3E9NA

Crystal structure of a putative short-chain dehydrogenase/reductase from corynebacterium glutamicum
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
225
structure length
189
Chain Sequence
b'KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVEPIESDIVKEVLEEGGVDKLKNLDHVDTLVHAAGSVAEWHAHLDLNVIVPAELSRQLLPALRAASGCVIYINNTIYAASKHALRGLADAFRKEEANNGIRVSTVSPGPTRPEIYIEPKEIANAIRFVIDAGETTQITNVDVRPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
publication title Crystal structure of a putative short-chain dehydrogenase/reductase from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum
molecule tags Oxidoreductase
total genus 71
structure length 189
sequence length 225
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.36: Acetoacetyl-CoA reductase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3e9nA00
3AUTA 3ON5A 3ANMA 3KSUA 4H16A 1V6AA 1E5LA 2X86A 3B1KA 1IZ0A 1KVRA 1R0LA 4IIVA 4GAEA 2W8ZA 3IJPA 1EUZA 2O7QA 4DQXA 2GN9A 2CDAA 4WNIA 4ZQBA 5BNIA 2HCTA 1IPFA 1LDBA 3SJ7A 4UREA 3GDGA 2Q99A 4EW6A 5IXYA 1A7KA 1ZEJA 2WYWA 3HDJA 3ROMA 3KTDA 4Y6PA 2OMEA 3F9IA 4D0SA 3MJSA 3KSDO 2VRCA 2J3IA 3S2EA 1UDBA 4WLEA 1KOLA 4XR9A 1N9GB 1EBUA 3N58A 2CZCA 3OQ1A 3D0OA 1SBYA 1GPDG 3ONFA 3VH3A 3NX4A 3JQFA 3TOZA 1WWKA 4A26A 3P7MA 1YE3A 4BNYA 1P3DA 4D44A 2FR1A 1A27A 4JBIA 1MGOA 4J1NA 3GMSA 3JYLA 2HRBA 1L7EA 1YJQA 1HDOA 1FXSA 4TROA 3KEOA 3RFTA 1L7DA 3KVOA 3ITKA 1O9BA 1P1KA 2Q1WA 4NH4A 2BELA 1QV6A 3K92A 4UEOA 3RKUA 3JCZA 4GMFA 2XF8A 2VTDA 4F45A 5CEFA 4PLGA 4XQGA 1XA0A 5HM8A 3I4CA 1I32A 1UUFA 3RWBA 4TRMA 3G79A 4E33A 2UUPA 4OL9A 3DHYA 5CFZA 3LYLA 1CETA 1NQ5A 2YQ5A 1T4DA 3DTYA 3JQGB 1WDKA 3V5NA 3VC7A 4WEQA 1EVZA 3OHSX 4MP6A 3RC2A 2JAHA 3WNVA 2Q1TA 3TN7A 4XCVA 4GWKA 2IE0A 3G0OA 4GLLA 4BNKA 4YRBA 4A2CA 4E30A 3VVBA 1X7DA 4PGFA 3RC1A 1LLQA 2VNAA 2A94A 3PLRA 3I1JA 4J1SA 2Q2VA 4PIVA 3E8XA 3QWBA 4Y9DA 1HT0A 2BF7A 2FR0A 3HDYA 2VRCD 2Q3EA 3P5SA 3PHIA 4GX2A 4PVCA 1P0CA 4FS3A 1GV0A 2V6GA 3QWIA 1WXDA 1KVQA 3PGJA 4LSWA 2J5QA 3ETEA 4E2YA 2EIHA 4J6FA 1R4MB 3AY7A 4KMSA 1ONPA 2CFCA 4W9NC 2VHZA 3E9NA 3NT2A 4U7WA 2G1UA 3QA9A 5TF4A 1E1KA 3DBHA 4OJNA 5JDCA 1ADGA 1YOVB 1DIGA 4WOKA 1GUFA 3P2YA 3DHEA 1ULSA 3WOHA 5CDUA 1QKIA 8LDHA 1J4AA 3PWKA 4QO8A 1E77A 3BHJA 4EZBA 4P22A 3TZHA 4EEZA 4Q9NA 2Y0DA 4MIYA 5L7YA 3Q11A 3PHLA 4LVCA 1SAYA 2VNSA 1BTOA 2CF6A 2D5AA 4BNTA 1WVGA 4FJ1A 1BXGA 1HSOA 4E5MA 3GN1A 4XKJA 2HRZA 4JK3A 3WQRA 1EVYA 3DMTC 3GEMA 5LDHA 3QWAA 3OEWA 1NM5A 2HUNA 1G6KA 2VZ8A 1Z82A 3FHLA 4FOOA 4HP8A 3GVIA 1NQTA 3GPDG 4E13A 3WYEA 5L53A 2QHXA 5T8KA 3HDHA 2V6BA 1YQXA 4EJ0A 3SLGA 3GAZA 2NM0A 1QYXA 4RPHA 4BNWA 4E3ZA 2OOSA 4BO8A 1GD1O 1JKJA 3G1UA 4CQLB 4FFNA 3IP1A 5L7TA 3SJUA 4G65A 1JN0A 3G17A 1QG6A 3QLJA 2LDXA 1Z6ZA 3H3JA 2E6UX 3H2ZA 2DTXA 3KM0A 3PFFA 1PGJA 5TJ9A 3DEYX 3W8DA 1KERA 1T2DA 3BHMA 4RZIA 1JLLA 3EHEA 4PN3A 1Y6JA 4L9RA 4ND2A 3W8EA 1ZBQA 4HY3A 1ISFA 2IODA 1Y8RB 3A4VA 2XAAA 1DOHA 1UP4A 2VQ3A 3BMCA 4KWIA 5U9CA 1ISGA 4LMPA 1ZJZA 4YJGA 4OXKA 5JY1A 4AJHA 1BVUA 3PVZA 4RVFA 1T25A 2ZK7A 5CAEA 2EG9A 4HFJA 4NI5A 1P1HA 4F3YA 2W98A 5IAAA 2ZYDA 1U7TA 2HQ1A 2WTBA 1ZW1A 1MFPA 1N1GA 3QJ5A 1C1DA 3RUIA 1ML3A 4CLDA 3RJ9A 4OH1A 2BI7A 1QMGA 2EGGA 5G4KA 1JKIA 4UVGA 1DC3A 4L76A 2WSBA 2X4GA 3JQAA 3QE3A 3JQ9C 3GR6A 5BR7A 1GYQA 3OJEA 1WP4A 3PWSA 5C7OO 3PYXA 4XGKA 3ZHYA 5TT1A 3H9GA 4JJFA 3AY6A 3EAGA 4DQVA 3WIDA 1HZZA 4DUPA 3IOYA 1LA2A 1HZJA 1NBOA 1PL6A 1ENPA 1U9JA 4IJKA 1ENZA 4NU6A 2PZKA 3NKLA 4DQUA 4MVJG 4CM1A 3ZHXA 1LDNA 4XA8A 4GKBA 3DO5A 4II3A 5DZSA 4BNFA 2OFPA 3B6ZA 1NR7A 3JTMA 1NVMB 3JQ6A 1Q1NA 5ENDA 2Z5LA 2Y1GA 1P31A 1MG0A 1F8GA 3EZLA 4RPLA 3DBLA 4OQZA 2O3JA 3A14A 3VZPA 3O26A 1YDEA 5DNAA 3BTVA 5G4LA 1LLUA 3DC2A 2C2YA 2YDXA 1NFQA 4J1TA 1BWSA 1SPXA 1HYHA 5THKA 2WD7A 2VTEA 3C24A 1DAPA 3IDSA 1PZEA 2EGHA 2NUAA 4JJIA 5LDGA 3FN4A 4B8WA 3RIHA 3FR7A 5DBFA 3RUCA 3JD1A 3NJ4A 5JMPA 4ALIA 4WOJA 4ONEA 2VHXA 1IUKA 2FP4A 4TVBA 1ISMA 1PGOA 2ILTA 3AJRA 2JHGA 4KUHA 3F5SA 5I7FA 1G0NA 4O59O 4TRJA 1I01A 4BIIA 3JQAD 5KVSA 3JQ8A 1HDRA 1H9BA 1XSEA 3OM9A 4L74A 2AEJA 4M55A 1PQWA 3RQSA 1PGPA 5TIIA 5CPFA 2PH3A 2PWZA 2PY6A 4GQAA 5C7IO 1E7YA 3R3SA 4MDHA 4ND5A 3TFOA 2GR9A 4ZQGA 3I9NA 1B8PA 2W2LA 2E49A 3RFXA 2ZTUA 3A1NA 1OZAA 4XGIA 2FOIA 3RVDA 4GBJA 4M49A 4OSOA 3GVHA 5EINA 1EBFA 1PIWA 4GI2A 1U4OA 3DBHB 5JSFA 2X9VA 3FNGA 3FRJA 4RPKA 3HN7A 4YRDA 2EP7A 3INTA 1N7HA 3WBFA 1BW9A 4UVEA 2PR2A 3K5PA 4ZRMA 1E6EA 2WYUA 3MZ0A 1YL7A 5JDCC 2NLOA 2EV9A 2JD2A 4WGGA 1SO8A 3I23A 3UKOA 1ISJA 2D2IA 4D3DA 1PR3A 4MVJM 1FDTA 1JU9A 3ZNPA 3B70A 3WGIA 5C7LO 2HK9A 5BSFA 2IYOA 3C8MA 3C85A 3U3XA 2Y67A 1NWCA 4XYMA 5IFLA 2DLDA 4IDDA 4ESOA 3EC7A 1J0XO 1EK6A 1T2EA 1PJ2A 1CJCA 4JIGA 5COBA 3PHGA 5AYVA 3GY0A 2NTVA 4BO3A 1H94A 4NIMA 4EUFA 4LN1A 1PJ3A 5F5NA 4J0FA 1E3WA 1PZHA 5AXDA 4ND4A 1H0KA 4YRAA 4J7UA 2EP5A 4AG3A 1UXGA 1UR5A 3S2IA 3U62A 1MC4A 3AWDA 4XX0A 3QWFA 2PFGA 3PIDA 1G0OA 3AU9A 2YFHA 1FK8A 2DPGA 2VHVA 4WLOA 3LT0A 5IXSA 5CG1A 3QVSA 4WLUA 3I4FA 4HWKA 4WCDA 1P1RA 2GRAA 4FFRA 4KUEA 2E82A 4UVDA 3SLKA 4ZQEA 4BO6A 3L6EA 2AXQA 1E1MA 2W2LD 1P0FA 3OBBA 2YFQA 4RLSA 4BQRA 5A9RA 1D8AA 1QRRA 1OBFO 