4BU1A

Crystal structure of rad4 brct1,2 in complex with a crb2 phosphopeptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
182
structure length
179
Chain Sequence
SKPLKGFVICCTSIDLKQRTEISTKATKLGAAYRSDFTKDVTHLIAGDFDTPKYKFAAKSRPDIKIMSSEWIPVLYESWVQGEDLLLVDKHLLPTLFKCRVCLTNIGQPERSRIENYVLKHGGTFCPDLTRDVTHLIAGTSSGRKYEYALKWKINVVCVEWLWQSIQRNAVLEPQYFQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords S-M CHECKPOINT CONTROL PROTEIN RAD4
publication title Phosphorylation-Dependent Assembly and Coordination of the DNA Damage Checkpoint Apparatus by Rad4(Topbp1.).
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 63
structure length 179
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
A PF12738 PTCB-BRCT twin BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4bu1A01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4bu1A02
2JW5A 4U4AA 3T7JA 1T15A 4IFIA 4XPZA 2D8MA 3OLCX 3PD7A 4BU0A 3AL3A 2XNHA 3K15A 3II6X 3QVGB 4XQ0A 1Z56C 4N40A 3L40A 4BMDA 3QVGA 2VXCA 4BMCA 3JVEA 3HUEA 1IMOA 3T7IA 2M2IA 3K0KA 3K16A 4OFBA 1Y98A 3T1NA 3AL2A 1IN1A 3SZMA 3U3ZA 1T29A 1KZYC 2EBWA 3PXEA 2R1ZA 4ID3A 3I0MA 3PXDA 4Y2GA 2DUNA 3L41A 3PXBA 2E2WA 1T2VA 2EP8A 2VXBA 3SQDA 2WT8A 3PC6A 2INGX 5ECGC 3SHVA 3PA6A 3K0HA 1N5OX 2COUA 2XNKA 4JLUA 3UEOA 2HTFA 2K6GA 3SHTA 2L42A 2ADOA 2NTEA 3K05A 3PC8C 1OQAA 3KTFA 3PC8A 2COKA 4IGKA 1L0BA 3FA2A 1JNXX 1WF6A 1GZHB 3PXCX 4BU1A 2K7FA 3I0NA 3L46A 3T7KA 3EF0A 3PXAA 2EBUA 3EF1A 1T2UA 4Y18A 1CDZA 2COEA 2LE0A 2ETXA 3HUFA 2AZMA 3UENA 3COJA 3PC7A 1L7BA
chains in the Genus database with same CATH superfamily
2C96A 1CDDA 3OQHA 5A5VA 4UU7A 1RI1A 2YWDA 3P94A 2RGXA 3ZZ0A 1NI5A 3N74A 4JODA 5EIHA 3S8MA 5MFZA 3SNHA 4GBJA 4XPIB 1LDBA 1C3JA 4BY9E 2W2NA 4B33A 4CIXA 2IYYA 2TMKA 3FCCA 3JCZA 4RLSA 3IQWA 3HXPA 1QGAA 4ZOEA 2V5VA 4HDRB 2OBNA 3WBBA 5AJVB 1EDOA 3ZV6A 4M1YA 3ZW8A 2ZB3A 1ZH0A 4J0JA 2DFKB 1LU9A 1J7KA 2IC5A 4I6JA 5JI3E 4D5EA 1VL1A 2VSFA 1RM0A 1WXHA 5JAZA 3FF1A 5KNCD 1F6BA 2HZ7A 2EFEB 2YWRA 3ZHXA 1NUHA 2J3KA 4F6RB 4OG2A 1ZJ5A 1U2DA 2R47A 6LDHA 5JS6A 3JVEA 1R4MA 2VATA 1G18A 3RWOA 2A5FA 2VDNB 1Z18A 4NK4A 2EX0A 2Q7DA 2MMGA 4AN1A 3U61B 5C5IA 2AQ8A 5EERA 5FNVA 2EG9A 3RFVA 1G7TA 1NTRA 1Y6FA 2O0MA 4CKWB 1YDMA 5EJFA 3KTDA 3GLKA 3ILYA 4MB0A 4EATA 3RSLA 3RYHB 2O19A 1GKUB 4Q16A 1NOKA 1WBDA 1FYVA 1QFSA 1GZVA 1HDEA 1TADA 2W22A 5JE8A 3U7FB 3ICQB 1EIZA 3ETJA 3SZUA 2G9QA 3NHWA 1E96A 3ZG6A 3D8SA 3IP3A 5KTRA 4JI8B 2JH8A 1DMRA 2Y1WA 5FXMA 2Z6QA 1EUDB 1U3TA 2C29D 4G8DA 4KO2S 4GX0A 3GA5A 4FHGA 1JW9B 1VPLA 4G0MA 3KPVA 2O2SA 4W4TA 4AJ2A 4IEEA 4BB0A 5L3SB 4ZYWA 2WJ6A 1U2PA 3VVBA 5L51A 2GMWA 3P96A 4KKXB 4X00A 5ECGC 3UT6A 5T5QA 3TB6A 3W5DA 1RYFA 3ER8A 4KXLA 5SYMA 4IG4A 4FLMA 1XEFA 3RTGA 5JHHB 5K4GA 5KYTA 5EG5A 3RIMA 1UJNA 5GAJA 1AGNA 4RD1A 4ZJUA 3HO8A 1IHOA 3AKCA 3EVBA 3LVBA 4QGFA 3T7RA 4B9AA 1M7BA 4LF6B 3K9FC 8OHMA 1K7YA 2WI8A 1CC1S 4IHJA 5A05A 3FIJA 4PX5A 4WAUA 2BZ0A 4Q9LA 2ORVA 1LLCA 1N6IA 3C8UA 1CRPA 3DYVA 5I9TA 4PLFA 4KQJA 2Z2XA 4U2CA 2GUWA 3D0RA 2FSGA 1LTKA 1E4YA 3KL4A 4H0CA 3H5RA 1RKBA 4QUKA 3RUEA 4KYUA 2ISSD 1L5KA 4EHKA 1B43A 4LF7B 1CERA 5AI4A 1T3SA 2MT9A 3PQ7A 3L7KA 1BC5A 1QUFA 2NLOA 4AVYA 1JH8A 3USZA 3CO5A 3AKZA 1IMJA 4G3XA 1TXGA 5CBPB 4G1UC 5IF9A 2WJWA 4P0QB 5SICE 2BFFA 3BSWA 3JTEA 1DG1G 4EAQA 3BTOA 3NWJA 5KJCA 4N65A 3FHJA 3LO5A 1WR8A 1HDRA 2NUPA 4X3OA 3VX4A 4W9MC 3KETA 4P4NA 4MI6A 2O06A 4NMHA 3IQHX 1BGVA 1XJQA 2A5LA 1M1XB 4FSHA 4TS9A 3ZBPA 4BX3A 1PQUA 4KR6A 2WFAA 5ALKA 4D96A 1W59A 1Y8ZA 4WNCA 4Z4EA 3H0KA 1H8HD 4F21A 5DULA 2GPYA 1Z25A 2X1VA 2PWYA 2PKQP 3ZE2B 2A5JA 4BNIA 4GWKA 1LBEA 1RLMA 4FFVA 1L5GB 1W36D 3PSHA 1B1CA 4EYGA 4D0NA 2MWMA 1NLMA 3OE4A 1KPIA 4JROA 4ZT4A 2ZIUB 4GLLA 3HMQA 3RCBA 2M32A 1CULC 1O95D 3HU2A 5CR9A 5HE9A 1LVHA 1FC0A 1NL3A 3EVFA 3MTQA 4WKPA 1Y3DE 1F5SA 1ZXLA 3DGFC 1FUIA 1NMQA 3TZ6A 4HRAA 4JWTA 2X0NA 2CXOA 3ZK7A 2GEDA 3N53A 1LWNA 4UMFA 4JMLA 3WBJA 2ZPUA 3ZCPA 2FGKA 3HCWA 5CXQA 1V9LA 3FKSD 1TUEA 2EQ5A 2IYTA 4KE6A 1J4AA 1BWQA 4O4LA 4DZZA 4XIFA 3W4KA 1TT7A 2D0OB 2AX3A 3KQVA 5CVCA 1ODCA 1P1HA 4IYRA 1SXPA 1X1RA 2HMUA 2JLUA 2A35A 4PLZA 4I8XA 1E2UA 4E2WA 1DIOB 3EUWA 3ZIDA 3K0KA 5HOQA 1QK4A 5IT5A 2OFPA 3BK7A 3B1XA 5J4KA 5FJIA 3I61A 1DTWA 5H02A 4NYIQ 3OTHA 1HC7A 4OXQA 4XR4A 5FL7D 3EGIA 1MNQA 4DQUA 1U2QA 3DWFA 2X4GA 2C88A 2F90A 5DP1A 4B83A 1FFHA 5DW3A 5AIBA 1G8FA 1E3LA 1JXAA 1IEVA 1KPGA 2H00A 3BKWA 1LBSA 3QW2A 4MUEA 4N1AA 2FP4A 2QRJA 5CLIA 2E49A 2IZZA 3DDSA 4L1KA 2LIPA 4O0MA 3LTNC 1JLLB 3M9XA 4QRHA 2IWHA 4UDYX 1EA5A 4GI7A 3UKOA 1ZSNA 3AO0B 3I30X 4KWEA 3VKWA 1RLUA 3LNTA 3E7FA 4NYJQ 4RMJA 4PYQA 1AMUA 1SVSA 3C3DA 3U19A 1JS1X 3LPCA 4XD2A 1JA1A 3LVRE 1XUOA 4MJ7A 1RWWA 1XZHA 4NBTA 4CMCA 5GIPE 2H8GA 2IYWA 3DF7A 1Z5NA 2C20A 3CZMA 3KCNA 4ZQIA 1YDGA 4WOPA 1UXIA 1NUTA 1SM4A 3L43A 3U4IA 2M9MA 3VSEA 4JGIA 4JJ4A 1ISMA 1A5ZA 2WJ4A 1S8NA 1J33A 2PIAA 4AWXA 1ICIA 1NHGA 1JIJA 2C2MA 3F71A 4MW0A 4NAHA 4D3DA 4F97A 5TLSA 2E4ZA 4WVLA 5KKCA 1KGSA 4C0KA 3SZLA 3GU3A 3DE0X 4M87A 4JI7B 1L1FA 3I64A 5F78A 1ZUNB 1FDUA 3VO8A 3RSZA 4EL0A 3KWJA 4BO4A 2N46A 5B58T 4AKTA 2EATA 2QROA 3FUTA 2DSNA 4XGQA 3RBZA 