4BU1A

Crystal structure of rad4 brct1,2 in complex with a crb2 phosphopeptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
182
structure length
179
Chain Sequence
SKPLKGFVICCTSIDLKQRTEISTKATKLGAAYRSDFTKDVTHLIAGDFDTPKYKFAAKSRPDIKIMSSEWIPVLYESWVQGEDLLLVDKHLLPTLFKCRVCLTNIGQPERSRIENYVLKHGGTFCPDLTRDVTHLIAGTSSGRKYEYALKWKINVVCVEWLWQSIQRNAVLEPQYFQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-M CHECKPOINT CONTROL PROTEIN RAD4
publication title Phosphorylation-Dependent Assembly and Coordination of the DNA Damage Checkpoint Apparatus by Rad4(Topbp1.).
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Replication
total genus 63
structure length 179
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
A PF12738 PTCB-BRCT twin BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4bu1A01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4bu1A02
1T2UA 2WT8A 2ADOA 3UENA 2COUA 2NTEA 4BU0A 2HTFA 3AL3A 3PC6A 3EF0A 1L0BA 3PXBA 4IGKA 2INGX 3KTFA 2XNHA 3SHVA 3T7JA 3PC8C 1IN1A 3I0MA 3PC7A 1N5OX 2JW5A 2EBUA 3HUFA 2L42A 3OLCX 3K05A 2K7FA 3U3ZA 3PXAA 3UEOA 3K15A 3EF1A 3JVEA 4U4AA 4JLUA 2DUNA 4BMCA 2D8MA 3QVGA 3SQDA 3K0KA 2XNKA 4XPZA 3PC8A 4XQ0A 3PXCX 3PA6A 2LE0A 1T2VA 1T29A 3K0HA 5ECGC 3T7KA 4IFIA 4ID3A 1KZYC 3SHTA 2VXCA 2R1ZA 3L46A 4Y18A 3PD7A 1CDZA 1Z56C 4BU1A 2E2WA 2EP8A 4N40A 2K6GA 3PXDA 2COEA 1JNXX 2ETXA 1L7BA 1WF6A 3FA2A 4BMDA 3T1NA 3T7IA 2M2IA 1GZHB 3L41A 3II6X 3AL2A 1OQAA 3COJA 2VXBA 1T15A 2COKA 3L40A 3PXEA 3I0NA 3K16A 4OFBA 3SZMA 3QVGB 1IMOA 1Y98A 4Y2GA 2EBWA 3HUEA 2AZMA
chains in the Genus database with same CATH superfamily
1JYEA 3AQIA 4TMZA 4WVFA 5A3VA 4S24A 1NC1A 3REQB 2DFDA 1K5GA 3H9QA 2A0YA 5A9TA 2X2FA 2Z1NA 1H1LB 3IOYA 3TVTA 3VHQA 4FFDA 1R0ZA 3ZK9A 1Z07A 4P5EA 1WTCA 2GN0A 1IAVA 3VJLA 5IDWA 3U13A 3JU3A 2GJSA 4W1PA 4EGAA 1RQ7A 1PLJA 3RJZA 4E1BA 1L0BA 3ABQB 1WQ4A 2W6JD 1XI2A 1R4NB 3EDRA 3JWJA 4QXRA 4ZVQA 3ZE2B 5DGTA 2Y2VA 4D8UA 2Q6VA 2QKYA 4QATA 4IKPA 3VBEA 3FCUB 4G56A 2Q28A 2PBFA 1IOLA 3ASVA 3DEAA 3E9QA 4X8HA 1U3DA 1DOAA 1TJ5A 2PSDA 3SFVA 3EFHA 4MV5A 4P7KA 4J07A 2YMQA 3EARA 3UKDA 3ZLTA 2WUWE 4HNQA 1BA2A 4HFRA 2O7VA 1A4RA 3GFBA 5EKXA 3UCXA 2HQOA 4QQKA 1DEOA 4B75A 1L8OA 4JVNA 5CT8A 2POCA 2Y1XA 3G3EA 3UWMA 1QJ4A 2Q0QA 5FPYA 1E0DA 3K1AA 4UBOA 3B1JA 2Y0PA 3GRUA 4MV6A 1L5YA 4YMWA 2BM0A 4HUQB 3HV0A 5D2CA 2X22A 4YT4A 3IIKA 1LDYA 3HCFA 3HGMA 2L69A 1YB2A 2B4YA 3GARA 3NWBA 2FRXA 4US0R 3V33A 1IHXA 3QPCA 4ARCA 1EFAA 1JIJA 3PC8A 1R0KA 2QNBA 3T41A 5HZMA 3CLUC 1PO7A 1RWXA 3CMCO 1GFWA 4DG5A 3IT3A 2IEGA 3SXJA 3FUUA 2Q7DA 4RH0A 3L8MA 1MDFA 2YHIB 4KLZA 3L8HA 3R7WB 4KRYA 3RKUA 2ZREA 2ACWA 4EW6A 4M53A 2RGCA 2V8OA 3TZ6A 2NXWA 3ISJA 4DG9A 4BAUA 5A6VA 1YFJA 4DMLA 2GXAA 2R79A 2QTVA 3QVTA 1XIVA 1J5PA 1N4DA 1IN8A 4PAGA 3G1WA 4UCQA 3RB8A 4I4IA 3P9YA 4S1WA 4HK4A 3ROMA 3T0IA 4B3TB 4JJ6A 2DT8A 1A8QA 1Y3IA 4KYUA 3OAAA 1Q15A 3GCZA 4O0LA 4WZ6A 4LY3A 5JAZA 4XWGA 1HEUA 1VJDA 4A03A 4D6YA 3IPAA 3KVVA 1QRAA 1XLUA 4P3NA 4U1RA 3LVFO 2P2DA 1DC8A 5HS4A 3ZK8A 4AD8A 4PG6A 5B7NA 4F45A 3SSAA 5KYTA 5F2EA 5FQOA 1XZHA 1VIMA 1V25A 2JFFA 3JARA 4RKYA 2C2YA 4BPBA 3HQ4O 1RQ2A 1D1TA 4XIGS 3BH0A 3BQMB 2H2GA 1M6VA 2V6MA 4UTPA 3MD9A 1NBEA 3CPJB 3IUQA 1NWHA 3V4OA 2WT4A 3VR4H 1I51A 4PHCA 1IY0A 2G80A 4GI3A 1XMVA 1F1BA 2WMNB 5EHGA 1U0OC 3RJ5A 4ZTUB 3VJRA 1J0BA 1HE3A 1QIJA 5FXMA 4RA9A 4RYDA 3UHAA 3IJ5A 3UAOA 4XM2A 4D3XA 4YJFB 5EJ4A 2DTXA 2I3AA 1TMKA 3ACDA 2IEDA 1CJSA 3MB5A 2WDZA 1TYAE 4RHYA 3IERA 1PWZA 1QFMA 5JT1A 3EF3A 2F3TA 4FI3F 3EG9B 1XF1A 2J9FA 1VJ5A 4DANA 3AVTA 4U2FA 2AUMA 1GTG1 1ZCFA 3RHFA 2FK7A 4Y1EA 4EYSA 1I32A 4WLVA 3VU9B 3G8CA 1R1DA 3H2KA 4X97A 3KD3A 1W88A 4L8YA 3E58A 3HR8A 4R9UC 4EUEA 3HPQA 3CNEA 4EHIA 4CMEC 5JAOA 3A0RB 2HA0A 1MOQA 3OY7A 4ND4A 1G7TA 1EGVB 5KQRA 2WWWA 4JLBA 4WCVA 1XXLA 3IBGA 1LJ8A 2VDLB 3P2MA 4ETNA 1ZMTA 4ZAVA 3ELDA 1TA0A 4DW8A 3RS4A 5KQMA 1PJZA 3HEMA 4DUGA 1S0UA 1N1MA 2A9KA 2SKDA 3MLBA 3QVVA 2WHPA 4L73A 3CNNA 3WNZA 1ISPA 5ARDA 2BFNA 2IE8A 3TTWA 3RFUA 3W6PA 1P80A 3SC6A 2FPPA 3E2PA 3Q3VA 4ZOLA 4BQQA 4DMMA 2R48A 1VL2A 1Z08A 3T61A 4NYIR 1YA6A 1W5AA 1ECLA 3Q10A 2VH2A 1W96A 1OTHA 1TW3A 3DNPA 2ORWA 3K1TA 1ISFA 3N2IA 1C9NA 1P9OA 4LSMA 3W4JA 5AVYA 3ANYB 3QVUA 2QN7A 2EX1A 3H8JA 4RVGA 4KN6A 5TPZA 4BZXA 2IH4A 5AVJA 1Z68A 3H5LA 4RVDA 3WRWA 4CCYB 4YRGA 1J8QA 1E20A 4Z0HO 5B5SA 5AUPB 1L4GA 5A7FA 2AS0A 1CG6A 3IQFA 4NBKA 5KWEA 1FCJA 3GJ4A 2FW1A 3BFJA 4I4NA 4WMLA 4TXHA 5B53A 1OASA 3LDGA 4RF4A 3BIWA 3WJ7A 2BR5A 2JPDA 3A14A 1F3LA 3BUSA 2G1KA 3DYVA 1I6MA 4GWGA 5AVTA 2QRPA 3D1JA 1NASA 1FBTA 3H1PA 4G0MA 1B43A 4IVPA 4V03A 3A4NA 1C0KA 3LPMA 4CIWA 5FCDA 2HA5A 4G1MB 1XUOA 3CEPB 2WAMA 2BYTA 3T7TA 1LFAA 3L9XA 2NSYA 4M1YA 3EGEA 2PL1A 2VQ6A 2GEKA 3BA6A 5BN3A 3BTSA 1S3FA 2PNJA 2EARA 5EEGA 5CEJA 4QO8A 1P2UA 1DDGA 1RHRA 3ZXXA 5D51S 1Q7TA 2LKCA 2HRRA 4HF7A 4BBAA 5IN4A 2K6GA 1K88A 5E1OA 2HQSA 1MPTA 3F49S 5IK2D 3CY6A 1ZUHA 1TYZA 1MJ5A 2I4LA 2Q5HA 2JZNA 3JASA 5E6UB 3V6LA 3WTBA 1MO3A 3QWBA 1SC6A 1Y7TA 2QY9A 3O7WA 4RPHA 3DMDA 1PFGA 3F8TA 3AU8A 2X0IA 3CJRA 1VRVA 1SD5A 5HKBA 1RKVA 4RGQA 4K9DA 3FPLA 4QGHA 3FSEA 4AF7A 4FEAA 1MOSA 1F2UB 