1JAXA 3H8VA 1NPDA 4YJGB 1RKXA 1MFZA 2HU2A 4EEXA 2JCXA 4PLFA 4D0RA 4GKVA 4M86A 2YY7A 2GN6A 3PI7A 4J90A 3H9QA 1I0ZA 4CJXA 2YUTA 3GK3A 1ZSYA 5F1PA 4D41A 3LZ6A 4DL9A 1GAEO 3TPCA 3LU1A 1R66A 2Y68A 3SXPA 4ZVVA 2CVQA 3NUGA 3OIFA 1VKOA 1C1DB 5KVQA 3VHRA 3WXBA 5I7SA 2X5KO 3VPSA 3ANNA 4PLPA 4A73A 2QX7A 1IY8A 1RWBA 5G4KB 4EJMA 4KUGA 3K31A 4CM8A 2FR8A 3JQAB 3CPSA 1IYZA 4FW8A 3CKYA 3IJRA 1O95A 1T26A 5IG2A 2JJYA 4BNGA 4DREA 3PPIA 2HJRA 3VKVA 3OA2A 4ZD6A 1F17A 1FMCA 1M66A 3PK0A 1XYGA 2CMDA 1F0YA 3WGHA 4NPCA 3U0BA 4I1IA 1NWHA 1U28A 4BNIA 4BNUA 2P91A 4N5LA 2I67A 2YV2A 3E5RA 5L95A 4QXMA 4XQCA 4YBZA 4GGOA 2GZ2A 2NACA 2G17A 4IGFA 3ROKA 4CMBA 5KIAA 3ZWMA 4MO2A 4EUHA 1GQ2A 1I2BA 1GDHA 2VWGA 4XRRA 4RVGA 4E4YA 4E2ZA 2FN7A 3ONEA 3ZCXA 1GR0A 3WSWA 2VOJA 1RM4A 1Y9EA 4NMHA 4XR4A 2VYVA 3ASUA 4KOAA 5EESA 3ZGYA 3TFQA 3DBLB 3H9EO 2DQ4A 5A02A 3M1LA 4DPMA 4S1VA 4XYGA 3RUAA 3ZHZA 4BB6A 2CF5A 3E6AA 3VH1A 4J7XA 4P4NA 1H5QA 1U5CA 4XIYA 1UH5A 1VI2A 3L07A 4G81A 1C0LA 2C20A 5LC1A 3K6JA 3K73O 3GFBA 2FZWA 3Q2IA 1HWYA 3U4DA 2P68A 5BNFA 3Q2KA 1GEEA 4H7PA 1W4ZA 2Y1OA 4L0QA 3FSRA 2FPGA 4GX0A 4AJEA 3LK7A 1QYWA 1KIFA 4RPGA 5TS3A 3U4HA 3BIOA 3ZNOA 2Y0CA 2ZB4A 2C5AA 2VT2A 1JW9B 3QW2A 4FDAA 2GLXA 1E92A 1CF2O 1YGYA 3W6ZA 1ONNA 4DIOA 3V1YA 2AHRA 4UUOA 2FRDA 4FQ8A 4E21A 4W9NA 1A4UA 4QECA 1Z75A 2BGKA 3GQVA 3JQ8B 3PDJA 3L77A 1EVIA 3C7AA 5CDYA 1PJCA 1X1EA 4AJNA 1M2WA 5JNLA 1KEVA 2QRLA 4CPDA 1ZNQO 3BAZA 4DMLA 4MKXA 1NFRA 5JCXA 3FWNA 2UYYA 4XYBA 3CIFA 4IIUA 5KJ1A 1J49A 1OC2A 4CMIA 4QQRA 2SCUA 1BVRA 2Q4EA 1DAOA 3NDRA 4U5QA 3QP9A 5I9NA 3ZV6A 2I76A 3RBZA 1E1NA 1B3RA 5I9LA 1HRDA 2O4CA 5U1PA 3FR8A 1OC4A 2IEDA 3DMTA 4N18A 3FTNA 3WIEA 4YAGA 1ZXBA 2WMDA 2D5CA 1NQAO 4NZ9A 1P1FA 4Z9YA 1LRJA 1YWGO 1RM3A 5KVCA 2VYVD 1BW9B 1XKQA 2X22A 1DHTA 5JAQA 4AVYA 1ONOA 1LJ8A 3LC1O 3EY4A 3AK4A 3F4BA 1XQ1A 1YONA 4IQGA 1BSVA 3STHA 5A04A 1B14A 1GUZA 3WQSB 4BHTA 2ZKLA 4TKMA 4RJTA 4XJTA 2GZ3A 4E6PA 5L45A 1ZCJA 3GVPA 5MGBA 2WD8A 4L4SA 4XWYA 5JO9A 4HADA 4JCOA 3L4BA 4UVIA 4CM4B 4RF4A 3WDSA 1LQUA 2YHIA 2HSDA 2I3GA 3DAGA 3PJEA 4K1LA 4J2OA 4L73A 4CM5A 1CYDA 4XYLA 2PD3A 4BKPA 3D64A 3IIEA 2I6TA 5DOVA 5DDIP 1E3WB 1XLTA 3FPCA 4IGEA 3SC6A 4IBOA 1DRVA 1PZGA 4BS9A 3DR3A 3HE3A 1QYCA 1AXEA 3ZU3A 1BG6A 1Z74A 3T4EA 1KY4A 3VKUA 4CMAA 5A9TA 3C7DB 3VH4A 1AN9A 4IDAA 2VHYA 5F1OA 2Q50A 3UCFA 4K26A 4CODB 1ADCA 2I9PA 3ZWXA 2PV7A 1DLJA 1HKUA 1O8CA 3PTZA 1QYDA 4W99A 5A3JA 3IKTA 1PS9A 4YAJA 1U3WA 1Y81A 1ZEMA 3DDNA 3IAHA 3B20A 1B3BA 1LEHA 5BNTA 1D4FA 1XU7A 2FHSA 1DO8A 1GADO 4BB5A 1E7WA 2DM6A 2QQ5A 4R9RA 3HJAA 1FDVA 4Y98A 3JQ9A 3LT1A 3NTQA 5DBIA 2JKVA 3GGOA 3D5QA 4JBHA 2FSVA 3RI3A 2AEMA 4OHUA 3CZMA 2X0IA 1ZK4A 4YJFA 5A03A 1MB4A 5DCWA 3NRCA 3IL2A 3ULKA 2VZ9A 3QWHA 1HDYA 2W4QA 3O9ZA 1IHXA 3DZIA 2AA3A 3H5NA 3KZVA 4IS3A 3WR5A 4OIMA 4IJVA 2ET6A 4J91A 2Y99A 1N7GA 2X8LA 2ZCUA 3OF2A 1C3VA 4IDCA 4CM8B 1HTBA 4LMRA 2NTJA 3K8ZA 2AQIA 3RROA 5ILGA 2VCYA 2CSUA 1TT7A 5TQVA 4RVUA 5ILOA 3IMFA 3VTFA 5JMWA 3EVTA 3KSZO 3MOIA 3PHJA 4DVJA 3CTMA 2X9GA 3UN1A 4UULA 1JA9A 2Y93A 1WNTA 4EYEA 5JC1A 5CDTA 1EDOA 4OQYA 4UAGA 2E48A 4EBFA 2EW2A 1Q0LA 3AFNA 4F6LA 3PRJA 4C7JA 3JQEA 2J8ZA 3Q0EA 3ZWVA 1YO6A 1HYEA 1Z73A 3PJFA 2EEZA 5B12A 4D43A 4PLHA 1FDSA 4YT4A 3GGPA 2BD0A 1YBMA 2C5EA 4ALKA 4P38A 4YJHB 3RUFA 2DFDA 3INGA 4AICA 2VWHA 1P9LA 5DULA 3BMQA 2VYND 3K2BA 1A72A 4IXWA 2ZQYA 3PHHA 4ID9A 3FNEA 1SCUA 1XR3A 1T1RA 4WPGA 2FWMX 1BXZA 4XB2A 4Z0HO 3KEQA 3WBBA 2R2GA 1K6XA 4MVJA 4S3MA 1YJ8A 3C1AA 4R51A 2C59A 2PKQP 2NTNA 3JYOA 5BSHA 2P4QA 3AUSA 1ENYA 2HO5A 1KETA 1W8DA 2NU7A 4NFYA 4DIFA 4FD3A 3VH2A 3GFGA 3H3FA 1ZVMA 2OXIA 3BTUA 5T5QA 1V0JA 3OA0A 5JBIA 2B0JA 4N5NA 1H9AA 5TRTA 4OM8A 4C4OA 4BO1A 5TGDA 2P9EA 4KTTE 4BKRA 4R68A 1K0UA 3H5AA 3KYDA 3WX0A 3OIDA 4URFA 1X0VA 1LTHR 2QW8A 4OAQA 2B83A 1PZFA 2DVMA 4NNJA 3QRWA 5I9MA 5EJ2A 3EK2A 4ZICA 2J3HA 4B3JA 4F6CA 2EERA 3I9OA 3UAGA 3RJ5A 1Q0HA 2GUGA 1VL0A 4CMIB 3ZU4A 3UXYA 5BSGA 3I5MA 4IUYA 4ZJUA 1IHYA 4J0EA 4IMRA 2E4AA 2ZTMA 3SEFA 4DMMA 3PJDA 3O38A 5CEEA 1ZK0A 5A05A 3ANLA 4IDFA 3X2FA 4A10A 4W6ZA 3WLFA 2D4AA 5JLAA 3NAQA 1HE4A 2X23A 5DP2A 4IS2A 3TJRA 4I9HA 1H93A 2UUOA 4XD2A 2YV1A 2WDZA 1ZH8A 1DPGA 2UDPA 1VL6A 1LSJA 4B4OA 4LK3A 4R1TA 2B69A 1IZ9A 3E03A 4MVJP 4RLHA 5TLSA 1TB4A 3K2EA 3GHYA 2XPCA 5FI5A 3DZFA 4YQYA 2FMUA 2JCVA 4MVJD 3I6QA 2OUIA 4UUNA 4I5FA 1Y8QB 2DUUA 2GSDA 4FJ2A 5JO0A 3NJ8A 5FI3A 5G0TA 2ZTLA 3DAFA 1H2HA 3GT0A 2YHIB 3DZHA 3ROPA 4CMEC 1B7GO 2YYYA 3PZRA 4O0LA 5ADHA 4HFMA 5AXAA 1ZZEA 3ASVA 3PQEA 4QX6A 4QFDA 1KS9A 3L4BC 4PLTA 4CLXA 3U4CA 1EUDA 5ENVA 3JQBC 1AHHA 4N54A 2G82A 4CV2A 3QY9A 4EDFA 2D1YA 4AJPA 6ADHA 2E37A 4II2A 1ZK2A 1UP7A 3UH1A 5F3RA 3GDOA 1HE3A 4KQXA 4BVAA 4CLOB 5JC8A 1NASA 3AI3A 1E0DA 2NADA 5EPOA 4IZIA 3ADPA 2IEBA 3WWYA 3AOGA 3HFGA 3PGXA 2BLLA 1N1EA 3GVXA 1HLDA 1LDEA 2X9NA 1CQJA 3C7CB 1LI4A 3OFSA 3W4KA 2X6TA 4K6CA 5A1TA 4BKQA 4NU5A 3VZRA 3MCVA 3WGGA 1RPNA 2I5PO 2PGJA 3COSA 1V3TA 1HDXA 4RQTA 1SEPA 2OGUA 1NHGA 1NPYA 3OQBA 4YJFB 1U1IA 2C7VA 1HL3A 4F46A 4LGVA 1U3VA 3QVTA 2B35A 2LDBA 1W73A 1O5IA 1ID1A 5DN9A 5IJZA 5JXWA 4J49A 2JHFA 2BFAA 1HF3A 1U8XX 2A35A 5JDIA 5JCJA 1K2WA 2NWQA 