3E9NA

Crystal structure of a putative short-chain dehydrogenase/reductase from corynebacterium glutamicum
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
225
structure length
189
Chain Sequence
KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVEPIESDIVKEVLEEGGVDKLKNLDHVDTLVHAAGSVAEWHAHLDLNVIVPAELSRQLLPALRAASGCVIYINNTIYAASKHALRGLADAFRKEEANNGIRVSTVSPGPTRPEIYIEPKEIANAIRFVIDAGETTQITNVDVRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
publication title Crystal structure of a putative short-chain dehydrogenase/reductase from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum
molecule tags Oxidoreductase
total genus 71
structure length 189
sequence length 225
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.36: Acetoacetyl-CoA reductase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3e9nA00
1KVRA 4NZ9A 2YQ4A 4BNVA 2VTEA 2BFAA 3PYMA 2QZ9A 4DLBA 4PG6A 3I23A 4XQCA 5AXDA 2VYVD 4YRBA 1YOVA 3IUSA 3TZQA 4N7RA 5CDYA 4BQPA 3GR6A 4YAGA 2DPHA 2PKQO 1ISJA 1X7HA 2HK9A 3QJ5A 3WFJA 2P91A 5G0WA 2NU9A 4D0RA 3VH3A 1QYVA 2HKIA 4XX0A 5IZCC 3V5NA 1GZ3A 1TEHA 4IJKA 6LDHA 2P9CA 3UCEA 4TQGA 4GKBA 1E3EA 1ZEMA 2X0IA 3F1KA 1TT7A 4DMMA 4RVFA 4CJXA 4L76A 1E7RA 4OOEA 1NXQA 2I3GA 3JYQA 4NG5A 4LISA 2CDAA 3F46A 5G0TA 1OI7A 1PIWA 2CSUA 3DZHA 1X13A 3QV1A 4LVCA 5TT1A 2AA3A 1YOVB 3E9QA 4UULA 4XWYA 1LDNA 3OSUA 3F6YA 3KLMX 1BW9A 4OL9A 2DPGA 3JYNA 4QTZA 3OMLA 3SBOA 4P4LA 3IMFA 1RM0A 1V3VA 4OSOA 1RM3A 3IKVA 3KVOA 4QQRA 5DF1A 4KDFA 1K3TA 3DWFA 4PLZA 3ZHZA 4Q3AA 4U8GA 2JCYA 2YDXA 4EJ0A 3SEFA 5GMOA 2OZPA 3ROKA 5CFZA 2DVMA 3LZ6A 1EVIA 2GGSA 3ONFA 4R3NA 4YR9A 1BG6A 3A1NA 2AQIA 4CR6A 4Z9XA 2O3RA 5C5IA 4BNZA 3S2IA 3JYOA 1E3LA 1GQYA 3BTOA 4IM7A 3OEYA 1KEVA 5A02A 3U3XA 1JKIA 4I5DA 3CMCO 3UAGA 5IAAA 2Q99A 3PXXA 1BW9B 4XYMA 3A28A 3JSAA 1YONA 2VYND 3DTTA 3Q9NA 1SB9A 3F47A 3QY9A 4XQGA 2OORA 4LCJA 1U5CA 3AFNA 4BV8A 3BMCA 3E5RA 3WLEA 3E5MA 4BIIA 1XYGA 3QVSA 5AYVA 1DAPA 3ETDA 1EUDA 4KUGA 4DIFA 2X23A 5TC4A 5TGDA 5BNIA 4FBGA 1ZK2A 3FWZA 3QIVA 4E5MA 3L0DA 1LSOA 4XIJA 1GUFA 2P4QA 1YO6A 4MINA 4U5QA 2ZATA 1YL5A 2GSDA 1IHXA 2Q1TA 4Y8VA 4P38A 2ZTVA 1V8BA 3LQFA 2FPPA 3KEQA 2B35A 4NFSA 2HMWA 2J5RA 3NDIA 3CXRA 1EUZA 4ALNA 1IOLA 1Q1NA 3NT2A 1FMCA 3BMCB 3PLNA 4XR9A 2RHCA 4PVDA 1ZXLA 1ZZEA 5CDSA 3GGGA 2H1SA 1LX6A 5CG2A 2A35A 2W2KA 4HFNA 1VJ1A 3C1OA 1KY4A 2W90A 2Z1MA 4MVJH 2GN6A 4MDHA 3GVIA 4A27A 4H16A 4CR7A 1R0SA 3DL2A 5CEEA 1KVSA 1P1IA 1YDEA 1NQ5A 3JQ8A 4JN6B 1NPDA 3WGTA 1E1MA 4YT4A 3RFVA 1QP8A 4EEXA 1P33A 4CM4A 2B0JA 4J90A 3GNSA 3VPHA 3HB5X 3BAZA 4GVXA 3UUWA 1ULUA 4CUJA 2CY0A 4KTTE 5G0UA 3OQ1A 2HO5A 4URFA 4JX8A 1G0NA 1R6DA 3DOOA 3S2EA 4CM9D 1X1EA 4E5NA 5CEFA 5L9AA 2C7VA 1NX6A 2W2KB 4P4GA 1H5QA 1LLCA 1A4UA 2CUKA 3D5TA 5KJ6A 3F3SA 1N1GA 3LC1O 3D4NA 2VT3A 1PL7A 1H9BA 2AXQA 3JQ8B 3M1AA 3JYLA 4WLVA 2WM3A 4R1TA 4RCVA 4YWJA 4CM4B 1NYTA 2JD1A 2A94A 3UN1A 4HWKA 3RC2A 3L07A 1N5DA 5ILGA 1M76A 2X7HA 4PZCA 4RQTA 1A4IA 3RKUA 5IN4A 4UUMA 4W99A 4J1NA 3AY6A 1GZ4A 3B1KA 2QYSA 4RO0A 3VDQA 1K5HA 5DN9A 1D4FA 1KEUA 3INGA 2A4KA 8LDHA 1XGKA 4KP7A 2BH9A 2W98A 5C7LO 1XELA 2OOSA 2WJPA 4BNJA 3AM3A 3RD5A 3RUDA 1QYWA 3KSUA 4OSPA 1NTOA 4RPJA 3EAGA 1F14A 4TZKA 3AI3A 2OBYA 4TROA 4YT2A 2W2LD 3JQAA 3NAQA 2VWGA 4CMEC 1A72A 3E9NA 4AJHA 1HDXA 3OIFA 3PLRA 5G0SA 4JXKA 1HDZA 1UXKA 4O1MA 1XCBA 2C5AA 2Y1EA 1P77A 1DO8A 2POQX 4E3ZA 2DBZA 1AXEA 3OFSA 2VWHA 1DBVO 1T25A 3LVFO 2W4QA 4FW8A 3GNTA 1HDYA 4U6QA 1P0FA 4RPGA 4FFPA 2OUIA 3T7EA 1GPDG 2BD0A 3RAJA 4FJ0A 1M66A 1EBFA 3P7MA 1QR6A 1T1SA 4E5PA 5DP2A 3QA9A 4INAA 2CNBA 3JQAB 2EEZA 1FK8A 4B7UA 2NU7A 4R41A 4PRLA 2AEJA 1XLTA 4WEQA 3W8EA 1C0KA 5B4VA 3JQFA 4LMRA 3DC2A 1MG0A 3G1UA 1HLDA 5DDIP 2VOJA 3TWOA 4ALMA 4WOJA 1WPQA 4G2NA 1E5QA 1C3VA 4M86A 2Q1SA 3BMNA 1E7MA 1ONPA 4YAEA 4R1UA 4Y6PA 1ZFNA 3AM5A 3U62A 3JQ7A 3IOYA 1ZVMA 1U3WA 2NU8A 1M75A 3AI1A 2DTEA 3B20A 2O7SA 3KTDA 4PGFA 3LF2A 1PL6A 1B8PA 1DIGA 3PFWO 3GAFA 5KJ1A 1GCOA 3HN2A 5JY6A 3U4HA 2NVWA 2Y93A 1LXCA 3X2EA 1P74A 2O23A 3N74A 3UCFA 3VTFA 2PA3A 1LRLA 2RH4A 3JYPA 2D0IA 5DT9A 4GQAA 4AL4A 4HX5A 1ADBA 4N5MA 3ONEA 2X0RA 2D8AA 1RJWA 3WGIA 3H9EO 1DFIA 3R6DA 3EZYA 1VL8A 1PTJA 2Y1FA 3P5SA 1PX0A 4PLFA 3BMNB 2IYPA 5JDIC 3A4VA 3QLJA 3TL2A 3JTMA 3K6JA 4BGVA 1L7EA 4D42A 2Y05A 3RJ9A 3I9NA 3JQ7B 5KKAA 3CIFA 2FRDA 3BTVA 2OO5A 4Z0PA 4EUEA 4JJIA 4QEDA 1CRWG 4XGIA 4R5MA 4F3YA 1J4AA 1N8KA 5CEJA 2WEKA 3MJEA 4TKLA 2HDHA 2ZK7A 3L6OO 3U5TA 1VPDA 4PG4A 5JSFA 3DZFA 1LI4A 2PR2A 5JNLA 1OAAA 1DPGA 1Q2XA 5A1TA 4C7JA 3HFGA 3IUPA 2PKQP 4XRRA 4WCFA 1K6XA 5F1OA 4AG3A 4DQXA 3QVTA 4CM7A 3B70A 4YRDA 2AMFA 2YHUA 1FDSA 3M1LA 3U0BA 2GASA 1XQ1A 4FGWA 4BB6A 1JWAB 2D1YA 3OM9A 2GUGA 4IJWA 3H8VA 1A9YA 2CZCA 1PS9A 3EVTA 3UH1A 1SBYA 4AJ2A 4QO7A 3NTQA 1PR9A 2AQKA 4PLWA 3EK2A 2C54A 4GWKA 2G82A 4Z0TA 4HNGA 4Z9YA 5TJ9A 4FN4A 1X7GA 4BNGA 3WGOA 1LJ8A 3PHLA 1C0LA 3DAFA 3IDSA 3JQBA 4B3HA 1Y1PA 1UXHA 3AW9A 2VZ0A 2FP4A 5COAA 4YT5A 4WCFB 4CL3A 4D43A 2ZYGA 1LQUA 4E21A 4OQYA 4B8ZA 2RH8A 4AJLA 1GUYA 2F1KA 2ZTLA 4GLOA 2NVUB 4GSLA 2IXBA 3JD1A 1HXHA 1R4NA 3RFXA 1V35A 4QT0A 4HV4A 3U4DA 5KJCA 4IDCA 1WDKA 5I9LA 3SVTA 1MV8A 