4PNHA

Crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
155
Chain Sequence
b'KKLVVLDRDGVINVSPDEWVALPGSLEAIARLNHAGYRVVVATNQSGIGRGLFDMATLNAMHLKMHRAAAAVGGRIDAVFFCMMKLIAERFEIDPADTPVVGDSLRDLQAGAALGFRPHLVLTGKGKKTLAAGGLPEGTRVHDDLRAFALDFLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D,D-heptose 1,7-bisphosphate phosphatase
publication title Crystal structure of D,D-heptose 1,7-bisphosphate phosphatase from Burkholderia Thailandensis
rcsb
source organism Burkholderia thailandensis
molecule tags Hydrolase
total genus 47
structure length 155
sequence length 178
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.1.3.-:
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4pnhA00
1ZRNA 2IOHA 3GYGA 1Q92A 3WK8A 1XPJA 5AK3A 4UAUA 2RB5A 3UM9A 2FPRA 3EWIA 3N5KA 1WZCA 3L1VA 1ZD5A 5AW9A 5AKJA 3SF0A 2MU1A 4BNDB 1RLMA 2YY6A 1NNLA 3ZUPA 5AKZA 3KD3A 2GO7A 2YJ4A 2WF5A 2W43A 3OTQA 1Z4NA 3SMVA 3A1EA 3QU9A 2HSZA 2WF7A 4HGPA 2O2XA 5ALFA 3NAMA 4DFDA 4GIBA 2R8YA 2RARA 4BNDA 1RPZA 2EARA 4YIKA 3VAYA 4KNWA 4BEWA 1RLTA 2ZBEA 3QLEA 2I6XA 2R8EA 4QJBA 5IT4A 2I55A 2P11A 4BX0A 1RMTA 1Z5GA 2I7DA 4YCMA 5AVVA 3AR2A 3ZVNA 3ED5A 4Y2JA 1CQZA 1IWOA 1YV9A 4Y2XA 2DQSA 2NO5A 3ZX5A 3R09A 4UASA 3WGVA 3IJ5A 1L8OA 5ALTA 5AW0A 3E84A 1LVHA 3SLRA 5AIAA 4MUMA 1WPGA 4EEKA 2JAWA 2W4MA 2O9JA 2R8XA 4F71A 4MWOA 3ZTYA 3ZWDA 4AS2A 5T41A 1WVIA 3FGOA 3OCUA 3OCVA 4EENA 5AI9A 3NRJA 5AVYA 4Y2RA 4NFLA 1CR6A 3D6JA 4EX6A 3PGVA 1Z4JA 5ALHA 5AM3A 3J7TA 3U13A 5ALRA 3IRUA 3WKBA 5ALQA 5IT0A 2GMWA 2ZG6A 4JB3A 4HGNA 3DDHA 4YCNA 4GXTA 4Y2SA 3ZVMA 1Z4QA 3ET4A 2YN4A 2CFTA 1ZD2P 5AKYA 2OM6A 5AI0A 2IOFA 2FPSA 1F5SA 4NABA 3S6JA 5JJBA 4UU0A 3OCZA 3QUBA 2YMPA 4QQFA 2I54A 2Q4TA 1RQLA 3L0BA 1T5SA 5AKKA 2C4NA 2YMLA 1VJ5A 4UMFA 1XP5A 3QX7A 3ESQA 3SKYA 5AW1A 4CNQA 3I6BA 3FVVA 3MPOA 3SHQA 2C8KA 2JAOA 2HDOA 1Q91A 1RMYA 3KOOA 2MSNA 2G06A 5AM5A 4L6CA 2YMQA 4CF4A 5A3RA 1RC8A 1PW5A 4I9FA 3L0CA 3QU7A 4HGRA 5ALXA 1S8OA 4HAIA 4G9BA 1TJ3A 4OHFA 2FPXA 1AQ6A 2P27A 1U02A 4EELA 2C88A 1TA0A 2VKQA 2WFAA 3EPRA 1L6RA 4Y2UA 4IFTA 3ZTWA 3ZU6A 4Y2YA 5AIBA 2AUTA 3CNHA 5AK5A 4HGOA 1Z4MA 3E8MA 3ESRA 3L1UA 2FUCA 1X42A 4UM7A 4DCCA 1S2OA 5E0OA 4O8CA 2HO4A 2W11A 3FZQA 1QYIA 5AW2A 2RAVA 2QYHA 1RMQA 2BY4A 3N07A 3E81A 4UAVA 3ONNA 3RF6A 4XE5A 2ZBFA 5ALKA 2EATA 1RLOA 3DV9A 4RETA 1J8DA 1RKVA 3KDPA 4C4RA 2I34A 3NALA 4KN8A 4G63A 2EAUA 3PDWA 3QYPA 3TLMA 1ZD4A 3M9LA 3QUTA 2RBKA 3M1YA 5AKXA 5ALYA 3WK5A 1SU4A 4YCLA 3WKEA 5AI8A 3WK7A 3U26A 5AVRA 2FDRA 1ZOLA 1RKQA 5AK6A 4BYGA 3DNPA 3KBBA 2GHTA 3QNMA 3L8FA 3OCWA 1O03A 4H1WA 5AVUA 2FEAA 2HX1A 2IYEA 2D2VA 3BWVA 2FI1A 5ALSA 3A1CA 3QGMA 4KX3A 2Q4RA 1MH9A 4EX7A 3OCYA 2R8ZA 4DWOA 5AVWA 3L5KA 1VJRA 3N8GA 4OCZA 5IS2A 2B30A 2PR7A 2B8JA 2YMMA 4UATA 5AW8A 5AW6A 2AGVA 3HLTA 1U2TA 3AR9A 5ALIA 3W5AA 5ALMA 2QLTA 4Y2QA 2FUEA 3NASA 3AR6A 4HYTA 2IA5A 1JUDA 2GHQA 2NO4A 3MMZA 3NUQA 4B6JA 1L7OA 2IOFK 2P9JA 2I33A 5ALGA 2WF8A 4BX3A 5AM1A 1ZJJA 3R9KA 2NYVA 2G08A 5AW5A 4ZEWA 3WK9A 4OFZA 1T5TA 1QH9A 2G07A 3PGLA 2B1RA 1TJ4A 4L6AA 4BEVA 4J2TA 5AVTA 4Y3UA 5AVSA 3HYCA 4UMVA 5AW4A 1WR8A 1Y8AA 1L7NA 3UMGA 1ZS9A 1YNSA 2HF7A 3I28A 3AR4A 4FYPA 5AVXA 4Y2PA 1EK1A 4FE3A 3U19A 3PCTA 3EF1A 1J97A 3AR5A 4ZEVA 3QUQA 2HEGA 3P96A 1KYTA 1Z88A 1XVIA 5AVZA 2BDUA 3I76A 2B1QA 2ZBGA 2HHLA 1QQ5A 3RFUA 3SD7A 1ZRMA 3WK4A 3QXGA 3WGUA 4C4SA 4OD0A 2YJ5A 3B9BA 4I9GA 1SWVA 1QQ6A 4XOUA 2G09A 1K1EA 1RRCA 4KX5A 1U2SA 2X4DA 1VFPA 4FFDA 2HCFA 5AK4A 4NWIA 3U7EB 2C8LA 1N9KA 2G80A 2YBDA 2FPUA 4RESA 4E88A 2JARA 4HGQA 4DW8A 5AVQA 3QU4A 3UMBA 5AW7A 1Z4LA 5AW3A 5AI6A 3E58A 3ZW7A 4BKMA 1U7OA 3MN1A 4AP9A 2WM8A 2OA0A 3FM9A 1Z4IA 5A3QA 3BA6A 5AM4A 2WF9A 4PNHA 3QUCA 1ZD3A 3WKCA 1LTQA 1L8LA 5AI4A 5AKLA 3U7HB 5ALNA 4L57A 5AESA 4UMEA 2WHEA 3L8EA 3ZVLA 2YJ6A 4YGYA 3AR7A 2JGAA 4YIHA 1N8NA 4UARA 3L0YA 1NF2A 3OCXA 2GFHA 3ZWKA 3MC1A 3L8HA 1NRWA 1YJ5A 3OPXA 2AMYA 5AM0A 3ZI4A 3NANA 1O08A 5ALEA 2OBBA 2CFSA 5ALJA 4IG4A 4KNVA 3WK6A 4JDPA 4CE6A 3IB6A 5ALZA 2ZXEA 3ET5A 1RDFA 4UU1A 2G0AA 2FPWA 1Z4OA 2P69A 4NAVA 4KYTA 5AKEA 5AICA 3A3YA 3W5CA 5AM2A 2B8EA 3U7FB 4ZEXA 2PQ0A 4EZEA 3KC2A 5FP0A 1RQNA 2WF6A 3B9RA 1YS9A 1FEZA 3K1ZA 3KZXA 1EK2A 2CFRA 1Z5UA 3N28A 4YH1A 5ALOA 4BX2A 4CF3A 3EF0A 1L7PA 1Z4KA 2Q5EA 4XPZA 1L7MA 3QU2A 4Y2VA 3L7YA 2JAUA 3U7GA 5AKHA 5A3SA 4UM5A 2B0CA 1SWWA 1Z4PX 5ALLA 3FPBA 3WKAA 2G1AA 3FPSA 3QU5A 2CN1A 5AKGA 1TJ5A 3DAOA 3B8EA 4CF5A 1YDFA 3UMCA 5AHXA 4AS3A 4XQ0A 3CZ4A 3WKDA 5ALUA 2OYCA 1T9ZA 2HOQA 5ALDA 4UMDA 3R4CA 3AR8A 4C4TA 3SKXA 1TE2A 2YFYA 2YJ3A 5ALVA 2ODAA 3NIWA 2PKEA 5AKIA 2HI0A 3N1UA 2HF2A 1RKUA 4F72A 3W5DA 3ZX4A 5ALWA 2ZOSA 1U7PA 2AH5A 4BBJA 3AR3A 1YMQA 2B82A 5ALPA 3I1YA 4J03A 3F9RA 3A1DA 2BDEA 4NV0A 4Y2TA 4UW9A 3W5BA 5AI5A 1QQ7A 3L8GA 2ZBDA 2C9MA
