3E9NA

Crystal structure of a putative short-chain dehydrogenase/reductase from corynebacterium glutamicum
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
225
structure length
189
Chain Sequence
KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVEPIESDIVKEVLEEGGVDKLKNLDHVDTLVHAAGSVAEWHAHLDLNVIVPAELSRQLLPALRAASGCVIYINNTIYAASKHALRGLADAFRKEEANNGIRVSTVSPGPTRPEIYIEPKEIANAIRFVIDAGETTQITNVDVRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
publication title Crystal structure of a putative short-chain dehydrogenase/reductase from Corynebacterium glutamicum
rcsb
source organism Corynebacterium glutamicum
total genus 71
structure length 189
sequence length 225
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.36: Acetoacetyl-CoA reductase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3e9nA00
3JQAD 5I7FA 1QYDA 2G5CA 4JJIA 4Y67A 1A7KA 4KUHA 4EBFA 1UP4A 3ANLA 3O4RA 5L45A 2EHDA 4MVJP 5CG1A 1ZMTA 1Q0HA 1SEPA 2LDBA 4W7HA 2YHIA 3GDOA 1E92A 1GV0A 3NDRA 4CM4A 3JQ8B 3B20A 2EGHA 3GEDA 2NU6A 3NRCA 1HSOA 1R6DA 2VNSA 3PHHA 2H9IA 4PRKA 1X0XA 4KUGA 1GD1O 4Q3BA 4AJPA 3KTDA 1UXJA 2BLLA 2J6IA 2PNFA 1ZW1A 3K31A 5JCJD 7MDHA 1DC5A 4U7WA 3TL2A 3BZUA 3P19A 4B7CA 4CUJA 2W4QA 1BDBA 2GZ1A 4X54A 1K6JA 4FDAA 4HBGA 3IMFA 2BFAA 2BRUA 3K2EA 3ASVA 4GH5A 4E12A 4RO0A 2OHXA 4D0SA 2PZMA 2F1KA 1E5QA 2NU9A 1ZJZA 3F5QA 3LT1A 4UULA 3SJ7A 2ZYAA 3WR5A 1KVSA 2BD0A 5TQVA 3WQQA 3IKTA 3RKRA 4GKVA 3JCZA 4OKIA 4XGNA 2F00A 4BB5A 1EUCA 4BNTA 4D43A 5BR7A 4RVDA 1HDXA 2EF1A 1XYGA 4HFRA 3NV9A 5BSFA 2ZATA 4IDEA 1ZJYA 1O6ZA 3TZCA 2B69A 7ADHA 1P1FA 3RFVA 5FFFA 1HLPA 1B7GO 4WLOA 3K9QO 5JXWA 4GPD1 4II3A 4BB6A 2GN6A 1SMKA 2BMAA 2QZ9A 4R69A 1HWYA 2C82A 1H94A 2FOIA 2X6TA 2D2IA 1N92A 1I30A 2CVZA 2Q3EA 1HL3A 3UCXA 4EUFA 5EMHA 3V1YA 5JC1A 3H9JA 4MKRA 4CLRB 3AI1A 3PJDA 1SNYA 1IB6A 1KEWA 1AHIA 2QQ5A 3AUTA 1DEHA 1ZK1A 4D42A 3GN2A 5ITVA 4R1SA 2R6JA 3NT2A 3KRTA 3QLJA 1E7WA 2DBRA 1ENYA 2J3IA 1OMOA 2P2SA 3ZHBA 4J4BA 3VPGA 1D3AA 3PJEA 1X15A 4LGVA 1C1DB 5BSGA 4OMUA 5F5NA 4CLEA 3M2PA 4WECA 3W8EA 4AICA 5A5FA 2WYUA 5A05A 1NQ5A 2OBNA 4HUJA 5DCUA 2EGGA 4U0JA 3ASUA 1P9LA 2TMDA 3E82A 3ZZNA 2WSBA 4YACA 1P45A 4CJXA 4BNHA 1U2GA 4J0EA 3CMMA 4FJ1A 1NAHA 3L9WA 3HWRA 5DF1A 1B16A 4XWYA 2Y0CA 1DRUA 3F47A 1IZ9A 5JMWA 1FF9A 1X14A 4HFJA 3SC4A 4D79A 3CTMA 3EVNA 5CDTA 4RPGA 3S2EA 3ZU3A 2O3RA 2UUOA 2CUKA 2H63A 4HXYA 2C2XA 3U4DA 2VT2A 3C3XA 3LC1O 1ID1A 2HMWA 4ONEA 1YL6A 5G0SA 4L9RA 4M8SA 2OZPA 4LCEA 3I9NA 2IEBA 4HNHA 1I0ZA 1LDMA 1Q7CA 3Q2IA 4WEQA 5DDIP 5B4TA 3K96A 2ZQZA 4GLLA 3GA0A 1CRWG 4YJHB 1FDVA 2BGKA 1PSDA 1QYXA 3VDQA 5FWNA 2AXQA 4DC0A 1DBVO 1MFPA 3ONFA 4CLRA 1N5DA 1ENZA 2JAHA 4GX5A 1LSSA 1WNTA 4R1NA 4RF4A 4EGFA 1T4BA 1PGJA 3BIOA 1VC2A 4QO7A 2YZ7A 4KWHA 4IQ0A 5U9CA 1HRDA 1AXEA 1IE3A 3GFBA 1YBAA 1B15A 1ZNQO 3FCOA 3C7CB 5IAAA 5K9ZA 3Q9NA 2YV2A 4RF5A 2Q46A 5DN9A 1G6KA 1C1DA 4RVUA 4AVYA 1B8UA 3JYNA 3ZI0A 5A4DA 3ZWVA 2Y99A 1UXKA 2FMUA 2QRLA 4IM7A 2B37A 3ICCA 3PI7A 5AXAA 1KC1A 1BRMA 1KBZA 5HA5A 3WFIA 1CERA 1ZEJA 2PK3A 3WB9A 3SXPA 1H93A 3FPLA 3F4BA 4ZGWA 1CQIA 1E7YA 2QIOA 6ADHA 1YQDA 1ZK4A 4BGVA 4I5GA 3WGYA 1DAOA 4CM7A 4YTEA 3UXYA 1H0KA 3DR3A 4R68A 1W8DA 2HKIA 3GLQA 3RU9A 3FR8A 2X5OA 3S2IA 5ER9A 3MOGA 4BO0A 3TQHA 4Q3NA 1PL7A 1VJ1A 2VHZA 3HDHA 1FDUA 1F8GA 3ZWOA 4E5PA 5I8WA 1GCUA 5CPFA 1ZFNA 1VL0A 2O7QA 1KS9A 3HFSA 1U4OA 4GX1A 1PR9A 3VZRA 1P31A 1OC4A 1ZZEA 3U4HA 5A1TA 6LDHA 2NLOA 1HDRA 4RQTA 4UUOA 4I9UA 4YJHA 4DPLA 3RSHA 3O9ZA 4FFNA 4DQXA 4R4JA 3C7DB 1YB5A 3GFGA 3GUCA 4I1IA 1LRJA 3FNEA 3SEFA 4B3HA 1P0FA 5L4NA 4IBOA 3H5NA 3GT0A 4B3JA 1CEQA 4BVAA 3Q9UA 1PL6A 5BQFA 1LDEA 3V1TC 3GAZA 3M6IA 4BKQA 2DFDA 4TQGA 1DIGA 3W6ZA 1YL7A 4J4HA 4A27A 1EDZA 4JX8A 2O7SA 3H9UA 3TNLA 4RPLA 3I4FA 3JYOA 4YWJA 3W4IA 3IL2A 1WZIA 2RBEA 5ILGA 4FFPA 4PLYA 1PGPA 4GAEA 4E2WA 3FTPA 1NQTA 1WMAA 1Z6ZA 1Y6JA 4J4TA 3PEFA 3F46A 5U1PA 1ENPA 3TN7A 2PZJA 4XRRA 3U4CA 4N54A 1NFQA 2DTXA 4D0RA 1CDOA 1ENOA 2JCXA 1G1AA 2ZB8A 2YUTA 2CDBA 4XX0A 2NADA 2Z5LA 1W6UA 3PP8A 4N5LA 5BNFA 5EJ2A 1RM4A 3I9LA 2EWMA 4FJ0A 3KZVA 4AL4A 4CUZA 1YBVA 3E5RA 3I23A 4GMFA 3PLRA 3GDFA 4MIEA 3R0IA 4XDYA 4AJLA 1GR0A 1NWHA 1NR7A 1JAXA 2C7VA 3EYWA 5IN4A 3IS3A 1V9LA 2D8AA 3GEGA 2VZ8A 1LU9A 3SJUA 4EITA 5KKAA 3ZU2A 4YAGA 1R4NB 4FFLA 4WCFC 4CODB 2ZJ1A 2AG5A 3LT4A 3PQFA 4BO8A 1F0YA 5KJ1A 4WUVA 3QWHA 1VRWA 3UVEA 1E7RA 1B8PA 4YT4A 2Y1FA 1LUAA 1TT5B 3ST7A 4BIIA 5BT9A 4FGWA 4RGBA 3ZWAA 4XRGA 3KETA 2DBVO 4BO6A 2EKQA 4IQGA 3A9WA 4JGBA 4CQMD 1MC5A 1IYZA 9LDBA 2VRCA 1UH5A 3DBVO 5IDWA 4LISA 1W73A 4PLVA 4XZ3A 3TDKA 4F46A 1E1NA 5KVSA 3V1UA 3JD4A 1A4UA 1E7MA 1LX6A 4J1NA 4DWVA 2YDXA 3F4LA 1ZVMA 4CQMB 3M1AA 1QYCA 2CMDA 3DBLB 1YOVB 4WK6A 4DIFA 2W90A 1XU9A 1H6CA 4D3SA 3DAPA 3STHA 5B4VA 1ZUD1 3FBTA 2NACA 1Z75A 1G0NA 1T25A 4FSHA 4LVUA 3IJRA 3VC7A 3JSAA 1XDWA 4Y98A 1NTOA 2DLDA 1PJ2A 2HQ1A 2NQTA 1NASA 2O2YA 2VN8A 2C07A 1Y9AA 2X4GA 1JDJA 3GN1A 1CQJA 3JYPA 4NQZA 4FIZA 5DULA 3RFTA 3BHIA 3MJCA 1NYTA 3COSA 4PCVA 1I2BA 3BTUA 4NJMB 1NQOA 1QG6A 1RM3A 2P9GA 3BMNB 1R4NA 2FSVA 5THKA 5DCYA 3WGGA 1UXHA 1HE4A 3VKVA 3CZMA 4FS3A 4KDEA 3UW3A 4CQLB 4KWIA 1CWUA 