2DLDA 3DDNA 1LEHA 3JD4A 4CPDA 2QYTA 1P1JA 3JQGA 2UV8A 4MVJD 2JAHA 3MOGA 3PDUA 5F3RA 2VQ3A 2DC1A 5JYEA 5T8KC 1MA0A 3WQSB 2NUAA 4G5HA 4YCAA 3ZV3A 3D1LA 1AHHA 1GV1A 4XR4A 3MJ4A 3K96A 3VKUA 4NBWA 4Q39A 3HFSA 4CV1A 2AQ8A 1WMBA 1MFPA 2VRBA 1PJSA 3CPSA 3QWAA 3ZDFA 3KOUA 3RWBA 2R2GA 2DTXA 4BL5A 5IF3A 1R4NB 1PGJA 2O3TA 4XJTA 4ND1A 3SXPA 2CMDA 3PGJA 4DVJA 3VOSA 1A5ZA 3INTA 4OQZA 3DMTA 1U7HA 3GDFA 3AJRA 1LDMA 1PZEA 1A71A 5C3MA 3JQGB 4XQEA 3D64A 3W8FA 4UREA 2UUPA 5AXBA 4GX2A 5L3ZA 5B4UA 4PG7A 3ZCXA 4BO0A 2ZIZA 1TLTA 3S2GA 3QRWA 3ZNNA 2OBNA 3ZWWA 5A3JA 4Q3BA 4KUHA 3DR3A 3H2ZA 3DOCA 1PWZA 3PTZA 3ZV6A 3TL3A 2ZYAA 2HK8A 3OHSX 1P45A 3O4RA 1ZW1A 1NNUA 3ZZNA 1UXJA 3R1IA 5ICMA 3MJTA 2VZ9A 2DFDA 1EK6A 4W7HA 4LSMA 3DQPA 3WICA 3HHPA 1NFFA 1VL0A 4B8WA 4KUEA 2PD6A 4PFJA 2DTDA 4CMIA 1Z6ZA 5CAEA 1MXFA 1RM5A 4GI2A 5TJHA 2EGGA 2F00A 3HQ4O 4M8SA 3TZKA 3RUIA 4BNNA 1T4BA 2ZB3A 5EERA 4GKVA 1B3BA 4J7CA 4ZQFA 1YBVA 2QRJA 1G1AA 4CUKA 2FHSA 4OXYA 4IQ0A 3VPGA 4BMVA 2NTVA 3RKRA 5IZCA 1JVSA 5KNLA 1I3MA 4HADA 1HSZA 4BO1A 3OP4A 2BHLA 3DHEA 3FBGA 2UDPA 3SC6A 4YEDA 4CMGA 5JFOA 1DDOA 3GDOA 1T4DA 4NBTA 2VNAA 3PEFA 5L4LA 4HY3A 1HDGO 3RUCA 3OJOA 3ON5A 1U9JA 3I6QA 5H82A 1YQGA 2O4UX 5T57A 4CMIB 1EEHA 3RCBA 1IZ0A 1HT0A 3Q6IA 3V2GA 2I99A 3LLSA 2EXXA 1ADCA 4JJFA 4IPTA 2ZYDA 5DZSA 3ZU3A 4JP2A 4CM3A 2J3KA 2YYYA 5I9NA 4CLRA 4BMNA 3KETA 2VRCD 1TVEA 3FD8A 2DBVO 1B2LA 2I67A 4E13A 5L53A 2BKAA 5EESA 2D5AA 4P22A 3OQBA 1T24A 1QYCA 2BRUA 4KOAA 1EUCA 4IDAA 1IUKA 1U4SA 3NT5A 2DU8A 4RZHA 1EZ4A 4I9UA 4W6ZA 4O63O 1P3DA 4R4JA 5AOVA 4YAKA 4RVDA 3ZV5A 3RIHA 2Q1UA 1LC0A 5T67A 3KRTA 5CDUA 1ZSYA 4CLRB 2BGLA 2P5UA 4GX1A 2O2SA 3P2YA 5KKCA 3SC4A 1UDAA 1DB3A 4QX6A 1XDWA 3Q9UA 1P0CA 2H6EA 2HMUA 3CTMA 3U49A 1XHLA 2QZZA 2JD0A 4TZTA 3ASVA 3ADOA 4QECA 3G3EA 4WKGA 3FR7A 4RF3A 3PWZA 3WBFA 3WYBA 2OXIA 2PH3A 3H7AA 1XU9A 1LA2A 3EGOA 1YGYA 3OJ0A 4ALJA 2HCTA 2X5OA 1DC5A 1HDOA 3WGQA 3DAGA 3MJSA 1MG5A 1DHRA 3KSDO 1MGOA 1E1LA 2B36A 3UGKA 3V1TC 4GX0A 1G6KA 4R16A 1XKQA 3WSVA 5L95A 5LDHA 1TT5A 1YBAA 3PZBA 1YL7A 1F17A 4O6VA 3PP8A 4L9RA 2V6FA 4J7XA 4J4BA 1MFZA 1PR3A 2ZCUA 1ULSA 1KC1A 3QW2A 4ZQGA 4KDEA 3FCOA 3TQHA 4OXNA 3L9WA 3S1LA 1AXGA 1JAYA 4BOYA 2HK7A 3P19A 4E4YA 4E12A 3CZMA 4DMLA 3GVHA 1BVRA 2H63A 4PLHA 1JKJA 3GZNA 5DNAA 1OC4A 3RC1A 3STHA 3RU7A 1FDWA 4HFMA 3BTSA 5A9RA 3TN7A 3G17A 1SMKA 4CMCA 3CE6A 4GMGA 3GRKA 2YW9A 1TT5B 3Q2IA 1U8FO 1UP6A 3JCZA 3E03A 4K6CA 4B3IA 1T2DA 1U3VA 1BTOA 2PWZA 2FR0A 2YHIA 3DMYA 3BMQA 3WGZA 3G1TA 1PJLA 4IXTA 4NH4A 4AJOA 2E4AA 2IZZA 4ALKA 1P9LA 1LDGA 2UYYA 3ZHXA 1YRLA 4JROA 1MB4A 4M55A 3UW3A 2PLAA 5CDTA 3KHUA 1D7OA 3KUXA 4BGUA 5K6AC 3BMOA 2C2YA 3CMMA 1J5PA 3F5QA 3GZNB 3I1JA 4L8VA 4NK4A 4WEOA 3UHAA 3WBBA 2EP7A 2YV1A 4MJLA 5EJ2A 3GOHA 4BS9A 3O8QA 4OIMA 3TOXA 4IJVA 5HWSA 4YXFA 1OZAA 1N9GA 1EQUA 4II3A 2BMAA 3IQDB 4ZRNA 3VZSA 1YQDA 5CPFA 4KWHA 4FB5A 5LCXA 2JFFA 1HE2A 2VCYA 3ROMA 4XB2A 2YHIB 5JXWA 3OETA 2NWQA 1JWBB 1I3NA 3BMQB 3HB4X 4RQUA 5L7WA 1H2BA 1UZMA 2UVDA 2B5WA 3NTOA 1PJ2A 4PZEA 4DRYA 1MUUA 3RC7A 5B1YA 5LDGA 3K5PA 5DBFA 3RUFA 1GL3A 3GF4A 5DOVA 2ZJ0A 2NSDA 3E82A 5IFLA 3BMOB 3UOGA 5GZ6A 4C7KA 1B8VA 4WPGA 4JQCA 4DQUA 5KVQA 2J3JA 2FWMX 2GNAA 4BO9A 1YJ8A 3ZWPA 1PWXA 4CMEA 3O8QB 4CL8A 3QP9A 2FSVA 4WJZA 1QYXA 4N54A 1P1HA 1ZK4A 3FNHA 3W4IA 3PQFA 1N9GB 4RVSA 4MVJM 2HMVA 2A92A 2E6UX 3UCXA 2Y0DA 4E5KA 5I8ZA 3RSHA 3H9GA 4K1LA 2J5KA 4U0KA 4CM1A 5G2OA 5JDCC 1WVGA 3DB2A 4FCCA 1I30A 4XDYA 1HDRA 4NFHA 1Q7CA 5A03A 1E5LA 2Q2WA 4J9UE 1DLJA 3O38A 3WDSA 2NLOA 2QW8A 1DRVA 1BDMA 1J6UA 3F1LA 1CIVA 1K6IA 1NAIA 2DQ4A 3FR8A 4H15A 1R4MA 1IB6A 2FSSA 2IYOA 5L7TA 4E6PA 1JLLA 3AY3A 3HN7A 5AXCA 1U7TA 3DBLA 4IUYA 1I2CA 1H6BA 3VH1A 2PZJA 1N7HA 5IZ4A 1EFKA 3GGPA 1SOVA 4I5GA 1VSVA 5TLSA 2EHDA 3B1JA 3F4BA 1QRRA 2VNSA 3OJLA 3RBVA 3PWKA 3IP3A 4ZD6A 1W6UA 4FC6A 4B7XA 1DOHA 2DUWA 4W9NA 4WLNA 3FI9A 2ZJ1A 3VPSA 1EDZA 3RUAA 3FNEA 4DYVA 1HRDA 2OGUA 2YFHA 1KYQA 4ID9A 3ZU5A 1Q0HA 1RWBA 2QHXA 2VWPA 1JKFA 3FPLA 1R4MB 4ALLA 1EE2A 3BHIA 2TMDA 4A2CA 2QX7A 1U1IA 2EG9A 3DBLB 4JBIA 4RV9A 3TZ6A 1R15A 3Q11A 1Q0LA 4IDGA 3FNGA 4PRKA 3IKTA 3DZIA 3GY0A 3D4PA 4YB8A 5KVVA 3TSCA 4ROSA 4WNCA 1HLPA 3ZWAA 3INRA 5JDIA 3WQRA 4A03A 2G17A 1GD1O 2YUTA 1R37A 1L7DA 2JFGA 2Y0CA 4I08A 1SAYA 4W4TA 4B4WA 4CV3A 1Z82A 4QFCA 4FFNA 3ZW9A 5KJFA 3JQDA 4WLUA 5F5LA 2G0TA 3JQ6A 1CF2O 3I9OA 1QV6A 4BB5A 5I7SA 1R66A 1CERA 2WD8A 2Y1OA 4O59O 3CINA 1U3UA 2JD2A 5F1KA 5EMHA 2LDXA 4TKMA 3QWBA 4OAQA 2BFPA 4BVAA 4TVBA 1NBOA 4R69A 2E37A 1ISMA 1K2WA 3L77A 3C8MA 4JNKA 1T26A 4DC0A 2LDBA 5KWEA 3GK3A 3VVCA 1DAOA 1R0LA 3S8MA 4J2OA 4D3FA 4GSKA 2EJWA 4BKRA 2V65A 2DFVA 4OOFA 2NM0A 5IXSA 2AW5A 1Z7BA 3GLQA 4IDBA 5JE8A 2FPGA 1W0CA 5HBRA 3AOEC 3EW7A 4IY1A 1HZZA 4B7CA 2B37A 1NQAO 2WE8A 4NBVA 4NK5A 4BNWA 1O95A 1VKNA 3R3SA 3GEDA 3PVZA 4CLDA 1CDOA 5C7OO 1O8CA 1W4ZA 2HMTA 2Y1DA 4RPLA 3VH2A 4GGOA 5DULA 4ZA2A 4YRAA 4EJ6A 4R1SA 5H83A 1I36A 4J9VA 1QXSA 3VPFA 3OQ6A 2CVQA 1CYDA 1X0XA 4RPHA 1Y5RA 4OO3A 4XEHA 2YFQA 3WR5A 1JW9B 3UVEA 1E7WA 2VN8A 3DZBA 1BHSA 1BXKA 4L74A 4WCDA 2I5PO 1H6CA 4MP8A 4BO8A 1YDWA 4DTIA 4YAJA 2FMUA 2Y67A 1XG5A 1ISGA 3AUAA 2YDYA 3FBTA 