5EEGA 1QPGA 1CD5A 1L5RA 1NJ8A 1NBMD 4HPJB 4RVNA 2BFCA 4TV9A 1CXZA 4PAMA 4FW8A 2B4TO 4XWGA 4TUYB 1G8GA 4S35A 4B6EA 3TD6A 1ZD3A 3I45A 2KLHA 3M1AA 1KHTA 4BCBA 4DB4A 1MDFA 2KBEA 4O8ZA 1E69A 4FHEA 1PK8A 2C31A 3T9FA 4LC1A 3R9IA 3Q1LA 3ESZA 3GRUA 1NXPA 2X86A 1F2VA 3TRHA 5D00A 4HWKA 3VVLA 3FM9A 5AJZA 2RARA 4RKRA 3ZLVA 2BGIA 4WX2B 1GGHA 3B60A 2JRCA 1WY7A 3LHSA 1ANKA 3BSSA 2FMTA 3RLFA 5CJPA 2Z9BA 2QNBA 1I4OA 3F2VA 3STVA 1GQQA 4F2DA 3AUJB 5LZ9A 4I5EA 1ORDA 4G0PA 2OHXA 1S6YA 1E0JA 1RP1A 1CUXA 3PNQA 1TIPA 4R4JA 3V2GA 3GB9A 2CVHA 3GWGA 1DBIA 5AI0A 3THSA 5A02A 2NMVA 3H5VA 4UC0A 4FGUA 3O83A 4ITRC 2L18A 2KMLA 1JQAA 3HGMA 3C5CA 3VNRA 3V8VA 3H65A 1QWOA 1VGRA 2ZGVA 2HQSA 1L5QA 2IYLD 3D2BA 4R8LA 3ROEA 4OTZA 3BWVA 3WRYC 4DA7A 2K5UA 4CHTA 1G6KA 3VBCA 3NT2A 2WRZA 5GM2A 5JYDA 1R4MB 1AKYA 2R79A 3DMYA 4DQXA 2P8JA 3QVGA 1NVGA 1VCMA 2BCGY 3AOEC 4XIYA 2BMWA 4DJEC 3NHJA 3AEUA 2DX7A 4F6LA 2AQIA 1CE8A 3KAPA 1C5KA 1MEOA 1Q1GA 2VF7A 4ODIA 4PHFA 4TUYF 5TQ2B 4FEAA 4E5SA 3QWAA 1U3UA 2DBVO 4KC0A 1B2LA 3AIKA 1W52X 4CYMA 4DKXA 5ICGA 1EXDA 5BN5A 2CLDX 3B13B 4R3WA 1W75A 5K0ZA 1M6YA 2ZYUX 3RF6A 3S81A 1HFWA 2WT9A 5HUJA 4PONA 2O6HA 1QS0A 2PGLA 4LC9A 3RRNA 3V4VB 4DLUA 1EQAA 1KS9A 2YASA 4JY7A 1QCYA 2PBLA 3WLTA 2WK1A 3TNFA 1CUAA 3QKSB 5AHXA 2CWDA 4IHKA 4PN3A 4KE8A 1LUAA 2NXEA 2FZVA 5ALPA 4HDSA 2GAOA 2RJ3A 2G82A 1F7UA 4G5SA 3O82A 4N3CA 1E98A 1FNMA 4WXHA 3W5SA 1SKBA 5AKLA 1JTVA 1T8PA 2ZBPA 3DOJA 4JLUA 3MWLA 1OIWA 4IHJB 2H5IA 3E6AA 2I1VB 4KKVA 3IT3A 3JPYA 2RGDA 4XCXA 3EXG1 5EE5B 2GZMA 4B31A 3Q85A 4BP1A 3ZS8A 4Y2HA 5JNUA 1JJAA 3BJZA 3CLHA 3NH6A 2E0IA 4A8JA 1JFRA 4XVQA 5ALEA 3SNKA 3VH3A 4BRSA 1W5TA 1DIGA 2P5YA 5BSFA 3I52A 3DPIA 1W35A 3OPYI 4E30A 5CT6A 4LG1A 3ZH9B 5HDQA 1KRWA 3WK8A 3O4JA 3RUCA 3H5LA 1QRUA 1PVVA 5I7SA 2EERA 3ABRB 3ZDQA 3RFXA 3IP9A 3T1YB 4WA8A 1S8FA 1MZVA 4QG7A 1XA3A 3NTVA 1IZYA 3KEQA 2NUPB 4PZUA 4B3FX 1PJTA 1L8AA 2CXXA 3Q88A 4PPNA 2H08A 1TA4A 3HSKA 4R5MA 4U39A 1L5WA 1OTHA 5FX2A 2BKVA 3QE0A 2XI4A 1R6XA 3AOGA 3C3YA 2ZRMA 3KTAB 4LZAA 3TUJC 5KU7A 3A27A 2V1XA 4C3OB 1IN8A 2I2DA 2X9QA 4F3RA 5HF9A 1MX9A 4PPYA 1HGXA 2ECOA 2VJDA 2DFLA 3WJ1A 5B30A 1P0FA 4YDQA 3O5AA 1GYQA 4Y9TA 2WAMA 3LCUA 3I2IA 4DC9A 1DARA 2C4TA 4EOGA 2HN9A 5FUBA 1FMJA 4P33A 4WKGA 5GJWC 3E1KA 2D1SA 2PM8A 3E3OA 3LVQE 3KR0A 4B4OA 4DLKA 1C30A 1NIPA 4MHOA 2F1RA 3ICWA 4MRSA 4D8WA 4E5DA 5ICEA 4A2PA 4JI4B 1Q17A 4XASA 5AXCA 1B6TA 3U1TA 4KN5A 3QVWA 1IY9A 1PJ4A 2D8MA 3AQIA 4IHJF 4ZI2A 5AKHA 4ZYUA 4WESB 4O4LB 1VI6A 2VNJA 3D7KA 5EKSA 3H1AA 4CKEA 5AR1A 1KWKA 4D1YA 4KVAA 4C2BA 3GARA 1A8SA 5CDHA 5C31A 2DFPA 3KUUA 3SWWA 1GHTA 4HVCA 1P3JA 1LF0A 1WCXA 1LPOA 1V16A 2EYUA 1KFBB 3CX3A 4R40A 4G5XA 5PNTA 1DTWB 5C8YB 3OCJA 3E48A 2C5EA 3WLIA 4BV9A 3K16A 1JG6A 5AVJA 4F60A 1EWYA 4KGXA 3VR4A 3CKKA 3EPJA 3I2GA 1SVKA 4Q02A 2QL7A 1TPZA 4V0MA 3RC2A 3IEMA 1T13A 3H84A 1YL5A 2XWJI 3KQMA 3G85A 1AH2A 3CRZA 2GCIA 3MGCA 5KAPA 4CUJA 4F1WA 4LZLA 4QODA 1MOZA 1QP4A 4N8DA 3LMKA 1UMCA 3JQRA 3PXDA 4KO4S 5K51A 4AO7A 2NUTA 4BUCA 5HK9A 3Q2OA 2GVDC 4RK7A 4ISBA 2CT8A 2XGOA 2J4CA 5HF8A 3WGUA 4X8HA 4GS5A 2IDZA 4QPDA 4CIVA 1HNXB 4OLBA 5C5EA 3B2NA 1ECBA 1UIMA 2RJOA 1GKIA 3CZCA 1TD9A 4LXGA 3WAJA 2P69A 5D5QA 3E27A 5HRCA 3WFIA 4F4JA 4BNGA 5D8DA 4EEXA 4ZCQA 1W44A 5SYNA 2IV3A 4YI3A 2WYVA 4H1TA 4FXPA 2X22A 4URVR 2H5JA 1WDWB 3VDRA 2XLBA 5F5NA 5E6SA 4O4LF 4ZCLA 3C1AA 1RRMA 1GLNA 2NW6A 1MENA 2OM2A 4ND6A 1HT2E 4C05A 1GRRA 4D98A 1D2CA 4FFWA 1TJ4A 3TLJA 4ENVA 2FF7A 3QX8A 2I78A 2FETA 1ZRHA 4TV9B 1L7XA 1AOXA 4RKEA 3H5OA 4WGFA 5IAGA 3DQQA 5C8YF 2VUIB 1NFFA 4L5IA 5DNWA 5LKAA 4C6TB 1M8JA 3PC8A 3NAQA 4NHEA 3Q72A 3CLRD 4AECA 3RK0A 4V0KA 1BXZA 1NA5A 1C4KA 1XYGA 5FBZA 3PFBA 2B3DA 2YWCA 3N0RA 3PC3A 1XQWA 4WPGA 1YB4A 4BO8A 1ULUA 2ZSHA 3HB4X 3I01A 4N0EA 4CTJA 1W7AA 1D8AA 3PPIA 1TMOA 4FCCA 4HZGA 2OXCA 2XEXA 4JELA 3HY4A 4Y9RA 4GNKA 3IEIA 5C8VA 4F9GA 2H7VA 1PR2A 2JJ2A 4KNVA 4QL3A 3Q5EA 3OQ6A 2B82A 1U7ZA 4AAYA 2BJHA 4DYVA 4DSZA 1G6OA 1RBZA 5CEJA 2W58A 4J9UE 1BRTA 3FWYA 5EKUA 1ICEA 4JQZA 1N3LA 1IHYA 1XDDA 5CK5A 5KYWA 1LDGA 3AVQA 4MUYA 3DDHA 1F51E 3NT5A 4LJ7A 3ZY3A 1XRJA 3UAVA 1Q1EA 3CVXA 4FFNA 1DKOA 1VMAA 3ZBTA 4X20A 4P82A 4AMUA 5AK0A 4IL5A 3GEIA 1LXCA 4EHHA 1DOZA 2VPXA 1DCFA 4LE1A 3AIIA 1CLUA 1Z0FA 2GHRA 3L18A 4XWOA 1VFPA 2HJWA 4G5RA 3GGGA 4JR0A 4RM2A 4OQFA 4YR9A 4AY6A 1CY6A 3B6KA 2J4DA 1RLJA 1X94A 4JUBA 2R6AA 4FLFA 221PA 5EA2A 6AT1A 2C7RA 5G0SA 2RK6A 2QAGA 2HDOA 2YINC 3IO3A 1IUKA 3QVGB 2H18A 4L07A 4OM7A 1F0YA 1D07A 1G16A 4JT4A 3GJ8A 2GYYA 4U9UA 1SA0A 1PDVA 3AEUB 2AOWA 2A9KA 4DLSA 2XQGA 3FBTA 3FR7A 3GRFA 4CMKA 1VM6A 1B3RA 1N2OA 4TN5A 4URHA 4HWRA 1ATIA 1KDRA 3ZY4A 2MSKA 4ND2A 2JFNA 5BN5B 5BQ3A 1Z37A 3RYFB 4CF6A 1I5RA 2RFLA 2X8JB 5BSGA 1EA7A 2AFIE 2IYAA 2V9PA 1JJFA 1QIJA 3R0IA 2H1OA 4RE5A 4B3CA 4QBFA 1QS0B 1M2HA 2OV4A 3HB1A 2HU5A 5E4YA 2IA5A 4LYAA 3WGGA 4CLDA 4DNQA 4TRNA 1Q7CA 1PS8A 3C8MA 4PPFA 1BYUA 3HXOA 1GR0A 3VZCA 3BX1A 2MOKA 2VYFA 4KQMA 1A5AB 3QPCA 3DS8A 3B9QA 5SY4A 3K70B 3PLNA 2RIRA 4K1XA 4HDSB 3OCWA 5BNFA 3C87A 8ATCA 3RAGA 1ZGZA 2ZRDA 3DUFB 4WUVA 3PFNA 4N5HX 4PICA 5HKKA 2NT3A 1QH1A 1RAHA 2F1KA 4BV8A 1JLHA 4G0UA 5U4XA 4LKRA 