3E9NA

Crystal structure of a putative short-chain dehydrogenase/reductase from corynebacterium glutamicum
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
225
structure length
189
Chain Sequence
KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVEPIESDIVKEVLEEGGVDKLKNLDHVDTLVHAAGSVAEWHAHLDLNVIVPAELSRQLLPALRAASGCVIYINNTIYAASKHALRGLADAFRKEEANNGIRVSTVSPGPTRPEIYIEPKEIANAIRFVIDAGETTQITNVDVRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative short-chain dehydrogenase/reductase from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum
molecule tags Oxidoreductase
molecule keywords PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
total genus 71
structure length 189
sequence length 225
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.36: Acetoacetyl-CoA reductase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3e9nA00
5FEUA 3ZW9A 2FY8A 3ZNOA 1RWBA 4MJLA 2W4QA 1PGOA 1RM4A 1C1XA 4R9SA 1JWAB 2RIRA 1DXYA 4O5OA 1EE9A 2Y68A 3FTPA 3ZU2A 1BW9A 4Y8VA 2H9IA 2A94A 2HUNA 4Z0TA 5TQVA 4DL9A 3KV3O 4MP6A 3OA0A 3K2BA 4UVGA 3DO5A 3E6AA 3INGA 4CM4A 3EW7A 1DIHA 4XYEA 3ZHXA 4F3YA 5IXSA 3RBXA 1DB3A 4TVOA 1LDGA 4NFYA 4EUHA 4D3FA 4LN1A 4AJKA 1MG5A 4ALKA 5F1KA 4E12A 5C7LO 1U5CA 1I3NA 4FGSA 5CEFA 1H2BA 4PFJA 1BXZA 2FRDA 2J5RA 2Z5LA 3EDMA 3GMDA 5CDSA 1S6YA 2RH4A 4LK3A 4CQMA 5BSGA 2GLXA 3S2FA 4LW8A 4DLBA 4O59O 1GPDG 4FR5A 5CP8A 2JD2A 1RYEA 2UV8A 5BNTA 4G81A 2IZZA 3DMTA 2GPTA 1DC4A 3I1JA 4R54A 2WWRA 3JQAD 4WLOA 4KDEA 3E9QA 4Q3BA 4R51A 1NASA 4WLUA 4DRYA 1XR3A 3M2TA 4PLZA 2PK3A 5FYDA 4U6SA 1LRJA 4WLEA 1X7HA 3NT5A 3INRA 4D3SA 1HRDA 5H81A 3X2EA 2GZ2A 1DPGA 2NWQA 2PV7A 3L07A 4PVCA 4XQCA 1XEAA 5BT9A 4ZD6A 4IQ8A 3RC2A 5L3ZA 1I01A 4LRSB 3HDJA 3JQGA 7MDHA 2C29D 1MP0A 3S55A 4KQXA 3VH3A 4BGIA 2CF5A 1TVEA 3EZYA 1U4OA 4HXYA 3LZ6A 1M76A 1YGYA 4UEOA 4HNGA 3B1FA 3OF2A 1FDUA 4B8WA 2WD7A 2R00C 2DTDA 3I9MA 4TKMA 4RDIA 3QVTA 1C0KA 2AE2A 5ITVA 4L4RA 1V8BA 1HE3A 4Q3EA 3T7EA 4EEXA 1JWBB 1MX3A 2UAGA 2Q46A 4QECA 4JGBA 4U7WA 1MGOA 3RUDA 1GEEA 3D5QA 1Q0QA 3TL2A 5ADHA 4OJNA 4BNHA 3GGPA 3LC2O 3V5NA 4XZ3A 3B1KA 1KETA 1HXHA 2J3JA 3QSGA 3BMCB 4NBUA 4YB8A 3RD5A 1ADFA 4ND4A 4CQMB 3OP4A 3IDSA 3M6IA 1E92A 4XKJA 3FNGA 3NJ4A 1WP4A 4J16A 3SC4A 1CIVA 1VC2A 1X7GA 3H3FA 2IZ1A 1B0AA 3UCEA 1YJ8A 1W73A 4Q3AA 2EJVA 4PG4A 2DU8A 3I9LA 4J1QA 3EZLA 2IEDA 4KTVE 3E5RA 3OJLA 2ZATA 1MA0A 2Q50A 4CR8A 4J43A 3GT0A 2VYNA 3QWBA 2YQ4A 2NADA 1EK5A 4OOFA 1X14A 3IKTA 1CEQA 2NU9A 1CQIA 1ADGA 3D4PA 5THQA 1GZ3A 3BMNB 2PZJA 4L8VA 4GSLA 2BLLA 1E6EA 2P9EA 4MIEA 3CE6A 4P22A 3DAGA 3WLFA 1WVGA 1V3TA 4UUPA 2NTNA 2O48X 5TX7A 3K96A 5A5FA 3RFVA 4MP8A 1SNYA 2GF2A 3SJUA 1PQWA 4YT5A 1V0JA 4PLPA 1TLTA 3FCOA 4R16A 2AEFA 1YVEI 3ADPA 4E0BA 1D8AA 1UR5A 3JD0A 1UP7A 3V1UA 1ISFA 3U4CA 2GCGA 3L6OO 3WWYA 3FI9A 1CETA 4CM8B 1VSVA 3AOEC 3GVPA 2EV9A 2RCYA 1FXSA 1UAGA 1T26A 1GPJA 4ZU3A 1DAOA 5JFOA 4RORA 4IDCA 1NBOA 1ML3A 5FI5A 3T4XA 1GR0A 3BMQA 5DF1A 3N7UA 2VQ3A 1OBFO 1B3RA 3U4DA 3JD3A 1NX6A 2D1YA 2HMUA 1GCUA 1I0ZA 3E82A 3L6EA 3H9GA 4CMJA 3WB9A 3GNTA 2PLAA 3L4BC 1X7DA 2DLDA 1HZZA 4PIVA 2VUTA 2HMTA 1Q2XA 2A4KA 3ETGA 4IIUA 2W2LD 4YXFA 1KVSA 4R1SA 1Z7EA 2HMVA 1MB4A 2I3AA 3HADA 4BQRA 4WLFA 1NM5A 1EDZA 4R3NA 2GN4A 4D79A 5C5IA 3P19A 2I65A 2AG8A 3ROQA 4Y6RA 3ROMA 4YRAA 4J3FA 2GR9A 4DTIA 4URFA 1QG6A 4DWVA 1QSGA 4BNTA 3JQDA 5G2OA 1DHRA 5G0TA 2EP5A 5KVCA 5ITWA 1PEDA 3AUTA 3ZWNA 1PX0A 3PQFA 5EJ2A 2C5EA 3WYEA 2PGJA 4KWHA 5BSFA 1IUKA 2DC1A 1N7HA 3CTMA 4INAA 4PZDA 2AQKA 3H65A 3WBFA 4I5DA 2EJWA 4OQZA 3AI2A 4GX1A 2YV2A 3GN1A 1WWKA 3V8BA 1PJBA 1QYCA 3WBBA 3KYDB 4BO1A 1EZ4A 1ZSYA 4HBGA 5TC4A 1SMKA 4J4TA 4BNYA 1GV0A 1NR7A 3T4EA 3PIIA 4RVUA 1BG6A 2EHDA 1LC3A 4YRDA 3CZRA 5JYDA 4IM7A 2JAPA 1FDVA 3OQBA 4DXHA 1PZGA 1YH3A 4Z9XA 1G1AA 3PJGA 4HNHA 1NR1A 1A71A 3ANLA 3RUIA 1NQTA 3I9OA 3OBBA 3UW3A 4BMNA 5CG1A 1DFHA 4DPLA 4IY1A 1VJTA 3NGXA 3PFWO 4NJMB 2B4QA 1KVQA 1R6DA 1WLYA 1T2EA 4ALJA 1YJQA 1B8PA 1O6ZA 3WDSA 3TJRA 3VTFA 1Y8QA 4CLDA 1BVRA 3BMOB 2B36A 2QRLA 2PKRA 4ZQGA 4J1NA 4E4YA 3JYQA 5JSFA 4E32A 1B14A 3D5TA 3OJ0A 5DULA 1YKFA 4YQYA 4BS9A 5KJ1A 4UUOA 1ENZA 3NT4A 2EKLA 4BMSA 2GN6A 4NZ9A 4DLAA 1EEHA 1EQUA 4WUVA 2W98A 1IHXA 1ZZEA 2EIHA 2OL4A 4I9UA 3AY6A 1DFGA 1Y1PA 3DBVO 3FSRA 4N18A 3UVEA 3IQDB 1P31A 4Y6PA 2BHLA 1D7OA 4XJSA 1DLJA 1LBEA 3C1AA 1A7KA 3DQPA 1O9BA 4PZEA 2VRCA 4RVFA 5A3VA 3WG9A 4BIIA 4ZRNA 5T5QA 2QZZA 4GI2A 3GZNA 1IOLA 1SOVA 3QVOA 2C2YA 5C7IO 3MJVA 4FFNA 3ZWOA 2ZTVA 3WLEA 5JO9A 4CV0A 3IMFA 4A5OA 4PRLA 2CF6A 3INTA 3O4RA 1FK8A 1X0XA 2VNAA 1RM0A 1LTHR 4PLWA 3K2EA 4AL4A 2B37A 5DBIA 5G0UA 1AGNA 5JCJD 3RASA 2Q2QA 3VPHA 5ER6A 3NTRA 3AUSA 1UH5A 1GTMA 4HFJA 1VRWA 3VPXA 3H8VA 1KEWA 1CDOA 4Q3DA 2HK8A 1NWHA 3HFSA 2X0RA 4XYMA 3GC6A 5LDGA 4II3A 3RC1A 1ARZA 3KYDA 1SEVA 2ZJ0A 4ALNA 5BNIA 1V3VA 5DBGA 3ZWMA 3QRWA 1IZ9A 1GQYA 3JQ9C 4E2YA 2HRBA 3GZNB 1Y8RB 1RJWA 3PJFA 3H9EO 3KZVA 5A1TA 2X5JO 5MGBA 3WICA 3OQ6A 4M54A 3HJAA 2CDCA 3PTZA 3U4HA 2IEBA 1YBVA 2JFFA 2YUTA 1YBMA 3FNEA 3O8QA 4MKRA 4CL3A 1IHYA 1LU9A 2J6IA 4BB6A 3ZGYA 3K5PA 3PLNA 3R6DA 1ADCA 2W8ZA 2O7SA 1YOVA 5TRTA 1UXKA 1ZH8A 2V6BA 5K6AA 1MG0A 3DB2A 