2JIMA 4Z6KA 3RC9A 1AG9A 4MMXB 5BQXA 3Q2KA 4EYQA 2RAFA 1Q3HA 3Q8MA 4Z4EA 1ORIA 2EJCA 4ZT7A 1UEXC 3KKPA 4J0FA 3ZCVA 4I55F 3D8HA 3OFNA 1P5HA 3CRW1 1YC5A 4Y8VA 2BAGA 3KOMA 2R1UA 4URZR 3VC1A 2AFHA 3EZFA 5BP7A 4LOLA 3VPFA 1T91A 4TSKA 1YUMA 2E48A 3PPVA 1QVVA 1XQ1A 2BMEA 3E7DA 3NGMA 1SQ5A 4OXRA 4PQRA 3NBKA 1LTKA 1NBMD 2W2KB 3K6KA 1JEEA 3KZ1E 2CWWA 3PGA1 2FVXA 1L3IA 1AXRA 1FU8A 4JT2A 3V2HA 4S04A 2I5PO 5KQLA 3UBTA 3P0EA 1N2XA 4W5TA 3OT4A 3SX2A 4DR6B 2VEDA 5ALIA 4HQ6A 4WAUA 4QOJA 5AM1A 1HH4A 5JSHA 3S29A 4YLEA 1DAEA 2D0IA 3C16C 4FBGA 2QA5A 4MV9A 5IPFA 3SFTA 1G1AA 1LBHA 3W5UA 1ADGA 2BGLA 1D6MA 1MW8X 2GT1A 3F7OA 4L0DA 4ARZB 3G1UA 2VSQA 5HR5A 3NIBA 5HIIA 3U3MA 3E3AA 1EG2A 1SVWA 5JYEA 1KE1A 2R7NA 5TQ0B 4EYKA 1SBTA 1K63A 3IQDB 1P2VA 2W42A 3LY8A 5KC9A 1FVFA 1TIKA 3LQQA 5GZ6A 2EX4A 1EVLA 3V34A 4H9GA 3SBXA 5JWOA 1PEKE 1NBOA 1T36A 1FDRA 2X8AA 2D8MA 3O75A 4X60A 2GWHA 1XTKA 3NR2A 5GTDA 4XGNA 3GNTA 2B20A 3K0KA 3A4TA 3ZG6A 2NG1A 2CWDA 4HH4A 5COQA 3CF4G 1E1NA 5EQFA 4FGZA 1U1FA 1NUHA 2CNDA 3L4JA 1E9BA 5AHOA 2R6AA 4ALIA 4N54A 3EXEA 2HSGA 2OFFA 1ONBA 3UF0A 3WGJA 1VKJA 3ZH2A 5AW0A 1N0WA 2I4NA 5A4AA 5HRUA 4F7DA 2J67A 2JARA 2NO6A 2BSAA 3IUYA 4J0QA 4H17A 1ZSVA 4JWKA 4BLPA 3ZCSA 3BDAA 1V35A 4YXFA 2HFKA 3MTJA 1SN7A 1VXOA 5C18A 2BEKA 2G8LA 4RSGA 1QHNA 3PGMA 4X3OA 1R3UA 1PJ4A 5HDQA 3VFDA 2X7XA 3UO8B 3TMYA 1NI4A 3DE7X 2AJDA 4CQMB 1YU6A 1VPWA 3UB3A 4Z49A 1PNVA 2X4GA 1ZGJA 5C1OA 1I0ZA 1IULA 4BFUA 3ISVA 3Q2IA 4KR2A 3CUTA 2O2XA 4WX2B 1G2PA 2EL9A 1R4MB 1XHLA 1WDTA 4OFZA 3TW6A 4CXMA 1XBTA 1AK2A 1O08A 1XB2A 4QUKA 4TTJA 2PU7A 5D87A 5H02A 2VJLA 1A98A 2ZU6A 2QZPA 3NCTA 4BTVA 2A2ZA 4CM8B 5B57C 2PQ6A 1RZVA 1FNSA 1E6WA 1NAHA 4CMHA 1CEYA 3N53A 4MROA 4OI4A 5BN5A 5IAEA 2QR2A 1KYVA 1EEXB 1FFXA 4XUCA 1Z0KA 2F8LA 3L6EA 2AN5A 3WGNA 2XXAA 1G20A 4H3HB 3KHTA 1RKBA 2JGEA 1SCKA 4J3NA 1I4LD 2IOYA 1P19A 4HXGA 2RH9B 3I37X 4YIHA 1GKKA 2WRZA 3ILXA 1YR7A 4CKCA 2OM6A 4FW8A 2M9MA 1TEHA 3H2IA 1EKXA 1XQ6A 2HB6A 3PQDA 4OKIA 3A1SA 1N6KA 1WIWA 5CHEA 2C77A 3UMYA 2FVYA 4Q4JB 5EXPA 5I7FA 1X86B 3BMQB 5B6PA 5G0WA 3PUIA 3OTOB 4D9GA 1Z37A 2CEKA 2AWNA 2IF0A 1DUIA 5JC1A 4ER7A 2CFSA 2FPUA 2W37A 3DCIA 1CY6A 3S8YA 4E4TA 4FB4A 1ADJA 3TSCA 4GR9A 1I9CA 1S3SA 1KGDA 2OCKA 3GUVA 1YVEI 5DI3A 4ZDWA 4NULA 1PBNA 2A94A 3F7MA 1BVYF 2REQB 4XDGA 1JIKA 3CB4A 1MOPA 5TVKA 1HMPA 1E3JA 2YYAA 3H86A 2X4DA 2E4UA 1UBEA 3ENKA 5F52A 2R6JA 2YJTD 3NIWA 2YS6A 3KKOA 3EZ2A 1UINA 3KV3O 4Z9BA 1W2WB 2I2FA 3BJMA 1SY7A 1XEFA 3QEMB 4KVGA 4N8EA 9ATCA 3OIGA 5JJBA 1DIOB 4JHXA 3K15A 3EF1A 5I7HA 3ZX5A 1NR7A 1M0EA 3KYCB 1L8XA 4OHWA 3SC4A 2VCHA 4OJMX 2Z9CA 4KFCA 4ZU1X 4AURA 2D2FA 3MRXA 4QAQA 2XT0A 4EQZA 2IXAA 5T8KC 1VE5A 1UBCA 2NPOA 5SZHB 3AJ9A 5JD3A 3QXJA 3G7NA 3G7UA 4DMUB 3FVVA 4UOEA 1JR4A 1V71A 5CTJA 2B7LA 4FLFA 5E7MA 3CG4A 3L5OA 5DMHA 1S1MA 2C2MA 1XZEA 1Y5IA 3IP1A 2QX9A 1GAEO 3ANLA 3DV0A 5ECGC 1ZNYA 2O2DA 3HGTA 4HZUA 4IV0A 4CUKA 5K8VA 4RE5A 1VMDA 4YP1A 3FF4A 3GLGE 3EIQA 1KJIA 3KLBA 2DY0A 3DVRX 2ILTA 3QWIA 5HTKA 1XJ5A 3SF8A 1GNQA 3KOZA 3ZNQA 5A9SB 3GDGA 1RVV1 1TJ4A 1CNEA 1JEDA 1P9RA 2AK3A 2FRDC 2OBFA 3B9PA 3DE0X 4CJXA 2I55A 1TADA 2B1RA 1RAGA 3ZWYA 5B7GA 4GM1A 2LUOA 1FS6A 2V98A 4CU5A 1I30A 1LSUA 3P7MA 1HLGA 1A77A 1CUUA 3D7RA 2I8AA 2NUBA 2FQYA 1E96A 2FEMA 1MJFA 1J97A 2VDNB 2BV3A 3HS3A 1F8UA 4UZEA 5EQDA 2QN1A 3WRYC 4B74A 4ZYTA 5I8PA 5KYWB 1F4PA 4HQOA 4LHEA 4G4SP 4AZSA 3I6MA 1V9SA 4P7BA 2Z30A 1NJSA 3FPEA 3MAGA 2PUWA 3SBDA 4DCSA 4WXMA 3CFYA 4DWWA 1D3AA 5IUNC 3QVSA 3N58A 4UE6A 5HIMA 5ALUA 5LMUB 1T4MA 2YQ4A 1CIVA 4Y2VA 3ZUGA 4EO4A 3L04A 4GL4A 5TGDA 4O3MA 3CUKA 3G2HA 2WHXA 2YIJA 4XGIA 5JYCA 1ZZGA 5LYJA 1ZI6A 4I08A 3K0AA 4MW6A 3U26A 1S2DA 1SD1A 5DRTA 1P73A 2ZPAA 3Q87B 4DXHA 1C1DA 2VP0A 2ZK7A 4Q37A 2IOFK 3LBHA 5J2UF 2MWMA 2AZMA 2LPMA 2XMRA 4HNAA 1D1SA 3DAOA 5AJTA 5F4BA 2OO3A 1U9JA 2EKBA 3AHHA 3WLPA 4BMXA 1CYDA 3MTGA 3GGCA 1GTJ1 2YQ5A 5COAA 2E1PA 2R47A 5C51B 3T7DA 1TUEA 3OZWA 5CPBA 4BMPB 1DQNA 3ED5A 3SYLA 3JAWA 1X8KA 2R7KA 2B25A 2D2IA 2PXHA 3AINA 3W9YA 3OM0A 4UBMA 2PO5A 1WB9A 3AXTA 3Q3GE 2VJMA 2HZBA 3DFZA 1L4MA 3TLGA 3NORA 5HOQA 1L7MA 4FOPA 2J4CA 4J1NA 1DIHA 5DASA 4ID9A 1KWGA 3MIZA 4L4XA 1JHQA 5D1NA 5JS8A 4KDRA 2GZSA 5H4GA 5LZ9A 3EXHC 3DD1A 3HEAA 5DPMA 1NJ1A 1R8XA 5KYKA 2QF7A 2NTYC 2VAVA 5FWYB 1YR8A 3OZDA 5K3DA 1XTZA 2B9VA 4H7JA 2WSYB 4NMHA 2A88A 2Q49A 4RDCA 5C9ZA 1TPZA 1B8NA 4V2IA 5ALFA 3QPBA 3ICQB 4ZCTA 3ZHOA 4QLBA 2V4UA 1XZLA 4YH1A 1H1TA 4XYGA 1GPDG 5FOTA 3RRZA 1SHLA 1R0WA 3NPAA 1NP3A 4G8JA 2HMVA 5E0KB 2QX7A 5EUQB 1OV6A 2WUEA 2VNHA 4KXNA 5CJJA 1L5GB 4G2NA 3DVSX 4G8DA 2KMLA 2OAP1 4OJTA 1CE8A 4PNHA 1B23P 1M8KA 2B2NA 3M1YA 1VSQA 3LFUA 1XOIA 1ORWA 4US2R 4DQDA 3QX9A 3UMBA 4H3KB 4DR4B 2QAGC 1FZQA 1W29A 5ENZA 3Q85A 3WICA 4BB9A 4BTLA 4Q9NA 1JG6A 4KMSA 5FPTA 5IT5A 3ECCA 5G4KB 1SXIA 4B80A 3I92A 2R00A 2XTMA 1V6AA 4KWTA 3TUZC 4OMFG 1RBYA 2O0MA 2I3ZA 4P80A 1P2DA 4UDNA 4E22A 3VGPA 5JDIC 3REGA 1VKRA 1UC5B 3W4KA 1VYTA 4N7BA 5EE0A 3EEIA 3OJXA 4J0CA 5JSUA 1GZ6A 1V8OA 2QRUA 1DC5A 4K6MA 4BPRA 4C76A 5LKAA 1PW5A 1T6XA 5LLTA 3BH6A 2J48A 4W5HA 1L7AA 1QS0A 1X70A 2JGNA 5FTJA 2A0XA 4DCNA 4ZDKA 1E2NA 1ZLYA 2X2OA 5DOVA 4LF7B 