2C8KA 4XX0A 4DWVA 3R8CA 4L8VA 2YJTD 1TAHA 1QTRA 2FK7A 4N7JA 3FZYA 3LNCA 1E9EA 4NDNE 5BXQC 1ES9A 1LS6A 4KMOA 4B4WA 2FA9A 2I3AA 1TA9A 2K6GA 3LWBA 1F6DA 3GNTA 4U0KA 2XZDA 2EFGA 2REBA 4K28A 5L3RA 3W6UA 4BN5A 3IQDB 4LZPA 3X44A 3G8BA 5UKDA 4QT4A 3AWDA 3HCOA 2QYOA 4RIHA 5CVVA 4P54A 1AC5A 1EFTA 1Z2NX 1ODTC 2B4QA 3GH3A 4FD3A 4QU8A 5HUHA 3AF3A 2AK3A 5IJAA 2PZAA 3IRUA 3LKVA 3GZJA 2AG6A 4QGSA 1JEAA 2JH9A 1DBRA 1P45A 4FCWA 2AD5A 1T9AA 1G1MA 4L78A 1T0HB 4F7WA 2HMAA 2YMQA 3KT3A 4G5GA 4LPKA 3W6ZA 1A95A 1XAIA 3DT9A 1DS6A 1YB7A 4PC6A 5AW7A 1WHTA 5JROA 3JWEA 4N9QA 3ZU4A 1VSQA 4TS4A 2WWIA 3L7DA 2DLDA 4R1NA 1CNEA 3LL7A 1SWVA 3T12A 4UHKA 3EIOA 1BFKA 2PV0A 3TMKA 3ZDZB 2PZFA 3R4VA 4MUBA 1DAPA 4F5EA 1X77A 1PLLA 2PKWA 2JEOA 3PL1A 5FLXA 3FYDA 1YS1X 4OMFG 3VO1A 5EWLA 1JIIA 3EIHA 3GAAA 3I9NA 2V96A 2ZCVA 3F46A 4LPSA 4ZC8A 1OE0A 3KD3A 3L6DA 4A0HA 3RS5A 1A97A 3G2QA 3KAQA 3Q8XB 4GBMA 4RMHA 4JB2A 4ZQGA 2HSGA 1KAOA 1NSFA 2GSDA 3GJ5A 4BNXA 1TM5E 1EDBA 1UM8A 1MXFA 2YWEA 3AM5A 3R44A 4IXNA 3ZN2A 3AHGA 4Y9UA 2CXTA 1Y5LA 3W04A 1EQ2A 2IZ5A 1DTEA 3GVXA 2IPMA 4KXNA 3HKEB 4QDUA 3IR6A 4IVQA 3CVJA 5EPOA 5FUVA 4CKEB 3H9BA 4D41A 1AGRA 3LK7A 4TTTS 3A6LA 2ZBEA 3LQ2A 4LWPA 3PGXA 2ATXA 2NU7A 1V37A 4MUKA 2Q4OA 4QOHA 5HCUA 1HG1A 1Z06A 4HLDA 4A0GA 1PYGA 1HT1E 2PL3A 3NGLA 1IG3A 4WFQA 3WQHA 4FW9A 3P0EA 1LD3A 1XZGA 2J8ZA 3G2IA 4I8DA 3RABA 4GZ6A 3LZDA 1H9BA 1V7QA 1G20A 1Y42X 2XUPA 4P22A 3TW0A 3ZCRA 4US2R 2BH9A 4RFVA 4WZBE 3PI6A 4MV1A 2Q1SA 4DSUA 3IELA 2XUOA 2JFFA 1DKPA 3NASA 2XHEA 3H6HA 1DEAA 5CB8A 1IWBB 3P9NA 1SU7A 4M8NE 5JPCA 1Y6QA 1I1QB 2AI1A 3BCRA 3IHTA 1KZYC 4FMCF 5MFPA 4IDNA 5IJWA 4UVGA 4KVFA 5FJJA 3M2PA 3GUYA 4CQMA 3CVWA 1WULS 1UMCB 3A05A 2HRBA 2ZAGA 1HYBA 3CRMA 2A88A 4LA4A 1XRPA 3F7MA 4TWJA 5HIJA 2EDAA 1OBCA 2ZSIA 3IMGA 5FBQB 1FYXA 3GRCA 1Q19A 2CC2A 4UCWA 2RGWA 3EWSA 5FFFA 3FHCB 4H3KB 3ZJUA 3MEQA 4X1OA 4CT0A 1Y1PA 4FSXA 4R1QA 1NE7A 1RQXA 3E9DA 1UBNA 3WLAA 2YJ3A 1STOA 4C4ZA 5CLFA 1BMFA 2NYRA 5CFLA 1JMVA 2VP2A 1HYQA 2PWPA 4MV0A 5ELMA 3SJZA 5JO0A 4ESVA 4YUYA 2NVUB 1JR4A 3UJNA 1V41E 3TZKA 4D99A 1YWGO 1QPBA 3ESRA 3RBXA 5I9LA 2QE7D 1FVHA 3RFCA 5IDQA 2BEKA 2CL6X 1ADBA 2IS2A 5IC6A 5KOHA 5E6SB 2JD0A 1Q20A 4QXAA 4ARUA 4KQHA 1YMVA 2TECE 4L5AA 5BRNA 3N0XA 4PXYA 1L7OA 4LYDA 1TYBE 2FSIA 4I4NA 3T7EA 3E9NA 2WWVD 1CUDA 2QBYA 4JQCA 3GAZA 3KVYA 1Q0SA 3LX5A 2P41A 2A1IA 4PINA 3C2QA 1H3FA 3PR1A 4RQAA 3U3OA 4ENUA 4RHCA 3R5JA 2FRDA 3Q9UA 3RJ5A 1YXMA 2Q1WA 1NRIA 1QX3A 4W5NA 2OBYA 1J2UA 2G88A 4US1R 1H8EA 1DB3A 1JN0A 4ZVKA 3RVRA 3UHAA 4BFUA 5AK4A 1Y7TA 1HLFA 2HJ9A 2NQ2C 2BGWA 2CNBA 2X6TA 4BQQA 2NO6A 3DLTA 4P34A 1QORA 1OFUX 1QLHA 2R5FA 3TSCA 2AG0A 3U1VA 1E79D 2H1LA 5KMGA 3CSSA 1AK2A 2O5RA 5HJ7A 4DLLA 2J3QA 4NMWA 2FR8C 4JC5A 1TK2A 2WU1A 4HN9A 1NQ5A 1GARA 3SVTA 4BFLA 1KMMA 3H1FA 1S2MA 3ZK8A 1OX5A 1K5PA 2W2TA 1H4TA 1YCHA 2VF2A 4M8LA 3RU9A 2QTFA 2ZJAA 2MDTA 3S55A 2D1QA 5DFAA 3LUDA 1I3OA 1BHJA 3F6CA 3IBYA 2WA2A 1RXVA 3CE6A 3N5KA 1IY0A 2YVUA 3AW9A 1RI3A 2WG2A 2CKMA 2B9EA 2HXGA 3FNQA 1EHYA 4UNQA 5C8XA 3S28A 1I7PA 1SCBA 3TMAA 3UVEA 2CNDA 2B20A 2VQEB 5KTYA 3CW8X 1XEWY 4EHDA 2Q0QA 1TK9A 3KM0A 2AEEA 4R2MA 3TJRA 3WZ2A 4O5AA 2LKDA 1YDFA 1ST2A 2DY0A 3ECCA 3HQ4O 4MI3A 4Q3NA 3T3EA 3HO6A 4C5AA 4LDZA 3EAFA 1X74A 2QW1A 1X14A 4HTAA 5K3CA 5JATA 1ZMXA 1J0AA 2OCGA 3BXFA 2BE9A 1Y3IA 4E46A 5BV8A 4TTAA 1ZUIA 1P8JA 1N2XA 2C2KA 1T5TA 3IPLA 2YVQA 3THWB 2ZJFA 1IB0A 4UFPA 5C5CA 4LY3A 1T9BA 4G4SO 3EGVA 1NJ1A 3EGCA 5FOTA 2DFNA 4K6KA 4MYCA 1G0NA 3SBOA 3HBNA 3AR5A 3VU3A 4F8JA 1RXEA 3NHZA 4KBFA 4V0OA 5D7NA 3V8NA 5AJUA 3ZYZA 4UD6A 1DC3A 2Y8EA 3P8ZA 4UMVA 2WAXA 5FA5A 4JFAA 3O7WA 1QCCA 1SC1A 1CFJA 1JPUA 2CFTA 1ZISA 3EDOA 1YJCA 3JQAA 4HB4A 4P9NA 4UHBA 2ZE8A 3HV2A 5CGZA 3N58A 2W42A 2QRVA 1PT9A 2FNAA 3IQIX 4X85A 2WJYA 3AIOA 4FQ8A 3M6FA 3DFZA 4ZAVA 1RQPA 3B6EA 2WKWA 4BB6A 4CM1A 5CVTA 3DC7A 3OCZA 4N49A 1X1QA 1QH1B 4PSCA 2WT8A 4GT1A 1OZFA 3IAXA 2AV6A 2OP1A 1G5PA 1W0KA 3KK0A 5LDGA 4ZCIA 2D0DA 4AUMA 2FW8A 4ESHA 1MC4A 3CVVA 1U9ZA 3K0HA 2PSDA 2ZUDA 1O57A 3U3MA 4L3OA 2Q5QA 5DX8A 1A4IA 2PHZA 3QUCA 3UEOA 3AINA 5CXSA 4POAA 3ROXA 3EIQA 3SHOA 3V1TC 4IO0A 1M0EA 2XXJA 4P3KA 4PG6A 5D3QA 3JD3A 1CJCA 5EJMA 2OKGA 4LTDA 3VJLA 3K70C 4WE3A 3NIBA 5KAMA 1MMFB 4OATA 2ZWIA 4RMGA 4DNOA 1JP7A 2ECPA 1XLTC 3TMYA 3T34A 2C4WA 4B5LA 3WGVA 3E5HA 1MJFA 1SEVA 2Q1XA 3S8YA 4JI2B 1RHRA 4PRYA 3CW9A 4YV1A 1BA3A 4YBRA 4P36A 5BYJA 1E2EA 1FTYA 1WNFA 1QJ4A 2HMWA 3PXCX 1NPTO 4YALA 1F48A 3CV3A 3Q12A 4XOUA 4E70A 4MVJP 4LQLA 1ZVQA 1ODLA 4EJSB 1SQ0A 3VA7A 1JKFA 3WWOA 4X64B 5K8JB 4OMCA 1V39A 2QRKA 4MS4A 3K0AB 5IP5A 5T3UA 1ESEA 3PX3A 5EWLB 4HQKA 5EC8A 1J8DA 2JJ1A 3LXMA 4HQRA 1MKYA 2FG6C 2QTRA 5E9JA 5F73A 3AZQA 4YAIA 1S2IA 1PU2A 3UW3A 5EJAA 4IVPA 5HE8A 3B1JA 3GP8A 1M2EA 3RVDA 2FWPA 2NPOA 4CMEA 3FDZB 1JMYA 1SHZA 3BVPA 1WUTA 5JYBA 1NSTA 3CFYA 4EDHA 2TMDA 3PEEA 4RV9A 2RI0A 3NM6B 2QGZA 3SSMA 1ECJA 2YW2A 3R74A 4BYMA 2ZEJA 1ACMA 2A86A 1JDPA 4A1FA 2R7LA 4F11A 3ISJA 4WADA 2CKDA 4ND7A 4NOJA 4FWIB 2ZTHA 3FWPA 2NU7B 3RT7A 1DRKA 2OENG 3NUGA 5C81A 1XHFA 3VTZA 1POWA 2JARA 4LXIA 3LPDA 3L4JA 3ENVA 1W6UA 4D02A 3G9QA 1G20B 4NU6A 2BSQA 2JEYA 1RYDA 