chains in the Genus database with same CATH superfamily
2K6GA 2EYQA 2WYIA 5DCUA 4KV9A 5AHWA 4QXMA 1IVSA 3HKDB 1T9GR 2C99A 2WDPA 2VWQA 4UTZA 1KJ9A 2NSDA 2FPRA 3MAAC 2RBEA 2AC2A 4INAA 5IM4A 3ZD9A 4LOKA 1L4EA 3HYSA 2DKNA 3LLUA 3OHMA 4RIEA 2NSLA 2O4CA 4GGPA 5E6RB 5EJMA 3OQ6A 1NNLA 1JDZA 1Y9EA 3PF8A 3ZUPA 1VP3A 1YBHA 3QZUA 4CKEB 3T54A 2GESA 2WF5A 3PNSA 3PQ5A 4FMPA 2VQ6A 4YAIA 5ABPA 3V8QA 2H11A 2HU7A 4L2IB 1GPAA 2YWHA 4LZNA 4WIAA 3W2TA 1P1BA 3DP7A 4KL8S 1VSTA 3E9EA 4F9EA 5P21A 1AD2A 2WIFA 4N40A 1BE0A 1IXYA 4PZYA 1QCYA 4KK4A 2O14A 3UN1A 3JAMA 1NLUA 2QPAA 3V33A 4EHIA 1E1KA 5ARCA 4P7JA 3MIIA 2P8SA 4M1OA 4PO3X 2DRIA 4LF4B 3DCYA 1HE4A 2VYQA 4MR8A 3GIWA 1SAYA 1I9GA 1XU9A 3IR7A 2WRZA 2HJGA 5FOSA 1UOPA 1QXSA 2C95A 3RC8A 4WBNF 3KQLA 1IOVA 5KS2A 1IHPA 3QIVA 4L1KA 1QNLA 1W9MA 2INGX 4WBNA 2DPXA 2IZ1A 1V47A 4B5KA 4EKGA 4LJ4A 4DV6B 1Q0TA 3R09A 3VKVA 1MH1A 4TS3A 1G64A 2XOKD 4HAVA 3LHSA 2Q1SA 1E2HA 1MX5A 1BQEA 1J9EA 4JJEA 1FQWA 1RJGA 2XA9A 3AP3A 2ISSD 1BA3A 2BEWB 3FRHA 2QIOA 1T25A 4ECEA 3A31A 2PSEA 2O8DB 5K3AA 5I9BA 3PDJA 1KYIA 1KO4A 4M54A 5JJLA 2HN9A 1OFUA 4JP1A 2W4MA 4NTZA 4TLLB 3OOHA 4TMTA 1LLQA 2EBWA 2HWWA 3FDXA 3GPIA 3Q2IA 2C2HA 3ZWDA 4RFLA 2Q41A 3I64A 5JLJA 3CT6A 4XARA 1DKLA 1KSGA 1F2UB 3GNLA 2XRZA 3KIPA 1FK8A 1DCTA 1JDUA 1RFGE 2VHTA 1QK4A 4EGJA 4IMJB 4OQYA 2ZWOA 1T2UA 1CIPA 4PG7A 4Q4HA 4D9BA 3ZVKA 1CUZA 2QRUA 2HRCA 2YRWA 1S2GA 2J9XB 3HSKA 4IV8A 2EJBA 4DLVA 5F7OA 3MRXA 2GRAA 4LGVA 2PT5A 4YWJA 3O95A 2CF6A 3T06B 2ZQ5A 5KYNA 4AROA 5CDFA 5B3JC 4MPRA 4KVGA 2EF1A 2FZKA 4M1SA 5HSGA 4UBOA 2RAUA 2GK3A 3S7ZA 4C06A 2PMCA 5CB4F 3D3KA 2AUNA 2RHHA 3LHIA 3L0BA 1KMNA 1R15A 3KKMA 2DR3A 4RHUA 5IH7A 2RKOA 4PY2A 1IB6A 1FU8A 2Q0SA 4O08A 4YJGB 1GY8A 1LSSA 3BSWA 3CGGA 4LQDA 4YJHB 1KU0A 4D6PA 4GECA 5JW6A 3EEOA 1QYDA 3ZWVA 1TUIA 1Q12A 1RVDA 1H2ZA 3HB1A 3B1KA 4OPMA 4RVNA 4RTPA 1GYQA 1NQAO 2ACWA 4JKIA 4WADA 1AMUA 1VI2A 4INOA 1US8B 1BJRE 1JLMA 2ZUUA 1M1YE 3OSZA 2Q3DA 3OT1A 3V4FA 5L4NA 4Z7QB 1XNQB 4PZ9A 3BE8A 1WUYA 2WW8A 3OJXA 1FFDA 4HGRA 4GPAA 4RFSA 5LQJA 1NJ2A 3WBFA 2PLWA 2DUMA 4MUJA 3AUKA 5BSTA 2ID9A 2ZIEA 4EF5A 5CH5A 2MSDB 1P0QA 5THXA 4IEEA 2I6GA 2Q5JA 1UIRA 4L08A 4UEJA 1W94A 3LECA 4V0SA 2VDJA 4BB0A 1Z0JA 2E49A 3NDPA 2HKIA 3SC6A 2IXBA 3DVAB 1DPFA 4KWHA 4DJAA 4MW2A 3G9UA 5FA8A 4U7HA 4ZDIA 3ADBA 1PVOA 2C88A 4DSUA 1SC4A 4PPGA 3ZCVA 1ONPA 4MGZR 4YV7A 2AYZA 2BMAA 3BFKA 4BNMA 4IJKA 1P39A 3WB0A 4TSFD 1XTJA 3H83A 1IM2A 3Q4GA 3SYNA 5HRAA 3H75A 2GM9A 1HOXA 3FNFA 3KAQA 4N5DA 3JVVA 4XWWA 2VXOA 4JT8A 2OV8A 5TS2A 4ARIA 2VTKA 3KJXA 3ENZA 4EPRA 1IONA 1DO2A 1EGHA 1Q0UA 4MS1A 1CRWG 1E79D 1RYNA 3BGOS 3LC1O 2FCRA 3OLWA 2OG2A 3KOWA 4XTCS 3VKUA 3D3WA 4I3GA 4GKVA 1OIVA 3LW7A 4GI3A 3VC1A 1U99A 3S44A 2HO4A 3FDZA 3UGTA 1OT5A 1DCMA 1ZSYA 4CUZA 2WWWA 5EINA 1NQVA 3VDRA 2JIZA 3H6HA 1P2VA 2OK8A 4D1YA 2JJ2A 3BG5A 2OQVA 3HP1A 4I9NA 5EXXA 3DBRB 3ECCA 3GWGA 5DW3A 4DEYA 4WVFA 1RI5A 1J8DA 5JHHB 3IUQA 5BUCA 4AIRA 3D5TA 3HCCA 4GSYA 1O95D 3AEYA 4FFOA 4U7PB 1Z38A 2C1ZA 2D5BA 5AKXA 3TIGA 3ZE6A 3C16C 2DM6A 4YJ2F 3D9QX 4ND8A 4YMLA 4GUDA 1ABEA 1IEXA 2JPDA 3BWYA 1GRNA 1QO0A 2PX4A 4IPTA 5CVCA 1ZM7A 3DOEA 1ZOLA 3DSRA 5ENDA 3H18A 5F7JA 3FMOB 3L8DA 4ZALA 3DYBA 3SJCA 2AEJA 3OFJA 4ZI5A 1L2TA 3B5EA 2QQFA 3EDCA 4NBSA 2ECQA 2V6JA 2C4HA 1ZUNB 2RHWA 2WZCA 4D0LB 2PT6A 3NH6A 4D6XA 4JQCA 5KVAA 3AP2A 3EOBI 3BHNA 5C5IA 1R66A 1T4BA 2VHWA 4FE4A 3ROMA 4DSZA 2VHCA 1PDOA 3F46A 5E1DA 2H1RA 1XEAA 4TL8A 2HCRA 2DYKA 4RPJA 4C05A 1FFXA 1IIRA 2AI3A 2JJ8A 2V9PA 3H3XA 1KYQA 2V4UA 4PSCA 2GS9A 5HIIA 1UBNA 2Y27A 4RKYA 4OGLA 4EARA 3GRRA 5DOVA 5AVWA 3K2BA 2E4VA 3L7LA 3DVLA 3DFUA 4RMJA 1PFVA 