3ABRB 1M0TA 4M7PA 1USWA 4P35A 2OQIA 3BBPA 1CUJA 3R7LA 1T2CA 2EBHX 3A9TA 2FP3A 3SNHA 4N5MA 1QMPA 1HMYA 2Q4DA 3OTHA 4ER5A 1M6WA 3T7IA 1EG7A 1PZMA 1R0RE 3R8CA 4FW9A 5EHNA 2MSCB 1IXRC 1SB9A 2I66A 4NMLA 3BTVA 4GSLA 1GRCA 2CVQA 3LPNA 3R0QA 5LA6A 4CEHB 1N9GA 1RWWA 3G89A 1XU7A 3P9QA 3FKSD 9GPBA 2WKPA 4LGYA 2I2AA 3DO5A 4AULA 5F3WB 4UASA 2B3TA 1ZJWA 5KSOA 4RJJA 3WIBA 3N5KA 1QG4A 2FMIA 1KGSA 2NAPA 2B78A 4MLDA 4AJOA 4UREA 5CT5A 4Q7KA 4ZAXA 5M3BA 2VHQA 3VPGA 3SQMA 4L3VA 5KWIA 1RJFA 4OMCA 2ANCA 2VJBA 4LX0A 3AJEA 5LP6A 1DJOA 2A7QA 3VPSA 1P75A 4C21A 3BQNB 3ZHYA 3BJZA 3E5HA 1NYTA 1HLDA 1LPNA 1P5FA 4B71A 4DQLA 1WF3A 4ERNA 4P4NA 2V7TA 1KOLA 1VCOA 2NTEA 4IUYA 1JNYA 1N0HA 3GA5A 3KYBA 3QWHA 3ZVRA 2BGJA 4GMGA 4FYXA 5JYBA 4PX2A 3L0OA 2HTFA 3GMSA 3MOGA 1IFXA 2FSFA 2GN9A 3OTGA 1BHJA 4NMWA 5FOVA 3RAJA 3TECE 3OF5A 4IGAA 4PRKA 1ODLA 4H7DA 3ABSB 1N6HA 1C29B 5DM0A 4CKBB 4X62B 1FOEB 3IDOA 5A9RA 2XKBA 4LW8A 1X1EA 1K89A 3GK3A 1GUYA 3G5AA 2IYEA 1VSTA 4HEQA 1A0OA 2HBRA 2XUGA 5C32A 3AJDA 4OQMA 4Q9KA 3TBKA 5TB5A 1DT3A 2PH7A 1EFRA 4OB6A 1E2HA 3LT1A 3MPUA 3AOGA 3PJFA 3GGSA 4KGXA 1D2RA 3GT4A 2J8ZA 1ZIDA 3DSRA 4QX6A 5L4SA 3P9CA 3FVWA 2DYKA 2FJPA 1HG0A 3UK7A 4M8NE 2GF0A 4MYCA 1TJYA 4MS4B 5KVSA 4NCXA 1YZUA 5DVZA 1THMA 1KZ7B 3RHZA 3WAKA 1SBYA 2GASA 2A1IA 2FW7A 2C83A 4BO6A 3WV5A 1A5AB 1F4LA 2YZKA 4EUSA 3UUGA 4FCCA 4H1VA 4X6XA 1GR1A 1OB2A 1VYUA 3DWFA 3LI2A 3R77A 2ZR0A 5CU7A 1LGYA 1JALA 1YS1X 3CVJA 2J31A 1ZRHA 3G2IA 1IB0A 1XTPA 1EJ6A 1XEWX 2JA2A 2MIIA 3HB5X 2NUTA 3RFFA 1SWVA 1WUIS 2HY7A 4KQKA 5FUYA 1TM1E 1NVUQ 2VPYA 5BT9A 2BDUA 4TMYA 2MSLA 2BH9A 4D9CA 2EJTA 4AM8A 4BKPA 2R4TA 1UM9A 2OZPA 4R1PA 2W2TA 2ZRIA 3WJAA 4F72A 1HA3A 4KIUA 4HYYA 5FD8A 4FP9A 5LDGA 1QAOA 3H8WA 4U2KA 1F2DA 3DO8A 1KKUA 4DNFA 4ZI3A 2E3JA 3N6RA 5LYYA 5J1TB 5EA2A 3B3FA 5FI0B 2IGBA 2PL5A 4HB2A 3L0BA 4LGMA 5FWDA 4C2BA 2H1HA 3F6BX 2G28A 3QI2A 5IDQA 3GJ5A 1AB6A 2Z5GA 1BEUB 1MV8A 3HA3A 3LW8A 3PFWO 5KYXA 3K1JA 4HQFA 1FDOA 3WHKA 1L4HA 1QV6A 2VHEA 1PFYA 4I5FA 1EBUA 4GO1A 4MRMA 3VUFA 1QGOA 4JLJA 4B33A 2ODPA 1ZJ5A 1VLMA 2X5XA 3D4NA 1N0UA 4DSAA 2E4XA 2A33A 3NGLA 2BKAA 4DDWA 3KO8A 1X3SA 2WG0A 3COJA 1J7KA 4MHTA 1OBHA 1NW3A 3EFOA 1EFCA 1UBNA 5E1DA 3PR3A 2BUCA 4U0KA 5FBKA 4B43A 1AKRA 3IEMA 4XKJA 3K16A 1C2YA 2I2CA 2QE6A 3B9RA 3GLHE 3BHJA 4OHVA 1TEZA 2WU3A 5IASA 3OQIB 3PWTA 4QC2A 1WV0A 4JEMA 4OLFA 4UHHA 3WYFA 4BNMA 4Y2GA 1ULHA 4MGEA 5K51A 1TU0A 4ZI7F 4NYJQ 3OOYA 3HJGA 2DHDA 3FNHA 3IUNA 1M2OA 1GG5A 2N0SA 3SKXA 2H8GA 1R2QA 3EBOA 3U56A 2F00A 3QP9A 2RGWA 4F4UA 3ZDCA 3O2JA 4TLDA 1KC1A 2J3HA 2QV7A 3SG0A 4HGQA 1B8OA 4TT3D 3RS3A 2R8YA 4BQSA 5HMLA 3VU3A 4UXIA 2XT6A 5K45A 3U40A 2P2NA 2CVPA 4YJ3A 2JLVA 1C50A 4TS4A 4X3CA 3H5IA 1B1CA 2Q2OA 4X7BA 5AUOB 2Q50A 1SKMA 1KI2A 3PDHA 5C1IA 2GVZC 4RY8A 3LT0A 4W1SA 2MYUA 2WVHA 3N0VA 1OXKB 2YOGA 3WRVA 4CZ2A 2VYND 3WGUA 4D26A 1BX3A 1ZM4A 3O26A 2X1VA 4TVBA 2RKBA 4KU4A 4ZOEA 3N0RA 3W2GA 1V1RB 3C8MA 4N82A 4LHZA 3FPCA 3QU4A 4GOMD 1DX9A 1E4OA 2CJXA 3IEUA 3M6LA 3NIFB 3G5LA 4RY2A 5JV5A 4DY4A 2AI3A 5ELMA 1E1KA 5I4KA 3SBEA 4MCAA 3K70B 1M7BA 3A1NA 2HHJA 4G5OA 1WQ3A 3GU3A 5JTUA 1U0JA 6ABPA 1V43A 3TZLA 1VE3A 2ZP1A 1GL3A 5LC1A 5C8YF 5AXDA 4MWDA 3CONA 5KYYA 5JR3A 1UPAA 3N7AA 1ECGA 1IN5A 2PUFA 1I3MA 4NBUA 3VO2A 3EX7C 1IUOA 4G8BA 1DO2A 1Q3TA 4C78A 3PRHA 2PZ8A 2H9AA 4TL9A 5AMXA 1SHTX 1O6BA 5FWXA 3BCUA 3S1AA 3KP1A 1DWUA 2F3QA 2I03A 4FT2A 3ZOKA 4WXHA 4QGFA 2C2BA 1MFZA 3BXZA 5D5QA 4ER6A 3NXKA 2AA3A 1K7XB 4R9NA 1M1YA 3AIMA 5AOBA 1CR2A 3VH1A 3TGPA 3ITKA 1PR5A 3ETDA 3NHLA 2CCJA 4PYKA 5JAMA 5KNCA 3AY3A 5I01A 1NMYA 1YB5A 1NWCA 1TTQB 2JFOA 5ILQA 1GPBA 5ETJA 1SC3A 2PMKA 4KAXA 4UNRA 5B6JA 5BR7A 4CDNA 3ZE1B 3K9WA 2GPNA 3O74A 4NFYA 2ZJFA 3TZEA 3EDOA 4J7UA 1NJ8A 1JNXX 1VZ2A 3OH8A 1PEDA 4TTQA 1MR3F 4PHHA 5IVPA 3EWSA 1UP6A 3GPBA 1P4GA 4NWIA 1YR3A 2BHTA 4XWKA 2OCXA 3BHMA 3CHYA 3EAFA 3NM4A 2VPIA 3D31A 3BD7A 4D98A 4GOLD 1BXGA 2GHQA 1WXWA 4QBHA 4DLKA 3MZ0A 1XC7A 1Z4LA 3BDVA 4KIFA 3LWBA 4AY2A 3S6JA 5JYDA 1IZ7A 1EJ0A 3PQ8A 3R1IA 3MUNA 5C8DA 3HY4A 1E79D 1XEWY 4J1TA 3OE7A 3F6CA 3E27A 1PI3A 2JC3A 2JLXA 1DFHA 4CCAA 2IHYA 1L6RA 3INGA 1PT6A 3WMEA 1WVIA 3GPDG 3KEFA 5E7IA 1NRXA 5DSTA 2I6QA 2QVGA 3O8LA 4F3KA 1WXEA 2BN4A 5TQJA 3CUVA 3CKLA 4WUVA 1DCMA 3ROZA 3TL3A 1CUAA 5BNTA 1P9NA 4HD8A 3ZGLA 1SXJC 5BVGB 1G8MA 1PX0A 1ENPA 2F17A 1ZH6A 1CUXA 1ZN7A 3CINA 4C88A 2YQZA 2HMWA 5I47A 2I87A 2PQ2A 4PXAA 5CW2A 2SNIE 5DDIP 3TVYA 1FS5A 1CY8A 2F9MA 4G8CA 4Q3NA 4AJEA 3RUIA 5IJ9B 3GROA 3TAXA 4YEDA 1JHRA 3T3GA 3U4IA 2XCLA 1M2KA 4TSFD 2GJ4A 4LKRA 1IBRA 5KC8A 2MSNA 1YS9A 1QRRA 2ZYDA 4L6IA 2ZT7A 5T3YA 2P2LA 2OMEA 3G2LA 3WWZA 3BFVA 4YRBA 4JVOA 1CB7A 4YV7A 2Q3CA 2PZLA 2VZ0A 3H65A 3TX6A 1B4DA 5LN1A 1QQ5A 1W48A 2IUSA 3F4LA 5CJPA 4EATA 2HH9A 4IQ8A 1DCFA 2Q5EA 1JKXA 1FJGB 3MTDA 2H29A 4MVJP 4I7EA 1W581 1CDOA 3S99A 2JIZA 2MCFA 4IH1A 3AYZB 3C48A 1PR6A 1KH2A 1H2ZA 4RLQA 5IKPA 1H6AA 3FKQA 1VHJA 1X80B 1LEHA 3N2NA 2UXDB 1REQA 4BBJA 2LTAA 3K5IA 4HLQB 5CXQA 1AUVA 1S02A 2OZLB 5ALNA 3RRBA 5DM70 4ABTA 4NZNA 1OIWA 4CQLB 3C7KA 3GDOA 1IQ0A 2ORVA 3T7RA 4NJOA 4JN6B 2J45A 3GRYA 3V4FA 1F7UA 1C3JA 1AS3A 3VU0A 3SK0A 5GJCA 3RNOA 1QB8A 