2V6BA 3WGQA 4CMGA 1DHTA 1EDOA 5DT9A 3WIEA 1UZMA 1WDLA 2Q1TA 4E13A 3G49A 3KO8A 4EZBA 1ONNA 1TT5A 2QYTA 4H16A 4EI2A 8ADHA 3TJRA 1LC3A 4M86A 3E9QA 3PIIA 4OJNA 1FMCA 4TSKA 4TVBA 3CMCO 3OETA 2P5UA 5JLAA 4TZTA 5CAEA 4J2HA 4LN1A 5JE8A 3WOHA 1AE1A 2A4KA 3QVSA 1LRLA 4MVJD 1BDMA 2BI7A 1MXHA 5F3RA 1JA9A 3ROMA 3C1AA 5AQ1A 4B4OA 5F21A 5JDIA 1NVGA 1VL6A 4E5NA 3PHIA 3RROA 3OJOA 4CQMA 4IGFA 4YA6A 1A4IA 1UP6A 4NHEA 3DBLA 3RC9A 1YOVA 2NUAA 2P9CA 3FF4A 4YYZA 3INRA 3ZV4A 2AEJA 2OP0A 2O2SA 3A14A 5G0UA 3LQFA 3N74A 3RBXA 1ZCJA 4HP8A 4JQCA 4CM5A 2HLPA 3T4EA 1VKNA 1NFRA 4U5QA 2FPGA 5FF9A 1O5IA 4BV9A 1PTJA 2YV1A 5JDCC 2IZ1A 2Y1CA 3QVXA 4Q3AA 1NM5A 1Q0QA 4NFSA 3JQBC 3T7EA 5KVCA 1PJ4A 3DMTA 5KKCA 3GHHA 4JBGA 2CDCA 5DBIA 4L0QA 5FEUA 3MJSA 1N9GB 3O8QB 1GY8A 4NJMA 5DNAA 1SCUA 2POQX 4BNIA 3BMNA 2GDZA 4GBJA 3PVZA 4OSOA 5JO0A 1F06A 4CQLA 4GWKA 4LVCA 3NTOA 2FPIA 2V6GA 1C14A 4I5FA 4WEOA 1YBMA 2PY6A 3FD8A 2Q2WA 3WFJA 3JQ6A 4CPDA 1XQ1A 1R16A 3AJRA 5A9SB 4TRMA 4XJTA 4K26A 2ZB3A 3A1NA 1LTHR 2I3AA 2HMTA 4BNNA 2C7GA 3PIDA 4J6FA 4EW6A 3RVDA 1E1LA 2WE7A 5KWEA 5GY7A 4Q3EA 3HB5X 3DFUA 1BW9B 1TB4A 4TRNA 3MOIA 1JTVA 2WWRA 3CPSA 4FPXA 3AI2A 4OH1A 1XQ6A 1DSSG 1ZK0A 1R37A 2C20A 2GNAA 4I9HA 4DYDA 4A03A 1VM6A 1PWZA 3H5RA 5L3ZA 4XDZA 3GMDA 3NKLA 3NEPX 1KY5A 4RDHA 1YS4A 4IDFA 4R5HA 4Z0PA 2JCYA 4IMRA 1EE9A 3AWDA 1UAGA 3NDIA 4PGFA 1E77A 4HWKA 3ETEA 4QT0A 3QIVA 1YDWA 2WMDA 4MO2A 4ND2A 4CMKA 3IP3A 3I6QA 4D7AA 5KCZA 2AQ8A 4E21A 1LJ8A 1U5AA 4RLHA 2J5KA 2EW8A 1OAAA 1Y8QB 1WXDA 1N9GA 1T2EA 3O8QA 1EBUA 1A7AA 1Y81A 4ALMA 5JAMA 3EZYA 1LBEA 1CETA 2D59A 3WNQA 4CL3A 2FP4A 3KYBA 4Z0TA 3ZW9A 3LDHA 4QUKA 3WLFA 3BTSA 2Q2QA 1JQBA 4XR9A 1H5QA 3OJFA 4ZQHA 1EZ4A 5A9SA 2A9FA 2PH3A 2VYVA 5L95A 2JAPA 4GWGA 2X1HA 3A4VA 4YRDA 3D3EA 4FFOA 5A3JA 3RJ9A 3DHNA 3H9GA 2OP1A 3B1JA 1DDOA 3VOSA 1DHRA 3I9OA 1HKUA 2O23A 1PQWA 2P4QA 2VHWA 3EZLA 4GLOA 1T1SA 1BW9A 1EK5A 1IUKA 1G0OA 4UUPA 4GVLA 3OJLA 4IINA 4IPTA 2VYND 3I1JA 2NNLD 3B1KA 1YQGA 3OQ6A 4ZICA 3RUIA 1SO8A 4BNFA 5GZ3A 5EQFA 4WPGA 4JJFA 2Q4BA 1JWAB 4IUYA 1XLTA 1H2BA 1HYGA 4GKBA 3ZNQA 3QRWA 4O6VA 5HRUA 1RYDA 4CR8A 5KOIA 3Q2KA 4AJHA 1JW9B 1DLJA 3KYCB 3WBBA 4R51A 4XD2A 2JHFA 4Q39A 2EV9A 2VOEA 3OQ1A 3VPFA 1KVQA 4TRJA 4NNJA 4NI5A 1ADBA 3G0OA 2PTGA 1C0PA 3PGXA 4HNGA 3E6AA 1IHXA 2BF7A 2C59A 3K2BA 3JQ7B 1IOLA 3G1TA 1Y8QA 3FPCA 2X0NA 2ZKLA 1PZEA 2AA3A 3OQBA 1O89A 4DL9A 3BA1A 4XJSA 1H6DA 5AXDA 5J23A 2Y1DA 4P4LA 3TSCA 1MC4A 5CDUA 3DZBA 5HM8A 1LLCA 4OM8A 4YT2A 1CIVA 4BNMA 2O3TA 4IZIA 1WW8A 1SEVA 4YT8A 4CUKA 3IJPA 2B4RO 3WJ7A 3HE3A 4GGPA 1NPDA 3L4SO 2Q2VA 1UDCA 2GZ2A 2FHSA 1AXGA 4CLOB 4E30A 3JYLA 1Z82A 2AE2A 4DBZA 5G4KB 1O94A 3WX0A 2CF6A 1X0VA 2J8ZA 3K73O 4O1MA 5T5QA 1ZO8A 3PYMA 2O3QA 5JAIA 1MV8A 3QWAA 4B4VA 2X0RA 1J4AA 2QRJA 1Z7BA 4BUCA 4BKOA 1EFKA 3DC2A 1HSZA 3TF5A 1ZSNA 2BFPA 1IY8A 5FI5A 3Q6IA 4Z6KA 3CINA 4JP3A 4I9NA 3E8XA 4DVJA 1SAYA 2Q49A 3GVXA 2VYNA 4UAGA 3TPCA 5BNTA 5TIIA 4AJJA 4RPKA 4Z9YA 4DIOA 4J90A 2Q50A 3VTZA 4CV3A 1TVEA 3KYCA 3VH4A 4YAEA 4Y6PA 4K9DA 4BMSA 1E6EA 2C5AA 2IZZA 2EEZA 1KVTA 4P4NA 1MLDA 2WM3A 4J1QA 4P8RA 1EK6A 2E82A 2FR0A 4RPHA 4MOWA 4Q9NA 3I52A 2CY0A 3LVFO 3S2GA 2NVBA 3ETGA 3JQ7A 3FHLA 1RJWA 1OBFO 2PGLA 3GAFA 3ZNNA 4B8WA 3WSVA 2D1YA 1A72A 5JY1A 5LC1A 4IS3A 2O50A 3R1IA 3RIHA 2UV8A 2PKQP 3FR7A 3H65A 3K92A 4XYGA 3WYBA 3TFQA 2WD7B 4NBVA 4WE3A 3I6IA 1X7GA 4UVEA 2XOXA 2QRKA 1C0IA 5IDXA 5CEFA 1MFZA 5IZ4A 4IXTA 1LXCA 2IEDA 3ZW8A 3JD3A 4JBHA 3GOHA 1HTBA 2Y66A 2I76A 1A5ZA 1RKXA 2PV7A 2C54A 3K6JA 3AY7A 3OMLA 4XR4A 3V2HA 4CLOA 5KNLA 1FDTA 5G4KA 4B3IA 4DGSA 2FWMX 2P5YA 1XHLA 1P77A 3DZIA 4F3YA 5AOVA 4U6QA 3ANNA 4CR6A 4IJWA 3JQ8A 1E3WB 3JQGB 3WMWA 4DC1A 5ILOA 3GVCA 4BNGA 3OP4A 3I83A 4FW8A 3O26A 4F45A 3RAJA 1DRWA 3PLNA 1DIBA 4RV9A 3PPIA 3PQEA 4R9RA 4RVFA 4OKNA 3L6OO 1WVGA 5HWSA 1RM5A 3WTBA 3RJ5A 5JY6A 1M6WA 1S6YA 2OOSA 4NBUA 4CR7A 4BNYA 3EK2A 5IFLA 1BG6A 3ANMA 2HCTA 2EIHA 3H6KA 4BNXA 3HHPA 3WS7A 1WP4A 1NPYA 1VJ0A 4WLNA 4J7CA 3GVIA 3GNTA 1UAYA 2BGLA 2V7PA 3DQPA 3LSYA 2V6FA 3GH3A 1WAMA 1DB3A 2BELA 2JFHA 1XELA 1KERA 5KJ6A 2B4TO 5EESA 3H3JA 4YJFB 1KEUA 3CE6A 2W8ZA 4WJZA 2EP7A 2WD7A 2Y67A 2VUTA 4BGIA 4TKMA 1P0CA 4TWRA 3AOEC 1PZFA 2YFQA 3R3JA 1GU7A 3KM0A 3NJ4A 1V35A 3GY0A 4R54A 4BO4A 1XSEA 3ONDA 4PLZA 3CXRA 2Y1EA 4BOYA 1ISGA 1SZJG 1VJTA 3DB2A 4YAJA 5C37A 1HT0A 1E0DA 4CM8B 4IDBA 1HE3A 4LK3A 1Q7GA 4C7KA 2IODA 4YRBA 5G2OA 2DPGA 1E3WA 3JQGA 3SVTA 2B83A 2JJYA 4XA8A 5ITWA 2QX7A 2ZB7A 4S3MA 4I08A 4DPKA 1SBYA 4RVHA 1QKIA 1X7HA 5I7SA 1R15A 2O3UA 2J3KA 4KUEA 1GL3A 2CF5A 1E6WA 3WLEA 3DOOA 4EUEA 3RUEA 4MVJH 3ZWBA 5JBIA 3WGIA 1JLLA 3AUAA 5JC8A 1U2DA 3GVPA 3RD5A 3ULKA 3GNQA 4PLTA 3TZKA 2FRDA 4CM9A 1DIRA 3HDQA 4R5MA 1PJTA 4GSKA 4BQRA 1GTMA 4MVJG 4PLGA 3O03A 1LRKA 3JQFA 2ZJ0A 3U9LA 4A73A 5BNIA 4YJFA 3AM5A 2R2GA 2Y0EA 1V8BA 1ZEMA 4MVJM 4IGEA 3ICPA 3EHEA 4ID9A 2A94A 3VKUA 1D8AA 4FGSA 3S55A 2IYOA 3GEMA 2OGUA 3ON5A 2ZCVA 1T4DA 2EJWA 1DLIA 1TA4A 2FN7A 4PVCA 4J1TA 5TT1A 4CMJA 4RJTA 1IULA 2NVWA 5JSFA 3S1LA 1BVUA 3ITKA 3TRIA 4CM8A 4OSPA 1WLYA 3G1UA 1LLQA 3H9QA 3Q1LA 5EL0A 1ZXLA 3EVTA 4LRTB 3JD0A 5B12A 1N8KA 3GK3A 3DWFA 1M6HA 3IDSA 4NG5A 