3KYBA 1H6DA 3V8BA 2P68A 5KIAA 3HDHA 3LF1A 5T8KA 5KJEA 1UUFA 4D3SA 3DBRA 4ZRMA 3ZU4A 1KVQA 1O0SA 1O94A 4WOKA 5EIOA 3PYLA 4HFRA 2CDCA 4Q3NA 1O5IA 1B14A 4KZPA 4O0LA 3KSZO 3MJVA 4UVIA 5KCZA 1DIAA 1SNYA 1BGVA 1ISHA 2GPTA 1ENYA 4IMRA 4J1TA 2X0NA 1JTVA 1VSUA 4XGKA 3ZN2A 1UP4A 1V3UA 1VJTA 1YVEI 3OA2A 2R00A 5DBGA 4FFOA 4LN1A 1UDCA 3KO8A 4K9DA 3I3OA 2ET6A 5IDQA 2WSBA 3L4BC 4IIVA 4AVYA 4QO8A 2ILTA 3G79A 2NTNA 2EERA 2PKRA 3BXXA 2OFPA 5JC8A 1U2DA 2ZCVA 1YS4A 3PHIA 3WIEA 7MDHA 3DBRB 4CM9A 4ESOA 5A9SA 5IG2A 4CM6A 1E6UA 1YJQA 4YPOA 2EKLA 3GH3A 8ADHA 2CD9A 3AM4A 4DBVO 1I10A 2EV9A 4M87A 1QSGA 5IJZA 4BO4A 3T7CA 3K30A 4HP8A 2IEDA 1F06A 3CEAA 4IDEA 5HS4A 2HQ1A 4B4UA 1C14A 4E30A 4MKZA 4R3WA 5HS6A 4I1IA 4A73A 3JQAD 2PZMA 3CH6A 1NM5A 1XU7A 4D79A 1NQTA 1LUAA 1YE3A 3AOGA 1ZMTA 3NKLA 4RVHA 1F8FA 5U4QA 1I3KA 1N1EA 1NFQA 2PY6A 1BSVA 4WGGA 3WJAA 1ZSVA 3WJ7A 5A9SB 1SOWA 1LLQA 1NR1A 3I9KA 5G4KA 3LC2O 4UUNA 5THKA 2JKVA 3PPIA 4M49A 4LCEA 3PI7A 4OMUA 1I3LA 2TMGA 4ZICA 5GZ1A 3IJPA 4D0SA 1BMDA 4ONEA 4RF5A 4ZHSA 3DONA 4ND3A 3ZU2A 4FFLA 4CR8A 2I6TA 1C0IA 1YQXA 2GN4A 1GCUA 4MVJP 5C7IO 5BSHA 3H9QA 4IIUA 3AWDA 3WTCA 3DTYA 3H2SA 4GPD1 3DOJA 1HYEA 4PLTA 1B15A 1GPJA 3F5SA 4WK6A 3TJRA 5COBA 1P1RA 3GVPA 1VJ0A 4J1SA 4IXWA 3RUHA 2FY8A 2JL1A 4IJUA 2YV3A 4PLPA 5J23A 2E48A 5G4KB 3VVBA 2GN8A 3FSRA 5F21A 3WIDA 3E18A 3WFIA 4CLEA 3GPIA 3RASA 3Q0EA 2E49A 4D46A 4HKTA 1WXDA 4UVGA 3HADA 4ZVVA 3B1FA 2NVBA 2Q45A 3BTUA 3CZRA 5I9MA 1X7DA 4NNJA 4PLVA 3I52A 4L75A 1PJCA 3AUTA 2BF7A 2AG8A 2I65A 4EGFA 1PJ3A 3NX4A 1GQ2A 2W8ZA 1AUPA 1A9ZA 2VUTA 2O3JA 2FR1A 3QVOA 4MIOA 1U4OA 3ZNQA 3PJEA 3ANMA 1O89A 3GA0A 1WMAA 4R1NA 4BKPA 2O50A 1JA9A 3D7LA 2DKNA 3COSA 5ENVA 3NV9A 3DAPA 2FR8A 1WLYA 2PGDA 4PIVA 3C3XA 1ZSNA 3ETGA 5T64A 1K89A 3QQPA 3KLPX 3DFUA 5TIIA 4DYDA 4BUCA 1DLIA 1PJBA 1WW8A 5KTKA 1NP3A 1H9AA 3DO5A 2Y1GA 5GY7A 1V0JA 1IPFA 2BGKA 3H3FA 3C7AA 2AE2A 2QIOA 4J91A 4FGSA 3SLGA 1M6WA 5CG1A 3LLVA 3R0IA 2X0JA 1O9BA 4JGBA 3JQ9C 1D1SA 4ILKA 1NAHA 2X9NA 1SC6A 3ZI0A 2VHWA 4XDZA 3TFOA 3L9XA 3OECA 1UH5A 2Q3EA 3HDYA 3DZJA 4RLHA 1T2CA 3GUCA 1B7GO 2BFMA 4RORA 5TRTA 4PVCA 2B83A 2C59A 2JAPA 1GADO 2Z1NA 4AICA 2YZ7A 1QKIA 3BHJA 5L51A 4FPXA 4EJMA 2J5QA 5JMWA 2GZ3A 4Z3KA 2DBQA 3KB6A 1H94A 1HETA 2X8LA 3BIOA 3C7DB 2PGJA 2XPCA 5ENDA 2C5EA 4F45A 1UJMA 4WLEA 5BSEA 5T6BA 2AHRA 1WWKA 3PIIA 4BNYA 2X9GA 4IINA 2IEBA 3I83A 4ND2A 1EDOA 4RDIA 5TT0A 1AGNA 3SJUA 1HL3A 3VHRA 3E48A 2IZ1A 5FFFA 3ZWVA 2CF6A 2XXJA 4H7PA 5FI3A 2WD7A 5JPIA 1UAYA 3NTRA 2NNLD 3GUYA 1J49A 1GYPA 3QWFA 2AQHA 1BDBA 2GRAA 1R16A 1LTHR 3D0OA 2NADA 4KWIA 3WYEA 4MKRA 4J4HA 3CUKA 4BNXA 4D44A 4ZGWA 3KYCA 1K0UA 3GZ4A 4I5EA 4MP3A 1VL6A 2FZWA 1FDVA 5I7FA 4RL6A 4IDDA 5JCJA 3H5NA 1R12A 4UVHA 5ITVA 1WDLA 1W73A 1PZGA 4YQZA 1LSJA 3IP1A 1Y9AA 3OH8A 3H5RA 2RBEA 3GT0A 3I5MA 4FC7A 4NJOA 3TRIA 1DFHA 5ER9A 5A5EA 3W6ZA 3GQVA 1QMGA 4YJHA 2DBRA 1V3TA 4EEZA 3JV7A 5BQFA 1DHTA 1GUZA 2GN9A 4TWRA 5AXAA 2WD7B 3WNQA 4A0SA 1KS9A 4M89A 1XA0A 1UZNA 3H5AA 2P4HX 4XA8A 4CMHA 1NFRA 5IN5A 2Q4BA 4Q3EA 2FZEA 1BXGA 2B4RO 3KM0A 3KYCB 5FWNA 4AJNA 4CM5A 4CV2A 3BZUA 1Q7GA 4Z6KA 3OJEA 1EBUA 2J3IA 3W6UA 3B6ZA 3AUUA 2XXBA 3TPCA 1GTMA 5IDXA 4EYEA 5IXYA 5I7VA 1DIRA 1GZ6A 5JO9A 3G0OA 1GDHA 3I6IA 5JO0A 2B5VA 3V2UA 4YJDA 1WDMA 3HZZA 1PS8A 1ZBQA 2ZQZA 3FTPA 3GAZA 2Y68A 4I8XA 4YJHB 3TOZA 5K9ZA 1EFLA 5A4DA 5JDCA 4ND5A 4J43A 4DUPA 4BKQA 1HF3A 3ETEA 5TQVA 4J0EA 1I24A 1E7QA 3WOHA 3E1KA 3VDRA 2WMDA 2B4TO 4AJEA 3RU9A 2OHXA 1BXGB 2D4AA 4PG8A 1LDEA 3ZWXA 2J8ZA 3QWIA 2HUNA 4IQGA 3ULKA 1UXGA 1LLDA 2VYVA 4FDAA 1RPNA 3M6IA 1ZEJA 2OMEA 2JHFA 4XJSA 2EF1A 2PK3A 4A5OA 4IGFA 4JK3A 1LDBA 3LDHA 3WTBA 4MPDA 1GU7A 3PHHA 3RI3A 4GL4A 1O6ZA 1ZIDA 1HTBA 1D3AA 3ANLA 4FOOA 4KQWA 1DRWA 1KEPA 3F4LA 5ES3A 4DLLA 4GWGA 4P8RA 5DCUA 5FF9A 4MVJG 2C07A 1CETA 1Y7TA 4EUFA 5L4SA 4WLOA 5AQ1A 3PJGA 2J3HA 3NGLA 1I01A 4KQXA 4GH5A 4EUHA 1UZLA 2XAAA 3GMSA 3E8XA 4YT8A 4ZN6A 2AEMA 3DHNA 1PZFA 2NV6A 1ZKMA 4Y9DA 1CEQA 3K9QO 2P9GA 1Y8QA 2B69A 2Q2VA 3BA1A 4TRRA 3GMDA 1LBEA 1H6AA 4WECA 1F12A 3DFZA 4R51A 5A5FA 4B4VA 4XYGA 2PNFA 1YKFA 1ZMOA 1T1RA 2IODA 5TNXA 4AJJA 1Y9EA 4G65A 2HSDA 4OKIA 1C0PA 5DBIA 1GAEO 4BNUA 3AY7A 4B79A 4S1VA 4EDFA 5EN4A 4A7PA 1ENPA 4DPMA 5BT9A 1GQQA 1NPYA 2NQ8A 2NACA 4YDRA 5AVOA 3GNQA 5A9TA 1OMOA 1T2EA 4IGEA 4F6CA 4FFRA 4FIZA 3TNLA 4JJGA 4IZHA 1PEDA 1KERA 4OXKA 1LSUA 2GR9A 4UEKA 3NYWA 4HFJA 3SJ7A 1Z7EA 3ONDA 1C1DA 5G0VA 4R9RA 2VYNA 2WWRA 1AN9A 2CVOA 3MWEB 3QVXA 4FQ8A 4BNMA 1QYDA 2EW2A 2VHZA 1U8XX 5IDYA 2Q2QA 4XD2A 1P1KA 3NGXA 1X1TA 3MEQA 1EK5A 4MIEA 3EMKA 2B4QA 1NWHA 1HE3A 2JJYA 3NJ8A 4LRSB 2C2XA 1LLUA 1YXMA 3EYWA 2BFOA 3OIGA 4FS3A 3I4FA 2I9PA 3WG9A 1PGNA 3KBOA 2GLXA 4Q3CA 3FHLA 5I7EA 3ZWNA 3T4EA 1BWSA 1ML3A 3AOEA 4II2A 2NTJA 3GEMA 4YTEA 3V1YA 2G1UA 4NU6A 1PS0A 1WAMA 3LK7A 4RGBA 3C85A 3WWZA 5TX7A 1C1DB 3TF5A 1DIBA 2SCUA 1YB1A 2IZ0A 2EKPA 2X1HA 1CQJA 1I5RA 4K6FA 1H0KA 4YYZA 4AJ4A 3C7CB 1NHWA 1N7GA 2QRKA 1YH3A 2FOIA 4PLYA 2P9EA 1E6WA 4JLWA 3K2BA 3EZLA 4J0FA 1E3JA 1Y81A 4XQ9A 5KOIA 4OJNA 2WE7A 5JYDA 2QRLA 3QWHA 2C7GA 4JBGA 4BNHA 4PN3A 1GY8A 3HG7A 5L7YA 2DT5A 1E7SA 4G81A 4J49A 1WZEA 3Q2KA 3GG9A 