3E9NA

Crystal structure of a putative short-chain dehydrogenase/reductase from corynebacterium glutamicum
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
225
structure length
189
Chain Sequence
b'KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVEPIESDIVKEVLEEGGVDKLKNLDHVDTLVHAAGSVAEWHAHLDLNVIVPAELSRQLLPALRAASGCVIYINNTIYAASKHALRGLADAFRKEEANNGIRVSTVSPGPTRPEIYIEPKEIANAIRFVIDAGETTQITNVDVRPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
molecule tags Oxidoreductase
source organism Corynebacterium glutamicum
publication title Crystal structure of a putative short-chain dehydrogenase/reductase from Corynebacterium glutamicum
rcsb
total genus 71
structure length 189
sequence length 225
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.36: Acetoacetyl-CoA reductase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3e9nA00
2B5VA 5H81A 1Q7BA 1E7WA 2FPGA 2GZ1A 1NQ5A 3PTZA 4EGFA 5CDYA 4HFJA 3LSYA 4XWYA 4QO8A 4J4TA 3ZWWA 2GO1A 4CM9A 1M2WA 4MIOA 1SB9A 5JO9A 3VVCA 1DC4A 1TLTA 3UOGA 1H6CA 3E1KA 3AU9A 1PTJA 3D0OA 2E49A 3X2FA 4BVAA 2YV3A 1XGKA 4YJHA 5B12A 1J4AA 4Y6PA 1ONPA 1E92A 3V8BA 1M76A 3IUPA 4ZQEA 1Y7TA 3GR6A 5DCYA 4DBZA 2FPIA 1QYCA 2Y93A 1KEUA 1UZMA 2CZCA 3F4LA 3PPIA 4XDYA 4Z0TA 3WGQA 1EFKA 4HUJA 1KVSA 2VZ9A 4CL8A 3H2ZA 1H6AA 2IE0A 2C7VA 2O3SA 4DLLA 2P5UA 3VPXA 3U4CA 3AM5A 4PZDA 2QHXA 2WSBA 4NBUA 4YACA 3FWZA 1R4NA 4B3HA 4RVFA 3RKUA 4UEOA 3V1UA 1JVBA 1NX6A 2JD2A 3H9QA 4QUKA 2HJRA 4YAEA 3EC7A 3D4NA 3PQEA 2D1YA 1Q7CA 3GUYA 3L9WA 4HADA 4BOYA 2ZB4A 3U4HA 4FJ0A 3JQFA 4IXTA 4ZD6A 5L7TA 1A9YA 1Z7BA 4UUPA 1NFRA 1XCBA 3EZLA 1YXMA 3DXFA 4BO1A 3LZ6A 3NX4A 2NQTA 5IZCA 3G49A 5GZ1A 4DPKA 2ZYAA 4D79A 1EDZA 1OBFO 3KXDA 3WGZA 4RPJA 4CM5A 3EZYA 4HFNA 3V1YA 4RCVA 4B8ZA 1O5IA 1IPFA 2G5CA 5I9NA 5TGDA 2J3KA 3UCXA 1NBOA 5KTKA 4DXHA 1N8KA 3D1LA 5JAZA 5EMHA 3LLSA 3D64A 1I32A 4YJGB 1LSJA 2HK9A 4XYLA 1R0LA 1CQJA 1DC3A 2R6JA 3RBXA 3F1KA 2BGKA 2D2IA 4WJZA 5C7OO 2G0TA 1IZ0A 1QYXA 2VYVA 1GDHA 4BB6A 1XU7A 2I6TA 2ZKLA 3UN1A 5KVSA 4XYGA 1HXHA 5F3RA 2WEKA 5AYVA 4K6FA 4WLUA 1SMKA 3OJFA 4HXYA 4IZIA 4OOFA 4WOKA 4BNMA 1EUCA 4JLWA 1YDWA 4G5HA 4ND4A 5B1YA 1U1IA 4INAA 3GMSA 5I8WA 2HUNA 4XEHA 2VWPA 3SC6A 3FR8A 3JD4A 2PGJA 3JYLA 4JXKA 4R16A 4BMVA 1T25A 3WNVA 5I9MA 4DQUA 5DNAA 4E0BA 2V65A 4YAIA 5BSGA 2Q99A 1DJQA 2ZB7A 2IDZA 4W82A 1FDTA 2Y0CA 2HMWA 3OEWA 4R69A 5C7IO 2BKAA 4YT2A 1EUDA 3F5SA 3M6IA 5L4SA 4NJMA 3G17A 3ZWCA 3IUSA 1FMCA 1QYVA 3I4CA 2BD0A 4E2WA 4MKZA 3PP8A 4MKRA 4Q9NA 1Z74A 1I36A 4W9NC 3DR3A 4N7RA 5CPFA 1B8VA 1ZK1A 2I99A 4NQZA 2P4HX 2E6UX 4BO3A 2PH5A 4IINA 2CVOA 5EQDA 4FFLA 1HL3A 4J4BA 3ONDA 4RVUA 4RZIA 1LLDA 3R3SA 3U4IA 4GMFA 2AE1A 5I9LA 1RYDA 1PSDA 1NXQA 2QX7A 4NR0A 4MVJG 5JBIA 4DQVA 1T1SA 1YONA 3A14A 1EK5A 6LDHA 5HS4A 5A9TA 3GMDA 2EGGA 3LLVA 4RO0A 4O6VA 5EINA 3DB2A 1DB3A 5CG2A 3CIFA 2IYPA 4ILKA 4PG4A 4UVGA 1QMGA 1UDAA 1NM5A 2DPGA 4II2A 1E0DA 2PV7A 1R37A 4FGSA 4CLRB 3WGOA 5J23A 2O48X 2Q4EA 4G81A 1HSOA 3C1AA 1EUZA 2BLLA 4DWVA 3GN2A 4CLHA 3RC2A 4GX0A 2FMUA 2DUUA 1ZJZA 2PGLA 3H65A 3VH3A 5IXYA 2JFGA 1P1HA 5DBGA 4ND3A 1R12A 3JYQA 4LMPA 4TROA 3TZQA 1I3LA 3FSRA 4BMSA 1QKIA 2CF5A 2PFGA 4L76A 2X0NA 4NJOA 4Z9XA 2DBRA 3JQ8B 3C7AA 3H5RA 3FNEA 4B4VA 3KYDA 4E2XA 1PQWA 3RFTA 1GCUA 4KWHA 1MG0A 4CMIA 1BHSA 4U0JA 1GZ6A 4QFCA 4M89A 4EJ0A 2BMAA 3BTUA 1P3DA 3KSUA 4HFRA 2NU7A 1X13A 1FF9A 3DBVO 1BDMA 2IRWA 3LC7O 4CM3A 2I5PO 3BMCA 2IEBA 5AXBA 1P74A 1PJ4A 4WNCA 3E8XA 3QE3A 4BMNA 3CEAA 5I7SA 4W7IA 2Q50A 3MTGA 4IZHA 1E7RA 2NM0A 4XGIA 3KO8A 1K3TA 3V2HA 3ZI0A 3PFFA 4DA9A 5HWSA 3CTMA 4OJNA 1I10A 3FTNA 2X22A 2OFPA 4BUCA 1LUAA 4QT0A 4NU6A 2O7QA 1P1JA 3NRCA 1ZSYA 4ZGWA 1Y5MA 4MP8A 2ZK7A 3BMOB 1ENZA 4RQUA 1PQUA 1BTOA 4IXWA 3FNHA 3F47A 4Q3BA 1P44A 3PJGA 1I30A 3FCOA 1WXDA 3AY6A 5CDTA 4IQGA 5B4TA 2ZB8A 4WLNA 2Q2QA 3OF2A 2CVQA 5TT1A 1B0AA 1XR3A 5F1KA 2WD7B 4JK3A 1UXJA 2WTBA 3WQSB 2IZ1A 3MZ0A 3PYXA 4Q3EA 3UAGA 2VYVD 3L6EA 1UP6A 2OO5A 4E2ZA 1E7SA 1B15A 4AG3A 2ZTVA 4II3A 4IJVA 1OI7A 4CMIB 1GV0A 1X15A 3QWAA 4J9UE 1ZH8A 2I9PA 4XX0A 3KYBA 1E7QA 1P33A 4AJIA 3Q6IA 4NI5A 1LA2A 3MJ4A 1GR0A 4NBTA 3HE3A 1Z45A 2JFHA 1O9BA 1WDLA 3HJAA 5DP1A 2OUIA 3KLPX 2BGLA 1O0SA 3UUWA 1HDZA 1LDBA 3H9JA 3GC6A 1R0KA 5T67A 1E3IA 2O2SA 1PGPA 4KTVE 4TQGA 4U8GA 1T4DA 5JDCA 5T8KC 4RL6A 4CMJA 1R4MB 2HO5A 2VYNA 2X5OA 3DC2A 4RPLA 3PIDA 4PLHA 3KYCB 3QVTA 3MJSA 1LU9A 1WPQA 4ND5A 1K89A 5A5FA 2EIHA 4BNTA 4DMMA 2OGUA 1VL0A 3DAPA 1F06A 1YS4A 2JCYA 2IYOA 2C29D 2NU8A 5IDQA 4YWJA 3S2FA 1GUZA 2C5AA 4NK5A 3C8MA 1EFLA 1JDJA 1EZ4A 1Y9EA 1SPXA 3IKVA 4FC7A 3GVPA 3IP3A 4QQRA 4E5YA 2Y67A 3RJ9A 5EQFA 1PL8A 2FPPA 3GZNA 4PLFA 1X7HA 1U2GA 2GERA 4F6LA 4GVLA 3EY4A 4A5OA 5ENVA 4Z3KA 3RVDA 1WMAA 3GLQA 1UUFA 4O5OA 3U3XA 1IPEA 1ZK2A 1E7MA 1NYTA 1WMBA 3WOHA 1ISHA 1HLDA 2Y1DA 3GGPA 3T4EA 4TRRA 2GN6A 4J7UA 1LQTA 1KVQA 2J5QA 4UAGA 5HBRA 3RU9A 4WEOA 5DF1A 2P9GA 3SEFA 3JQ8A 1TB4A 3JYOA 2BGMA 4WCFC 5L53A 4ZJUA 3I9KA 3M1LA 3PHJA 4XQGA 2YV1A 4E4YA 1NVGA 4PFJA 4B79A 1Q7GA 5ER9A 4GLOA 3CPSA 3BMCB 3BAZA 4R01A 1SO8A 3M2TA 4GKBA 4ESOA 1Y6JA 4U0KA 3VDQA 1BXZA 3QWFA 5KCZA 3WWZA 4DC0A 1EVYA 2X9GA 1JA9A 1FK8A 