3H97A 1UPBA 5EHNA 3TINA 2GASA 1J2RA 3B9QA 2AI1A 1G5IA 2PR7A 2RJNA 5LB2A 1L3BA 3QI7A 5IP5A 2AZMA 1YZHA 2CB9A 2ZB2A 1ODLA 4ISCA 4O4HA 4Q82A 5IAKA 3SR4A 5BPHA 4YLEA 4FEGA 1A7UA 3TKAA 2FMTA 3KL2A 1IMJA 4CKBA 3VR6H 3KVVA 1UMDB 4CLEA 3RB8A 3GVXA 2I2CA 2F62A 1PSDA 4HN2A 4CTKA 2JS7A 1G1MA 3F5DA 4Y1FA 1C8KA 2KMLA 4DRXB 1R50A 4GVLA 4N8DA 5ALMA 1KJ8A 1KYVA 3G2PA 4CQMD 4PLVA 4DXAA 1RTTA 4JLUA 3EGDB 4OBEA 5DYWA 4JLWA 2E4UA 1TTPB 3U31A 5C35A 4PRYA 2VBIA 3PCRB 4R2LA 1O97D 3QPBA 1TMKA 5L95A 4TN1A 4BGVA 1EFVB 2YS7A 5EWLB 1U6JA 3WC4A 2XQJA 4GVPA 4IXDA 4ZT2A 2A4MA 4R1OA 4L6AA 3ABRB 3EYAA 1I7QB 2B34A 3FTDA 1E6CA 1T8PA 2Z2YA 3ROZA 1JHMA 1RS0A 4KQJA 1EIZA 2ZJYA 4K8RB 4MARA 3RTEA 1GP2A 1XZKA 4E31A 1N0UA 1PTJC 4R3WA 3RS5A 1AHPA 3TMYA 4AUEA 5LNK6 3TR0A 2IEZA 3V1MA 1P17A 1RXWA 4YRNA 3BHIA 3GH1A 4DCNA 5CVDA 1K8ZB 4LRUA 4MWZA 2JLSA 1YA4A 2C20A 4MQFA 4AI6A 1R6AA 1XVVA 2VDPB 1ND6A 3AR4A 4FYPA 3ZLTA 3WLQA 4BNVA 4EI9A 1FDSA 3A37A 2J0SA 3JAWA 3TFOA 1FRNA 4I5GA 5IAGA 4EYSA 2CEKA 4ZK6A 4R1PA 3HLYA 1EM8A 3BIOA 3E1KA 3I6ZA 3T61A 3LBYA 2JDID 2OENG 4A82A 1Y9AA 2IU3A 3I76A 3O3MB 4JOBA 1JEYB 3LUAA 1VYHA 3TQQA 3JYQA 2VUHB 4P80A 1B26A 3JQ7B 1RLUA 2PZGA 3VO9A 3R9XB 5J2UB 3A0UA 5LQDA 4BECA 4GOLD 4EW3A 2IKSA 1NTRA 1GPH1 1T35A 2O0MA 4MSUA 3T5MA 3TRDA 1OB5A 1U7DA 4BMXA 4Q9AA 3DE5X 1RJ9B 3NKLA 4LWZA 2PRJA 5EMNA 4URXR 4QBTA 3VI3B 3WGUA 3A06A 5A5EA 1QQ6A 2VHQA 4IHKA 1IJEA 3OE7A 2Q1UA 1W76A 2NU6B 4L28A 3TJRA 3DKKA 4EUKA 3HADA 1GPDG 1KMHA 2O8FA 4NU6A 4BTLA 2I6UA 2PD6A 2ZRJA 3JVUA 3QPUA 4OHVA 5AHOA 3RTCA 2GVZC 3GDHA 4Q4AB 5SY6A 3VAAA 2ZRQA 3CW8X 5KINB 1E0SA 2H3EA 3HFJA 4KGZA 3RREA 3TLZA 3W9YA 5EJ4A 1ZLYA 4EA7A 2ZRKA 1YB6A 3RS4A 3CVUA 1CJMA 5LP1A 5ER9A 3OG9A 3VR6A 1N1DA 5F9FA 3B3FA 1H8EA 3D4BA 3TBFA 3WGZA 1IZYA 4AY3A 4EB6A 2AZTA 4LHVA 1RCFA 5GPBA 1GKUB 3LXRA 3LDFA 3H04A 2OBYA 5EL0A 3V8BA 3RQIA 4BE9A 4HPJB 2HJRA 1U3WA 1A27A 3I01A 3U4GA 4XCXA 1J70A 4PX2A 3V1YA 3EC7A 1PHPA 4HEHA 2CDAA 4YX9A 1H1TA 1ULHA 2QDKA 2XUGA 4M36A 3U4HA 4IIXA 1JZTA 2H18A 2SBTA 4PYKA 1ILEA 4D9HA 1OXUA 1FP6A 1MJHA 2PO5A 3GRPA 3Q5EA 1U0RA 1ADGA 4RGYA 1X1AA 1JXQA 2VJAA 3UWPA 4NJEA 5F64A 1RAAA 4AQDA 1MV5A 3TAXA 1NFFA 1NBWB 1ZICA 1GNSA 3VNRA 2E6KA 4JI7B 4ZGGA 3P9ZA 4FFSA 5ALJA 1MPXA 2A7QA 3R0VA 4CM3A 1EJ0A 1KL7A 1M6NA 4NNOA 4ZAYA 3KLMX 4MW6A 1FYVA 1P91A 1VL5A 5G3YA 4FM9A 3W8NA 5J4VA 4CT4B 1MGPA 2BW0A 1Z73A 2IU4A 3GRUA 3GROA 3WYCA 4ANFA 3VHQA 4PG8A 1CG6A 3KLOA 4MICA 1JEQA 2I71A 1RACA 2VH5R 4LCEA 4WXYB 5PNTA 5T6BA 4EY4A 3PQFA 2EIXA 2IBSA 1MC4A 1XZ8A 3GFPA 5AICA 1P1JA 4P34A 1BMDA 5FTJA 1Q0SA 3F9IA 3KYCB 1V7QA 2Z2IA 3A10A 2XT0A 1Z0SA 1N4DA 3BTUA 3ORSA 3RVMA 4FWIB 3ZK7A 4EZEA 3KZMA 1HOTA 2VTVA 4E7PA 3UV3A 3WA6A 5G3ZA 4YMHA 2LTAA 4DCTA 4HG2A 1NY5A 2MYPA 1AZLA 1FX0B 5TF4A 5C5DA 3IVXA 4IFEA 1GKYA 4H1HA 4BX2A 4C21A 1THMA 4QXAA 1G9SA 4YLYA 2GVDC 2RCYA 2B7LA 4I2VA 2QA5A 5B7PA 1CYEA 1V8PA 4RK6A 3ZDAA 1DNPA 1FFBA 1UKYA 3NTRA 4GC5A 4Q4JB 1U0BB 2BTQA 1MJGM 4PONA 2IHBA 3N2GB 4MO9A 3U39A 1IM5A 3WKAA 2GN1A 1QIJA 3HGMA 4HWOA 2HQSA 1MT0A 3G0GA 5D00A 2YIVX 2WA2A 5ECWA 5IMBA 3OO0A 4HGYA 2X7XA 3DLAA 2PX3A 1PG5A 2BBOA 4I6GA 4MQBA 4X20B 1KYYA 1L1FA 5DTIA 3A1UA 2CVOA 3UMCA 3L4KA 4UOEA 2R4UA 1CUVA 4WOJA 2EEZA 5E7IA 2FX3A 1C8LA 1SXHA 3UT6A 3AVTA 3AXTA 4EZIA 2OZKA 1R7RA 2GR9A 1X13A 1YQWA 3SIPA 2FZVA 1P8JA 2QAGA 2BL4A 3DGEC 1O6BA 3EVNA 3FCCA 3HLKA 3QXHA 2AX4A 5EP3A 3JQ6A 1JE1A 3ELUA 1ZQ9A 2X6QA 2FZ4A 1K7YA 4J16C 5GONA 5B1DA 3VR4D 4HAOA 4YP9A 5HFNA 4BMCA 1WSDA 4JZKA 3O8RA 3LC7O 5B3AA 3ODPA 2ZVQX 4JJIA 2J3KA 2BP7A 5IKOA 1UMCA 3DEFA 4NCHA 3VNBA 3X1ZA 1ADJA 2C2KA 3AR3A 1YMQA 2B82A 3BDVA 1HQCA 4PSDA 3OZEA 2WB2A 3T94A 4KJXA 3K4QA 3VSAA 3X1YA 5HFAA 5AJUA 2VP0A 1ZM2A 4NV0A 4C04A 2CHVA 3DWFA 3RUHA 3I9MA 2FUG6 4P53A 2D13A 1GVNB 1FU4A 5FBQB 4ZHQB 1G55A 2CXOA 4AO8A 1TO2E 2QK4A 1O5TA 3V4PB 5K45A 1WB5A 4G0MA 1FW8A 1QHXA 1PQYA 3ICOA 3TTVA 1YMUA 2W6JA 4J6FA 4FDLA 2O50A 1L4NA 3AV3A 3IRVA 5K2MA 1A4IA 4G86A 2QTMA 3FDJA 3BD6A 3RRXA 3IR5A 1RYDA 1K75A 3MOSA 1F8GA 5F77A 3W5IA 3MWYW 1K8YB 3PXCX 4KXYA 1T3SA 4D4HA 2PPVA 3D6HA 4AG5A 4AN1A 4C07A 1OI7A 5BRNA 4A36A 3P45A 2R6HA 3C15C 2WU3A 4WN9B 2XE7A 1KZYC 3O47A 1Z4NA 4QRDA 2FF5A 2Q5CA 2HIGA 