1IULA 3OA0A 2Z5LA 4PLCA 2NU6A 1ZK1A 4CM8A 1FXSA 2ZB4A 1RM4A 1N92A 2VT2A 3U4IA 4UEJA 5COQA 1T2FA 3WNVA 4TVOA 3PYXA 4UAGA 3EDMA 1E1KA 3A14A 3VZRA 4A10A 2UUOA 3N7UA 2X58A 2AEFA 3WWYA 3LU1A 1SEVA 2WYUA 1ENOA 1K6JA 5CP8A 3E9MA 3DZKA 2VZ8A 4GX5A 1QLJA 1OC2A 3NJ4A 3WMXA 1TA4A 1F0YA 4BO2A 1ISFA 1VRWA 4U6SA 3KV3O 1ZO8A 1KBZA 4MKXA 3K31A 4EI2A 3WSWA 3ZNOA 4J6FA 4BO7A 3L4BA 3GN1A 1PGQA 4LK3A 1YBMA 4AJPA 4RDHA 2PH5A 2DUUA 9LDTA 3D3WA 4QSMA 4CM8B 1B16A 4LW8A 3V1UA 3D5QA 1QLHA 3K8ZA 1PQWA 4BGIA 2Y1CA 4J2HA 2BI7A 3ICPA 1LU9A 1V6AA 4Z3DA 2DAPA 4LGVA 2EJVA 2Y99A 1RYEA 3L6DA 3O9ZA 4E2XA 1ZJZA 3VH4A 1HYHA 1PZHA 3GHYA 5L40A 1SCUA 2O48X 2H5LA 1DSSG 4PCVA 1RKXA 2HAEA 5BNTA 2BGMA 3LC7O 4O5OA 4UUPA 3U9LA 2EGHA 3TDKA 5B12A 2GCGA 1HE4A 3F9IA 5CHEA 3RBZA 1I33A 5B4TA 5JC1A 3ST7A 4CMJA 3RJ5A 1UXIA 3D3WB 3KXDA 2W2LA 4OHUA 4OKNA 4RPKA 1U3TA 3PRJA 4I5FA 3EC7A 4IQ8A 1U2GA 2R6JA 2HLPA 2D59A 4XGNA 3VZPA 3VPXA 2CF5A 3K2EA 5DCYA 2V7PA 1B26A 1Y5MA 3FRJA 3WMWA 4CMAA 4EZBA 1DC6A 3AI2A 4Z0HO 4YJFA 1MX3A 2EP5A 2O7QA 1TB4A 1E3IA 3C24A 4D7AA 3PGXA 1KETA 1I32A 3CKYA 3LT0A 4NI5A 4F6LA 5A06A 1XQ6A 1NASA 2FPIA 2I76A 3M2PA 4DXHA 1IYZA 3A06A 4BNKA 4RLSA 3UF0A 5TF4A 2JFHA 5HTOA 2HJSA 4FR5A 4WUVA 4NPCA 4XYBA 2RCYA 1ADFA 1B0AA 5T5QA 3MTJA 3SX2A 4E5YA 1DJQA 4U0JA 3NEPX 1ZCJA 1VM6A 4JBHA 4M1QA 3E6AA 3O26A 5HA5A 4UVEA 1R0KA 2O4CA 1B3RA 3ABIA 2VHXA 4TRJA 4Y98A 3WLFA 4CV0A 3GFBA 4YJFB 3KZVA 3MOIA 2PTGA 5EPOA 2HRZA 1GEEA 1PL8A 5F5NA 4IDFA 1ZNQO 3GEGA 4DL9A 3HDJA 1YWGO 1TXGA 3K73O 3RBXA 1C1XA 2X86A 3MJCA 3AU9A 2X6TA 1QORA 5ILOA 3MCVA 4DC1A 1AHIA 2VHYA 4HNHA 1SB8A 4XKJA 4R01A 4YJGA 1W8DA 1JAXA 2CVZA 5A04A 3RROA 3KEOA 4ZQHA 3UFXA 2C20A 3S55A 1H93A 4MVJE 2YJZA 3OF2A 4F46A 1I0ZA 2Q46A 3WX0A 3GFGA 4MO2A 5DP1A 1LQTA 3WQQA 2O3UA 4RF2A 3ASUA 3ZWBA 4BO3A 3I9MA 4P4NA 5MGBA 4BNLA 2WTBA 5EINA 2EW8A 4CMBA 4BHTA 2VUSA 3JQ9A 2PZKA 3ROPA 4CLXA 4XZ3A 2P5YA 6ADHA 1C1XB 1FDTA 1QG6A 2QQ5A 4E33A 4Z9FA 4WE3A 4N5LA 4BO5A 3D3EA 3DBHA 5FEUA 4RZIA 1L1FA 3HE3A 4GMFA 4DREA 4Y67A 3OBBA 4YJGB 4ZQEA 2RAFA 1MP0A 3M2TA 5JW6A 2XF8A 2YV2A 4YACA 5K0ZA 3HWRA 3AFMA 4EITA 1E3SA 1IHYA 1Y6JA 4QUKA 3OIDA 1A7KA 4Y6RA 2JCXA 3PZRA 1IY8A 3VKVA 3HDQA 3P2OA 1XIVA 3MWDB 3GRPA 4CLHA 4U7WA 2VHVA 3AUSA 4L0QA 4W9NC 3DEYX 2WDZA 4RVUA 4TSKA 3VC7A 3RFTA 3DBHB 3VZQA 3ADPA 1Y8RA 2PD4A 3WGYA 1KY5A 1P1FA 3W1VA 3GGOA 4HXYA 4NFYA 4R5HA 1V9LA 4DLAA 4AJKA 4NQZA 2ZB8A 2A9FA 2JHGA 3A9WA 2WYVA 4NBRA 1T2AA 1I2BA 3JD0A 3C1AA 1FDUA 3IC5A 4PZDA 4BKUA 4BQRA 2ZQYA 4GAEA 3NRCA 1TI7A 4NMHA 1A7AA 9LDBA 1BRMA 1NVMB 2G76A 4OH1A 4MVJA 1D8AA 1M2WA 3OJFA 5L4NA 4TMFA 1E1NA 4J4TA 1HZJA 1HE5A 4EW6A 3OEWA 1S7CA 3H6KA 2EIHA 2BI8A 2GD1O 4HBGA 1KIFA 1WZIA 2X9VA 1PJ4A 1Y8RB 3I9JA 1M67A 1DC4A 1PQPA 3CSDA 1HSOA 3RVDA 4DIBA 2V6MA 2C82A 2G5CA 4BMSA 4E2ZA 5A3VA 4J1QA 2YY7A 3JD3A 3PJFA 1KOLA 4JIGA 5C37A 1DXYA 1LSSA 3W8DA 1E7YA 3H3JA 3V2HA 3I9LA 4X54A 5FI5A 3I4CA 4J7UA 2Q4EA 3UICA 3LT4A 3T4XA 1XEAA 2NVUA 3GVXA 4EBFA 1P31A 3S2FA 2GF2A 4ITUA 4GGPA 5JBIA 1GR0A 3TFQA 3GHHA 3R3JA 1ZK0A 4LSWA 4UVDA 1DJNA 3WB9A 3BYZA 3H4VA 2RHRA 3LT2A 5ITWA 1ZUD1 2J6IA 1IZ9A 3EY4A 1DRUA 1JDJA 4AFNA 5IDWA 1Q0QA 5B37A 2BELA 1ONOA 4AJIA 2HJRA 1CWUA 1HYGA 3G49A 4IZIA 4JCOA 1BXZA 4MVJF 3ENNA 4W7IA 3ROQA 5BNFA 5TS3A 4OGWA 1X14A 1LDYA 3ZWOA 4Q3DA 3U09A 2H9IA 4YAIA 4L4SA 3GVCA 2RIRA 4ZU3A 1SEPA 3NDRA 5A05A 2OL4A 5JS6A 3ZW8A 1U28A 4QFDA 5H81A 2C0CA 3L4SO 3FTNA 4IBOA 1NHGA 2XOXA 4BKOA 3IAHA 2Y66A 1ENZA 2IDZA 3ITDA 4YVFA 1M6HA 3NT4A 2IE0A 1EE9A 1VC2A 1UDBA 5JMPA 2CFCA 3GG2A 4YBZA 1H2HA 1BVUA 2EKQA 3ZHYA 2X4GA 1DC3A 5HM8A 5MDHA 3TZCA 2O3SA 2FN7A 5JLAA 4E2WA 2AE1A 4NR0A 2GZ2A 1NVGA 3RC9A 2ZB7A 4QXMA 4NJMA 5ICSA 2Q50A 3H9JA 1E6EA 4KMSA 4N18A 3N58A 4I9HA 2Y0EA 3AU8A 4C4OA 4E0BA 3MZ0A 4IS2A 4D41A 1SO8A 5DOZA 1GV0A 2I3AA 5JCXA 2Z95A 2ZTUA 5FYDA 3ANNA 3Q1LA 4CODB 3HSKA 1E77A 2VOEA 2ZKLA 1ORRA 2GERA 2CDBA 3ITKA 4CMKA 1PSDA 2AG5A 1OOEA 2PZLA 5L45A 2YQ5A 2ZTMA 3DHYA 3JQFC 2R00C 4OYRA 1XWFA 3PQDA 3ZH2A 4FFMA 3W4JA 4B4OA 2V6BA 3WS7A 1MC5A 4DBZA 4FJ1A 4DGSA 2VRCA 3EVNA 4RVGA 1G0OA 1PQUA 4PG5A 4NJMB 2OP1A 5EQFA 4WLFA 2V6GA 3AK4A 4HUJA 3ZNPA 1KC3A 1HEUA 1EVJA 4XYEA 2NQTA 4YA6A 3U4CA 4FJ2A 3IS3A 4J16A 1JN0A 5BSGA 5HRUA 5DCWA 3IIEA 4TRMA 4BNFA 4L4XA 4BV9A 1N2SA 2P2SA 1MXHA 5GZ3A 1J0XO 5G4LA 3QE3A 4W82A 4MP6A 1E92A 3PFFA 1S6YA 4NIMA 1GEGA 1KVTA 3GDGA 2PD3A 3JD2A 2EWMA 3IJRA 3ZWYA 4XRGA 2D5CA 1FJHA 4FSHA 3W4KA 5EQDA 2Q1WA 4Y6SA 3X2FA 5JAIA 3NUGA 4DA9A 1MLDA 5K6AA 1NPTO 5ER6A 1MC4A 2IXAA 2QG4A 1FF9A 1IL0A 4BO6A 2GDZA 5TSDA 4GVLA 1KEWA 1YB4A 4LRTB 4AJ1A 1LC3A 1HDCA 3D4OA 3ENKA 2Q49A 4RJTA 5KVSA 4NBUA 4H3VA 4E31A 1DEHA 1I2ZA 3EHEA 1JQBA 3DBVO 4NDNE 5I8WA 1SPXA 1LNQA 1PGOA 3QHAA 4ND4A 3UXYA 1X0VA 4D3DA 7ADHA 1Q7BA 1VE9A 1NQOA 2IRWA 4FD3A 4LMPA 4B3JA 5U9CA 3NDJA 1QV7A 5JAZA 3ZWMA 4WCFC 1I8TA 3IL2A 4E2YA 1CQIA 3HJAA 4XCVA 4JP3A 4CLOA 5LC1A 1AE1A 1EVYA 3QVWA 4M54A 1HWYA 2I66A 1ONNA 3GN2A 5BSFA 4ZQBA 3BHMA 5CPBA 2D2IA 4CQMA 3PDJA 3Q3CA 2GZ1A 4R54A 4L73A 3PJDA 4Q9NA 4XB1A 4DIOA 3VTZA 3L6EA 3OICA 4FOSA 1ZJYA 1ADGA 3DZGA 1EMDA 3WGGA 4I9NA 1EVZA 4BNTA 1PU2A 3RQSA 1U5AA 3JQBC 3RUEA 