3TSCA 4BNIA 1BTOA 2YHUA 1TXGA 4FFOA 4XGKA 4PLYA 2B35A 4J91A 3GDFA 2JCXA 1NHGA 1EMDA 1NPTO 3DBHA 4GSKA 1FDWA 2YFQA 2RBEA 3CINA 4IGFA 3QV1A 2FZEA 1JKFA 1V9LA 4HFRA 4JP2A 5BR7A 3ULKA 4A03A 3ANNA 4BNWA 3C8MA 1ENOA 1UJMA 2I3GA 4PLVA 1W6UA 1GQ2A 1D1SA 3F4LA 4FQ8A 1ZMOA 5IXYA 4QO7A 3P7MA 3BTSA 1ZW1A 1YDWA 1HDOA 1LDNA 4XGIA 4CPDA 2VUSA 3DMYA 1NVGA 1HDRA 1EK6A 3RBZA 2ZK7A 4NR0A 5DOZA 2E4AA 3ASVA 4PLCA 1UP6A 1AUPA 1XQ1A 1DOHA 4BGEA 2DUUA 4FGWA 1DHTA 4HP8A 2Q4EA 1O89A 3WGGA 4HV4A 3I6QA 5JS6A 5KKCA 4QX6A 1MFPA 5U1PA 2FZWA 1VJ0A 4AFNA 1QR6A 1UZLA 1YQGA 4E13A 3L77A 5I9MA 4FC6A 1AN9A 3VZRA 1P77A 2I76A 4WK6A 1EVZA 1HEUA 3OEYA 2O3TA 2RHCA 3OIGA 3WJ7A 1RM3A 4H3VA 4QXMA 3EC7A 4XYBA 1WDKA 4D7AA 3ROKA 2QQ5A 1UUFA 4W6ZA 5JXWA 5KWEA 3WX0A 1HKUA 3GPDG 4YAJA 3LU1A 3MWEB 1H6BA 4KUEA 1V35A 4TROA 4I08A 4B3IA 2NTVA 1ZCJA 2PNFA 4BO7A 2VHZA 3Q9NA 1XSEA 1NPYA 3MJSA 4NPCA 3OJOA 2YJZA 1M75A 3H7AA 3SLGA 6LDHA 3U0BA 2NM0A 4F6LA 1OC2A 1EVJA 1XCBA 1ZK2A 1HYGA 4OMUA 1ZBQA 3KRTA 4PLFA 3L6DA 2VT2A 2QHXA 4BVAA 1YB5A 4L4SA 1TT7A 4RLHA 2FR1A 1H6DA 4KZPA 1VLLA 3H2SA 4EBFA 2D5AA 4BKQA 4EZBA 2DTXA 3ZNNA 1Z73A 3WGIA 5G4KB 4R1NA 4JP3A 2OORA 3NJ8A 2O3JA 2A35A 4K26A 2B69A 4OHUA 4WASA 3QWFA 4H15A 4MO2A 4IJWA 1H2HA 3PHHA 1JW9B 1XHLA 5JAIA 1A7AA 1QV6A 5DDIP 4L74A 1VE9A 2PY6A 4OXNA 3FR7A 3GUYA 2V7PA 3F3SA 4KWIA 4MIOA 4A10A 1BXGB 1T25A 3HB4X 3HWRA 1PJSA 2O2SA 4XWYA 2DTEA 1DO8A 3VH4A 3UN1A 3BIOA 4ROSA 5B12A 4FFLA 1EUDA 3KSDO 1QRRA 3JD4A 2NU8A 4E3ZA 5CEEA 1NVMB 1WZIA 3AI1A 1P1FA 5H82A 3WQQA 3WR5A 1BGVA 2X5KO 3ZWBA 4EDFA 5JAZA 5JCXA 1GY8A 2GZ3A 3VVBA 5ICMA 1GEGA 3DZIA 3QA9A 5C37A 1E7WA 2JCYA 2BD0A 3Q6IA 4E2WA 3BAZA 3BMNA 3JQBA 2FOIA 8LDHA 1T1RA 1HDXA 3PGXA 1K2WA 4EGFA 5I7FA 1LUAA 2HO5A 2ZJ1A 2OXIA 4R1TA 4OGWA 1SB8A 2WEKA 3HZZA 1I24A 2Y1GA 3RAJA 4YJHA 1K3TA 1K6XA 1Z82A 1KERA 1GZ6A 2O3QA 2Y0CA 4ND3A 4I5GA 4E6PA 4OSOA 4I1IA 1H6AA 4P4LA 2B5VA 1J49A 4F45A 3PVZA 3C1TA 2BGKA 5K9ZA 4MIYA 3WYCA 4F6CA 2DQ4A 3DZKA 1E7YA 3K30A 4IGEA 3IL2A 2UUPA 4ZN6A 5TS3A 1SCUA 4HADA 1B15A 3ZV6A 4F46A 3IP1A 4BKRA 1R4NB 1NVTA 3FR8A 1I2ZA 5A9TA 3PWSA 3L4BA 3WOHA 1C14A 2PWZA 3DZFA 5ENVA 4U5QA 3RUCA 1XGKA 2GGSA 2HCTA 2OGUA 3UGKA 5IG2A 2OZPA 2Y66A 2TMDA 5F1OA 4OOEA 4I9NA 2FSSA 1JTVA 3CPSA 3G3EA 1PJQA 2C20A 4Q3NA 3RUFA 3GDGA 5IFLA 5JC1A 2D59A 4PGFA 4A0SA 3ZWCA 3EGOA 4JROA 4LMPA 4P38A 4W4TA 5KJEA 3H6KA 1CQJA 5BQFA 1ZJYA 5A04A 1T2AA 4RPGA 3DFZA 3E48A 1LDYA 5I8WA 4ZQFA 4CLOB 4CJXA 5GMOA 1UZMA 2E6UX 3AM5A 3VZSA 3UCFA 2BI7A 3EVTA 3PYMA 1R37A 1KC3A 2VYVA 1QYXA 4XB2A 2Z1MA 7ADHA 5IZCA 3NAQA 1B26A 3RI3A 1DIRA 3MCVA 3JQAB 2YFHA 4Z0HO 4CMEC 3OJEA 3Q2IA 2DPHA 4GWGA 4KP7A 1QLHA 4XYLA 2WE8A 3GEDA 4B7XA 4J4BA 4EUEA 4GMFA 3F1KA 4EW6A 3WFJA 1MV8A 4RL6A 4CLXA 2H63A 1Y9AA 4YACA 5BNFA 3WQRA 1F0YA 1LDBA 1ID1A 4RVGA 2Q45A 1UAYA 3PQDA 4XQGA 3I3OA 2IODA 3NYWA 4RF5A 4J4HA 4YJDA 4E31A 2H5LA 3FPLA 1LDMA 5EINA 4DYVA 5CDGA 2NVUA 3GOHA 1UXGA 4O6VA 1FMCA 4MKZA 1GUYA 3VKUA 4AJ1A 1U7HA 2Y0EA 1N5DA 2BGLA 1X1TA 2ZB4A 2EERA 1RYDA 3D0OA 3B20A 3K6JA 1NXQA 4WCFC 4QEDA 1DFIA 1KOLA 4BOYA 4BHTA 3MJCA 3Q1LA 1T2FA 1GD1O 4KUHA 1EFLA 1W8DA 1VL6A 1O8CA 1DLIA 5COAA 4WJZA 1W0CA 1YBAA 3QVXA 1N92A 5IDQA 2ZB8A 4CM5A 1OAAA 5DNAA 4ID9A 4FC7A 1ENYA 1NQOA 3JQFA 4M1QA 3WJAA 2UVDA 3KOUA 4N5LA 4CM6A 4E5KA 3PQEA 1A4UA 4IZHA 2DBZA 2D0IA 2UDPA 3JQ8A 3SBOA 1LRLA 1LI4A 4CQLB 2E48A 3TL3A 4NG5A 2VWHA 4RPHA 5I7EA 2ZB3A 3VAZA 4BNGA 2R00A 2CY0A 2WMDA 5ILOA 3GRPA 5LCXA 3WGZA 2B5WA 3D1LA 3DZHA 4N5MA 3ENNA 5EMHA 1LLQA 2XPCA 1ZFNA 3O26A 3NDIA 2Y0DA 1PS0A 4FJ0A 5GZ1A 1CYDA 1NFQA 1ZKMA 2A92A 3IUSA 3SX2A 1E3WA 3C7AA 1O5IA 5A02A 3QJ5A 3ETDA 3TN7A 4HFMA 4NU6A 4XD2A 5F1PA 4IBOA 1NFFA 1P1KA 4BO6A 3ZZNA 4DYDA 4WCFA 2HRZA 3KM0A 5THKA 1QYVA 2X5OA 3RJ5A 3W4IA 1KEUA 5J23A 4OXKA 3DBLB 4W99A 1I33A 3PRJA 2YDXA 3W6ZA 1M66A 4R5MA 5KTKA 4LRTB 3D4OA 2BELA 4QQRA 2WJPA 1EUZA 1C0IA 2BFPA 3PFFA 4AJPA 1VPDA 3PYXA 4K9DA 4IJVA 5G0SA 4B4OA 3JYOA 3WNQA 3DOJA 3NDJA 4DBZA 3O03A 1IZ0A 4D43A 4A26A 2WSBA 1NFRA 1ISGA 2H1SA 1GL3A 3AFNA 4RQTA 1U2DA 1TB4A 3M1AA 3RROA 3NX4A 3ZN2A 2CMDA 2P4HX 1VM6A 1SEPA 1YQXA 1PGPA 3WXBA 3TOXA 2IXAA 1HE4A 3H9QA 4CLEA 1Y6JA 1EBUA 4UUMA 3UUWA 1HYEA 1PTJA 4MVJP 4HKTA 1PJ2A 4GMGA 2B0JA 4WECA 3CUKA 4FPXA 4YDRA 2VN8A 3M1LA 4J49A 4C4OA 4H7PA 2X9VA 3FBTA 3O8QB 2G5CA 3HDQA 2ZCUA 3R3SA 4PRKA 5FF9A 5CG2A 5A4DA 3H9JA 2SCUA 3E18A 5L95A 5LDHA 5ES3A 4IQ0A 3LLVA 1SZJG 1PIWA 5B37A 4BUCA 4CLRB 5HS6A 4ONEA 1PZEA 3CXRA 1PL7A 5IDWA 4XA8A 4R9RA 3NGLA 2V6FA 5IDYA 3WWZA 1LNQA 1XIVA 1JKIA 1HLPA 1YB1A 1P0CA 2DUWA 4LCJA 4Q39A 1MFZA 5AXAA 4BNVA 4WNIA 3IKVA 2W2LA 3G1UA 1IL0A 4OKNA 2FSVA 4GX5A 1XG5A 1OZAA 4OYRA 2R2GA 2ZYGA 3HB5X 3LLSA 3VZPA 1ZXBA 1A4IA 3L9XA 3EHEA 4BB5A 1YWGO 4P4GA 2RHRA 1VJ1A 4J2OA 3GQVA 3WMXA 1LRKA 4P4NA 3KYBA 3DBRB 4RF3A 1KEPA 1H0KA 1R16A 2EGGA 3B70A 4WOKA 5GZ6A 4JLWA 2LDXA 4RZIA 3BHJA 4GH5A 2VZ0A 3UH1A 2GNAA 4QUKA 4Y98A 2TMGA 4YJFA 4B79A 4FS3A 4CUJA 3PGJA 2VOEA 3TRIA 4CMBA 4WPGA 3HHPA 4IMRA 4KDFA 1VKNA 1YL7A 2O23A 1JA9A 1TT5B 2CVZA 4GGOA 2VRCD 3DTTA 4JBGA 2EW8A 4TMFA 4AJLA 2XXBA 1SAYA 2HLPA 1ZEJA 4UAGA 1YQDA 4UUNA 1DRWA 1U8XX 3LK7A 4OAQA 