2OBLA 3CLHA 3O1LA 2OB1A 2ZULA 4HWGA 4S1NA 5CA1A 3T99A 5DXJA 5DBGA 3IVAA 1A9QA 3DCNA 3R3WA 5EIFA 1A8UA 2VSNA 4KVFA 4BXOA 1MJGA 3H3FA 1X3LA 1GLGA 3WGKA 1BAPA 1H05A 2GWRA 3V1KA 2M6KA 3P5SA 3VAYA 4ZMSA 1DC8A 3ZUGA 3OQBA 2X6TA 4AIIA 5DBEX 1UOQA 1G9XA 2RK4A 2VP4A 2AN4A 2QE7A 3UWSA 3P5BA 1ZFNA 5D85A 4PCUA 5JECA 2G9QA 5LQAA 1T5HX 1USIA 1VG9B 3DBHA 3U3RA 4X7MA 3HJTA 4J4TA 4PZDA 4Q66C 4DL9A 2J0EA 1RZUA 3MJSA 5AVVA 3VC7A 4TVKA 5JCJD 4QODA 1FLDA 2F17A 2RGGA 2XNSA 3AF2A 3H0EA 1E9DA 1TA4A 1X1TA 5BR4A 3PGXA 3HKEB 4R2MA 4R7GA 2ATXA 3OAAD 4MITA 1K5DA 4DYHA 3PDUA 1RABA 1KERA 2IC5A 1YVRA 3K2EA 2BFEB 1L8OA 1FYXA 5DV9A 1XC7A 2WBLC 3WDSA 4CG1A 6LDHA 1SRRA 1V3UA 2GGSA 1SBTA 3LM8A 2ERXA 2C03A 1BJKA 2VVTA 3IS3A 4R3NA 4K9RA 1K08A 5EZSA 5BVGB 2JFQA 1LU9A 3LGSA 1N2CE 4KQCA 4WY8A 1HNZB 1XIVA 4J0JA 2GLTA 4A16A 5L9AA 1UBTS 4Z0HO 2OPHA 1KRHA 3R3YA 3L05A 3NC0C 4OGFA 2UUPA 1DHRA 3BVPA 4Q48A 1ESZA 3UG6A 4LZOA 4BRZA 2EF0A 4IOMA 2HSEA 1XCBA 3EVZA 3ZLVA 4RPGA 3N2KA 2EFYA 5ALHA 2WJPA 3M6UA 1U1EA 3J7TA 1KZ9A 4MRSA 1P77A 3FKJA 3IRUA 4JSRA 2CXTA 1AF7A 3OJ0A 1E7MA 2ODWA 3OIFA 3TOZA 5FT9A 1LXCA 4YY3B 5LQKA 4BJ3A 3HJCA 1IHYA 1YDGA 4HGNA 3RO7A 2ZRHA 3OX2A 3EMDA 3PLNA 2N3ZA 3TZKA 4C0QC 4EWLA 4ZTZB 1UXGA 3KQMA 5TV2A 4A2QA 3JQRA 3Q0IA 3RIMA 5IXYA 2C96A 3KX2A 1JDSA 4FK8A 4OHPA 4U2CA 2FEWB 4G0WA 1IHXA 3K53A 2IEBA 3NKVA 4GMDA 3JRXA 5KSYA 3CVWA 4JXJA 2YMPA 4CKXA 3DJFA 3GQVA 2AZXA 3JWEA 3KSDO 3T34A 4I5EA 1P6XA 1HKHA 1QZTA 4IXWA 1IZ8A 2DSNA 2V7PA 2R66A 1ANKA 4OHWA 3IE0A 5TLSA 1M0TA 4N9WA 4CM8A 1T3GA 2I9PA 4PLCA 4WZBE 4OIFA 2O07A 2PV0A 1YL7A 2B4TO 4GL4A 2R5FA 4ZVSA 1Q91A 4ZQEA 1X8XA 2F7SA 4ZQIA 5DWQA 3SJBA 2BYTA 2F59A 3UHOA 1KFKB 1VLZA 2H5LA 3E22B 4CMEC 1OYVA 1G5RA 1DKRA 3QU7A 1KVQA 1VYVA 2AJ8A 3MJDA 3EPPA 5T67A 3ORRA 4WL0A 4PLTA 1S0UA 2PEZA 3KR9A 2QN6A 1SOVA 2CZQA 1Y9JA 1WCYA 2C94A 2XYGA 2ZYUX 2ZUVA 1R27A 4NARA 2OD9A 2RHBA 5ITSA 1QDLB 5HW0A 4HSGA 2X0NA 5CU7A 3DM5A 5L7YA 3SXPA 4DAEA 1YR2A 1OXSC 3C8ZA 1JLSA 2GEDA 4X0EA 2O3JA 1L7XA 2O7VA 2P7IA 3RQSA 5IUKC 4WOCA 1KBQA 3MCAA 2H5EA 2O3UA 5B37A 2VEOA 1I80A 4X1IB 4B17A 4M8KA 2EKZA 5BRAA 3AEZA 5JHGB 1GTG1 4WASA 1F20A 1XZIA 3HZZA 5C53B 3DTVB 5TEWA 3HU3A 3I6MA 2H59A 2Y1GA 5E0OA 1V95A 3T1TA 5F1OA 2QLJA 3Q9NA 4RUKA 5AW2A 2QYHA 2UKDA 2HRDA 1T3ZA 3HCWA 3M4YA 1PUIA 1OGYA 3ZPXA 3K15A 1D0IA 1PGOA 1ZRHA 4F85A 2GAOA 2PKYX 1JT2A 2FHPA 3D3JA 3OBIA 2OY0A 4M22A 1A69A 3RIYA 3LFHA 5M04A 5IBPA 4O6VA 3EGEA 3EIOA 5U4XA 3QUTA 1GXSB 2PGLA 2I2FA 3DFFA 2P1ZA 2AKAB 2BH9A 3PRYA 1AH2A 2X8JB 4NDAA 1E0JA 1GRQA 3HA3A 4IGEA 3JYHA 3AUSA 2HNBA 2DOKA 4RZQA 4LHXA 1XXHA 4JYCA 4QG7A 2RMKA 1ZJWA 5BYJA 3C5EA 3AG6A 3NIBA 3FTNA 1J33A 2V7UA 2UVDA 3GJ7A 4OJYA 2LCIA 1AHIA 1ZC3A 2VAXA 3D1VA 4MA5A 5TIIA 1B6GA 4G4GA 3QNMA 4HWSA 4BZXA 4LMRA 4A27A 5JAPA 3IAFA 1XZEA 4RVDA 4J0KA 1EGQA 3AY3A 2BFWA 5HBRA 1L4MA 4OU5A 4G9EA 4H18A 4MRMB 5DMXA 5KYUB 3QE3A 3I6YA 4FT4A 5EZYF 1U5CA 1P9LA 1GYPA 2XUIA 4LDQA 2WIDA 1AQIA 1E6MA 1RQXA 5JWHA 3WBKA 1LLUA 3ZXSA 1NWCA 1WUHS 4C22A 1C9YA 4EB3A 3K1YA 3OZIA 5ECGC 3PFWO 4LX0A 5JSYA 3VHXB 4A2PA 4L76A 1LJLA 3ADKA 4HWTA 4RLSA 1IUOA 1JR3D 5T3YA 4NCIA 1R6UA 2LDXA 2I6FA 3DJYA 1A72A 2HFJA 4EPVA 5HZKA 4FOOA 4YRSA 5LOVA 1HO3A 3KBOA 3KFLA 3KEMA 3HLTA 3E6AA 4QJ5A 4DSOA 4JROA 3KZCA 3H7AA 4NZNA 3CXUA 4FGKA 2V65A 4MK4A 2ODNA 4O0LA 2BR5A 3TPFA 2UUOA 1U0TA 3H2HA 3WLKX 5JDCC 3T9DA 5JCPA 2PIAA 4L9RA 1SKMA 2II6A 4C7MA 1XRRA 1HZJA 3BSSA 1DT5A 3AR6A 3PSAA 4TGLA 4NLLA 5B58T 1EFHA 1NN3A 1RXUA 4W6QA 5EMKA 2GUGA 2AFIE 4AG6A 4B3JA 5CPFA 2IOFK 1AS0A 4WK2B 1RRPA 1YA8A 2OLJA 3KKPA 2AN5A 1NQTA 4MMZB 1Q2UA 1SC3A 4X8HA 4I1VA 1AKNA 4FJ0A 3WGLA 1JLRA 4JJKA 3QPAA 5FWYB 3RAEC 4YJFA 2GD2A 3PTZA 1ZK3A 2XCQA 4PX9A 4DV1B 3C3PA 1VBMA 4N48A 5IXSA 3WQQA 3WWDA 2Y71A 3GUYA 4RV5A 3KSBC 4TXHA 3OUUA 2QEQA 2OFFA 3ZJ4A 3MT8A 2E37A 4TYQA 1YE5A 4P4UA 3GMIA 1NJ1A 1QYRA 5ICEA 2GNPA 2QWXA 1T3HA 4Q9JA 3SJ7A 2LIVA 1QIEA 4P81A 4UMVA 2W6IA 2CL6X 3OTOB 1TK9A 1NJFA 4EL0A 4PHGA 4TKUA 1B6TA 3FMIA 4WWHA 3E82A 4AD8A 2HM7A 2J85A 3HYLA 1WV0A 4ZPXA 1UJCA 1ZGAA 1R0YA 1KVRA 4HNHA 4CV1A 1D1SA 5EHIA 4OK5A 5JO9A 5BV1A 5DOZA 2BI8A 3CUTA 3I28A 2RKWA 4NCKA 3RSLA 1QG2A 2CDCA 3FROA 1N3YA 2O2JA 4NDNE 3TSZA 