3D4OA 3GUYA 5F5LA 4ZA2A 2QZZA 2VT3A 4O6VA 3S1LA 3AFMA 1CEQA 2V6FA 3IS3A 1I30A 4I8XA 5B4TA 3ABIA 2AG8A 4PZDA 3G3EA 5GMOA 3PIIA 4QO7A 4A27A 7MDHA 1KVSA 1DBVO 4Z3DA 5A5FA 4PFJA 1V3UA 3I9LA 4WJZA 5H83A 3RCBA 4CMJA 3OECA 2HMTA 4Q3EA 4BV8A 3KXDA 4FOSA 4ALMA 4Q3CA 1LBEA 1Y7TA 2OP1A 4GVXA 5HTOA 3K9QO 5K6AC 1DIHA 1XG5A 2D0IA 1GTMA 1R12A 5EQDA 5HS4A 5THQA 1PWXA 3K30A 3OQ6A 9LDTA 1ZMTA 5IDYA 3EMKA 4LVUA 3E9MA 5CDSA 3U9LA 3BMQB 4ALJA 3DOJA 4LSMA 4CL3A 2OO5A 3IKVA 3GNTA 4BGUA 5AXCA 2QZ9A 1LXCA 3P19A 1G1AA 1K3TA 3EYWA 1K89A 4MVJE 3OEYA 3BYZA 1YBAA 1FDUA 4TZKA 4KP7A 3DZKA 1YB4A 2JD1A 4J9VA 4NK5A 3LF2A 1XU9A 2A4KA 3LT4A 3RASA 3R1IA 4DPLA 4YYZA 4B4VA 1HXHA 3TZKA 1ZXLA 1N92A 4PCVA 4UEJA 2IYPA 1EQUA 1P74A 4UVHA 1LC0A 2ZATA 5FF9A 4KQWA 4AJJA 1XGKA 4BNLA 3BHIA 4RCVA 3DTTA 3ZH2A 4DIBA 4FGWA 5JCJD 3RUEA 2WWRA 3NV9A 3RBVA 5KJ6A 4IXTA 2AE2A 1LDYA 3ZWBA 3KYDB 4QTZA 1EE2A 1IE3A 1Y5RA 4WUVA 5EQFA 4DYVA 2ZJ0A 1MC5A 5IDWA 3E82A 1FJHA 2GN4A 4W82A 3RUDA 2JFFA 5KKAA 3WGYA 3ICPA 3JQCA 1SB9A 2PTGA 3GNSA 2GYYA 4CMCA 1IULA 1ADBA 3E9QA 4Z0PA 1BDMA 2W90A 3F1KA 3GH3A 3PZBA 5FYDA 1R6DA 4A0SA 1A5ZA 3Q6IA 1UP6A 1R37A 1E3EA 2NU9A 5IZ4A 4L4XA 4RGBA 3VPFA 3AI1A 2VUTA 3LLVA 1L1FA 4PZEA 1ZFNA 3WJAA 2A9FA 1D1TA 4YACA 5KCZA 1BRMA 4NDNE 3WICA 4ITUA 4I5DA 3ZV3A 5ICMA 5IZCA 1PX0A 1UXHA 4CR7A 4DC0A 2QYTA 2VRBA 3DZJA 2DBRA 4NR0A 4E5YA 1P45A 3MWDB 1YL5A 2WE7A 3BA1A 1PL8A 2HAEA 4CM4A 1N5DA 5K0ZA 4NFSA 2GCGA 4U6SA 5IN4A 1VE9A 1WDLA 4CM6A 4OO3A 1E6UA 1A4IA 1PEDA 1GL3A 1YRLA 3IP3A 4PRKA 2H63A 1MX3A 3DZGA 3VPHA 2HLPA 4BO9A 4I08A 4BO4A 1TT5A 4MIOA 2O2YA 5BSEA 2G76A 1HETA 4EI2A 1B26A 1ZJYA 1UXKA 2Y0EA 3NEPX 2CVZA 4KDFA 1NFFA 1VRWA 5BQFA 1EZ4A 4FFOA 3ZV4A 5DF1A 1UDCA 5KNLA 4FC7A 4I9NA 4JP3A 1H6DA 3BMOB 1JWBB 1GZ4A 4Y67A 3G1TA 1E3SA 3WGQA 3GDFA 2RAFA 3S8MA 2Z1MA 2OBNA 2W2KB 3JSAA 3OH8A 3M6IA 4BGVA 4B7UA 2Y1CA 5G0VA 5EERA 4OYRA 3GVCA 3ZU2A 4GGPA 1ZSVA 1U8FO 1H2BA 3FWZA 4R1UA 3JD3A 5ES3A 1AHIA 3VPGA 1EK5A 2RHCA 1ISHA 3NGLA 4CMHA 1PTJA 5TX7A 1JKFA 2VHWA 2Y1FA 4E2WA 3DB2A 4WLNA 5F1KA 3RSHA 4YA6A 3VOSA 2NVUA 2Q49A 4RO0A 2RBEA 4Y6RA 1HSZA 3WYBA 1GQYA 2DPHA 4K9DA 2BFPA 4YEDA 3U4IA 3X2EA 3D4PA 1LDGA 4FPXA 3QSGA 4RPJA 3ORFA 4AJ1A 3UW3A 1DRUA 4CM3A 1K5HA 1KC1A 1JTVA 1U5AA 3E1KA 3JD0A 1ENOA 2J3JA 2X5JO 3QVWA 1LQTA 3ZWWA 5C3MA 1OI7A 1LLDA 3QQPA 4ROSA 2GASA 3WFJA 4BO0A 4WLVA 4B3HA 3H65A 4J4HA 1YKFA 5JDIC 1ADFA 1ZO8A 3NYWA 2Q1UA 3RFVA 5GZ1A 4PVDA 2JD0A 1LU9A 4JXKA 1C0KA 2C2XA 3MOGA 2PK3A 2P5UA 1MP0A 3PJGA 5DCYA 4YJHA 5JPIA 2XXJA 3R0IA 1LUAA 3A06A 4JP2A 3AM5A 2HK8A 1RM5A 4KZPA 3GGGA 1UAYA 3GPIA 3TDKA 4AJLA 2NQ8A 3HZZA 4H15A 5G0WA 3F46A 4GX1A 1YL6A 3ITDA 2UVDA 3RU7A 1T2CA 1I5RA 4WASA 2CNBA 4B4UA 3DFUA 2IRWA 4YWJA 5L4LA 4XZ3A 1PJBA 4DWVA 4B7XA 2EXXA 2PGLA 4INAA 4M89A 5GZ6A 3ZNQA 1RM0A 4LCEA 1GPJA 4WNCA 3ENNA 3L6DA 5DOZA 1I3MA 2IZ1A 3UICA 1NYTA 3IC5A 1VKNA 3I9MA 1D1SA 2D3TA 3GAFA 1W6UA 2O48X 3E18A 4NQZA 1YDWA 1DB3A 1C0IA 1U2DA 4BV9A 2WJPA 4AJKA 4GSKA 3KYCA 5ICSA 2DFVA 4YDRA 4R9SA 1JVSA 4FJ0A 3UUWA 2VOEA 5KWEA 2J3KA 5JE8A 5TC4A 4UUMA 4CV1A 3GHHA 1MV8A 3HG7A 2C29D 3D4NA 3DZBA 4PG7A 4RVHA 2ZQZA 4R1SA 5JAIA 2GDZA 3OIGA 4PG5A 4JQCA 5ER6A 2ZIZA 4QEDA 3QIVA 2C7GA 3FPLA 4TRRA 4D46A 3O03A 4DBVO 3SX2A 1HDZA 3VZSA 3T7CA 2HDHA 1X7GA 3BTSA 2J6IA 3A9WA 3W4JA 1R16A 1AE1A 4BNMA 1DEHA 1R4NB 1DSSG 2PA3A 1YQGA 2Y1DA 1H6AA 1PJQA 2DC1A 4O5OA 2X7HA 3BXXA 4WEOA 1F8FA 1XDWA 2PLAA 1RYEA 1OMOA 4J7CA 2BGMA 3JQDA 5COQA 3ROQA 1XELA 1YS4A 2O3RA 5KOIA 4ZRNA 3I83A 4MOWA 1NHWA 4CMEA 1ZK1A 1NAHA 1TA4A 3WGZA 2I66A 1I8TA 4RDHA 2EKLA 1Y8QA 3WYCA 5JYEA 3GUCA 3JQBA 4LRSB 3RU9A 3W6UA 2G5CA 5IZCC 4PRLA 4EJ6A 4FC6A 4YVFA 3FBGA 1ISIA 3ZWPA 1MG5A 1P33A 2B4TO 3DHNA 5EIOA 2I3AA 3NGXA 3HADA 4PZCA 4XJSA 4YAKA 5EN4A 3V8BA 4I5EA 1VLLA 4Q39A 1E3LA 4ALNA 1LSSA 3L0DA 4HFRA 1PSDA 1TT5B 4TKLA 1KY5A 1QORA 1M76A 3OJOA 1DHRA 1TLTA 4RF5A 3LC7O 4CLOA 3MJVA 1E7QA 3LQFA 3LC2O 1VSUA 3UHAA 1GZ6A 2VYNA 2CD9A 3HFSA 1WPQA 4BNJA 4Z3KA 1HLPA 4ND1A 4R69A 1E3JA 4B4WA 1HDCA 4AJ2A 1MXFA 3C1TA 4R5MA 3QVOA 1Z7BA 4PLVA 1B2LA 4B7CA 2YDYA 4GSLA 4R3NA 3KETA 3HUDA 5I7EA 5TJHA 2AEFA 1XCBA 5JFOA 2AQKA 4WCFB 1Q7CA 4E5KA 3PLNA 5GY7A 4ZU3A 3I52A 1DC5A 2B37A 3V2GA 4P4LA 3WB9A 1UZMA 2P4HX 5IF3A 4CR6A 1A9YA 1GZ3A 4XQ9A 4YT2A 1XQ6A 3SBOA 4CLRB 4O1MA 4WCFC 1M75A 2HMVA 1U2GA 4C7KA 4IMPA 4NBWA 2BFMA 2ZB7A 4E31A 4R16A 4NBVA 4CR8A 3RC7A 5AQ1A 5TNXA 3F1LA 3WMWA 2NVUB 4XQEA 4CM9A 2BHLA 2P9GA 3LDHA 4YXFA 1MLDA 3MJEA 3D5TA 3HNPA 1PGNA 1EDZA 1M67A 3DFZA 4AJ4A 2B4RO 3KBOA 3PP8A 1U7HA 2O3UA 1PU2A 3CMCO 2GERA 1GYPA 2NVBA 2C07A 4AJIA 1AXGA 3INRA 1X15A 4GVLA 4NFHA 4MVJF 4XYEA 3WGOA 2POQX 5K6AA 2YHUA 4CQMA 3KO8A 4JBGA 1F06A 5L4NA 1Y9AA 3RC9A 5U4QA 4BO2A 3S2FA 1F14A 3OJLA 4DA9A 4J4TA 2Z1NA 2CVOA 1WW8A 3H5RA 1NVGA 3I6IA 1VSVA 2O50A 5GZ3A 1ZUD1 3O8QA 1WDMA 4OGWA 4CM7A 4A03A 2DTDA 5B4VA 2PGDA 5JAZA 2H1SA 4IJUA 1OAAA 3L6OO 1E3IA 1DC4A 2TMGA 2PKQO 2Y05A 4OSPA 1A7AA 4HX5A 2UV8A 1GV1A 4O63O 4Q3NA 4CUKA 2ZCVA 3OICA 3D3WA 3NT4A 4XB1A 4J3FA 5L7WA 3WMXA 4EITA 4TWRA 1PJSA 4ZN6A 4YJDA 4IDBA 2O3QA 4RZHA 1VJ1A 1BDBA 1QV7A 5T57A 3RKRA 3OJFA 1NAIA 1V9LA 2VWQA 