5AJWA 3LQYA 2V9CA 2AK2A 3O2JA 4EH1A 1M33A 5JXWA 2M2IA 3BHIA 3WWPA 3EGWA 4G63A 1YR2A 1XWIA 1ZM4A 2JFZA 2LPMA 3N0WA 4F5ZA 3PJEA 4M0LA 5JARA 2IZOA 2WNHA 2QE6A 1EBUA 3KLPX 4CQMB 4GL4A 3UJ3X 3A9RA 4B2PA 4LYHA 1UBHS 2XWSA 1WDTA 2IUFA 1W1IA 3FZEA 4WERA 3ILHA 4JBIA 1THZA 2DQYA 4DNFA 3OA2A 2BSXA 2EFJA 3NHRA 2M6LA 5I7HA 1KAGA 1PP4A 1WXFA 2J45A 4C6HA 3E18A 3D31A 1XCLA 2G5PA 2PUJA 2XUAA 2YN2A 4E3WA 4DV2B 5JAOA 2EARA 4N3GA 1WA5A 4FVTA 4OP2A 4JU9A 2EF0A 3D64A 5FKJA 3B6MA 5AW5A 3E53A 3IUBA 3VHXA 4MWOA 1Z8FA 4FYVA 4YRCA 1TKBA 3VHQA 4PAGA 3HDJA 5KOHB 4DA9A 2YXNA 2D74A 3DD1A 3I5AA 5BNZA 5A71A 1SCUA 3V48A 1AD2A 2RG1A 1AO0A 1Z38A 4MQLA 3FCEA 4RJTA 1J07A 2PGOA 2GB4A 3GMTA 1YR9A 1PWXA 1U0GA 1WZUA 4AT1A 4F2HA 2QBYB 1ONPA 3RADC 1JQ3A 3A4YA 3EPLA 4XTCS 3JR7A 4L76A 4AIIA 2HLDD 1D2NA 3AFGA 3NBQA 2IYFA 3R6TA 4WK6A 1SC6A 3UWKA 4ZALA 3QKTA 4NS1A 4NBWA 3U4AA 3W3AH 2BM0A 2ZWAA 3G2KA 2AC2A 4ISCA 4UW9A 4JFRA 4D4LA 3CWZA 1DKUA 1A69A 1Y0BA 3L4BA 4Q5IA 2Q2QA 1KJIA 3DEIA 4NLLA 2NTNA 3RFFA 1WL8A 2C82A 3WLNA 1KZ6A 4CT5A 1Z6QA 3KZXA 3GFVA 3I1IA 5KMGB 4W99A 2IZ7A 1PJQA 2W2QA 1R5OA 1A88A 1SOMA 2GJKA 2MSDB 2QRUA 5DTJA 5F33A 4DMLA 1KH3A 2GPAA 3B52X 4DEYA 1UEJA 2QM3A 1PJAA 4RK4A 1IOVA 3SX2A 2W5UA 2NZ2A 2ZB2A 4ZVLA 4L8LA 1UFVA 3BPSA 2HYDA 4YV2A 3ZVKA 1V47A 1R66A 1VCIA 2WUVA 1ZD8A 2GZDA 1D03A 2ZS8A 3AXTA 3MMZA 2F48A 1JE1A 1T1GA 2GF2A 4IJ6A 1W4RA 4Q1AA 5DOZA 1CDEA 5C1IA 4ENRA 2R1VB 5LDHA 1RJDA 3CCFA 2IDKA 1CU1A 3RC7A 2VJBA 3TTXA 1PNOA 4FFRA 4WRRA 2JD1A 1DP4A 4S0ZA 3VR3D 1P1RA 2VK8A 1PG5A 5JY6A 5K8CA 3G1UA 3T9AA 5BN3A 5BSKA 3GGSA 1CW2B 1BRMA 1JL3A 3V4LA 4P4LA 1KOJA 4M0PA 4BWGA 5HJEA 2NXNA 2C0PA 5IDWA 1GG2A 4D26A 1TT5A 1BE1A 2R44A 3EVGA 3HFJA 4UBLA 3UK2A 2ZW9A 4JVSB 1F8YA 1JMKC 1Z56C 4M98A 1TZBA 4LVUA 4B71A 5EMMA 1F1BA 1HEYA 4I2NA 5JWRA 4NONA 3EIEA 2FHSA 3QBVA 1OH6A 4FIDA 1NNEA 1KEWA 2A1UA 2Q41A 3JR3A 4F4HA 4JWKA 4P31A 3PYLA 1E6CA 2HTEA 2OECA 3DMHA 3MLAA 3ZWCA 3DMDA 3BJIC 3OCUA 4N4AA 4M7WA 3GG9A 1E8MA 5JD4A 3TTYA 3C43A 2O8BA 2VHXA 3ETDA 2R4UA 2A0YA 2JGAA 2RKBA 2RIPA 1U0NA 4FYXA 4MWSA 4N5DA 3CNBA 3BRQA 4Z2YA 2CB9A 2VEDA 3UC9A 3JQAB 1V8FA 1FFDA 1VSUA 4FNMA 3GLFA 5FBRB 4HMPA 4EHLA 4EBFA 1KY2A 2BD0A 2VAPA 2Y9PB 2FX3A 5DNCA 5U9CA 1MO2A 4A92A 3NAMA 1RAGA 3SR0A 4HZUB 4B3RB 3FETA 3U39A 3FTPA 1XZDA 1ZH2A 1Q7RA 1PX0A 2Z58A 1UPFA 3G13A 3L8ZA 4RGYA 1YFKA 1SB9A 3AZOA 1ZONA 3AF1A 1E8NA 2JGKA 2PSFA 1I13A 1HI9A 4JB0A 3TX2A 4JYMA 2O7RA 1WCV1 3EMKA 5A7FA 1OMOA 2FTKE 2J48A 1BCSA 3P2KA 1EUQA 1ZJZA 2H57A 3I8XA 1EESA 1LLDA 2ANBA 4BNWA 4LJKA 1QVRA 1AG9A 5AXDA 3NETA 1MAVA 3AMVA 4B81A 2KS6A 4R1OA 3F5MA 4MI9A 3E7PA 4E09A 3BS4A 2WSYB 4TKZA 3K05A 2NSJA 1D1QA 2V55B 3GFFA 3QIVA 3V97A 1LFAA 1N5DA 1XTKA 1GPMA 3B2QA 3NNSA 4URZR 2GTIA 3D5QA 3PV0A 3A1SA 4GLJA 1ETHA 1RSZA 3FWZA 3AUXA 3J81A 3C7CB 4PRZA 1Q0TA 4JLBA 1CQWA 1N1EA 4D3YA 2K2QB 1TF7A 5CCDA 4Y2YA 1MG5A 4BEJA 2WSLA 3OP4A 3SC4A 1Q12A 3BWYA 1VL5A 3NOQA 5DLYA 1WBJB 4FYIA 5JCOA 1EFLA 5B3JC 1M73E 4OLAA 4Q24A 1R0SA 2HMVA 3JPWA 3ABSB 1SXQA 2XUDA 1NP7A 1R5NA 1RAFA 1WLSA 1KFEB 1JYSA 1P9NA 2CFIA 2FQYA 4G24A 2IXAA 4RIFA 3WGJA 3PGVA 2ZRPA 1EXVA 3G5AA 2QUKA 2ALJA 2X58A 3NJ4A 4O3MA 4XARA 1OWNA 4DYDA 3UWOA 1B6SA 2HY7A 4RJKA 3NC0C 2IEBA 2FAXA 1NVUQ 2IUSA 6REQB 5LB2A 4Q3BA 2TYSB 1Q74A 2ZBUA 4MW9A 2G5CA 4HX2A 3DHWC 1L5HB 1QWSA 3LAWA 1N4DA 4UNPA 3WJ7A 3D8BA 4XUEA 2XXAA 3NG1A 5COAA 7ADHA 2Q6LA 4XUDA 2QSJA 1J00A 2J9XB 5I7EA 3KKZA 2HHHB 3CNLA 2FUKA 1JLMA 3P4XA 4MAAA 4RXTA 4FXOA 2ZXEA 3EWIA 4EJSC 5LQRA 3RSQA 4AIRA 4Q01A 2CLHB 4MPDA 4UMDA 5A9RA 4NV3A 2CXNA 1YDHA 3KJEA 3LYAA 1R6AA 1YB2A 1J2EA 2G7ZA 5GOTA 1MV5A 1O87A 3QUSA 4H15A 5F77A 1U63A 1CEXA 2LV8A 4OXNA 3W9UA 3GNQA 4BPRA 1LB1B 3RSFA 5LZ5A 4PTYA 4WJZA 4YAUA 1ISRA 2BF4A 2QZPA 2DT5A 3R9WA 1A8IA 3IHWA 1ZM9A 1M6WA 2UZ1A 4R9RA 2I3BA 3AM3A 3IA7A 3JVIA 4JUFA 2WWGA 3X2FA 4IM7A 4CF5A 1E64A 4HGNA 1RI2A 2POCA 2E87A 4D3ZA 1XC7A 4NY1A 5KVVA 4O4HA 5AUNB 1DDIA 1EUYA 1P62B 2O3RA 1K7SN 4QBGB 5MN4A 3KJZA 1CY7A 3H83A 3VTAA 4DCUA 1A5TA 3GMSA 3PWKA 3WLPA 1B8VA 2YY6A 4MW5A 3KQHA 2C78A 1PZGA 2ZT8A 1LLQA 2OZEA 2NVOA 3CSUA 4E3ZA 4ZHQF 2ZWOA 3ZBUA 3QE4A 1V6SA 3I12A 4RD0A 1KE1A 3T0IA 4BMZA 5I9IA 1N2HA 1VHDA 3BORA 4I4CA 4URXR 4F4CA 4KO8A 4X63A 4X6UA 5AFSA 4NX2A 5HFJA 4ZCPA 3S27A 1ZI8A 5CNJA 3QX3A 1CJUC 1LKZA 4NQRA 4C3ZA 2B61A 3EDRA 1KYYA 4WUTA 2UUAB 4AMGA 5JNVA 2EX4A 2Q5OA 2EGUA 1HPLA 1GAJA 3EAQA 1UFOA 3F7TA 5BW6B 3VPHA 3TFQA 5KX5A 5LM3A 4JKYA 3TL6A 3KFLA 2RHGB 4A82A 4DANA 3ED5A 1Q1BA 1QDUA 4I3GA 3U6BA 1JWLA 3IUNA 5K8IA 1M1ZA 5B6JA 1UT6A 3WWYA 4WL0A 1OFIA 4IIYA 2XB8A 3GVCA 1KDYA 5KS2A 2Y1EA 1LA2A 5HK8A 2BFEA 5ILQA 1JGTA 3EZYA 4OSPA 3ONEA 3I2JA 1FPQA 2PBFA 2X3UA 1Z7BA 4FDMA 2Y68A 2HCRA 4FIZA 2SKCA 4TT3A 1XRRA 3CMMA 3RC1A 1GQYA 2PGDA 3P9IA 1ST3A 5IAOA 4EVIA 1OI7A 2RDMA 4OP3A 4QU5A 3GIWA 5AKJA 4GP7A 3AVYA 4DUGA 2FPXA 2YXLA 2FCAA 1ZD4A 3GMIA 4HNVA 4Z9BA 2AZ4A 2L82A 2MSEB 2JIPA 4HC4A 3A3YA 1ULHA 3Q7SA 4MCJA 4UNIA 2ET6A 4RSGA 1PJ2A 4BO6A 3E84A 3FNIA 4Q6BA 2FFQA 3FNGA 3M4JA 4GC5A 1P1CA 1YUBA 4QVIA 4IX1A 3JQ6A 4KXQA 3WNDA 3PC2A 4KXMA 3PQEA 3C3JA 3KLOA 1IIRA 4NH4A 2HGSA 3T5DA 4E15A 3BXXA 4BJ6A 4D25A 