4D0SA 4OIMA 1CRWG 1CWUA 1X13A 4B7UA 2WD8A 3IAHA 2JD0A 2Y1EA 4D42A 1RM5A 3PIDA 3ROPA 1WNTA 3F47A 3Q9UA 1DIAA 2OBYA 4J1SA 1QXSA 1PGQA 3WNVA 1GUZA 1WXDA 3RQSA 5JW6A 5AYVA 3NTQA 4EUFA 3BMOA 3ADOA 4IPTA 2Y93A 4TSKA 4RDHA 2P5UA 1DEHA 2EXXA 5CFZA 1YO6A 3RC7A 2GASA 5HWSA 3GH3A 4DQUA 3B6ZA 2IDZA 1ISHA 3ZH2A 1DIBA 2G1UA 4II2A 3WSVA 3BTOA 1I5RA 2J5KA 2WE7A 5JDIC 2VZ8A 1F14A 5TF4A 2BF7A 1DSSG 5L7TA 3W6UA 3IIEA 1N1GA 2VWPA 2Y1OA 4JK3A 4O1MA 3A4VA 1JVBA 1JDJA 3H5NA 2HU2A 2P9GA 1ZNQO 1EBFA 4LCEA 4MDHA 1E6WA 4P8RA 4GL4A 1YDEA 1GV1A 3FNFA 9LDBA 3DBHB 2VYVD 1JN0A 1LSJA 1UDBA 2YW9A 4R01A 4LMRA 3KUXA 5DP2A 3VKVA 4AJ2A 4DIOA 2E82A 4YQZA 1A27A 5AXBA 1DRVA 2FR0A 1F06A 2C5AA 2QRKA 4NIMA 1ZK3A 5EL0A 4CUZA 3DHEA 3DR3A 5MDHA 1YOVB 4QTZA 4DC1A 3F1LA 3LSYA 2POQX 3U9LA 4RJTA 4WE3A 2X1HA 4ZQHA 3PK0A 2O4UX 3H5RA 1SB9A 2RH8A 1A5ZA 4EJ0A 1BDMA 1JLLA 1KBZA 2CDBA 2O3RA 4UVEA 5IDXA 3WQSB 2PFGA 1KY4A 1CERA 5L7YA 4M8SA 3RVDA 5HA5A 5AXCA 1PR9A 4FW8A 4HUJA 1R0LA 3CMCO 2IZ0A 2ET6A 9LDTA 4J1TA 4XDZA 2CFCA 3ITKA 3OFSA 5TSDA 3ST7A 2XOXA 3LF2A 4BL5A 1LA2A 1EFKA 1HDCA 1E1LA 3MJ4A 1XWFA 2XXJA 3GY0A 3VZQA 3ZWAA 3ZW8A 2FPGA 2G17A 1TI7A 3C3XA 3I23A 1LQUA 1T4DA 4RVDA 1E7QA 4UEKA 3KBOA 1GADO 2CNBA 3SXPA 4AJNA 1ISMA 4CMKA 2QZ9A 3UCXA 3PJDA 1AHIA 4G2NA 4IDBA 1SOWA 1K6IA 3WS7A 1JU9A 2E49A 4XDYA 4RGBA 4KUGA 5HBRA 1MXHA 1AXGA 4D41A 3GVHA 3LVFO 2NV6A 4MVJH 4MVJA 2DAPA 1EE2A 4PG6A 4WEQA 1SPXA 3N74A 4BO9A 1JAYA 4CLRA 2I66A 3OQ1A 3ZNQA 3G17A 3JSAA 3U49A 2Q2VA 4J90A 4FBGA 2O3SA 3I5MA 1Q7CA 4JQCA 3DAPA 4ALLA 1E7MA 4C7JA 3K73O 2G76A 1ORRA 4MVJF 1GQQA 5EERA 3UKOA 1B3BA 1MUUA 3L0DA 3V1TC 3F4BA 1PJTA 4ND1A 3NRCA 3ZV5A 3F5QA 1TT5A 3FWZA 5JDIA 4RQUA 4PLGA 5G0WA 2NU6A 4CMAA 1ZK4A 3TWOA 4BO0A 1ZSVA 3GNQA 1ZUD1 3D64A 4W7IA 2VNSA 5A03A 2Q1SA 5EESA 1FF9A 5CDYA 3HNPA 1NQAO 3PWZA 4NJMA 5ICSA 3LC7O 3BYZA 4FFRA 5B4TA 2OMEA 4HX5A 1GAEO 2HK9A 3K92A 1DC5A 1MLDA 2HAEA 2VYND 2EKQA 2NQTA 3DBRA 5DT9A 3OJFA 1BMDA 3PWKA 4MOWA 5K6AC 2EW2A 3ENKA 4UVHA 4Z9FA 3TPCA 1ZEMA 1PU2A 1HDGO 1G6KA 4JJIA 2EEZA 3OH8A 4FDAA 1GDHA 4XIYA 2DBVO 1J0XO 1NWCA 3KXDA 4PVDA 2FPPA 2BFMA 4J6FA 3PJEA 2Q1TA 2VTEA 1L7EA 2QYTA 2C0CA 1H94A 1YE3A 4MVJM 2ZKLA 3RCBA 5BSEA 3LT2A 5JNLA 1Z75A 3IOYA 5A9SB 4D3DA 3N58A 3OEWA 4MKXA 3R3JA 4CMHA 2CD9A 3HFGA 3HUDA 3ZHZA 1K5HA 5G0VA 5G4LA 5CEJA 4AVYA 3UAGA 2W2KB 4GVLA 1C1DB 5KJFA 2AEMA 3GGOA 3TZQA 1P3DA 1U28A 3UXYA 3GNSA 3PHJA 2VCYA 1I3KA 3OETA 2P4QA 3KETA 5T67A 3ZU3A 3D3WA 5CHEA 1YB4A 3WMWA 1AXEA 1Q1NA 3KEOA 3P2OA 2D8AA 3ZU5A 2O4CA 5HTOA 5JO0A 4MVJI 2JL1A 2Y05A 3ONEA 2GYYA 2WD7B 4PG7A 2PD4A 2C7GA 4TRMA 3U5TA 3HE3A 4XQEA 3S8MA 2YQ5A 4L75A 2BFAA 4N7RA 4IXWA 5COQA 1M6HA 1XU7A 1DJQA 3TF5A 4L76A 3JQGB 1WAMA 3LT1A 3FN4A 1C0PA 4CMGA 3IUPA 2G0TA 2DFVA 5IN4A 3FRJA 4CM9A 4W82A 2I67A 2OO5A 4OL9A 2AE1A 5KKAA 3OIDA 2FR8A 1DC6A 3HSKA 1N1EA 3VTZA 1E3SA 2X58A 4KMSA 3VPSA 2X9GA 2AQHA 4KTTE 4UVIA 4JNKA 1N8KA 3ANMA 4FOOA 3BMQB 5KVQA 4UULA 3ZNPA 4R68A 5KVSA 3DEYX 1KIFA 4PLTA 4ALIA 2DM6A 2VHXA 3UICA 5HS4A 1XELA 2P68A 3E8XA 2GO1A 1LQTA 1PL6A 1ZO8A 3CEAA 3EYWA 1C3VA 1BHSA 3RBVA 1U4SA 3SC6A 3G0OA 1PGNA 2IYOA 3JD1A 1M67A 1PQPA 4NNJA 3QVSA 1I36A 5TNXA 2GRAA 3W8FA 2DKNA 4MVJD 5CAEA 3I9KA 4EJMA 1HYHA 2Z1NA 2QX7A 2DVMA 5DCWA 1F8FA 4CQMD 5TT1A 2Q4BA 1Z45A 3IJRA 4FJ1A 3VPFA 1LSSA 3W4JA 5JAMA 8ADHA 4K6FA 1U5AA 1LC0A 2OFPA 3F5SA 2JFGA 3MJEA 3TZCA 3JQFC 2RAFA 3A28A 3F9IA 5FI3A 3V2HA 3ZI0A 3ICCA 5KNLA 1E3JA 3PHLA 4GAEA 4CM4B 5JDCC 3ZDFA 3AJRA 4GKVA 3VPGA 1PZHA 3CMMA 5FFFA 1YS4A 1P74A 2HK7A 2P91A 3CKYA 3KO8A 4ND2A 2IRWA 3DWFA 3GVIA 5CPFA 4AJHA 3RU7A 3NDRA 3NKLA 1Q0HA 2BH9A 3EVNA 1B16A 4NFHA 1I8TA 3H3JA 2GDZA 3Q2KA 1CJCA 1T4BA 4QO8A 2YDYA 4GPD1 3JQBC 4DC0A 3U4IA 4ZGWA 4TRJA 3QE3A 4Q9NA 3V2GA 2WM3A 4M55A 3RIHA 4DLLA 3U62A 1HZJA 2J5QA 3I52A 3BHMA 3QLJA 4XRRA 1UP4A 1PWZA 3JQ7B 5DN9A 4QFDA 1Y9EA 2JKVA 4JX8A 3RJ9A 1LLUA 2JD1A 2HMSA 4BO4A 1J5PA 4RPLA 1F8GA 1Y5RA 1WMAA 3HQ4O 4YBZA 1RPNA 1UDAA 2NSDA 3BTUA 4QSMA 1G0OA 1IE3A 3OICA 1BVUA 1Q0LA 2X0JA 4GKBA 4D46A 1PJLA 4A2CA 2D5CA 2Y1DA 4J7UA 4J7XA 3HN2A 3VHRA 1P1RA 3NT2A 1QYDA 2OP1A 2O3UA 4XX0A 5F3RA 4Z3KA 3OECA 2BGMA 3D4NA 1B8VA 4FJ2A 4YPOA 3C85A 3OSUA 4K6CA 3GLQA 4BO8A 3AOGA 4OM8A 1P45A 2PGDA 5TGDA 4AJJA 3RWBA 5A9RA 3X2FA 3CH6A 4IINA 3ORFA 2PZLA 2ZCVA 3F6YA 5T57A 1E1MA 1EVIA 4W9NC 4YAIA 5AXDA 4CLOA 1NNUA 3CZMA 3KSZO 4YVFA 5L53A 4YT4A 2AQIA 3IC5A 1OMOA 5JAQA 3JYNA 4UVDA 2EWMA 1UXIA 4AG3A 4WGGA 3ETEA 1D4FA 3GA0A 3AOEA 2HMWA 3V2UA 4XQ9A 5KOIA 3ZWVA 3Q3CA 1BDBA 4XGNA 2X6TA 4Y6SA 4DPKA 3GUCA 2AHRA 3MWDB 2PKQO 3A9WA 3PDUA 1A72A 1HDZA 1GFSA 2Q3EA 4AJEA 4DBVO 2FN7A 1E7RA 2C59A 4JBIA 4XEHA 2DPGA 2E37A 2FPIA 3LT4A 4IXTA 3UFXA 4W9NA 4RLSA 4R69A 3MJTA 3QVWA 2V6MA 4MP3A 1L7DA 1R4MA 4ESOA 2EG9A 2AW5A 3D3WB 4NBTA 1LSOA 4Z9YA 3DFUA 5CPBA 3RUHA 3AI3A 2BKAA 4BNMA 1AE1A 4I5FA 2DFDA 1O94A 4RZHA 4KQWA 1ZVMA 4RPKA 3I4FA 4FOSA 1U9JA 3MTGA 1SBYA 2AEJA 4HWKA 4J2HA 5L4SA 3P5SA 3WGYA 2B4RO 5A9SA 4UEJA 4TKLA 5T64A 4OSPA 3GEMA 1VL8A 3OMLA 2GN8A 3QP9A 2BMAA 2NLOA 4RV9A 5HM8A 2AA3A 1HT0A 1D3AA 2GN9A 2H6EA 1M6WA 2QRJA 1I10A 2OOSA 4BKPA 1XYGA 2PZKA 3PYLA 4BNUA 4J9UE 5C3MA 3DXFA 