3R6DA 2VRCD 4B4UA 3JV7A 1C1XB 1YB4A 2UUPA 5A5EA 3ZWMA 2DBQA 3I9JA 3RI3A 2RHRA 2ZYGA 2H5LA 5L7TA 1W4ZA 3U3XA 1M2WA 3F6YA 3W4JA 4Z3KA 3ZWYA 2AQIA 2OL4A 3F9IA 2YQ5A 1LC0A 1HE5A 4TZKA 5JDIC 5MGBA 4ALIA 1WZEA 3D4NA 4OYRA 3PYXA 5C7LO 1HF3A 2JFGA 3KSUA 2QZZA 4J9VA 4DRYA 3DMYA 1U9JA 4N5MA 4NDNE 5IDYA 4DLBA 2VZ9A 4E2XA 1BXKA 4MP6A 5DOZA 1I10A 4TRRA 1SC6A 4IQ8A 1B2LA 3U0BA 3AUUA 2ZTLA 4AJ2A 2JD1A 4ZQBA 1U7HA 3HN2A 3DHEA 1PR3A 4O59O 4OIMA 5GZ6A 1SOWA 3C1TA 2CNBA 3PWSA 1LQTA 1LDYA 2GZ3A 3VPSA 2PA3A 4E5MA 4DMLA 1UP7A 4PIVA 4RQUA 3DMTC 1SB9A 1VPDA 4QEDA 3GZ4A 3MCVA 1BMDA 4ND4A 3ZWXA 4OHUA 3AOEA 1I5RA 4R1UA 1YE3A 3L6EA 4ZRMA 1YRLA 3H8VA 1L7EA 3OA0A 4UVIA 3OIGA 1XR3A 1LLUA 4PLWA 1Q1NA 2DFVA 1T1RA 4G81A 2DVMA 2PH5A 4J7UA 5IZCA 4YXFA 4DLLA 3ZV5A 4Q3DA 4CV0A 1QYVA 4Z0HO 4L74A 3FRJA 5I9NA 4ALKA 4W9NC 3UCEA 1C1XA 4DXHA 2GCGA 5L4LA 3LT2A 4PG7A 3EAGA 4YQZA 2P91A 4IZHA 3H7AA 4R16A 1B8VA 3EC7A 4PZCA 2GRAA 1Y8RB 3RFXA 4XGIA 4E31A 3ADOA 1YKFA 3HFGA 2VHXA 2P9EA 4AJOA 5ICSA 4UREA 1BWSA 5A02A 1U5CA 2PZLA 2Q1SA 4QTZA 4RPJA 4W7IA 3ZCXA 1GCOA 2PLAA 3WYEA 1I3KA 1B26A 1P33A 3D7LA 1PS0A 2YHUA 4ZQEA 4WNCA 1V6AA 1DFHA 4ZVVA 3WICA 2JHGA 3AW9A 2RCYA 4P4GA 5TJHA 3M1LA 1KY4A 5AXCA 4BO7A 3RUFA 2W98A 1BXZA 5IN5A 4RVSA 4ILKA 4O63O 2Y1OA 4S1VA 1ARZA 1GV1A 4BNLA 3QVWA 5F1KA 3WDSA 4NK4A 3ZV3A 3DZHA 4OXKA 2C0CA 2DC1A 3DZKA 1EMDA 1ZSVA 4PG5A 4Z3DA 3UH1A 3ZDFA 1H6BA 4AJ4A 1MG0A 1VSVA 5AYVA 1Y5RA 1PQUA 1L1FA 3K8ZA 4URFA 1JKJA 1A71A 3AY6A 3BHJA 4GL4A 1HE2A 3ZGYA 4MINA 1PWXA 1PEDA 2P68A 2YFHA 5DCWA 1GZ6A 5EINA 4QSMA 3PHJA 4Y6RA 2JKVA 4XYEA 3ZNOA 3DAFA 2CD9A 3MZ0A 1FDWA 2DUWA 3VZQA 4XYBA 1A27A 1QXSA 3EMKA 4LSMA 5COAA 3W8DA 4CLHA 1I2CA 3T7CA 1I3MA 1UDBA 1B3BA 1WDMA 2TMGA 3NT4A 2SCUA 1P74A 1QV6A 5L51A 2I65A 3GGOA 3LF1A 1Y8RA 3PK0A 2DQ4A 3N58A 1GUYA 4HFNA 5T8KA 4BGUA 2VWGA 2B0JA 3KOUA 2HJRA 1UZLA 3MWEB 2YYYA 2CVQA 3VH3A 4A7PA 2JFFA 4ALJA 2RHCA 2AEMA 3V8BA 5GZ1A 1PQPA 4PLPA 2XXJA 2YDYA 3L9XA 2J3HA 1NHGA 3L4BC 4UEOA 4IMPA 3RC2A 2DPHA 1JAYA 1L7DA 3KUXA 3PZRA 5ENVA 5TSDA 4CM6A 3JYQA 1PZHA 3BTOA 3V2UA 3KSDO 4PG4A 2FZWA 3OEWA 5LCXA 3ZNPA 1ZKMA 3WGOA 2NVUB 2EG9A 5JYDA 3CKYA 3SLGA 3ZHXA 4CMAA 4ALLA 4RF3A 4JLWA 2IDZA 1NWCA 4FQ8A 4D41A 3D0OA 3G17A 4NZ9A 1GPJA 2ZTUA 5DBFA 3U09A 4N18A 2HUNA 4B8ZA 5U4QA 2CSUA 1C0LA 4Y8VA 4EDFA 1IPFA 5H82A 3CIFA 3QJ5A 1IZ0A 5DP2A 5THQA 2RH8A 2VYVD 4OXNA 3ZN2A 4R01A 3AI3A 2ZCUA 4F6LA 4NBRA 4XQ9A 4WOKA 4IIUA 5A3VA 1YGYA 3UKOA 4IDGA 3F3SA 2GUGA 2R00A 3PJFA 4WOJA 1J5PA 1O9BA 4O0LA 1BGVA 4W9NA 4JK3A 3PQDA 1D4FA 5COQA 4B7UA 1O95A 3ABIA 3D5TA 4BNJA 3GNSA 1DFIA 1PX0A 3AY3A 5L40A 3RUDA 2OUIA 2BI8A 1XA0A 1K3TA 1UDAA 3TZQA 1UZNA 3GDGA 5EIOA 4B7XA 4BNWA 2O3JA 3LLVA 2CDAA 1VI2A 2JD0A 3KSZO 3MJ4A 3PDJA 4J0FA 3C8MA 2A92A 2GPTA 2Q1UA 4DA9A 1KOLA 2DAPA 4YDRA 1LDBA 2WD8A 2X5JO 1JKIA 2HO5A 4L4SA 5GMOA 1E7SA 2DKNA 5EN4A 5K6AC 3P7MA 4ITUA 4HY3A 1E7QA 4NR0A 3DL2A 1HDYA 3C85A 2NVUA 4BNUA 5CPBA 3ROPA 3HQ4O 4BO9A 3I4CA 2EW2A 3VHRA 3W4KA 1PGQA 1H9AA 2ILTA 1T2CA 2EJVA 1NX6A 1TLTA 3IOYA 4EJ6A 5JAZA 1RPNA 5L7WA 4JNKA 1U8FO 1WPQA 2DT5A 1Y5MA 4ND3A 4BV8A 2ZYDA 1MB4A 2G82A 3DO5A 3E48A 5T64A 2D5AA 4PG8A 5CDYA 3IKVA 5TC4A 3BMCB 3ORFA 1JKFA 2X23A 1M76A 5DP1A 2HJSA 3DHYA 4ALNA 3W8FA 3H4VA 4FOOA 4N5NA 1S7CA 3NGXA 4PG6A 5ER6A 5B1YA 4KTTE 3PZBA 3IIEA 2HK7A 1OOEA 4W6ZA 3CSDA 4JP2A 4MIOA 4UUMA 3TFOA 1ZXBA 4A10A 1P44A 4ZJUA 3GHYA 3I3OA 1DJQA 3MWDB 2HMSA 5BSHA 1GQ2A 4U8GA 3QP9A 2NQ8A 1F8FA 4EEZA 1BSVA 4IY1A 2C29D 1A9ZA 2X8LA 3UOGA 1M66A 4CV2A 3PHGA 3EGOA 1DC4A 2EXXA 2EKPA 2GD1O 4QFDA 3OA2A 2HRBA 3ZU5A 1NR1A 2HAEA 4IIVA 3KEOA 4LRSB 3FWNA 3VTFA 1BTOA 2CFCA 3GC6A 4M1QA 1I8TA 3L4BA 4BGEA 4Z9XA 3S8MA 3X2EA 1AHHA 1I24A 3OJEA 4UUNA 3TWOA 1KVUA 5L9AA 1DPGA 2EERA 2HK9A 1GYRA 5KTKA 4CMBA 4R9SA 2VRBA 2W2LA 3FNFA 5TJ9A 1N2SA 2P4HX 4NPCA 2VUUA 4AJNA 4E3ZA 1PL8A 4BS9A 4OGWA 4EJ0A 1ZK3A 2DBZA 4QXMA 5T6BA 3ZWCA 4XYMA 3WMXA 5HS4A 1ZBQA 1DOHA 4RCVA 4WCDA 3VH2A 4JBIA 1YJ8A 5L7YA 5F5LA 1U3VA 2Q4EA 3NGLA 2A35A 1I01A 4KQWA 1DO8A 3BMCA 3DZGA 3KHUA 3G79A 1H9BA 2VHYA 1ONPA 3QWBA 2EKLA 3OJ0A 4L8VA 5HBRA 2PKRA 1SOVA 3HDJA 4C7JA 1NQAO 4J1SA 3SX2A 2FPPA 4XQCA 1UJMA 2O4UX 4Z9FA 2V6MA 3LT0A 3NYWA 3RASA 1JVSA 3UHAA 3MJTA 3KXDA 3E9MA 2I3GA 3GQVA 3ROKA 3L0DA 4RORA 1U28A 3QA9A 4JXKA 3JQDA 3PYLA 4IXWA 1J49A 1ONOA 1M75A 4J3FA 1ZSYA 4BMVA 1U3WA 1PS8A 3DFZA 1R0SA 1K5HA 4CV1A 3GR6A 1F14A 1I2ZA 4BKRA 3H3FA 4AG3A 2WJPA 4R3WA 4LMPA 3H2SA 3BMOB 5TF4A 3BHMA 1LLDA 1K89A 1UR5A 5ENDA 3GPIA 4HFMA 4BNKA 3WGZA 1JU9A 4MP8A 2FY8A 3VDRA 5JS6A 4L76A 5KJFA 4NU6A 2W2KB 4P22A 1DRVA 1VE9A 2VUSA 4MPDA 3CH6A 3GMSA 4CMCA 4EYEA 2YY7A 4YB8A 1GADO 3W6UA 3KB6A 1SB8A 3M2TA 1QLHA 3JTMA 4XQGA 5K6AA 1ZIDA 2YV3A 4QX6A 1GEEA 1AUPA 3WIDA 1XWFA 4K28A 3ROQA 4PZEA 1QV7A 1MXFA 5G0WA 4R41A 4J16A 1PJSA 3AU8A 2V65A 3QHAA 2UDPA 2X7HA 1V3UA 3JQAB 4UVDA 2OBYA 3EUWA 4OOFA 2C2YA 1K6IA 5LDGA 5TLSA 5CHEA 4EEXA 3JQFC 2GLXA 3ZWNA 1I33A 3C24A 4DUPA 4IS2A 1PJCA 5I7VA 3INGA 5F1PA 4CMEA 3D5QA 3QW2A 3SC6A 3E18A 1EVJA 1R0LA 3SBOA 4J91A 3NT5A 4IJVA 3PRJA 3ONEA 3U62A 5IF3A 1K6XA 3DZFA 4W4TA 2J5RA 4BO1A 2B5WA 2PKQO 1EQ2A 1OI7A 1DIAA 1C0KA 