5F1PA 3GC6A 3PWSA 1UAGA 5ADHA 3WXBA 4BNIA 2D3TA 1ZK3A 3QSGA 5U1PA 2DM6A 4XIYA 3ZV4A 3FPCA 1A27A 1DFGA 4GBJA 1XSEA 4CUZA 4RF4A 3O03A 4CLOB 3PQEA 1RYDA 1GYQA 2HRBA 4DPLA 2VTDA 3GPDG 2HMSA 4K26A 1JU9A 4N5NA 1LRJA 4IMPA 4L4RA 1Z74A 3WGHA 2X22A 4CQMB 5THQA 2PGLA 4ZJUA 4GLLA 4YQYA 2PFGA 2GO1A 3MTGA 3UKOA 3ZWCA 1Z45A 1XR3A 5JCJD 4MIYA 2E82A 2OP0A 1IE3A 4IS3A 1HKUA 4DQVA 4MOWA 1LRKA 3HUDA 4CQLA 4BGEA 4WASA 5JY1A 4ALIA 2HU2A 3KYDA 3FN4A 5CDGA 3PHJA 3JQEA 4OM8A 4MVJI 1WNTA 4UUOA 1PJTA 3EUWA 4E32A 3ICCA 1IPEA 4DWVA 4TRNA 2WYWA 2BLLA 4UEOA 3FNFA 4DPKA 4XYLA 2GYYA 1DIHA 1EQ2A 1UP7A 1D1TA 1E3WA 1YL6A 3H65A 2O3QA 3ZGYA 3FWNA 5KVCA 3DMTC 1KVUA 4A26A 1VKOA 4WNIA 5JAMA 1YB5A 4R68A 4S3MA 4NU5A 3PK0A 1ZXBA 1VLLA 2X5KO 4NHEA 1E0DA 1VI2A 1SZJG 1PGPA 1GFSA 2C29D 1ARZA 4PLGA 1OBFO 3SLKA 3H9UA 1F8GA 1WP4A 3K92A 3LT1A 3ORFA 4CQMD 3FF4A 3HNPA 1UR5A 3TZHA 4CQLB 1Z75A 3KYDB 3LSYA 5EL0A 2VUUA 4K28A 1NVTA 5BR7A 2X5JO 3PHGA 1P44A 1Z73A 2JCVA 4J3FA 3DXFA 1GYRA 3ZHBA 2PV7A 4KTVE 1B8UA 1ISIA 1CJCA 1OFGA 4D45A 2VWQA 3JQCA 1Y8QB 4LVUA 4R9SA 3WYCA 1E3WB 2O2YA 3VAZA 3PIDA 1ID1A 1NR7A 1JVBA 1PJQA 1X15A 3C1TA 3LYLA 1NWCA 1ZH8A 5JAQA 2UAGA
chains in the Genus database with same CATH superfamily
1KVRA 1RYFA 1XLUA 1H5UA 4MS4B 5J63A 1KDVA 2BFAA 5BYBA 1VZ2A 4JEHA 1R6XA 4XFDA 3RR2A 3BF8A 4DLBA 5IT4A 3HMQA 3OE1A 4RE5A 4GOKA 4PG6A 4YRBA 3LGSA 1UPFA 2GH1A 4GDMA 2XYHA 1DAGA 2WPDD 4OHXA 3FFTA 2EDAA 5I4BA 4YAGA 1HDEA 1L4LA 3MS4A 3ZKWA 1WO8A 2ZJZA 1RFLA 1FFHA 2ONZA 3QJ5A 3QU7A 1JTFA 5BW4A 4EHKA 2UYCA 4GNRA 2D1RA 4QYSA 1DCFA 5T4HA 1ISPA 3WSTA 3ZVRA 3EFEA 5IZCC 5GJBA 1GZ3A 1TEHA 4IJKA 2P9CA 2DFNA 2Q4DA 5AKYA 3KJQA 1K7CA 1QQBA 1WZ2A 4KNWA 3AQ4A 4QDZA 1N3BA 2Y1LA 2WKSA 1F4VA 3EXHC 2WUVA 4UD2A 2OPHA 4RVFA 2AVNA 3EEFA 4D6XA 2PAFA 3LWNA 2BEVA 4JLOA 1TPYA 2I3GA 3JYQA 1VCOA 3F46A 1PIWA 2F64A 1LJLA 3FMFA 3NC4A 3CIOA 3CUYA 1AV7A 3K8QA 4Q1VA 4Y2JA 1NJ8A 4B6FA 4JXZA 4LVCA 2WV7A 3A4NA 2AA3A 4CTJA 1YOVB 1Y5LA 4NBNA 2R47A 5E1MA 1F2UB 3MT9A 2P40A 2OXEA 4ZEVA 4WOBA 2G80A 3AINA 3IMCA 1KMHB 3JYNA 4QTZA 4P4LA 3STYA 3KT6A 3QM1A 1FTNA 4HEHA 4XX0B 4BFYA 2FHPA 3IXQA 5D85A 5LU8A 5AJWA 1NBWB 2P6OA 3IKVA 4UPDA 2NXJA 4KDFA 1E94E 4G1VA 3RNLA 1GZ7A 4PLZA 3VYVA 2CE7A 5FUQA 4U8GA 1C4OA 1FL9A 2YDXA 3B5IA 3T0IA 1JILA 2V58A 3A3YA 4EJ0A 2O57A 1M34A 4S1NA 2CB0A 3W6NA 4CKZA 5CFZA 3AL3A 1NZFA 3LZ6A 3QHPA 4UMFA 3QKSB 2B8TA 3HKEA 4YWHA 1WLSA 1YRWA 4K2AA 3OEEA 5F76A 5FQOA 1E3LA 1VJRA 2C1XA 4LBVA 3T7AA 2BGIA 1QFJA 1NW4A 1S7GA 2VP0A 3C0KA 4IM7A 2XCTB 2IW3A 3QFSA 5D7NA 3WL7A 5B30A 2HLDA 1PNRA 2CV2A 4I5DA 3RHFA 1CS0A 2NYRA 1IVYA 4Q01A 4RH1A 1T15A 1QK4A 2R1ZA 3A28A 3L7NA 3Q6NA 1SB9A 4RFSB 2QVCA 3F47A 1HGXA 1J2JA 3LL4A 3NR2A 1NLMA 1SXIA 5D3MB 1U5CA 3AFNA 3UMBA 3BMCA 4C0XA 2AC2A 3U3JA 2EBUA 3WLEA 2Q1XA 4BIIA 5HIKA 1H5NA 3QVSA 1DAPA 2XQGA 3IODA 5IPFA 1EUDA 3K20A 2INGX 4KUGA 2WQZA 4H1TA 4P9NA 1P2TA 1P61B 5BNIA 2FN8A 2YIVX 3BWBA 1ZK2A 1DQZA 2G0AA 2PZAA 3VC1A 3FWZA 3V3TA 1RRPA 4E5MA 5A4MS 4DNPA 1ZIOA 4K86A 5J1SB 3KJXA 3OQJA 5C7YA 1ECJA 2GSWA 2JI4A 5IP5A 1KOJA 3RRMA 4BXOB 3SHTA 5KMGB 2HT6A 3BAFA 7ABPA 3AZQA 1JLSA 4M1TA 2ZZNA 2PG3A 1XEFA 2ZUVA 4M2LA 3D4LA 4MJXA 3ZJVA 4YRRA 2C57A 3GZJA 2IS1A 2ZTVA 3SICE 5AUNB 2FPPA 1ZD3A 3IBYA 2B35A 3ENQA 3OPYB 4KVAA 1KAOA 4NFSA 5EOVA 3NDIA 3HXPA 3ZZUA 1Z56C 3CXRA 3PPWA 1E69A 1YZNA 3ORRA 3U17A 1F7VA 1H0SA 2FG5A 3CRQA 5IVIA 1WG8A 3R7FA 3D2LA 3PLNA 2QD2A 3V4SA 3AONB 1KR5A 5DMXA 3SSMA 1R8QA 4DLPA 4H9GA 1ZZEA 5CDSA 3B13B 2PM8A 3AI7A 3OZ7A 3ZH9B 1Q0PA 5IKOA 4P7FA 1SOMA 5CG2A 1PT9A 2A35A 1VJ1A 4F56A 3D4BA 4B0OA 1KY4A 1OI4A 2Z1MA 1KARA 1JR3E 4MVJH 3GVIA 3KE8A 4H16A 5ALJA 4WBNB 4RTNA 4MVYA 5MN5A 1S2DA 3DL2A 4ML3A 4UCFA 3V8RA 4D9EA 1DS6A 5JZVA 4D99A 1NNSA 2FAXA 3GD7A 3KQTA 4JN6B 1NQ5A 4RK0A 4IJ6A 3ZLVA 3WGTA 3GLHB 4CKCB 1AUXA 3UTCA 1J97A 1WMEA 1QP7A 1QP8A 4MMYB 3STUA 3W1EA 4XASA 3RSFA 2J46A 2WF5A 2FK8A 2CJPA 1QU2A 3VZCA 3VPHA 3EDYA 3AETB 2O2JA 2V7QD 2VO1A 2CNWA 3G0BA 3BD8A 1E2NA 3HB5X 3IQWA 1G18A 3LV8A 3PD7A 2EZTA 4INOA 3WKCA 5KTPA 1UFOA 2CY0A 2O52A 3OQ1A 2QRNA 3L06A 1Q0UA 4WKBA 2VNHA 3SJCA 1FSPA 3O7MA 2EQAA 1R6DA 1ZHFA 2HWXA 2XA1A 3AP2A 4JX8A 4CM9D 4URVR 5L9AA 2WHPB 4NCIA 2W2KB 4LMBA 3TS1A 4P4GA 1R50A 4A8JB 1LLCA 1LV8A 2GEJA 1AQYA 2JA2A 3EQZA 4G8DA 4Y2RA 3D5TA 2OZLB 3FRHA 4C6TB 1N1GA 4O4LF 2CV1A 4UBIA 1PL7A 3UAWA 1E4VA 3VR5D 2VPWA 5B7PA 4QNMA 4RCVA 2AI1A 4QREA 4ARBA 5HVNA 5K2OA 1E61A 1NYTA 4MDEA 1LBQA 1WSDA 1BZYA 3V4FA 2IOHA 2A94A 1AO3A 2WSMA 1WD7A 2ODNA 4GPAA 4JUCA 3B2NA 4N4AA 1UEXC 4Z1MD 4OLAA 3L07A 3PXAA 4LKOA 4RW0A 1EVEA 1P1CA 1TCCA 2UVPA 2YV4A 4HJXA 4PZCA 3RKUA 4EO9A 1LTKA 4MTLA 1Z18A 5TVGA 1ZI9A 1XVUA 4RZQA 1QDUA 2XWBF 4M37A 4HMOA 8LDHA 2IP2A 4KP7A 5JYCA 2BH9A 4YRNA 2WU4A 3Q10A 3QKIA 1JDUA 4CKEA 4OP2A 1A96A 3GJ5A 3QHQA 1XELA 4OFBA 3UATA 2ZSBA 4PYNA 2PKCA 2XMDA 4LHYA 4S2EA 5CBPB 1Z4NA 2Q8NA 3PC8C 4ZTBA 1MBZA 3AFOA 5D2CA 4ABTA 4PZZA 4AB1A 3HV0A 3I6YA 3EAGA 4JA0A 2PWYA 5ALEA 1ESEA 3NAQA 3ZYZA 1U9IA 3DD1A 2FZGA 3E9NA 1JR3A 4Q1BA 1ZRSA 3TEJA 3RYTC 4JJ6A 4JXKA 1HDZA 1R5OA 2I7VA 5E6RB 2FYTA 1XCBA 2PS3A 2HQSA 1PD1A 3NIBA 4HLCA 4P7GA 2ZG6A 1KHTA 