2D1RA 4JQOA 3EZGA 4NCAA 5GAJA 1G6HA 2ZE7A 1JT2A 5D01A 1VFNA 1GKYA 4DM3A 4JBNA 2V7QA 1UC8A 4MAAA 3UWKA 4TN5A 2UUCB 3PNVA 2PMFA 3PZRA 3ODGA 4LGCA 3UHOA 3PQ2A 2ZSIA 2DKNA 3L84A 3ZKAA 3TIFA 1ELOA 1PNTA 2FG5A 3O8BA 1S2NA 4YJFA 1OLSB 5EJ9A 1GAWA 4IG9A 3TF5A 3WA7A 1WZIA 1TIBA 1G291 1UP4A 2DQSA 4TYPA 2C0PA 5AW6A 4M9CA 2NQTA 1EGMB 1GZHB 3EQ9A 2O2ZA 4MS3A 4NNOA 4UU7A 2ZBUA 4GGPA 3WL5A 5IS2A 5JCXA 4JIMA 1VKHA 1Z7EA 2VJAA 3ZC3A 4MQEA 4NFSA 1CQPA 1X77A 3D0KA 1QIMA 2O8CA 2FXIA 3KYJB 3LA6A 1G38A 5G0TA 1O96A 3DOIA 4NYIQ 3ACBA 1XTVA 5FRDA 2IA5A 2YDYA 3HJAA 2YVLA 2IS1A 4HAIA 1ZNWA 4CN8A 4XWYA 1KVQA 1UZMA 3Q1KA 1YB7A 3ANTA 2FY8A 2OCPA 4OHOA 1GP2A 1KFEB 3BFPA 4Y2XA 2BMVA 5DZSA 5CDYA 4U9HS 5GV8A 3OQNA 1A1SA 5CFZA 2OP1A 1RIFA 1U02A 4I50A 4P32A 5JS7A 2ZT6A 3T5GA 4BWGA 3E8MA 2NW6A 3FDZB 4OL9A 4B4UA 1G3MA 3C8HA 1MJGM 1XVLA 2JAWA 3ESXA 3I04A 3KOWA 1EXMA 3IXMA 3M5WA 1GZ3A 4OIFA 4Y1RB 1VL8A 4N5HX 1YDHA 3Q4GA 1QU3A 3P9SA 1SVUA 3GCWA 4LECA 5TV2A 2R6R1 4LFAB 3RIGA 2ORYA 5AKGA 4JT4A 3RUFA 5FBQB 4XLTA 1LZLA 3IVCA 4I8IA 1EIZA 2WF8A 2DWUA 3NV7A 2FWPA 2GBIA 4FINA 1Q7BA 1WMFA 5LWHA 1N2CB 5DLDA 2C5LA 1EHIA 1YWGO 4GG1A 3FOBA 4FDMA 3SZLA 4I14A 5LXTF 1DBSA 3EPRA 1Z4OA 3JWHA 1CNMA 4B3BA 1O0BA 4H7KA 3AFMA 1TTPB 1C0EA 1SKYE 2ZJ4A 3DEIA 1Q1ZA 4A92A 4F5ZA 4QXQA 1PNQA 2VNKA 3T5BA 2EFJA 2GEDA 4F97A 3NWPA 4PLPA 4R1QA 2CFIA 1X7ZA 5DBHX 4YONB 1MU0A 3BDIA 5LQKA 1T43A 1AK1A 1CY0A 5GZ3A 1QIHA 1JDJA 5EVCA 3LU1A 5DX0A 5LDHA 4YRDA 2W6ID 1E2FA 1L7QA 4B4VA 4E33A 2PWYA 2X41A 3GFTA 1N6RA 1Z8DA 5B1DA 3MOIA 3SS8A 4IY1A 3WYGA 3DP9A 1U1DA 4W6ZA 5MN4A 1RZRD 1IG0A 3TD6A 4DIBA 3LDHA 2PQ0A 3DOJA 7MHTA 2I0FA 4HX9A 3UXMA 3WSTA 5CMLA 2HEIA 3KVYA 1ZUIA 2FZWA 4WLFA 5K6AC 2R1VB 2HU8A 4HWRA 1T5BA 1U4SA 1NQTA 3V80A 3T7SA 1CUFA 3GFOA 3AF2A 2WD7B 1DINA 3GT7A 4OXNA 4A2WA 4BNJA 2PT7A 1G4AE 2IPAB 1N92A 3OHSX 2IS2A 3HWWA 1U0HC 2HRBA 1RQGA 3U4AA 3IYLW 3ZS9A 3WBFA 1XQVA 3EC2A 2C7PA 1RP1A 1A5SB 2Q1SA 4O33A 4K6GA 2OXEA 4QYIB 1GTRA 2PUVA 4XX1A 2CV2A 1SK9A 4NK5A 3HJUA 3I01A 2UZIR 4JEIA 2WNHA 3EWAA 1K2VN 2IZ5A 5LR6A 1ESNA 1Q2UA 1PGOA 5T41A 5CB8A 3LUAA 2RI6A 8ATCA 4NBSA 3GJ7A 2DQZA 1KR5A 2J32A 3MFQA 1G9TA 3IKJA 5HE9A 1FYDA 1XEAA 2RGBA 3A26A 4I4TB 1UFRA 3UK6A 3MINA 3MWEA 2Q4BA 1JEAA 2FSVC 5JY6A 3NKVA 3AVQA 1CRPA 4TV8A 2DC1A 1JDBB 3F5QA 4EHNA 3VC3A 3PGJA 2QZ4A 3CE6A 3LA8A 5E8RA 3ZVLA 2VP6A 4QBGB 4LJLA 3N2EA 4MMYB 4EY5A 1XRRA 4G9BA 2EW8A 3BMXA 4LFCB 2F4NA 2JJ1D 2Q6KA 1NVDA 1XF9A 3KVNA 4HMQA 4JENA 3RROA 2CLDX 3L4BA 1P31A 4C0WA 3WXMA 4KCGA 3SZMA 3IKVA 4QGGA 3C6XA 2LBPA 5CVTA 3TNLA 1BKSB 4F1JA 3CN9A 1E3QA 1OLXA 2CDRA 2WF6A 5JECA 5ADUS 5HRCA 3PFHA 1EDDA 3T3HA 1L4LA 4BS9A 2BCGY 2BFPA 3RADC 2G6BA 3JQ7A 1CY2A 3UMGA 1Z0FA 2XUPA 4XB6B 4DNPA 2D59A 2IS6A 3D9QX 2VOJA 4HDNA 5EZYB 1PT7A 5CBPB 2Q46A 2C97A 1QYVA 2O8NA 2J9ZB 4PEVA 4TTSA 1HG1A 1NUTA 3K8YA 3M6AA 3ZW9A 5D3MB 1CY4A 2V6BA 3V5NA 5JZSA 1PFUA 4QPNA 1JIIA 2XJ4A 5LMZA 2JJ2A 4WY8A 2C42A 3PXBA 5EIOA 3KEOA 3THWA 1B3BA 3I30X 1RRFA 1WXQA 2R6FA 4XM1A 3U9SA 4ENUA 3ZNOA 4II3A 1JDNA 1VL0A 2JFNA 4C0LA 1ZC3A 2QRGA 3FVTA 2NADA 2FEWB 1MOZA 1YFLA 1KK2A 2HOQA 1ZHFA 5MN6A 1M5RA 3I8OA 1XT6A 4OXXA 5KVQA 1PSWA 3R3WA 4KC0A 1C9EA 3ZPXA 1EQAA 3GNQA 3IMCA 1KFCB 1S5PA 3OZCA 1H3EA 3ED1A 1JEOA 2YNMC 4WEOA 1K06A 2ZIAA 2YV5A 4C4TA 1P2GA 1MQ8B 4L78A 4C3ZA 4EB0A 3WB2A 3SJZA 1O6FA 3D3KA 3DOOA 1ULTA 1S3GA 3GH1A 3QF7A 1MX5A 1BIFA 1VMIA 4CQMA 1DBPA 3ZXIA 5JISA 2AEEA 2ZYSA 4IMPA 3U7IA 4ESHA 1JHXA 1KYZA 3NLLA 4LXYA 2PZAA 5EWJB 1WY7A 1YKFA 3I9V1 4PZZA 1RI1A 3JVVA 5DHQA 5JFTA 3A6DA 3H5VA 2PKQO 1RYEA 3SZ3A 2WMYA 4C5BA 5CA0B 1BRTA 1JPJA 2QVZX 3Q0IA 4E7OA 1W6RA 1JR3E 3U81A 1C1XA 3WKBA 3LY9A 4PYJA 1ZQ1A 3T7AA 3GPLA 2TS1A 4CM8A 4TVSA 3RVPA 1AUOA 3LPLA 4KO1S 4ZCLA 5KMGA 1J90A 4Y0VA 1MG5A 4FIDA 3KT3A 4KXVA 3TKYA 4TZ0A 2XT9A 2A5LA 4A1FA 2A7XA 3NEPX 2FSGA 5J4HA 2CXXA 2BHRA 3BXHA 4HPXB 3ZD9A 5JQGB 3P2OA 4FFSA 3NUGA 1W5EA 2VRCD 2D1QA 3B52X 3CZ9A 4RA6A 4XGKA 1BNCA 3HR7A 3GY0A 2J3LA 2P1DA 3I28A 3PFKA 4Q5IA 2FQWA 3V7WA 5DNDA 4KGVA 4OU5A 5REQB 4GKVA 3K92A 5ANRB 3RGWS 1N25A 3A7DA 2R44A 1VQ1A 1WEKA 1YE5A 1OMOA 2EZ8A 2BW0A 2I54A 2XV1A 1VYVA 3FOWA 3BMQA 4BGIA 4BXOA 4PGHA 2HU7A 1XO1A 3WIEA 5AUNB 2UXCB 2IP1A 4LRWA 1XP5A 4YUZA 4D96A 2BTEA 2G70A 2JBAB 1OJ7A 2JH8A 5BUSA 4OUKX 4AKEA 1Z8FA 2I8LA 5K3BA 4IV5A 1J09A 2OENG 4L7VA 3FHLA 2WF9A 2YJZA 4LOJA 3MCZA 4Q1DA 1M1ZA 1IUNA 2ZS7A 1LD3A 2BKVA 4BX8A 4HS9A 1A76A 1ZU5A 3MAJA 3AUXA 4CE6A 1V3UA 1OW3B 3SZOA 2QTGA 2UUAB 3IULA 1MH9A 2CXPA 1K7SN 2W2MA 2P1ZA 3DCYA 3WOVA 2CXUA 3QU2A 3U62A 1MZPA 9MHTA 2GPYA 3RTDA 3M33A 5IYZF 1BCRB 4NY1A 4QWWA 5K0ZA 3P94A 2Q1XA 2HIMA 4YCMA 3ORFA 1F6WA 4UNIA 1YNOA 2UZ1A 1PG5A 4BEJA 2CZQA 1O77A 3LGXA 4FBLA 2AW5A 3F6RA 4GLLA 4F6RA 4JLMA 1YAHA 4LEIA 3G0CA 2VDWB 2JK0A 2XOKD 2RHLA 4QOEA 3OFJA 4CKEB 4RHXA 3OFVA 4M9ZA 4TN1A 2YWDA 3DMTC 3NTQA 2GYWA 1QRDA 4NQRA 3WYDA 1JXMA 1E60A 4EW2A 5BWBA 2IIPA 3USZA 2UZAA 2O7NA 4M1ZA 4QRHA 5F7OA 1QRUA 3HB4X 3PUXA 2JAXA 4CRWB 4JOBA 2P5SA 1T8RA 4W9NA 3M9XA 2AW3A 2ZTLA 3O8OB 5KX5B 1J5EB 5HJ5A 2GD2A 3JR7A 2XIQA 1C1HA 2R8EA 2QYHA 1YZHA 3EUFA 1VIAA 2NX2A 2YWXA 4DNOA 2G9NA 3VR2D 3WLRA 1WPXA 