2FR8A 4YAIA 1P1KA 1AN9A 4CMIB 5G4LA 1B14A 2AG8A 3FN4A 3GGGA 3HUDA 2C5EA 1LEHA 3VZSA 4ESOA 1QYWA 1XU7A 1X1EA 4FC6A 4MVJE 5TT0A 4ZU3A 3IQDB 5C7IO 1U8XX 1BXGB 3GVHA 3QVTA 1OFGA 3C1OA 3GRKA 1PJBA 1UXIA 4B4WA 4DMMA 2B35A 2GO1A 2QYSA 4FD3A 3Q3CA 2GN9A 3D4PA 3WBFA 4D3FA 3RUHA 2I99A 3GG9A 2Y05A 3R3SA 3UAGA 4K6CA 5JYEA 1ISMA 4J2OA 3BMOA 3PXXA 1HZZA 2UVDA 4YAKA 1Z7EA 1LDNA 5T57A 3TZ6A 4J7XA 4CLXA 4E5KA 1HXHA 4Y9DA 4D44A 1PGOA 1I3LA 2W2KA 4XIJA 4CM9D 3QWFA 4WNIA 1UUFA 1ZH8A 4KDFA 1YVEI 3NUGA 3RUCA 1WDKA 1TI7A 3K5PA 4IJKA 2H6EA 3ZV6A 4CMHA 3JQAA 3LK7A 2UAGA 3AM4A 4G65A 3WGTA 2IYPA 1EUZA 2ZK7A 4YEDA 4BKPA 2NSDA 3P5SA 2AHRA 2VQ3A 4I5EA 4OL9A 3L07A 4R3NA 3FNGA 1DJNA 4NFYA 2VTEA 3H9EO 5JFOA 2CVOA 3H2ZA 1ZK2A 3D64A 3VZPA 2RAFA 3A28A 4PVDA 5JCJA 2X9VA 5A03A 1U7TA 4KZPA 4CMIA 1PS9A 5DBGA 2G0TA 1PJ3A 2E49A 4FJ2A 2JCVA 4IDCA 4DREA 1M67A 1GUZA 3D3WB 3ZHYA 5IZCC 2ZB4A 2UYYA 4YJGB 1BXGA 2XPCA 4RL6A 3OICA 4LCJA 4M49A 4TKLA 3ZH2A 4WASA 5CEJA 1FJHA 4PZDA 4D46A 2EP5A 3DTTA 1U1IA 1Z73A 2GGSA 2VCYA 4HKTA 1P1IA 3NTQA 1Q0LA 2NTJA 5A9RA 4OQYA 1YB1A 3L6DA 4DQVA 5HTOA 4MJLA 4BO5A 3F1KA 3BAZA 4HV4A 5BSEA 2PWZA 5ES3A 1NPTO 3IUPA 1O8CA 3LYLA 5IG2A 2QW8A 1GZ4A 2WTBA 3CUKA 1T26A 4M89A 2RH4A 4GQAA 1WWKA 1KC3A 1C3VA 4A2CA 2X0JA 3U5TA 2XAAA 4BNVA 2AW5A 3INTA 4OOEA 2Z1NA 3DZJA 3JD1A 3I5MA 4NFHA 4WLEA 1R4MB 3VVCA 4GMGA 3UF0A 1DAPA 2GASA 5KVQA 4ND1A 1EUDA 1XIVA 9LDTA 4XEHA 5L4SA 2D0IA 1X13A 3CZRA 3UGKA 5A9TA 2X9GA 3JQ9C 3QQPA 4MKZA 1LNQA 4DTIA 3HJAA 1E3EA 1LSUA 3JQEA 3HDYA 4BHTA 5CDSA 5I9LA 1GZ3A 4PRLA 3LU1A 1KETA 4G5HA 4RZIA 4FC7A 3TL3A 2VT3A 2Y0DA 4J9UE 3UFXA 2O4CA 2NV6A 2ZIZA 4II2A 4RZHA 5H83A 5CEEA 1EFLA 1V3TA 1ZMOA 1GYPA 1W0CA 3RC7A 3D3WA 2WEKA 4YJGA 1GFSA 1N1GA 1JN0A 5KIAA 5AXBA 4OO3A 5ADHA 2VTDA 1R66A 3WJAA 4A26A 4MP3A 4O5OA 1D7OA 1PU2A 1ADFA 3LLSA 3PWZA 1XEAA 2NTVA 1YXMA 1VSUA 2PGDA 3GG2A 3L77A 4I8XA 4Y6SA 2ZTMA 3FTNA 2I5PO 3OFSA 4IJUA 4L73A 4M54A 4DIBA 1V3VA 1FDSA 4R1TA 1IL0A 2WYVA 2VWQA 3VH1A 3DOCA 5T8KC 3D4OA 3WG9A 2AEFA 1E3SA 1PZGA 4BQPA 1YH3A 3LC7O 4UVHA 2BFOA 3KLPX 2GN8A 5KVVA 3WNVA 2VOJA 3QSGA 1ISFA 3IUSA 1H6AA 2B5VA 2JD2A 1ISIA 2YQ4A 3PWKA 1I3NA 8LDHA 4LSWA 1R4MA 1RWBA 1YL5A 3OH8A 5JAQA 3ZHZA 3ZU4A 4I5DA 4FB5A 2X58A 4N7RA 1B0AA 1T24A 1QRRA 5B37A 2GR9A 4M55A 3IAHA 3LF2A 2FR1A 1E1MA 2D4AA 1Y9EA 3QY9A 1LA2A 1ISHA 1LSOA 2PD3A 2XF8A 1TXGA 2VNAA 4Q3CA 3ETDA 3WTCA 1PIWA 3PFWO 5B4UA 5C5IA 3B1FA 5JW6A 3VAZA 2IXAA 3NTRA 1NP3A 1DFGA 4L4RA 1I36A 4TMFA 4DYVA 2D5CA 4IDDA 1QSGA 4NJOA 3WWYA 4E33A 2IZ0A 1FK8A 1XG5A 2BKAA 1Q2XA 4NBWA 4YQYA 3RWBA 2R00C 1E1KA 2CZCA 3KVOA 2AQKA 5I8ZA 1UXGA 1MX3A 2Q1WA 2NTNA 3P2OA 3D1LA 1E3IA 1EVYA 3ZWPA 5IXSA 4YCAA 4WLFA 4CM1A 4E2ZA 5CDGA 1F17A 4YRAA 4LMRA 1EE2A 3E9NA 1GYQA 3RC1A 1PGNA 3DONA 1P1RA 4C4OA 2BH9A 1YQXA 1ORRA 3NX4A 4JIGA 4YT5A 1IPEA 1LDGA 4E4YA 1NAIA 1HYHA 3OIFA 2VHVA 5EPOA 4TROA 3LZ6A 4H15A 4UEJA 3WSWA 4E2YA 3V5NA 4DPMA 4ZHSA 4GX0A 4E32A 3E03A 1H2HA 4CL8A 4KMSA 1NFFA 1WMBA 1A9YA 4E5YA 4ZN6A 3HNPA 1MG5A 1NXQA 4MIYA 4AJIA 3TZHA 2OO5A 4NMHA 1Q7BA 3OBBA 3PHLA 4XIYA 5G0VA 1CJCA 1KVRA 4PLCA 3VPHA 3HZZA 4MVJF 4K1LA 5C7OO 1VL8A 3OF2A 1DC6A 2GERA 4AJ1A 1N7HA 1MGOA 2Y1GA 3JQ9A 3KBOA 4NBTA 1HDCA 5C3MA 3OECA 3SLKA 1OZAA 4DQUA 2GF2A 3V2GA 4M87A 2O3SA 1GEGA 1NNUA 3FWZA 3ZWWA 1ADCA 1GUFA 4JN6B 1SPXA 5I7EA 2X0IA 4HADA 4U0KA 3AFNA 4XKJA 5FYDA 3B70A 2HDHA 3KEQA 2PGJA 3GPDG 5F1OA 2ET6A 4QFCA 4WLVA 2DTDA 4OQZA 1U4SA 2BFMA 2DM6A 4FR5A 4D45A 3QWIA 3TOXA 4ZQFA 2ZTVA 4YPOA 1KIFA 1XKQA 1RM0A 3HB4X 4GVXA 3KLMX 4FBGA 2JL1A 5K0ZA 1R12A 2DU8A 5CP8A 1PJLA 1DIHA 5T67A 4FFMA 3EW7A 3AFMA 3OIDA 5DZSA 4B79A 4MDHA 1YDEA 4XB2A 3C7AA 1YJQA 3DBHB 4JJGA 1T2FA 1N7GA 3RBZA 2HRZA 1QR6A 4A5OA 1HDZA 1PJQA 1VLLA 1Y7TA 4ZA2A 2GN4A 4BNZA 4WCFB 3AOGA 2B36A 5AVOA 2PD6A 3MJVA 1LSJA 3DAGA 2G76A 4W82A 4CM3A 2FSSA 5KJCA 3HG7A 3H5AA 3MJEA 1U3UA 3W1VA 3UN1A 1R0KA 1GQQA 1DC3A 3G3EA 4UEKA 1EQUA 1GPDG 5IJZA 4KTVE 2BHLA 5TS3A 3IC5A 4P38A 1JWBB 1QMGA 3OM9A 3PTZA 3RU7A 3NJ8A 3EDMA 2D3TA 3LC2O 4D3DA 1NBOA 5HS6A 2Z1MA 3WQSB 2DUUA 5JMPA 2WDZA 4MVJI 1P3DA 1GQYA 3FNHA 3HN7A 1JVBA 1T2AA 4WGGA 1ISJA 3PGJA 4FFRA 3FBGA 2I67A 1X1TA 4BMNA 3ADPA 4BO2A 5L53A 4HX5A 1HETA 1ML3A 1RYEA 1V0JA 2WE8A 4DBVO 2IXBA 2X5KO 3U4IA 4PN3A 4FCCA 3F1LA 5JPIA 2XXBA 5IDQA 4RVGA 1E5LA 3RCBA 1LQUA 3NAQA 1U3TA 4KOAA 2QG4A 3F5SA 3UCFA 3E5MA 3PJGA 5G0TA 1E3LA 1LI4A 4CLDA 3AUSA 1P1HA 1Z74A 3DEYX 1QLJA 2Q45A 3DBHA 3I9MA 4NU5A 1BVRA 3VVBA 3WXBA 4PFJA 1Z45A 2E6UX 2NU8A 3T4XA 3QVOA 1NVMB 3UICA 5TRTA 5JCXA 4L4XA 4WCFA 4H3VA 1ULSA 4QO8A 4U6SA 4PLFA 4DLAA 1T2DA 2AQHA 3RBVA 3BYZA 2W2LD 1AGNA 4WLUA 5TX7A 5FI3A 4L75A 2PD4A 4UVGA 3FSRA 3BTVA 2AE1A 3P2YA 3GZNB 1MUUA 4XQEA 3U49A 2GSDA 3DDNA 1FXSA 2IRWA 3DOJA 3MTGA 2VZ0A 5IXYA 5EQDA 3HSKA 2OXIA 4XYLA 4GI2A 1HLDA 2OORA 3HADA 1GAEO 2VWHA 4XGKA 3A06A 2HU2A 5TGDA 3GGPA 5ICMA 1HEUA 4BO3A 2G17A 2QHXA 4CMEC 3B6ZA 2GYYA 4MVJA 3DBRB 4K6FA 5KJEA 2YJZA 4GGOA 4ZD6A 3KV3O 3ITDA 3NDJA 4JCOA 1NVTA 2LDXA 3BMQB 4LW8A 5CG2A 4QQRA 1QP8A 2PR2A 1MA0A 3WWZA 1I32A 1DXYA 3I9KA 4NK5A 2VWPA 3X2FA 1KYQA 3Q0EA 2X9NA 4KP7A 2PZKA 2IE0A 1XCBA 2E48A 1TEHA 