4ZOEA 4I1SA 3HA2A 2POQX 4CRWB 4E3ZA 3ONVA 2C9MA 3GGCA 2I1LA 1R8XA 3FKQA 1FMLA 3I09A 1Y98A 5GV8A 3B9RA 4BZXA 2A0WA 2VAMA 3QPAA 5CD9A 5ERGB 1SBNE 1Z2PX 4LRQA 2QD3A 1QTQA 4DILA 3B6MA 3EIWA 1F0NA 4FW8A 4RZSA 2FPUA 3TINA 5KWVA 1NUHA 1P0FA 4C2AA 1RFGE 5HE9A 1WPXA 3ABQB 3J7TA 1QKJA 3OM0A 4PCAA 3T7EA 3ZX5A 3I61A 5J58A 5ADVA 1XVAA 5B2FA 4CE6A 2IXTA 1T1SA 4BTEA 1S0UA 2Q6VA 1KNXA 5F52A 3V9AA 1YI0A 2CNBA 1SXJB 1SA0B 2Q5LA 4KCGA 4RD1A 1NYRA 3A6EA 2YVKA 4IL5A 4Y2VA 5H0IA 1AU9A 1YIOA 3I2FA 1KZ9A 1MG0A 2D3WA 2ZRCA 1HLDA 2VOJA 3NBKA 1PJZA 3TWOA 4OP3A 1WPQA 2ID7A 4LF4B 3TB4A 1KI8A 2V74B 3HCRA 4R1PA 1KMNA 2CL6X 2XQJA 2ZAMA 1NT2A 1IN7A 4IMIB 4R1UA 1N6NA 3PQ8A 5CXSA 1ZFNA 1U1GA 3AM5A 4PX2A 1U6KA 5DLEA 3RLIA 3QY0A 2F9LA 4C2BA 1ZVMA 2NU8A 5LJLA 1FUYB 4TLCA 4ZAYA 3A11A 3L1IA 1NOKA 4PGFA 3KTDA 1FLNA 3EFHA 1PL6A 1B8PA 1DIGA 1S2LA 3V8VA 4Z7OB 2Z3WA 2JCSA 1UIMA 1GCOA 2OAP1 3HN2A 4H1VA 3UO8B 5JY6A 2MSNA 3F67A 3NM6B 4ZK2A 3UCFA 4CQJA 2Q5HA 3OTQA 1PV2A 1FUIA 4HLUA 3JYPA 4CNQA 2D0IA 5J2TB 4TTQA 3W5AA 4BIMA 4GQAA 4BCCA 3WGIA 1ADBA 3S44A 2D8AA 4HB0A 2RGEA 4ZOLB 1DFIA 1AKUA 1PVDA 2VDMB 1JLHA 3KJIA 2IYAA 3LH5A 5CXQA 1EVKA 1GR1A 1PTJA 1VL8A 1MHPA 1YS6A 3HI6A 3IP5A 2WHXA 4BAZA 3BH6A 3NHZA 2BVNA 5TQ0A 3BMNB 5CK4A 3CZAA 2DPMA 3QLJA 3TL2A 4O4JB 2VCHA 1RBZA 2PL3A 3HI4A 3YASA 3C3AA 3TPZA 3I9NA 5HEKA 3JQ7B 2MINB 4DDHA 4JYAB 3ASYA 2OO5A 4Z0PA 4DLUA 1ZUNA 1LWNA 4MQ5A 4XGIA 1JV2B 4R5MA 4ZZ2A 4TV9F 3HZHA 2C3PA 1IN4A 1NXXA 2A7XA 2IE8A 2Z04A 2PGIA 3AT1A 3B3FA 3ADCA 4UZSA 1KZ1A 5C31A 3ZD6A 1KI6A 4BEJA 4PG4A 2OBXA 3CW2A 3D02A 4Z86A 1JDSA 2OHHA 2PR2A 3HYRA 4Q15A 4KW7A 4ARZA 2ZUDA 4MEAA 1JXAA 4C7JA 1CLUA 5B55A 2PKQP 4XRRA 4WCFA 5TY0A 4DQXA 5I7RA 4HNTA 4PE5B 1T13A 3B70A 4IG9A 3AVWA 1EQAA 1Z29A 3Q40A 1JEYA 4OFWA 1EHIA 1X9HA 1ZOIA 2D7JA 2X5NA 2OPBA 3EGVA 4LOAA 3WLIA 1CJMA 3I39X 1B73A 3IVMA 3OM9A 2GUGA 1I13A 6NULA 2NYUA 3IR5A 2GD6A 4N0MA 4NJEA 4PQFA 1SBYA 4FHDA 2REQA 3CONA 3V4VB 1JG6A 4MV0A 1P18A 3ICVA 3R5KA 5FWYB 3S7TA 3EK2A 2C54A 5HQTA 2G82A 4RD6A 4Z0TA 1Y7IA 2I29A 4DKXA 3KIPA 5LR6A 2JI6A 4PONA 2W6JA 4IX1A 4BNGA 4RBNA 3WGOA 4DZTA 1MH9A 4DUYB 1O4WA 3MWJA 4AWAA 4BLOA 1FU7A 1LJ8A 1YNOA 2Z9BA 3PHLA 5ED4A 1Z0SA 5BV1A 1K88A 4N5DA 2VG8A 1IXZA 5EXPA 3KB2A 2JAXA 2FWIA 1NMYA 1U02A 4M0EA 3FROA 3GDHA 4I1VA 4E21A 4C04A 4UTZA 3BUSA 2A3NA 4RWEA 2A5JA 2RH8A 2RHJA 3IHTA 1GUYA 2F1KA 3OFNA 2NT4A 3UOAB 1A2OA 4UOEA 3UPUA 3JD1A 1SVUA 4FLEA 3LUDA 4LQLA 2OY0A 4PAGA 5SY9A 1PFUA 1R4NA 1VE3A 2V3WA 4LYDA 4NS4A 1U98A 2CXPA 4HV4A 1GG8A 2BCEA 2F9FA 1LB1B 3D6MA 3ZDRA 1WDKA 3ZY6A 4NSNA 1R00A 1EFRD 4R7TA 4B3MB 3JD4A 4MCHA 4NU0A 2JIZD 1I2DA 1QRDA 2QYTA 3VNSA 5JASA 5JNTA 3QUAA 2G5GX 3OSZA 4TSFD 1EWRA 1Z7WA 2ZT6A 4EFLA 2JAHA 5F3RA 4IIBA 3UWKA 3OVMA 4H1WA 5B36A 5AVWA 4RKYA 3BE5A 1HG1A 3DEKA 2A33A 2R4TA 4N5IX 2Q0SA 4X6YA 4XTRA 5D5HA 3UHFA 2VJNA 3VU9B 4D8XA 2J3EA 2NT3A 3CGWA 1N4DA 2AFIE 2RGDA 3H11B 3K96A 4K3VA 4X61A 1L1QA 4Q7QA 2AKEA 4YUZA 2FP4B 3Q8KA 5C52B 3FOCA 3HFSA 4HK4A 1H2WA 4WZAB 5AM3A 4R9VA 3OT5A 1OXTA 4HRVA 3ZDFA 2V45A 4G9EA 1L5LA 5KYYB 5JRDS 1DMRA 1J24A 2IYYA 2Z2XA 1D2HA 3FKJA 1CR1A 1PGJA 2O3TA 3R23A 4XJTA 4RTKA 3RVKA 3SXPA 2OXRA 5F2KA 4BFSA 4BLQA 4OA5A 2ZBVA 1OBHA 1RXIA 1VLHA 2EJCA 4PZPA 1JE0A 3JAWB 3LXUX 5C3MA 1Z13A 3JQGB 4FGLA 4EA9A 2EC5A 5DGHA 1PT6A 3KDSE 3EQ8A 3W8FA 2K87A 5BOSB 1PNOA 5AXBA 3WLTA 3I5UA 2Z83A 1FMFA 1Z25A 2XAUA 4FNOA 2QX9A 1TLTA 3S2GA 4R2IA 2Z8XA 4URZR 4F9EA 3ZNNA 1O9GA 1WY7A 3IVRA 4JCCA 2VDQB 4Q3BA 3ZWWA 5A3JA 3HUFA 1IIRA 5JT1A 1RJEA 3IERA 2ZYTX 5TMDA 4RSGA 1CRPA 5CJJA 4G4IA 2IEIA 3OHSX 5HE8A 3KTAA 1LNZA 3WDLA 1NNUA 4UBJA 1UXJA 3ZGNA 1N0WA 3FW1A 4K9OA 3MJTA 1UOOA 1WVIA 2GS9A 5F3WB 1EM8A 2PUBA 2DFDA 4DIMA 1EK6A 4W7HA 3FRIA 4YV1A 4LSMA 4DIUA 3ZCQA 2E3JA 1ZMXA 4ARIA 5EIFA 5FR2A 2BJHA 3ZGXA 4OQNA 2OOKA 5J9FA 4B8WA 1UWKA 1M6EX 1WCXA 3KG2A 3V4RA 3M5DA 2C5SA 1Y4AE 3W3ZB 4LPSA 3FIUA 1MXFA 1OLSB 2NAFA 3I1FA 2EGGA 2M98A 4GI2A 5TJHA 2FUCA 4BNNA 1DNPA 1T4BA 5ALVA 4JI4B 1L4FA 8MHTA 4QUBA 5EERA 4ZQFA 3AV3A 1E2FA 5HRCA 2AZTA 1DBPA 1MV5A 4Q21A 3R7LA 4XOUA 1VIDA 2V8OA 4CUKA 4HN4B 1QU3A 3A0RB 4UU1A 4XVQA 2EBWA 2FCRA 2R65A 3QBVA 1XEXA 4XI9A 4PXSA 2PGNA 1VZ3A 3AEKA 4XLTA 1I3MA 1XA4A 2HH9A 2AFIA 4TV8A 1YQEA 3OC6A 4ZVNA 3TLXA 4BO1A 2BHLA 5DT2A 4CQNA 2UDPA 3SC6A 3VX3A 1TIBA 3FZYA 3GDOA 1T4DA 1EP9A 1YA4A 3PEFA 5KPDA 1O5OA 4GP6A 1AQ6A 1CRZA 2DH6A 1WXIA 3UJ6A 1Z4OA 3CLSC 4A8HA 4PQRA 1E5XA 1EEHA 1V2GA 1Y33E 4L15A 3RCBA 1A8IA 1PQ4A 1QF6A 2MU1A 1WB4A 4TMTA 5LBTA 5AW2A 3LLSA 2EGUA 5P8WA 2ASVA 4JP2A 4QFMA 5A71A 4EJSB 3D3QA 5IYZF 3PDHA 3LS2A 4C05A 1XMQB 3E3AA 5C8VA 3OFJA 1V7QA 4KVFA 1PR2A 2ZU0C 3CEJA 2RK3A 2MMGA 2BMEA 4JFRA 4U2KA 2I67A 4JJ8A 3NYRA 4Q00A 4CN8A 4E13A 4X41A 4EKIA 3NUZA 4BRUA 2IQ5A 2BKAA 4YECA 2D5AA 1E1YA 2V0GA 1XZKA 5CNJA 4ZCLA 1N34B 4P0PB 2Z2KA 3BSYA 5EKSA 4X8LA 4ZXFA 5FA6A 5A6SA 2R84A 2HNKA 5SYAA 1RI3A 4HR7A 2C4WA 2X6QA 1R9MA 2XX3A 3FCCA 4R4JA 2ATXA 2FSPA 3GLFE 2XCOA 4DMCA 1UF9A 4QGHA 1I1HA 3QVLA 5HHTA 4XWWA 3EYAA 3IT2A 1ZM7A 2QT0A 2UZAA 3M6MD 4UASA 3ZV5A 5HKBA 2PT6A 2WR8A 4L5IA 3UAXA 1OLXA 3CLVA 3IDQA 3X1JA 4R8SA 4ZZ3A 2YVUA 2FR8C 2O2SA 4GX1A 