1D3AA 2QIOA 4DLBA 5JYDA 3ZWAA 1JDJA 5MDHA 4HBGA 3T7EA 3DBRA 4YCAA 3F47A 5T64A 4RF2A 3CE6A 2B36A 1VL8A 4GL4A 2AE1A 3HWRA 1Q7BA 1VC2A 3OETA 4GWGA 3VDQA 4CM9D 1DDOA 4TVOA 4LW8A 4DLLA 5ITVA 2HMWA 4HFNA 3P2OA 2H6EA 1ZIDA 3KYCB 3TZ6A 4U6QA 2RIRA 2BKAA 2HK7A 3VAZA 3KUXA 2YQ4A 3VPXA 4WE3A 1VJ0A 1HDGO 4MIEA 4G2NA 4IJWA 5KJCA 1VJTA 3PFWO 2EF1A 5G2OA 4P8RA 3H6KA 5TSDA 4CQMD 1GU7A 4R5HA 2H9IA 4HKTA 3AOEC 3LLSA 3OSUA 4TSKA 2AW5A 2GN8A 2JFGA 3T4XA 2DBZA 2Q46A 1UAGA 3KB6A 3HB4X 5CP8A 4TQGA 4PG6A 1XWFA 2ZB8A 5LCXA 1UZNA 1FF9A 2P2SA 1E1LA 1PJTA 3R6DA 5KJEA 3ZU5A 5AOVA 3ONDA 4E5NA 1YB5A 1GUYA 1DJQA 2X1HA 1SNYA 1B8VA 3CINA 3DXFA 2UAGA 1SB8A 4LCJA 2C82A 3ZWCA 1E7SA 4CUJA 3WTCA 1SEVA 3LSYA 4BQPA 4DXHA 1EMDA 4MJLA 4NG5A 5G0UA 4JNKA 4XDZA 5HBRA 5DP1A 3IUSA 2ZJ1A 2C54A 4OOEA 3WFIA 1I3LA 3DOOA 5KVVA 4J2HA 2O4UX 2CY0A 3NT5A 4PLZA 3WQQA 4CMKA 2IZZA 1UXIA 1DRWA 3PDUA 4R3WA 4WKGA 2O3TA 3CZRA 3H9UA 4CL8A 2BRUA 2QRKA 3MEQA 2NNLD 4BGEA 1M6HA 4FCCA 1V8BA 1JQBA 4RDIA 4IPTA 2A92A 4FFMA 3EZYA 1GYRA 1SZJG 3ETGA 1KBZA 3Q9NA 1YQDA 4BNVA 4B3IA 4JLWA 3JYQA 3Q3CA 3O4RA 4M8SA 1DLIA 4BNZA 3GC6A 1OFGA 3L9XA 3BMOA 1PGQA 3TWOA 2R00C 2W2KA 4FSHA 3NTOA 1W0CA 4D3FA 5KJFA 2Z95A 3UFXA 4XDYA 4MKRA 1CDOA 4QFCA 2DT5A 4OKNA 2IZ0A 5BT9A 2D59A 1QLJA 3U5TA 4MPDA 2V7PA 4EUEA 4BO5A 1WMAA 4Z9XA 3MTJA 4R54A 4RV9A 4P4GA 4EGFA 3AUAA 1I36A 2J5RA 4WECA 1M6WA 3Q9UA 2PZLA 4FFPA 5I8ZA 1PQPA 4KWHA 2IDZA 2CDCA 1IPEA 3DOCA 1UJMA 3NTRA 4ZGWA 4DTIA 1E7RA 4YQZA 1NTOA 4BUCA 5ITWA 3F6YA 1C14A 4NJMA 3W4IA 2X58A 1BMDA 2Q2QA 2CDBA 3D1LA 2B5VA 1XIVA 4M54A 4J4BA 2Y1EA 2YJZA 1DIRA 4PLYA 4ZQHA 4D45A 2YZ7A 3JV7A 4AL4A 4CLHA 5T6BA 4DLAA 3UF0A 2B4QA 3V1TC 3F3SA 1DFIA 4MVJI 3GN2A 3TNLA 4NBRA 2AG5A 3UOGA 2PD4A 2PNFA 3FD8A 3HSKA 4L75A 1T24A 4IDGA 1YXMA 1P1IA 2AQHA 5JS6A 1QYVA 2EW8A 4A5OA 1ZKMA 2BGLA 3CSDA 3JD2A 1B0AA 3PEFA 2VUSA 3KHUA 1I2ZA 3GOHA 1LSUA 4WLFA 2VN8A 4DBZA 4CQMB 4E5PA 2WM3A 4IY1A 1LC3A 3FNFA 1C0PA 3HQ4O 5CPBA 4QSMA 4U0KA 1I2CA 4W7HA 1TI7A 1YH3A 2C0CA 5G0SA 2Q4BA 3PXXA 2ZYGA 2HKIA 3HB5X 1T1SA 2GNAA 3KV3O 1N2SA 3TZCA 1R0SA 1GFSA 1JAYA 3GEDA 3AY3A 1EVJA 3E5MA 3GA0A 3O8QB 5CHEA 1NP3A 3CXRA 1ORRA 4NJOA 3KOUA 4XRGA 5H82A 1Y5MA 1DFGA 4E2XA 4E12A 2ZB3A 4FN4A 3JQFC 1KVTA 1C1XA 4FIZA 4K28A 3PWZA 4D3SA 1P44A 3D3WB 1X7HA 4Y6SA 1XEAA 1Q0QA 3D7LA 5JW6A 1KC3A 2F1KA 4Z9FA 3WJ7A 1Z45A 4IQ8A 3I3OA 4RF3A 2OBYA 4L4RA 5AVOA 4YT5A 3ZWYA 1H6BA 1PQUA 3LF1A 3AM4A 4HV4A 2AQ8A 3RAJA 4AFNA 3QV1A 3DBRB 4IDEA 2JL1A 5A3VA 3B1FA 3UVEA 1BGVA 1LRKA 4OKIA 4ALLA 1EQ2A 3RUHA 3KYBA 4LISA 3TL3A 4FBGA 3SC4A 3ZN2A 5JAMA 1LX6A 2NV6A 3UCEA 1Q2XA 3VTZA 4N7RA 4YPOA 5FEUA 1AUPA 1TXGA 3QVXA 1JWAB 1H6CA 1O6ZA 4JGBA 3WSVA 3ZW9A 1HYGA 3GZNA 4LRTB 2DBQA 2RCYA 1EE9A 3GZ4A 4N5MA 4DPKA 4G5HA 1PJLA 5ER9A 1K6JA 5IDQA 1GCUA 3BTOA 3Q1LA 3R3JA 5DCUA 4ZQFA 5A4DA 4H3VA 4OXNA 3F5QA 2H5LA 3ICCA 2IXAA 1E5QA 1R4NA 5IN5A 5T67A 3GLQA 1K6IA 3H9JA 4TRNA 8ADHA 4Z6KA 2PKRA 5C5IA 5HA5A 3GNQA 1R15A 4FGSA 1U4SA 2JAPA 4B8ZA 3M2PA 1FDWA 2FPIA 3A28A 2HMSA 1MA0A 4RQUA 5I8WA 2P5YA 4BNXA 1WMBA 2X5OA 1NR1A 1X0XA 1Z7EA 7ADHA 1P77A 3NDJA 3GF4A 3MJTA 4YR9A 1I24A 2BH9A 4IINA 3HN2A 3KLMX 3VVCA 1BHSA 4D79A 1VPDA 3OP4A 4RORA 4HNGA 4UUPA 1DC6A 1OOEA 1NNUA 4JJGA 2G0TA 2EJVA 4MKZA 1E6WA 1D7OA 1QSGA 3OMLA 1BXGB 1J5PA 4UEKA 1CQIA 1S6YA 4GX5A 5COAA 2OL4A 3GMDA 5HS6A 5HRUA 3FBTA 2NU6A 3IUPA 3VDRA 1I3NA 2X0JA 4FR5A 2FPPA 2BMAA 2GGSA 1KVUA 1NX6A 2HMUA 4R41A 3RD5A 5FWNA 3N74A 4GPD1 3S55A 3UGKA 3DQPA 5CEJA 3JQ7A 5A9SA 1I10A 1SC6A 3BMNA 3PYMA 4J1QA 4DC1A 4CV3A 1V35A 2VWPA 3K96A 5JY6A 3MTGA 3L9WA 5IDXA 4XEHA 3FF4A 4JN6B 5T8KC 4BL5A 1B15A 1QXSA 2WEKA 5CG2A 4WCFA 4XGNA 3H2SA 3TF5A 1SOWA 1J6UA 1O94A 2IXBA 1EEHA 3ETDA 4W4TA 3I9KA 4QUKA 2XOXA 1KEWA 2X0RA 3U09A 1HE2A 2JFHA 1QP8A 4QT0A 1NQOA 4BMNA 4CLRA 4Y8VA 2DAPA 1GEGA 1NXQA 3DL2A 1YB1A 1MXHA 1S7CA 3BMCB 4YB8A 3WNQA 3LVFO 5DBGA 2V6MA 3CUKA 2Q2WA 2YW9A 5I7VA 4Q3DA 2EKPA 2ZYAA 2OORA 1Y1PA 1CRWG 4YAEA 4KDEA 4NJMB 4GLOA 4FB5A 3GEGA 1A9ZA 5EMHA 1JVBA 1LSOA 4RVDA 2NSDA 2F00A 4GH5A 4M1QA 3F4LA 3TOXA 1CIVA 5K9ZA 2V65A 2EJWA 3C1OA 3ADOA 3DBVO 3KRTA 3MJCA 4HNHA 3E48A 3WS7A 2YV3A 5B1YA 1T2AA 3ZV5A 1HE5A 3ZHBA 2HJSA 2WYVA 4D7AA 5A06A 4HUJA 1V3VA 1T4BA 1X14A 2FY8A 1N9GA 1O0SA 5FFFA 3CMMA 3CH6A 3KLPX 2QYSA 1X1TA 3EW7A 4DYDA 2I65A 4NBUA 3W1VA 3PQFA 3EGOA 2GD1O 4RVSA 2P9CA 1ZMOA 3WGTA 2RH8A 4BOYA 2DKNA 2RH4A 1ZK3A 3IQDB 5L9AA 4E0BA 2O3SA 3QHAA 1PWZA 1LRLA 4OOFA 4XIJA 3HDQA 4BNNA 5F21A 3PQDA 2X0NA 4D42A 4IQ0A 1LDMA 1ULUA 2PD6A 4JROA 3RBXA 1IOLA 1T2FA 4HXYA 5TT0A 1DIAA 3BZUA 1C1XB 1LLCA 1WZIA 5CDGA 1I33A 2GF2A 3MJ4A 1R0KA 3C3XA 2I99A 4MVJH 3MWEB 4J43A 2BFOA 3JQGA 1ZSNA 1DFHA 2J5KA 5L4SA 2VZ0A 2DBVO 5H81A 2Y66A 2R6JA 2O2SA 3ZNNA 4CV0A 3EVNA 1E7MA 2WE8A 2WD7B 1AGNA 4W7IA 5L51A 1PR9A 1QR6A 2O7SA 2NVWA 1UDAA 5B4UA 3DONA 1GQQA 2VUUA 3H4VA 2TMDA 3AOEA 1U3UA 4NBTA 3ZZNA 2PZJA 1HEUA 3SVTA 1GY8A 3LT2A 2B5WA 4R1NA 3JD4A 1WZEA 4OMUA 3ENKA 3U49A 3GZNB 3H7AA 4GMGA 4YT8A 2XXBA 4TZTA 1IB6A 4J16A 4YTEA 4MP8A 1PJ4A 1N8KA 2NU8A 2BI8A 3N7UA 1KEUA 4J9UE 3GRKA 9LDBA 2QG4A 3AM3A 3FCOA 4IM7A 2DU8A 3ZWNA 1R4MA 1A71A 1PS0A 2EKQA 4BKUA 