3CZQA 3BYZA 1YI8A 5EUMA 3JSAA 4PYOA 4XJXA 5BWNA 2NIPA 4RVDA 3PHJA 1NR7A 5I5GA 4AJKA 1CT9A 1N9KA 2VWPA 2IUTA 3NEYA 4JOSA 5TF4A 3GGOA 2FEPA 1RBYA 4AF8A 5J4LA 1HV8A 2CVQA 3HJUA 3A36A 3W1VA 1TT5B 4R9UC 4BTVA 3IL2A 2DF8A 3CLSC 3EK2A 1ODSA 3FD8A 1E2DA 4B7AA 3R0XA 1JJVA 1E2JA 3GBPA 4GXQA 1H2EA 1VPWA 4M9ZA 1Z2PX 4J43A 1JXQA 3TRDA 3P0FA 3WB0A 3OTOB 1RJFA 2GBFA 4UE6A 1V45E 3OJXA 1OV6A 4F7DA 4BDSA 2A1UB 2VTEA 5BR7A 2QQ5A 2R25B 5CG1A 1T5IA 1JSZA 2VC2B 3FYHA 4XDHA 3I92A 1E4VA 2EJWA 3JASA 2XE4A 1E3WA 1OTYA 5JCJD 1U0LA 3OM8A 2DHRA 3TCKA 2G76A 3JVVA 3C6YA 3P4UA 4KIFA 4F96A 1TEHA 3E0QA 3B1ZA 2O8BB 3LP5A 1E1CA 1J2RA 4FYWA 4G01B 3KD2A 2Z8YA 1ZCZA 3AX6A 2AR7A 3GLFB 3T3DA 3V1LA 3RS4A 3PFKA 3M3HA 3DAPA 2WNSA 1UBJS 2NUBA 4H16A 1AUQA 2OZVA 1VHWA 4MW1A 5ILGA 3GGJA 5K3FA 3MD9A 2WVJA 1UK6A 3DVQX 4GX5A 5F9HA 5FDFA 2ETVA 4Q03A 3OF5A 3QLVC 4HSGA 2J67A 3F9RA 3SD7A 4U9HS 1NW3A 2ZS9A 1TOAA 4KIJA 2O8FA 3Q6MA 4KDRA 5BV2P 1HQYE 3VV3A 3AH8A 4HWSA 1D0VA 4MQEA 3N70A 3SHWA 1XEWX 4H6VA 3OZVA 3LOPA 2JF0A 1BCSB 3PA6A 4HBGA 1WM1A 1ZX1A 1Y3HA 2AF4C 2YZGA 5H83A 4NECA 1SCQA 1QG0A 1TD1A 1QBKC 4IUCS 2XYHA 1NVKA 4B46A 5B6PA 1Z08A 3NTUA 5I5EA 3HYNA 1SVWA 1N7HA 1HNWB 2NSHA 3OJOA 1BXKA 2CSXA 1Z75A 5KSWB 2O7VA 3SX0A 3LGAA 3WRXA 4ZU3A 4B4UA 1A98A 3NYWA 4INJA 4GW3A 1H69A 1E2QA 5DWDA 4ADSG 2YXBA 3HJGA 1G8PA 3WSTA 5G02A 4BBJA 3FRIA 1OUMA 4EVSA 3OWXA 3T0FA 4PTZA 4YT2A 7ABPA 2P35A 4JEUA 4LQCA 3UT5A 1K4YA 1L4UA 3H19A 1I6KA 2VHQA 3G2LA 3KDSE 2YC2C 3DTVA 1W85A 4HVTA 1TTHA 2XYRA 4KX5A 3M70A 2PSJA 2WYHA 4OOFA 2WMOB 5C80A 1LFDB 1UJMA 4P35A 4RVCA 4DIEA 3N2NA 5DGCA 3ZWYA 1U2SA 3O1IC 4JR1A 1IHPA 4NZZA 4UHJA 2XGJA 5DT9A 4BRZA 2JAPA 2QRZA 5FPPA 6CHYA 1KI8A 4QAJA 4RTRA 3VKHA 4UUOA 1I94B 2Z6UA 4OLHA 3RJMA 3PGMA 4RV5A 2ZTMA 4G4GA 3JQPA 3U5TA 3PR3A 3MWKA 3O8CA 3CF4G 1XPRA 3NNNA 3W7AA 4O33A 4PSVA 2XXAB 3DZCA 1UDWA 4GM4A 4IIHA 1CNFA 3AUAA 4MEJA 3EBPA 4CW7A 2ZZMA 3JZMA 4RELA 1VMIA 4UVHA 2OCDA 1IJEA 3PUXA 4RF2A 4V0ME 3PICA 2D7CA 3WNVA 3N7AA 3OIWA 1DRUA 1D3AA 4QFCA 3IIKA 4BNMA 2HR1A 2VQ3A 3TIFA 1S3GA 1OT3A 3TRKA 3WL3A 3DTTA 1ZVJA 4U7DA 3M5CA 3TDKA 3VSAA 1W2HA 3LT2A 4MQFA 2HFKA 4P83A 3FMGA 5EKTA 3VX3A 4M1OA 3CA8A 2P4UA 5ENDA 2EJBA 2ZT5A 5AJXA 4DLVA 1GXSB 1VBNA 1Z16A 3OLVA 3UMCA 4CF3A 2W8BA 4CMEC 3GPCA 1C9KA 3NC1C 1UAAA 4JCCA 1TIKA 2R8EA 4KE7A 3WMEA 4OY3A 1CYEA 3VUFA 2WF8A 1V9CA 2A7XA 3PWSA 2JFPA 1J99A 2OESA 4O0LA 3BHNA 3LD9A 5FI5A 3UJ9A 4UTPA 4JQYA 5H3LA 2C99A 3WXBA 4DMCA 1I3LA 2D2FA 5DLEA 4G0ZA 2I71A 4D4KA 4J90A 4XIJA 4BO5A 1IEXA 4MLZA 1JZTA 4ND1A 5C4IA 1D4ZA 4Y2QA 3FKJA 3NWPA 1YD7A 4RADA 1YVPA 3WLKX 4L6CA 2RHCA 4X8OA 3A1CA 4D8XA 4I9NA 1E5XA 3CRQA 3HWRA 1GYRA 3JD4A 1C1DA 2A33A 1VLQA 3FJ1A 3UQYS 3VR6H 5G1NA 4ZVTA 4AMBA 1RJWA 3MFYA 4CEJA 1P5HA 3G17A 4IZHA 2HLPA 2AHRA 5LJLA 3OOJA 3T99A 4ZHSA 3IVAA 2WWWA 3OQIA 1K88A 4TWIA 3OI7A 1B41A 3MLEA 2C2YA 1QG4A 4YGXB 4GC9A 4CKCB 1A8UA 1DG9A 2HTFA 1AHPA 1TL7C 2IBMA 4HAXA 4ZEXA 4DLPA 2C7VA 4B73A 3L1KA 3ZUGA 1DUVG 1BX3A 5DBIA 3BAFA 5CNIA 3WAGA 1IEQA 1KVRA 3EPKA 3KSZO 2WSSD 4JP3A 2EDCA 3TO5A 1SUFA 3KG2A 4DTCA 4UTVA 1GG5A 1XFAA 4NBUA 1M5RA 3SEQA 3ASZA 3QU5A 1FYWA 2HU2A 1FQOA 1JLSA 1Z12A 2QP3A 3HJBA 4XD7D 3L6BA 2CHEA 3DL0A 1ZA1A 1P60A 4H4DA 1H85A 4LRTB 1NX6A 4Q93A 5ICCA 3LDHA 1U6IA 1YUNA 1LNZA 2OM6A 1WY5A 2GPTA 3LX6A 5ALYA 1GZHB 3QKWA 5ALMA 1DAKA 3OPXA 3R40A 3DO5A 5KKAA 3ZCSA 4LJLA 4DCPA 5B3LA 4EK9A 721PA 1Q6ZA 1ZZGA 1IXZA 2GCOB 3E8SA 3PXAA 4PC7A 4A0QA 4EW3A 2XR1A 4GO1A 1TJYA 1HDGO 1HDYA 3L7BA 1DQYA 2R00C 2W4QA 3UYKA 2Z6AA 1YAHA 1Z0UA 2RGCA 2ZJ2A 2JIZD 2Z3ZA 3OX3A 2G0TA 2WOJA 3W4IA 5LPNA 1W76A 3L4BC 3IJRA 2NWQA 5J3JA 1XU7A 1QO0A 3DJFA 4Z51A 2C5FA 2DOKA 3PWZA 2WJGA 4DCOA 2XUQA 2P9TA 4RTPA 4IFTA 4MVJI 3PLAE 5DRYA 5KU1A 1MFZA 1WRBA 1TF2A 8GPBA 3OCXA 1TJ5A 3U60B 3C6QA 1I5EA 4J2HA 4XFDA 1UOQA 3MWYW 4KRYA 4TRRA 4MITA 3U7GA 1NY6A 5AM0A 5DZSA 1YZGA 3FGOA 5TGTA 3URMA 1RWNA 5GJVC 1M6EX 3MUEA 3M5WA 5HBRA 1O6ZA 4LBYA 4CV2A 4LZJA 5AW9A 1A7JA 2BIFA 2ID7A 3SQLA 4AB1A 1MGPA 3IVGA 2BFPA 4RK6A 3KYCA 2ID4A 2F17A 4R1TA 4LSMA 4YR7A 4GSYA 3OJEA 3W2FA 3F6EX 3JASB 4KVZA 1E3WB 2XOKD 2BCJQ 3HABA 4KB5A 4PFSA 5L3VA 1KI4A 2ZBGA 4K9SA 1DCKA 2EW8A 2Y1CA 2WD8A 3EWNA 2C3UA 4QXQA 4R16A 4YCMA 4Q3EA 1E1CB 1RLOA 1W1UA 2AOTA 3IMFA 4M7PA 4Z7JA 4C7BA 2NVWA 1I4WA 1EX7A 3DZ8A 1BG6A 1YV9A 1JILA 1O6FA 2YOHA 3F3YA 521PA 3UATA 4GSLA 4OJNA 3EYWA 3RRJA 2CYCA 2R6R1 3D3EA 5ENVA 2XSZD 2ZR0A 4HCJA 5K3FB 3TKAA 1K98A 3Q2IA 5JDIC 3MGBA 1Z83A 1VSTA 2C4HA 3R6WA 2JHAA 1XZQA 2QKYA 3H2SA 3PHIA 4KIWA 4OB6A 2AL7A 4AY2A 2O8FB 1E92A 2CZCA 2X0RA 4MQEB 4ZOBA 4DLWA 1H2HA 4KUGA 3IGFA 3NT4A 4RF3A 3OESA 1TQDA 5B1DA 3RNLA 2ZFUA 3PPYA 3UYLA 1TJNA 2HJSA 2CMKA 1ZOLA 2JBHA 3WYEA 1C7FA 1WQ1R 3K5WA 3X1XA 1I2AA 1CZRA 4GP9A 1L7MA 1JEQA 1YIOA 2PZLA 3CM0A 4GI2A 3QMVA 1RWPA 1TQ6A 3ABQB 4UUMA 5CMLA 4TYYA 2Q3HA 5FOUA 3VPDA 1EPUA 4BYGA 2VZEA 3F6PA 4TXHA 1KU0A 4V0NA 4CR8A 4BC0A 2EIXA 2O3QA 4HUQA 3QEAZ 4UM8B 2D5CA 1JAXA 5AVSA 1W9MA 2PFKA 3P97A 3H4VA 4N5NA 3DBLB 1LLFA 4IQGA 3DXZA 1AM4D 1MXHA 4CLHA 2ICAA 1MRSA 5FR2A 1XTBA 2GNOA 4MRPA 3KQQA 2GASA 4C4TA 3AU8A 3ESYA 4F1JA 3DTVB 4QJ5A 1W85B 4YRPA 