2UVDA 1H5QA 5HRUA 4CM8B 2CVZA 2Y68A 1A4IA 2NVBA 4BB5A 4LRSB 3HWRA 1SOVA 3KBOA 2EGHA 3FNGA 4J4HA 4L4XA 2AQIA 5EIOA 3LDHA 4PRKA 2BFMA 5T57A 1UXKA 2DAPA 1BGVA 1DXYA 3PDJA 3BTSA 4OOEA 1JW9B 2BELA 4ND2A 1HDOA 4UVIA 2AG8A 2ZCVA 5CEJA 3A4VA 4AJNA 4CQMA 1DLIA 1P1RA 1E1LA 2ZTUA 5BNFA 1TA4A 1RM0A 4TZTA 4XGNA 5L4LA 1C0LA 2EXXA 4YEDA 3A28A 3EW7A 3G1UA 4J1NA 2YDYA 3GZ4A 4IGEA 5BNTA 1C1DA 4CQLA 1T2CA 4KWIA 2AEFA 3AW9A 1L7DA 1SNYA 2ZJ0A 3ZWYA 4CQLB 4P22A 1ZZEA 3ENKA 4NBRA 1K0UA 4MKXA 3UH1A 3IAHA 1D7OA 3TF5A 3I3OA 3GFGA 3EYWA 1GD1O 4L0QA 3LT0A 1V9LA 2PZKA 3LC2O 5JC1A 1DIAA 2D5AA 1NPTO 4P4LA 2VN8A 4KDEA 2ZQZA 3WMXA 3KM0A 4WPGA 5GZ3A 4BNJA 1GZ4A 1N5DA 3LT4A 3NV9A 1MB4A 2EJWA 4O0LA 1Y8RB 4NFYA 4LVUA 1XSEA 3ON5A 5FI5A 5ITVA 1YL5A 1M67A 3DMYA 1BVRA 4R1UA 5CDUA 1E3JA 1VSVA 2PD6A 1DHTA 4BNVA 1TEHA 2AXQA 4UVDA 2B37A 4RDHA 2PZMA 1ONNA 1UXGA 3PVZA 4XQCA 3VH1A 2P4QA 4IY1A 3OJLA 4AJPA 4BO7A 4RPHA 3BHJA 2B35A 3RIHA 1HF3A 4J16A 5LCXA 2VQ3A 4OO3A 3V2GA 3JQDA 5DOVA 3HHPA 1KETA 2V6FA 2RAFA 5ER6A 4LCJA 3ETEA 5JYEA 4R54A 1C0KA 1IOLA 4CODB 1W6UA 2HCTA 2FP4A 3VZRA 1P1IA 1MA0A 4KUHA 4ZQGA 3SLKA 3HB5X 5ICSA 1MX3A 5T5QA 1Y8QB 3M2PA 2V7PA 2VTDA 2VHXA 1PU2A 4RDIA 3W4KA 1IB6A 2Y0DA 5JPIA 5CEFA 1YH3A 1JKJA 5KKCA 1AHHA 3I9MA 5ES3A 1UP7A 2JL1A 2EKQA 1HTBA 2DC1A 4OL9A 4FQ8A 5COAA 4YQYA 1WZIA 1MC5A 1VL6A 3FHLA 3OSUA 4R4JA 4XR4A 4Z0HO 4BNIA 5L7YA 3GH3A 1DIBA 2R00C 2X0IA 1QYDA 4AFNA 2O3UA 3S2IA 4B7CA 4H15A 2OHXA 3O03A 1NASA 4CMKA 1B3RA 1AHIA 2X23A 3JQFC 1B16A 4E3ZA 3C7CB 3RC7A 3F3SA 1EMDA 2AW5A 4NBVA 2P68A 4YXFA 5ILOA 4DLAA 1I5RA 4J2OA 1KVRA 2CD9A 2Q46A 5F1OA 1W73A 1IULA 1H0KA 4R68A 5HA5A 5U4QA 1XEAA 1NVTA 5IDWA 1A72A 3B1JA 1PS8A 1WZEA 1HDGO 2HRBA 5IFLA 2Y1GA 2Z1MA 1VL8A 4AICA 4RQTA 1PJSA 4XYMA 1R4NB 1HZZA 2X5KO 2XF8A 3CSDA 3GOHA 3I6QA 4LK3A 4J43A 3WJ7A 4Y98A 1WDKA 1L1FA 3UF0A 4AJJA 3O26A 4CLOA 1A7KA 3FBTA 3W6ZA 2FRDA 5F5LA 2OORA 1RWBA 4RPKA 3OQ6A 3O8QB 2ZATA 3NJ8A 3ROPA 2DBVO 3VC7A 3PJFA 1KBZA 1NNUA 3BTVA 4D45A 3H7AA 4R3WA 2FHSA 2NU6A 4M8SA 1E3SA 2YUTA 4OSPA 4RVGA 3R0IA 4GWGA 4KUGA 4YJHB 4BNFA 3HFSA 3UCEA 4HX5A 1OFGA 5IN5A 4OQYA 1UZNA 4IDCA 4CR7A 1LX6A 4M87A 1FJHA 4IIUA 2DTXA 2X7HA 1JWBB 4HV4A 4EUFA 3P19A 3NGLA 3GRPA 2YJZA 3GEGA 4IBOA 3NGXA 1WNTA 1YL7A 3R1IA 3DWFA 4IS2A 3PDUA 5COQA 3L77A 4N5MA 3KB6A 1GADO 2B36A 5I8ZA 3TWOA 5K6AC 2IXAA 1ID1A 1SZJG 4IJUA 7MDHA 1IL0A 1PGNA 3TOXA 2WE7A 4CV1A 2J5KA 2D3TA 2NNLD 2PK3A 4CM1A 3OJOA 4WLEA 3JD3A 5I7VA 2IZZA 4Z9FA 2EKLA 1U7TA 3K5PA 1DOHA 1V8BA 1YB1A 4ND1A 4AJEA 3ITDA 1E1MA 1QSGA 2VRCA 3QWHA 3P5SA 5F1PA 4DIBA 4R51A 5G0WA 4E5NA 4C7KA 3F1LA 3U49A 3HG7A 3G79A 3ZHZA 1PEDA 3B1FA 3G1TA 2C07A 3DEYX 3TZCA 3ABIA 1E3EA 1D4FA 2O7SA 1DIHA 1D1SA 1U2DA 2Z95A 2C20A 4CMBA 3JQEA 1B2LA 4MVJM 1KOLA 5DP2A 4U6QA 4JP3A 5KWEA 3BHMA 4CLDA 4J7XA 1PZFA 2PD4A 3AFMA 3QWBA 2GZ2A 3DTTA 4CPDA 6ADHA 3FNFA 4WOJA 3CZMA 2VNSA 3D4OA 4IQ8A 3VOSA 3I9NA 1N2SA 1BSVA 3F5QA 1XQ1A 4BNHA 2VT3A 3I9OA 1MFPA 2QRKA 5AOVA 4UVEA 3QVXA 3WFJA 3ROKA 1A7AA 1HWYA 3A06A 1H93A 5IZCC 5TF4A 3GDOA 3VH2A 4BV8A 4L4SA 4QX6A 3KZVA 4GLLA 1VPDA 3ZH2A 2C82A 3PLNA 4EZBA 1NTOA 3U0BA 3QIVA 4JN6B 3PWZA 4NFHA 2IXBA 5L7WA 2DFVA 5ILGA 3JQBC 4XA8A 4NK4A 5KJFA 3GAFA 1PGOA 3ONFA 4QEDA 4BGIA 5AQ1A 3DZBA 5BQFA 3W4JA 3JSAA 2WWRA 3PYMA 1A27A 1U8FO 1VC2A 4QECA 3OBBA 1YBMA 4GAEA 2HQ1A 2Q2WA 3JYNA 1H94A 2RCYA 3WMWA 1T26A 3GG9A 3IIEA 3WS7A 1CEQA 5AXDA 4A0SA 1F8FA 2BH9A 3T7CA 4BIIA 5IG2A 2GUGA 5C37A 2DBQA 1DRVA 3F9IA 1C3VA 2H5LA 2UV8A 4FGWA 4J0EA 2TMGA 1UAGA 5L9AA 1P31A 2ZTMA 4YT8A 1U5AA 1F14A 1HYHA 1ZEJA 4EJ6A 1UAYA 3DDNA 4CM8A 4YB8A 4IDEA 3NUGA 1GQ2A 2CFCA 1ARZA 1WDMA 1YVEI 4PLWA 4M55A 2E48A 3GEMA 5L45A 4DVJA 1EQ2A 2BF7A 2O3RA 1D1TA 1LSOA 3UW3A 1I3NA 4FDAA 4PLTA 3T7EA 5KJ1A 3BMOA 4QSMA 1A9ZA 3DONA 3LQFA 3ZGYA 3UCFA 2NVWA 1NR7A 4YAGA 1AUPA 5JS6A 2HU2A 4E5MA 2A92A 4CLXA 5A9SA 3TFOA 5IZ4A 1FXSA 2GD1O 2IODA 4UULA 1R15A 3FN4A 4Z0PA 3A1NA 4J2HA 1UJMA 3GT0A 3PRJA 1C0PA 4Q3CA 4ZN6A 5TC4A 4N5NA 1Q1NA 3PQFA 4CV0A 4E33A 4BNUA 1HT0A 3S1LA 1F0YA 3RUAA 1UXIA 3DBHB 3G3EA 1YOVB 1QG6A 4NG5A 3AUSA 5BSEA 3PLRA 5JMWA 5JNLA 1Z6ZA 3WBBA 1R16A 2DFDA 3G0OA 4GX2A 4ALJA 2HK7A 2PKRA 5IXSA 1PJLA 2P2SA 2NSDA 3GNSA 2GRAA 1RM5A 5MGBA 3IS3A 2HLPA 2R2GA 5CDGA 4BO9A 3RUCA 3AUAA 4GGPA 3QVSA 3TNLA 4JIGA 2D59A 1KC3A 3S2EA 4C7JA 3C1TA 3K92A 3LYLA 4EW6A 4FFMA 3PGJA 3WSVA 1HDCA 2VHWA 4U7WA 4P38A 4WEQA 3RUDA 1ML3A 3ASUA 2QZ9A 4EDFA 3K2BA 5JSFA 4D0SA 3DAFA 4GI2A 1R0SA 2RBEA 2VCYA 4UUMA 3VVBA 4Q3NA 3WTCA 2JD0A 5H82A 4JQCA 3K30A 4CLRA 4PG8A 3ZWNA 2A94A 2QW8A 4XRRA 3MJCA 3LC1O 5F5NA 2RIRA 3ZWBA 1CERA 2VRCD 2ZB3A 3RASA 3WIEA 2G76A 3UHAA 3VPSA 4I5EA 2UDPA 3ZU5A 1YJQA 4LMRA 5U1PA 4BO2A 3F6YA 4Y6RA 3DMTC 4YT5A 2JCXA 4D0RA 3RJ5A 1R66A 3FR7A 1CJCA 4IIVA 3NYWA 4Z3DA 5A4DA 3ONEA 1XYGA 3PHLA 1PGQA 3DTYA 1KERA 2NWQA 1FDSA 3L4BC 4XB1A 4E12A 1Q0LA 3ZWMA 3RQSA 3QWIA 4Y6SA 2G1UA 2OBNA 3AJRA 1EEHA 3RAJA 1OZAA 4HFMA 4RZHA 1DRUA 3TSCA 4NHEA 1AXEA 1ZW1A 3ANMA 4Q3DA 3TFQA 3U5TA 4CLEA 3ZHXA 2Q1UA 1XQ6A 3WLFA 4BKRA 4DTIA 4XQEA 4A26A 3KV3O 4RF4A 1U5CA 5C3MA 3UKOA 4BNLA 2Y0EA 4FFRA 2WYVA 3DZJA 4RGBA 1WVGA 4XIJA 1Q2XA 4LN1A 