4BKOA 4PG4A 1I3KA 3WWZA 3G49A 4X54A 3TQHA 1YOVA 3AU8A 2JCYA 3JYPA 4A7PA 2Q1SA 4PLCA 4R4JA 2FSSA 3FTPA 4L8VA 3V1UA 4MP3A 2OHXA 2GPTA 1UZLA 5B37A 3TRIA 4BMSA 4NHEA 4E32A 1CERA 1DJNA 1UXJA 3GG9A 2FZEA 3OJ0A 5KTKA 1LNQA 4R01A 1TEHA 2PH5A 4MINA 3AUUA 3UCXA 4CLEA 4U8GA 3ZDFA 2DUWA 2QRJA 3DAPA 4WK6A 4DRYA 4I5GA 3WTBA 3JYNA 4RL6A 3DMYA 4Q3BA 1B16A 1QLHA 3D3EA 2AMFA 2OP0A 1WLYA 3TSCA 1O89A 1YBVA 2O23A 4FFLA 2Q45A 2R00A 1SMKA 4TMFA 3ZWOA 4I9UA 5A5EA 3AW9A 4Q3AA 3DWFA 3PYLA 3L4SO 4DGSA 2DTEA 3EDMA 3HHPA 3ZI0A 3ZW8A 4YAIA 3M2TA 4KTVE 3B1JA 3VZQA 5J23A 3FNHA 5EL0A 1DIBA 3FI9A 1PL7A 4CQLA 1MUUA 1X13A 2CUKA 1GCOA 1U3TA 2GO1A 5L40A 1VM6A 2OZPA 3TZQA 1PS8A 2PZMA 3JQ7B 4JX8A 5A9SB 3BMNB 3WLEA 4OXYA 1EFKA 4CUZA 4ZHSA 3GRPA 2RHRA 4PLWA 3V2HA 2ZTVA 4AJOA 5HWSA 1IL0A 1F12A 1XHLA 3CEAA 3I9JA 4U0JA 2EHDA 1CWUA 4Z0TA 4BMVA 2NQTA 4K6FA 4IZHA 4CMGA 1DXYA 5DT9A 1EUCA 4B79A 3NDIA 1Y8RA 2D8AA 1ARZA 5KKCA 6LDHA 1Q7GA 4ILKA 4BGIA 5AXBA 5C37A 1P1JA 1RJWA 4BNHA 4ND3A 3S2GA 1NVTA 1TVEA 1WAMA 1NPTO 1KYQA 3WG9A 1YVEI 3V2UA 4BO7A 4PG8A 3AI2A 1B8UA 4M87A 3M1AA 4NK4A 1EFLA 3GG2A 1BXKA 3ST7A 3TL2A 1RYDA 2GZ1A 1SOVA 1KEPA 2EWMA 3EUWA 3W8FA 5L3ZA
chains in the Genus database with same CATH superfamily
2EKBA 5IPFA 4AAYA 3KJNA 1V6AA 1R6XA 1Z4OA 2VDWA 4QQNA 4XVHA 3DXYA 1T9GR 3C5VA 1Q1ZA 3RYIB 2W8ZA 1EUZA 2O7QA 2ZOSA 4XWAA 1UBNA 2GN9A 4ZQBA 4E1AA 3HY6A 3OWXA 2BFBB 5LBTA 1HNWB 2VNHA 4PPQA 3U3DA 1R6VA 4UOZA 3ND7A 1U2QA 1F5SA 2LBPA 3R7WA 3ZCSA 1DX4A 4B9AA 1A7KA 2CB0A 3CIOA 3I3SR 1GGMA 2WYWA 4H59A 1SKBA 1L9KA 4OAOA 5JJCA 1EM6A 1GPH1 5AQEA 3KSDO 2O2ZA 3LQRA 3IQXA 2XCSB 4GR9A 2H5IA 1NKSA 1X1QA 2ETVA 1GR1A 4E5DA 1S3GA 2WSSA 4WBXC 1OY1A 2O0MA 2OK7A 3OQ1A 1QFYA 3C74A 3D0OA 2JGEA 3GGSA 4JEUA 1TNDA 1XTPA 4Q21A 5NULA 1GA1A 3ONFA 2NZWA 4NE7A 3T9CA 2AC2A 1N0IA 2HGZA 1WBJB 1IIBA 3PUVA 4WW0A 3TOZA 2HWXA 4FE3A 1SZCA 1MGOA 2RKBA 3DPIA 1RQPA 1Z6QA 3FFTA 4PWZA 3DBIA 4L4YA 1E6KA 5AI6A 2JLVA 4TLMB 3NWEA 4UE2A 3KR2A 3KQQA 5P21A 1NP6A 2H0AA 2ZJ4A 1XLVA 1DNPA 1YJQA 8OHMA 4P9NA 3STXA 1R0ZA 3R0XA 4OK6A 3FM9A 4HOYA 5IC4A 4L85A 1BX0A 2VR1A 5JZMA 1T9CA 2Q1WA 1X7WB 4ZV9A 1U28C 2R6CA 4UEOA 3TL6A 3RKUA 1A7JA 4D0NA 2DWCA 5I5EA 2ZSKA 4QVGA 3RRNA 5CEFA 5DLDA 2WSMA 3G2NA 4B6SA 1QGYA 16PKA 1OH7A 1I32A 1UUFA 2VTBA 3ABSB 3UKDA 1PJZA 3UJDA 1Q11A 4J0HA 2UUPA 4E33A 4YRGA 3FPEA 3DKRA 3T7RA 4P32A 1PZXA 1N2OA 3LYLA 4RCZA 1Z2NX 4FYYA 2F1OA 3G9UA 1OWOA 1CETA 4EMSA 1RXSA 2IX9A 3V5NA 2R6AA 2BWJA 3S40A 5K51A 3CCFA 3L7DA 3D2AA 4GP7A 2BGGA 3BGDA 1OLXB 3TN7A 2EKDA 4M1EA 5KTSA 2IC5A 2BM9A 3P9PA 4OX9B 1WIWA 4GWKA 4BP9A 3LUJA 4FNOA 4TT3A 4YRBA 4E30A 2ORIA 3ESQA 5ADWA 4E07A 5FOUA 2JKZA 1P1CA 2CWWA 3C4JA 4OQXA 5F3DA 3Q7EA 4PGFA 2II6A 3RC1A 3TEFA 4B73A 2CBZA 3HA7A 4J1SA 4R8MA 1RXEA 4PIVA 2CL7X 4G9BA 1Y48E 3FKJA 5AKKA 2I4LA 1XP8A 2EZUA 3GFPA 3GJXC 4ZMRA 3HDYA 3ZIDA 1C7ZA 2X4LA 3PHIA 4G36A 4OB8A 2HOQA 5AOAA 1HO3A 3VNAA 5AK5A 2V6GA 3B12A 4AQYB 1WXDA 4LDQA 5AK6A 1C80A 2C1XA 5IAJA 2HADA 3AHHA 1D8TA 4ZT3A 4UHDA 3TLYA 4X3PA 4D5EA 4PTLA 3T7TA 5GJBA 2HZBA 1M6EX 3MWYW 3L05A 3WLKX 4DA6A 2BHTA 3FZYA 3AY7A 1J20A 4MR7A 2IKQA 4NZZA 2WP0A 3B1XA 4UTZA 1OXSC 1JL3A 4ZAVA 3U5ZB 1XNRB 4RZUA 2JGAA 1ADGA 1YOVB 2A7QA 1NU6A 1TPYA 5HP4A 4GP6A 2Z08A 2PSHA 5CX1A 8ATCA 3KIPA 4JYZA 1J4AA 3MLBA 2G1KA 4CIYA 1E77A 4Q4AA 3ZTYA 4G37A 4LWPA 5TPWB 4UTRA 2HN9A 3FCYA 2Y0DA 4Y1EA 3RSCA 2B7BA 1FQJA 2PS3A 2QW0X 3Q11A 5AW1A 2BBWA 2X0FA 2YZNA 4KXWA 1SAYA 2CF6A 1M2EA 3OKFA 1WVGA 3C3BA 1MGPA 3LWNA 3NBZC 4CDMA 1ZMXA 5IJ0A 4XKJA 3JWHA 4QDZA 1T4CB 3QVJA 4O4HB 2G77B 1EVLA 1RQRA 4L8GA 1UQTA 3DMTC 3GEMA 5BR4A 5LDHA 1E66A 1WUTA 3QFHA 4Q6WA 4CU2A 1NBAA 2DQSA 1P81A 2PYDA 4NYIQ 2VZ8A 3N0TA 1BQ4A 4HQ0A 3Q7PA 5E1MA 5J1TB 3SGLA 4HP8A 5HFNA 2RGXA 2P9BA 3ZCRA 3IUJA 3MWFA 5T8KA 2IOFA 3HDHA 4ZMBA 3CQ9A 3SLGA 4V3CA 1WXIA 2BEWA 2NM0A 4WZAB 4EJ2A 3NHFA 4HDNB 4BNWA 1EWYA 4R6WA 4BO8A 1P75A 2WHYA 3UZUA 4BECA 4E3ZA 4H7EA 4CQLB 4L07A 5L7TA 3VC2A 4DEVA 2JFUA 1UC8A 1NQUA 3GEHA 3UGQA 2H1FA 1ANKA 3PFFA 3AEKB 4KE8A 3N0RA 1XTIA 3TRDA 1RCFA 3W8DA 4BLQA 2AXNA 1T2DA 2O54A 3BHMA 3ZI4A 5C81A 1V39A 2F1JA 2F3RA 2W2PA 3VNQA 4EHLA 2BEJA 2IHKA 3FB4A 3CF0A 4IIFA 4L9RA 4JMPA 2XTJA 1XPJA 1WY5A 1YE8A 2HF9A 2XKAA 4HY3A 3ZHSA 3CVYA 1MHTA 4KR3A 3G0GA 3VJRA 2ZYSA 3KT3A 1F6DA 3A4VA 2C03A 1OILA 5B7QA 2XAAA 5DGTA 1V5GA 2CFSA 1XLTC 2RGWA 1JKMA 1PKEA 1UP4A 2FSGA 2XE4A 1V37A 1R9JA 3BMCA 3DLIA 3LYAA 5J5AA 1MPXA 4YJGA 4CLOA 5DNVA 3KNZA 4OYLA 1YVPA 2UXCB 1SXGA 5JY1A 1J56A 1VHJA 3BSWA 3DTNA 3KJIA 2D7DA 3DW3X 1T3LA 4YNBA 4RMIA 5CAEA 5JI3E 1P1HA 2YJNA 1CS0A 3QY0A 4DY4A 1P62B 4C7VA 5LNK1 1I9GA 5LKAA 2ZYDA 3DFMA 3C39A 1QIKA 2O2HA 1SK9A 4L3OA 1ICIA 1U7TA 3KJEA 4MKHA 5FL3A 3FG9A 3SF8B 1GN9A 1GTL1 4MQBA 1N1GA 4KBGA 4Q1AA 5KNDH 4LHVA 2P2CA 4CLDA 2XADA 2EGGA 3OM0A 4UVGA 5AUNB 1P9WA 1QX4A 4ARCA 2HRQA 4L76A 2WSBA 3E4DA 5F4ZA 4Q12A 3S5UA 4HT3B 2CNLA 5E8RA 3JQAA 4KO4S 4S1TA 3QE3A 4BGDA 3PL5A 1U7ZA 5CIYA 3GLIE 4Q37A 5KTPA 3TJMA 2LIVA 1WCV1 2MOKA 3OJEA 4DV6B 1WP4A 1L7XA 3RVLA 3U0VA 3J81k 5HJ7A 5KHOC 4QOGA 1OGIA 1T0HB 1Z88A 2ZBEA 4MR9B 3R7AA 3IERA 2WBLC 4YMHA 5H0IA 1MMFB 2W93A 4KIWA 4KWTA 