1AQLA 2V6FA 3ZTWA 3FNBA 3G0DA 4JBIA 5E7QA 5HKKA 1NF9A 4KKVA 2WFLA 3B38A 1I4TD 4F93B 3MMNA 3D8UA 1BS2A 1YMVA 1YTUA 1UPBA 1QCCA 1CVLA 5EJ8A 2QTLA 3CJQA 1TM2A 1F17A 3PDIB 4DIDA 3T4EA 3L5KA 1XHFA 3F6EX 4D0LB 1OWOA 2IYTA 1MC1A 3RODA 1C7QA 2BE9A 3BMOB 4R68A 1AQIA 1ICIA 4JWTA 4EELA 3KQMA 2XDAA 3OOWA 4ZEVA 1VLLA 2OGUA 4AJ9A 2MMGA 1A9PA 2KBFA 4S1NA 1T1SA 2JBWA 2XHEA 1DBQA 4UE2A 3QK7A 1QE5A 4MRRA 5E2IA 5T3UA 4BQFA 1ST2A 2Y67A 5JCJD 1NG9A 3VKGA 4QGAA 3K8QA 1Z39A 4Q3LA 2PZBA 4DLWA 3KL2A 4D4MA 4X85A 3RVKA 1UK8A 2FWAA 3FLMA 4Q7QA 4TXLA 1JFFA 1OZAA 4BJ3A 4PC6A 5BMVB 5BV8A 3CIOA 3FDFA 3KQSA 1P7CA 3RQSA 4AJ1A 5B4UA 4CI9A 3C5CA 1Z5VA 5LD2B 4LBYA 4O2AA 1P2TA 4WN9B 1JI3A 1KQOA 1Y4UA 2QE7D 1MC5A 3H5OA 5A4MS 3C74A 3A25A 3C2QA 3QVLA 5FAKA 2PLAA 3HVJA 1OI2A 3MEQA 2GZMA 2RAVA 4URUR 1V5WA 2I7XA 1Y8QB 1JQ3A 2X76A 3B6JA 3PENA 4DXDA 3Q12A 3HYCA 2WJVA 5EZ6B 3V4VB 1JX6A 2DY1A 1M74A 2AX3A 1ZD3A 4M0PA 2BUAA 3KZMA 3S1LA 5B3AA 4Q1CA 4XUGB 3H11A 1AZWA 2BDTA 2ODWA 2P75A 4ENQA 1QGED 1F8GA 1S01A 2ATCA 2ETXA 2XMSA 3EH1A 2GCIA 3NH9A 4MKGA 3N07A 2H0QA 4MUYA 4ZC8A 4BUJA 1RXVA 1RJ9A 2AFIA 3L4EA 4M0EA 3L7NA 1O94C 1P1CA 1SA0B 4R7TA 3ZEAA 4NZYA 5G3ZA 1OREA 3BHNA 5K0TA 4WJKB 1AN0A 3T0GA 4O6VA 1ACMA 4MJLA 1KTVA 1ZFNA 4X92A 1U7DA 3NATA 4X93A 5E7JA 4CLOA 3G82C 2AKEA 1UWKA 3VR6A 2HMAA 3DBIA 3VXKA 4D9FA 3V42A 2Q27A 1BS9A 5IH7A 2ZBEA 2WSSA 4E13A 1GU7A 3CURA 4JEUA 3GVXA 3BMNA 3AX6A 4PW0A 5EIFA 3DTVB 2HIHA 1B0ZA 1FU4A 4LYDA 4MUGA 2P4QA 4YAUA 1NUPA 5DRYA 4HUJA 4H3VA 3WFZA 1Z62A 4NJEB 1ZEJA 4RJIA 1U7WA 1G8PA 1K8XB 2AB0A 2Z2IA 1NPTO 2HXYA 1LI4A 2FEAA 3F78A 3WGTA 5IWAB 3QEAZ 1MAUA 1P3DA 1NKTA 3TE7A 1QIIA 4HDOB 5FHQA 1NVWQ 1AF7A 4V0SA 2BJWA 1WRBA 3CB2A 3GJSA 4MR9B 1PKEA 4PINA 3D3EA 4PZLA 1KEUA 2ODNA 4X45A 5LB2A 1QQAA 1I2CA 1O6ZA 2VP9A 3CH5A 1E2BA 1A88A 3MIIA 4NL4H 4MR7A 1YZVA 1QO0A 3MGBA 4AICA 4L5AA 5JH7A 3PYLA 1MF7A 4MV1A 1SG6A 1U0BB 3AESB 1EP1B 1JLRA 3G0BA 1TPYA 3ORSA 4W9RA 5IC6A 4C4OA 4UARA 2ZIZA 2A57A 4O25A 1Z4MA 4CEIB 2IIBA 2WWVD 5AKJA 3BFXA 4YHHB 1UADA 3IALA 3DZFA 3RYIA 2ZR8A 2ZRAA 3DOFA 3ND8A 3ZQKA 1S8AA 2WZDA 1K97A 1U3CA 3U3ZA 3WDSA 3QV2A 4UTZA 5DU2A 1E63A 5ISMA 3W7VA 4KO8A 5AFSA 1RIIA 2GHTA 1VHDA 4GLBA 4I3GA 3PJRA 1XPUA 2ECQA 3ETLA 4EM6A 1AV7A 2FGKA 1EVEA 1NHGA 3HZHA 1N77A 2L82A 2D62A 2NO1A 2ZUBA 3MTBA 3HJHA 3LCJA 4NMXB 5IARA 4CF4A 4BP8A 2CHVA 5JVDA 2XVMA 5LQCA 3O8CA 5KO2A 3QHPA 1GQRA 1ORDA 1F51E 2CVHA 4ACAA 2B5WA 4B6SA 2ZM5A 1QP4A 3E81A 4BNTA 1B41A 1D8TA 1XMIA 1QH8A 5I5EA 3WGLA 3R8FA 3KJXA 2VHCA 4D3DA 3PA6A 4Q4HA 1E98A 1LF5A 4K3UA 5DGCA 2JLCA 1FSGA 4FHCA 5KIAA 4AS3A 3E7PA 5LNK6 1YZKA 3BZWA 2G40A 4H7IA 1U2EA 2LD4A 3RSSA 1T3TA 1UKYA 2BBTA 4HAUA 2PGJA 2D2EA 3BEDA 1ECCA 1OA1A 2H0AA 3QYJA 3VHRA 2YJNA 3WLNA 1KMIY 3IOMA 4MWTA 2W2OA 3EBPA 3KEQA 4F85A 4UNSA 2FUCA 3PBKA 3PRKE 4IHJB 1XZKA 2CYBA 4X7PA 1OB5A 1N6OA 1U0TA 2DULA 1SOAA 3LQ4A 4RLSA 3HU5A 3P20A 5EKSA 4WJLA 2A5JA 4PTYA 4XCXA 4FK8A 2RHGB 3JXEA 4EOGA 3WXBA 1QHIA 4IV8A 4IZ6A 4ZJYA 1UOEA 5F77A 4KFRA 3FHTA 2Y1LA 2PZEA 1PZHA 2G83A 4RFVA 2QTTA 2JLRA 4L02A 1E9EA 2C8VA 4P0QB 2QUJA 1BQEA 1BMFA 1ID8A 1ZH2A 1SXJE 2IRWA 4GIBA 4Q48A 1T1JA 4AZ3A 3DWGA 3HKDA 3OZTA 1PHPA 5AVSA 4L0QA 2H7VA 3SX4A 3WLAA 4G89A 1M66A 1XJWA 4KQ1A 4TOIA 1EUYA 1IM2A 1T3HA 4D9NA 4OI2A 1MRZA 1RYHA 1SBZA 4UTNA 4DT1B 3U0VA 4A6PA 4TXMA 3I34X 4BFXA 4CTOA 3F5SA 3RVLA 3IEVA 4H2DA 3R3ZA 2AFHE 2C82A 1FTYA 1J5XA 2JAOA 2O1SA 3ANNA 3PNSA 3TZCA 1CXZA 1VBKA 2RHWA 1XCPA 3PWKA 5KAMA 1AD2A 4YCCA 1N5LA 3LYLA 4F3TA 1DQRA 3ZBQA 2EXXA 2Q9UA 2W2NA 1JDUA 2P67A 4QRIA 4YJ2B 5A6SA 3K09C 5IAJA 1ENOA 4BV9A 1I7DA 1WBBA 3E18A 1TLFA 1G9XA 2JGRA 1M76A 3RS2A 3SXUB 4A4DA 2VAWA 4ENVA 2JEZA 2UYQA 4E5UA 4WNAA 4BIIA 4M38A 1E6MA 3LRPA 3JZIA 4HCJA 2W2LD 1EGQA 1Z5GA 1XYYA 5LQAA 1RAHA 1ZXLA 2CXHA 3TTYA 2JI4A 2BY4A 2RGXA 1P6QA 3V8PA 2DE0X 2WHQA 3P2KA 2G9QA 5NULA 1PTJA 5DM1A 2C3MA 2ZVJA 3DZKA 1D6NA 3HDHA 4ICIA 1DC7A 3HMKA 1Y7PA 3O8DA 3TQCA 2CUZA 1UBFA 2NZ8A 4B2PA 1VLZA 3R7NA 4C4RA 3TR0A 3PEYA 1YZYA 2ZDHA 3PKJA 4CDRA 5TY0A 1GFSA 3OE1A 2JCSA 1L5HB 2C7RA 4WXRA 1U04A 3I8SA 2FX5A 2VTDA 2IDJA 3O3MB 3SLRA 4LXQA 1D2CA 1X8XA 2BP7B 1WW8A 2AOTB 2HSZA 3MRVA 4D4IA 5JEEA 4GMFA 3ZBUA 3QE9Y 5J3JA 4L16A 4GGOA 4RK4A 1RVDA 1O95D 3MUFA 3OX2A 2PWBA 1TJPB 2Q0SA 4NKRA 3PDUA 4GP9A 2HUNA 1ZIXA 4D4GA 1QM5A 4GWLA 1HQKA 2FPGB 2C5SA 1B6TA 1DP4A 2QPLA 3ASUA 3BD9A 3QPVA 4PZ9A 2ZJAA 5GOZA 1XN4A 3X1ZA 1C7ZA 4EDHA 1YOVB 1ML3A 3GAMA 1Y37A 3V48A 1EZZA 4R1NA 2OB1A 4K05A 3X1DA 1NE7A 4KQ6A 4R81A 4EENA 4R2XA 4XJSA 5J2TA 4TTVA 1S8FA 5CCXA 1XKXA 5JTTA 1G8YA 2F90A 3QVWA 4ROSA 2WLSA 4Z1MA 3R3HA 1DEKA 2Y0CA 3KSUA 4DV2B 1YRYE 2GAAA 4UJ3A 4WESB 1KMNA 4IDHA 4MKIA 1EVKA 3E9CA 4Y18A 1H1DA 1O0SA 1V11A 1N6NA 4IJVA 3CT6A 1LLCA 2CNWA 3OZBA 1G21E 2A5DA 4PSAA 3RAEC 2YCBA 2AC7A 3ILHA 3K72B 4G4JA 1NPDA 2QOEA 5EPEA 5LJIA 4KQ2A 3WGIA 2O2JA 1B8PA 2YASA 3TW8A 5HFNA 2PXAA 3IHWA 5I6DA 1J9GA 2ZIGA 3TB4A 4BATA 3DWEX 4Z0PA 3AIKA 3FFBA 2J0SA 16PKA 1HORA 1T8YA 4R3WA 3G79A 4FNAA 2BVNA 1YRAA 1QSGA 1U8YA 3LVRE 3QZUA 3UN1A 3EPHA 4YMUA 1FY2A 1SUSA 3CCBA 4AC9A 5BRNA 5JJLA 5A62A 1TAHA 2E82A 1V5FA 2JFXA 4XDZA 1ZR4A 1O1YA 4EYEA 