4OH1A 4DMLA 5JDIA 2H1SA 4XDZA 2J3HA 5KKAA 4BNKA 3VHRA 4R1SA 4ZRMA 1UR5A 4Y8VA 3HDJA 4BV9A 3ZNOA 3AWDA 4I9NA 1ZKMA 2JD1A 5JMPA 1E6EA 1J0XO 1DAOA 3RD5A 2FZWA 4RVDA 3DZHA 3CMCO 1PZGA 5JAIA 4OYRA 4FIZA 2WJPA 3NJ4A 1V3UA 2VWGA 3TN7A 3FTPA 3WR5A 2W8ZA 1PX0A 2DTDA 4YJDA 1LRLA 2Q4BA 2Q1TA 3WG9A 1VKNA 1NAHA 1U3WA 4CMEA 3PZBA 4IPTA 1Z7EA 1TT5B 3HDHA 2EP5A 2P9CA 2O2YA 3OEYA 3GEDA 3VTFA 2DQ4A 2VZ0A 3GGOA 5KJEA 1DDOA 4BQRA 4J0FA 2X4GA 4NFSA 3OP4A 4FFNA 4LVCA 5T6BA 4YRAA 1I8TA 1O95A 1QORA 1GV1A 5KVQA 3N58A 3PFWO 5B4UA 2Y05A 1IHXA 2RHRA 3EVNA 4GQAA 2BI8A 4GSLA 4MP6A 1ADFA 2JJYA 5A05A 3GGGA 1I33A 2Z1NA 3PQDA 4RJTA 4CLOB 4TRNA 3D5TA 3K6JA 3K2EA 4EI2A 1C1XB 4Y67A 2B4RO 3EUWA 4K28A 3F46A 3AOGA 4ALMA 3ANLA 2O4CA 3E9QA 2OP0A 5A06A 1GQQA 3KUXA 3DZFA 4EJMA 1PIWA 5LDHA 3U09A 1FDWA 3PWKA 5GMOA 1B8UA 1ENPA 3GHYA 3H6KA 4TKMA 1HDRA 3RBVA 4JJGA 1JVSA 1N9GA 3JD0A 2W2LA 4BKOA 2YW9A 3ZN2A 1LC3A 1VJ0A 3DO5A 1FDVA 4BGUA 1O6ZA 1ZSVA 3H5NA 4FS3A 1E3WB 3GG2A 4OSOA 4BGEA 4ID9A 1VLLA 5THKA 3W6UA 3TPCA 1T24A 1BVUA 5IDXA 2G82A 2GF2A 1EVJA 4WCFB 4GVXA 1VSUA 1U8XX 3SVTA 4XGKA 3I52A 3LT2A 1JAXA 2AA3A 3DOJA 3NKLA 2EERA 4M54A 5FWNA 1GL3A 3QVOA 2UUPA 2W98A 5G0VA 3ZV4A 1Z73A 3I9LA 1TXGA 3QVWA 4WECA 1LLUA 1HETA 1DJNA 1Y81A 4WLOA 3OETA 3IL2A 3KLMX 3ZWVA 4WLVA 3OIFA 1G1AA 2EV9A 2DT5A 4JJIA 1UDCA 1VRWA 1XWFA 3TQHA 3HN2A 2W90A 4KMSA 3RFXA 2NVUA 3HZZA 5TSDA 4W9NA 3VPHA 3CMMA 3ETDA 3Q2IA 2X9NA 1OC4A 3JQAA 3JYPA 3RC9A 4ALIA 1N7HA 2GLXA 2AQHA 4NBWA 3RSHA 1X7DA 2E82A 3JQAD 4W99A 1P9LA 2DPHA 1N9GB 1ZK4A 3OHSX 3BTOA 1PZHA 2QYTA 4FOOA 4TVBA 3EK2A 3ZWOA 2E4AA 1LJ8A 3KEQA 3EVTA 3AOEC 5KJ6A 3I9JA 4S1VA 2HSDA 2HMSA 4R9SA 1N1EA 4M1QA 3V5NA 3ZW9A 3DBLA 3W8DA 2GZ3A 1AE1A 4NMHA 2OXIA 1C1DB 1NHWA 3C24A 2YHIA 5JY1A 5CP8A 4UREA 3TRIA 3VH4A 1E3WA 1E7YA 4L74A 3BZUA 3WGTA 4BQPA 2J3JA 3Q2KA 1NFQA 1RYEA 2AEMA 4CV3A 1WLYA 1U4OA 4IJWA 3RKRA 2FR8A 3SBOA 1YO6A 1QR6A 4XJSA 5DULA 2HK8A 3ZU4A 1L7EA 2AQKA 4KZPA 3GK3A 1F8GA 3AI1A 2B4TO 5JE8A 1E5QA 1I2CA 1LDMA 1DHRA 3QV1A 1GPDG 1WWKA 3D3WB 1I0ZA 1I24A 1O94A 2I66A 3FI9A 1ZK0A 3E6AA 4L4RA 5EN4A 4ALLA 3IOYA 3PIIA 4KQWA 1GPJA 2UUOA 5CAEA 5EL0A 2QRJA 5JAQA 4E6PA 1H9AA 3EHEA 3VTZA 1PGJA 4OKNA 2C2YA 1ZBQA 5TX7A 1TT7A 5TRTA 5L51A 5ADHA 1DFGA 2XAAA 3KHUA 4J1SA 4YRDA 5DDIP 3CXRA 1ISMA 3CZRA 4BGVA 4E5KA 5A02A 4OXNA 4ZHSA 4HBGA 2X6TA 4GKVA 4LISA 4N18A 2J3IA 3I4FA 1LSSA 4CV2A 5JCJD 3NT4A 3VAZA 3WQQA 1HYEA 4B4OA 1SBYA 4QO7A 7ADHA 2F00A 3AUTA 1AXGA 2Q2VA 4N54A 2B69A 2VUTA 3K31A 1CWUA 4Z9YA 1IYZA 2FR0A 4MVJA 4J49A 5A9RA 5AVOA 5LDGA 5EESA 2CSUA 4BNWA 1DSSG 3VZQA 1M6HA 4EYEA 2Q49A 1N7GA 2PZLA 4E32A 4G65A 4U6SA 2FZEA 1LRKA 2VYND 3DHYA 3QW2A 4XD2A 4JNKA 3TL2A 4B3JA 5JDIC 5HS6A 3D7LA 4X54A 4B7XA 4IJKA 4BS9A 4UEJA 2VWQA 1H6DA 2AEJA 4EEXA 3O8QA 4PVDA 3OA2A 4B3IA 4DPMA 5CDSA 1UXHA 2Y66A 1RKXA 3VPFA 4B4WA 1GEGA 4RF5A 4E30A 5DCUA 3GF4A 5BR7A 3JQCA 1NWHA 4J7CA 4CMHA 4EBFA 5U9CA 4WK6A 1IZ9A 3TZ6A 4KP7A 1SAYA 1LTHR 3OA0A 4GSKA 4CUJA 4J6FA 4TSKA 3INTA 3PZRA 4NPCA 4YDRA 4YRBA 2H6EA 4AJLA 5TS3A 3IQDB 1PR9A 1X1EA 1JWAB 3FRJA 4WNIA 3ADPA 3DL2A 2A4KA 4BNXA 4WKGA 4D41A 4D7AA 4NH4A 4C4OA 1O8CA 3QJ5A 2CDBA 2JAPA 3ST7A 1TT5A 2GYYA 1JLLA 4RVHA 4CR6A 5JDCC 2Q1WA 1KIFA 3JQBA 2BRUA 3H3JA 3KVOA 5AXAA 4I5FA 4ZVVA 3KRTA 3RWBA 4LW8A 3LK7A 5G4KB 2QRLA 2WD7A 4MVJE 4F3YA 3BMQB 5ENDA 4GGOA 3GY0A 4GX1A 1MG5A 4OAQA 1KY4A 4DBVO 4HP8A 3GFBA 4I9HA 3ZNPA 2IZ0A 2Q45A 4TVOA 5DBFA 1RPNA 4FFOA 2VOEA 1YWGO 4QFDA 4ZRNA 1PQPA 3C7DB 1JKFA 1Y5RA 4R41A 1YE3A 3GDGA 1NP3A 2Q1SA 3QRWA 4CUKA 3H2SA 2V6GA 5JCJA 2O3QA 4D43A 5IJZA 1EVZA 3IP1A 1VE9A 2PLAA 3DZGA 3NDJA 3HNPA 3T4XA 3DFUA 3PYLA 2JFFA 3ROMA 4A27A 1H9BA 1HRDA 2VHZA 2D4AA 2GN4A 3RI3A 5A9SB 4DPLA 1P1KA 2VOJA 1OMOA 2UYYA 4J90A 1SEPA 2VNAA 1ZEMA 4FOSA 3GRKA 4ONEA 3WFIA 4O59O 3LU1A 4R9RA 1I3KA 4CL3A 1PJ2A 2CNBA 2O4UX 3DBRB 2NACA 1NWCA 3TOZA 2WDZA 1LLQA 4FFPA 4I5DA 1MLDA 1E3LA 5GZ6A 3AK4A 2PD3A 4BNYA 3GDFA 1Z75A 4P8RA 3RFVA 1NQAO 4RORA 1N92A 2BI7A 2B83A 2ZTLA 3AY7A 2EKPA 3TDKA 4AVYA 3PEFA 1ZCJA 4IMPA 4BO4A 3V2UA 1HSZA 1GFSA 3AUUA 4I8XA 1YKFA 5EERA 3WYCA 3I5MA 4W4TA 4ALNA 3R6DA 3MOIA 1X0XA 3DOCA 2P5YA 2C2XA 1BG6A 3BMNB 4DYVA 3O4RA 2NV6A 3FPLA 4NU5A 3KYDB 3VPGA 5KVCA 3ZNQA 4ZQHA 2VUSA 3ZU2A 4XQ9A 4WCDA 4BO8A 3IMFA 4E13A 4M86A 3VZPA 3MJEA 3DZKA 2XPCA 2EW2A 3I83A 3NT2A 4UUNA 3ZW8A 5FFFA 1YB4A 3BMNA 3F4BA 1RM4A 4DLBA 4J3FA 5BNIA 2FSSA 3OM9A 2FOIA 1U7HA 4I1IA 5IAAA 1ULUA 4EUHA 3C3XA 3D3WA 4Y9DA 2WMDA 1ADGA 3OIDA 1GZ3A 2D8AA 3E9NA 4CM6A 4O1MA 2OP1A 3HFGA 3RC1A 4PZEA 2Y1FA 3QHAA 2H9IA 9LDTA 3DBHA 2GPTA 4NIMA 2B0JA 4HNGA 3WJAA 1BXKA 1NQOA 4TMFA 1YQDA 2A35A 4R5HA 1T2DA 1U4SA 4OXYA 5TIIA 1VJ1A 3RBZA 5ICMA 3JTMA 1MP0A 1QV7A 1ZSNA 2AMFA 2W2LD 3D4PA 2TMDA 1BMDA 3HDQA 2DU8A 3TJRA 3X2EA 4E21A 2X5JO 4TKLA 5TJHA 2HAEA 2NTVA 2XOXA 3WDSA 3ENNA 4YR9A 2VUUA 3Q9UA 5K0ZA 4PRLA 3H9EO 4LGVA 1S7CA 4J1TA 3W1VA 1XDWA 4XYBA 1E1NA 4PN3A 4Q39A 4BO6A 4TWRA 4LRTB 3LF2A 2GCGA 3AI2A 1H6BA 5FI3A 1YRLA 9LDBA 4I08A 3ZZNA 3PGXA 4MOWA 5H83A 4G2NA 4YYZA 5IN4A 3JQAB 4NZ9A 1B7GO 1NAIA 3L0DA 4ZU3A 4B8WA 1J5PA 5G2OA 1W4ZA 4QTZA 1ZMOA 4R1TA 4A7PA 5HTOA 4XJTA 3OQBA 