4P5DA 1FMJA 3CUYA 5FI5A 5FBWB 3DLIA 4FXPA 5E95A 3IBGA 1RHKA 3FI9A 3DVRX 3U61B 1HRKA 3PGKA 2VWHA 3AJ9A 4HEQA 2VDWA 1FRQA 2OG1A 2V9ZA 4GX2A 4M37A 4Q3BA 1JP7A 1YZUA 4U6QA 3IT3A 3W7VA 4YR7A 5DEOA 4EBBA 1BDHA 4GYKA 2GF0A 2Z95A 4G2NA 4L78A 4MA4A 1FTWA 3LLMA 1R2QA 3DDCA 4UZSA 4HAUA 2PUJA 2YYAA 3AFNA 4EEZA 3KTAA 4YP1A 1HPLA 2VAMA 4NNPA 4D56A 3EPLA 1HZZC 1V71A 2NQTA 3MK31 2JCXA 3TDKA 1TO1E 3WK4A 5G0UA 2WWIA 1SWVA 1DB3A 1P9WA 2C2YA 2H00A 4AX8A 1BXRA 1OPXA 1K1EA 2EERA 2WFLA 4RGQA 5H9WA 3QW2A 3BMNA 3CLUC 1J1UA 2O5CA 3W8DA 4C6SA 1G9TA 3VPHA 4AJPA 1N7GA 1DO8A 1OAAA 3A3PA 3DWIA 3FTCA 1Z13A 2IYQA 2XODA 3I1JA 2NAPA 4ICIA 3W5VA 2XXAA 3KQHA 3OETA 3CGWA 3L40A 3ZHRA 1XLUA 1UQTA 1S3IA 4OXNA 2XAAA 4O2RA 3RC3A 3HUUA 1H6DA 5AW3A 2Y1WA 1RYMA 1EI9A 2HHAA 2OHXA 3AF5A 1DAGA 3MN1A 1QCDA 1SCKA 4QLBA 1Z39A 1G21A 1PQWA 4EECA 3B60A 4PU0A 4NCAA 1LX7A 3ETNA 2WF9A 4CM9D 1WP9A 3WKCA 3DR3A 4HK4A 4Q1FA 3E5MA 1XOIA 5IC5A 1X7YB 3BL8A 5J4KA 1Y6QA 5KOHA 3GRVA 2O06A 4WUVA 1FU7A 1OKKA 2JFBA 1A7JA 4HH0A 3G9QA 4GMKA 3H9EO 3UQYS 1ZVMA 2AMYA 4F4DA 1JE0A 4MR9A 3NANA 3W06A 4EF6A 2VWPA 2ZDHA 2JKVA 1H0HA 4KB5A 1KQPA 5LYYA 4JP8A 4MV1A 2X0EA 1S2LA 3GVCA 2NO1A 1WXWA 2WABA 3CZRA 4KTTE 3ROEA 4BO1A 2VO1A 1T0BA 2QZJA 2HADA 3ZHOA 2KI5A 5CVTA 5CDFE 4X93A 2VNSA 3HZRA 4KXVA 4WNIA 2G7ZA 2ZZNA 1GUYA 1W85B 2ZYHA 3OM0A 1UKVY 5FPSA 2ZIUB 4E4YA 3GLGB 3VGJA 2IZ5A 4C5BA 2H29A 3AWIA 4B3CA 2ZRGA 2QVLA 2ZB8A 3GLRA 4LGMA 3C3WA 3L02A 1FIUA 4FKZA 3RASA 3H2IA 3ENKA 3NJRA 1DBQA 1NVTA 3IEPA 3ZU5A 1NXVA 5KWJA 1KZGB 1CQIA 4YMSA 5K8CA 2F3QA 3K0FA 5ECDA 4JX9A 4P3XA 4KCGA 5FP0A 1GUZA 1I1HA 1SZPA 4LC0A 4P38A 1ZN8A 1K8QA 5ELXA 3IQWA 3OPMA 3K1ZA 4RTSA 1BVRA 3NOXA 5DGXA 2AEFA 2BJHA 4YBRA 2BI7A 4I50A 5M3BA 3C8UA 1E6WA 3ZN2A 3OJEA 1PWZA 4HWRA 3NBQA 5LFAA 1RHQA 2XCRB 3TDNA 4O1HA 1SY7A 2Q9UA 2GFQA 4S1TA 3MCTA 3RJTA 1BDBA 2FLWA 2UVPA 4DV5B 3HYNA 2HV9A 3VDMA 1NP7A 3ND6A 4NQRA 3B3AA 1NJ6A 2VPZA 3L07A 3OM9A 2OCXA 3QU5A 1E1YA 3R0XA 1E59A 2ERYA 4RNDB 2MYNA 2YIDA 2HH9A 4MS3A 1PYGA 2AW5A 1VHLA 5JJKA 1TD9A 1ZH2A 5AHXA 5H02A 2QBYA 4DA9A 5FQOA 5JMTA 4P0PB 3BCHA 2J41A 4HDMA 5CH8A 3E4DA 2BWJA 2AE2A 3TTWA 1XMSA 3EPJA 1FS5A 2C42A 5E3IA 2AWOA 2Z5VA 1TIKA 3UAXA 2CYAA 2WVAA 5A5FA 2DHRA 1GO2A 2XT6A 4QTYA 2D0PB 3CF0A 2GAFA 1Q20A 2PH3A 1RM0A 3GNQA 3USES 2PE5A 3NIWA 4IXNA 2BFBA 1GLVA 2ECFA 2AC7A 3PNKA 1ORRA 5G4KA 1Z06A 3BRQA 3C3MA 1BU5A 4QUAA 1GGHA 2HRQA 3GT3A 2XUHA 5DT9A 3ZHXA 2XRMA 5HX7A 1TAGA 1N6KA 1P74A 1RCUA 2W6NA 1CVIA 3CNOA 1M2GA 2C5SA 1YRQA 1I7SB 4QYIA 4C0AC 3OA0A 5DN6D 2FMUA 4P92A 5LZ7A 4J3JA 1S2DA 1OBCA 4KOEC 3RUFA 2IEAA 1WEKA 4GPD1 1SU7A 1PX0A 1WOMA 3SIRA 1H2XA 1I6MA 3OZFA 4XJVA 1DJOA 1OFVA 1R64A 2G6TA 1TO6A 2QLFA 1PK9A 2BCJQ 3P7MA 2F55A 1KEWA 1UF9A 3C3EA 3E48A 2EL9A 3K3PA 1N25A 4JLNA 5HS6A 3OP1A 4JJ7A 4BV3A 3K2IA 2BE7A 2I4MA 5EWMA 3UMVA 4DC1A 2XB9A 2R6JA 3MWKA 1Q92A 3PPWA 4HY3A 5BWOA 1N2IA 2E7ZA 4WN3A 3O8LA 5LIPA 2PQ2A 4EY5A 1O6CA 3WLSA 3C5CA 3GJRA 2FP4B 1QO7A 5AW9A 1N33B 1VIAA 5LUBA 4JB0A 3GT4A 4DMHA 4JXKA 4F11A 1MABB 5B2EA 3TW4A 1WUTA 1ZH4A 4PQEA 2EHJA 1DZ3A 5GJWC 3D1LA 5CD9A 2GYUA 1D0SA 1SCUA 3AV0B 4Q1EA 2UYGA 5DPMA 5G0SA 3X1MA 4W99A 1XDWA 5FNVB 1O87A 1U94A 5BOVA 2OGZA 5CA0F 4Z53A 4G36A 2C7QA 2HWYA 4CLDA 4ZTUB 4GP9A 2BHLA 5LCXA 1KH3A 4E2WA 3T9EA 3U44B 3SQDA 3ZBPA 4B85A 2REQB 4IHJF 3NUZA 4UOZA 1QIKA 2VJPA 1TIBA 3DMRA 2MINB 4HQNA 2HCBA 4QBKA 4IHJA 1X0XA 4W7IA 1LNSA 4PGMA 1YDMA 4CMJA 4V1CA 2JEOA 1XYGA 3S1LA 1HC7A 2Q4EA 1H9AA 4QJBA 3HRHA 4UUPA 2NTNA 5BR1A 3V46A 3ESZA 3UK1A 3I61A 3L6BA 1ZM3A 4QBFA 4JBIA 1P0CA 4EUHA 5JS6A 2D7CA 4M60A 4R5MA 1N5RA 3JCZA 1EP2B 5IAEA 4WVLA 4M0PA 4RGBA 3H6KA 4HZUA 3DDNA 4PZLA 5H16A 4ARZA 2WUFA 3GJ4A 4Y30A 4OFXA 3DEJA 4EY7A 9ATCA 5B1IA 3EA4A 1L8AA 5DX1A 2XNDA 3MIZA 1R5BA 1A5ZA 3O8QA 2IYFA 3GVHA 4I4CA 3BH6A 3ZV6A 5DP2A 4ZO9A 1IZ0A 2W2LA 4E5UA 121PA 4MEJA 4KMMA 1N0WA 4PIMA 4B3FX 1IK6A 3NXKA 3U7IA 1Z75A 1F4LA 4NK4A 2QTTA 3R7NA 3EMBA 3TLJA 4M8IA 3T7AA 4PVCA 1ICEA 2NU9B 2O8EB 3OFKA 2IX9A 2Q5QA 3P9SA 1DBIA 1R16A 1CDDA 4N8SA 4REOA 1EDDA 1TYZA 2DFDA 2O9JA 1NUPA 3MAJA 1NL3A 4IKOA 1BOFA 2Y77A 1Y89A 2L0XA 3ZC3A 3STHA 1J0DA 2JFNA 2Q9BA 3GQBB 5D7BA 5T41A 4NPCA 5T4EA 3OCVA 1O8BA 3NRJA 