1P72A 2C3UA 4G4IA 5B1SA 1ZN2A 4O2BF 3IQWA 2GNPA 4I1RA 1Y6ZA 1Z28A 3VKUA 4EW3A 1CJBA 1SB8A 1NY5A 2W8ZA 4Y9SA 3H1EA 4RANA 1QX4A 2MDTA 3EDMA 4B3DA 4CM9A 5HZKA 1XVUA 1T0PA 1T5HX 3D02A 3I9OA 4OJQA 2V9ZA 2FOIA 3UG6A 1K3UB 3ZGXA 4CVNA 1U2DC 1CR6A 3IAUA 4AMBA 1BHO1 4C7MA 1JI0A 2G08A 1VBFA 2GZHA 2V7UA 2X9GA 2YUIA 2ZE8A 3QKRB 4HGOA 4V3CA 4BGUA 4UTXA 1AGRA 2V0NA 4E15A 1I1NA 2FSSA 1M73E 5KOHB 3PEVA 1YJXA 2AG1A 1KFJB 1JDPA 4NBNA 3TN7A 1XNQB 3I2GA 2VP5A 2O48X 4QUHA 5FB3A 3RS0A 3ZKWB 3CS3A 5CX1B 1XPOA 1E1DA 2MSKA 4YMHA 1MX9A 3JZAA 4BP9A 2ZTSA 5DNUA 4HNGA 1Z6TA 1ZVQA 3V4SA 2BTOA 2R8RA 3ZWWA 1G4UR 5TDHA 1VM6A 3C87A 3QPAA 1NLUA 1BZYA 1T3ZA 3T1VA 2HBYA 1Y82A 4LJ9A 3IIIA 4DV4B 4JBHA 3OUZA 5JHGB 3I09A 1YO6A 1NLMA 3ORQA 5DO9A 4HQKA 4P9NA 3SMQA 3H0KA 5AHRA 7ABPA 3DL0A 1KXZA 3PGKA 4DRYA 2OHOA 5JSFA 3KTDA 4ALMA 5KREA 1TCBA 2Z58A 3TRDA 3TE6A 3CW8X 3LKDA 3OIFA 1UBOS 3GD7A 1MTOA 2G1UA 5AW3A 2R1TB 1NVVQ 1L4BA 4F2DA 1FTWA 1KSFX 1TI7A 1YVDA 4RXTA 4UQOA 4ZARA 5K0FA 5CFRA 4LDAA 3L1JA 3MWDB 3UT5A 2BGWA 2QSZA 3O0DA 4DCUA 1PZNA 1Y80A 2DPYA 1KIAA 4QOIA 2OESA 4ND1A 4OHXA 2PLRA 3BL8A 3HN7A 5FJIA 4ZKDA 6LDHA 1BE0A 1IHOA 1G7CA 2EIXA 4WUTA 2VFAA 4HWSA 4R71A 1HLPA 2EQAA 1ZRNA 3G7SA 5AW5A 4QXAA 1GNSA 3QLVC 3HG7A 4HYQA 4RD3A 1Q14A 1XU9A 4XIIA 1DV2A 5LOVB 4PSVA 5FFFA 1FVXA 6REQA 4MWOA 1MUUA 1LNZA 2AX4A 3DYIA 4TUYB 2FG6C 3OOEA 1GU0A 4Q9DA 2HJHA 2GF9A 3FIUA 4UM9D 4AJKA 4EPRA 2HPZA 4OD0A 1WDKA 1W1IA 3AY0A 4KO4S 3TEJA 4BX0A 4CIXA 4YLYA 5TLSA 2V0GA 3JY6A 2OBXA 3FAKA 4FM9A 2VDKB 2OLKA 3E9NA 2CLIB 1G63A 4U2CA 4H6XA 1CETA 1GY8A 3LK6A 2I33A 1X7XB 3T38A 3UY4A 4GBJA 3UHJA 2BFDB 2QJWA 1GVNB 1B74A 1L4EA 2EJUA 5ALYA 2XNCA 2PL9A 1GR0A 1XZPA 5BVGA 3FMOB 3JQDA 4KN5A 1VDZA 5BSUA 4EYGA 4ZAWA 5LYJF 3CVWA 2P9EA 1LH0A 2HMTA 3M49A 5ESWA 1Q7CA 4IJUA 2PD6A 1RHMA 2UYCA 4D4KA 2MJLA 3H2ZA 2PS0A 2QN8A 5KNDA 4EHFA 1UDXA 4MNTA 5BN3B 1Z34A 3NHSA 1WMDA 2Z95A 3AY7A 3QNUA 3SWWA 4RGVA 2J87A 3KQQA 1U5BA 3AGPA 1DCTA 5CNIA 3KZCA 3WK8A 1HYQA 1I2AA 1JPUA 1PSZA 1LPOA 3SMVA 1CDEA 1PF7E 3D6MA 1CUHA 4OQZA 4XQGA 4AWAA 4BVJA 9ABPA 1R9GA 1CRLA 3EBLA 5CB0A 1HEIA 2BEJA 4FGJA 2PM8A 2D54A 4Y3UA 2P5YA 2GZRA 2N75A 3FG9A 4O4LB 1MVNA 1PJQA 3RC1A 5J4VA 4LDZA 4YN3A 2PUBA 4IEFB 1KNQA 5JCOC 2IBMA 3GXOA 3GLIB 1W36D 3I8XA 1U2GC 4RBNA 3ZN2A 4BFSA 4CIDA 3PE4A 5H9VA 5LP6F 2JLYA 4UXJA 1JBEA 3R76A 2NYUA 1YS7A 1QG0A 4UQPA 4B9AA 3DUFA 3EFBA 4KPFC 4ASUD 3C1AA 4IVNA 3KHUA 4ZEMA 2GPWA 4B79A 2GHRA 4RPIA 3RJMA 4HN4B 4BOYA 5IRCD 2YIMA 4GUAA 1ZMOA 1U3GA 1QPGA 2J5KA 3R0VA 1RC1A 1H69A 4MB6A 2WKQA 5DBIA 3THRA 1IN1A 2ZJYA 2Z8YA 421PA 1YB6A 3LNTA 4P5PA 4RPGA 4MGKR 1C7JA 3IAAA 5C4MA 1SUBA 3IQZA 5E9WA 5H70A 3ZDRA 1F6DA 1T6NA 2ODTX 6NULA 2XW6A 1PJCA 4BE4A 3N6VA 3ESQA 4PG8A 4HWTA 1Q19A 2AXNA 3O9ZA 3QVJA 5HJ7A 3M5PA 3PSHA 3DCJA 2B7CA 2FWJA 1O5TA 3CU5A 4OGWA 1O97D 4R9SA 3TLMA 3FPFA 2O8EB 4HAVA 2DUNA 2FDXA 1IWOA 4GPAA 2O8BB 3GX1A 1JU9A 3BSSA 2NVUA 5FNVF 1HFWA 1K7EB 1QOZA 4ENTA 3KWFA 4QXMA 3JATB 4ND8B 4XDYA 1IVSA 1ZDMA 1P2BA 1SQFA 3N9IA 3DZIA 2BKUA 3PQ7A 5LQNA 3BRWD 1OLSA 5JAPA 1I5OA 3P9PA 4QU9A 1NOKA 3IAM1 4ZMSA 1ACJA 3AR3A 1KXJA 1KVRA 4HAOA 3OKCA 1FRVA 2IZ0A 2QSJA 3C7DB 3FYSA 4V0KA 3ZV7A 3AO0B 3GFSA 3OA2A 2O5EA 1PFKA 1Z73A 1HZZC 2FWRA 2QJTA 3EY9A 2IELA 3G6KA 3W4IA 4B2IA 3DQZA 4F8JA 2FP4B 2FW8A 3B60A 4RAOA 3FJYA 1UPFA 1YL7A 4TSRA 2X7HA 5CYGA 4F3RA 3NASA 1OR8A 2P65A 3ONFA 1E2MA 2Z2JA 5EESA 4EJSA 5JWRA 4W1QA 2BUBA 1QGUB 1X7YB 3BC1A 2H1IA 1SC9A 5LA6F 5CEFA 2COEA 1I01A 3NU1A 3MM4A 4MKFA 4PM4A 3WQHA 3UPTA 2B6NA 1M2JA 3EOBI 1FC0A 2IU6A 1ENZA 3FA2A 4ZQBA 1PAUA 3HBNA 3GLFB 3AEUB 4KQMA 2BFCB 5D00A 5IG2A 4U7GA 1F8YA 3GEDA 3KNZA 2WUVA 2X8WA 2ECKA 3HUUA 1YJBA 4QWMA 3CGGA 5EPOA 4D8VA 4F4JA 4N1AA 1KAOA 1L5FA 4CU2A 3UQYS 3ZHSA 4X1IB 2XBMA 1VB5A 1ZNZA 3ENQA 3BIXA 2IPMA 1KAEA 3DEYX 1YRQA 1I13A 2WPDD 2G77B 2Y1FA 2ZZNA 1NLYA 2X3YA 1Q92A 4GR4A 5K4GA 4HTFA 1KKLA 2F6RA 4LCEA 5HWSA 3U19A 2JAUA 3B1YA 3UMJA 3AOEC 2ZAOA 4JUAA 4PFQA 1FFSA 2HSWA 1GCUA 4IDEA 3V7FA 5C1BA 5FL7D 1QTQA 1AV6A 3K4QA 4OLBA 3IMKA 2ABWA 4RVNA 1T2UA 4BZQA 5HUQA 3FFWA 2EFYA 4RK0A 5JSKA 1W36B 2FQQA 4NECA 1N7HA 5TX7A 3KB2A 1CZUA 4IF4A 1GADO 3HXLA 5ECDA 4DIOA 1T8PA 2BMJA 3DXYA 3DULA 3TD9A 3W6UA 3WMWA 4LS3A 4EG7A 4U7DA 1QIKA 2XCUA 3A58B 3OFKA 3RREA 4CMJA 3L8EA 4E31A 4Q4CA 1MBZA 1VTKA 1YS2X 2G76A 1VJ1A 2DLNA 2PJZA 3JYNA 4BLOA 4B5KA 3JD4A 3OUTA 4CF6A 1DBVO 2RG1A 2RHHA 3R6DA 5E95A 2EX0A 1C41A 3FOFC 2Y66A 1V5EA 3QW4B 3CLRC 1UQUA 2J3EA 3RKRA 1ECJA 1UZUA 4GNRA 4HH0A 4J90A 4BVFA 2GCGA 2NU6A 3AF3A 1GZSA 1N5OX 3FDXA 4BFTA 2JLUA 1MIOA 4UVGA 4CL2A 3W1WA 4LBWA 1G8HA 4HFMA 1XNHA 1RYDA 1M1XB 4KODA 2D1FA 2ZZMA 2BH2A 3DMFA 2RIPA 3B12A 2H51A 1NLZA 2PHZA 2G9ZA 2ZULA 4UAUA 3UEOA 3N05A 1TW2A 1W4CA 1KY2A 2GZ1A 4RHUA 4D99A 3TQFA 1W4RA 3N28A 3RM3A 3LOQA 4B9EA 4E0BA 2BRUA 4CODB 5F35A 4BDSA 1OT5A 1Q0PA 4DDTA 2A84A 2GVDC 1J2YA 1QZZA 2FUG1 1KJJA 2OV3A 4IIBA 3KKMA 4M1EA 5F1KA 4ESVA 3SQWA 2C96A 2NZUG 3GO4A 3AR8A 3C7CB 3G13A 2B8WA 2GM3A 5C7OO 4CLEA 2ID9A 1A8IA 1RAIA 1T5DX 2FWNA 4J0JA 3T0FA 1U1CA 3WYNA 3ZDQA 1B0AA 2PT6A 4YJHB 3HSKA 9LDBA 1OLOA 4QDXA 1MEEA 1SAYA 4BZPA 4B3MB 2Q9AA 2AOUB 