3OEYA 1EVZA 2H1SA 4RF2A 3KYDB 3ENNA 3RQSA 3OHSX 4GX2A 1YONA 4E0BA 2OMEA 4ND5A 3BXXA 4OXYA 3AK4A 2J3JA 2I6TA 2WYWA 4ZRNA 1TT7A 3JD2A 3O38A 2AMFA 1ADGA 4RDIA 4RLSA 4INAA 1D1TA 1P1JA 1HDGO 1CF2O 1GDHA 3VPXA 1HDOA 1HYEA 2I9PA 1B3RA 4NIMA 3FI9A 1EVIA 1X7DA 3GZNA 3QV1A 5TNXA 2X22A 4ZQGA 1YO6A 2ZQYA 2BGMA 4XB1A 4JROA 1NHWA 3PFFA 3UUWA 5DOVA 2YHIB 1EBFA 4CM4B 4J49A 4E6PA 4EJMA 4PLHA 4G2NA 2HMVA 1BHSA 2FZEA 2G1UA 3RKUA 4BL5A 2DTEA 2E4AA 3AU9A 1D1SA 3DTYA 4W99A 5I9MA 3DBRA 1ULUA 5CFZA 5LDHA 2YW9A 4GSLA 4TVOA 3JQCA 4XCVA 3GUYA 2HMUA 4BKUA 4QECA 4FN4A 5H81A 2RIRA 3BMQA 2X86A 3DXFA 4KQXA 2E37A 4YBZA 1VKOA 1K0UA 3CEAA 4MKXA 5A06A 1KEPA 3ENKA 1K2WA 3OSUA 1MP0A 3RUAA 1QORA 3AM3A 3GRPA 4WKGA 5A04A 4FOSA 1N1EA 1KEVA 4YVFA 3WGHA 4AFNA 2OFPA 1XGKA 3EY4A 5JDCA 3WYCA 3E1KA 4H7PA 2HSDA 4F6CA 3JQBA 3MEQA 3KYDA 3GF4A 4OAQA 4AJKA 1CYDA 3Q11A 1IHYA 5JNLA 3N7UA 4J43A 4ROSA 1F12A 5EERA 1J6UA 3PDUA 4AJEA 2O48X 3MTJA 1HZJA 2I66A 2NM0A 1YWGO 1Y1PA 4NH4A 1OC2A 2PFGA 2NU7A 5MDHA 3S2FA 1EEHA 4EUHA 1E6UA 2Z95A 3K30A 2HK8A 4YJDA 4IDAA 2Q99A 4A0SA 5JO9A 4YR9A 2J5QA 3IP1A 3QE3A 1J0XO 1E3JA 1O0SA 2B4QA 2Y93A 2Y68A 3WQRA 3TOZA 5COBA 2NWQA
chains in the Genus database with same CATH superfamily
3IP8A 3CUSA 5I7FA 4OP3A 2IYLD 3V2IA 2YXEA 2EHJA 4G0PA 5BURA 1HI9A 2EHDA 1M2EA 4GT1A 2WWTA 1ZMTA 1Q50A 3RRJA 1K06A 4DMHA 2BHNA 2C04A 1VXRA 4HEHA 3W9BA 1SEPA 2E4VA 4BPRA 4W7HA 2YHIA 4CM4A 5C8ZA 4JLSA 2X3YA 3B20A 2WJVA 3GEDA 5HQTA 1HSOA 2VNSA 4B6JA 2H9IA 1CHDA 3G1WA 2X9QA 2I33A 3GCGA 3HBNA 4Q3BA 1OBHA 4JI5B 4AJPA 3KTDA 1UXJA 4CN8A 2BLLA 1P17A 2FRVA 4JC0A 3URKA 3NYIA 4BFZA 3ZTWA 5CFMA 4J0KA 5JCJD 2WNHA 3BZUA 3CBGA 3NGMA 2C4WA 4QFMA 4ZVLA 1P1CA 1BDBA 1FYWA 2GZ1A 4I8DA 4PWYA 1AY0A 4X54A 4D9EA 4JQOA 5K4HA 3IMFA 2BFAA 2F3TA 3K2EA 4E12A 5KDDA 1QRUA 3HJUA 4OQDA 3RTDA 4AO8A 4C6TB 7YASA 2H07A 3P4XA 4I99A 4YCBA 2R25B 4M9CA 3SHFA 1NW5A 3ILHA 4BJ3A 2I71A 1E5QA 2YC2C 3S29A 3FNRA 1IBCA 5AMXA 2VHQA 4NV1A 3I30X 2J0SA 5TMDA 3RVPA 1KVSA 5EKTA 2AF3C 5DHQA 3TLJA 1G8FA 3IKTA 4F1WA 4OKIA 4S12A 4XGNA 4BB5A 4X5OA 1EUCA 6CHYA 2C9OA 4E1BA 1GCGA 3QLUC 1J24A 4RLFA 1MMFB 1WUYA 3K1JA 1HDXA 1G8YA 4HFRA 4ZV9A 3NV9A 1N3BA 2HBZA 5B1EA 3B6EA 1QF7A 4DJJA 1C9KA 3D2AA 3KOZA 4FCWA 7ADHA 2A5LA 3TI7A 5FFFA 4YP6A 1HLPA 3D3QA 1GKIA 4WLOA 5JXWA 3NHBA 1LBQA 3GRRA 4II3A 4O8CA 4WBNB 3LYHA 1F51E 4YH1A 1Y4AE 1TO1E 2P8JA 3CNBA 4B44A 1HWYA 3EYAA 4IGAA 2C82A 4RHEA 1O7JA 4A8JB 4KJZA 3KV1A 1ISSA 3K9GA 1L4MA 4JI8B 2H52A 3U13A 2DLNA 3AKEA 2GPAA 3UCXA 3V1YA 4EJFA 2AVDA 4EJ2A 1EGVB 3H9JA 4CLRB 3AI1A 2INGX 1IB6A 1ESEA 3DSRA 2PZAA 1KYXA 1M1ZA 3AJDA 2QQ5A 2YN0A 4KQEA 1DEHA 3C39A 1ZK1A 1BKYA 2IYSA 1V96A 2R6JA 4NCKA 3QVMA 3KRTA 3QLJA 1ENYA 3UJ7A 2JFNA 4Q1DA 3N8IA 2J3IA 2P2SA 3L3BA 2H3HA 4KYUA 1F20A 4TOIA 4Z86A 3A32A 2PQ2A 1W94A 1E2QA 3RVNA 3QKSA 4Q37A 1BXRB 3BWBA 3BH6A 5BN4A 2EFYA 2JH9A 2DJ5A 4V0KA 4FEEA 4AICA 3F73A 5H3LA 3MJFA 1JA1A 1KI3A 1PVDA 1NQ5A 2FZKA 2OBNA 3VXKA 1W581 1D2EA 2OCYC 1G38A 1NW3A 2EGGA 1NLUA 1P9LA 1O97C 3C4QA 3WK5A 2A9RA 2OCKA 1H1LB 1T1GA 1TM1E 2WSBA 4KU4A 4YACA 2PBRA 1CQIB 1B6RA 1P45A 1WEHA 2HWYA 2JHAA 1JT9A 2NTYC 2PKEA 2Q8PA 4LYDA 4ZZ3A 1XL1A 4J0EA 3WLNA 2PMCA 3AJ9A 3P8ZA 2C2BA 1NQXA 2ZSUA 5KCMA 5IUJC 1MA3A 4FJ1A 3S40A 2XMCA 4S1WA 3HWRA 4ER3A 3DE2X 5DX1A 2SKDA 1KSJA 1I2DA 1KFBB 1IZ9A 1GM5A 3WY9A 5C51B 2F1RA 2V0CA 4CDMA 3CUYA 2ZRMA 2BWJA 4D79A 3CTMA 1FBTA 3EVNA 4RPGA 1GQFA 3QU5A 4O4IF 4B3TB 2ID4A 1DJLA 3WYFA 3SGLA 2P6OA 4HXYA 1BFUA 4AG6A 2VT2A 2HMWA 3HXTA 4JBYA 1KP9A 4B76A 2M6RA 2X6RA 4LI0A 1Z8DA 1YAHA 3I9NA 3H13A 4PSVA 3VTKA 5AKEA 5FAKA 1GDTA 2ZZNA 5IJAA 4YRPA 3K96A 4GI5A 2BUAA 2OKGA 3S5UA 1CRWG 4WXYB 4YJHB 1FDVA 3EY9A 2X76A 2BGKA 2BEUB 3CO0S 1QKKA 1HMYA 2ACWA 4UBNA 3ZDRA 5JBQA 1L5ZA 2AXQA 3A3OA 3IQEA 2EARA 1NXTA 3NONA 4B6GA 4AY5A 4RFVA 1V25A 2A1IA 2QTCA 1ENZA 1Q5PA 5FOSA 4EGFA 1RRCA 1QWSA 2VDJA 3AGPA 1PGJA 1I7LA 4QO7A 2EX1A 2CNNA 4IQ0A 1MTZA 1HT3A 3OT1B 1Q1ZA 3C7CB 3PWTA 5K9ZA 4FN5A 1TJ3A 3W5IA 3PA6A 2VTBA 4RF5A 2RHJA 2WK1A 2J5XA 4X7RA 1J8VA 2BHRA 1C1DA 3AKCA 3HCWA 1ZLYA 3ZI0A 3ZWVA 5E95A 2Y99A 3R0VA 4ZV7A 5KAPA 1RMTA 2V8BA 3W7BA 4H4DA 4Q4HB 3TQRA 3PI7A 3R7BA 1GL7A 5LMNB 2PRZA 2WJ6A 4F4DA 3H2IA 1J21A 1JAZA 5HM6A 3WFIA 3ESYA 3OPYI 2ZRPA 3LK6A 3F4BA 1H23A 1E7YA 4MS3B 3C6XA 1FTQA 3RU3A 1PI3A 3PXCX 4I5GA 3WGYA 4KO2S 2BZ1A 1HNWB 2XUZA 1TCAA 1QO0A 3N8DA 3FCAA 5KREA 5E7JA 1AB6A 1H0KA 2J5BA 2JGDB 2A9VA 3LQ2A 3PGMA 3RU9A 4UMFA 2G80A 3JQRA 5HKOA 4M7WA 4LFBB 1OAOC 3MOGA 4ARAA 1NQUA 2QE6A 3M8KA 2YV5A 3LLUA 3MPUA 2NMVA 1PL7A 4M1ZA 3IAAA 2VHZA 5CYOA 2JZOA 5J59A 2ZSJA 1WCWA 4C1NA 3B1WA 3O4GA 3WB0A 5EIEA 1F8GA 1OVGA 1UWVA 3PFGA 4E5PA 5I8WA 5LZ4A 4AKIA 1O58A 3CNHA 1ZFNA 4K46A 1K4KA 1HOTA 1WR8A 1T6YA 1V1RA 3AT1A 4QDTA 4GX1A 4BVJA 1FNBA 2NUPA 4YRZA 5FPHA 3U4HA 1PNTA 5A1TA 6LDHA 1XDUA 4I9UA 5LM3A 2IQIA 1TL7C 4LOHA 4DQXA 2IDMA 1RJFA 1M8PA 1KDTA 1NXOA 1KH3A 4K86A 4H59A 4IIEA 1E1RA 1F8YA 1K8YB 2HBYA 3QPDA 4N6NA 1K86A 3SEFA 4KXUA 5L4NA 3H5NA 2VDLB 5AVVA 3RYHB 3GT0A 1Z5UA 4H6WA 2JAUA 1JECA 4DQ0A 3O2SB 2C57A 3RK4A 4U8HA 3OIWA 2GKOA 4UFNA 5G3YA 3CW8X 4N82A 3WGVA 2DFDA 3E8MA 1II0A 1Z5NA 