1T1RA 2RH8A 3GVIA 2XXBA 1NR1A 1XG5A 1Y9AA 3OH8A 3AOEA 3COSA 2YQ4A 4PG6A 3C85A 2NTJA 3E5RA 3IJPA 3KTDA 3O38A 4DIFA 2ZQYA 3JD1A 3LT1A 3OMLA 4D3SA 1P1FA 4DYDA 2FSVA 1M66A 2YYYA 2P91A 4PG7A 3IJRA 3QY9A 3MJTA 4ZA2A 8LDHA 3JCZA 4DUPA 2YHUA 3BA1A 4CMGA 3GNQA 2IEDA 2X0RA 5DZSA 1YBAA 4CM7A 3GVHA 1EBFA 1HE2A 3U62A 4MVJF 1BW9A 2GGSA 1P0CA 3C1OA 4S3MA 4IDBA 4CM4B 1W8DA 1JU9A 4YJFA 1KYQA 1ZXLA 2PWZA 3H5AA 2PNFA 1PR3A 1QXSA 1B8PA 2UAGA 5TNXA 3B6ZA 1VM6A 3ZCXA 2I3GA 2Y1CA 1GQYA 2HMTA 5JCXA 3N74A 3JQGA 3SX2A 1Q0HA 2JCVA 4DREA 3MWEB 4FW8A 1XIVA 3RUFA 3ZHYA 4DC1A 3D3EA 1LRJA 4R3NA 2BFAA 1VJTA 3RU7A 4PIVA 1HE4A 1G6KA 3FWNA 5MDHA 4XIYA 2CUKA 3NAQA 3L9XA 4LSMA 3I23A 5A1TA 5C7LO 3GVCA 1HLPA 1LNQA 4QXMA 4ROSA 1CQIA 1XKQA 3FPCA 3QA9A 1W0CA 3L07A 1SB8A 2AE2A 1NHGA 1DEHA 4MDHA 3OIGA 1XLTA 4WLFA 2A9FA 1F17A 1QRRA 1Y1PA 5TT0A 3WNQA 5ITWA 1AN9A 2EJVA 4WUVA 4BO5A 3JQGB 4PGFA 1XU9A 4FSHA 2JHFA 3PHGA 4AJ4A 1SOWA 1VKOA 4JP2A 4PG5A 4RF3A 5K9ZA 1X1TA 3WBFA 2PZJA 2O3JA 5IDYA 5JAMA 3ZV5A 1MUUA 2RH4A 2YFQA 2YHIB 4WE3A 4NJMB 4ZQBA 3PHHA 3MTJA 2OOSA 4AJHA 4R5MA 3ICCA 3GNTA 2F1KA 4MINA 1DPGA 1U9JA 2CMDA 3JQ6A 2PTGA 3P2OA 2DKNA 4ZICA 1A5ZA 2Y1EA 2DVMA 4A2CA 1NVMB 1CIVA 3GAZA 3JV7A 2AQ8A 4F45A 2VRBA 5JW6A 5DCWA 3MEQA 2J6IA 4TRJA 1EE9A 1BDBA 3E03A 3L4BA 3Q11A 3MWDB 5FF9A 4FCCA 4PLZA 5CHEA 4KTTE 3GUCA 1I01A 5L40A 5JO0A 2EP7A 4RLHA 2NVUB 4GMGA 1UH5A 2X9VA 3H3FA 1AGNA 3PHIA 4KUEA 1E6WA 3QP9A 1ULSA 1DIRA 3K8ZA 2GN9A 1LXCA 2C7GA 2J8ZA 1SCUA 1XHLA 2D0IA 3Q3CA 1JKIA 1Q0QA 4YT4A 1GU7A 3RUHA 3ASVA 3VZSA 3NTQA 2PKQP 3H9UA 1HE3A 1M6WA 3KSDO 1BXGA 2NLOA 4D3FA 5BSFA 5I7EA 3B20A 1YGYA 1PJ3A 1ADCA 2WM3A 3ADOA 1DFIA 3E82A 2QYSA 3CKYA 5TJ9A 4YJGA 3H9GA 4YTEA 2E37A 4CMAA 4CQMD 1DC5A 1HYGA 1JTVA 1PL7A 2EHDA 3OJEA 3UICA 1MFZA 3IC5A 4AJKA 4FB5A 3BHIA 1UZLA 4EEZA 1D3AA 2O3TA 2GDZA 4H16A 2J5RA 1YJ8A 2AHRA 1EE2A 2QZZA 3BXXA 2C0CA 3GN1A 3WQRA 4D3DA 2JHGA 5JYDA 1HKUA 4I9UA 3OECA 5TLSA 4YBZA 1ZIDA 1DAPA 1K6XA 4I5GA 3SXPA 3WB9A 1FDUA 1ISGA 3JQ9A 3CH6A 3RUIA 3ZWPA 3ZWAA 5KJCA 3IDSA 2O50A 4D42A 5BSHA 3P2YA 1EK6A 3VKUA 3WIDA 1YQGA 5T64A 3IKTA 3PJEA 4AJ2A 4JJFA 3ZDFA 2EF1A 2ZJ1A 3ITKA 1T4BA 3FF4A 4L73A 4U5QA 4A73A 4RV9A 1U3TA 4NDNE 4W6ZA 4EUEA 4K9DA 3SLGA 4OGWA 1DO8A 4R1NA 3HB4X 4GL4A 1KEVA 4PZCA 1C0IA 4FPXA 4PLPA 2ZIZA 3NTRA 1PWXA 2W2KB 5KVVA 1BXGB 1H2BA 3ETGA 2O23A 1B26A 1Y8QA 1EBUA 4BNGA 4CQMB 4YJFB 3I6IA 4IMRA 4UVHA 2X0JA 5JY6A 4FR5A 1ONOA 3MCVA 1KVTA 3QQPA 4D44A 1HE5A 3BIOA 3W8EA 1PJBA 4L9RA 2OL4A 1C14A 1PZEA 3PWSA 2VHYA 4TZKA 2DBZA 1P0FA 4GWKA 3B1KA 1H2HA 3GQVA 1LDEA 2DM6A 2ILTA 4MPDA 1CETA 1ENYA 3ZV6A 4A10A 4K26A 2HDHA 4BKPA 3HUDA 4W7HA 2PGDA 5B4VA 3D5QA 3Q0EA 4WCFA 3WXBA 4DRYA 3LF1A 3B70A 1RM3A 2X1HA 3S8MA 4GBJA 3NDRA 3QSGA 2H63A 4MIEA 2W4QA 1KEPA 3R3JA 5A5EA 1VI2A 1ZXBA 1DIGA 4B7UA 3OICA 2C5EA 4OQZA 4PVCA 1DC6A 5DBIA 1YBVA 5AXCA 1CF2O 2YFHA 3DBRA 5A3VA 1ISFA 4FC6A 4E5PA 2VT2A 2YZ7A 5G0TA 3JD2A 1XELA 4MVJH 1HDXA 3WYEA 4MP3A 3WGIA 3ZNNA 2I76A 4A03A 1SC6A 2B4QA 2Y1OA 4UUOA 1EQUA 1C1XA 2EWMA 3N7UA 2BFPA 4ITUA 1R4MA 3EDMA 5CFZA 2NU9A 1U3UA 1LQUA 3ZHBA 4JBHA 3STHA 1V3TA 2WD8A 3SJUA 4IUYA 5DOZA 2YDXA 3AM3A 3ANNA 5KNLA 3O9ZA 5JXWA 2C54A 2EEZA 1SEVA 4L8VA 1NFFA 4MJLA 4CR8A 3K96A 1T2FA 3AFNA 3DQPA 2B5WA 1KY5A 4FD3A 1IE3A 5COBA 4ZQFA 3K73O 2ET6A 1JAYA 3EMKA 4PCVA 3HDYA 5GY7A 5TQVA 1CRWG 1U3VA 1Z82A 3NT5A 1G0OA 4AL4A 1G0NA 4IDGA 4MVJP 4EITA 1EDOA 3BMQA 2GNAA 4GPD1 1R6DA 2BHLA 1PS9A 3K9QO 4YQZA 3GPIA 2PA3A 4IS3A 5L4NA 4PLGA 2WYWA 2X58A 3ZU3A 1IUKA 5A03A 5T8KA 1OAAA 1K6IA 4DIOA 2JAHA 2PR2A 3E18A 1X14A 3U9LA 1PJTA 2VTEA 2EG9A 1P77A 3GHHA 3VDRA 4D46A 1BW9B 1PS0A 4CM4A 1ADBA 3RCBA 5HM8A 3H4VA 5K6AA 3Q1LA 4B4UA 2DLDA 2Q3EA 4J1QA 4JGBA 5CPBA 3WGHA 2LDBA 3M1AA 1LLCA 4XKJA 3P7MA 5LC1A 2I3AA 1P45A 1E5LA 3WWYA 2OBYA 4JROA 1GTMA 1I2ZA 3NEPX 4GH5A 5G4LA 2RHCA 4KOAA 2ZYGA 3S55A 2GASA 1YQXA 3PI7A 1ISIA 4H7PA 1E1KA 1TI7A 5EJ2A 1O89A 3I1JA 1J49A 3SC4A 1LEHA 3L6DA 2YY7A 2JKVA 1DLJA 3W8FA 1ORRA 5BT9A 4K1LA 2YV2A 3WGYA 3WLEA 4MVJI 4FJ2A 2GSDA 4FN4A 4N5LA 2NADA 4CJXA 3HN7A 4XCVA 3U4DA 1GYQA 3KYCA 3VKVA 1LDYA 1GCOA 4FJ1A 3ZWXA 1E6UA 3ICPA 1LSUA 4JBGA 3RROA 4JX8A 3PJDA 4Q3AA 5JC8A 4BO0A 1B3BA 4F6CA 3GVXA 1K5HA 1WW8A 3H8VA 4ALKA 1HZJA 2G17A 1V6AA 2FN7A 3HADA 4J91A 1T2EA 4K6CA 5B37A 2P9EA 2CDAA 1I2BA 3UXYA 1MXFA 3Q9NA 4UEKA 3LVFO 5A3JA 4DGSA 3WGGA 1YB5A 4PLVA 5KOIA 2I65A 4HNHA 1OC2A 4KDFA 4GX5A 4OIMA 4P4GA 3KEOA 1KVUA 1J6UA 5I7FA 2YQ5A 1ZUD1 2QG4A 5L3ZA 8ADHA 5CEEA 1GAEO 4YCAA 2DUWA 3WSWA 1DBVO 4WGGA 1PWZA 2BFOA 2VHVA 2VZ8A 5G0UA 2GR9A 5G4KA 3UVEA 4CM9D 3AY3A 2LDXA 2PH3A 4YAKA 4IM7A 1MXHA 3DOOA 3PXXA 1MV8A 5CG1A 3OQ1A 4RPGA 4DQXA 1GY8A 2DTEA 3TL3A 1N1GA 4E31A 3HQ4O 3FD8A 3JQ7B 5EPOA 1BRMA 3L6OO 5C5IA 4XB2A 1ZFNA 1KC1A 1YOVA 4CMCA 1T2AA 1MC4A 1UP4A 2FWMX 3KOUA 3L4SO 3QLJA 3CINA 4OMUA 4BNZA 1X7GA 4OXKA 4BHTA 3PK0A 5FEUA 1GUYA 3BYZA 1V35A 1HEUA 2D5CA 3DZIA 1RJWA 3OJ0A 2CF6A 2HJSA 1IHYA 4MVJD 4J9VA 4P4NA 2SCUA 3NDIA 1HDYA 4LCEA 4PLYA 3KSZO 3ULKA 1ZO8A 2HMVA 4XRGA 3EAGA 3UGKA 1QLHA 1BWSA 2NUAA 1YDEA 4IQ0A 1ZVMA 4AJ1A 1MGOA 3GZNB 2POQX 2HRZA 2QQ5A 1JN0A 2HMUA 3WTBA 1GYPA 1M75A 