1TNDA 5J23A 5EP2A 5JRDS 2VH5R 3IS3A 2GFHA 1TRKA 4FC7A 2QPOA 2VA9A 3IDAA 5LM3A 1L9KA 1W85A 4PX9A 4RTQA 5IJZA 1Q3KA 2ID4A 3QTBA 4KVZA 1Z0DA 4OXIA 4KFSA 4O4IB 3TLZA 1ZVVA 1II0A 4Y6RA 3OY2A 1V6SA 2K2QB 2GZ3A 2O0HA 3U7JA 4YRCA 2P6PA 3LYAA 4E2YA 4WOPA 5JZVA 1V1JA 4LI0A 1HDCA 1U31A 3AUKA 1QO7A 4O1IA 4BB6A 4N9WA 2OHGA 3I83A 3KXPA 4QD3A 1H8EA 1PW7A 1U8CB 2XGOA 2LCFA 3KJEA 5TQ2B 4DEXA 4KMRA 1UK9A 2YINC 5AKYA 1K6XA 1H9CA 3Q3JB 3TOVA 1V8DA 5CT6A 3VZQA 2Q1TA 3SJ7A 2X0EA 4RH3A 1P1IA 2WK1A 1O0CA 2XUDA 1XSEA 1NV9A 1TK2A 2NU7B 3DF9A 3PVCA 3AK4A 2H2HA 4JB3A 3Q41A 1VLQA 4FD2A 1TU3A 4RKFA 4BLQA 5A06A 3DAGA 4FLMA 5LZ7A 2VL7A 3P32A 1JFVA 1FMJA 3P52A 1VLHA 3A4MA 3E70C 3I39X 5FFNA 4WNYA 3TAUA 2NMVA 2ZYGA 2B4TO 3ND6A 4C87A 5BSRA 3I6QA 4V0LA 5BVHA 1J06A 1FYFA 1D2GA 1U6JA 1X2BA 1YSCA 3K4HA 2NXEA 4JSTA 5KYNA 5AXBA 1NQUA 4RJ2A 5C4GB 3ID6C 1ZM3A 4MB0A 3PCRB 1RRCA 1TO6A 1Q0HA 3P9ZA 2FMXA 3D4PA 4O4HA 5LBTA 1KP2A 3EXIB 2VZLA 2QTCA 2MINA 3O4FA 3A7EA 3NC4A 4A8PA 4PPGA 1E4EB 1ZD5A 4OP1A 3S68A 2H1WA 3HCBA 5F73A 3AI3A 5SY4A 3WKAA 2Z43A 4DQUA 4UTRA 3I52A 1RHUA 4W63A 4MS1B 4EJ2A 3PX2A 4YR7A 2VBFA 1M8PA 3QXGA 4HYTA 4WBXC 4BYMA 4DA0A 1U1EA 4K5QA 3GW8A 2Y1KA 1J1UA 3L0DA 4I4LA 1NU8A 1CP2A 1X7WA 4CM3A 5LUAA 2XGJA 2XD4A 4MITA 2GTPA 2X9NA 4RX1A 1GCGA 1U2QA 2HWXA 1H5NA 4ZTBA 4DBLC 1LK0A 3LRTA 3PTAA 2ZRJA 4JU9A 3L1IA 3SYTA 2C7BA 3PC8C 4GI1A 2PTHA 5FEMA 4JT9A 1JEQB 5CB4B 3HB0A 4BB5A 3RTBA 3V4PB 1GPH1 1BS1A 3KJZA 5FBZA 2P90A 2Z08A 1VA5A 2P6MA 4L28A 2XBLA 4OQYA 1T0JB 4YJKA 2A6PA 1EK2A 2MTBA 2HRQA 4IPTA 2JCVA 1U3VA 3IKTA 5LJLA 2F3SA 2RH8A 3GEIA 1GFZA 3RE1A 4DV0B 3D5QA 3E9ZA 2H4JA 3VYVA 3SHOA 2EWWA 1QR2A 1WCIA 4B3IA 2CXOA 5KQSA 4ZRDA 4CKYA 2RC6A 4IRMA 5JNRA 3UC5A 1DKUA 3OAAD 3T6KA 3ADDA 1YKSA 2PRSA 4O1MA 1ZVKA 1Y1RA 3LV8A 2OP0A 2PL3A 3KSMA 2RDMA 1YZQA 4R1OA 4XB1A 4G0YA 3UKOA 3LD9A 3SVTA 2JBAA 4IDOA 4KZKA 3GCXA 5TT0A 4NPCA 3G9ZA 3I58A 3PYMA 3S8EA 3ENWA 4GYKA 2CW5A 4MSUA 4GDFA 3PRYA 5ALZA 5AOAA 1M1YE 1SIBE 4P4SB 4K81B 2BI7A 1NY6A 1YB4A 1M72A 4KNYA 1CNFA 3VSCA 1SCIA 5JSZA 2QPTA 4OHZA 4R2IA 3H1TA 2RJ3A 3AETB 4JK3A 3KKZA 3RS7A 1ZH8A 2GM5A 5L8VA 1QHFA 3FLAA 4QT4A 4IZIA 4JUBA 4RGYA 4WLOA 2DR0A 4KDCA 1YDEA 1Z0AA 4YYEA 3N2ZB 5KHAA 3EGIA 4JZYA 3TNJA 5DHSA 1PJAA 1VZ3A 1XCBA 3WWDA 4K88A 5BSGA 2FMHA 3RYCA 4A15A 3ZY2A 4E6EA 4M83A 4MRSA 1MG0A 2ZRCA 2C5HA 1NMQA 2PSFA 2FPSA 4U5XA 4ZEWA 4B6RA 5ARBA 2X1MA 4JP2A 2W4IA 3AF5A 3A70A 3HNPA 2B6HA 5AJZA 1D7OA 1ABFA 1CR0A 3M9WA 2PX0A 521PA 3Q2OA 3KV1A 4R6XA 3LT4A 2PG3A 4BQOA 1V9LA 3VYSB 2GPBA 5H16A 4DV1B 2QP9X 1RAEA 4HR7A 3ENNA 4RWEA 4DCJA 2XYGA 3GEEA 5LMNB 4LBVA 3SR0A 3K6SB 2CV0A 4CHTA 4LPKA 2OO5A 3OWOA 5DYIA 1C9KA 3TXYA 3C3CA 3IHLA 1U63A 1DAHA 4CEJA 4DUGD 1KO5A 4RMNA 4QHSA 2WT8A 5K05A 3LQ2A 4ILKA 2VT3A 4TS9A 2JZOA 2WWTA 4HXFB 3FZEA 5D3KA 1QZUA 4LF9B 2W6ZA 1NQ5A 1R50A 4J6FA 4E94A 3BTOA 3VV3A 3KBOA 2PX5A 1T24A 5HNKA 2Z0MA 1JILA 2BGRA 3T1TA 3UUWA 4LZLA 3AR4A 2ODBA 4FFRA 1U2TA 2D7DA 3MS7A 5EEHA 2P62A 5EINA 1L4NA 4RNDB 4Q3DA 2C2GA 3WQBA 1U8EA 1YVUA 2XNHA 3GBVA 4KNVA 1Y1QA 1BXRA 4ZVOA 4QM6A 1PV2A 3AF0A 4Y1GA 2EKZA 5C2JB 1JL3A 1JPNA 2QG4A 3N2GB 4L6AA 1LVUA 3VNQA 1DELA 2YTZA 1E3WB 3C3YA 3ESYA 1XTIA 1N3IA 4KOEC 1EK1A 3AHJA 1XQWA 3DCNA 4CLRA 5HM8A 3JCZA 1WOYA 3BGSA 2CBGA 2VYNA 4JLVA 2KS6A 4PIPA 4DPKA 3U49A 2DFKB 1ZIPA 2ZFUA 3GZNB 5EAIA 5BOSA 4WQMA 1MNQA 1YRLA 1PZEA 3EJWA 3OF3A 4I36A 1LRJA 1V4BA 4WBNB 4YT8A 1U0GA 1IQRA 1GPNA 3PJDA 5T64A 3NTUA 4CDGA 1RQRA 3RBAA 2PX2A 4RK7A 4ISBA 4J0DA 4RS3A 4CMKA 2WR8A 3OTQA 1NJFA 4JOSA 1SG0A 3C3DA 1FE8A 3DPSA 1KMHB 3O03A 1E9RA 4W5NA 3AERB 5K7SA 3KR2A 1TZCA 1YZTA 3ONDA 1CQIB 4I6EA 4QARA 3WQQA 1M5TA 1Q6ZA 1QIEA 2BLLA 2OBNA 3I2IA 4B3SB 3A1CA 4YNBA 1SO8A 5A71A 5L53A 3JYLA 4LYYA 4M22A 5CH8A 2IHKA 1M8FA 2IHTA 2M1XA 4Q82A 4RENA 3L7YA 3WL7A 1OWMA 3DGEC 4V0RA 7AT1A 1HPLA 1KBZA 1Z7WA 2P9GA 2WINI 1AM4D 2ZTVA 4OY3A 4YT5A 1IXSB 4AP5A 3D43A 5EYPB 3UMVA 4F11A 3D7NA 1SHUX 3HABA 3C3JA 3R3YA 3TR6A 4B4WA 5BN4A 4JJ4A 1H65A 1NBWB 3OPVA 4X54A 4YDRA 1DKMA 4AJ4A 1LA2A 3QJGA 4MI6A 5SY6A 2OZVA 4J9VA 5CD1A 1TAUA 3MJFA 1SG9A 1LNSA 1ORVA 1RAFA 4JC5A 3A4LA 1KETA 3OFND 3TPZA 3WRXC 1R6AA 3DMNA 4LYJA 4A82A 2NACA 2XTJA 3ET5A 4JYMA 3PNQA 1E0JA 3DPIA 3OCUA 2CXTA 1ZK4A 1M6HA 1G42A 3HVHA 1PFVA 2XMCA 3KQPA 3NGXA 3UANA 3UM9A 5A05A 3C6KA 4POAA 2JLWA 2FHPA 2D2XA 1Q0ZA 5G0UA 1V16B 1T8UA 3TMAA 1SCQA 5BWMA 4OHYA 3ADOA 1ZWLA 3C97A 1EHYA 1UP7A 1STOA 1F8XA 3CUEF 1WR8A 2GAIA 3NT2A 2LCQA 2HGSA 3TLAA 2GEBA 3S27A 1G0OA 1QH9A 2ZTHA 3C7TA 1VMEA 3GYGA 3LDUA 4PWZA 1KYIA 1LDNA 1Q0UA 2Z5VA 4K40A 4FGLA 2XCIA 4M9XA 4W82A 4D9BA 3VH3A 5D3ZA 2ECPA 4CKWB 5BW8A 2HA6A 1UJBA 1NMZA 1S4QA 4JQCA 3HYNA 1NTRA 4DNXA 1T8TA 4B6QA 821PA 2NYRA 1FFCA 1ZI9A 3COYA 3OZIA 4GZ6A 4P4LA 4U8GA 5C52B 3PQ5A 2JCYA 3LYHA 3U09A 2G06A 1PG0A 1I10A 2JHGA 2N1MA 1DMRA 4RK5A 4FR5A 1ZA1A 2ADOA 2QVYX 5LZ8A 4PXYA 3S44A 3O31A 3KUUA 3D1VA 3MWGA 1JSZA 1IZ9A 3C8DA 4ZMBA 1UDWA 1YL5A 2VAXA 5KNLA 4BNFA 3VVBA 3CZMA 1KDRA 3LE8A 3RBVA 3SAJA 5JARA 2ZM6B 3FUVA 1PGNA 3GIDA 2PH1A 4BNDB 2NO0A 3BEOA 4OHFA 4RF2A 3SX0A 3TG8A 4EI9A 4FEGA 4L2IB 5DBGA 3FJOA 4HVCA 2P2GA 4ZA2A 1T0IA 2GEJA 