2J9RA 1GKKA 2ZZKA 3KAPA 3PDCA 5JE8A 4F3YA 4Q7QA 3JARB 2GTIA 4B2PA 2LPMA 3BCRA 3FE2A 3QFTA 4UXJA 1KETA 1QYXA 5GJCA 2G4LA 5AM3A 5ALQA 2JZCA 1H66A 2V5VA 1TMOA 2G5GX 4UHEA 3TXAA 3Q72A 4E4TA 1NUSA 3D8RA 2PCLA 4YASA 4LXQA 5FAXA 1C7RA 1GIAA 3S2FA 2WHPA 4JELA 4U2FA 3BXPA 2ZPAA 2EG5A 2IHTA 1JHAA 3WR5A 1T10A 2DBVO 1BKSB 2OM6A 1H2RS 1R88A 1PQPA 3IDAA 1FQKA 5SYMA 1KZHA 4EGCB 1Z0AA 2WT8A 3LRPA 3E18A 1UXIA 3K8QA 2R00C 1U5BA 2BR4A 1G7TA 2P9FA 2XCSB 3UWOA 2H2AA 1Z5ZA 2J4DA 3GFOA 3BMQA 1DC6A 3OF5A 4QUEA 1W9HA 3N0TA 2WYHA 1DQRA 2HA7A 2VDOB 2YHAA 1VJ5A 2WG1A 3HJBA 4RJKA 5ILQA 3FYHA 4ZHSA 5KNDA 4BAUA 1BOOA 1SVIA 2R6ZA 3AEQB 5LBIA 2I2WA 1KI6B 5TNXA 3EY9A 4BPBA 4GS5A 1FP4B 3KJEA 2XQKA 3KQUA 3MTQA 4Q9KA 2R85A 3KNZA 2FA9A 4R1UA 3KOOA 1Y5NA 3WMRA 1ZL2A 2HMYB 3I09A 1PJLA 4UTXA 5AM5A 1JV2B 1ZVJA 2R6FA 5EJIA 5CEFA 5JXWA 5EKXA 3IOBA 1TJNA 1KPGA 2CLMB 2M1ZA 2CLFB 1CF9A 3O8NA 4I9FA 5JCOA 2BKXA 4FGUA 4TS4A 3UCEA 1DEHA 1XL0A 1P4JA 1YHZA 4KUGA 2IHZA 2H9YA 5CFLA 1T6NA 4JLDA 3WB1A 3IEVA 2AS0A 5EZQA 3HXMA 5K6RA 4MAMA 4ZT6A 1UDRA 3L77A 3LC0A 2B6HA 4MJ3A 4Y2GA 2WT9A 1JJAA 1U2DC 4YRDA 1CPYA 2VKQA 1VYTA 2QTWB 5E6UA 5AJVB 3EXFA 2ALJA 3VTKA 3EWAA 4QBGB 4BNGA 4EOGA 4RHEA 3WP0A 2IELA 1T0IA 1UBLS 2IHYA 3IMKA 2J3DA 4OSOA 3T7EA 1NUTA 3LKZA 4CFZA 1OBFO 5CITA 2AUTA 2EJUA 5H4GA 3WGGA 4FHEA 3EXHC 3AESB 2MOKA 5A9SA 3SGLA 2VF7A 5HYVA 1OE0A 4DIEA 2P35A 3Q6NA 1ECGA 2P79A 4D0RA 2W42A 2XCIA 4JHXA 3NHRA 1OGIA 1QIIA 3LP5A 2BDTA 1U8UA 2OL4A 3FZQA 3JU3A 1QYIA 4JH0A 3RYCA 3DNFA 3CEJA 3W8EA 3ZQ6A 3STVA 3BXEA 4F4HA 5HDBB 1C50A 1NW5A 4M6WA 2EATA 3BAFA 5FBHA 3NWPA 4NV3A 4LYDA 1P0MA 3DOIA 5CLLA 2Y0CA 3UXMA 4HDRA 4F3RA 1P1FA 1G4UR 3ITKA 5GP1A 3H8SA 2RH9B 3IPLA 2VJMA 3I04M 1EWQA 2I87A 3EDRA 2H31A 3RADC 3Q9LA 3EXHB 1NBIA 2WEKA 4O2BB 4CL3A 1KK2A 3NFRA 1G60A 2ZYGA 4PXYA 4BFYA 2I3ZA 2BGUA 1KIMA 1BWSA 3ZWMA 1Z18A 3G0IA 5T3UA 4D0SA 2I2AA 4M7PA 1N0HA 3IMFA 1IN8A 2FDRA 4CQNA 1NR7A 1XEXA 1RKQA 1YGPA 2IYOA 2OCPA 1NVGA 4E7OA 4XM1A 5FD8A 4YPOA 3B2EA 4JVLA 2X22A 4BJHB 4LJRA 4A91A 4XGQA 5HJEA 1SXJA 3H2SA 2ODEA 1OW3B 2AXPA 3EEFA 4H7DA 4I1OA 4MUXA 1C14A 3KR0A 3OE7D 3TPCA 4P2BA 4U0JA 4CMKA 1GM5A 2Q5LA 3NCTA 1NI5A 2Q46A 4ZCMA 4NXMB 5BSWA 5ALSA 2UU9B 1W581 3QGMA 1II9A 1NOIA 2X5XA 3QYAA 1I7PA 4QDOA 5DM1A 4NMLA 4P86A 4E1BA 4PR0A 5DP1A 1E3DA 2GNAA 2X23A 3SR3A 2IEIA 3THYA 2A9KA 3F6YA 4CTMA 2FPGA 3EXAA 5H9VA 3UAWA 3H5OA 5DSXA 1N78A 1DV1A 1L8QA 1B14A 3O82A 1KNXA 4WMLA 5FFFA 4CQLB 4KLZA 4OCZA 2HRBA 3R5SA 3UTDA 3JZIA 2C1XA 3RANA 3NGLA 5LUAA 1T6YA 2C4VA 2IYZA 4BP1A 3U81A 1VIDA 1JR6A 2N47A 4YV0A 2XKBA 1U9CA 1D6MA 1G63A 4RHYA 2J0UA 3K20A 2XGMA 4LV8B 1NP3A 4AMYA 2GZ1A 4JLAA 4EA9A 1LC3A 2WKSA 1IWPB 1WKBA 2N9UA 3PGMA 4C3UA 3DZIA 3GHYA 3GI1A 3CG0A 2B5VA 1E9RA 4D5EA 1I5EA 2HJVA 4RZUA 1RJEA 1NPDA 2FUEA 3L7OA 3LKBA 3TW8A 3NIFB 5I7AA 4Y6PA 2Z8ZA 3CIFA 4YXWA 1KKMA 4Y0AA 1XNRB 4MHTA 3G8AA 2P0AA 4P4NA 4R51A 4RH1A 5DH9A 4QUJA 3HVIA 5LP6B 1WUIS 2ZW9A 3CSDA 4UNNA 3WZ2A 3IEIA 1AK1A 2Y1FA 3QHQA 4GYYA 3DB2A 1PT7A 1SHKA 1ZJJA 2XWSA 2ON6A 3BL6A 1E2NA 3F6RA 4N0MA 2LKCA 1Y1SA 2W8ZA 4JR1A 3RWOA 5LIRA 4Q5IA 4DNOA 4U2BA 2R68A 3AM5A 4MR7A 4AY2A 2Q2QA 2YZGA 4HNVA 1I01A 3MJVA 3OZBA 4BO4A 4GNRA 3B85A 4AZ3A 2O2SA 3RS2A 3I04A 1XMJA 4CHGA 4D96A 3JPYA 2HA6A 2ZRAA 3HKBA 2IP1A 4OYHA 4B7CA 4JOCA 4X6XA 3MUOA 3T7SA 3ZOZA 1GL7A 3KFXA 1FCJA 3SY8A 1MEEA 1VPLA 3H1FA 4OHXA 3UOWA 2PT7A 1UDBA 2WSYB 1XTKA 2V59A 1XVUA 2HK8A 4AULA 4P35A 4CUJA 3UJNA 4E94A 1OOEA 1RKXA 3MYYA 1BU8A 1Z45A 2PX2A 3B53X 3K0HA 2FX2A 4EKDA 1KI4A 1JU9A 3L8CA 1TQ2A 5F98A 1T1RA 2VG8A 5EERA 1KHTA 1UBGA 2IZ7A 3ANYB 4AYXA 2GXSA 5YASA 3SM9A 1YZNA 1YB5A 4Y2PA 3CLRC 5EMMA 3W3AH 4FE3A 5TGTA 3PCTA 4J29A 1UQRA 3QELA 1T1IA 1V11A 2C0QA 1L7EA 3ESAA 3NYIA 1DIAA 3CLKA 3Q8KA 3OZAA 4J90A 3DBOB 4KUHA 1KYTA 1OHHA 1U2PA 3P9YA 1M1YB 1M2EA 2AMLA 2BDUA 3H9BA 1VIYA 5AVZA 2Q28A 4KR9A 2PCJA 2WUVA 2LR0A 3N58A 3HBMA 2CLHB 2X9NA 3TFQA 1U0LA 2QTNA 3QLUC 3KYDB 3RVLA 3LT4A 2Q5OA 1YRAA 1YR3A 5HE8A 1E6LA 5K0ZA 4C1BA 5KTSA 1YDHA 5FLKA 4D4KA 1UR5A 3JALA 3JZMA 5CDUA 1VLMA 3P71T 3UMJA 3HCBA 3IP3A 1Q57A 4O33A 1WZ2A 4J75A 4BBZA 1FUKA 3SHOA 5F4BA 1O97C 2X86A 4B3RB 3N0WA 2PTGA 4M0MA 7REQB 2PKWA 5L3SA 2C00A 