4JKIA 3ESYA 2GVDC 4MUIA 3EAGA 3H6GA 5FQNA 4DQVA 1ZIPA 1YNOA 3BKWA 3WK5A 1VPEA 5EJAA 4FYVA 4D3XA 3IOYA 3OZUA 1LA2A 2C99A 3FZEA 4IJKA 2QUBA 1DWQA 1ENZA 4URVR 4K9LA 5HZHA 4MVJG 3A1CA 3FFAA 5EXSA 5FL7D 1NXXA 3AIOA 3BRWD 1HE1C 2QD1A 1YQQA 1M2NA 4GKBA 5DZSA 1G63A 5EP2A 4PR0A 3QEJA 1ZRNA 5KQMA 5J3JA 1VI6A 1T3SA 3HP7A 4AIRA 1DCMA 1P7ZA 4XUDA 3EIHA 1E99A 1YFZA 3MMPA 4S1WA 3U1BA 2WOOA 3JQ6A 2Y1GA 1MG0A 3EZLA 3OLXA 1CX9B 1TMKA 1T8RA 1Y4AE 2VF4X 3DBLA 3NHPA 4DKJA 2XMCA 2BE9A 2WG2A 3NWJA 3THXA 4RW0A 3SMVA 3QF4B 5BVGA 1THMA 1YDEA 2H4HA 4YCBA 1YT5A 3FMGA 3IE0A 3E5HA 2CXNA 4MMYB 3K0AB 5HHTA 2IHZA 1KZ7B 2FOXA 3RSGA 3WQBA 1NFQA 2VATA 5FR2A 4KPYA 3RBAA 1SPXA 5DNDA 1XQWA 1M2JA 1IBMB 1L5WA 1NA5A 2RI0A 2VTEA 3ITNA 3OHMA 3IDSA 1VHTA 2Y3IA 2EGHA 3GJ6A 3TAXA 1NF2A 1B43A 2QK4A 2GAOA 3T95A 4PHHA 5LDGA 5K09A 1EGAA 3O9VA 2X2PA 4BASA 1RP1A 4NAHA 5MN6A 2FV8A 3SBEA 5A5DA 5ED4A 3NJ4A 4JYPA 5JBQA 5C9ZA 4ALIA 2BP7B 3CH5A 3T3MB 3NYRA 4JL8A 3OOYA 1ZGJA 1DAIA 3WLAA 4TVBA 3TINA 3AJRA 1Y3DE 5KTRA 4KUHA 3D8UA 1G0NA 4PYMA 5DXAA 1QHYA 1I01A 3KTAA 5J5VA 1IEVA 5KVSA 3KTOA 5EZQA 1H9BA 1NV9A 3OM9A 4L74A 1TM5E 1RR6A 2IQ5A 2BSQA 1V26A 1PGPA 5HRCA 3PTAA 4O4JB 5TIIA 2HLDD 2IYWA 3MGKA 2PIAA 3IBCA 3RVJA 3L7NA 4C20A 2ZSIA 3MTIA 4O4IF 3OZVA 4HGPA 3I28A 1Z6XA 2H7VA 5DTJA 3UHJA 5LMUB 1K0FA 1IQRA 1XD8A 1XZDA 3IR5A 1XP5A 1UC4B 3QG5A 3I9NA 5JEEA 2SECE 5H8WA 2R7KA 5KBYA 1GNPA 4Q16A 1JHVA 2YYZA 3JWIA 1RYBA 5LOVF 2REBA 2XH8A 1CFZA 1ESCA 3ZY5A 1QB8A 3DBHB 2O8NA 2WG0A 2UXBB 4HRYA 4RPKA 2J67A 4YRDA 4HQKA 5H3CA 5DLEA 5KAPA 3G9XA 3I37X 8AT1A 2XRYA 3T8YA 1GNTA 3RYCA 4MB2A 2IIPA 4UVEA 4J7AA 2IX3A 3PRYA 3MZ0A 1S4MA 2WYUA 4R2IA 3UWOA 3EIQA 5JXHA 1QE3A 1Q57A 1SO8A 2DULA 3AH8A 3LDGA 5AKYA 2VPQA 1GUBA 4Q3OA 3MHTA 4PXSA 3VR0A 2OQRA 3B6IA 5IBRA 4D3DA 1N5IA 1FDTA 2GCEA 3B70A 2HK9A 1RWXA 5LLDA 4XPIB 2C9MA 4MS3A 3VM6A 4B17A 3E84A 5I47A 4UHEA 1IJBA 1NWCA 1WQ1R 4IVNA 2DLDA 2IS1A 5JG7A 3X0DA 4OGGA 3SX0A 2ISCA 2LP4Y 1SQFA 1J0XO 2P2ZA 4FQ7A 4HYYA 2GSWA 1EK6A 3WLSA 2V54A 4RFSA 4BBPA 1E8MA 4FMPA 2QZPA 1CJCA 4HH4A 5G41A 1SCJA 2RG7A 2YWJA 3A6FA 3PHGA 4BO3A 1KAOA 2C98A 3EZNA 1DEKA 2DJ5A 4NIMA 5KTNA 1YI1A 4LN1A 4TYWA 3MTAA 4HBZA 1FS4A 1L5FA 4ND4A 3MWLA 1H0KA 4QULA 5IWCA 4J29A 4J7UA 2EP5A 1TJPB 3M0EA 2OV1A 2WF8A 4UM9B 3UHPA 1N2ZA 4BQNA 2VSQA 4RHCA 4R1LA 2HJHA 1M0TA 4HD8A 5FIUA 4BU0A 4EGSA 2IEGA 3OD5A 1FK8A 2VHVA 3IH5A 4WLOA 4YV1A 2ZUEA 2MSNA 1NZFA 3K1YA 2GRAA 3Q2OA 1AM4D 3QBDA 4KUEA 1F2DA 5CYFA 5EXDA 5P8WA 3SLKA 4ZQEA 5BXYA 2V8OA 1RJGA 3OZIA 4BO6A 3K71B 1J2YA 2W2LD 1P0FA 2YFQA 3BWYA 3OP1A 5TPZD 4BQRA 2IDKA 3WJ2A 3DKKA 3BFPA 1OBFO 1JAXA 1U0TA 1JXAA 3PITA 4YECA 1Z68A 4Y3UA 1PD0A 1MFZA 4OQEA 1J1ZA 4PLFA 4HZGA 2FGJA 3ORRA 3D8SA 5IS2A 3F98A 4IDHA 1W19A 2GN6A 3ZE2B 2AOUB 1HDIA 3BAFA 2ZUUA 4P92A 4CJXA 1KZGB 5F1PA 2GK4A 1EIZA 1YIAA 4C0SA 4DL9A 3HNRA 3PEEA 3TPCA 3LU1A 1PEAA 5JZOA 2RKWA 2Y68A 1LLFA 4ZVVA 2HIHA 3OIYA 3P0FA 5DK4A 5H5JA 1T3GA 3KQPA 1C1DB 3GWGA 3VHRA 5BYKA 3ANNA 4PLPA 3KB8A 2QX7A 1CE8B 1RWBA 2R8ZA 3JARB 2FSUA 4KUGA 1HFJA 3IRVA 4MPPA 4LDRA 4RSGA 1KJIA 2E4ZA 2FR8A 1G5QA 2JGFA 5ELXA 2FTKE 3CPSA 1IYZA 2Z3ZA 4OH7A 5EJ5A 2XHZA 4K87A 3CKYA 2GS9A 1QIFA 2RFLA 2AFIE 4E5VA 1S89A 4X94A 3LK6A 5IG2A 4LF6B 2WHQA 2H17A 2JJYA 1X38A 3ORQA 3QPDA 1DG1G 4DREA 4ZD6A 3T15A 2OVBA 1SBQA 2CMDA 4NPCA 4XD7A 2QBYA 4D8XA 1N2JA 3L1VA 2QJFA 2YWFA 3ZEAA 2XOKD 4EWLA 2P91A 4N5LA 4BE9A 4UDOA 3FDJA 4OFXA 4KXLA 4YBZA 4DWJA 3LFUA 1H2EA 2P7HA 1Z9BA 5HEKA 1OI3A 4EUHA 2QT9A 1AMNA 2R1VA 2WSLA 1X7WA 1I2BA 4P08A 1ZR4A 1ADYA 1N2IA 1PK7A 2A59A 3GRUA 4QRIA 2XMGA 3DCYA 3C5EA 3DPSA 3DTVD 1Y9EA 4IEFB 4Y6GB 3A31A 2VYVA 2CNNA 1ISPA 4KOAA 4EMUA 3WZMA 2QAGC 2QT1A 3USZA 2DQ4A 4BYGA 2FEXA 3AC0A 3KSMA 3RUAA 2CF5A 3E6AA 4RKFA 4Y0VA 4P4NA 3TIVA 3SICE 3VH1A 4XIYA 1UH5A 2GJ8A 3N8HA 5FTKA 1VI2A 1O57A 1RZUA 5DHRA 4G81A 3KZMA 4H18A 5E6UB 1F7VA 5LC1A 4EB8A 1U0FA 2SBTA 4CGZA 3GFBA 2ECOA 1MOZA 4R8LA 2FMIA 2PGXA 5BNFA 4U9IS 1EPUA 4CN8A 5CFNA 2VAXA 1GEEA 2RONA 4H7PA 3RV3A 4G5SA 2Y1OA 3TRKA 2G1PA 4OFWA 1ISSA 1GGKA 4GX0A 2KBEA 1IQ0A 1BE1A 2FLVA 5BMOA 1ZD3A 1N7JA 2E4WA 3LK7A 4ND8B 2XA9A 5JOQA 3GLTA 4WCVA 2IPOA 3JATA 4TLAA 3U4HA 1E4EB 2Q0HA 3BIOA 4FGUA 2Y0CA 4TTPA 3ZNOA 2AYZA 2C5AA 1Q3HA 2B30A 2IQIA 3C87A 3CZ9A 1JW9B 4KVAA 2CHQA 4KRFA 1E92A 3O74A 1RYMA 4TUYF 4UUOA 4UCXA 1E69A 4E21A 4FFVA 4Q15A 2XW6A 1A4UA 1EIWA 5E6SB 1Z75A 3GQVA 3TW6A 4GXRA 1V5WA 2BGUA 3GPLA 3PDJA 3T3HA 3RNLA 1SHJA 2LKDA 3AEQB 1T9BA 3O1LA 5CDYA 1NVKA 1O95D 1VL2A 1A1SA 2PKWA 3QU5A 2B1JA 1H4TA 3AKEA 3R9IA 4AF8A 1Z63A 4RSRA 1KEVA 1RAHA 4LDJA 5JNLA 3WL4A 3CNQS 2UVQA 2QRLA 3OZAA 3V80A 2AHOA 1H23A 2FQ1A 3DOHA 4MKXA 2W8BB 2VJNA 4C0BA 1EHIA 2ZITA 4AW9A 5JCXA 3FWNA 1N2CE 2KWIA 3CIFA 4IIUA 5C0OE 1J49A 1OC2A 1XTVA 3UB3A 2QQEA 3R6LA 4U5QA 3T5GA 2I76A 2JASA 3RBZA 5A4KA 4AUNA 1ORTA 5I9LA 1HRDA 3PNSA 4KJZA 5U1PA 4FXOA 3IAM1 5K8LA 4WESA 3WIEA 5KDDA 1MC1A 2ZJ5A 4YAGA 2WMDA 5EHIA 5FBKA 3N70A 5FWYA 2I7VA 4NZ9A 1P1FA 2R7MA 3C4VA 3SKXA 3ZUPA 4CDRA 2H8GA 1N4DA 5BOVA 3QJGA 1QTQA 5KVCA 2BY4A 2GFHA 4BC0A 3Q6MA 1M1YA 2HJWA 4G3XA 4KPEC 1USWA 1BW9B 5K4GA 2WB2A 2E87A 3QU4A 4O4HA 1TEVA 