2LP4Y 1DIGA 2CDRA 3W6ZA 2LKCA 3LUGA 1P9OA 5A6SB 3AJEA 1V2GA 4N8EA 4JX8A 3A2NA 4C0AC 3OQNA 2WF5A 3H9UA 1ISPA 3ORHA 5CX1B 3ID6C 3FUXA 3T3IA 4O2RA 4WKPA 2FW8A 4X1YA 3KT6A 1JH8A 1XRNA 1MEJA 3OFKA 1P1BA 3IL2A 2CT8A 1WZIA 3HWX1 4X20B 5DGIA 5FXMA 4KVFA 1A4XA 2NSYA 3L8ZA 1JEAA 2BZ0A 1PGPA 3MMXA 2ZTSA 4FFPA 4TMVA 1WXFA 3I92A 3CTPA 4C76A 4QDOA 2XCQA 3U7EB 1Y4ZA 1WMAA 5IF9A 2YVUA 4BB9A 5EKDA 1P5ZB 4CT5A 2ODWA 2P3OA 3Q0TA 4Q00A 2BZSA 1ENPA 4TMYA 3TN7A 2PZJA 2BCEA 3PUHA 1Y6QA 3SOZA 4EBBA 4F0JA 1ZU5A 4UCQA 3R3ZA 1CDOA 5DW0A 2JCXA 1L7NA 5JEDA 2JFUA 2H59A 4XX0A 4GZ3A 2G0AA 3AWIA 1ZGHA 3PP8A 4ZI2A 4O0MA 3DS8A 4CDRA 4H77A 3I9LA 3N1UA 4JOBA 1GTZA 2RK6A 2QEQA 2ZSKA 3O94A 3AC0A 4JLKA 3FZEA 3K3PA 4AECA 2ZU0C 1KRHA 1EWYA 2YINC 3E5RA 3I23A 2RGRA 3CEMA 1J8MF 3R0IA 3ND8A 3GROA 3KE8A 1J99A 2QSYA 3EDYA 3PD1A 3RFFA 3B9PA 4BZWA 2C4MA 1Z33A 2ODQA 2C7VA 3G85A 3EYWA 3KOMA 4OJMX 4REMA 3IS3A 2JGEA 4EJSC 1M1YA 3SJUA 3SSAA 3TLGA 1LU9A 1NYQA 2IOYA 2Q9CA 4MO9A 5H4HA 4DYHA 5LYJB 5KKAA 3RF6A 2ADMA 4ZO9A 4QQKA 4FFLA 1WMEA 3IRUA 3UHPA 4AFNA 4PNPA 3A6HA 3R41A 3GCZA 3AB8A 4FDMA 4ON9A 4J0GA 5AKIA 4D9KA 5KJ1A 5A3RA 3PCXA 1KZ6A 2WU0A 1Y3DE 4BJ1A 1ZMBA 3UNXA 2Z3VA 3SM9A 5BV2P 3ST7A 3CLSC 4XRGA 1IJKA 3EFEA 2HHLA 2C4TA 1Z4OA 3G02A 5EFOA 5KTTA 4HD8A 3SF0A 4JGBA 4HWOA 4TLLB 5K5EA 5CAEB 2W83A 2QD3A 4NAHA 3COJA 1UH5A 3BB4A 2PWBA 1WOMA 1W73A 1GTVA 3BJEA 1SBQA 4L8FA 4LC9A 4LISA 5KYVA 1E1NA 2DQKA 3IGFA 4RTQA 3H2JA 1EK1A 3LCRA 1QP4A 3HB1A 5JSYA 1A4UA 3FA2A 3RWMB 4EL5A 1HOXA 4BTVA 3N0RA 4DWVA 2PHZA 4Y0NA 3F4LA 1MO3A 4H6XA 1QANA 4Q7JB 5B3AA 4BLQA 2VJAA 3M1AA 4X1KB 3USES 1DDIA 1QYCA 3E9EA 2J3EA 4H1HA 4WK6A 3V46A 5BVGA 1Y8ZA 5I48A 4WX2B 1JXQA 2PXXA 3BMXA 1E5TA 1MAVA 3VYSB 1XU9A 3TTXA 2C9DA 5TEVA 2DPMA 1FMJA 1AZWA 3Q3IA 1T25A 4TQUS 3C97A 4CKCA 3D6VA 4COOA 1DKNA 4UTRA 1JTEA 5C8DA 2WFAA 3D8BA 3I2JA 4L0CA 5AVYA 2H4YA 4B84A 5C5EA 4NATA 5GWXA 2D00A 4ZI5A 4ISBA 2O6LA 1Y9AA 2A5FA 4BY9E 1JT2A 2G0NA 3N2EA 1CQJA 3JYPA 1UM9A 4MW4A 3RYIA 1HGXA 1R0ZA 2JBAA 3QGMA 4AXXA 2HMAA 2AF4C 1NYTA 5H1YA 5JEEA 1NQOA 3I1YA 4TYPA 2VDWA 3IAS6 4HZUB 1Z0IA 4PONA 1R4NA 1SXJA 5DCYA 2FMFA 1ODKA 4LTNA 3D1VA 3CZMA 1C9DB 3EULA 4FS3A 3UW3A 5EJFA 3ENQA 1JDSA 2Q7DA 3WGQA 3E22B 4CMGA 4PGMA 5IMSA 1P5HA 1UZMA 3AG5A 1G9XA 1WDLA 2Q1TA 2YMMA 4NTZA 4XSHA 5H3HA 3OZVA 3UB2A 5K3DA 4E13A 4EZBA 5LQDA 4EYGA 3FYUB 2PWPA 1GNVA 3PIIA 3QBJA 4OJNA 1GPLA 4TSKA 1Y8CA 4XUDA 3K4PA 2ZWAA 2P5UA 5ECYA 5C4MA 2WD9A 4ERNA 1FP1D 2FSIA 5E6RA 5J5AA 1YCDA 5JE8A 1AE1A 2PGIA 1EDBA 1G7CA 3EPJA 1LRLA 2O1SA 1C5KA 4MVJD 5F3RA 3RS5A 1XQVA 1NJ1A 1CRPA 2EJTA 3EH2A 5F21A 4B4OA 3NC0C 4RCZA 3T38A 5F73A 5GQSA 4RGYA 3BB3A 4E5NA 1A4IA 2QKYA 4EF5A 4F6RB 1W30A 1K7CA 4E5DA 3HVHA 3FTEA 3FHOA 2FXVA 1N2ZA 4D82A 5IKXA 2AEJA 3CRZA 1N2CB 4MH0R 4PQYA 2XTJA 3COYA 3N74A 1ZCJA 4HP8A 3H4IA 1P4RA 3EVFA 4EHAA 1ZJJA 5FNVB 1NFRA 4U5QA 3GFPA 2NPIA 2Z43A 5FF9A 4EPWA 4QYTA 1PTJA 3BIWA 3TEJA 5DNYB 4FHFA 4UBOA 1DTWB 4Q3AA 4RHXA 3WGUA 1JVNA 5KYGA 2GBFA 4NARA 3U6KA 3MIIA 4G6ZA 2WIAA 2H7YA 4FWBA 3T7EA 1X6VA 2AWOA 4ACAA 4EVQA 3QELA 4L0QA 3ICOA 5FEUA 3O8NA 3SBDA 5FUYA 3UJHA 4EHDA 3OEHA 1SCUA 2YN2A 2WAXA 3RIGA 1IJFA 4KBGA 4YMIA 3KSAC 4BB0A 3VU1A 4QL3A 4AIIA 5K0GA 1GN8A 1H2WA 3PFIA 4GWKA 4MV6A 4JD5A 4JUCA 5HPYB 2VA8A 3KFXA 4YO8A 4EUNA 4NOMA 4P5PA 1U1CA 4I5FA 1RWVA 5AJYA 2UXCB 4MRMB 1P6XA 1VIMA 1W76A 4DJDC 3JQ6A 5A9SB 1R16A 1UBLS 2FVYA 3QXXA 5HZMA 5EE5B 1IHDA 4RY2A 1JBEA 1O94C 2ZRGA 1QHSA 4D25A 3A1NA 1L1QA 1QGYA 4BNNA 2CNDA 4P6VF 1BU8A 1JSZA 1TTQB 2KMLA 4C5BA 5IBCA 4LHZA 2JCBA 3LC0A 4B8YA 5AKZA 4TSRA 1CY1A 2VPTA 4EG7A 5F2NA 2ZEJA 5GY7A 1XDDA 3HB5X 3DFUA 4OHVA 4KFUA 4RABA 3EEBA 2XB6A 4AZSA 3CPSA 4FPXA 5K4GA 4NESA 2Z8XA 2O5VA 4EY8A 4J3JA 5CFQA 2QSUA 5CGZA 3AFHA 2RK4A 3P0FA 2K6GA 2WJ4A 4MTCA 4A8PA 2OHIA 4I9HA 1DWPA 3TMKA 1PJ8A 3WB2A 3AXTA 1G3MA 5AW6A 2I6SA 1N2BA 4MHOA 1MB0A 5KTPA 3DLHA 5EJGA 2UYHA 4QGGA 4RDHA 4BU0A 3B3GA 4R5HA 2WF7A 4X44A 2GXUA 3HKEA 5BQXA 4Z8YA 3NC4A 4IMRA 3AWDA 3G2JA 1JFSA 4NZOA 3R5JA 1YNOA 2DUMA 2JI8A 4Z5XA 1JL3A 1FS4A 3C1UA 1C0EA 4HWKA 3TDMA 4QT0A 5ALQA 4ND2A 2BFDB 2P11A 1BS9A 3CX7A 1U5AA 4V0LA 2EZUA 3N86A 4MARA 4C30A 5GINE 1EFAA 4TYQA 2A0WA 3DDZX 1M2FA 3RSLA 1RHJA 3O8LA 1NJ2A 1VKJA 3GH1A 1P2UA 2CXPA 1U80A 2XGOA 4TYMA 3OLVA 1GITA 3SP1A 3T3HA 3P71T 4D81A 3L4KA 2CSXA 1QHHA 3EZYA 4K0KB 1LBEA 1ZD2P 3L1VA 4UBLA 4E7PA 1FS5A 4CL3A 1DCMA 4X90A 4XOIA 4Q12A 1TGYA 3MRSA 3LDHA 2GEDA 1OLSB 1CHNA 2ISQA 1WJGA 1HYBA 4JGGA 4D9MA 1ZH0A 2Q2QA 2QTBA 4HDAA 1H5QA 2XBMA 3BREA 2V3CC 1XXHB 1FIUA 4GWGA 2ZPUA 4DC9A 4Q4AA 4QBFA 1CJBA 2OP1A 2WJHA 1DDOA 3CPJB 1HKUA 2WM2A 4G0XA 4LF7B 2QPTA 2EBFX 5SY4A 2EC5A 2YZ2A 4WXRA 5FPPA 3G2LA 1GZUA 1MJHA 3WRXA 1EK5A 1CY6A 1H85A 3CRMA 4IINA 1ZC3A 2IHTA 1V11A 1W5SA 2O2DA 1WO8A 3UAYA 3I1JA 3V9AA 1RRKA 2B9VA 4OKSA 1QIFA 3ESBA 2DGDA 1PWEA 2NYVA 3B1KA 4C9BA 3F9CA 4MS4A 4ZICA 1RWMA 3OAAD 5BWCA 5BYJA 3RUIA 5TGZA 2WHPB 2ZDQA 3DVAB 4JJFA 4URXR 2Z56A 2ZI5A 3SC2A 2PT5A 1L7BA 2H2FA 3B13B 4LZOA 3GELA 3IB3A 4HWGA 3SICE 3ZNQA 4EG8A 4NECA 3MF4A 1ZH6A 2VQFB 4JMLA 4EHLA 4ZARA 1UL1X 3HKDA 3KYCB 3WBBA 2JHFA 2GSWA 5D85A 5NLLA 1US8B 