4DC9A 2R6CA 1IEVA 1T1GA 1LH0A 2DLNA 2PPLA 1TVKA 2ZE8A 4PEVA 1QH8B 1N9KA 2VJBA 5DEOA 2XWSA 4KXXA 1MJFA 3CTMA 3Q41A 1XHLA 3R9IA 2IH2A 4BBPA 3OBIA 5CA1F 5EJ6A 4X65B 1IH8A 2EFYA 4OU4A 1AG9A 1GFZA 1MORA 2Q3JA 5D3QA 5SYMA 3AVPA 4DR2B 1AUQA 3PNMA 5FADA 4K40A 5JZOA 3TL6A 3HEMA 4HLQB 1THGA 3ZLTA 3OP1A 2AV6A 3N7AA 2GZSA 3PWZA 4LXUA 2C04A 3H7AA 1XU9A 4X00A 3AR2A 4K0RA 2NN3C 1YGYA 1E6LA 2PGXA 3FYUA 3C3KA 2C0PA 4F7DA 3TKAA 5LOVF 1HDOA 1PK7A 1REQA 2J0SA 4DBLC 1E1LA 2B36A 3BG5A 4R16A 4QA9A 4JL8A 3C70A 4P7JA 2JANA 5L95A 4YHHB 1VTKA 1RTKA 1TT5A 2ONCA 2DCMA 4YMGA 4B3FX 3PP8A 2JGMA 2WD9A 4J7XA 1VYUA 4L9RA 4A92A 1ZH6A 4EOGA 3R9XB 3K1JA 1GRCA 3OM8A 4NS1A 1ULSA 3C74A 2AYYA 3IKMB 4FGZA 3EGCA 4ZQGA 5FOUA 3DB1A 3NCTA 5TMBA 1THTA 4Y2YA 3L5KA 2O2EA 1JAYA 1Z28A 1KJIA 1Z2OX 4FMBB 4QVIA 3SF0A 2GJ9A 1PE0A 2R25B 2HK7A 1E2IA 1Z3IX 3P19A 1H0HA 4JP5A 4TMYA 3ROEA 4E4YA 5IABA 4DMLA 4P36A 3R09A 1QO9A 4P81A 4PLHA 4PIPA 4H7EA 1RLTA 1OC4A 1WKVA 4LJ8A 3QJYA 3STHA 3RU7A 2ID9A 3PNOA 3QKWA 5H8WA 5BWCA 3OZFA 1WV0A 1MN6A 3K9BA 4BMXA 4YCNA 3BTSA 5IVPA 1Y5NA 1NNLA 3GRZA 2ADOA 3AH8A 1SC4A 1SH7A 3U1VA 1C3OB 1LZKA 1O6BA 3GRKA 2VYCA 2YW9A 3BSSA 4LYJA 2FUG1 2VATA 3SMQA 5CFNA 2BKLA 3HKCA 1U8FO 2J85A 5T3UA 3GLFA 1N32B 3V1MA 1BTOA 4QJBA 1ISSA 3DMYA 5JAUA 1H3NA 5LA6F 5L3QA 3IHWA 2CNDA 1P2SA 2ACKA 4M8NE 4ZVRA 1UBFA 1JSLA 4NONA 3ROTA 3WGUA 3M9XA 1YBFA 3QELB 1LDGA 2GQ0A 3OOSA 4KB5A 5A4IS 3ANSA 4JROA 1MB4A 1UJNA 1MIOB 4I5IA 3Q72A 2C97A 4UDYX 3RABA 3TW0A 3KUXA 4BGUA 5AJYA 4UU7A 1NRXA 2I4NA 4A8PA 4E5DA 1JKJB 2HMYB 1TZJA 3TQOA 4L8VA 5EXSA 2QLJA 2EP7A 4MJLA 1X87A 1G6HA 2AG0A 2EAUA 5LLSA 3IEIA 4JR0A 4YH1A 1PK8A 1MNQA 2QAGB 3DVQX 1RRFA 1YFKA 2WVAA 1EQUA 4U5XA 3IQDB 3OE4A 4NYMQ 3N75A 4KWHA 4X7RA 5CPFA 5LCXA 1LWOA 4D3XA 2NXEA 2CHFA 2QP9X 2NWQA 1JWBB 4H59A 4RQUA 3SKYA 1QX3A 2GBGA 2NUTA 7REQB 4PO8A 1BFUA 1GGMA 3GUVA 2AOXA 3JQPA 3M6UA 4J0JA 4PFSA 1XAIA 4DRYA 1UKBA 4IKEA 4RD3A 4XUGB 4LSGA 1XQ9A 5DBFA 3GEBA 3LPDA 5B1YA 4TYNA 1C7FA 2YYZA 4FMDF 4IIGA 5A4AA 1GL3A 1KAEA 4JQYA 5KTNA 1MC1A 3BXEA 1A7JA 1NQXA 3L6UA 3TZEA 4C7KA 2E2WA 1QPBA 1Z4QA 2QTMA 4DQUA 3BK7A 1U31A 1ZGBA 2J3JA 2GNAA 4TXLA 3W8NA 1QGUA 1YJ8A 3WRVA 1PWXA 4CMEA 4WK0B 2ZLBA 2IQIA 4CL8A 2FSVA 3VYSB 5CH8A 1P1HA 1ZK4A 3FNHA 1Y6RA 2BTQA 4XE5A 5HJ2A 3C87A 3O3CA 3UB2A 4D8WA 2HMVA 5CNIA 1K8YB 2E6UX 4RJLA 3SZOA 1G8AA 1SU7A 5LBUA 4B6RA 1EAMA 3QXJA 3H9GA 4CM1A 4U0KA 2H11A 2HYDA 5G2OA 4BQOA 2G9RA 2OKCA 1MX5A 1I1QB 1ZICA 2IPNA 3CZPA 3D43A 4MUXA 1I30A 5AFSA 2H54A 2XMPA 1NW3A 4RHXA 2G0NA 421PA 1NVBA 5A03A 4G5GA 4HC4A 2AUTA 4XSHA 1OBVA 2QUZA 3L49A 3SOPA 4RTLA 4L28A 2NLOA 1ODLA 4IIJB 1BDMA 1W47A 2Y2UA 4F1KA 3BCUA 4DSTA 3WAGA 1FY2A 2VP3A 1W85A 3A7DA 3THWA 4W7SA 1Q44A 3AY3A 5AXCA 3Q3EA 4NFLA 4IUYA 4NARA 3TRJA 1I2CA 1XNQB 3PEWA 2Y8EA 2ZR9A 3OLZA 3GGPA 2LPMA 2V9PA 4EY3A 2PUFA 3DZDA 5E2AA 1IM8A 5IM5A 4BX0A 2FN4A 1I1NA 2VNSA 3N0TA 2GEKA 1FYEA 1U3DA 2VAXA 2VC2B 3THXB 3E7FA 4IAOA 2GBLA 4RL4A 3MVEA 4ZD6A 4FC6A 4KN5A 4ZJPA 3GMIA 3SVLA 2VSFA 4A2QA 1Z38A 1YAJA 3RUAA 3FNEA 4RY9A 2YFHA 4ID9A 1XDGA 3ZU5A 3FYCA 1XAHA 3KQPA 2AFHB 1KR2A 2VJKA 3EIOA 2N0SA 3IAEA 4FWTA 2Q5OA 1ZOLA 3UJPA 4P2BA 4UCQA 2O8EB 2FLWA 3ZCVA 3GJ0A 3DMPA 1EE2A 3BHIA 2UXCB 4A2CA 2ZIXA 3TZ6A 4RV9A 4YONB 5LJIA 1XRPA 1MQ9A 5EIWA 2AMLA 4YPVA 2ZJ6A 3KU1A 1AJEA 2Q5JA 4S1OA 1R5BA 1CDEA 1JDTA 3CUEF 3DZIA 3OU6A 2QLFA 4YB8A 3M4XA 1Z88A 3KT0A 3MNFA 4H35A 4ROSA 2PXCA 2G9ZA 4BEBA 1TD1A 4KE8A 3VU3A 2O8CA 5KUTA 3L7IA 4WNYA 3INRA 4U63A 4UCXA 3WQRA 3FVRA 1JSRA 4J0IA 2P5TB 1R37A 5BWLA 2X5XA 2OTCA 4ICIA 1SAYA 3P2IA 2B8JA 4CV3A 2I2AA 2CFOA 4FFNA 5KJFA 4LPKA 5T4BA 2V55B 3L7KA 5AT1A 3ELWA 3UMFA 4FYIA 5F5LA 3WHLA 6Q21A 2G0TA 1PDVA 3JQ6A 3EEQA 4AIRA 4M22A 1KHHA 4HHEA 1OFUX 3DLAA 1CERA 1J7JA 5HKOA 3CINA 3Q7QA 5G02A 3E0XA 4BZQA 3KPYA 3B6EA 1MT0A 1SKAA 1DAIA 1U2PA 2EBFX 1PO7A 2JH3A 2RHTA 3PDIB 3QWBA 1Q1EA 3KP1A 1E2MA 4FXOA 4GI3A 4JVOA 4TVBA 2GZDA 3F97A 5BR1A 5AIBA 1CY8A 1QO0D 4NOKA 4JNKA 2AMVA 3N8DA 3NEAA 1FP4A 2Z5FA 1Y1RA 3PSHA 4DC0A 2LDBA 4C7BA 4YMSA 1R7RA 2QR2A 3FUTA 3S2SA 4LXIA 5KTOA 3VJRA 1CEEA 2LRHA 5EVCA 4HAUA 3LPNA 1RE0A 2E5FA 2WMYA 1DO0A 1XMXA 3BORA 3FB4A 4GSKA 1WSBA 1OFTA 3A1WA 2V65A 1KTIA 3IQHX 2K2WA 2IDJA 3F0TA 2XT9A 5IXSA 1P2UA 1Z7BA 2AW5A 3GLQA 1AQLA 4WUTA 2FPGA 4PQYA 1CNFA 1YJ5A 3OKPA 3PNKA 2ZRBA 4L51A 1N2IA 4GDFA 4TT8A 4BQSA 1HZZA 3C3JA 4GLBA 2VP9A 4EEKA 4N82A 4BNWA 8AT1A 4RLFA 1JHZA 2LIPA 1P4RA 1O95A 1VKNA 3FJYA 5AOBA 1KZ4A 3U7EB 2UU9B 2FRVA 2VYQA 3GEDA 3NWBA 5EJGA 1O8CA 1OFUA 1W4ZA 1BKDR 2HMTA 4TL7A 3S1AA 2Y1DA 3FNBA 4YLEA 4BVFA 1F0KA 4DG5A 3VH2A 1GPNA 4ZA2A 4GM4A 5JCOC 3HGTA 1M1UA 2UZ1B 1B76A 1U9YA 4UM7A 2AHOA 4J9VA 1XCLA 1Z2CA 1D9XA 2NO1A 3JPWA 1BC5A 2Z8YM 3DM5A 4XLZA 2FE1A 2CVQA 4ARAA 4Z51A 4CFYA 1TYBE 2POCA 4RHEA 2YFQA 4JP1A 2CCGA 1JW9B 5ITZB 1TYEB 3H2JA 1CUGA 2FI1A 4BO8A 4C7OA 4DTIA 5C18A 1JDPA 1YDWA 1FUKA 1U7PA 1A0OA 4US0R 1Q3TA 3KYBA 3FBTA 5K45A 2AXEA 4DLWA 3BJIC 5T8KA 2ISQA 5BN3A 5BVGB 2QXYA 3U4GA 3A1DA 1I7SB 3HVIA 2LD4A 1KVQA 3EDCA 5DBEX 4OJTA 2ODPA 4WOKA 3TOCA 1A98A 3GAAA 4HFRA 2J9FA 3DYVA 1RTTA 5DX8A 1A3CA 1B14A 3K35A 4KZPA 4R0NA 5HK8A 4QYIA 