5F21A 2NQ8A 1NPDA 1ZNQO 2Z5LA 3AU8A 2CY0A 2EW8A 3OFSA 4URFA 1DFHA 3CUKA 4DL9A 4NNJA 5JLAA 4YPOA 5L95A 1X0VA 4CMEC 3INGA 4CUZA 1PJQA 2R00A 1B14A 4M49A 1S6YA 4AJOA 1QLJA 1ENOA 3GPDG 3TZKA 1CYDA 1EVIA 1GEEA 2NTNA 2WYUA 3AM4A 4XYEA 3JQ7A 2CDCA 1ZMTA 3ZV3A 4BL5A 1GYRA 4Z6KA 3W4IA 1GUFA 1QP8A 5A04A 5FYDA 5KIAA 3NTOA 1A4UA 2FR1A 1NPYA 4BNNA 4IDAA 3FBGA 2FY8A 3DHNA 1K2WA 3S2GA 1LC0A 3AI3A 3DFZA 2XXJA 3KETA 3HSKA 5THQA 3DAGA 1QYWA 3E5MA 1LDNA 1ZJYA 3ROQA 2VWHA 2W2KA 2QIOA 1E77A 1Y8RA 3SJ7A 4HKTA 3E9MA 1K6JA 3TZHA 2PKQO 4MO2A 4IDFA 1LDGA 2I67A 2PY6A 1U28A 1PJCA 1V0JA 1UDBA 4JBIA 1JQBA 1F12A 3JQ9C 2HKIA 4IGFA 1KS9A 3INRA 2WE8A 4RVSA 3MJVA 3DHEA 4YA6A 1OOEA 4JCOA 4L75A 4RF2A 2GN8A 2V6MA 4H3VA 4OHUA 1KEWA 1TVEA 2OMEA 3GA0A 4OKIA 2AG5A 4BKQA 2ZCUA 4OM8A 4HWKA 3WICA 2X86A 1WP4A 4FBGA 4F46A 1D8AA 3CE6A 5IF3A 4XZ3A 1V3VA 5JFOA 4PLCA 1ISJA 1XA0A 4HY3A 4LSWA 5G0SA 3DMTA 3A9WA 4XR9A 2OZPA 1LBEA 1IY8A 1ZK3A 1DRWA 3EGOA 5DN9A 5DT9A 3DBLB 2X8LA 3E48A 3ORFA 4RLSA 1WAMA 4TRMA 4IDDA 4E2YA 1NQTA 2C59A 3V1TC 3UFXA 1PL6A 1QV6A 4YVFA 4WASA 1LI4A 4MIYA 1CDOA 2ZYDA 1I3MA 4BKUA 3MOGA 1A71A 3WYBA 3WX0A 2V6BA 2Y99A 4YAJA 4O63O 4KQXA 3RUEA 1YL6A
chains in the Genus database with same CATH superfamily
1F8YA 5HZKA 5H81A 2GZ1A 2GB4A 3PTZA 3SU8A 2N42A 4DEVA 4QO8A 1U04A 3L4JA 1XTZA 2VDWB 3HPQA 3LPMA 3CEMA 5JO9A 3LXUX 1P6UA 4M38A 1M5UA 2Z56A 3AF2A 4QU0A 3S2ZA 3T94A 3ZBPA 1NVVR 4DR5B 3E1KA 4H1VA 1EP9A 1U98A 1HQCA 4D57A 5JBQA 2XXAB 4GOXA 2PPLA 2E49A 3DE5X 4YJHA 5ETJA 1ODSA 5JVDF 4ZV7A 4I6JA 4MCAA 5ALMA 4E5UA 2FP4B 4RC9A 3QUSA 3T6KA 3WO1A 4C76A 1NXOA 4Q6BA 1SUWA 3P0FA 3ETLA 1Z68A 2G8LA 1WO8A 4NV0A 3RPEA 2ZJFA 4LDJA 2VDKB 3PPIA 1EFKA 4HUJA 4ICIA 1GZ5A 1KVSA 3BEOA 4L78A 4WTOA 3V8EA 3T3OA 2PT6A 3H2ZA 2VPPA 1N6LA 2AMVA 1H6AA 4C2TA 1Y34E 2C7VA 4ARUA 3AM5A 2QHXA 1P2UA 4YACA 1NP6A 3FWZA 3DEFA 2OLKA 2IZ7A 4UAJA 4RVFA 4G5SA 5FLEX 2M6RA 3E4DA 2FPPB 1FFXB 1E5TA 1NX6A 4OFXA 2XYQA 3H9QA 2HJRA 4YAEA 4LTNA 3VO1A 2II6A 3B1XA 3D4NA 1ILEA 4RV5A 1Q7CA 1A76A 2AJ8A 1E98A 3L9WA 4BOYA 1C9JA 2ZUCA 4IXTA 5KDDA 1F60A 5G40A 3C3BA 4B3RB 3T7TA 1Z7BA 4EF6A 3H19A 3ZWQA 3R3HA 1YXMA 2B94A 4CIDA 4M0MA 2BRUC 3A26A 1R6AA 1DBRA 1PUJA 3EZGA 3LZ6A 4M0UA 4OBBA 1QFXA 4WUTA 2YY6A 4ZVQA 2HFKA 1V6SA 1JHYA 4W7SA 1T3ZA 1FFXA 1S2NA 2V3WA 4MICA 1QS0B 2UVQA 1FP4B 5HKBA 1P73A 4ZXFA 4B8ZA 3CKMA 3T0FA 5I9NA 1U31A 1JLKA 3UCXA 4BUZA 4OQFA 5KTKA 3R0QA 5JXJA 1GFIA 2VK2A 4DXHA 1QR2A 1WNFA 2PJZA 1O57A 3D1LA 4G1VA 4KG7A 2VH5R 4QYSA 4Y2YA 5BPHA 2KX7A 1ZDMA 3QGMA 5DLEA 4B6PA 2HK9A 1R0LA 4ZHQA 3HEMA 4GI1A 1E3TA 1MRZA 3F1KA 1KIAA 4P82A 3E4CA 4WJZA 5C7OO 2B92A 3LO8A 4JJZA 3WYDA 1T91A 4X7MA 2G0TA 2XTNA 4PXYA 2ZVPX 1PK7A 1EWTA 3W8NA 5TQ0B 2W37A 4EDHA 1E59A 1T10A 1SR8A 1IZ0A 1QYXA 4QU5A 5JJ5A 2F9FA 4P53A 3E3LA 4MNTA 1R7RA 2JI8A 4RK5A 1XCLA 1GDHA 4Y2XA 2ZKLA 5KKNB 4YECA 5FBKA 1NJGA 5KVSA 4QZVA 4BB0A 1B23P 2VAVA 4LYGA 5EYPB 3UATA 1GSHA 2C4VA 3FOCA 3N28A 2J48A 2OTCA 5K03A 1G21E 1A0OA 4K6FA 2G9UA 4HXYA 3O7MA 4OOFA 5AW0A 5B3JA 2IH2A 4FDTA 3OQNA 4DIUA 3THSA 6YASA 5CCXA 1US8A 1PX2A 2V7QD 4MPTA 1U0OC 1U1IA 2ZM5A 3O92A 4P0PB 1WUJS 1LTQA 2HU8A 2PUJA 3HR4A 4XEHA 2ODAA 1VB3A 3SC6A 4C0JA 2XUGA 2PT7A 2XZLA 3JYLA 4LZWA 1UIRA 4ZU1X 4E70A 4BMVA 1YA6A 5F77A 4DQUA 1KYXA 1QHNA 2AH5A 5DNAA 2GAFA 1CSEE 4RL4A 1CU1A 4YAIA 1GSIA 3KU1A 2QXTA 2Q99A 1RI2A 1DJQA 4YCCA 3F78A 2G1AA 4WJKB 1FDTA 2Y0CA 4RXMA 2XB9A 3KR1A 3CX7A 1AUOA 2RGWA 2C7PA 5C7IO 1EUDA 2EC5A 2Z8ZA 4NBLA 5L4SA 3BWXA 4E4TA 4EYQA 2WJGA 3UOWA 3IUSA 4ZRDA 3HO8A 3BB3A 3I4CA 4MWDA 4PZLA 3ZBTA 4BCBA 4E2WA 4OBXA 3CNQS 4WQMA 2B1JA 1ZOIA 1I36A 3EW9A 4UUBA 2B8NA 4I1OA 4N7RA 3WZ2A 1B8VA 3RC8A 3EZ9A 3A1FA 3KWFA 1EIWA 1XRPA 2AD5A 4R2LA 2G06A 2P4HX 1RJ9B 4QBIA 4H7FA 2PH5A 4IINA 2CVOA 1EJBA 5TY0A 5K3CA 4ARZB 1PWEA 4ZI2A 1HL3A 3T9CA 4J4BA 3ONDA 4A8HA 1HRKA 1V48A 1W75A 1RWWA 3GWZA 5JSUA 2BYTA 1PNTA 3DVAB 3U4IA 2CXRA 4GZ5A 4E5SA 5BR8B 3LCVB 3OO1A 3DE0X 1NXQA 5DGCA 3DF7A 1KP3A 1JMKC 1QZUA 4NR0A 3LHSA 2WTUA 4KE6A 3TTVA 2PTHA 5LB2A 2OFOA 2BUCA 3OTGA 1UL1X 1SXJA 4GP7A 1PT6A 4W6QA 1F2UB 3A04A 4WNYA 3D59A 5A9TA 3RTAA 2FW7A 1QPZA 1VG0B 4KXLA 1JR2A 1WSAA 4NOMA 2ZITA 4JBWA 4RH0A 3CIFA 3JARA 5EWLB 5AM1A 5C5EA 1NURA 3UUEA 5CG2A 5IUJC 3TCNA 2C7RA 2W6JD 1DDGA 4HWPA 3VU8A 4II2A 3B7PA 5IWAB 3OT1A 1CJKC 1XL0A 4ZV4A 4FGSA 5A0TA 5J23A 2JCGA 3ZKAA 4G1UC 1FP1D 5GAJA 3LD9A 1F0PA 4L9WA 3A2LA 1E9RA 3IQHX 3E0QA 3JWJA 4QOIA 3IEKA 5HIMA 3CN9A 1Q6YA 1DAMA 3WK5A 5KDOA 3BXOA 1FQJA 1S8AA 3VH3A 4GYJA 2J0VA 2ZR0A 4MR8A 3Q2OA 5FA8A 1NSTA 5DBGA 3CUVA 1EHIA 2L0XA 3JYQA 3Q7EA 2AJLI 2PL5A 5CH8A 1VPVA 4NJOA 4I8IA 4MS1B 4BMSA 4BP8A 3D7RA 2DBRA 3JQ8B 1JHUA 2FUG1 1COWD 3FNEA 5J5VA 2D1RA 3KDPA 3IRVA 2H7VA 2AZDA 4JODA 4RQAA 2XCOA 5CMLA 5K09A 5LOVB 2XYGA 4DF3A 4KWHA 2YXEA 4TV9A 2C4TA 1VHLA 4AX4A 4U0JA 4YRKA 1GZ6A 3NIWA 1SZPA 3TZLA 2GMWA 3NASA 4EB0A 3NV7A 1W88B 1J97A 3BA6A 1FRVA 4OF4A 2YVQA 2ZWPA 1C1HA 5HX7A 3L6BA 1X13A 5FOUA 3SF8B 1RWNA 5BSTA 2IRWA 2C98A 4CM3A 5I45A 4Z4EA 4ZVSA 1CJSA 1B1CA 3LBHA 1BEZA 4PR3A 3BIXA 4C6TA 3AKEA 1E2BA 3E8XA 1I4EB 5LUBA 2WJAA 4KQ1A 1Z13A 1U3CA 5DBHX 1OTHA 1RXSA 3CEAA 5FQNA 