3A0UA 4JB8A 5C31A 1LJ8A 3NATA 2KQUA 5REQB 2PUEA 4LJ4A 4OB6A 1OW3B 3EY4A 1J09A 4Y2UA 3F4BA 2QGZA 2VXBA 4ZZ1A 5A04A 1ECCA 4ZV4A 5CBPA 1B14A 4WT7A 4Z49A 1BU5A 2ZKLA 4RJTA 2BVNA 3R7LA 1RWWA 3ILXA 4MV3A 2XGOA 3BM5A 3PNPA 3PPWA 1QDUA 4MAAA 1E5XA 5DJ5A 4E6PA 5CBKA 1ZCJA 3GVPA 5EHXA 5I3CA 4YUAA 5F3WB 5LIRA 1D2CA 3WLPA 1BDIA 1BGWA 1X1AA 1OXMA 3LUCA 3I76A 3SKVA 2GD6A 4CM4B 1O8BA 4IUDS 4ZDJA 1CT9A 2JI9A 5KDOA 1LQUA 3KEFA 3UENA 2I3GA 4A8TA 1UBKS 4J2OA 5ALLA 2P9HA 3A1VA 3BGWA 3WMEA 4BKPA 3LHKA 3QUCA 2Z2IA 2HA6A 2C8VA 4K86A 2C9ZA 5CM2Z 1DRVA 4K2AA 4FOLA 4W1SA 4B6RA 1IK4A 2O2IA 2QMOA 2QN2A 3WB0A 1NT4A 3LHIA 4HPJB 1E2GA 4C6TA 2JGKA 4L02A 2RGUA 1DAHA 1BG6A 5AW5A 3C6MA 4DNFA 4B85A 1GPLA 1QZ3A 4XX0B 3TQCA 4S2EA 5AKZA 1JZSA 2DPXA 3V9AA 3A9VA 2WJZB 3EWSA 4TWJA 2FAXA 3C7DB 1TF5A 1AN9A 4HEA1 4IDAA 3UCFA 4MR8B 3MELA 3W8NA 4ZYUA 1IJKA 2IYFA 3ZWXA 4DLRA 2PV7A 2A1IA 3DWEX 2BW0A 2ZU0C 3EH1A 4Q19A 3V8VA 1DKMA 3OZGA 4U2FA 2Z5FA 3QITA 3IPCA 4YAWA 4YCNA 4I1OA 4K9NA 1U7UA 4Q24A 3VSCA 2ADMA 1TCBA 2E2WA 1PDWA 3VO2A 1LEHA 1JDPA 1WKCA 2P0YA 1XU7A 1TO6A 1DO8A 4MS4B 4BJ3A 4KIGA 4F7WA 3RODA 5KO2A 3X1YA 3VYUB 4TKZA 4ANFA 4I3HA 4BX3A 5LXTA 2DM6A 1ZRSA 2ZXFA 4QPNA 1PVDA 3HS3A 3RJMA 4EQZA 1FDVA 4Y98A 4WBNA 4A4DA 1ZHHA 1S8NA 3I2JA 3G7NA 3W5HA 3IT2A 4M0MA 2OYSA 1V8DA 4OHUA 2Q5LA 3C7TA 4YJFA 2EKZA 4M1SA 1MB4A 5DCWA 5GM1A 2ORED 3FPGA 1W0KD 4X91A 1Z3CA 3ULKA 3G2MA 1I4DD 1CK4A 2ZSBA 3IBGA 2CJWB 3ABQB 1TCUA 4AYTA 4QZVA 5BVHA 1N57A 4O8ZA 3V46A 1VFPA 3EMBA 2ZRAA 1IHXA 1AY0A 2O05A 3GELA 3KZVA 1F2UA 3F73A 3UBTA 4GI5A 4JI7B 1A8HA 2ZYHA 2ZI4A 5KKNB 4MR9A 4IJVA 2IHJA 3TI9A 1MW9X 2X8LA 2ACEA 2Z9BA 2ZCUA 3OCXA 4FMDB 4H9GA 1JG4A 2XYHA 4GZMA 4MQ4A 1YZFA 3E3MA 5ICFA 3TNDA 2AQIA 4C0AC 2Y1XA 3WZ2A 3G2HA 3IQGX 1DCKA 2V1XA 4U5XA 2VCYA 3KOZA 1TQ4A 3URKA 4RACA 1C2TA 1G7SA 2UKDA 1TT7A 3H05A 4C3UA 3WA7A 4NCAA 4EKIA 2PT7A 3IMFA 4TVKA 3VTFA 3MOIA 4TTTS 2X9GA 3KDSE 2WQ6A 1GFWA 2GTHA 3P97A 4ZARA 1JLMA 4LZJA 4ENRA 4WXRA 3MOSA 4BWFB 2FFRA 5HQ3B 3LSTA 2FUCA 1Q0LA 3AFNA 1U0EA 1PCXA 1W35A 3PRJA 3KE8A 3ODPA 5FTWA 4WNAB 1Z73A 1HYEA 4KYVA 5EJ6A 1HQKA 1QHHA 2OILA 2R8OA 3D6JA 3L8CA 1U65A 4FEYA 1HE8B 4BNDB 1RPAA 1RZ3A 2QMZA 4D43A 4D98A 4PLHA 4LGCA 2L17A 3CVJA 3W9YA 5JALA 2BD0A 1YMUA 5JZ9A 3OTQA 1NVXQ 1PUXA 1VYTA 2VP0A 3QOXA 4HQ6A 3EGEA 2WW8A 3L0CA 1Z0ZA 2DFDA 4AICA 3CXUA 3H0EA 4ZQCB 3BMQA 4COOA 2VYND 1GHTA 2WABA 3RFCA 4O2BA 2CE2X 4KLZA 4GKKB 1PR2A 2OHOA 3IPXA 3LCJA 1MEEA 4KR0A 4IXWA 2QTLA 2YIVX 4EPXA 3I9V6 3PHHA 1UM9B 1Q0RA 3VGJA 7MHTA 5C4GB 5EWJA 3ZS8A 5BMVA 1XR3A 1T1RA 2WRZA 2FWMX 3R3UA 1JHRA 3C2QA 3DAOA 2WMNB 2AOTA 4XTRA 1QBGA 3WBBA 4DSNA 1RD4A 3ZDEA 5ADVA 5IAKA 4JASB 2B8WA 2C59A 3IUQA 4R51A 1G20E 3MCWA 2WB4A 4NS1A 3G5MA 1IATA 2GUWA 2FPGB 2YWXA 1W8DA 2ZT5A 3QXGA 5DIFA 5AW7A 2NU7A 2WV9A 3P2MA 4Q1DA 5KTMA 4DIFA 3H4IA 1G21A 4E7PA 1P0IA 3MCUA 3TQTA 3LCUA 1WXWA 4QA9A 1KQGA 2XJ4A 2ZAGA 4QUIA 4PYNA 3BMXA 2F6RA 2OYRA 2OXIA 3V8EA 1BFDA 2IW1A 1I7SB 2B0JA 1CVRA 1KSHA 1NLMA 4OM8A 5TRTA 3W9SA 2OSBA 3C3EA 4BO1A 2Q9BA 4QBGB 3C5HA 5DX0A 4KTTE 3GUUA 2Q3BA 1V8OA 1K0UA 1RWMA 1QGZA 4FZRA 1PNTA 3DNMA 3JZMA 3OIDA 4QHYA 3WX0A 1U1DA 5BV7A 1T8SA 3IEVA 3T9FA 4TXMA 3DWGA 3QNWA 4NBNA 4X8OA 3GAMA 2ZRJA 2P0EA 3QVVA 2OY0A 4OFBA 4NNJA 4TSRA 4LBYA 5I9MA 2XUFA 2R84A 1NVVR 3D8NA 5AKGA 5DHTA 1L1EA 4DZZA 2BBSA 2QUHA 2EERA 3UAGA 4C06A 1FX0B 2OBMA 2SNIE 1TYZA 2YIMA 1EFVA 3C41J 4BMCA 1YU6A 1A96A 1YACA 2BZ0A 3N1UA 3QYFA 1OR8A 3O82A 3GJ4A 1N5JA 4ZJUA 1J2UA 3ACCA 4B6EA 5F78A 1E2JA 3ZLJA 5FBLB 1RKBA 3AYZB 3DDSA 3SEFA 3PJDA 2VJPA 2I8CA 3DLTA 3O38A 3IP6A 1I1OA 3B3QA 2GCOB 2HPHA 1GNLA 3ANLA 3SHVA 4KREA 3Q0IA 3HVUA 4HWOA 2YJ5A 3WLFA 4AMYA 4JP1A 3HNOA 3NAQA 5JLAA 2QY9A 3AM1A 1ACMA 1LW7A 4JJAA 2NSYA 2INGX 1W2GA 3ORSA 1H93A 4I9HA 2WWTA 4MQFA 3WY9A 4D4LA 2UDPA 4QUHA 5JRJA 5I3ZA 1XK7A 5AK4A 1UPAA 5K4AA 3GV0A 4QVKA 1V1RA 3K05A 4LK3A 1ESDA 4EM6A 5BN3A 5LPNA 5TLSA 3GHYA 2FZ4A 2Z2XA 1A3CA 3DZFA 5EKDA 2PGOA 2D0PB 2V8BA 3DOUA 3NNNA 1FVXA 3QOWA 4MVJD 3VR2A 2P40A 3T5DA 2IYEA 3I6QA 2OUIA 1GPMA 1RHQA 2GSDA 3HV2A 4I5FA 4UUNA 4EQ6A 5JO0A 1W44A 2XCRB 3PNOA 2RGRA 2AOXA 1N5MA 3HBAA 2G4CA 2QMEA 2W0MA 3L7JA 4L8FA 4QXAA 1XYYA 2YHIB 4OQDA 4R8VA 4CMEC 5C51B 3TQQA 1WUYA 3KQVA 2E5FA 4HFMA 3WHKA 1E0JA 5AXAA 1ZZEA 3PQEA 1G5HA 2P6NA 1T2UA 2R97A 3JU3A 4JKYA 1EUDA 1GU0A 1R8YA 1ZH4A 2VPPA 4UHHA 3SQLA 3FIUA 2N9UA 1AHHA 2LNDA 4N54A 1B6GA 4H7KA 4GRAA 1BHJA 2DXIA 2JARA 2V0NA 3WA6A 1I5EA 4JR2A 2YWRA 3HUTA 3EA5A 4GL2A 2C2KA 1T5SA 3GDOA 5LYJF 1HE3A 1NASA 3DVSX 5E4FA 3HMKA 4CKBA 3ADPA 3A3KA 3IBFA 1TL7C 5LMZA 2VF2A 2OCAA 1N1EA 3GVXA 1QV9A 2QTRA 5CB4B 1KORA 4N47A 1LDEA 1YD7A 2X9NA 2AOUA 3C14C 4Q82A 4N7BA 2WJ3A 2XCLA 4TLLB 4DIKA 2AFHB 2IKSA 2X6TA 1E1CB 1MB0A 1YJ5A 4K6CA 5FNVB 3UK2A 3ZDQA 3UAXA 3IALA 3FIJA 4EVQA 1FNNA 3AERA 4RQTA 1V3TA 2ISQA 5A0FA 4PHGA 1U2ZA 2OGUA 4CTKA 1CE8A 4Y9SA 4C0LA 3UYKA 1VIAA 3IB3A 1U1IA 3JARA 4F11A 5CFQA 5EHZA 3TG8A 1GG9A 2HF7A 2ZYRA 4MRPA 2FFAA 3MC1A 2QD2A 3C5WP 1EK1A 2B35A 2WA1A 2G4VA 3QVTA 3O8RA 2C96A 2QQ0A 1GL9B 3IPRA 4WHMA 2M1ZA 1O5IA 3NEYA 4ZZ3A 2CXSA 5DN9A 1C4KA 2REXB 4TM7A 3EODA 3MG9A 5C3UA 3MSXA 1HF3A 