1NXSA 3GD7A 4FU0A 4ME6A 4NNJA 1ADBA 1G8SA 2D4HA 1KOJA 2JHPA 2P35A 2Y0PA 1QH1B 1XRJA 3MTAA 3QKRA 2QAIA 1UANA 1XMQB 4IIDA 4LYYA 1PZEA 1QDEA 5IT9A 2BMEA 5AXDA 1H6DA 1GOTA 1O54A 2QPLA 2Y1DA 4MUIA 1SUBA 1B23P 2IYEA 2GJSA 2KLHA 1ID8A 3H42B 2ODNA 2Q5FA 2OAGA 3P0RA 4P92A 5EXEA 4UNRA 5HM8A 1E61A 3PA8A 3RWOA 3W1EA 3LP5A 9GPBA 4OM8A 5K09A 4FEYA 3EQ9A 2J9GA 5HBGA 4BNMA 1N0WA 2LW7A 1K1EA 1SEVA 1YJXA 3L7IA 3MPOA 1FVFA 3WJ7A 1FLNA 4GGPA 3SQLA 1RXYA 1TK3A 1UDCA 2GNPA 3I2YX 1HFEL 3LHIA 3P0EA 4G5SA 3TTSA 2R79A 4FHCA 3DDSA 4IHKA 3ZX4A 5J43A 2YJ4A 3BFVA 2WR8A 3UW1A 5KQGA 1RU3A 3GFSA 1Q3TA 2ZANA 3JYLA 2L69A 3Q7SA 1W5EA 1Z82A 4GOND 4QAQA 5G4KB 5J5CA 2O0MA 3A1TA 3WX0A 1O0BA 3CCBA 2AG1A 2CF6A 2A59A 2GEJA 3GRVA 4YRTA 3I6MA 4IIJB 3PYMA 1ZESA 3QX3A 1BYUA 3TKAA 1JR3E 2ODEA 1J4AA 3M83A 2BGIA 1JA0A 5GP1A 3VDMA 3UG7A 3DMGA 2I2DA 3K1AB 4ZWNA 1EFKA 3OOEA 5D86A 1HSZA 2JA1A 2YWJA 2HJ9A 3ISVA 1KEEA 4OX9B 5BNZA 1ZSNA 3P96A 4L4UA 2Y1XA 4DMGA 4LJLA 2BFPA 1IY8A 1RC0A 1B4DA 2OV3A 4QM6A 4Z6KA 1VDZA 2ZBUA 4YRJA 1FYXA 3G7NA 3WL6A 2C8LA 4UTVA 1XVLA 1IZYA 1W4BA 2M6SA 3PC6A 3E8XA 4I9NA 4JP3A 1E3MA 1JNXX 1WSWA 2GUWA 2AUNA 2AOUB 5LLDA 5AW9A 4DIOA 4J90A 1JALA 3A6KA 5JU6A 3G6WA 2RB5A 3R6GA 4HGZA 3CVWA 3LUFA 2AYXA 4P4NA 5KMGB 5C5DA 2B82A 4I50B 4CU2A 4ZEVA 3V8MA 4Q9NA 2XJ9A 1W5BA 3S2GA 2YBDA 3ETGA 1WZ2A 3WDLA 1PR4A 1FQOA 5LZ7A 2V5UA 4P86A 1M72A 1OBFO 2MMCA 4F9TA 1I7SB 1TVCA 4GPEA 4B8WA 5JY1A 5CLLA 3LX5A 4BZXA 4QTYA 1K7SN 1RHUA 4UE6A 3LQYA 2DH6A 4KAFA 5FBHA 5FPSA 3KQTA 2PN1A 3LUBA 4P7FA 3WYBA 4GZ5A 2QU8A 3TFQA 2WD7B 4BMZA 1N1DA 4GW3A 2YYZA 1NQWA 3CISA 5K2OA 3D2CA 2DY1A 3GA5A 3Q8LA 1I4WA 2LIVA 4PEVA 1G20A 3IESA 3SZUA 1H8EA 1KJWA 2Q3MA 3HJRA 4XOUA 5D6NA 5IZ4A 4FONA 2V74B 3WE7A 1W5FA 2OOKA 4BN4A 1P7WA 2X40A 3ZW8A 1XLUA 3F4KA 5AKLA 1TKCA 3JD3A 5J1TB 4Q7KA 3FWHA 4ZEMA 4ARUA 1EHIA 1A5ZA 1SRQA 3K20A 3K5WA 4A2QA 2PV7A 3R9KA 1S7GA 3BXFA 3VSAA 5KNLA 2D62A 3V55A 1FDTA 1LW6E 3KXPA 5HILA 3JQPA 3MLBA 2R1UA 4YMLA 1KJNA 2J45A 5TQ2B 4DV7B 3SWWA 5HIKA 1N57A 3KKOA 4KR9A 4F3YA 2LIPA 1YZGA 1T8WA 2EKBA 3K0HA 4JT9A 4LI3X 3JQGB 3ILVA 2IYYA 1RDFA 3GVCA 1CR2A 1PR6A 1D6SA 1CQWA 1SBCA 4HN4B 4J75A 4LJ7A 3PGA1 2HUPA 5L3RA 1DRWA 1LF5A 3ORYA 4JEUA 1SIOA 2YVLA 5DHPA 3D9QX 4U7DA 4G1EB 2Z04A 5F52A 1UKVY 3PPIA 3PQEA 4RVFA 1WIWA 2XNKA 3L6OO 1SUSA 2ZRBA 4Q93A 4AB1A 3ZCSA 1SUIA 1CFJA 1WVGA 2AC4A 4G1BA 4QARA 3EW9A 1O87A 4G26A 3W2HA 4AX8A 5JS1A 2J3LA 1N2OA 2PQ6A 4BNYA 3DT8A 1OV6A 3PE3A 1BDJA 4XWTA 4D8XA 1N4AA 3CLTC 3ANMA 1CP3A 1NVVR 2HCTA 3H6KA 3QTBA 3ZDZB 4KR2A 1NVKA 1JLLB 4OMDA 3D7NA 4B1FA 1FFYA 5AUPB 3LPLA 5JNSA 4HNAB 4J7CA 2NP6A 3JYHA 1U6IA 4B31A 2HJGA 3QKWA 3DHWC 3GNTA 3OTIA 2BBTA 1K9VF 2BGLA 3CBQA 1SXGA 3EGXB 2J9FB 1N6NA 3FMOB 4OHRA 4OYHA 3TJMA 2ZSEA 5I3ZA 1WAMA 4GGMX 4JX9A 4RA9A 4EH1A 4AKEA 1RMYA 2XVMA 2ZE6A 1XELA 3O1HB 4JEIA 1E9SA 2VBGA 1FP4B 4M0PA 3VSEA 4BBZA 1LPSA 2B4TO 4ZALA 1ND5A 3FROA 5CA0F 2JAOA 4L1KA 4BTLA 4ZZ0A 5KOYA 3H3JA 2JLQA 1J2UA 3EGIA 4YJFB 2ZUVA 4OGKA 4WJZA 2EP7A 1SC9A 4US1R 4DDKA 2VUTA 4MQFA 4TKMA 4BGIA 5LL6P 1NUQA 2ZIWB 2D2XA 2J33A 2Z2IA 5A0VA 2BKVA 1SHJA 3A9VA 5KKNB 1J33A 2Q2OA 3RS4A 4YLGA 1GA4A 3SJAA 3D8SA 3ZVKA 4XJVA 2P3LA 4EPXA 4X8MA 3C15C 3ONDA 4E6EA 4Q7MB 4WW0A 1S3IA 1WTCA 1YZLA 1KU6A 2IDJA 2QN7A 2X9LA 4WFJA 1HT0A 3LWBA 3CKLA 1E0DA 4CM8B 3S7TA 2QN6A 4HO1X 5J5VA 2NT3A 3EODA 1ZY2A 1CJMA 4C7KA 3WAGA 1MEOA 3H5WA 3TJZA 1P4SA 1UT5A 1VLHA 2IHYA 5D3MA 4D0GA 1ZUIA 3WSTA 3BFXA 2YWRA 3RVRA 4XVUA 3V1KA 1PR5A 3MMZA 1YA8A 3IQXA 3SVTA 2B83A 2DHCA 4XTCS 4XA8A 5GJVC 1E58A 1LZLA 1W85A 3NVMB 3RU2A 5IJ9B 3OZSA 1G1MA 1K27A 3HCFA 4FT4A 3WLTA 2HW8A 2ICAA 1D04A 4DPKA 5EJ4A 4DSNA 3VOTA 1NSYA 1X7HA 3KR1A 1QCCA 2H5IA 4XFKA 1RJEA 1HFKA 2Q5CA 3DMNA 1F8XA 1GL3A 4ID3A 3PEWA 3JWJA 4LX0A 3RYFB 2BMJA 3W2GA 2AMJA 3WLEA 2QNBA 4EUEA 1G18A 2HD4A 2V7WA 4MVJH 3ZWBA 4A4DA 1YR9A 2JS7A 1QR2A 1L7QA 4NDAA 3AUAA 1TAUA 5LFAA 3VNBA 4QOFA 1ACMA 1ZX1A 4OQ4A 4PLTA 1D1QA 2VHTA 3EAQA 4TLBA 2PZGA 5EIHA 5LPNA 1HMPA 3RVJA 3RRNA 1DIRA 1RRVA 4BQQA 3I8XA 1PJTA 5HF9A 1ZD1A 1GAWA 4X6UA 1BKDR 1RNLA 2QE7A 3ANXA 4MVJG 2J7PD 1SPBS 1JHQA 1P61B 2FW7A 2OV6A 3O03A 4HL6A 3EZGA 3U31A 1PKEA 1FBNA 5BNIA 3T3GA 3AM5A 1R0BA 2Y0EA 3FKQA 2E5FA 4M1KA 3PFNA 3LQKA 4KQFA 4RKQA 4URWR 3ZOZA 4XI9A 3AZOA 5TEWA 2AI2A 4QUAA 3PUYA 4WESB 1D8AA 2QRVB 4WADA 1QH0A 1KJ9A 2IYOA 4KO3S 1MQSA 4REQB 5IPFA 5FB3A 2OGUA 2NNWB 3JU3A 2ZCVA 3EQ7A 3WLHA 1BE1A 4RJJA 2FN7A 4F2GA 1HV8A 5D87A 3S8YA 2NVWA 3W2EA 1QM5A 1KK2A 3I5XA 1BVUA 3QOXA 5DTQA 2QN8A 3ITKA 3TRIA 1QU3A 3KHSA 3EXIB 4MB6A 4F38A 1LX7A 3H9QA 2K7ZA 4QDJA 2J4FA 3ZE7A 3Q1LA 5EL0A 4EKIA 5DTRA 1ZXLA 1DOZA 1JTFA 1GU1A 1XN4A 5B12A 2H16A 2OC4A 3GLIB 3IDSA 1T5DX 4NG5A 5KYUB 1D5CA 2OR3A 4JY7A 4L8GA 1WDWB 2UUPA 3AVVA 5FKJA 2IW1A 2OCGA 1QTIA 3ZHRA 2H5LA 1T5IA 3H97A 5EYPB 2NP7A 1M2WA 4XIIA 1DEOA 1YASA 1HM5A 2ZWIA 1VG0B 4OQLA 2X42A 3O8OA 4NENA 4Y1FA 4XWWA 2OL4A 2UZ1B 2Q8NA 2V4ZA 1UPFA 2YQ5A 721PA 3ZX5A 1XV5A 4NNOA 4TZKA 3DH0A 1P19A 1RI1A 4H7EA 3VM6A 3NHRA 1NBMD 3D4NA 3FPBA 3UMGA 4UUQA 3SJBA 4CI9A 4KG7A 3OESA 1S9HA 4NEGA 1ZONA 1DV2A 2JFGA 2QZZA 2XOKA 3C2QA 3ND7A 5JECA 1N78A 4DRYA 1GFWA 