1IULA 1JKJA 4UREA 2VHWA 2NU7A 5T8KA 2P5YA 4BQPA 1J4AA 3GFGA 1U1IA 3EMKA 1PQUA 2VWGA 3D3EA 3ZCXA 3GG2A 4YAEA 2HJSA 2GSDA 1CF2O 3K8ZA 3HDYA 1E3WB 1JQBA 2OUIA 3WSWA 1GZ4A 1OI7A 3FTNA 5DCYA 3WIEA 1PWXA 4B4VA 1C1XB 4TQGA 1M2WA 4ZVVA 1EQ2A 4L0QA 1YL5A 3GAZA 2JCVA 1Z7BA 2X9NA 2I5PO 1ISIA 4TRRA 4EITA 2VT3A 4CL8A 2JFHA 1LDEA 4BNXA 1KY5A 2D3TA 2I9PA 2J3IA 3PPIA 4CQLA 1R0SA 2VUUA 4FN4A 2R6JA 3JQ7A 4XRGA 5I8ZA 4NDNE 1E6UA 1NHWA 2ZQYA 4PG5A 1ZSNA 1U3UA 4CR6A 1H9BA 4EI2A 5JLAA 3ONDA 1LJ8A 3AUUA 3QIVA 5L45A 1I32A 4L9RA 1ZMTA 3DAFA 5DZSA 1U7TA 5JCJA 4Z3DA 2FMUA 4R3WA 1E5QA 4M87A 3JCZA 3IS3A 2IYPA 1V6AA 1ZIDA 3DOOA 2CDAA 3MZ0A 5I7VA 3I4CA 1H5QA 3DHNA 4U0JA 1DIGA 2G82A 2BI8A 1EVYA 4A7PA 2OHXA 4J7CA 1TEHA 1OC4A 3TZKA 3KYCA 1K89A 4RVHA 3TNLA 1VKOA 2Y67A 3DONA 3G49A 3LDHA 4CUKA 1X15A 5FWNA 4ITUA 4IJUA 3TOZA 3UF0A 3D7LA 3JTMA 4FB5A 1DDOA 2YZ7A 3R1IA 3E03A 3OM9A 3O38A 3L9WA 3T7CA 3ZV3A 3HG7A 4GX2A 5KCZA 3AM4A 4I5EA 3ICPA 3V1YA 1P1IA 4DVJA 1I30A 4CV1A 4GBJA 3FPCA 1S7CA 1GYRA 5KJCA 4BNJA 2X7HA 2X0NA 1R66A 4KOAA 3STHA 2O50A 5F21A 4RF4A 4M89A 3RSHA 1A9YA 2ZYDA 1WDLA 2JJYA 1BSVA 4CMEA 1X1EA 1PR3A 1F12A 3B1JA 3FBGA 4LVUA 3IP3A 5ER9A 1E7SA 1LEHA 4RF2A 5JC8A 5C7OO 3QHAA 4IJKA 4CODB 5B1YA 3PXXA 4JJFA 2O7QA 3GF4A 1BXKA 5JBIA 1FJHA 2PZMA 1XKQA 1FDSA 4G65A 5JYEA 4E2XA 5A06A 2ZTMA 3GVCA 4CM3A 1Z74A 1OOEA 4ZICA 5A5EA 3GK3A 4FD3A 3WFIA 1P9LA 1KC1A 3WYBA 4IDAA 3PHIA 1PS9A 3JQCA 1N9GB 5U9CA 1GUFA 2PTGA 4R4JA 2QYSA 4ND5A 3VH2A 4LISA 4IUYA 4WEOA 1P44A 3KLPX 5K0ZA 1Q7GA 4OXYA 4O0LA 3E1KA 2W2KA 1GYPA 2AMFA 2NQ8A 3NTOA 1HETA 2YHIA 2YYYA 4BV9A 4BKUA 3MOIA 2D4AA 1GCOA 5GY7A 4GLOA 3KSUA 1ONPA 4J0FA 1PGJA 2YY7A 1HSOA 3H9UA 2WTBA 1WPQA 4DMMA 4LSMA 4YJGB 1T2DA 3JYPA 3C7DB 3HDHA 4ILKA 2HJRA 2X8LA 4S1VA 4IMPA 5EQFA 4EYEA 4JXKA 4RVSA 3ZV4A 4LGVA 1WW8A 1UXJA 4CM7A 1YONA 4YJHB 1BRMA 3DZGA 4U6QA 3C1OA 5TIIA 4DPMA 5EPOA 3JQ9A 1Y81A 5LC1A 4DGSA 3LC1O 3I6IA 4WOJA 3PI7A 2DBQA 4YA6A 4HY3A 4ZRMA 1E3LA 3R0IA 1Y8QB 3LF1A 1E3IA 3BHIA 3AFMA 4J0EA 4MVJE 4Z0PA 4RO0A 3WGQA 3PEFA 2VZ9A 4OKIA 4WNCA 3JQEA 4BO3A 4M86A 1QYWA 3RUAA 1R12A 2EGHA 4I8XA 1VSUA 1DAPA 3GGGA 5A3JA 3RKUA 4IDGA 2EF1A 4E5NA 3WGTA 1ISJA 4RPJA 3PHGA 4U0KA 1LSUA 3W4KA 3KEQA 3GAFA 1HSZA 5IN5A 2FHSA 4IIVA 2IE0A 4ALMA 6ADHA 1I3MA 4IDEA 2VRBA 1DBVO 2YV1A 1C1DA 1Q7BA 5TLSA 2JHFA 1BXGA 1KEVA 1J6UA 2BRUA 1WDMA 4XYGA 5ENDA 5CDUA 2X23A 1ENPA 3ABIA 3GEGA 1PSDA 4QT0A 4XB1A 4CM1A 1E3EA 1HF3A 3GFBA 1EDOA 3ZWPA 2HSDA 1IPFA 1SC6A 4CMIB 4DIBA 4XR9A 2UUOA 4N5NA 3AY7A 3W1VA 4A73A 4PCVA 3MEQA 1B7GO 5JDCA 1PZFA 3AU8A 5JE8A 3QY9A 1XA0A 4N54A 3FF4A 3ZU4A 4GGPA 3AU9A 5AOVA 4GLLA 5G4KA 2CZCA 3W8EA 2AXQA 4TZTA 5TJ9A 1N2SA 4OO3A 3GPIA 1PJ4A 1HLDA 1B8UA 4WKGA 3PP8A 4NH4A 4BV8A 1ZXLA 4DQVA 4NFSA 1P1JA 1XDWA 3FNHA 1WMBA 4X54A 3DDNA 5F5LA 4ZHSA 3EY4A 4NBVA 2WYVA 4JN6B 4A27A 2IXBA 4CV2A 4JCOA 4Y67A 1NQ5A 3G1TA 3E9NA 3OIFA 1HE2A 3GMSA 1QP8A 4NU5A 3PZRA 2O2YA 1NYTA 2EKPA 5L4NA 1IYZA 3QQPA 1VI2A 2AG5A 3PLRA 1PS8A 1P1HA 3RU9A 1U3TA 3SVTA 3JV7A 1MXFA 4YJGA 4L73A 2VHVA 4IZIA 4ZQEA 5JY1A 1Y7TA 1LXCA 3ASUA 1QV7A 2WYUA 1UXHA 5DOVA 3GRKA 5DCUA 3GN2A 1GYQA 4CM8A 5KVVA 1NAIA 2W90A 4LSWA 2D2IA 5GZ3A 1R15A 4RCVA 3AY3A 1IPEA 3QW2A 4R1UA 2Q1WA 5EIOA 1XQ6A 3LT0A 1H9AA 1UDCA 4PG8A 2Q1UA 1U3WA 3DZJA 3K9QO 5BSHA 2QG4A 2NTJA 5IAAA 2VOJA 4MINA 3RUEA 4B4WA 4PZCA 4YEDA 1G0NA 1GU7A 1T2CA 1U2GA 3JQ8B 3NEPX 4FIZA 3KHUA 4E5PA 5B4VA 5L9AA 5IF3A 1DRUA 2X86A 2I99A 1N9GA 1QLJA 1T1SA 3NUGA 3TZHA 2EP7A 3S1LA 1DJNA 3GZ4A 1XU9A 3DMTC 3TQHA 4BNKA 1HDYA 3EUWA 1ADBA 2HDHA 1I3LA 3I83A 4J9VA 3UOGA 4YAGA 4ZQBA 3QWIA 3VC7A 1T24A 4BGUA 1E1KA 4AJIA 4B4UA 3L4SO 4YT2A 5T6BA 1U8FO 3BTVA 4D44A 4JIGA 4BMVA 2CVOA 3GHYA 2J8ZA 1RKXA 3E5MA 1Y5MA 3VOSA 3U09A 1JAXA 5TT0A 1E0DA 2Q49A 3Q0EA 4CR7A 4DREA 3BA1A 3WTBA 4DUPA 2GERA 1PJ3A 2NVBA 3LQFA 2Z95A 3Q11A 4WLVA 5A05A 3ZWWA 4K28A 2Y99A 1V3UA 3EK2A 2B83A 4FFPA 3VVCA 4YYZA 4NBRA 2NVUB 1DC3A 3PZBA 3QWAA 4NJOA 4MVJG 4YAKA 2QIOA 3JYLA 4B7CA 1C0LA 5KIAA 1PL8A 4CMIA 1BWSA 1U3VA 2Y1CA 1Y8RA 1KVTA 1TA4A 4O63O 2ZQZA 5JMPA 3DTYA 3KTDA 2PD3A 4Q3CA 2DT5A 4TRNA 2PKQP 2I6TA 4NK4A 2NACA 3H2ZA 1XLTA 1P0FA 3DL2A 1QKIA 3SEFA 4AJ4A 4E30A 3CSDA 1O95A 4XIJA 4XJTA 4L4XA 4BNFA 4TZKA 2UYYA 2WDZA 3FD8A 1P33A 2WYWA 2PR2A 3AW9A 2C2XA 2PH5A 3FHLA 1YL6A 3JQAA 2P2SA 4FFMA 4IS2A 4NQZA 4W7HA 3UHAA 2HQ1A 3TZ6A 4AICA 4LVCA 4Y9DA 3WTCA 2Y1FA 1LX6A 3E9MA 5B4UA 3JQ6A 1I2BA 2VWQA 3TFOA 4GWKA 3ZWYA 4BNNA 4R41A 1ZJZA 4IDDA 2CVQA 2V6GA 5DBFA 2JAHA 4S3MA 1MC5A 3GG9A 4B8ZA 2OBNA 2VTDA 3DHYA 3FWNA 3S2IA 4YCAA 3P2YA 4B3JA 4MPDA 4E2ZA 4ZA2A 3A06A 5COBA 3COSA 4JJGA 1H6CA 3DZBA 3VDQA 1ZK1A 2C54A 4NK5A 3ZHBA 1NP3A 1B2LA 5I9NA 3JD2A 4OH1A 5L51A 2DBRA 4E5MA 4NHEA 4ZJUA 3EAGA 2V65A 3BXXA 3GVXA 2ZTLA 3WGHA 4E5YA 2J3HA 4I9HA 3OA2A 4BO5A 4YRBA 1OFGA 4YWJA 2ZTUA 2C7VA 4IDFA 4CLHA 2PH3A 3QWHA 1EUCA 3VDRA 4M49A 3RFTA 1Z6ZA 3S2EA 2ILTA 4WCDA 4IQGA 4BGVA 3W8DA 1ULUA 3BMCA 1R4NA 2ZYAA 3AM3A 1KYQA 5CDTA 2HKIA 3BZUA 4DQXA 3F46A 2JHGA 3GHHA 3ZHYA 4C7KA 2X4GA 1ONOA 2A9FA 1YRLA 5JMWA 4QFCA 2YHIB 4PLHA 1NTOA 4YJFB 1SO8A 3NV9A 4DIFA 5AVOA 4G5HA 5IZ4A 1A9ZA 3I9NA 2J3KA 4YR9A 