3KTFA 5DH9A 2DTDA 1E4EB 4JLVA 2QY9A 4QOEA 5JQGF 3N3BC 4QYIA 1ZHOA 2R11A 4MUGA 2ZRFA 1IE3A 4MQ5A 3TRIA 4LVOA 3V00A 1FP4B 2IBTA 1GAEO 1YQQA 4W5HA 2PL9A 4IINA 4EI7A 3EN0A 1BVRA 4RWEA 3QP9A 2GN4A 1AA9A 1Y4UA 3KJHA 3KLNA 2FW9A 2QX6A 3MTAA 3KSMA 3MTEA 2I4IA 3KVOA 3MTDA 4IIVA 4Q18A 3OCVA 4RLHA 5CYOA 5CHEA 1WVGA 3DH0A 3SM3A 1ZUD1 3QTBA 1I3NA 4Y18A 3HB5X 3W6PA 3O26A 5H82A 2VWHA 4M1QA 4UXIA 3WXMA 5KYKA 3FDFA 1M8FA 1FVOA 1ZIDA 5B6IA 1UZAA 1SBCA 4W8HA 2BI4A 1DXOA 4M8SA 2AKAB 2EXXA 4HEA6 4DLNA 4LJYA 4AJLA 1B8NA 1OGYA 3B5IA 3ECSA 2CMFA 2CZGA 2ASVA 1KQOA 2ZRKA 3ABOB 1SZCA 2QB5A 5ALOA 5JY1A 2OO5C 2ZI6A 1Y1RA 1MT3A 1NI4A 3A9SA 4LI0A 4MQFB 1XHEA 5CYPA 5CDFE 1G2IA 3D6AA 1W47A 5CW2A 4C0XA 3D3WB 4TL7A 2PT7A 2JLVA 5AH0A 1C3OA 2A14A 3CPJB 1FEZA 3IHLA 4KQFA 4CQJA 4LBVA 4EFLA 5K2OA 5HJ5A 4B45A 4TWZA 4FNGA 3MNFA 2X76A 2W8BB 5EZ5A 4GMKA 3ROGA 1JEEA 1XROA 4G5YA 4QZVA 1LVUA 2VHVA 1KVQA 3OPMA 3UH1A 3NBFA 4V24A 4RACA 2WZCA 3X0DA 4E4YA 3KQUA 3WLLA 3KLMX 3DBVO 4KAAA 2YHIA 1SVOA 3QPDA 2I80A 1TO6A 3GA0A 4J4TA 2VPTA 3EZXA 2X19A 4WLEA 1HKHA 1YS6A 5KNBH 1GTSA 1SEPA 3I6BA 1KJ9A 4UHHA 1FS4A 3IKTA 3NOOA 3T94A 3I4LA 3PDUA 3PXEA 3T9EA 1CUWA 4YCSA 1ABEA 4WJKB 1HFJA 2C4NA 4OOEA 1TZCA 1K6IA 1VMEA 4ZZ0A 4BX0A 5EIEA 1C1DB 1M6NA 3MT0A 3QUQA 4OUDA 2QTTA 4LJSA 1U2GA 5K3BA 3FPCA 4CEJB 5E9QA 3LW7A 2IYUA 2SCUB 1X9HA 2B1GA 3NVKI 1CUZA 4F2GA 3W3AD 3GZNA 4EB6A 3OQIB 1C9NA 1GZ6A 1M2OB 2VZ9A 1ITZA 1A7UA 3GF4A 1YC5A 1NUSA 1X80A 2BEJA 3IQZA 3K8YA 1KVUA 3GG2A 2H3EA 1QIHA 4KPUA 3OAAA 4MS3A 3WGMA 2YMMA 3Q9SA 4FGLA 4RA6A 4ETWA 2QLMA 4R9VA 3V2UA 2P2SA 1RWMA 5F1OA 1GAQA 3ZWAA 5LD2C 1M34A 2FQWA 1U94A 2IU3A 2PMDA 2WP8J 3K2BA 3M89A 5KTTA 2OB2A 5KPDA 3OZAA 5JRJA 4UTRA 3RRFA 1GPKA 3QWIA 1Z2AA 3O8LA 4MQ4A 1JPJA 5MGBA 1T9KA 4ZRMA 1XF1A 1OYWA 4KX3A 3GPBA 1PAUA 2J5QA 1PZFA 3K9WA 3M6WA 4AY3A 1JFVA 2P2NA 4M1MA 1C8KA 4JI5B 2WFMA 5IARA 3MPUA 4TYWA 2EJUA 3K3PA 4LISA 1D09A 1RI4A 3E9RA 3NVMB 3PT9A 5ALNA 1L7DA 4B2YA 2H4FA 4C89A 4NMXB 1OLUA 2EKZA 1MAUA 3FH0A 3SLKA 2HA3A 5C7IO 2VJMA 3GFSA 1JH9A 1M75A 1MQAA 3UH0A 4TMVA 3QK7A 4CLRA 3DMTA 3I32A 5ERGB 3FWHA 4CR6A 2AIRA 2W2LD 3DB2A 3E58A 4KDFA 3D5TA 5LFAA 4C29A 2PGAA 1CIPA 2G40A 3HSYA 4RDIA 5LZ8A 4J16A 5L4LA 4NV0A 3D4LA 5K01A 4AXBA 1XMOB 1OBFO 1LI5A 1OF1A 3V8MA 1T1JA 4N3AA 1KEVA 3WQRA 4NJMA 4TL8A 5ALHA 5IK2A 4DA4A 3QJ5A 1XVVA 1OAOA 1PNTA 5LQUA 2QS9A 3UXEA 3EPHA 3G0BA 2F9MA 3HHEA 1LJUA 4HMOA 1JAYA 2Q4BA 3W4JA 4B7UA 4WLUA 1IN4A 5K8LA 4K9NA 1KYIA 3CB2A 4N48A 5EP2A 5JWOA 1UK8A 2RHHA 2AJDA 2WPDD 3OLQA 4U2DA 3S1AA 1OU0A 4JI0B 4CG3A 3HEBA 3CISA 3TXYA 5CTJA 5KUTA 3DE2X 1QHYA 2XIQA 3MMSA 5F52A 3ZJ4A 2ZJ7A 4BZXA 4M21A 2X1HA 4ZRNA 4NBNA 3HY6A 1PT8A 3KYCB 3DC2A 3RJTA 3OT4A 4RLQA 3TOVA 4PF1A 2PUHA 1E3MA 1T0BA 3NEAA 1ML4A 4I5IA 4BLQA 1AK1A 1DNPA 3L7IA 4EPWA 2GOYA 2ZK7A 4PCUA 2G1UA 3ZQJA 2LWIA 1GLVA 4OLJA 5U1PA 2AXNA 5AKKA 1Z7YA 4AS3A 3HXKA 5HG0A 1G5QA 4DA8A 4I08A 1KPHA 4EG6A 1E7WA 4KLRA 2WJAA 1F2UA 1JE0A 4RNDB 4DM7A 5C53B 1OA0A 4CI9A 3UFBA 3A6EA 4QULA 1OC4A 1EGQA 5EIXA 2D0IA 4YRDA 4XWWA 2ZYHA 3K2EA 5IVPA 1NXSA 1RR6A 1JR3A 4DCMA 5I9SA 3GAFA 5ALGA 1UR5A 3EXHA 3CUYA 3WG9A 4F45A 3O03A 3GJ6A 1JEQB 3E81A 4GDMA 4UAGA 2Q7OE 4C7MA 4EB8A 3FOEC 1MNAA 2GVZC 1E7MA 4FR0A 3QWFA 2WKSA 3TH5A 5L4NA 3AI3A 4C7JA 3K71B 4PVCA 3QIAA 4IGFA 4TKVA 1J5PA 5EIBC 2R751 3SMQA 1KYZA 2R3SA 3FSJX 3LC2O 4HUQB 4L5BA 4KYTA 4PQYA 4CDGA 3DBIA 1QYRA 5KQSA 1RHQA 1YHYA 1ZM7A 2DPMA 2XJ4A 4XVHA 4D9IA 1YMUA 3R3XA 1B14A 4D4IA 4CIYA 2EG5A 4TXLA 4IKOA 4OK3A 3RHTA 4PN7A 2VOJA 1LPBB 5IBRA 3H1BA 1VBFA 4IJ5A 4AYWA 2C9YA 2G3YA 1YDEA 4YI5A 1G3UA 1JQLB 3UKJA 4RULA 4EO4A 5EI5A 2DPHA 3GAMA 4K9RA 4L22A 5JPIA 2G8LA 3L02A 2IXEA 4IRXA 4QYIB 1KIFA 3DP7A 1E0KA 5DHRA 2JLZA 2V8BA 3IMCA 1XQXA 2XITA 4OQZA 3B3FA 3FSGD 2XV1A 2D7JA 3QPWA 4JJ8A 2FWRA 4WDRA 1P31A 1BE6A 3N05A 4BNHA 5LWHA 2AR0A 4ZPXA 3G9ZA 4ZT2A 4C7OB 1E2GA 2QJFA 4L5CA 1IM8A 4TN1A 5EFZA 3WRXC 1YKFA 4BQIA 4RZQA 3GGCA 4Y6PA 1G6Q1 4D45A 1KMQA 2GZAA 4MO2A 4ZGWA 3ETHA 3CRW1 3EFEA 1KO5A 3FGPA 3GRAA 1EIWA 2VUTA 4JYAB 5J59A 1CDZA 2NTJA 3L01A 3QBDA 1RTTA 1JAZA 4NG5A 2H17A 1OAKA 3D4NA 1UDXA 4INZA 4NENA 4X62B 3FOFC 2H6EA 2OCLA 3HNRA 1KP3A 4BP9A 1DFHA 3PJDA 3H9QA 1CJKC 2ERCA 2OD9A 2FFJA 4GNRA 4WDQA 4H35A 5KPJA 2VTBA 1NI4B 1RP7A 4LXUA 3NDJA 5M3BA 4CBVA 1X8KA 4G5HA 4QUBA 2J6BA 3QVUA 4A3SA 1C3OB 4I99A 1RYZA 3WYCA 2VF8A 4EZEA 4GPTA 5CT4A 5BP7A 3R41A 4TWBA 5JDCC 4RH0A 2GAJA 4ZIRA 4EHNA 5KEIA 3L2OB 3H17A 3PDIA 2Y71A 4J4BA 3CNQS 4L5JA 3ZV3A 4BZQA 4LJAA 5J4YA 4EF4A 1RABA 1YOBA 1PNRA 2YWFA 3IAS1 3ITDA 1NFQA 3ADKA 1DX9A 2YHIB 2FFAA 3V4SA 2OFXA 2W6ID 4YQEA 2PFGA 2OA0A 1DAIA 5FV7A 3FG9A 2GBPA 4PR0A 2FEWB 4URFA 3OEEA 2J87A 3VZPA 4H4EA 2P1DA 5A4MS 1BH6A 4QOIA 3COZA 3HGTA 1SBQA 5CFOA 5HBGA 1GA1A 3PK0A 3R3JA 4X1KB 4YAOA 2AI2A 5K2MA 3RHZA 4FB4A 1AHHA 3T61A 2CVOA 4R7ZA 3GRVA 3SR4A 4OI4A 3CH4B 1NJ5A 5G40A 4OUDB 3VQTA 3L0DA 1BVHA 3I1YA 2DT8A 4JKIA 3CNHA 5AT1A 2GFHA 3WTCA 3EODA 3CEHA 5T6BA 1SXJB 4D9CA 1L7PA 1AXGA 1GSHA 1M83A 2JAHA 2UU9B 1A2BA 2I99A 2JVJA 4EB6B 3GEPA 4GE0A 2IF0A 3HCRA 2H52A 2ORIA 1PDWA 1A8HA 1X80B 5EUCA 2I6FA 4UBKA 3CZAA 1OXBB 4KPUB 4MS3B 