3DMYA 4DLBA 2C99A 3FKSD 4AO6A 1R7RA 4ZT7A 1ZUNA 2CMGA 4OXIA 2V7UA 3K0SA 1SC6A 4IQ8A 4P58A 5ICFA 4EG5A 4AJ2A 3U0BA 1V45E 4QQ8A 2JD1A 2BGJA 2WUDA 4FYWA 1PCXA 2ZBEA 1EX7A 3M9WA 3WWDA 1SZPA 1D09A 2CNBA 3B38A 4HXEB 1LQTA 5IASA 1PTJC 2OB2A 2OBBA 4K87A 4AK9A 4D6XA 3AR4A 3EVGA 2J4DA 5LB2A 2K2QB 4DMKA 2PA3A 2LCQA 4IR7A 3JVDA 3EJ6A 4KMRA 2RCNA 4RQUA 4RKYA 1SA0B 1FU4A 1VPDA 1JLMA 3CR3C 4QEDA 1J9ZA 5LOVF 2PAAA 5DNDA 6REQB 2J7PA 4TLAA 4RHUA 5KYYB 4IJMA 9MHTA 3AOEA 1KJ8A 5H16A 5H7XA 2ZUWA 4PN7A 3M4JA 1NQVA 4UMDA 1TUBB 4H35A 3MAJA 5DKFA 2HV9A 4L72A 1LV8A 1EFPA 3L0IB 3T06B 4HVLA 2MINB 3NTVA 2PH5A 4EO4A 1ESCA 2G1AA 4F60A 5IZCA 4YXFA 2Y9PB 1KDVA 3UQZA 1XHEA 4Q3DA 4CV0A 1QYVA 2P69A 2GK7A 2XA1A 4L74A 2I4OA 3FRJA 4IHJB 1WZCA 3P26A 3O84A 3OO1A 1VECA 2PSJA 1WSBA 4JWKA 4LJKA 2GCGA 3TM5A 1FTGA 3LT2A 4DV1B 1C4XA 5SYMA 2BP7B 3EAGA 3L8CA 4YQZA 4B74A 4C6HA 4IZHA 4GEGA 2PH7A 1NC1A 1L1RA 3H7AA 5EA2A 4W9RA 1L5OA 4FT2A 1B8VA 2OD9A 3EC7A 4ZT2A 4AY4A 4C4AA 3C5CA 5CT9A 3RFXA 4XGIA 4QYIB 3BRWD 4BXOB 5ICSA 2V97A 3CT6A 4I55A 3BEOA 1UJ5A 1BWSA 5A02A 4IHAA 4WN9A 4PC6A 2JFQA 2WFLB 3HSSA 3CVUA 2PZLA 3FCEA 3ZVMA 4UKDA 1KOFA 4DUGD 1JDNA 1I4EB 2PX3A 5JS7A 3WICA 4WNCA 4N7JA 4ZVVA 1CK4A 1Z6QA 1DWQA 3A2MA 2MU1A 2QSJA 3M1LA 4FTWA 1Z34A 3TNJA 4ZO6A 2NVOA 4V0RA 2RHHA 2I6QA 3MGAA 3STUA 5JCOA 3O1LA 2W98A 5DGDA 1YIOA 3BGWA 1BXZA 1JJAA 4PXAA 5ALWA 2ORVA 2E7ZA 4HI0E 4D4LA 2R4QA 2ZU6A 5KWIA 2XBLA 3FBWA 2RKOA 1XZIA 3O3MB 2KX7A 3FKSA 2FKAA 5CB4B 5J40A 3FUCA 5T6MA 3WDSA 1PEAA 1YE8A 4V0SA 1JHMA 3ZV3A 3LBNA 1PDVA 4OXKA 5ARCA 1J20A 2DETA 4YJ3A 2IH4A 2UVPA 1U1FA 3N8GA 2DC1A 3BEDA 4PG5A 5EMLA 3KT3A 1T6XA 4KYTA 2GT1A 1ZD5A 2ASVA 5AI9A 4HLNA 3HCDA 5AYVA 2DR0A 4BX9A 4QOEA 1DXQA 3AJAA 4A2WA 3AY6A 3IIJA 1HE2A 1SKBA 4BC1A 4BXOA 4RMNA 4LX8A 2P68A 3GEHA 1GZ6A 3HYCA 1OZ0A 1JFRA 3ML1A 5EINA 4COKA 2QL7A 3P0HA 1ORIA 1AMUA 4BLOA 4QSMA 1Z4LA 4LNUB 5KC9A 1VCHA 3AEUA 2FX5A 3PHJA 3EZ7A 4YBRA 4DTCA 1EXDA 2B2CA 121PA 3CLSD 3VJMA 5CW2A 3KXLA 2CD9A 1GNRA 3IH5A 4L3VA 3TMYA 3WIDA 5COAA 5BWOA 1T1IA 5K0CA 1RT9A 3NXKA 4CLHA 1RC8A 5AJUA 3B8HA 3SEZA 4B87A 4CEHB 2LRHA 4EY4A 1ZHFA 2PO7A 3H84A 3G2OA 1QV6A 3HO1A 2VA9A 1MX5A 1WB6A 3GGOA 4ZCIA 3CZPA 3DV0A 5KNDD 3PK0A 4JB2A 1JR6A 3WRXC 3BZBA 4BGUA 2VWGA 2B0JA 1WXIA 4JI6B 1UZLA 2P90A 3VDXA 2BR3A 3VH3A 2C9MA 3OZXA 3WQHA 1Y1TA 2AR0A 3BAFA 3OZBA 4A7PA 3V8BA 1PQPA 4K5QA 2XXJA 4ASUD 1NHGA 4QVGA 1K4YA 3L4BC 4XIGS 1WMSA 1JIKA 2ZRJA 5T3UA 2M6LA 4C7OB 4D5EA 4GG1A 1CJTC 3KUXA 4KIWA 2PGOA 4CM6A 2WICA 3JYQA 3MILA 4OQQA 4CL2A 4BRSA 4MPTA 5FUVA 1H8HA 1BCSA 1Q83A 1JB9A 1X80A 2DSTA 3W3ZB 4DUGA 5K3AA 2JIBA 3BM5A 4QHTA 3UIEA 4J29A 3T52A 3IQIX 2FUNB 1EX1A 3QPWA 4IICA 1X1DA 2EG9A 2NVUB 5IM4F 3WL5A 2XIQA 4PIPA 1T10A 2EP8A 4JLWA 5SYAA 2I6GA 2IQ5A 5IAGA 4UXIA 3VPCA 3LYAA 3TLMA 1QIJA 1NWCA 4FQ8A 1R6AA 3IYLW 4FZ3A 5L8VA 5LDDC 1DX4A 1OQAA 3QE0A 3RVSA 5CBPB 5FUMA 1Q1BA 5K3OA 13PKA 1NBEA 4NBKA 1I6WA 2HUNA 2VR1A 3E9DA 4B8ZA 2IH2A 3OWHA 2Z2JA 2CSUA 3JWGA 1OI3A 2WIDA 3QJ5A 3TCNA 1TECE 1ACLA 4Y2TA 5DP2A 1YVRA 2E5LB 2P30A 2B30A 1TOAA 2RH8A 2VYVD 2W0MA 4OUKX 4F6LA 3AI3A 3OPXA 1CF4A 5BW5A 3S0JA 1MEEA 1RBZA 5KTSA 1N34B 1Z37A 2YBEA 4IIUA 1NVXQ 4MYRA 1RTKA 2XVYA 1H2XA 3AB3A 3IELA 1E63A 3RDPA 1FZQA 2J59A 2R00A 1FNDA 1FUIA 1AB5A 1T3ZA 3AF3A 3A9TA 4LWQA 3TAHA 5AVRA 3IOMA 3H17A 4O0LA 1Q44A 1PN3A 3PQDA 1FRZA 4FQ7A 2O8NA 2AKEA 2WNIA 5COQA 3H5VA 2IW3A 3ZWQA 2CL5A 4BNJA 3DKPA 2W71A 3G82C 1GQRA 3AY3A 2DXIA 2BI8A 3MWEA 4FFWA 2MR6A 3NAGA 5IUNC 3R7LA 3CG4A 3GDGA 3IULA 3AP2A 3KTAA 1XMVA 1VIAA 1BCRA 3MJ4A 4D6YA 1SURA 3PDJA 1XZAA 4BFCA 4QPCA 2XMQA 1E9BA 4RD1A 2GPTA 4FUQA 2Q1UA 3H83A 4GRIA 1X1BA 2JJ2D 2NT4A 3NI2A 2JEYA 2DAPA 5KYKA 5FJIA 4I4IA 3Q5GA 3QYPA 4L78A 3P9PA 4YQFA 1JKIA 4G0NA 4EA6A 2C7RA 1KYWA 2ODPA 1V1MB 4LE2A 2MSEB 1I9GA 1PRYA 3V3KA 4ITUA 4NR0A 4ASUA 1OLUA 3DL2A 4K9RA 4ZVRA 1HDYA 1S8AA 4BNUA 1RQGA 2HN9A 1ODIA 4M6WB 4BRUA 3I5YA 4WVLA 2AUTA 4IKPA 4BO9A 2REQB 3R3WA 1OGJA 5TB5A 4DCCA 2EJVA 2B6HA 1NX6A 1TLTA 2QX8A 1RYNA 4EJ6A 4X3OA 4DIKA 1RPNA 3K09A 4JT2A 3CWCA 1DNPA 1GVNB 3T4PA 4MR9B 2IYTA 1WPQA 4US0R 5DTIA 4QBIA 5K3SA 4CCAA 3GLFA 1C7IA 3G2PA 5DWVA 4JJ7A 1J8FA 4IDHA 3V8VA 2WWXA 1MB4A 1D8TA 1HC7A 2G82A 2CUZA 4V0OA 2D5AA 1WNFA 2W4MA 1N2XA 1FUYB 2CL7X 2Z3WA 5CDYA 5ELXA 3TLBA 4DCOA 1P2GA 2X23A 1XTKA 3IV9A 5DP1A 2O14A 2CLIB 3C4VA 4DNOA 2CV0A 4LZLA 1YVUA 2XYQA 2H11A 2FSFA 3AR8A 3DHYA 2ZI6A 4KX5A 4FOOA 3Q7RA 4MS1A 4N5NA 4D8TA 1YBFA 4Y18A 1ZNWA 3ZJTA 2C00A 4PNZA 1PEKE 1O94D 1HG0A 2P0EA 4W6ZA 2FPPB 4M1SA 4RK1A 4Y1GA 2OB1A 2OWDA 2OV2A 3BCHA 2V4UA 2WVAA 3QEKA 1NUHA 3UJAA 4U3JA 2O8EA 1QX3A 3FOCA 3IP9A 1P91A 1Q1QA 4P0QB 1IBLB 1B43A 2X15A 2FU5C 3KHKA 5AM3A 3K8QA 4LMBA 4PWZA 5KSOA 2KLBA 2PDAA 4GU5A 3JQQA 3H1EA 3AHEA 4EEZA 1BSVA 4IY1A 1Z0SA 2IOFK 3UOGA 4EB8A 3G9QA 3PHGA 4ROTA 3EGOA 1DC4A 1CUZA 2GD1O 3L1HA 4QFDA 4GWLA 3AHGA 5KHOC 1AQYA 2KW5A 4HT3B 1J90A 1VI5A 4CKBA 2WJJA 1IOWA 2HAEA 4FHEA 3RE1A 3BERA 3VTFA 4PFKA 4F71A 1BTOA 2CFCA 3GC6A 2UXDB 3QLVC 4FEAA 3AINA 3L8EA 3KVYA 2HXYA 3VKWA 1M6VB 2OECA 1SUWA 4W6QA 3ZEIA 4BGEA 1R50A 3S8MA 3X2EA 4U00A 5DB4A 4U9HS 1AHHA 1U2QA 4YALA 3OJEA