2OP0A 1MC4A 4TVBA 3A1NA 2NNLD 5EQDA 3RKRA 2ZIZA 1QORA 3RC9A 1UZNA 1X0VA 2C82A 4GQAA 2LDBA 4B3HA 3U3XA 1W4ZA 1PJCA 4CMCA 4GVXA 2AQ8A 3CIFA 3KB6A 3AWDA 5I9LA 2Q2WA 3TFQA 4BO2A 5KJ6A 4U8GA 4E21A 1L1FA 1NPDA 4D45A 5HRUA 4JBHA 1HL3A 1KVUA 3A14A 1BW9B 2XF8A 4XR4A 3S2GA 3K31A 1HTBA 5DP1A 2Q99A 1YXMA 3IJPA 4R5HA 5L7WA 3OHSX 2CUKA 2XAAA 1D1TA 1HWYA 1ZK0A 2B4TO 4D0RA 5U4QA 2YV3A 3RFXA 3VH1A 4GX0A 1F17A 4DA9A 4NI5A 3ZWXA 5H83A 4DMLA 5JPIA 4BKOA 5ILGA 1R4MB 5AQ1A 2CSUA 3G79A 4OQYA 4AJOA 1AHHA 2ZB7A 1IY8A 2NVWA 1E5LA 3DOCA 4WLNA 5F5NA 3ON5A 5JY6A 2BFOA 4YTEA 4CM9D 2F00A 3AUAA 2F1KA 4NBWA 1IB6A 1LLCA 1QMGA 2C07A 4Z6KA 2PD6A 2NUAA 2VHYA 5EN4A 3SLKA 1ULSA 1KS9A 2GD1O 4CV3A 5I7SA 1WZEA 1K6JA 1HE5A 3KYCB 4XCVA 5IZCC 3C24A 5T8KC 4E33A 2GZ1A 3DBLA 5L4LA 3H5AA 1E1NA 3SJ7A 1O0SA 3O9ZA 1KVRA 4WCFB 3KVOA 4PN3A 1JVSA 4IS3A 2FP4A 1I2CA 1ONNA 2FWMX 3MTJA 3M2PA 3WGOA 3C7CB 3TDKA 3WIDA 5IJZA 4YT8A 1FDTA 1VL0A 2X22A 3AK4A 3I9JA 5TJHA 4K1LA 4HFNA 3H4VA 4EJ6A 2X0IA 3DC2A 1E77A 4FSHA 2P9CA 4BNLA 4H16A 1LLDA 2PGLA 3ONFA 4FCCA 1NAHA 3GR6A 3PDJA 4BNZA 4NMHA 4EEZA 2PA3A 3MOGA 3GDOA 3ITDA 1N7GA 2GUGA 5L40A 2QW8A 1H93A 3KLMX 1R0KA 1K0UA 3LYLA 4TWRA 3HN7A
chains in the Genus database with same CATH superfamily
2JRCA 4DRXB 4Q5IA 3GIDA 1IJEA 1C0EA 3ETHA 4MJLA 1PGOA 1RM4A 1C1XA 4R9SA 2G83A 4LXHA 2EP8A 4E46A 2R48A 3A6FA 2NX2A 1EE9A 4U5XA 2Y68A 4Y8VA 4F4FA 5FAXA 1TGYA 3CS3A 1CQIB 2O0JA 4QC2A 4EFLA 3DOEA 3IULA 4M4SA 4QYIA 3KHKA 4OU5A 3SHOA 3BDAA 4ZAXA 4MWEA 4MP6A 3TSWA 2H1LA 2OBBA 5LQNA 1E1RD 3LFUA 4UVGA 3EZ6A 1Y3FE 3AESA 2WIDA 1I0IA 4L28A 1OR8A 2GRJA 2NU7B 2JW5A 2WJAA 3RC3A 4XYEA 3TO5A 1NKSA 3ZHXA 1ORWA 5IXSA 2OZVA 4TVOA 1OYYA 4GE0A 1GNPA 4LF6B 3L8ZA 4EUHA 1AZTA 3OIYA 3QXJA 4L72A 4AB1A 3PKZA 1V48A 3GFQA 4ALKA 3HACA 1Z08A 2QMUA 4ND8A 4JI3B 2JASA 2ZPTX 1U5CA 2G9ZA 4BBZA 3AHFA 1YTUA 1H2BA 3G2KA 1I7DA 4MDFA 2J5RA 4FT2A 2Z5LA 3EDMA 3QX7A 3ECAA 2RH4A 4LK3A 5CM8B 1KK2A 3CUUA 4B7AA 2FPOA 2VTBA 2D2VA 2C04A 3EXIA 1GPDG 4N49A 2QSJA 2BGRA 4WQMA 2I2WA 5CP8A 4DIEA 4LECA 3K15A 4REQB 1SN7A 3DS8A 3EH2A 4U7JA 4G81A 3V4PB 5BNTA 3ZY2A 5E7QA 1DC4A 4HQ6A 3DTVA 3ZGOA 1YR8A 3TRHA 1C3OA 3DJYA 2WWRA 4CCSA 3SJZA 3JASB 3LPDA 4H4CA 5K0CA 1M3SA 4GC5A 4UASA 4DRYA 4GNRA 1KE2A 3M2TA 3W2HA 3EVZA 1OBCA 1TKAA 3OFVA 3EDQA 3H86A 3FOEC 1TQ8A 5H81A 2F1IA 2A78A 3W34A 4WAUA 5HFAA 4KQGA 1QFMA 1DQYA 4RJKA 2FN3A 3FBWA 1ZDMA 3L07A 3TTTA 1XTTA 4CDGA 4S1PA 2QJOA 4X6UA 4JHXA 2IH2A 1A8HA 1ULAA 2EG5A 5ALVA 5IABA 4B5KA 1QH8A 2WRZA 1EFVB 2IW3A 1M34E 5IUJC 3Q0TA 2JIMA 4LRSB 2J4FA 3S55A 5I7HA 3VH3A 3OQIB 4KQXA 5FBQB 4KO1S 1YZQA 2ZI7A 3EZYA 2WINI 2WMOB 1UMBB 4LJSA 3ECCA 2QPTA 3ZXSA 3STXA 5TARA 3LZ6A 1M76A 2I7VA 3FVRA 5K7SA 1T1JA 4CL2A 1SR8A 5C5EA 3UMGA 1E18A 1LV7A 2QUKA 2W2VA 3OF2A 1M6VB 2QTNA 3Q6NA 4DF3A 5KMGB 3CX8A 4B8WA 3R3HA 5JS1A 2C9YA 4KQJA 2R00C 1HT3A 1TMOA 2NZYA 4FCTA 4TKMA 4KK4A 3QVTA 4GF5A 1C0KA 4S05A 2XCOA 4CN8A 4YRZA 4O02B 4OY3A 2IY8A 3VOTA 2XT0A 3U7HB 3QVJA 1CJKC 3WNZA 1HE3A 4OD0A 1N5IA 4HO1X 2YOHA 2JGKA 1MX3A 4MS4B 4U63A 1V25A 2Q46A 4UQPA 1ML4A 3T3HA 4QECA 5DK6A 2QTVA 4HDAA 1OLUB 3D5QA 4DJTA 1Q0QA 2H0RA 2VVTA 4FYIA 2XH8A 3ZHOA 2IU0A 1T0PA 1FFEA 1KJWA 1UOEA 4XZ3A 3KKLA 3IAUA 1HXHA 2EL9A 3EVFA 3F3YA 3GWZA 2J3JA 4NBUA 4Y1RA 2XEXA 4YB8A 1ADFA 5B3AA 4ZQCB 1HZZC 1AOXA 1IUPA 4ZCIA 2G36A 1E92A 4LJYA 3FNGA 2ZBEA 3UGQA 1X7ZA 4LEIA 5EG5A 1WP4A 1Y80A 1CTQA 2VP3A 4R1OA 1VC2A 3O31A 1X7GA 4DG5A 5ITZB 2QE6A 1SIOA 1IQRA 4TQUS 3UMJA 3U9TA 3W7AA 4MUXA 5LL6P 2D4HA 3K09C 4ZEOA 3FZQA 4MV8A 1B0AA 3UCEA 4BP1A 1L4LA 3OUZA 4FN5A 4UNIA 3TUJC 2MWMA 3A27A 2DU8A 1G8MA 1BX3A 3OJLA 1QGOA 1ABBA 2DCUA 4K9MA 3GT0A 2VYNA 1UBOS 4UCQA 5DLDA 5ALYA 5IWAB 2WYOA 3A4MA 2GOYA 4KBGA 1EK5A 10MHA 1F2UB 3FSJX 1E5VA 4X9XA 3RHZA 4Z4GA 4TUYA 4ERXA 4IQFA 3T06B 3KHTA 3LHIA 4M9SA 1CEQA 2C2MA 3OUUA 5WRFA 1IVNA 4IAOA 4V38A 1ZD2P 4PSCA 1YA8A 2FQ1A 2D6FA 3Q7IA 2BLLA 3SKXA 2E1RA 1R0ZA 1E6EA 2H57A 3OCCA 4MIEA 2O5VA 3WLFA 2DHCA 3O1IC 1J7JA 1F2DA 1UJCA 5FNVF 1SHLA 2HDWA 4OLFA 5A5FA 3BEDA 4DV2B 1EGHA 4QYXA 4G5OA 3FYUC 2GF2A 3P4XA 1SA0A 1PQWA 3LFTA 4B40A 4Z4CA 5CIYA 3QLTA 4FYWA 4AQDA 4PZUA 4F4UA 4NZYA 3UMBA 1POXA 1UT8A 1DEKA 2W83A 3OIVA 3IVCA 4OBEA 1HBJA 4F60A 3GQBA 5HMMA 2SNIE 1SK9A 1SQSA 3KT0A 3V1UA 1XX6A 4QOSA 4W5NA 1TZMA 3A1UA 1EDEA 1CETA 4CM8B 221PA 2PL9A 3J7AC 4QAQA 4PYOA 3G2LA 3L0PA 1FVHA 2XVAA 3AOEC 4FNAA 2EV9A 2RCYA 2I8LA 2QMYA 3Q9SA 4L16A 1O94D 1SC1A 1B8OA 2WUDA 2EF0A 2Z8XA 1NBOA 3ZHUA 4PYMA 2AN4A 5CM9C 3NM5A 5DF1A 3G9TA 1RDFA 1JZSA 1UQRA 2VQ3A 3KHSA 3N7UA 2HTEA 3VRHA 3U4DA 3JD3A 4RE5A 1Z29A 2F3RA 1QG2A 2D1YA 4PIPA 4XM0A 2VJCA 2BHSA 3IGFA 1SUCA 2F8MA 3BBPA 2Z6UA 4C5AA 4DTCA 5SZHB 2B25A 3HKBA 4PR0A 3L6EA 1WIWA 3KT3A 2D13A 4QU8A 2PLAA 3KJGA 2P40A 3WB9A 1X7DA 2WSMA 5KUTA 3EIUA 1EP1B 2L2QA 3TD6A 2P2DA 2UYQA 2VUTA 3T1HB 4F97A 2D00A 1Q2XA 2QUZA 5KYYA 4IIUA 1F5NA 4QOHA 2JF0A 2Z6VA 1FP1D 3LYAA 4YK7A 1Z7EA 2HMVA 2I3AA 3KPYA 2V7XA 3L0YA 1PNTA 2PUVA 3T5DA 4YIKA 5AK6A 4D79A 4R3NA 2GN4A 2FZ5A 2Q6OA 2I65A 1JDBB 2AG8A 2BCEA 1TJPB 4G97A 3VC1A 2G63A 4GDFA 1ZD8A 3EA0A 4II7A 3ROMA 1ZD3A 2KMLA 1RRVA 5ALLA 5D3MB 3C8HA 1GPBA 