5ARDA 1KEUA 4L8GA 3I1FA 4BV3A 1E6MA 2XRMA 3PNKA 4GGMX 4F8YA 1M34B 2WUGA 5INTA 1BEZA 1V11B 2ZBQA 3LWNA 3ZLUA 3CEAA 2CL0X 1KI7A 2HF7A 3KKLA 4KU4A 4QT0A 1O0CA 2Z2JA 4JP8A 3Q7EA 1Q7BA 3CG0A 4G0YA 4YJHA 1SWWA 5T4HA 4TL6A 3TLZA 2WWRA 3PHHA 3DLAA 4FINA 5IN5A 4E5PA 2QW0X 1A4RA 1NW4A 1RBMA 5EIAA 2VEOA 3LIPA 2H31A 4CZ2A 5M34A 3PZBA 1LPNA 2CDBA 3C7AA 4JJIA 1S4MA 3VPFA 4O8CA 2C7QA 4G0VA 5CD1A 3WFJA 3B1WA 2PXXA 4TTRA 4MCIA 2VJMB 4GR9A 3GVPA 2OQIA 3RS7A 4CLRB 2FZ5A 1Y1QA 4B76A 1HRKA 4UBNA 1WF6A 1HWYA 1NW5A 1G8KA 2Y2VA 5KVQA 5D2CA 4GKJB 4MULA 1PLKA 3BWXA 3SQNA 4MR8B 1S4QA 3K0BA 4HEJA 4NCHA 5HM6A 3AL0C 4FI3F 3TBHA 1NC3A 2D1TA 3RW9A 4TMFA 2N1MA 1PUIA 1QF7A 4Y6GB 1UZMA 3BL6A 3BMOA 3F9IA 3R3VA 4NJMB 5DJ5A 3VKVA 2PJRA 4DPLA 3Q8LA 1OZHA 2R1TA 4EELA 3FDIA 1COZA 3LT4A 3ZW9A 4K0KB 1OKKA 5J40A 5E2AA 5K3DA 4EEKA 2W71A 1L4HA 1PS9A 2AXQA 2P62A 3PXXA 2BONA 2O5CA 3S1AB 3MGAA 3JTMA 3VAAA 2Q5HA 3N1UA 3RG8A 1GU0A 1MEEA 2PKYX 1OIXA 2QLBA 2JAQA 1HDXA 4ZEMA 2OLKA 4X71A 2WAYA 2PPVA 1O08A 1DT3A 1M6VA 2HJGA 2I3ZA 3K1AA 3NOVA 3NWEA 4C08A 4GDFA 2GA8A 1H6DA 4GUAA 1NMEA 4BU0A 1C3XA 1LSUA 5AOCA 1VRWA 1YHNA 2FJ0A 2YNMA 2ODWA 3QEKA 4D0SA 3OOSA 5JWHA 4PCAA 1OI2A 1ISHA 2OC4A 2BT4A 3WQQA 4DLTA 2KB0A 4ECAA 5K0FA 2OL4A 3BGDA 1U80A 4QO8A 4UXJA 2R96A 4D92A 2R0QC 2KJQA 1IBCA 1RKUA 2K4MA 5I7UA 1VQ1A 4M8KA 5E4TA 2BGGA 1T9ZA 1U0EA 1IMOA 2RSLA 3WDSA 1Y4AE 3W5IA 1J22A 4I9GA 5DISB 2MIIA 2HA4A 4YCAA 3CH5A 4V1CI 4PQGA 1KMIY 4FR2A 1HFEL 1IK4A 1J70A 1RC8A 5ALTA 1F2UB 4XJSA 3AVXA 3TLYA 2ID9A 3QOYA 2P2YA 1YBAA 1H2FA 3OFJA 4M0MA 3NWOA 4LKOA 4TLMB 1XKXA 2XQJA 2YHSA 4OHCA 1ZP6A 5E95A 2AR9A 2OP0A 3CNNA 2VP6A 4CKYA 3WGTA 2TRSB 1UKCA 2OSBA 3RRMA 4BNFA 2NU6A 5LMZA 3IBGA 2IBSA 2M6SA 1Y5MA 2EKQA 3EXHB 2FSPA 2VXBA 3B7GA 4IF4A 2IX9A 5BPFA 2EZ8A 3JAKB 2QYSA 4OO3A 4JL8A 5AI8A 4TYNA 4EDFA 1JHDA 3IIIA 3AG5A 3DE7X 1HLPA 1PDOA 5G3YA 2O3UA 4N5IX 4TKVB 1EGHA 3RIEA 1RE1A 3ESDA 1SFRA 3MAAC 4QDZA 1H3NA 3OCYA 3ZU6A 4BHTA 2BC9A 2HX1A 4N6OA 1E9FA 2I8CA 3RRZA 1OXTA 4FOOA 3DAYA 1C80A 3CZ4A 1K3UB 5CLLA 1WD5A 1L7AA 1ONSA 2P9YA 1KKUA 2L42A 4J03A 1HX7A 3OZCA 3COVA 4D97A 3L8GA 5HHTA 1NJ6A 4DR3B 1JALA 4I5FA 2GZRA 1JRLA 1X0XA 2PGNA 3UAZA 1MB2A 1U8YA 1WMSA 4NPHA 3UXHA 5CVDA 1WCIB 3LFTA 5TS3A 4EVRA 4GX2A 1HQCA 1OYOA 1UJCA 2VJPA 2X5NA 5KQMA 3T4EA 2XHZA 2BP7A 2OG1A 3H6KA 1Z0DA 2QXUA 3SZGA 3CCCA 4PWYA 3P52A 1RFLA 2WMDA 4A73A 1O5IA 5FBHA 5GONA 1YVRA 3MK31 3LPLA 1FP1D 1L5ZA 1HT0A 1YZFA 2WHRA 2W4IA 4FZVA 1QVVA 3IAAA 4HDKA 4WACA 4IWYA 3T6KA 1I0IA 1I14A 4OF4A 4M76B 2FSVC 4ZP1A 2PNFA 4FU0A 5E7QA 3SF8A 1NNUA 3QVKA 3R5HA 2ERXA 4JK3A 4TXJA 1B42A 3USES 4P2BA 4LEIA 3TL3A 4DQKA 3DO6A 4W8GA 2PN1A 2QTMA 1KO8A 3HBFA 4FCTA 4W5WA 4W63A 5GOZA 1PVOA 5CJ2A 3TLBA 4KXUA 5KREA 5DTMA 3RU7A 3RIYA 4E0BA 2QZ9A 3HCFA 2VTBB 4NBRA 2PX0A 2FU5C 1MGOA 4XDGA 3D5EA 4YPFA 2X0KA 4OHYA 1FDTA 5AI9A 1NONA 2IPLA 3MCZA 2QI9F 4U2GA 1UF9A 1CVRA 3KQKA 4O5OA 1GKYA 2VDPB 3GLUA 3Q40A 3CZPA 5THXA 3C8HA 2B1JA 3TI9A 1I6WA 3TTWA 1FDVA 3IYLW 1NKSA 3ZE1B 2H0QA 3FI9A 4B6GA 4ZIRB 4HXFB 2IUYA 3PCXA 1TGYA 3URKA 2QSZA 1CUVA 1VB5A 2DSTA 4WW0A 5H3CA 4EF6A 3AFOA 1QYXA 1TRKA 3L05A 1EJ2A 3E03A 1RKXA 4JNKA 4AZWA 1MX3A 1QP8A 1ZK0A 3F0TA 5FA6A 5I7VA 2O1XA 1DPGA 2JGFA 5IRCD 2V3VA 3VR6D 2WAOA 2IYXA 4MJLA 4J3NA 1F8GA 4IH1A 3ASUA 3E1GA 5IJZA 5H9WA 3SQMA 1DOAA 1M74A 1N7IA 3BFPA 4O2BB 5EUQB 4B44A 4BKPA 1E3IA 1PUXA 2ZJYA 3GQBA 2XZLA 1HOXA 2P9JA 4OH1A 1BHQ1 3E4DA 1VBMA 1G9XA 5AKXA 2XKBA 3IE2A 4ER5A 1UBCA 4NS4A 1C0IA 4JMPA 4FX5A 3AR3A 3PGLA 1WPRA 4GF5A 1IY2A 4A1OA 3G1WA 5TMPA 1US8A 3OM0A 2R85A 1PYDA 3UZUA 4WLVA 3KSBC 1WMEA 3LWDA 4YT5A 3T52A 1CQIA 1YKSA 3DEAA 4BGVA 1GT91 2M98A 2WV9A 1WP9A 2ACVA 1OWMA 3A4TA 3BGIA 3K0EA 2GN2A 1MB4A 3DCYA 4ND5A 4PO9A 5EVCA 3I8OA 2N1BA 1KMCA 1K4MA 2QYTA 4WVFA 5D1NA 2ZZNA 4BGDA 1BEEA 5I3ZA 4IEFB 4QEZA 4BLOA 3MJTA 1T4GA 1VB3A 4MK4A 1YU6A 3L7AA 5TPZA 2CNWA 1LGYA 5KDLA 4C78A 3RBVA 5ELXA 1U8EA 3KS9A 4D81A 1GTMA 1KU6A 4BVEA 4YYZA 2VBFA 5IXYA 2C03A 4Q6WA 4OKNA 3CGGA 3Q3JB 3M4ZA 4YJHB 4H17A 1DELA 2I4TA 4HGZA 2QZZA 4QAQA 5ETJA 1C9DB 1E89A 4ZVRA 4HLUC 1SXJC 1LJ8A 4HT3B 4JL5A 3K70D 2R8PA 4EA6A 3FGZA 2GXSA 3D7RA 2A9JA 3HSSA 1ZD1A 1K06A 3OFND 4KQEA 3T3GA 1JHYA 3VU9B 1VLLA 1XZEA 2IEYA 1JTEA 4WGGA 1VIVA 3H18A 4NIMA 1GDDA 3LWZA 2WQ6A 2PRYA 3VDMA 1T4CA 2A5YB 3FPHA 3LA6A 4O2BF 4BQFA 3IBSA 4EQZA 3TTUA 3DEZA 5G0WA 1CB0A 1GTJ1 1NSYA 3GDHA 2IEDA 3SFTA 5A06A 3IXMA 3E9CA 4CCAA 1CIVA 1JNXX 3D3KA 2E5FA 2WWHA 3PRJA 4M9RA 2V7QA 3MINA 2I2WA 2ZWPA 3K6SA 5HTKA 2IW3A 1TC1A 2NP7A 4F4DA 3ONFA 2AB0A 5IUJC 2MYTA 2I33A 2GETA 1P7ZA 1W5FA 4FDTA 3BMOB 1ACJA 3BKXA 4X3PA 4EGSA 1RZUA 2EL7A 1GL9B 1JIQA 2R1TB 3WK4A 3CONA 4YCNA 1FNSA 2GCNA 1I7LA 2LR0A 4HNAA 4DR2B 3DOOA 3LE8A 1UAYA 3GEMA 3GLSA 4IJWA 4JJ6A 4O2AA 5CJJA 3PYXA 3N2GB 4C07A 2C7BA 3PC7A 3HM2A 3BFKA 3WQBA 2UUBB 4J3FA 3WJAA 1UKZA 1JEYB 5BW4A 3BFJA 3T41A 5CB4A 1EFAA 3LDFA 1E58A 1E9AA 1G55A 2X6QA 4AP6A 4F38A 1XVLA 3DULA 4RD2A 4DSAA 4HUTA 1JG3A 1M6VB 2W2MA 3K1AB 4RIIA 3SZRA 1N5KA 2MSCB 3JALA 5A5FA 3R3HA 1G5RA 4HATA 1QB8A 4QQRA 3E9QA 3WSWA 4QEKA 4OJYA 4RHTA 3UO8B 4UJ5A 1AQYA 3E61A 4P4SA 3Q10A 3TYXA 1H2XA 