A 4BFVA 3O2NA 3IOBA 3PFGA 5LWHA 2QAGB 4K9DA 4MB2A 2I2CA 2O2SA 1QFSA 4PX5A 3TKLA 4EK9A 3FHCB 4QXRA 1GPNA 3HUUA 4IUDS 1DXYA 1KGDA 1W9HA 5CFLA 1O54A 1C0KA 3ICOA 4WN9B 2AFHE 1KJWA 1QGYA 4PVCA 5K0EA 3HPRA 3AJEA 3GLHE 1CUIA 1MAAA 2B7CA 4LYHA 2IQ5A 2P2NA 1PJTA 5KWEA 2Z43A 4I66A 5H81A 1EK2A 3M1IA 3UPUA 2BZGA 3A1FA 4IAOA 4TXNA 1M2KA 4KPUA 3CT4A 3EK2A 2XVXA 3VPHA 3DJFA 2PWPA 1FLDA 4OI4A 5IANA 2BKVA 4XVQA 4X1KA 3RJTA 2YKGA 1MLDA 1OFVA 1SKYB 2P3QA 2P40A 4KWIA 3LDUA 1DMRA 1VBKA 2WIKA 5A3JA 4EFNA 2ZCJA 4MV0A 4NX2A 1VG9B 1MV8A 1W85A 1XTJA 4J1TC 1NVMB 4UHDA 1VG0B 1PGJA 2R0QC 2BEJA 5DNWA 1HXHA 2QM3A 5K0GA 5LN1A 1GDTA 3UWDA 3OO0A 2P6OA 4J9VA 1KDTA 4EQ6B 2CL0X 1XMOB 3P9PA 3ZGZA 3CX8A 4HDCA 3HU1A 2C92A 2CVHA 1GNLA 1NTOA 1Y8RB 2APJA 2XCSB 4P4SA 1KO5A 2OFOA 4XUCA 3SJBA 2VTBB 4GD3Q 5H7XA 4AMUA 4DAEA 2VDQB 2WFLB 3ILYA 2QI9C 1IQPA 2GN9A 1BW9A 3C85A 3F8SA 3K0KA 4JYAB 4N7JA 3HL0A 2C20A 2W2LD 1QSGA 2ZLBA 3L8DA 2CFOA 3K6RA 2WPDD 2XYGA 3W7AA 1DIAA 1IQRA 1SK9A 2WFAA 1JLLB 3BMOB 2PMKA 3JU3A 3VR4D 3W8FA 3ZWBA 1HQYE 4LWZA 4NCKA 1TU3A 4BGDA 3KCQA 2ZR9A 3TO5A 3U7QA 4KFTA 3I61A 3G9XA 2POQX 1JPVA 2V3WA 1JIVA 4WA8A 2B8JA 2LBPA 2Y0PA 1PLKA 3FWZA 3N9IA 4I50A 3U9LA 5AUQA 1NFQA 2V55B 4Z0NA 3L0YA 3E7WA 3M33A 4KXLA 1FSGA 1NJSA 3R0QA 1EHCA 3NP9A 2A5GA 2IYAA 2EQAA 2EAUA 1VP3A 3AUJB 4RHXA 4WKGA 1V4VA 3H2IA 3FDFA 5IHPA 3NYIA 2FQ1A 1XVLA 1NXWA 2GTHA 1QAQA 1MG0A 5FOVA 2ZJ2A 2R1UA 1FUEA 3B7WA 5LQJA 2OEPA 1DRWA 3C5WP 1IHPA 4NFYA 3SNKA 4OJMX 1P8JA 4YNBA 3UMGA 5JC1A 1UDWA 5JH7B 1UR5A 2GPYA 3PR3A 1IH8A 4RBNA 2RGCA 3V7NA 4V3BA 1II8A 1QE0A 2HDWA 4G5XA 4GLJA