4EO7A 4H4CA 4GZLA 1F48A 2DH6A 3GFFA 1OGJA 4CIAA 4NU0A 2GO7A 5IJZA 2AD5A 3GUYA 4UEQA 1UMDB 2V3VA 2HPVA 1KEKA 2QZZA 1K8YB 2VT3A 4O6VA 5KYUB 1CEQA 3D6UA 4I4LA 4XJVA 2XCTB 521PA 4PZDA 5AI0A 2BFEA 2JIQA 3HEBA 4FN5A 4K3VA 4H6WA 4Q0MA 4A27A 7MDHA 1KVSA 2NP7A 2RK6A 1OKKA 3I30X 1Y3CE 4R7ZA 4Z3DA 1U2TA 4DCNA 3KVVA 1JEQB 1EK2A 2CXTA 3OECA 1QPZA 4W8HA 5A0TA 1QG4A 2P3QA 4ZT5A 3VNUA 4R1QA 3S2ZA 1IEQA 1I2AA 2Q5QA 3DEHA 4JI5B 1Y7TA 4BBAA 1EX7A 2FEKA 4GVXA 2QW1A 2B8TA 2PWAA 3L0IB 3SOZA 5EQDA 1GTMA 1R12A 4IOJA 3IA7A 4DRZA 3CEHA 4X7BA 3BVPA 1ZMTA 1U0RA 2YOGA 3CBQA 3LPMA 3CX4A 1K8ZB 3EMKA 5IDYA 3L7LA 1LKZA 3G2QA 1J0AA 2QR5A 1MAAA 3I9FA 1SUWA 1YR3A 2FETA 5KDLA 3GLVA 1EP3B 4P31A 4YRCA 5A4IS 3FSEA 1C9EA 4G1MB 3WGNA 1CBUA 3RSQA 3E5NA 3VJLA 1O97C 1IU9A 3OEYA 1T0PA 4JJKA 4BFCA 3DVQX 1FDUA 2QRNA 4H7FA 2FQXA 4CTNA 3DZKA 2IBTA 4JGIA 1YB4A 2J7PD 3ESAA 2JD1A 1OB5A 3R44A 4B43A 3HK2A 2R68A 4ABTA 3R7FA 3AVXA 1P4RA 3IDQA 4I5IA 1ZNZA 3OEHA 1BAPA 2ZRLA 4IWNA 4IIDA 4UAVA 1VG1A 1P74A 5K3EA 2A14A 1R4AA 1ZD5A 3WGJA 3ZBTA 2D5IA 1G2OA 2ZATA 4TS3A 4KQWA 4BNLA 1XGKA 1VMEA 3AEQA 3BHIA 3GXBA 3E0XA 3TIFA 1T5BA 3BIWA 3MWKA 2IHYA 2Q0XA 3ZEIA 4NABA 4D0GA 3R74A 5JCJD 2ZT8A 5CH8A 1VL5A 3G0DA 2WWRA 1BFKA 2F43B 3BWBA 1ZS9A 1CIJA 3FHOA 4D57A 2O8FB 2W8BA 1LDYA 2YV4A 2PCJA 2CMFA 1HC7A 4NYJQ 4X9XA 3K5WA 4X97A 5EQFA 3OJXA 2OCYC 4DYVA 3FKSA 2YXPX 5A3QA 1MC5A 4M1KA 4RD0A 1XWIA 1A88A 4WINA 2ZSDA 4YI5A 1TK9A 3WL5A 5IDWA 3RUDA 2JFFA 5LM3A 3GZTB 3NOQA 5TGZA 5K0JA 2ISSD 1DI0A 2YIDA 2AR9A 1Y3BE 2C00A 2PTGA 2WIBA 4FGLA 4RY8A 3T1OA 4DA4A 4DJ5X 4R2HA 1XPOA 4IHJB 4IWYA 3EQ6A 1BDMA 3G5UA 5LVAA 4DIEA 1P2GA 1JIXA 4C43A 1K8XB 2VPTA 1WA5A 1R37A 2HJ9A 2WT8A 1II8A 2FDRA 1ODIA 4P3XA 4AWAA 4OQPA 4P3YA 5REQA 4RGBA 5IZ4A 3AI1A 3CB2A 1L1FA 4C5BA 4PYRA 4PZEA 1ZFNA 1GG2A 5HXAA 4S05A 4KK4A 4RZXA 1I2DA 3M6FA 4RLQA 4YACA 3ZE8A 3ICQB 5BN4B 4NDNE 5JMTA 4ITUA 2P69A 5HK9A 5L3SA 1NLFA 3OQPA 4IFIA 5D7NA 4IX9A 1KMCA 4DC0A 3KHTA 2WF7A 4NR0A 2DBRA 4J3NA 1QF6A 1EH5A 3RVOA 2G71A 2R48A 1WB4A 4LHWA 1OVGA 3HUEA 2WE7A 2J87A 4HAWA 3EVFA 3DAYA 1PL8A 4JY7A 3GT7A 4PF1A 4QBKA 2HAEA 4CM4A 1N5DA 5JXJA 2GCGA 3I4LA 4BIMA 4OD0A 1GL7A 1P9OA 1A97A 1OLSB 4JBLA 3TNFA 3ONVA 4OO3A 4P58A 3RS7A 3ZHUA 3K4PA 1IY0A 1PEDA 2VHTA 2V7UA 3HV0A 4ZCPA 1JBQA 1SKYE 3I1IA 1MX3A 3OX2A 1JDBB 4KLRA 4DGQA 2EFDB 5IH7A 3E0QA 3OU2A 4IO0A 1SCAA 4QUJA 2OV2A 3SX4A 3T9DA 3U56A 1SIUA 4M60A 4YAUA 2CYAA 1ZJYA 3NHKA 4L7QA 1TYCA 2J0UB 3N0XA 4DMKA 4AZ3B 5FV4A 1FXWA 1ZNXA 1V1JA 3ZKWA 5ELMA 1EZ4A 4FFOA 3JR7A 3CB4A 1Z36A 1W30A 2J30A 2WIAA 5KNLA 2GPSA 4I9NA 1QWOA 4JP3A 8ABPA 3EJWA 1H6DA 2EEPA 4Y67A 1KJQA 3GDFA 2RAFA 1XTRA 3S8MA 3PJRA 2Z1MA 4QGHA 1A2BA 4Y30A 1XXHB 5HIJA 5JADA 3FHJA 3OH8A 4JLDA 3RTEA 2BMVA 1NVUQ 2BCEA 1P7YA 4IO1A 5DB4A 3WL7A 1WEKA 1S9HA 1XC7A 3UXMA 2WYOA 1OU0A 4FE7A 1LNSA 2A2ZA 3GVCA 3VMMA 2QP9X 4FILA 3EC1A 2G9QA 4TTVA 1W36C 3FSJX 3PQ6A 4DDWA 1QH8B 4QGGA 4LHEA 1OFVA 1WZNA 2AEEA 1F8YA 3TOSA 5THXA 1Q12A 1NN5A 4HR7A 2CJWA 5SY4A 3C70A 4MUEA 1N5LA 3EVCA 5F76A 2I1QA 1PTJA 5BSKA 2VHWA 3CF4G 3H16A 3DB2A 4E2WA 1KPHA 3Q7RA 5GV8A 4Y6RA 4RO0A 3LFHA 1GQYA 1LV7A 1NYRA 4I50F 4B33A 4F3TA 2BFPA 4D8TA 3LX6A 3TLXA 3U4IA 2C2OA 1F2VA 2I34A 1X2BA 3K1AA 1LDGA 3NTUA 3IIMA 4JL5A 4NHOA 3LKBA 1DJOA 4X20B 1G98A 2IVFA 4GOKA 4N5DA 4GOLD 5EQJB 1DJPA 1MT3A 4HWGA 1QS0A 1NXTA 3E1KA 3JD0A 1ENOA 2G36A 1X6VA 4WZ6A 1USVA 2FA9A 3C8UA 3QVWA 4Q7JB 4DV2B 5AM3A 4BN0A 2NX2A 3AG6A 4RTJA 2X9LA 1NT2A 2P1RA 4WLVA 1DG3A 2PMWB 4HYTA 1R7RA 1AH2A 4UAUA 5CB0A 1POWA 3MRTA 2QAGB 1WXHA 3RFVA 3GLGA 5AVVA 4ZV7A 4PVDA 2JD0A 2QGNA 1Y7HA 2YMLA 2P5UA 1FP2A 3O7WA 5FBHA 1WSWA 3PJGA 4BMXA 1P2VA 2WVAA 3UMYA 1GZ5A 1X9HA 4XX1A 3C3CA 4GDMA 4GYWA 3KEGA 4FWIB 3R0IA 1BA3A 2FWBA 4G5GA 1C4WA 2ZREA 3B3GA 5FOXA 1J9GA 1RM5A 2OXRA 3KUCA 4ZZIA 5LQJA 3GPIA 2RGDA 4H15A 5G0WA 2VAMA 4FGZA 1RRKA 5B7GA 2ZBRA 4Z4IA 3Q6NA 3ITDA 1NOJA 2QI9F 1JF8A 1UM9A 2ZJ8A 3FMOB 2FI1A 2GEVA 3MGCA 3H83A 4B4UA 3DFUA 2A5FA 4YWJA 5L4LA 4UC0A 4XZ3A 3LBYA 4MIKA 5IC5A 4B7XA 4DWVA 5GZ6A 4RVNA 2ABWA 5GINE 2CKDA 4X44A 2VSOA 1Q6ZA 2XB8A 4QQFA 3G0CA 3OESA 4V0SA 2Q7OE 4QOHA 4KMRA 4L6AA 5FBZA 4TX1A 1IM5A 3UICA 3UC9A 1YSCA 1PT8A 4KIJA 1NYTA 2XMDA 3D6AA 1W5TA 3CF2A 1XRNA 1P1BA 1U9IC 1EDBA 3HMQA 2YHSA 2Q29A 1NJSA 3E18A 1FVHA 3BH7A 4FSXA 5FPSA 4F2GA 3GJRA 4HWTA 5ALJA 4HYEA 4Q47A 4Y2YA 2DR3A 4HI0E 4PZZA 1GPAA 3ETJA 5A4MS 1PW7A 2IWRA 4C4AA 4AJKA 1NZDA 1KH1A 1QCYA 5ICSA 2FVYA 1G66A 4Q9LA 1ZYUA 3HA5A 3W77A 4R9SA 1XF9A 4BXOA 2ZXUA 4YRFA 4DQ0A 5KWEA 1WM1A 3M1IA 1A9SA 1FS5A 2PEYA 2VJAA 1MAWA 2GEJA 4N5IX 2RH9B 4ZHQB 1CZUA 2D5LA 2GN2A 3D4NA 4PG7A 1L5RA 4EGAA 6NULA 1KFBB 3OIGA 4IZOA 3WGLA 1JNYA 3PNMA 1Y6QA 2DFPA 3ECCA 3PR1A 2YY6A 4JQCA 2ZKIA 3OTHA 1V4NA 3KU1A 4MPJA 4ND6A 2G25A 1V5FA 5EHGA 4AY5A 2EJTA 4EJFA 5JV5A 1H1LA 4QEDA 4Z0NA 2IU6A 3M34A 3QIVA 3DZ8A 2C7GA 4TRRA 4DBVO 3LD9A 4R05A 3SX2A 3Q4GA 1OFTA 4AO6A 2Q27A 4Z1MA 4ZJYA 2HDHA 1X7GA 5F33A 1E0AA 2BKXA 3GQBB 1OXKB 1R16A 2FH5B 3NI2A 3RRFA 5HCUA 5LZ9A 1DSSG 4P4TA 1K1EA 3HR7A 2WKPA 2X7HA 3I73A 5JSKA 2XB9A 1XLUA 3FGPA 4B3MB 2RHJA 1RYEA 1OMOA 1YUBA 1ZH0A 2WKQA 5JJ5A 3K70D 1YS4A 3D8TA