3L8HA 5E7IA 3SZOA 4TYMA 4E12A 4EPTA 5F51A 4UTNA 4Y8VA 3GGDA 1OX6A 2PH5A 5DKFA 2ONZA 1E0AA 1W6RA 2JAOA 1PR5A 2CFRA 4JUDX 1H5UA 3B3GA 3ID6C 1ONNA 1W46A 1UQTA 2JASA 3E4CA 3K1JA 3GFPA 3D6MA 4OHUA 2JZOA 3LCMA 2QTNA 3PPWA 4D9BA 3U48A 2TSYB 5BOSA 2EKBA 2FPWA 2ZI3A 3H1PA 1GPYA 4LMPA 3IUSA 4HH3C 1FTQA 1W4LA 3U2QA 4P6VF 5BV7A 4MV5A 2Q3CA 1JT2A 1ENZA 3IEVA 4FK8A 3G8DA 1UZLA 4V3BA 1D2MA 4AG6A 5E4JA 3UB4A 4G5FA 4E2FA 3CVUA 1EP2B 3L0OA 4IJMA 3QF4A 3QE2A 1KDVA 1MN6A 3VSDA 2WE7A 1IJKA 3ANMA 4RVUA 3IEKA 1NE2A 4E33A 1ESZA 2NU6B 1P7CA 3EEQA 4CL2A 1BOOA 2HQBA 5AHWA 1CEEA 1H9CA 3CUVA 2F00A 2YW9A 1ADJA 1N57A 2PZJA 3O75A 4M0DA 3VR4D 1A0OA 3JYOA 1BS1A 2R86A 4M88A 3U4MA 4ND8B 4ZYYA 1GFSA 1GG8A 3EVCA 3EXG2 4KAJA 4CDMA 3WNCA 1B0UA 1TAQA 3TF5A 1GT6A 3GJZA 3WWDA 5BT9A 4PYNA 4LFBB 3I4CA 4H77A 1ISFA 2B5VA 3TKYA 1JFTA 2AJLI 1DWPA 3TGLA 3QVOA 1T1IA 3CVYA 2IYZA 4R8MA 3I6YA 3F2IA 2VLBA 4QECA 5IKOA 1G19A 5BYKA 3UMBA 1NW9B 3EYAA 1XZCA 2FWJA 3QUBA 1SXHA 4MLPA 1XBTA 1QX4A 3SHTA 3NFYA 5IT4A 2D5BA 3KHKA 1ZWKA 3VNVA 5DI3A 3VYSB 4DG9A 5BOVA 2BGJA 1GQFA 5CD9A 3ZXUB 2XAAA 1PD0A 3EXHC 4LHEA 4PIMA 1KY3A 2A4MA 2IY7A 3GROA 4IOKA 1XU4A 4QXPA 4B8WA 3I62A 1UDAA 2JAWA 3LDAA 2ZLBA 3O4FA 3LC7O 5KJFA 2QI9C 3CR8A 2LDXA 2DWCA 3FIUA 4FUQA 4HP8A 5GONB 1EI9A 1XDBA 2X41A 1GNVA 4HDKB 3OQMA 5TMBA 1WLYA 3GMDA 3QXSA 1WCYA 2WHYA 3AONB 1HSZA 1YS9A 2BEUA 3D43A 5FPTA 3SF8B 2GD6A 1JB1A 1C7EA 1QO9A 3DEKA 1GTZA 3JS5A 3MTGA 3ZX5A 1WBBA 1S2DA 1YAJA 4N7RA 1AHIA 3OM1A 4JJEA 4C1BA 4N7MA 3C74A 4F3NA 1KXJA 4LNHA 2YHUA 3RTCA 4KQ2A 4A8TA 3ADCA 4MRNA 2PE5A 1RLTA 1ZZEA 3EMDA 1HMYA 1YGYA 2B8NA 2QPLA 3F49S 5BURA 1TUGA 4R1PA 4DWOA 5AW6A 4KDEA 4GYKA 4L9WA 3RYCB 2RE8A 4E5VA 1RBQA 1KO7A 4AMZA 1U2ZA 4NCKA 4ONEA 4E08A 1PFWA 1GZSA 3U81A 4DCVA 3CZ9A 5JHGB 2B36A 2FPGA 4ZAXA 1LX6A 4A8HA 2ZITA 3P2JA 1FB5A 4RBNA 4TS3A 4Z4QA 2JJ2D 3DMNA 3QLUC 1GNTA 1OV4A 1GN9A 1L9XA 1OVGA 3H9EO 3HGQA 3KT0A 4FFSA 4IRMA 3ZOKA 3PDCA 5CH3A 3I0ZA 3WOVA 3LYUA 3MBIA 1SUIA 3W9SA 1NF3A 2DR0A 3OH8A 4DMKA 5CDGA 4Z1MA 3ZK9A 4UTXA 4C7XA 3ESQA 3IHKA 5LYYA 4BV2A 1TVKA 5JCZA 4OK5A 2ZJ6A 3AVWA 1M2NA 4GLBA 3QFRA 3CEMA 1U8ZA 1I4DD 1ZD5A 4GOMD 2GERA 3GQBB 4J0FA 3VO9A 2JFWA 2PUFA 4MR7A 4ZPJA 5A4AA 2YJNA 3QFTA 3D6JA 1DQRA 4Q21A 4XLZA 4D9NA 1TU3A 3BB1A 4K6OA 3KQWA 3WGIA 1U1CA 2QUBA 3FDJA 4ZVQA 3RT9A 3AHFA 5K99A 2OHHA 1C2YA 2I6QA 2IIBA 3W8NA 4EB0A 1CQIB 4ZQEA 3JWJA 1LRJA 3AEYA 1P29A 3VDQA 2QUHA 3L41A 5FOQA 3EH1A 3PI7A 4KK3A 1PZXA 4OIMA 4B47A 4TYPA 1WV1A 4EQ6A 2VS1A 2XD4A 3O38A 1XR3A 2GPJA 1QIFA 2B92A 5DX1A 1XKQA 2QAJA 2DUUA 3DJYA 4I36A 1RPJA 1WZIA 1UZUA 2X40A 4YC7A 4GZ5A 1BXGA 5E3JA 1IOLA 3EXFB 3R75A 3U4GA 1G4HA 1B7GO 1WB5A 3G9XA 5BSTA 3S5UA 4X54A 1T1RA 4M1TA 1EFHA 4OHZA 4IIJB 3FVWA 2QTVA 1E18A 3DOIA 4KV9A 2XCUA 4JJKA 1YJQA 2X8BA 3BN3A 3R1IA 5J5AA 5TY0A 3IKJA 5B7QA 4W5OA 4EW6A 2X9NA 4UDXX 4U7GA 1ACLA 1KORA 3ZKAA 3E8MA 1XXLA 3VPXA 3P1JA 1UPBA 1TGVA 4MWDA 2VNKA 1PQYA 1Q22A 4II2A 1S5PA 2NQ8A 4HFRA 1RYYA 3QMMA 5TARA 2ZRQA 3CBQA 3A3NA 1DXQA 4B3BA 4UATA 1IPFA 2BHLA 3P32A 4MGHA 3UJ8A 4EY4A 2OAEA 5CXXA 1NRXA 2BBTA 3T5GA 5L3QA 3BDIA 2JB9A 5EMNA 3L49A 4LHSA 3BMQA 1QQ5A 5IHPA 2JGDB 3MINB 3OMXA 1T8YA 2CFOA 3OIFA 4FDUA 3M2TA 4HGQA 4GR5A 1EB9A 1G64A 3VR5A 4CM6A 1S9HA 1QMPA 2HNAA 5LLSA 3HK2A 2B5OA 5CK4A 3ANLA 1L2TA 4MKFA 2J08A 2XUFA 1HE1C 4BWFB 4HLNA 2MINA 2YQZA 1J5XA 2QT0A 1L4NA 4HNAB 1LX7A 3GJXC 3O2QB 1RE0A 1T2UA 4O2AB 1TU0A 4L27A 3GUCA 1LSOA 2R9VA 2Y6VA 3K94A 4CEIA 2YN0A 5BR4A 3P20A 3DE4X 3E9YA 5JISA 4UCFA 3FWKA 3K1ZA 1U7XA 5CB4B 1HFKA 5IN4A 4CT4B 2IELA 3GL9A 1M8PA 4E11A 1LC0A 4ZTBA 1P4RA 2BFNA 2QRGA 3FR8A 2RHTA 1XCOA 3KYJB 2FQ1A 2VDVE 4IIJF 3RS3A 2H2FA 4EFNA 3OKFA 1UKYA 1XD9A 2Y0CA 4IMJB 1B2RA 5C1OA 2WTEA 2GSWA 2ZT7A 3EA4A 3HJFA 4P4SB 5DM1A 1H6AA 2FWBA 4QHSA 3PFFA 4M6WA 2E85A 3WLJA 1GZ4A 1VG0B 1K4KA 2YDXA 4ZC1A 3FMFA 1R12A 2Z5LA 4TMWA 2V97A 1T3TA 3DXXA 4LRWA 4IIFA 5KOJA 1WB4A 3HN2A 2Z04A 4EB3A 1T35A 1XJ5A 2J9YB 1S7GA 2L0XA 3OHMA 3WP0A 2BKEA 1YRBA 2JZCA 3KV3O 3MS2A 4CL3A 3CJTA 5ARBA 3GP3A 5A6SA 1GFZA 4E07A 1CZLA 3GWZA 4Z7NB 1MO6A 2Z4TA 3MJHA 4GVPA 2OOKA 4P58A 2VN8A 2AEMA 4I0WB 2JHCA 5IBPA 1ZD2P 2QR3A 2XB4A 2YNMC 3X1YA 3FJYA 1UC9A 2DCUA 4JLAA 2P27A 4HAYA 4MRMA 2BJVA 2JFHA 4WK4B 1GCAA 5HKBA 2DTEA 4FGKA 4L4SA 4OU5A 3RV3A 2H06A 4YRNA 4PQEA 1Z6XA 3ORRA 1DUSA 3OVMA 4GUDA 5JAQA 4A9AA 2CCGA 2NU9A 1L5LA 3IDOA 2ZJ1A 2GM5A 3MGKA 5CB4F 3UAXA 2PX2A 4MARA 4DM4A 3DOCA 2FPSA 4WK0B 1MG0A 2YYYA 3S7ZA 2CXPA 5BVHB 4CQMD 4YFVA 1PJRA 3G7SA 3MS7A 5AVRA 3UPUA 4MDFA 1DGQA 4MWBA 4E14A 2Q3FA 9LDBA 3SYMA 3U80A 4Z9AA 1PKXA 2WKRA 4TQUS 2QHXA 1FDRA 2MTBA 3L6UA 4LZWA 2XB2A 2E1RA 5E0KB 3ETNA 5B4VA 1FSPA 5DI3B 1UBLS 4R7GA 4YP9A 1ZYUA 4OMDA 4DSOA 1UPCA 5CUQA 1FDWA 1GO2A 3OQ1A 1AK9A 1MO3A 2P6UA 2JGNA 2YV4A 3RC3A 2JIRA 1QHNA 3WIVA 1BMFD 3DWGA 3RWMB 4CQLA 3AY0A 1Y63A 1DC7A 3DLIA 1KZ9A 1YCDA 2NGRA 4J7XA 4Z6KA 2G5TA 5JBQA 3RHSA 1U7TA 5FWNA 4AWAA 4N12A 1QANA 2I7CA 2HSZA 2QTCA 5I7AA 1K0UA 1YIAA 4EYQA 1L4YA 4ZZ2A 5IZ4A 3UMYA 3H75A 3N7TA 2VWQA 3SE0A 3W05A 1HDZA 3EY9A 1QQ6A 4FBLA 1TMGE 4WOCA 5DYYA 4YYEA 2SECE 2G0AA 2EKLA 1QYDA 3A9TA 5E2IA 2PIDA 3PTAA 3