3D6VA 1R1DA 4KVAA 4N54A 3TLBA 1EUQA 2DWUA 4E5VA 4C78A 3REOA 1DJMA 3QLJA 4F0JA 3IP5A 4A8JB 2ZPUA 4TV8F 1F2DA 1M2OA 4KC0A 5F4ZA 3F6EX 3V6LA 3WGOA 4CL8A 4DMCA 5IN4A 5K3BA 3ZGYA 4TV8A 3DE6X 1P2UA 1DMSA 1Z4LA 3GBSA 3CVVA 1WQ4A 3ENVA 4CQMB 3UWKA 2WM8A 4I14A 1M2VB 5JISA 1F8XA 5A3QA 4M88A 1JLLA 4ZOQI 5TQVA 1J23A 4RY8A 3FNGA 2VBGA 4PNHA 3DDZX 1T8TA 1OTHA 1NRXA 4URZR 5CLHA 4GXRA 1XMOB 1F7VA 1O1YA 2RE8A 1I13A 2J67A 4EHBA 2EV9A 1PNOA 3TD2A 4BPRA 3AFOA 3FY4A 3EAQA 3W2EA 1H42A 4MVJM 4RKQA 1U81A 3ND8A 4KFTA 2JFFA 1BS1A 4B35A 4ER5A 3K9HA 4DJFC 2R1TB 1MZPA 3OPXA 1MT3A 2OAGA 1KC3A 1EX7A 4GO1A 3T7IA 1T3LA 3U4CA 2PZJA 1O3YA 3H8JA 1IFXA 2QP9X 4IZ6A 3QYJA 1ZJZA 1DG3A 1UZUA 4YAOA 4ZT4A 1QK3A 1KYXA 2EGUA 3K0AA 5F5XA 3VR2D 4WK6A 2ZFUA 1FW6A 3I9JA 3G2MA 3EDQA 2VPPA 3TJZA 5KYWB 5B4VA 1USUA 1OAOA 1ISJA 2WC1A 4HMOA 3VO8A 4O4IF 1I1NA 4CYMA 3HZHA 7YASA 1NT4A 3HXOA 4FOTA 4P4LA 1ORWA 3L7AA 2Y76A 3KU4A 3QV1A 1XALA 2A9VA 1L7QA 4KLRA 3ZW8A 3I83A 4MVWA 3U37A 2H7YA 2VJCA 2GPWA 2A9JA 2WV7A 3W3AA 4LBZA 3AGQA 1ORIA 1BZYA 2YJTD 2CDRA 3UJPA 2Q3MA 4LI0A 2QPOA 4NYMR 4F5YA 4HTFB 3KC2A 3RT7A 1H2FA 1VCHA 4TT3A 5KQSA 2CD7A 2FW8A 1V16B 3HKCA 1CY0A 3KALA 3R6DA 5CTJA 7MDHA 2ZT6A 2YYYA 4XWTA 5KVQA 1N6IA 2OV3A 3A9WA 3PKIA 3VNQA 4BO3A 3IO5A 4A15A 3B13B 1TRHA 4HXGA 5ESDA 2XCUA 2G63A 5I01A 1N6LA 4E46A 2OXCA 3FGPA 1NMEA 2JFPA 4JJ4A 4N0PA 2X4LA 3JYNA 1TZBA 4PTYA 4BLQA 1UCFA 4RVSA 4Z0TA 2NXEA 2ZPTX 4R68A 3K1AA 3FCAA 5DX8A 3SFZA 4IIBA 2RAPA 3AY6A 1PFWA 3SE7A 2ODPA 4GX5A 3ELDA 4LUCA 4DCUA 4DUGA 5MHTA 1WL8A 1ULAA 4C03A 2COUA 3M6IA 1I3KA 2ZATA 3B8EA 2XYPA 3NM4A 4B8YA 1A5AB 1MC8A 1QSGA 1UBCA 4MVJG 3W6PA 4BOYA 1OPRA 3CWQA 5LQRA 1QVWA 1FXWA 1R6DA 4YC7A 3TGLA 4FNAA 1K97A 1IPHA 2HLNA 2Z9BA 4K9QA 3ZE7A 2W93A 3PC8A 4R8RA 2D0IA 4G56A 4BNHA 1LF5A 2YFYA 4YDQA 2VNHA 1EJ2A 3GPBA 2V03A 3O8BA 4NH4A 3ZV5A 5AOBA 2RHMA 3M9XA 1R0BA 1MVNA 3KO8A 4I8XA 2HF2A 2Z58A 1BYUA 4U7WA 3UIEA 421PA 1X92A 3IBFA 1LPAB 3KYIB 3T5PA 4DR4B 2JASA 1ZEMA 1YWGO 4L0MA 2AH5A 1OGJA 1E3MA 1A1VA 1UKCA 1GFZA 2AHOA 1JHUA 5HQ3B 2D06A 3W1VA 4DDUA 1U8EA 4IIYA 4AYTA 1DAFA 2UUCB 3C5HA 4JIGA 2I3DA 3AQ4A 4F97A 2I3GA 1EH5A 1G6Q1 4HNAB 4ZOLB 3W5BA 2QMZA 1Z83A 2ACKA 1QRAA 3L0PA 3L6EA 5DHPA 4UM9D 3M4NA 5C46F 1YFJA 5JAQA 1KRWA 4CMBA 1Q3KA 1PN3A 3GYGA 3K0SA 2DF8A 3TMKA 1OVGA 2AJCA 1SCJA 3BK1A 2ONCA 5H5JA 3WK8A 4CVNA 2AG0A 5C4GB 5AK3A 1XXHE 4TOIA 2E4ZA 3IOYA 3LYHA 4GICA 1QH1A 5DBFA 5JY6A 1L1EA 5CAEB 4OMCA 3ZDEA 3L7IA 1D4AA 1I0IA 1UEJA 5BMVB 2RIPA 1RLMA 3B6MA 3EAFA 1M74A 2W90A 1A9SA 2CL0X 4QECA 3ZI0A 5KMGB 3TLGB 2FRVA 2YJ4A 1E58A 4EA6A 3LFTA 1YUNA 1NVMB 1U8AA 2NPFA 1EXMA 3F6BX 4AF8A 5BYKA 3MA0A 1Z0IA 4GZ3A 5EQTA 4EJSC 4XEHA 4PZZA 4LECA 4IJVA 4O4JB 2V0NA 1X15A 4F21A 3SVLA 2OV6A 1F14A 4JL6A 4XX0B 1KA9H 4BNDA 1RPZA 3NTVA 4G1EB 3RE1A 2NWQA 3GJ0A 4NF2A 3RRMA 4KNWA 3OZGA 3H9CA 3RH0A 5AFSA 4LGYA 2YL2A 5AOAA 2EKQA 3ZZTA 4JP5A 1XZFA 5I9SA 5BVHA 2IOQA 2I55A 2R8PA 3MXOA 4EW1A 2I8LA 1XZBA 1JI3A 3LGXA 4M7WA 3T3PB 4F7DA 1PK8A 1IOWA 3LL4A 1MFZA 4HFNA 4LX8A 4UBJA 3WHLA 3PVSA 4LJLA 1CXZA 1ZNWA 3GN2A 4FNGA 3R76A 4CPDA 5BP7A 5A3VA 3LLVA 5JOQA 3K9QO 4TKMA 3J7AC 3RGGA 1FYDA 3O2SB 2OVBA 2PXAA 3TE7A 4DA8A 1ADBA 3RJ9A 3V5NA 2COEA 5DMHA 3ESBA 4TMFA 1F1JA 1MORA 1UKZA 2A35A 3W9SA 4K6KA 3CX7A 1QVAA 4ND2A 5C8YB 1UXJA 5ER6A 1K92A 1KOJA 4N47A 4D9CA 3WYAA 3P2EA 3H9QA 1Y48E 3IDQA 5D7NA 1QH8A 3PNOA 5F9MA 4OQXA 2XF8A 1R3UA 2H4ZA 3LVQE 1LPPA 1MP0A 1T9HA 2ZKLA 4KMOA 4Y6GB 1WVIA 1B16A 1NXQA 1ZAKA 4BE7B 1EDEA 3WB2A 4PX5A 3EQ8A 1P1CA 2GJSA 2PMBA 4UHCA 3U48A 4MGHA 4ZREA 4L9WA 4QSHA 3FGZA 1U63A 4TL6A 1GCIA 4IIEA 3U0VA 4FZ5A 1CUSA 4LQLA 4W8HA 1TIPA 3FNIA 4RKFA 2QX8A 2XAUA 2UXCB 3QRWA 1FTYA 3DFZA 4JC8A 1WE2A 2H0AA 1HDCA 1EK0A 1NWHA 1A97A 1F0NA 4ZPJA 3W5SA 3W3ZB 3HXTA 4JT4A 3NX4A 4EH1A 4H0FA 2FPIA 3PUYA 2ZSBA 2Z4SA 4E11A 2LRHA 4HQFA 4WFKA 4B4UA 1K4KA 4DT1A 1LGYA 5TMPA 2WWVD 2FYTA 2Q6LA 3S6JA 1EFUA 1UBKS 1JYSA 1D4OA 1KPIA 4ECAA 1BWQA 3BFVA 2P91A 3INRA 4MI9A 4WHMA 3UXHA 4NXNB 3BWDD 3QMWA 1JEEA 1YK0A 3BDIA 1DARA 3EEQA 3NH9A 3FI0A 3AUUA 1F8UA 1QKKA 4V38A 5MN5A 2ZYVX 1EUCB 4HCJA 4XWGA 5FL3A 3VVCA 4EJ6A 5C1DA 1SN7A 2YVQA 8ADHA 3NHBA 4NU8X 2PLFA 5P8WA 4B7AA 2KQUA 2VA9A 