3IBYA 4MUNA 2BFBB 2PUGA 1C1YA 4YLEA 3ML1A 5KEIA 1JLLB 2GPYA 1DHRA 2W93A 3RADC 2GFIA 4NCNA 4MKHA 1CLEA 2OG2A 3DE0X 1PKEA 3ZWNA 5EJ2A 1TPYA 1CUXA 1MB3A 4GSYA 3KV1A 3WYEA 4O2AF 1M74A 1WA5A 3B9RA 4MULA 4PXSA 1GA4A 2IDMA 2ZJ8A 3T3IA 1JKXA 1W5TA 2Q2OA 5DNDA 3CXUA 4INAA 4IRUB 2AQKA 2YXEA 3E3NA 4MA5A 3E4DA 3I45A 3LG2A 4EABA 3N53A 4DLPA 2W4MA 3K0KA 1WWKA 3N0XA 1PJBA 4HDNB 3R3YA 3BJMA 3RRXA 3WBBA 2LBPA 5JZSA 3UKDA 1P4SA 4HBGA 3DP9A 5C9ZA 5TC4A 1J2UA 3T1OA 4QPZA 1L6RA 5EIFA 4BNYA 3VOAA 4ER7A 8ABPA 1GV0A 1E62A 3T4EA 4F2PA 4EYSA 4NENA 1IN4A 4RVUA 4LDAA 5JYDA 4IM7A 1NE7A 2JAPA 2VJDA 3GJYA 1PZGA 3KLNA 1DTSA 3PQ6A 2WTMA 3J7TA 2BDTA 3G2IA 4RD4A 2YICA 5DRTA 2ATEA 2ZI5A 1FUKA 1NR1A 4J03A 2XE7A 3AJ8A 1XDGA 3GV0A 5AWFC 2OYCA 3RUIA 3UW3A 5SICE 4BMNA 1KFCB 4X85A 1U0HC 4RTPA 1A9XB 2B4QA 1KVQA 1GZDA 4TV9F 3TLGA 4ALJA 1YJQA 1B8PA 1ZJ4A 1O6ZA 2WWFA 3CWQA 3GI1A 1O95D 4MLCA 3DV9A 4ANFA 4F85A 1CULC 1Y8QA 2P0EA 3P9CA 4DIMA 3I6BA 5BW6B 1FE8A 3W05A 2BVNA 3BMOB 5KC9A 1G6Q1 1MJHA 2PKRA 4V1CI 4MQEB 2AWNA 1T4CB 4E32A 5KJ1A 5DULA 1CVLA 4OUDA 4Q4AA 4LFCB 4EX6A 1EAYA 3KSMA 1U0LA 3TTYA 4BGIA 3O5AA 4JOSA 4EFNA 2EKLA 1VBKA 3EQ8A 4X97A 3VR5A 4DLAA 3J81k 1TYBE 4IOJA 1DMSA 4I9UA 4YLYA 2Z0MA 4KRFA 2AL7A 3DBVO 1QP4A 3FSRA 3ZCVA 4WA8A 3UVEA 4DLKA 2E18A 3CBQA 1K0FA 3EA5A 5ALEA 3ZI4A 4BYMA 1UFVA 2RJ3A 3AY0A 4MA0A 3BXHA 1EB8A 2RC5A 3KJZA 1MNQA 2QLNA 3THWB 3DQPA 4Q4AB 4DT1B 2C8JA 5A3VA 4MXDA 1F4LA 1TCBA 1M5TA 5IAKA 1A1VA 1Q92A 5AI9A 3V1KA 2CJPA 4PWZA 2MHCA 3MT0A 5E8RA 2GBPA 4NEHB 3U80A 2C4MA 4BU1A 5FPSA 4QPNA 5LQDA 1ODLA 4CEJB 1ATZA 2DWPA 2JKZA 1KK0A 2Z57A 3IMFA 1MRNA 3FCSB 3EIHA 3INTA 2VNAA 5IT0A 3MILA 1OW3B 1T6YA 4W5QA 5FA6A 2GN2A 4YECA 3WP1B 3A3YA 4K9LA 1OWPA 5HE8A 2PWPA 3O84A 3F8SA 3U61B 3P0EA 2BMWA 2QKYA 3ILXA 1G66A 4ZV4A 2JGEA 3AUSA 4UDYX 4GMHA 4J75A 2YJGA 3TMAA 4MLPA 4V24A 5AKEA 4EJSC 3BREA 1VPLA 1C9MA 2P0AA 4DJEC 1XTJA 3Q3JB 2WJIA 2XE4A 2JCSA 3OU6A 3LVRE 3HFSA 3A4NA 1UF9A 5BN1A 2FMKA 4G5QA 1II9A 4O2LA 4ISCA 5B6PA 1ARZA 2J6HA 4RVNA 1G7RA 5BSWA 1Q0RA 2AXNA 1RHKA 2E55A 2I4RA 4MR7A 1IZ9A 5JEDA 3ZZUA 1OJ7A 3O4IA 3UEOA 4QXAA 4R05A 4HH0A 2HRBA 3CJTA 1FYEA 4CCYB 4Z99A 1QWOA 4RK6A 4BLOA 3HKEA 3H9EO 2ZJ6A 2X13A 3KZVA 4O1HA 3N2EA 4X93A 4BFWA 4E11A 5MGBA 1N8NA 2YINC 4M54A 1T6BY 1XMSA 5LDDC 1XTVA 1QYRA 2VDUE 1N0UA 2R6R1 1BS2A 1KI3A 1GPYA 2EKZA 2XOKA 4KO4S 3TXYA 4C7BA 4AKIA 2QNIA 1UBCA 3QMMA 1PBNA 3FNEA 3TRDA 4MKRA 4CL3A 1EVQA 2AOUA 1IHYA 2Z9CA 1OSNA 4BB6A 2ZI4A 3L3BA 4IHJB 1NZJA 3VPBA 5EZYA 4F38A 3ENQA 4FOTA 3HWSA 4YR7A 4ZHQB 1TU3A 1ZH8A 2G25A 1ODIA 3CPEA 3F49S 4UFOA 5E0OA 1MG0A 1IN5A 1RE1A 2YN2A 1LFDB 3ROGA 4BNIA 4H77A 1PEAA 2H3HA 1ULTA 1UOPA 2I2DA 3FNIA 3FROA 3IT2A 2COKA 1B6GA 2YHUA 3ANTA 3C8UA 5KI6A 1BQEA 1TXGA 3CLRC 4U2KA 4XGKA 1M83A 4EA6A 4NBLA 1TL7C 1GARA 4KVAA 2NXCA 4HZUB 4MV5A 1NHGA 2JCXA 3SZOA 5LZ2A 3DBHA 2OBXA 2XWBF 1EM8B 3CX4A 1CNEA 2YFQA 4B6RA 4D98A 2RBEA 1N9ZA 3QV1A 2ZEJA 1JKFA 1T0HB 1V9LA 1MAVA 3OZVA 3T0GA 3V4SA 5IFKA 5KSYA 1U6JA 3ANNA 2Z8ZA 5KWVA 1J99A 2BKUA 5GPBA 5JU6A 4GZ6A 1BA2A 4DSTA 3F7OA 1GQ2A 3NBFA 1ORVA 1PLKA 1D1SA 1ETUA 1C5KA 1Z4JA 2JIOA 4K9RA 1T3LA 1YQUA 5SYAA 5C18A 5IXYA 2IWRA 4QO7A 3P7MA 5LA6F 1VHQA 1HDOA 1YDWA 1LDNA 3BQNB 1EX7A 4CPDA 3WGJA 4YJ2F 3IR7A 1PK9A 1NVGA 1MB9A 1YR1A 2Q62A 2ZIWB 4LI0A 3WE7A 1N3YA 4LGYA 3PR3A 1GVHA 1UP6A 2I33A 5ECDA 1XQ1A 1DOHA 1TRKA 2DUUA 2RI0A 3D43A 3KJNA 3O4VA 5D84A 4D4HA 4G0NA 5JXJA 1DHTA 2P78A 1Z4QA 5IJWA 2P3OA 2TSYB 3DF7A 4HNAB 3I6YA 4J0IA 1MFPA 2I4IA 5U1PA 3INNA 1N3IA 4NLLA 3IELA 5LA6A 2ZVPX 4UTXA 4AFNA 4O3MA 1LI7A 2XB6A 1UZLA 1FTQA 3H2IA 4XIGS 2BTOA 5I9MA 1E61A 2PSHA 4KBFA 1C3LA 4I55F 3VZRA 4LXXA 4W5TA 2I76A 2IC5A 4WK6A 4BUJA 2WA2A 1GGHA 2ZUFA 1LNSA 4R6WA 3M8KA 2RHCA 5IHPA 3OIGA 4P86A 3I42A 1ZIOA 4RAQA 3VISA 1RM3A 3EG9A 3FGPA 1JH8A 3MFYA 4H3VA 3EC7A 2RKWA 1P4JA 1QWSA 3BFPA 4G4JA 4PZ9A 1WDKA 4W8OA 4D7AA 4DNQA 1H4SA 1FNDA 1G6HA 4N0MA 4HVTA 1SIUA 1UUFA 2PN1A 3GPDG 3T35A 1BKSB 2WICA 3MWEB 3E35A 1MAUA 2PR7A 2ZSEA 4TROA 1H4VB 5K3DA 3ZVLA 2Y1KA 3OOWA 5TDHA 2XJ9A 2O0LA 4B3XA 4HUTA 3MJSA 2ZRQA 3T1YB 3GU3A 4OMFG 2FW7A 3TW0A 4FYMA 2ZKIA 3H7AA 6LDHA 4O4IB 1PWEA 2AMVA 2Z83A 1E9RA 3COWA 2I9KA 5K3AA 3ZWDA 3OZXA 2P2CA 3T1QA 3IAXA 2YMPA 1R6BX 2XUPA 3X43A 4CT4B 4DQ0A 3IX7A 4DCTA 5LFAA 4D0NA 1ZNWA 1UC9A 1TT7A 2YQZA 4KPYA 1R50A 1RCTE 4DV3B 4A8JC 1GA6A 4UMEA 3LBIA 3SCZA 2DTXA 3ZNNA 3BK1A 1Z73A 3KCQA 2QRZA 5KNCD 2R8RA 1H42A 2QAJA 4R81A 2EYQA 4JP3A 2OORA 2ZSIA 4C6TA 2BR4A 1QRTA 1GGVA 2A35A 3BWEA 2MSEB 4B6SA 4K26A 1P7ZA 1XZBA 3UTDA 2RAUA 4NE2A 4FFDA 3FAKA 2PZEA 3KTAB 2ZSKA 2IYAA 4MO2A 5DLEA 2Q3MA 4BE4A 3IVXA 1XHLA 1QV6A 2JBAB 5DDIP 3T94A 3GL9A 2JPDA 1W85B 1IG0A 3QYAA 1PUIA 1C9JA 1VE9A 4MKFA 1NVWQ 3ZE7A 3KR9A 1DRJA 3GUYA 4PPNA 4DKJA 2V7PA 5FBHA 2B6NA 4L9AA 4DB2A 1BXGB 3HB4X 4FFVA 3P0HA 1VPEA 1BE8A 5B12A 1EUDA 4R2KA 4HAXA 2NU8A 5EUBA 4C20A 3IHLA 3ZGVA 3LPAA 2RARA 1P1FA 1IHPA 2CE2X 3DNMA 3WQQA 2O8BA 2XCQA 2GEDA 4K9QA 4PTZA 5JCXA 3B7GA 4WINA 4MH0R 1JWLA 5EMKA 1GNTA 5AJVB 3PGMA 4XEUA 2MYTA 4D26A 5C37A 2FDXA 3DZIA 3V97A 3GLHE 1L4BA 3NIWA 4EW1A 2GEUA 2O8FB 3UZUA 5K45A 2GJ8A 1I1HA 3BMNA 3AR9A 4N0EA 