4C0HA 3L8FA 3R5JA 1G6HA 5KHOC 2EDCA 3OY7A 4UTRA 1AMUA 3V4OA 1KJQA 4FWBA 3HVRA 3QU4A 4R9NA 2PJDA 1RI1A 4LFAB 4IZHA 1E7RA 4B6SA 1XTIA 3KO8A 4BMOB 2HHJA 1K3TA 1SUIA 1UPFA 3GRUA 4DA9A 4PNPA 2PNJA 4ABTA 1T4GA 1T4CB 2ZIUB 2C8VA 1R5OA 3FTNA 5DX8A 1MJNA 1MEOA 2OFPA 4EJSC 2ZRQA 3SIRA 1R0ZA 1I7QB 5SYAA 1LUAA 1FP2A 1ODCA 4MS3B 5LUAA 2Q5LA 5CT8A 3O2SB 2O7QA 4LKOA 3K4PA 4QOSA 3O4GA 4LJKA 5EXTA 3SN6A 3I5YA 4O2AB 2B8JA 4ZGWA 1P9NA 5B36A 5HIJA 1L5NA 1OASA 2GPNA 4JGGA 2BJHA 2DPXA 4Q4HB 2RC5A 5K8TA 4HMQA 1AKYA 5FUVA 3T4PA 1ULHA 5DBEX 4P2GA 3CLSD 4HN2A 2QVCA 4LSGA 3MMZA 4XOIA 3OKAA 3SICE 2OGZA 3G0GA 3FFTA 3IAM6 4FINA 4LY0A 1US8B 5LQNA 3PSAA 2BUAA 1JXMA 3FOWA 3ETNA 4HDOB 2LCIA 4DB2A 1DPFA 2CVQA 1Z7WA 1YR2A 2EAUA 2YWJA 3H5LA 1P4HA 1UXJA 4AZ3A 4DQ0A 3PNPA 3QHPA 4KZKA 1UKBA 5GGYA 4XM2A 3X1WA 4JV5B 1OH5A 5BW4A 3JAKB 1IIRA 1KSGA 2I9KA 3FHCB 4DWJA 4CMIB 3BJMA 2JLYA 5KYXA 4U2DA 4AQYB 4J9UE 2LV8A 4G4JA 5HYVA 2PUCA 4Q1AA 1Z37A 1P33A 1WOMA 1W1UA 4BLPA 4IQ4A 1GR0A 1XLUA 2JFHA 1WDLA 5J1TB 1CBUA 1VRCA 4ML3A 2QM3A 4FFBA 1A98A 2H57A 1M1XB 1USWA 3LRTA 2BGLA 2AVDA 4BJHB 4DAOA 1UZAA 3SG0A 1JZTA 1THMA 4HJXA 5AHRA 1P0PA 3H11B 5F3DA 5F7JA 3EGVA 3NYQA 5DLQC 1DEOA 4KTVE 5EKXA 3HYNA 4OA8A 2ZUVA 4XVUA 2G36A 3N2ZB 5AOBA 1RQNA 2Q7DA 2JLRA 1CG6A 4TMZA 2W4IA 3C70A 4PLHA 2IELA 1E3DA 4W8HA 3DEJA 3VOTA 1JT2A 5KX5B 2NO9A 1LU9A 4FX2A 1RE1A 2EIHA 3O8CA 1LWNA 1I6MA 1T6NA 3I5XA 1TQHA 3HKBA 1YS4A 2JCYA 4NSNA 4PO1A 2Z6VA 2NU8A 4V1CI 5FPKA 3M6FA 4ZKEA 5CT4A 4KVGA 1GUZA 3PFNA 3J7AC 4EW1A 2QMYA 3P9SA 1EZ4A 1ZH2A 1SPXA 2GKGA 4FLEA 1FMTA 3RK0A 4BZZA 4FYHA 3GJ8A 4Q93A 1L7BA 2P62A 3QFRA 2Y67A 2AG1A 2H1IA 2FLWA 2QTTA 2X2OA 3GZNA 2F59A 4W5RA 2XNJA 1RKQA 2CDRA 3LC0A 3L79A 3SM3A 3PE6A 2GERA 3R7NA 4D4LA 1RBYA 3SS9X 3R6WA 3V8PA 4UHDA 3TLAA 2XZPA 4MW9A 3GLHB 3RVDA 1SZCA 2WIFA 1OY1A 4O5OA 1S4MA 1JFRA 4MS3A 4DARA 1ZI9A 1O96B 1NXXA 1WMBA 2YHSA 2Y1DA 1UAAA 5C0OE 3T5BA 1Z4KA 4D3YA 4B48A 3E2IA 4QG3A 2IW1A 2WKQA 5KU1A 4BE7B 1G9TA 2Q27A 3VBEA 3CO5A 1WZNA 3DVSX 3K1YA 3DLBA 1TB4A 1E6LA 3L7MA 4KO2S 3OURA 4RHXA 5ALXA 3RK4A 1USIA 3TBHA 4YR7A 5L53A 4TL7A 2PJRA 4JLDA 4PAGA 3E35A 2HRDA 1ZL2A 1IBSA 1WCXA 2O52A 2YV1A 3H16A 1NVGA 4E4YA 2QA5A 1Q7GA 2R11A 2BDUA 3P9QA 4EPRA 3VKHA 3G13A 2P4UA 3I2FA 3AG5A 1U3FA 4GKBA 3WB2A 4ESOA 3VDQA 4LOKA 3IKLA 3UGTA 1EVYA 1JA9A 1XQYA 2X9GA 4M46A 1YE5A 2UVDA 1H5QA 1E4EA 1S2GA 3E1GA 5HRUA 3KBBA 1Y7LA 1QHYA 1UPUA 4DJEC 3TDNA 5FO1A 3OM0A 1A4IA 4BB5A 1TNDA 4MX8A 1O6CA 2P9YA 4J4HA 4OG2A 4FOTA 5ALTA 1OGIA 3RUPA 3LDHA 3ZDEA 5LP6C 4HZUB 1NIJA 4EYSA 1VLVA 1B73A 2JLAA 1BGVA 4IMIB 9GPBA 4CF5A 3PDJA 4OHXA 4ZEOA 4CIYA 4TL9A 2BELA 2LWIA 5J5AA 4ND2A 4UFPA 2QTRA 3CPJB 1S8NA 1EFVB 2AG8A 2ZCVA 4ZKDA 5CEJA 1E3MA 1U1CA 4TYMA 2XLBA 1WCIB 2C94A 4NS4A 1TPZA 4LUCA 1NG1A 1GTJ1 2WTNA 2Z09A 2R8OA 3PIRA 4I9FA 4G0ZA 4TZTA 4XGNA 3A2KA 3MGCA 2YOFA 5DYYA 4DUYB 3HBMA 1UBMS 3A28A 3FIUA 3T41A 3G1UA 2NT4A 3RADC 1I2DA 5HE9A 5CDFE 3CWZA 1PFYA 2G9NA 5BNTA 1ZIPA 2HSGA 2Y2VA 4F5YA 3TEMA 4B6OA 3AW9A 4GS5A 4ZJPA 5M29A 1KZYC 2HCFA 4HF7A 2W42A 3NETA 1KE1A 4RHYA 3ENKA 1D04A 5BN4A 4BVFA 4LMAA 4EA8A 4HGYA 4UTNA 2YOHA 5F2KA 4URXR 1CF4A 3EYWA 5CLHA 4GBMA 2W6NA 3LT0A 5BOSB 3Q72A 2HBQA 1I7DA 4JQOA 5KWVA 2G9VA 2WV9A 3OCVA 1DIAA 4BYGA 1T36B 1QHHA 1QRUA 1NPTO 1CUBA 2VN8A 4KDEA 3FCCA 3WMXA 4I50A 5ELXA 4KQMA 1ZIOA 3OE5A 5LU8A 2EJWA 2UZ0A 2QQEA 3Q3EA 5AT1A 3BFPA 5I5EA 4NFYA 4LVUA 5ITVA 2HSWA 2Z6AA 1RZRD 4HXEB 1SCUB 2R62A 1VTKA 1BVRA 1IBKB 2PD6A 3ZYZA 1BQ4A 1T3SA 2HF9A 1JLHA 4BNVA 3ZK7A 1TEHA 2AXQA 4RA6B 4ENQA 3AVPA 4JB3A 2P8SA 1T2VA 2PFSA 4MJXA 5AI9A 3EH2A 4OA5A 3WRYC 4XQCA 4WZAE 4YCDA 3T9BA 2P4QA 3K2IA 1EVLA 3EGWA 3LGXA 3MERA 4KEAA 4BO7A 1JYEA 4RIIA 5FTWA 1KDPA 5DXAA 1L5FA 3JRNA 5B6IA 2O0JA 1LZLA 3GLFE 2AFRA 2VQ3A 3ZDZB 1GNVA 4D81A 1NA5A 3IIJA 2YHAA 2RAFA 1QOZA 2EJTA 3ETCA 2AYXA 4LCJA 1BO6A 3M4NA 2SECE 4R54A 2AYYA 1KI8A 2PX4A 3F2IA 1JR6A 3VNVA 2V9ZA 3BGDA 2YRFA 4OHZA 1GPUA 2QLMA 3DKPA 2X7JA 5H7XA 5KNBA 2JDIA 4D9KA 3JR7A 5HCUA 1E2UA 3HEAA 1Y8QB 3M2PA 3RVMA 1F8XA 2NO6A 2VHXA 4QUDA 3W4KA 2B7BA 2JJ1A 3QE2A 3VDXA 2WFAA 2AOUB 5BXQC 5CEFA 4BXOB 5CDHA 1MENA 3BL6A 5KKCA 4LBZA 1Y6FA 1Z2PX 4GZ6A 4YY3B 2JL1A 1Z17A 3TOCA 3K9LA 1HTBA 2AG0A 2FFAA 3GXOA 3O1IC 7GPBA 3FHLA 3QE9Y 1V16B 1CUAA 4QHYA 4IO0A 3KKEA 3P0HA 4UDXX 5L7YA 3U44A 4DJ5X 3KOMA 4NCXA 4EYOA 1KP2A 1Q17A 1QYDA 4P0QB 2QRGA 4AFNA 3S2IA 5AK6A 1V47A 3GJ7A 3EY9A 4I9GA 3U3RA 4XUDA 2ENWA 1L5GB 3SYLA 4ECAA 1NASA 2LW7A 1B3RA 1X1QA 1J8VA 2IQ5A 2C4MA 3A6GA 4E3ZA 5DTQA 4ETIA 4PZUA 5E1OA 3ZLJA 2QGFA 2X40A 4RJKA 3Q41A 4H6XA 1E69A 3PBKA 5KYWA 1O6GA 1I5RA 3TRJA 3T1OA 5IKPA 2R65A 4N12A 4A16A 3K09C 1TYDE 1TD9A 6GPBA 5HKLA 1W73A 1IULA 4OAOA 1JBQA 1E2MA 2PXHA 1PR2A 2NYRA 3CX6A 1XEAA 1NVTA 3LOPA 3B1JA 3R3UA 1E96A 2H1CA 4KQ2A 5GPBA 5IDWA 5IFLA 1NNEA 2Y1GA 3Q87B 3IUYA 3LY9A 4A15A 5I4IA 4DR7B 4AICA 1PJSA 1JFFA 1R4NB 2XF8A 3GOHA 3I6QA 4XYMA 2R4QA 2MINB 5AI5A 4DWWA 2EFEB 4C4SA 4AJJA 4D4HA 2H2FA 1N36B 2X14A 3NHUA 2ZCJA 4BPRA 4IG9A 1JNYA 4CN9A 1W1WA 2R7AA 4M7RA 5FJJA 4QDXA 2ZATA 4IFTA 3ROPA 1PAUA 2IH4A 3H9CA 4E14A 4I99A 1YKGA 1Z5NA 2FUKA 2LZ0A 3H7AA 1QVZA 1IXSB 