5HPYB 1EI9A 5KCZA 3CA8A 1ISHA 2OECA 2WYIA 3NW9A 2YS6A 1K1EA 1C7RA 4DLVA 1FLDA 3NC1C 4WCVA 1EFAA 1QAOA 3HBMA 4XGKA 1KRWA 5F64A 1VJTA 5LZ7A 3D6VA 1KP2A 4K9DA 1W9HA 3PDWA 4RA6B 4WACA 2ET6A 1ZWKA 2JBAB 2Y27A 5L8VA 4IIVA 3R77A 2ETVA 4FFBA 4QO8A 2ILTA 2Q4RA 1F6WA 4F8YA 1VLMA 2EERA 2PKRA 4KV7A 4RY2A 4ASUD 1DKOA 2Z30A 4DWJA 2BAGA 5JC8A 3GBVA 2ZCVA 1YS4A 3PE3A 3IB3A 5LB4A 3WIEA 4I8IA 4A6PA 4ESOA 1R27A 4LOJA 4D0NA 4YO7A 3RW9A 5A9SA 5CD1A 2F2TA 3DKKA 1YJQA 5AI5A 3GH3A 1ULBA 2CD9A 1FQOA 1HY3A 1NI4A 1PTKA 4M87A 3M8KA 1AZWA 1A9TA 1V7PC 4KX5A 3E3MA 5EMLA 3Q7RA 3T7CA 1TUGA 2OM2A 2PYDA 4HDCA 1S2GA 1UT5A 3CEAA 2XVAA 4UMVA 4QICA 5DI3B 2XRYA 1FSGA 5BSWA 4XM0A 2EL9A 1QB8A 4MKZA 1QUEA 1RYZA 4IEIA 2JC3A 1HA3A 3T3DA 3CEMA 2A14A 1VG8A 1S8NA 3K9FC 6REQB 1SXJD 4XWGA 2YCLA 1F60A 1XU7A 2G77B 2HHLA 3FWHA 3LDUA 5LP6B 3UV6A 3KQOA 1LUAA 3LDAA 1YE3A 2DHRA 3RQIA 3WKEA 5HSGA 2B61A 1ZMTA 2Q8PA 4RVHA 4D81A 1F8FA 3LECA 5U4QA 1N1EA 3LW8A 1BSVA 2CYCA 1QGOA 4DDTA 3WJ7A 2LWIA 1SOWA 5GINE 3AKEA 4RTSA 4L22A 1B2RA 4Q12A 2BONA 2XNDA 3PPIA 1T8WA 4M49A 4QARA 5AJXA 3V42A 4ZICA 1UJ4A 5LLDA 2H06A 4TVSA 4D0SA 1BMDA 1SKUA 1V7ZA 1XRJA 3DONA 3R2JA 3BB4A 1RJGA 1SPBS 4BCBA 1I1OA 4FFLA 4CR8A 2I6TA 2VDWB 1YR1A 5BV8A 1T3HA 1YJAA 5C7IO 3R5TA 2X2FA 5EFZA 2IXEA 5CX1B 2GA8A 4NEHB 2OV8A 2V1XA 4X45A 4AC9A 4DAOA 1CB0A 4E15A 4Q4AA 3L7OA 1NVEA 5HRAA 4LDRA 3EH2A 3E53A 2AF3C 3WMFA 3TIGA 1CFJA 2BIFA 1VJ0A 3EX7C 4IXWA 1VJDA 2I8LA 3E5HA 4B09A 3LSTA 4NCHA 1QH0A 3SNHA 5G4KB 4UTNA 4FP9A 2GN8A 5KWJA 5SY6A 4B82A 5F21A 1MAHA 3C6BA 3WFIA 4DM3A 1L8OA 2QR3A 2E21A 2WM8A 4HKTA 1C8VB 1NU8A 3KPWA 4NCXA 2ZRDA 3EVCA 3FLAA 1H1LA 1E1QD 1XU4A 3B1FA 3BTUA 2Q45A 3CZRA 4KFTA 1YI8A 3VZDA 3VV2A 4HX9A 4NNJA 5IK2D 2FW8A 1CEXA 5E7JA 3I52A 1H3EA 3EUAA 3G0CA 2PKWA 1M74A 4KFUA 4XWAA 5FAKA 1VXOA 2HV8A 4JVLA 3LKBA 3R7BA 1CZKA 1GQ2A 3ELDA 2V6IA 5KYNA 3IAS1 2VUTA 3VZBA 2FR1A 1FX0A 3QVOA 1C8LA 2XB6A 2G8NA 3D54D 1U4OA 3PJEA 1QVZA 1O89A 3ANMA 3G8BA 2JVKA 1E1RD 2DWPA 4R1NA 4X85A 5AKLA 4H1UA 3PFKA 2OO7A 4JIMA 3D7LA 3TAXA 3Q7TA 1AGRA 4M7PA 4ZU1X 3TZLA 3FYDA 2AMJA 2R8EA 4CCYB 2XI4A 1BH6A 1L4HA 3N2LA 4UUAA 3C3XA 1ZSNA 3ETGA 3H83A 4L6CA 4DCJA 1N2JA 1RQXA 4E1VA 5G1PA 2QI9C 4HPWA 1F0PA 1Z0JA 1AK9A 3PC6A 1H9AA 2GK3A 3DO5A 4U7DA 5GY7A 1H8ED 1OX4B 4DLKA 2NGRA 3E5NA 4RCYA 2J32A 3EF3A 3H3FA 4BYMA 5HQ3A 1I7QB 4MW4A 3C7AA 2AE2A 1WCIA 2I4RA 2OYSA 5BYKA 1M6WA 2KI5A 2PJDA 1WULS 3HU1A 3KBBA 2X3FA 4WH0A 4CN9A 4LE2A 4GLFA 4DMFA 1U8TA 2Q9AA 1N0UA 4ILKA 2J09A 4K5QA 4Q18A 4NCNA 3LKDA 3EGDB 1KYWA 4NOMA 4YR7A 1FZQA 1SC6A 5ULLA 2VHWA 5F2OA 1JPVA 3AKYA 1V25A 3OECA 1UH5A 3ZWQA 3CV3A 5CITA 1UL1X 5JS8A 3Q0TA 2PJUA 3LBHA 3IPXA 4Y9TA 5KNCA 3RYCA 2WUEA 1RHUA 1T2CA 1O6GA 1X42A 2G6TA 4XW2A 1W36B 5FOTA 3KT8A 1WVMA 2R8ZA 3KWFA 3NALA 3QPWA 3H8JA 3UMMA 3A05A 3DKPA 2B83A 4PVCA 4Y7DA 3TQTA 5JHHB 2B1GA 3GEHA 2YZ7A 3PR1A 2WAMA 4JT4A 5KTRA 4O25A 2AG1A 3I0MA 4LHVA 3U3MA 4EJMA 1X7YA 6YASA 2CLSA 2WF9A 1RLUA 4L1KA 3QF7A 2QG6A 3D0KA 3RT7A 3O8OA 4HQRA 1H94A 1LBSA 2DR3A 1Z2AA 2O0LA 4X1YB 5EXDA 3UMVA 4ESHA 4N6OA 3JR3A 1FLAA 4B3XA 3W5SA 4HUTA 5BSEA 1BD4A 1OWOA 5EWMB 2EFJA 3DVAB 3KSRA 1M2VB 1GNRA 4IINA 4Y18A 4IRXA 2CD7A 1UPAA 3T12A 3LOUA 2O1WA 5D3ZA 5CA0F 1AGNA 1NBMD 3RADC 5CUQA 2IZ1A 5FFFA 2R87A 5GJVC 1A9PA 1AT1A 1SU6A 2XXJA 4Q19A 1Y7PA 2DFLA 3LWDA 3UJBA 5DXAA 1JAZA 1N0VC 4GICA 4QUEA 2NNLD 3GUYA 2QRVA 1GYPA 3C15C 5IANA 5D5QA 4F3KA 3D0OA 3OTOB 3AJ9A 4WINA 3LUJA 5EUQB 5C5CA 1ZC3A 2QQ0A 4D44A 5A7GA 4ZGWA 2C2WA 3CKMA 3KX2A 5KZMB 4MP3A 3HKBB 2FZWA 2ONYA 4M8KA 5AK0A 5A5GA 5I7FA 5LM3A 1H8HD 2C84A 5JCJA 3TRDA 3T5CA 5ICFA 5CJ2A 2B4KA 1WDLA 1A8UA 1LS6A 1W73A 2XLCA 5PNTA 2Q5CA 3HM2A 4DMUB 4FC7A 2RBEA 3GT0A 3VR4A 1G5QA 2IX9A 1DFHA 5A5EA 5FX2A 3W6ZA 2J9XB 1SFRA 3ZZ0A 3GQVA 1E2EA 2PSFA 1VIYA 2IKQA 3A1SA 4IEFB 4YNBA 1JHMA 3KR2A 1W5SA 4LQ4A 1V3TA 3O1LA 3GQBA 4MGEA 4PZAA 5DMHA 3SFZA 4KVZA 4EEZA 3FZNA 4ZTUB 2QTRA 1ZISA 5B1SA 2DERA 5CA1A 3A3NA 1GUZA 3MJFA 2E0IA 1IN8A 1F1JA 1OX5A 2R5WA 2WD7B 3G2NA 3KS9A 3T9CA 3VNBA 2FUG6 3H5AA 3C8HA 4JLUA 1AHNA 2D1QA 2GXSA 1BKSB 5BORA 5IN5A 3CLKA 2HSJA 2FZEA 2F55A 2Q3MA 3W2TA 2ID4A 3ZEAA 2YUIA 4CV2A 3BZUA 4QTUB 1Q7GA 5E1DA 5LOVA 1A69A 3FLEA 3AIKA 3P97A 1FFXB 3AUUA 4Q05A 5DK6A 3EXHB 5EJ4A 1QP4A 1E0AA 3H2HA 2V03A 5IDXA 2P62A 1OI3A 5JD6A 5AI4A 4YJ2B 1AGYA 2KBEA 5I7VA 5LQSA 1XKTA 3OZDA 4ESEA 5BWNA 2B5VA 3Q9LA 1WDMA 3HZZA 4DY4A 2C8KA 2G88A 2WJAA 2Y68A 2NZ8A 2AJCA 2I8CA 4HYYA 4AULA 3O2QB 1Z8HA 2Z5VA 3MLAA 5JDCA 5A0TA 3EZ2A 3NH6A 4DUPA 1DXHA 4PZYA 2IYUA 3AF5A 4KSCA 4RAOA 4D9JA 1QHSA 5JTTA 3GLGA 1O2DA 1G64A 4GZ5A 4GC5A 3WOHA 1FA9A 3BD9A 1X9IA 1K27A 2XECA 3RU9A 4L4ZA 1DOAA 2FW0A 2I2WA 3GFVA 3COYA 1YRYE 1LDEA 2GK7A 2IZ5A 2WPNA 2Z43A 3CY6A 3GLKA 4MRSA 4U39A 4XPIB 5F2EA 4D3ZA 1GARA 2J6HA 3PQ2A 2H65A 4P84A 5GWXA 3K2QA 2IA5A 1QH1A 1ODSA 3T94A 2WPDA 3PT5A 1Q0RA 2WU0A 2OMEA 3M6IA 4MYSA 2OV2A 4DVGA 3FLMA 1FQKA 1BU8A 2QMQA 2RHMA 2IV7A 3PTAA 2ZVPX 3UUEA 4A5OA 1ZNXA 2O5RA 4LG1A 1G5FA 3ZOKA 3VJMA 4AZ3A 5C7LO 1DBSA 1LDBA 1Z2EA 1JQDA 2R6GA 2WTUA 4MPDA 1H4TA 2IYLD 4UFNA 2NZVG 3TVTA 4DG9A 1QTNA 1W1IA 1Z12A 1D3AA 1CLEA 1EWVA 1ZIDA 2NYVA