3WIUA 1T5BA 3ZE9A 3DE6X 1J00A 3OQIA 1OFHA 3PFHA 3QEJA 1QPGA 1T1RA 1WVIA 2P2NA 3CZPA 1D7AA 3QE9Y 1L8QA 1SWWA 3ZLJA 3C3DA 1GRNA 3W2EA 5JZVA 2OLJA 1QFJA 1YA6A 4R1TA 1JB1A 3TQFA 3GLIB 1W36C 4G5RA 4JEMA 2AD1A 5KWJA 1L1QA 2JI7A 5HMLA 3RAJA 3ZTTA 3GB9A 4H4EA 4LUCA 4PHHA 2C78A 4JAVC 3B7PA 4TLEA 1K3TA 3HGQA 3SIWA 1K6XA 2D3WA 4JLDA 1FJXA 4OL0A 3EC2A 1GZSA 2FX2A 5AW4A 4JOQA 4I1IA 3EBLA 3CA8A 2BGKA 3K0AB 2H06A 3WYCA 3WLQA 1GLNA 2X1VA 4LC1A 4OK6A 1E7YA 1RAAA 1L7XA 4J6EA 4OPMA 4ETMA 1DOAA 4X7MA 2B5OA 3IERA 3VPAA 2HREA 3ZUGA 1JEQB 2V7QA 1MU0A 5AJYA 1X7YB 1EWVA 3A36A 4OX9Y 1XKLA 4L50A 1UIMA 4RX1A 4Y18A 4MR8B 1MZPA 1C4KA 4W5JA 4XPIB 3PLAE 1YAJA 2KWIA 4IKEA 1NDUA 1BROA 3VO8A 2EX0A 4L0DA 2PH7A 3FR8A 1I2ZA 3BK2A 2QTBA 4IKOA 4N8EA 1JHDA 2O2DA 5A9TA 4B45A 4N41A 3H6HA 5JZ9A 2NO4A 2R5WA 5I5EA 2BFFB 1C14A 4EHFA 2RJNA 2IHVA 1XGKA 3O3MB 2BF4A 1Q12A 2GJAA 3HRIA 3B3GA 4FFBA 2PMBA 3BSYA 3CJRA 3CNEA 3DA8A 3N8GA 4HRAA 5C34B 3TQIA 3V7UA 4EQZA 4G0WA 3NJRA 5F1OA 2R25B 2B20A 2HMYB 4IH1A 2HEGA 3CEHA 3K53A 2E9SA 4I9NA 3CPSA 1PJQA 1GG5A 1D0VA 1MNAA 2OM2A 3RYFA 3HK2A 2FXVA 5JC1A 4HDKB 2JFYA 4QQ8A 4X84A 1ND6A 1UL1X 4PQEA 4UE3S 3CO5A 4GYWA 2JGNA 5I9TA 4LMPA 4B71A 2JJ2A 4MLZA 3BC1A 3KOOA 3OJWA 4QYIB 1ATIA 2VP4A 3QF4A 3JAKB 2PHZA 1E20A 2X40A 3RJZA 5A04A 4RPGA 1AK9A 1K5GA 2XYVA 1S01A 4PRYA 2WSYB 3KDSE 4MQ5A 1O0CA 3AB7A 2ID8A 2H4FA 3MAJA 1P4AA 5EQTA 4YRGA 4A0QA 1SBZA 3PFBA 3VZSA 4DRXA 3CUEF 3DEAA 1CIJA 1VG1A 3H1TA 3KKQA 3MCWA 4HXGA 5H9WA 2QTAA 1VE7A 5IZCA 1M2VA 2ZJBA 1JLRA 3OEHD 5EJ7A 5J4YA 1B26A 2WZDA 3MCTA 3P9XA 3RI3A 1VSBA 3JQAB 3AVYA 1DDGA 2JI9A 3OBIA 3Q2IA 1ZD5A 2NUPA 2O5EA 2XNHA 4GWGA 1MDFA 1QLHA 5JSHA 1Q16A 2MYNA 5D5PA 4U2FA 2FLWA 4PZ0A 3NC0C 4AMVA 2X5NA 1H2YA 4EUEA 4GMFA 4MB6A 4EW6A 3REOA 5DBOA 3WQRA 4NCIA 1W85A 1QX3A 1NMYA 2XYRA 1LF0A 4CF7A 2O8EB 2I03A 1UAYA 1UINA 4XQGA 3HCBA 2WUVA 3LXXA 5TR9A 1W1IA 3NYWA 4I1PA 1U9CA 4YJDA 4M9QA 4E31A 2C9CA 2QA5A 4ZT3A 3QY0A 3GOHA 5K8UA 2PE5A 1G63A 3VKUA 5SY9A 4V1CA 3UWPA 4GRAA 1ZHHA 2Y0EA 4YMGA 1QR2A 3P2MA 3QENA 4LG1A 2ZB4A 4BJ3A 3KEFA 3OX2A 4R1LA 4UTRA 2IZ6A 2JGFA 2ZSHA 2A30A 3MD0A 1ABEA 3MHPA 1SG6A 2YV5A 2N47A 1BQ3A 5CDFA 3EC1A 3RV4A 3O83A 5HGXA 2VJPA 4JKYA 4JJAA 4I9GA 1XQVA 3MJCA 3P9NA 1GD1O 2QTTA 1SUEA 3ORRA 4KUHA 2ZVJA 1W8DA 1VL6A 3V8MA 2NO5A 3P97A 1T4MA 1O8CA 4Q3OA 3HBLA 4L08A 3S1SA 5IP5A 1O03A 1TTHA 1W0CA 1YBAA 1C9KA 3P32A 3QVXA 3T3MB 4C9BA 4G26A 5EGSA 1OAAA 5GGYA 4KPUB 1VGRA 3C74A 4AWBA 1PR1A 2V8BA 2AUNA 2IVZA 4KK3A 2BN4A 1UM9A 3CB2A 3KOUA 4NBSA 1FRFS 4UUQA 3TMYA 4E5KA 2CXXA 2V7TA 2ENUA 5H3LA 3ZY5A 1ACJA 2DBZA 3WB0A 2QJRA 3HUUA 3MTBA 3K6KA 3M6LA 3PQ5A 1YJXA 3JQ8A 1N5LA 1QJ4A 1HFJA 1SULA 3NH9A 2VDQB 1RMQA 1LI4A 4CQLB 3C3KA 4NG5A 5I7EA 3ZHVA 1XQXA 2K4MA 3VAZA 1SQ0A 2R00A 4QTUB 4JI1B 2Y92A 5FYQA 2ACWA 1G8YA 1IXKA 1KPHA 3WGZA 1AV7A 1KA9H 2KE5A 3DZHA 4N5MA 3NLLA 5EMHA 5BN5B 4RV4A 1X7XA 2CXHA 4BFYA 5FUMA 4UFNA 1ZFNA 3O26A 5LP6A 4LZZA 1SVOA 2WJVA 4QUDA 4DCMA 2GBGA 3WHIA 3VJLA 3ICEA 3AVTA 5CVEA 3C7AA 4N7BA 5A02A 2J9XB 3TDNA 1UOOA 1CVRA 1GPMA 4FHDA 3A32A 4XD2A 3VI3B 4C14A 3I04A 1XWWA 1NFFA 3MJDA 5CT6A 1FBNA 3IO5A 2HRZA 1BQ4A 3LX5A 2J1LA 4TS4A 4X6YA 2M6LA 1CYEA 1X70A 1YUMA 1KEUA 2QZPA 5J23A 3W2TA 1MABB 3B8EA 1NUTA 2IEIA 3BXFA 3PRJA 4MR9B 3TD9A 1FCJA 2KPOA 3D5EA 5IYZF 3BKXA 4QQRA 2WJPA 1EUZA 2PM8A 2BFPA 4IF4A 5HXAA 1O97C 1K3FA 1X94A 3DZCA 4ZPXA 1R4AA 4IJVA 5CLHA 5E6RA 1U8YA 3GLHA 3JYOA 4B4OA 5IPFA 1TO1E 3HCNA 2JC3A 2XGGA 3ME5A 4OJKA 4A26A 3PPWA 4L15A 4K9KA 4B0PA 4KNWA 5KOJB 4HL6A 1E0JA 1TA0A 1OZFA 2WHPA 3HZRA 3LO8A 3OM0A 3H1PA 3RUPA 4ZAGA 1HFKA 3LKDA 1PGPA 3WXBA 3ER6A 3TOXA 3EFOB 2ZWAA 1RC1A 3D6AA 2P79A 3A9VA 1ZGAA 3O3OB 3IBSA 1EBUA 4UUMA 2C94A 3DDHA 1HYEA 3QXCA 4CFYA 2Z2ZA 1BD4A 2NXJA 1ZY2A 4GMGA 3AHDA 4TSFD 5IEJA 3REFA 1DELA 4YREA 3ND5A 3DVAB 5IUNC 1Z5OA 3CUKA 4DR5B 1F2TA 2C83A 2NP7A 3NFRA 2CCKA 3M1LA 4ZI7A 4IFBA 3IBTA 2I2BA 3O8QB 5FUBA 3I2FA 5K4AA 2WAMA 1X92A 2WP0A 2FRXA 3O8OA 5FF9A 5CG2A 1DWPA 2AF4C 4QKQA 2JLBA 1NI3A 3H9JA 2OV6A 3SICE 1MHTA 3K6SA 1IJBA 1OFVA 5ES3A 4IQ0A 4MUYA 1DARA 2Q0SA 3LNCA 4YBRA 4R7GA 4YCNA 4GS5A 2PKYX 1P80A 2PX6A 4ONEA 5T6MA 5CXQA 1PL7A 1DP4A 5JJ5A 2GTPA 2YCBA 2W2MA 4K3VA 4R9RA 5A4MS 1GIAA 2J9YB 4BGDA 2OK8A 3LYUA 1LCIA 2A9KA 2FWRA 3IQGX 4IW3B 1XIVA 1K06A 1JKIA 4L4UA 5DJ5A 4R7ZA 1FRZA 1Y4SA 2F4NA 4MGYR 3HRKA 3NRJA 5AXAA 4BLSA 4HEJA 4WNIA 5K09A 3G1UA 3SYRA 3BCHA 4FHFA 1XZPA 2FSVA 3CLVA 1XG5A 3WWOA 3KWJA 4I55B 5JANA 3HB5X 3E3AA 3L9XA 4YCBA 3ZDQA 4BB5A 1RBMA 2GVZC 1E63A 2O2CA 2RHRA 1M1YA 1JR3E 2XECA 4HLCA 3WMXA 2R11A 4E2FA 1EWTA 5E95A 1YRHA 4CTMA 4WOKA 4UARA 4MRMA 1GRQA 1RT9A 2I0FA 2P5TB 2ZJOA 4JLWA 4L95C 2XVZA 4X60A 3ZHRA 5JSYA 4UUAA 1G8JA 3FSGD 1O96B 2ABWA 2FPRA 3KDAA 4MX8A 3REGA 5KNDD 1RXVA 2VQ6A 1NVAA 1OYOA 5CA0A 3Q5DA 4GPTA 2TMGA 4Y98A 3U7RA 2Z98A 4B79A 5K3CA 2PLRA 4CUJA 2BFEA 3FCEA 2VOEA 4P6VF 5H4GA 1G20E 2Q9BA 2YOFA 4QRHA 3HHPA 1RXUA 4IMRA 5ALMA 3OO1A 4E7PA 2ZXEA 1OTHA 4Y2GA 1W5FA 5AW2A 1N1MA 1TEXA 2O23A 4DCPA 5CH5A 2H1FA 2CVZA 1YZVA 1SKYE 2Z5VA 5AUQA 4Z7OB 1BDJA 2VAMA 1WBDA 3L1KA 4N6NA 2XXBA 2X0DA 3UBTA 1OQAA 3MA0A 2DZDA 3NC1C 2QN3A 2LUOA 