2QD2A 1G19A 3PX3A 3C4VA 4K6HA 2BTOA 2WF5A 5CFZA 4FEYA 3TRHA 4EGAA 4RVGA 3CG4A 2AZTA 2JBAA 2WHYA 3EQ2A 4G84A 4HH1A 4BNFA 5AW8A 3SYRA 1CS0A 4PO3X 1RAEA 4KBFA 4QOFA 4G5FA 4BLTA 4BVKA 2BF4A 1HPLA 1P7YA 1VYHA 4F93B 3ZHSA 4B32A 1JWBB 1ADJA 5LPNA 1E8DA 2P8JA 3QA3E 1ZHFA 4N40A 1Z8FA 2HA5A 2WP0A 1WNTA 1YL7A 2APJA 3NGXA 2VSOA 3P1JA 4PNEA 2QEQA 3H87A 5IVIA 3ZDRA 3KSAC 1GTRA 5COQA 2FWJA 5ALVA 2XZTA 2J0QA 1FZQA 1XZ8A 1FYXA 1L8LA 4X61A 1SZJG 2CNDA 1X87A 2VYFA 3IOEA 4LYHA 4MW1A 4L07A 4O4HA 1KI1A 1G21B 1PGNA 2XYPA 2WE7A 4RMJA 5H70A 2EHJA 5ALRA 4AUNA 2NNLD 4EFNA 5D85A 3NAGA 3FKSD 2PK3A 1F6WA 4NH0A 3JD3A 4YXWD 3UNXA 5AUQA 4YV0A 2PSDA 1NU8A 1DOHA 1EIZA 5FUWA 4O3MA 3HKDA 1YB1A 4OHMA 3DE6X 2H4XA 3T5MA 4DCCA 4AJEA 4F5EA 3LBYA 3EXIB 5DIZA 4CFSA 3GFTA 4ZI3A 2QRNA 3TNDA 3IXLA 1KYWA 1ID8A 3EEFA 4L95C 2Z3WA 5B1SA 4KPUA 4DKXA 4ZMRA 1D6NA 4F6RA 4HDKA 4L15A 3U49A 2LCFA 2VF7A 3B1FA 5TEVA 2C07A 1JI3A 1U0GA 3DEYX 5EZ6B 4WZBB 2GEFA 3FLMA 2C20A 5JJLA 3JQEA 3BCRA 2QW1A 3K1ZA 4A8JB 4ECEA 2GK4A 1I14A 1Z8DA 4PXSA 1WXHA 3CUSA 3GFRA 4J29A 4CIBA 2F8SA 3NHSA 3QWBA 3AFMA 5F2NA 5KYYA 3UMGA 2V5VA 6ADHA 2Q3JA 3QH4A 4MVYA 1JU3A 4WOJA 4JQSA 3CVYA 5EZ5A 4C0AC 3I9NA 2QTVB 3RE1A 3TRKA 4JXXA 1N2SA 1BSVA 1P0MA 3F5QA 3KKKA 3AR5A 4MZXA 5IK2A 1FRZA 4NHOA 4B9AA 4BMCA 3SR4A 1ULTA 2H08A 2BFEB 4Z7OB 3IUNA 2Y92A 5DPMA 4AI6A 1REQB 4O2BB 3BL5A 1JE1A 2CLMB 4UPVA 5DYGA 3CVXA 2ZJ4A 1BS2A 4ZCSA 3ROKA 2G5PA 1HWYA 4JKOA 3HYTA 4DAEA 2G3YA 5TF4A 3GDOA 1GAWA 1UFRA 3Q7PA 4BV8A 1KI9A 1NUPA 4QX6A 4PTYA 1N0VC 3SSAA 2WRZA 2K87A 4RHEA 1QBGA 1ZA1A 4W1RA 3ZH2A 3ABRB 5B2EA 2IDKA 3A6KA 3A25A 2FUG6 1AQ6A 1UT6A 4JN6B 3TL6A 2GK6A 3PPWA 3E9EA 3JQBC 3M89A 3MTDA 1UM9A 4DMCA 2B98A 3K9NA 1SPBS 3ONFA 2AJCA 4LY6A 5AI8A 5ED0A 3JSAA 2WWRA 5FPHA 1Z0SA 2PIDA 1PNQA 1U8FO 4K05A 5EEGA 5FWXA 5HNKA 2OWEA 5CIQA 3OBBA 3TEFA 4AD8A 1OI2A 1SIUA 4RULA 3PTLA 2NXWA 2MR6A 4JXZA 1KXJA 4YASA 4MRMA 1GTVA 4O2RA 5B5SA 4XTCS 5JFGA 5DI3A 4KXWA 1QQ7A 5AXDA 1T3HA 2B61A 1CQPA 3QYJA 4BC1A 1IXYA 2KLHA 2MWMA 4QGGA 3FUTA 1RYHA 4TSFA 2C8JA 1C3VA 2H5LA 4HDRA 2PAFA 2TMGA 4YJ2A 1EP1B 2HHLA 3C3DA 4GM0A 3RFCA 3VC2A 5E9JA 3ZBQA 1YHNA 2VJDA 3H7IA 1JHRA 4CM8A 4AURA 4X6YA 3NO4A 4DFDA 3KT0A 4CG2A 4U39A 2NSLA 4NMWA 2YKGA 3GEMA 2BDTA 4DVJA 1EQ2A 2BF7A 2R6GA 2VJBA 5B2ZA 1I3NA 1PYGA 4DB4A 2VJMB 2ACWA 5LYJB 2QENA 3CISA 1KH2A 4MW2A 3TGPA 3EGXB 5J40A 4D2IA 1A9ZA 3BWVA 4UW9A 3P9NA 3UCFA 4Q4AB 1DG3A 4FHEA 2GPAA 1NR7A 2WU3A 1AUPA 3FDZB 1SXQA 3L0SA 4OB8A 2E6KA 2F4NA 2HSEA 3A37A 4KBYA 4YP7A 3ND6A 2L2QA 3DO8A 3R7AA 1YFLA 5SYMA 3GV0A 3V1KA 2FSVC 3GT0A 5KQSA 2W0MA 1SXJE 1JSXA 1U3DA 1VG9B 2QAJA 1SHLA 3K8QA 4FMPA 1C9YA 4LHEA 2IKSA 1KWKA 4A6XA 1PE0A 4JUIA 1E1CB 4BNUA 3QHQA 1WUTA 3LY8A 5DYWA 1F0YA 1ZS9A 3RUAA 4BBAA 1UXIA 5DE3A 3LQ1A 4BX0A 5KWSA 3O3OB 1MDBA 3WBBA 1OXKB 5FYQA 4NXMB 3WLHA 1WKVA 3QPCA 1EUCB 4RZ2A 4NJEB 3S68A 1K1EA 1VLJA 2QF7A 4MI3A 4Y2HA 3SCZA 3OQPA 1BHO1 2Y1KA 1Z36A 1WHTA 5K4GA 5MGBA 2QQ0A 4I3GA 4QXQA 2HLPA 4EY5A 5I9TA 2XODA 5EIBD 2QTMA 2VG8A 3UPTA 1F2TB 1RHRA 1NUAA 3QVSA 3ZD6A 4COKA 1JLLB 1KC3A 4BTEA 3N2YA 2O07A 4HEHA 4FZ3A 4DDTA 5KHLB 2O14A 1O95D 1SVLA 1ESNA 5ICGA 1CJMA 1D8TA 5GP1A 3DYBA 3WGKA 4CT5A 1SQGA 3FZQA 3RUDA 1Q7TA 4WEQA 1XRQA 3ASUA 4F8EA 3K71B 1FTWA 2QK4A 3K2BA 2PZEA 3ZY5A 3K1TA 2ODWA 5LL6P 1QE5A 3K72B 2JD0A 5IU6A 5H82A 4JQCA 3SHFA 1VBNA 2M6LA 4ZYLA 4H6WA 4PG8A 4RWZA 2GBFA 5E7JA 5CX1B 3GZTB 1XZPA 1T8UA 3FPSA 4MV4A 3E70C 2JS7A 5FLKA 1E1RA 3A9UA 3FH0A 5DXFA 3E22B 3RASA 4MI1A 3UHAA 3VPSA 2BFBA 4KSYA 5G53C 1IQRA 1F2UA 1J2JA 1XMJA 1LNZA 1YJQA 3T1YB 1X2BA 3HJTA 1Z4NA 3IP8A 3IP6A 3PS9A 4JR1A 1GGFA 3UUGA 1IVSA 3F6YA 1THGA 3MF4A 1Y7PA 2QN6A 1XB2A 3ICWA 2ZIXA 1F4VA 3RJ5A 3QEMA 3JRXA 3HZRA 4KRYA 4MQFA 4JLAA 1DQYA 4RACA 4M7WA 2R6HA 1FDSA 1GRNA 2O06A 1WSBA 5K0JA 2RGYA 3ZWMA 3RQSA 4C6HA 2FWIA 4GE0A 4Y6SA 1VHTA 2OBNA 3AESB 4PFQA 3QSYA 1ZAYA 3ZJUA 3EMDA 5H68A 2A7XA 1WXGA 4NHEA 1AXEA 3E7XA 5DLPA 3TFQA 5A3QA 3U5TA 4CLEA 4X90A 5LQUA 2JGKA 2Q1UA 1XQ6A 2P4SA 3BXGA 4BKRA 4DTIA 2JLWA 3A1WA 3HJRA 3WZMA 3RYFA 4D9MA 4DZZA 2YMLA 1E79A 3SAJA 4OEHA 5B1EA 1ORHA 3TX2A 3WHPA 1NN5A 1RAFA 2Y0EA 3L4EA 5C3MA 1JXOA 1DMRA 3F9RA 1QKJA 1T9GS 2HGSA 1O6BA 1UC5B 2C9ZA 2JGEA 1RLOA 1U1EA 3HA3A 3CZ9A 3E7DA 1Q2XA 4LN1A 4NENA 4XIJA 1Q20A 1J90A 4MARA 3UMFA 2GHTA 4DMLA 1TF5A 1JZSA 5DV9A 3C43A 4HDCA 3F7MA 4BNKA 2OEPA 4BV9A 4ZMSA 3AWDA 1X9IA 2G9ZA 3WWEA 2NXEA 1ZKMA 4I9NA 4C2AA 1YZLA 5JMPA 4CW7A 7REQA 1ZGBA 2ZRAA 3RD5A 4U3JB 1J22A 4RVDA 3SE7A 3PR1A 2UXBB 4IKOA 1IVYA 4FIZA 2AR9A 3PUIA 5CLJA 3K0AA 4DLTA 2C5HA 1V3UA 4HDRB 2NUTB 2PZAA 3DDSA 4O0MA 5E6SA 3SMQA 4B74A 1U5BA 3CHYA 3ID6C 3JPWA 1WW3A 4YAFA 4R0VA 2YXDA 4JYAB 1JL3A 2G5GX 1I7PA 1O95C 1OLSA 4RXTA 1T9GR 3STTA 3M3DA 1ETHA 2ZI4A 3WG9A 4TN1A 3LQQA 1QGDA 2UXCB 1XWWA 1Y33E 3K4HA 1KRWA 1TT5B 2ADMA 2EP5A 2P9CA 3FYUB 1MQAA 1V1MA 2R5FA 2ZFUA 4G4SO 4NCKA 1Z6TA 2VZ0A 1Y63A 3VNSA 4BQRA 4BEVA 1H1LB 3I04M 2WJYA 1SU8A 1KRXA 4C3ZA 1MOSA 2WJ3A 4U9IS 4YRAA 3GUVA 4LZZA 3W34A 4G67A 3H6HA 3S5UA 1GV1A 4NBKA 2WQZA 4UTPA 5C9ZA 2Q0QA 2W93A 1UBHS 5B4UA 2IBMA 2Y05A 3CFYA 1ZUNA 2QTGA 1IHXA 3VI4B 3EVNA 4GSLA 2BI8A 3FRIA 