4BLSA 5D85A 1HL3A 3FR8A 3I9JA 4GFDA 3RT1A 3V9AA 2JEYA 3NEYA 4XH9B 4NYMQ 5ALEA 4EHDA 1I8TA 1TM3E 1QIGA 1KJ8A 3U37A 3K2BA 3FF1A 4FE3A 2D00A 3AF6A 2C4WA 2C4HA 4XIJA 3IKLA 3CLVA 4L4UA 2CUTA 5AKIA 2O2EA 1DRWA 3BHIA 1OKKA 1MGPA 2H08A 2O50A 4MUKA 3VC2A 1Z38A 2GS9A 5L95A 5FX2A 1JMVA 1H22A 1U7OA 2VHVA 1LJLA 3NQ41 4REQB 4YUWA 3D4LA 2ZEJA 4UCWA 3NOVA 3K70C 3FI0A 1Z22A 4FJ2A 4XVUA 4YP7A 3HV2A 2ZB2A 5KTYA 1SPXA 3EVFA 2WM8A 3L8CA 4OUDA 7GPBA 2CVOA 1FP6A 1UEJA 3PQ4A 1PUXA 4U2GA 2IDMA 3KAQA 4Z2YA 1MW9X 3FZQA 1YDWA 4Q19A 4V0OA 1ZC4A 4ZQHA 4UOZA 2B0JA 5TJHA 1HOTA 4KRXA 4NF2A 1TLTA 1EUDA 1Z0JA 4TKUB 4YAOA 3TNDA 2GCEA 1GPAA 2MSWA 1Z4QA 3BIOA 5HQTA 3AY6A 3VHLB 5KNDD 5GINE 3FDIA 4LVNA 1MB4A 4LCBA 5E6RA 4JKOA 1YHNA 1XLVA 3AHFA 1GCAA 4QDUA 3YASA 1DZ3A 1E1CB 3BGWA 1IG3A 4JI6B 1SH7A 4XX0B 1B0UA 5IT4A 2O1EA 1FX0A 1P1FA 4ZVNA 3TL2A 3SJUA 2EF0A 4F1WA 4XR4A 4DT1A 4BFVA 1JEYB 2JF0A 3FM9A 3L3BA 5FIUA 1IZYA 1NVAA 3CVVA 2QQ0A 2VCEA 3RC8A 4HP8A 4HBGA 3VDQA 4FVTA 2B9EA 5KPJA 1H9AA 2BTQB 1YR1A 2NSDA 3ZE0B 5I45A 4FZ3A 2ON6A 1E59A 2YN4A 3Q0TA 2WC1A 4JC0A 2DWOA 2A9QA 4YALA 4Z7NB 2R66A 4YJ2A 4Q0MA 3SHWA 2ZR9A 3DHYA 1FZTA 3JQBC 3FFAA 3NAQA 5EJMA 4MR8A 5JANA 1N8TA 4I55A 2QD2A 4FX5A 4QODA 3KXDA 1FRFS 1E7MA 1O6CA 1RR6A 3ZWXA 1R00A 2E55A 3WLMA 3QJ5A 1FNDA 3UV3A 1NV8A 5KSZA 4YUVA 3NEAA 1CRWG 3QKTA 3L7DA 2BBSA 2FR8C 4Z54A 3HKEB 1GXSB 1Y89A 1D2MA 3GGOA 3KD2A 3RWBA 1CYEA 2JFWA 2YWJA 4Q21A 1NOIA 2IUEA 3TCXB 4K9LA 4Z8YA 2BFBB 3HU2A 3R74A 2O4CA 3KALA 5FL3A 5AUQA 1MIHA 2PDAA 4G4SO 2QLTA 3B7WA 3HXMA 2D8AA 1IHPA 4Z3DA 3GJTA 5FUBA 5C8ZA 4ZCIA 3ABOB 1M34B 1ML4A 2WSLA 3DHVA 4O08A 3WZMA 3ORYA 4ZJPA 5H8WA 3S7ZA 5EJ5A 4H77A 1JJBA 4KPUB 4COKA 5T67A 4URXR 3QIAA 5L3SA 2JAPA 1K92A 1NUSA 3MOSA 2C4NA 3IKMB 4YCDA 3ZXSA 5I9NA 1E2IA 2CNBA 1KJNA 1E2QA 1YNSA 3U61B 2J0QA 1DXHA 4AKHA 3ZDFA 4FC6A 4R8VA 2GM9A 2CJFA 3GJ8A 1WPRA 3QU9A 3SLKA 3Q8XB 4ECAA 5EE9A 1DQPA 4F5YA 2QD3A 8GPBA 1YOVA 4G2TA 4KAFA 4LG1A 3RUDA 4JASB 5LQMA 4TMVA 2HJWA 3PKIA 4EKEA 4DCGA 3HRKA 1TAQA 1KPGA 2QAIA 1GGMA 1QV9A 2KX7A 1B93A 2WNSA 4BEVA 5LVAA 3B1VA 1E6CA 2Y77A 2CFCA 4CT0A 1THGA 3NG1A 1Q16A 1CS0B 4CV0A 1WU8A 4X1YA 3GZ4A 1SR8A 1JV2B 2FPOA 2EATA 1HBJA 2W8BB 5FJJA 5JNTA 2XI4A 3T3NA 4LHYA 1GGEA 1EDOA 2IYQA 2SKEA 3M82A 2CMDA 2HK9A 3NTOA 4UUOA 2ONKA 3BN3A 4YHBA 4KPEC 1UBKS 1LDBA 4RL6A 1I3KA 3H75A 4X71A 3E5RA 5A5FA 1OXTA 5K03A 5KDDA 4P93A 1E8DA 2MT9A 1J49A 1AGYA 2ZYTX 3F4BA 1EFUA 3IXQA 3HVUA 2LR0A 3QITA 1OAKA 2FU5C 2VWQA 5CLFA 4I1IA 4OLJA 2Q5CA 3BREA 4BNYA 4WKCA 4LF4B 3WBBA 3PXCX 2YFHA 2YJ3A 2ES4A 5CNJA 4ZVKA 3BYZA 5K01A 4BN5A 3KR0A 4FHZA 3E3NA 1T2VA 4C06A 1Z47A 1U6KA 3AP3A 4MI1A 5FI1B 1XGKA 2HZ7A 1N5RA 1RRVA 1FP2A 3PNYA 3BORA 2OFPA 2QD5A 3DMRA 1U98A 2ZCUA 3UOAB 5IJ0B 1CUWA 4FFWA 4Z4IA 4PLYA 1J8DA 5HMMA 1ZP6A 4NMMA 1QX3A 4UUQA 4JB8A 4PSCA 2Z2YA 4M7RA 3LAWA 4PG4A 2PS9A 4XARA 3ZDAA 3VTAA 1NXVA 2XSZA 3W2HA 5H80A 4BO5A 5D3QA 3ZNNA 2Q45A 3C3KA 1D4OA 2BDEA 1BDIA 2ID7A 3EC1A 3H1GA 4LSGA 3FNFA 2PZJA 3HZOA 1E2UA 4NOKA 4DWOA 3AEQA 4IXTA 2WIBA 2GKOA 2KWIA 2ZT8A 3PUJA 4EZIA 3HBJA 5IZ4A 3OETA 2CLSA 4IR7A 1ZOOA 5G0VA 3L18A 4TWJA 2C1EA 5TMEA 4CM5A 2FKAA 4L9SA 3OHPA 1K6MA 2XGGA 1O6GA 4REMA 1P8JA 2ODEA 3SQXA 1EAYA 2IP2A 3D3WB 3M6FA 1NNEA 3Q9LA 1Z45A 3A8TA 1SOVA 1LX6A 2NYAA 1ZBQA 3TPFA 4L8VA 2XQFA 1K4KA 4LQDA 3UK0A 1TYEB 2H9YA 3NV9A 3QVGB 4QQ8A 3E1GA 3D0OA 2IODA 2VDOB 3D54D 4CL3A 5ICGA 4NOJA 4DARA 5ESRA 3BB3A 1Z6QA 1IONA 4NENA 1E0SA 3MGCA 4EX7A 3OZUA 1OXSC 1A8PA 2OCBA 5IJWA 3RSHA 2VLBA 3A6JA 5TE9A 2P7HA 3S2GA 4AK9A 2AZ4A 1DGQA 3D6FA 1PU2A 1YV9A 2R9VA 4JR2A 2G67A 2Y9PB 1LBSA 4X1OA 4CG3A 2YV2A 3Q7TA 4IFEA 4WPGA 4J7XA 4BU0A 1JQKA 4GZMA 4IGFA 4JLAA 4PO9A 4Q01A 5E9AA 4S1PA 1KK3A 3VNSA 1ECPA 4Q4AB 2Q0HA 4I5DA 3UJPA 1VKNA 3PEWA 2J7PA 1Z4JA 4LK2A 3WK5A 3NANA 1ISHA 1C14A 2X4IA 1UXOA 3VV2A 1G64A 3R5XA 4ZV4A 1XCGB 2IYOA 4JA2A 3FSGA 5CHYA 2FPMA 4YMSA 1GQOA 1J0AA 4U7JA 1CF4A 2HLPA 4C1BA 1TKAA 3EVBA 3A2MA 1KIMA 1MABA 1QOPB 2GEFA 2J5QA 3LDFA 4HBZA 4IUBS 4GLOA 4Q1VA 4Y2HA 2E21A 4J8PA 4S1VA 5AKKA 4L9RA 2CD9A 4QQFA 1P5RA 3MCVA 1IPEA 2SHKA 1B0PA 3G8DA 3P4XA 5H1YA 2IZ6A 2ZTMA 2QRLA 4FMCF 4R40A 5G1NA 4E2ZA 2VUTA 5IVIA 2I6XA 1ABBA 5KJ6A 4D56A 1D0SA 1OBFO 1XZCA 3LTEA 4LF5B 1G7SA 2HA7A 3OO0A 1F3OA 1G8KA 4IQGA 1Y8RA 1ZX1A 3PWSA 2B34A 4X95A 2PUGA 1DU4A 4HDRB 4JCCA 5DTQA 3EASA 3C5HA 1PS0A 3K5HA 5AR1A 1AGPA 5EQTA 1IVNA 3RD5A 3NNNA 4NDAA 2RGYA 5BSHA 5DWDA 4AUKA 4RC9A 3QFRA 4TV9A 5IMBA 3DBLB 4BQIA 4MQLA 1EUCA 4PQGA 1DKLA 5SZIA 4BWVA 4Y2UA 4IZHA 3EISA 2R5WA 1DOHA 2H31A 3KT6A 3NDRA 4RCVA 4UEJA 3DNFA 2A9PA 2H3EA 5DYYA 1YAJA 3EA4A 3NPMA 4G0QA 3FMIA 4GD3Q 1OXUA 3QKSB 4IGIA 4OHUA 2PXCA 4CV3A 3UMSA 5JS2A 2UVPB 3LCVB 3M81A 5T5QA 2PS3A 2YV3A 3RSLA 1K98A 2DWPA 2F9LA 4RIEA 4FKBA 4DAOA 1U65A 1EU1A 2JNWA 4G5QA 4ED9A 4O2RA 1CKEA 2GJAA 1OROA 1QP8A 4ZT2A 2VA8A 2WAXA 4FFPA 3GUUA 3KTOA 2FRVA 1RHKA 1VPDA 2H2FA 2AI1A 1JDBC 2Z2XA 4GSKA 1NQAO 4IDPA 4OP3A 3TLEA 4IBOA 3TSYA 1XXHB 3NAZA 4B6FA 5GP1A 1XLTC 3UGTA 4HT3B 1CVIA 5AVXA 3PX7A 1SBIA 5DXJA 2XE4A 3KPYA 4K26A 2PD4A 2FN3A 2SCUA 1PWEA 5HGXA 4X66B 3AU9A 3JV7A 4EG3A 3NAMA 4RSRA 2ROQA 3HJCA 1GL7A