3QU4A 2H3EA 2ZUUA 3ORQA 4GPIB 1ZPDA 4P32A 4OAQA 3GYBA 1KOGA 3BT7A 1EUYA 3FSGA 1QE3A 3DBIA 2A3RA 4LGCA 3OQMA 1TJYA 1X13A 1XMQB 1GTRA 4QYWA 4BLWA 4D42A 5ADUS 3NHJA 2FMHA 1U0GA 2Q0QA 2VQEB 3F47A 1EXNA 2QMOA 1IY2A 2CYAA 2X9QA 1OE0A 2L19A 3DEJA 2QM0A 3OFKA 3CX6A 4JEHA 3K1TA 4I7EA 3SK0A 4PFSA 1OIXA 2MSKA 3N2ZB 1Z13A 3Q3VA 5KOHA 1WXDA 5AHXA 4EUFA 3BMOA 3ADOA 1HO3A 3K1YA 2Y93A 4R2LA 1S4MA 3W8RA 1EP3B 3L6RA 3M6AA 5CFZA 1JQLB 2A58A 2GS9A 3L7NA 4L5YA 3RC7A 3QVMA 5JSQA 1A76A 1FNNA 4M1MA 1KPGA 1Q22A 3TUZC 3TLGB 3KFVA 2G1UA 3FOZA 3SKYA 5FTJA 3DYIA 3QX3A 4BN0A 2WILA 2M6RA 2VA9A 4OHWA 1SC3A 1CS0B 2WE7A 5JDIC 5HNKA 2VZ8A 1F14A 3IE0A 2QW0X 5B1IA 2IZOA 3LSTA 1WY5A 1T2NA 5L7TA 3E5HA 1G38A 1N1GA 1CZUA 4MTLA 1TW2A 3SYNA 1PAUA 4MDHA 1GG9A 1ZNQO 1GPUA 1JXOA 4Q1BA 5HQJA 2DLCX 2JJ1D 4GL4A 2G0NA 2YW9A 1JN0A 1LSJA 1UDBA 2WZBA 1KFJB 2PSEA 1N78A 1XMIA 4BP3A 2G1KA 1CQPA 1DT5A 1ZUNB 2EBWA 2NTYC 3KALA 5AXBA 2FR0A 1F06A 4PQGA 4DQLA 2EFJA 1F0NA 1Y3DE 2RGXA 1B0ZA 4D92A 2AN9A 4UAUA 5LMZA 4PCLA 4CUZA 5JEEA 1Z5PA 1Y5NA 2C98A 1B93A 2G08A 4ZVOA 2QZSA 4CKCB 3F1LA 3LSYA 2FWAA 2CB0A 1E5DA 1SUWA 3S8EA 4RJTA 4URWR 3LY7A 1WXGA 3HCAA 4ZARA 5JD4A 1BOFA 4OLAA 2ZRCA 1ZC4A 2O4UX 1E60A 5IBCA 2ZB2A 1JP7A 2D8MA 4KFSA 3DD5A 3Q5GA 4URXR 3KOXA 2Q5HA 2I22A 1KOFA 4EHLA 1N2BA 1KY4A 2PFGA 3ESCA 3SF8B 2W6CX 1CERA 3R9IA 3I30X 2ATCA 4GXQA 2R6GA 3KTOA 5HA5A 2O20A 4IX1A 1HFEL 2WUEA 1MR3F 1WXFA 1BFUA 1JA0A 3EIFA 4AW9A 4NAVA 2HA6A 3QOWA 1OAOC 1V41E 2XBMA 3VNVA 1T5TA 4ZCQA 3GT7A 5GWXA 3T1VA 3ITKA 4YJ2A 1MO3A 2XOXA 3Q8WA 1LA2A 1OXXK 1XWFA 2E5FA 2XXJA 1L2TA 1M2NA 3ZW8A 2G17A 4HZIA 4Y2RA 3C8DA 4ZZIA 2YZGA 3EBPA 4UEKA 3MGCA 3I23A 5FOUA 4AKHA 1NBHA 2REBA 4ACAA 4XD7D 4W1PA 1T0UA 3W6OA 2CNBA 2PSSA 3T8YA 5AHRA 4YP9A 2VH2A 1BD3A 3H2JA 3PDHA 1MO2A 4GP6A 5LLTA 4CMKA 4LC0A 4P31A 3UCXA 3NS7A 5FQNA 1BKYA 3TI9A 3UT5A 3OQNA 4IDBA 1SOWA 5KC8A 1DUIA 2Q2NA 3WS7A 3A6ZA 2E49A 2JIBA 2ZJFA 1C2TA 3AR4A 3IOEA 4KUGA 4PSVA 2WF6A 5JOQA 2Z4SA 3R09A 4I46A 1NX9A 3GRUA 4D41A 4PG6A 1QHFA 4G8BA 1EK2A 4WEQA 1SPXA 1YQEA 3N74A 2RAVA 2DQZA 3AKCA 4BEWA 4CLRA 4IIYA 2BMFA 3FHOA 4PAMA 3T3NA 4OQ4A 1K4KA 2JI8A 4FBGA 2RKOA 4FYKA 3I5MA 4TVKA 1JEAA 3WLNA 3DAPA 3N5KA 2WLSA 1J8QA 1NLYA 4PZPA 3CIOA 4ALLA 4EY6A 3K73O 3IDAA 3TCNA 4PQRA 3IUYA 3RYHB 5HKLA 4ZT4A 3LW7A 4EMUA 5H3CA 4LDRA 4C1BA 1KJQA 5JD5A 1OV4A 1XRJA 3UKOA 3ZDYB 3V1TC 3SHVA 3TG2A 1PJTA 2Z6AA 4ND1A 2ZRMA 3NRCA 1TT5A 2B30A 2JGAA 1CJTC 3FWZA 3IESA 2QVYX 2VBIA 4EQ6B 4LYAA 1EFAA 4ESHA 2G67A 5CURA 4CMAA 5AM3A 4BO0A 3IMEA 4QFMA 4O8ZA 3GNQA 421PA 4KLAA 4LZNA 4DLYA 2JH8A 3TSZA 4DCSA 5AM2A 2A57A 3JZMA 5CDYA 1UANA 3WMEA 3PWZA 2ZWVA 4NJMA 5FP0A 5ICSA 5K2OA 2VA8A 2IKQA 4FFRA 4IHQA 3OQOA 3SXUA 3P2KA 3PKIA 3DMHA 1VXRA 3GOQA 4M83A 2VYND 4NATA 2Q3CA 5DT9A 3DBRA 5I47A 3T1NA 3O82A 5K6AC 4MOWA 1HOXA 1U2GC 2EW2A 2IS2A 4UVHA 3C5WP 5CB4A 1C8KA 4Z9FA 4I14A 1S4QA 3OE4A 1CUWA 1L5YA 1HDGO 2X2OA 1G6KA 3L01A 1XRMA 2BGNA 3EXHA 3OH8A 4MSUA 4FDAA 4XIYA 3RTCA 1W581 3X1MA 1FTNA 1Z2PX 3EZ2A 1O4VA 4J6FA 2OVFA 2NT3A 3VTAA 2VBGA 3WL7A 1NW4A 2C0CA 3EIWA 5BSEA 4KR0A 4UXHA 1NG9A 2IXGA 3NIDB 3W04A 2FZCA 2I7CA 2XX3A 4OJMX 4AAYA 2CNWA 3OEWA 5ED0A 2OB1A 1EJ0A 3WL5A 1X2EA 2CD9A 2MOKA 2PCLA 1K5HA 5G4LA 3DGFC 1C80A 2XCSB 3NAMA 5IANA 3GRFA 3I76A 4GVLA 4P3OA 4AZTA 5KJFA 3AIIA 1FY2A 3TZQA 1FFDA 1P3DA 3UXYA 2JJ2D 3UM9A 1XZGA 1F48A 3QUTA 3L8CA 3OETA 3RIMA 5CLFA 4XWTA 3KDPA 3WMWA 3KQHA 3G7NA 2D8AA 3I6MA 4DZRA 4HQRA 2NMVA 4NNPA 2HSJA 4A3SA 4LJRA 3ONEA 4QUBA 2ZULA 2JFNA 2OAEA 1ZH0A 3MMZA 2PD4A 3NB0A 2PU5A 4KPUA 5AVZA 3S8MA 5KQMA 4L75A 5DGCA 1J0BA 3MWDA 4MUJA 4OKSA 3SC2A 1ZCZA 5CNMA 3SI7A 4IXWA 2HV9A 1GUDA 5COQA 1Y8CA 2WHYA 1M6HA 1PDVA 3SG0A 3VNRA 1DJQA 1LK0A 4XVHA 4B6EA 3TF5A 4L02A 3N2LA 3IUPA 5A4KA 4ZDKA 4HVAA 3KVRA 3R0XA 3A0UA 3CX3A 3NFYA 2RK6A 3DKIA 1A4RA 2AYZA 4HD8A 4W82A 5CXXA 4CM9A 2WFMA 2FR8A 4YDSA 1FSSA 2CUTA 4IMIB 3Q5EA 1N1EA 2IQ5A 4UBLA 1IOVA 2X58A 1K8XB 1FNCA 1Z34A 3JATA 4KMSA 5AVXA 5AW0A 3WA7A 4J16C 1TVMA 1TLFA 5ARCA 1TM4E 2AQHA 3ZOZA 4BPRA 4P3XA 4UVIA 5JPCA 4AN4A 4FOOA 4AF7A 3HCEA 1Z3CA 1EP9A 3BMQB 5KVQA 4UULA 1E0SA 4L5BA 4R68A 1BCSA 3DEYX 4N0PA 2GLUA 4HMOA 5JRJA 3EPHA 1ZOSA 3LK6A 5AUOB 3V7YA 4K40A 3G88A 4LXQA 4B3BA 2Q6IA 1VMEA 2IUEA 1LQTA 2GCEA 1ZO8A 3G6WA 4WXHA 3OX1A 1MMFB 2LCFA 3CEAA 1AZLA 4GPEA 5F33A 4YMWA 2XD4A 1U4SA 3OQJA 4ERNA 1WW2A 1W2HA 1S9DA 2UZ1B 4S1OA 3SS9X 3QHPA 3T12A 2VEDA 2WZQA 1JMVA 1LLFA 1SVWA 3DW3X 3UK1A 3W8FA 3W5JA 5CAEA 1HYHA 4BNDA 3U3MA 5DX8A 3SGLA 1VHDA 2VJMA 4AO7A 3UAXA 3COYA 3R4VA 4J0DA 5I8PA 3VPFA 4P3KA 4RTOA 2EZUA 4Y9UA 2WF5A 3R5KA 2OEPA 2P3SA 4K6FA 2G88A 1DAIA 4AQYB 1YI1A 3KS9A 4EFKA 3MJEA 3QM1A 5AW5A 2B94A 3JQFC 4O25A 3TZCA 3F9IA 3FDFA 3ANXA 5JD6A 2OFWA 4OJTA 3UJ3X 1PFKA 4MUGA 3BWXA 3ICCA 2B99A 3M6WA 4GAEA 3AP1A 5JDCC 4PYJA 2Q0XA 4LJ9A 4TYQA 2W43A 1FSZA 5K3FB 3ZDFA 5HQ3B 4MQBA 2ZJ3A 1YS4A 4OGLA 3RSLA 3KO8A 2IRWA 3HKCA 3GVIA 3G9ZA 5CPFA 4LHEA 3NDRA 3RU7A 1JDVA 3M6VA 1ADJA 3B36A 5IDVA 3GRZA 1QV9A 4RFLA 1QF6A 3V00A 4I50F 4V0SA 2M1ZA 3A2LA 3KQVA 5DO9A 2G6TA 4X1KA 4GPD1 4C0HA 4CKEB 3PNPA 1FL9A 1LTQA 1REQB 3S1AB 2HWKA 3RIHA 3A6HA 1HZJA 1Z7GA 3BKWA