4W5TA 3NCHA 2O8FA 4HLCA 1ADFA 1V8OA 5A05A 3QEAZ 5BMVA 3CU5A 4HQ0A 4OV6B 4PAOA 3V4ZA 3WV5A 3N2LA 3JS5A 4LXTA 2K4MA 1MC8A 1I33A 1RHMA 1G2IA 2ZRKA 3PQDA 4MWOA 5SZJA 4F21A 2QBYA 2VC2B 2XH8A 3K6JA 1MAWA 1XD8A 1CY4A 1VECA 4Y67A 4S1TA 5DHRA 3Q8MA 2B4RO 2QZ4A 3WVNA 3MT9A 5IP5A 5DGIA 2IEIA 3GOQA 3IIKA 2HU5A 1QH8B 2QU8A 3MTEA 4ALMA 5HTKA 4XVHA 1WEHA 1AZLA 4AZWA 1J21A 2NAPA 3DKVA 3LVRE 4L9SA 1JE0A 3E9QA 2OP0A 3RVBA 3SEQA 3UHPA 2DYKA 5H9WA 3C4QA 3DZFA 1SY7A 3UA4A 4EJMA 3BIJA 2SNIE 2D2XA 3PWKA 4WAUA 2H2WA 3GHYA 5GMOA 3GLIE 3ZVLA 4JJGA 3I5AA 1A82A 1PK8A 4TKVA 2SBTA 2W2LA 4C5BA 2YW9A 3ZN2A 4C1BA 1T4MA 3G2IA 3EG9B 1AQYA 3PPYA 1P7ZA 1UBEA 3E53A 4KLNA 3AETA 3LQ4A 3UOAB 1ZSVA 4FS3A 1DAKA 1OVGA 2MYTA 3B1YA 3CVOA 4HPWA 3BWBA 3DNPA 3I09A 1BVUA 3CUUA 3M49A 3M6LA 3P32A 3I2JA 2IHYA 1YVPA 1U8CB 5CU7A 2G82A 1L5OA 3L82B 3DDHA 2GF2A 1AU9A 1COWA 1Z88A 2PDAA 3R76A 3BRCA 1NJSA 1VSUA 3K0EA 3HB9A 2XGOA 3RG8A 4ZDIA 1KSJA 2HA3A 4AKTA 3SVTA 1HNZB 2UZ1A 1FVOA 2QMQA 3LG2A 2C2HA 3UK0A 2AA3A 1E94E 3KB8A 5TS2A 1A04A 3AM1A 1NLFA 1Y1LA 5H0IA 1RLIA 3QVOA 2EZTA 4GDFA 3GROA 1KSHA 1Z25A 3PGKA 1AUQA 1YQWA 4FFSA 4NCJA 3QBJA 5HJ2A 1TC2A 3SSMA 5DW0A 3QVWA 4QTUB 1THTA 1LLUA 2JA2A 1DJNA 3CBGA 4RCYA 4U8HA 4WLOA 3KLMX 1FNNA 3ZWVA 1YZHA 4IEIA 4EPWA 4ETWA 2NXCA 4RELA 1G1AA 3CUEF 1AY0A 5D1HA 1Q0ZA 1W96A 4KMSA 3RFXA 1VJCA 2HN9A 4RD2A 3CMMA 1Z9BA 3Q2IA 4LBVA 4DLKA 3I0NA 1IOWA 3AEUA 4NBWA 4QREA 1FUUA 2PIAA 3GX1A 3ZIUA 4ZGBA 4TKVB 2C3YA 4GBGA 4K9PA 3OHSX 1GN9A 3BTOA 2AF3C 1KFCB 1PZHA 1ZP6A 3SC3A 1K8YB 2QYTA 4FOOA 4RJ2A 3ZDXB 4B83A 5IC4A 1ZICA 2I33A 4A1FA 4YCLA 2E4AA 3CRZA 3KEQA 3NFYA 3QBTA 3DULA 4AK9A 5K0FA 3AF3A 4S1VA 1X42A 3LV8A 4TMWA 3ROGA 3PUXA 5JRJA 4HVAA 1PG2A 3V5NA 5L3RA 4R2KA 1QZXA 4D8TA 1UQRA 2OXIA 1AE1A 1FFDA 1FPMA 1SKQA 5H9VA 1NHWA 4N3GA 4Z8XA 5DNUA 3LNTA 2JANA 3CNOA 3SR0A 3U48A 5JY1A 1RYZA 2YS7A 3TRIA 8OHMA 3VH4A 1E3WA 4LOIA 1UT8A 3TNFA 2E3JA 2JLQA 1PW5A 3V6LA 3WGTA 5C1PA 5KMGB 3AUJB 2O7NA 2J3JA 2GD2A 3A31A 3FMFA 3D0KA 1RYEA 4BMPB 2FCAA 2X4IA 4CV3A 1WLYA 4O4JA 3EOBI 3FTDA 3EXEB 2J85A 5C51B 1DARA 2V7VA 2CJXA 5CVVA 2IXTA 4HATA 1AVTA 4OUKX 1XEWX 3ZY4A 3GFFA 5ALQA 1YO6A 3QEBZ 3ZU4A 2CBGA 4HXGA 2A0XA 4GPBA 4ZQCB 4C0XA 3NTUA 4R0NA 2FZCA 4UXIA 1WKBA 2ECOA 4NU0A 5JE8A 4ER3A 1I7SB 1E5QA 1I2CA 3MN1A 1LDMA 3QV1A 4JOCA 4MWSA 2ZJ6A 3FY4A 2F3QA 1O4WA 3PGLA 1I0ZA 2C97A 1JXQA 2AI3A 1R0XA 2XVYA 3OC0A 1GLVA 3NHYA 1XA4A 1JIKA 1P3JA 2UUOA 5CAEA 5EL0A 1HMPA 1H9AA 3EH1A 1UJNA 4UU8A 2TYSB 1WMSA 4G63A 4GPZA 3VR1A 3VTZA 4D92A 1ST3A 5JFTA 1ZBQA 5TX7A 4B82A 3L8HA 1IMOA 1TT7A 5TRTA 4RDXA 1VFNA 1T5DX 5ADHA 2XAAA 4YRDA 5EG5A 1FXUA 1SUAA 1X7ZA 2A0FA 1G55A 3FDIA 3O4HA 3OF5A 2C03A 5DRYA 1WETA 2AZMA 2QMUA 3B36A 1J2EA 5FPQA 2QDXA 3FCXA 1V39A 2X6TA 3EXG2 1ZC4A 3AHGA 4YCMA 3I01M 3CJQA 4KFUA 4D6YA 1YVUA 2W22A 2GI4A 4J1TC 5AM0A 4CV2A 2R1VA 2V3VA 3Q1KA 3WQQA 5JCJD 3SZUA 5KSZA 4FK8A 1WZCA 4B4OA 3SKXA 3VR6H 4DJFC 3OQHA 1POXA 3O31A 2YS6A 3KL2A 3IR5A 4MLZA 3MCZA 4L5BA 5ERGB 1XVVA 5EIWA 1R9MA 1RZUA 4A2PA 2B69A 2VUTA 3B89A 2VKQA 4L4UA 2W6PA 1CY8A 2NT3A 2IP4A 4MVJA 4TM8A 4YFYA 3U7EB 5A9RA 5TARA 1K6EA 1U2QA 4MMXB 2CSUA 5EESA 4DR3B 4BNWA 1DSSG 1E8NA 1XFAA 5BSUA 1M6HA 4LFCB 1YI0A 1MF7A 4NE9A 3QBDA 5IJAA 2QR5A 3RFUA 4KX5A 1XVLA 4G65A 2FZEA 2VQSA 2VYND 1BXRA 1X2EA 2XADA 4XD2A 1ZUHA 4CKWB 3LHIA 5AFSA 5HZHA 4RHCA 3VGJA 5K6TA 1K9SA 1PT8A 3D7LA 1WJGA 1N2XA 3QELB 3CB2A 2W48A 2CXXA 2CLDX 1NMSA 3LCMA 1AM4D 3WWCA 4IJKA 4BZXA 3CLRC 4BS9A 1KZGB 4LAFA 2WMNB 3SYMA 4KPFC 4LDPA 1YE8A 4HRVA 4L7VA 4YMLA 4EEXA 3O8QA 5KYNA 1JVNA 1YTUA 5CDSA 2XWPA 3FDXA 4C22A 4B4WA 1NLMA 4NWIA 5FAKA 4RF5A 5DCUA 4DBLE 5FBZA 4UCQA 3GF4A 3LPCA 2PS3A 4I19A 1WPXA 1NWHA 4P4SA 1HORA 5LXTF 4DSOA 1W2GA 4F72A 5HUQA 3THRA 5L7TA 3CONA 4E11A 1V8PA 4EBFA 1R3UA 1PSZA 1Q3TA 3EXHA 1IZ9A 1XCJA 4G5GA 4XWTA 3ZZTA 1VBFA 4DUGD 1DVRA 1UBUS 2WDPA 4KP7A 1LTHR 4K88A 4G26A 2C9YA 4J6FA 2AZ4A 3EBOA 2BJVA 5JADA 1U80A 4N9WA 4P4UA 1HOTA 5TS3A 1FRFS 1L5HA 4ZPJA 1S7GA 1WSWA 1X1EA 5E4YA 2V0NA 3EDOA 2IF2A 3EIWA 2PZBA 3TLYA 5JCOC 3TE6A 3Q3GE 4WKGA 4BNXA 4ZCRA 1E0AA 5HRCA 3PFHA 5ECYA 3LZCA 4D7AA 4NH4A 5CXSA 1JDVA 4C4OA 3QJ5A 1W0KA 3ST7A 5DM0A 4LFBB 4X64B 2YV4A 4HX9A 1JLLA 1SVUA 1L4NA 3JQBA 5CB4B 3WGMA 3GQBA 3LK7A 1C9KA 4A6DA 4CL0A 4DW8A 2DCMA 2PBLA 4J0QA 1FMFA 4R1PA 1ZCZA 3D3NA 3BMQB 1M2VB 5ENDA 2WICA 3DLAA 1R0BA 5AW4A 1MG5A 3GGCA 1KY4A 4DBVO 1MIHA 3L43A 4Q9AA 3KTAA 2Y77A 1E58A 3DPUA 3HKCA 3L49A 3OC6A 4ZT6A 3ZNPA 3W5HA 2HMYB 2WIKA 3IE2A 4QFDA 5FUQA 4PZZA 5KUTA 1YR1A 4MGIR 4AWXA 1G64A 5BSWA 4YIKA 3IP7A 1PFKA 2HZ7A 4GZ3A 1YI1A 2QE7D 2O9JA 2PSJA 3PPXA 5GM2A 4RTNA 3ELYA 2Q1SA 3H2SA 1XKLA 4JGIA 3TLMA 2V6GA 4HTAA 5JCJA 2R44A 1X7YA 4F5ZA 1AKUA 3D54D 5EXPA 1Y9ZA 3DZGA 5FUMA 1NUSA 3HNPA 4YHBA 5JQGA 4JR2A 3QXCA 4JBYA 4TUYA 3DFUA 3EC1A 1OILA 2CLSA 3DZDA 2JFFA 3OFJA 2QVYX 1JDZA 4XGRA 1H9BA 3ROMA 5AVQA 2D4AA 1P4SA 2GN4A 5ITZA 5KQRA 3O74A 1AK2A 1W85B 3CX3A 1P1CA 4KQJA 4U9UA 4MEAA 3VFDA 1CVLA 1ZMXA 1GDDA 2QRMA 2Z2XA 3RIXA 3VDNB 4I2NA 3HLKA 3RANA 3FDZA 5BT8A 3GJRA 1XPJA 2DETA 1UPBA 1ZEMA 3JZDA 5HKKD 2ZIWB 4U02A 3UB2A 3MFQA 4PW0A 4O59O 4HUQB 1PJ2A 2CNBA 3FMVA