1FBNA 1VRVA 2IDMA 4HO1X 4KXWA 4X94A 4BN5A 4DN6A 5LKRA 2B3DA 3SVTA 3HNPA 3UW3A 3ELYA 4AUKA 3U3JA 2PA3A 4R8LA 4G5GA 3HVHA 4W5TA 2QORA 3DBLA 1HNWB 1BGVA 1IMOA 3MCVA 2IXDA 2IW1A 3HCOA 5A3RA 1ORDA 3I5UA 1QHSA 3SQNA 1KIFA 1D1TA 1EFDN 5DI3A 3NM5A 2HJSA 5ALXA 2RDMA 4F3CA 3PA8A 4IS3A 3R9WA 2FPMA 3PR2B 1Y3FE 2GAIA 1MB2A 1TJ3A 2HWKA 5BWCA 5A7HA 3T5AA 1SXPA 4MXDA 1GNVA 2DWQA 5DGCA 1OF1A 1GUAA 1QG0A 2WAOA 3SMQA 3TQHA 1QHYA 4NDZA 1BJTA 2JAQA 5ADWA 4MGEA 3L01A 2JGLA 1NUHA 4NV1A 2YWEA 3QX8A 4RM2A 1SQ0A 4G81A 4CMCA 4D25A 1SA0A 4PSUA 3RABA 1H1LA 2R4TA 4WEOA 3W4IA 4Q9DA 2FSGA 3NU1A 1HSZA 2X40A 2LCQA 3TR6A 1A7AA 3GJ6A 3VJKA 5CNKA 5FUYA 2VXYA 5JMPA 1DV2A 1S2OA 1OX4B 1GZ5A 5FQNA 1AGPA 1AKQA 2QUBA 4UTVA 1TF5A 2AG5A 4Z9YA 1TF2A 4KXMA 3N59A 4YGXB 4AG3A 2BMVA 3U2QA 3EASA 2MSEB 1PO7A 3AJDA 3QVVA 1PTJA 3I9V6 4XVQA 5LU9A 4Z9FA 4EPXA 3EBLA 3M4ZA 2JEZA 3JWIA 4MHSA 2L17A 2GCNA 1XSEA 4RDIA 4JS0A 1SKAA 1OLXA 2WINI 2XTMA 3DTYA 3PQ7A 1Y9DA 4YUVA 4MOWA 4RETA 2VAWA 3WGMA 3PK0A 2WE7A 3COYA 3Q7SA 4ZCQA 3KDPA 3P0IA 2A0UA 3NALA 1V6SA 2W8BA 5CVVA 4RPIA 4AZSA 2OCAA 2VTBA 4JI8B 4BU1A 2YJGA 4K87A 4NESA 4BQNA 5IYZB 1Q1GA 3PI7A 4RA6A 4HT3B 1KWKA 4QRHA 1C7JA 1WZIA 3ZIDA 3BAZA 4FCWA 1QGUB 3VJLA 4BNJA 6GPBA 2R86A 3RAFC 1P75A 4P7KA 4WLNA 1ZW1A 3L0ZA 2CHQA 5BQOA 2W6PA 4PZEA 5SYAA 1EWTA 3FCOA 2XZDA 3PGA1 3QEMA 2WKRA 3MMXA 4X97A 4BO9A 2WYVA 2I1WA 3LPDA 3B5IA 2WLSA 2JGKA 1NY6A 4J7XA 4XWKA 2QN1A 2WHXA 3SF8A 3TIVA 4WGGA 2E5WA 2JGRA 2NUAA 1CD5A 1JMYA 2BKAA 3Q3HA 3QEJA 3WLFA 4B83A 4DF3A 3MWJA 4N3NA 1C8BA 1S8FA 3WNQA 4PZAA 2YVAA 1U3VA 1XEWY 3F6SA 3T4UA 3W8RA 2HYDA 1ATIA 1D8TA 1V1RA 3GJSA 2PV7A 3E9CA 2QVCA 3ESDA 4WD3A 4JBHA 2PU5A 2Q99A 1FDIA 1XMPA 1S3FA 1PZGA 2NQ2C 4MINA 3P9QA 1NUUA 2R8ZA 3ZIAA 3LWNA 3ZS9A 4EMUA 5K4HA 3AWDA 4IDCA 2PKQO 1T2VA 1PNRA 3ESCA 2CNOA 2ZUCA 5EHGA 2PQMA 3S2EA 5EZ5A 4X90A 3HWWA 4BLVA 3KM0A 1KEEA 2PZAA 2WYWA 4OLFA 4AO7A 1SZDA 4GI2A 3WYNA 3CQ9A 4JL8A 4G5OA 4ZGBA 1V0JA 4RTLA 2Z1NA 2QI9C 1COZA 2W2KB 3EGOA 3WXBA 4O25A 5IWAB 5LA6A 1OZAA 4OHUA 5CXXA 5GVSA 1E0KA 5A7FA 4IUBS 3MT7A 5TGZA 1E60A 5KNDH 2GK7A 1N2CB 2QD3A 3E9RA 2C2XA 2JLZA 1JDBB 3ZWYA 5IJ0A 2EKPA 4MWCA 1YNOA 1NV8A 1PR6A 1XZGA 4R01A 2HXSA 3PWZA 3I0MA 4DR2B 4GPBA 4B6JA 1L7OA 2QX7A 4LA4A 3Q9UA 4OH1A 4XB1A 2GF2A 4E3WA 1ODCA 1R9JA 1XU4A 2J1LA 2R62A 3N2NA 1FMLA 4DS3A 2JFUA 2XBUA 3EUEA 3ZW9A 2G08A 4MP8A 5KOJB 4KPGA 4NJMB 3UT0A 1F0PA 2PJUA 1W0CA 1HMPA 1W0KA 3GH3A 2YQ5A 2JLBA 3IELA 4MTCA 1IN4A 4FYMA 1DFIA 2DUNA 4JLKA 3DAFA 4RCYA 3F2VA 4RIGA 4RKEA 3D7KA 4KQ9A 3PCXA 3ZGXA 5A6VA 3P2JA 1E1CA 1KK0A 2A8YA 1NGSA 2QL7A 1SBHA 4CGZA 2QTVA 1AN0A 1BVUA 4QATA 4TQUS 2M1XA 3MMNA 4ZOAA 5E9AA 3ZWPA 4QICA 5H3CA 1HFEL 3GO4A 3H2JA 4H0CA 5F2EA 3UMGA 2MDTA 1YQUA 1ICIA 4K9DA 1YNSA 3MWDB 2IW3A 4J9UE 2I3AA 2BKVA 2HK6A 1GLNA 1GA4A 1KAQA 4WZBB 4JENA 1RI3A 3FLMA 3QWAA 5CFQA 1XHFA 4YACA 3R7DA 1D07A 4QLAA 3T5CA 1OXTA 3MT9A 1WXGA 2QMUA 2C97A 1NQ5A 1P7VA 3LOPA 5DSTA 4B6RA 4J0GA 3V7YA 3JQFA 2LE0A 1RM4A 2DFVA 3OF3A 1J7JA 3I12A 3WFJA 4DGSA 2UXDB 1VLQA 5IFKA 3THXA 4F5ZA 5BYBA 1OA0A 1V8FA 4ES6A 1WNTA 2P4UA 3QPCA 3UV7A 2WOOA 3EIFA 4D9KA 3LD9A 2VZEA 3U49A 2RHGB 4OBBA 1OZ0A 4RA9A 4BDTA 1U8TA 3GGGA 1W5EA 1X7ZA 3HRIA 1DGQA 5EWJB 2AFRA 2VCEA 5EGNA 4REQA 4BTVA 3B1XA 3CR3C 3RWMB 1ACMA 1IB0A 2RHDA 3UBTA 1CERA 1KSFX 4IVRA 2IDKA 2V9CA 3LLSA 4NPHA 3V2IA 4CDGA 5CLJA 4WX2B 4C01A 2JFWA 4F86A 3U4IA 3D8UA 1A5TA 4L8YA 2LW7A 4ZHQF 2I6TA 3ETJA 2H08A 1NC1A 4QLOA 5HQJA 3SXJA 2FFAA 1XHEA 3ZHTA 1MENA 4D92A 4I8IA 4BFCA 5ELLA 2WD7A 2ZBQA 1WMDA 3FCSB 4LRSB 3BH0A 4WLOA 3VR5D 3VOAA 1Q6ZA 4LMPA 3T4XA 3ZW7A 2YHIA 3F1KA 5B6JA 2WZDA 3AI3A 4ZXPA 5BSHA 1N9GA 4AW9A 4M0DA 1L4FA 3RFFA 1KI1A 2A5JA 5FCDA 4A2CA 4F6LA 1IQPA 1KOFA 4H7KA 1PL0A 5TPWA 3ZWCA 4CV0A 5KREA 5D1HA 1S1CA 1QP0A 4AKEA 1BEZA 4DQDA 4EQ6B 1FDUA 2XTNA 4G8BA 5I4IA 1SG0A 1JEDA 1K6JA 1AQUA 2JI6A 3R75A 3FOFC 3O26A 1YBFA 2G17A 1HEIA 1RIFA 3WZLA 4FW8A 4J91A 3K9NA 3RHTA 4XX1A 3B1YA 3SR0A 3DHWC 5D5PA 3PFKA 3FXAA 2SCUA 2JIOA 2QRZA 2HUPA 3L8HA 1YJXA 1IDN1 2OXRA 4ALLA 4ZICA 2ZI6A 1VHQA 2E4XA 1N2XA 2HU5A 2JK1A 2DG2A 2H2FA 2SICE 3QLVC 4U5QA 5AO9A 5REQB 3CF6R 3E0XA 4MQEB 5ITZB 3ABSB 4PXSA 1DKNA 2V4MA 3MRVA 4LZJA 2WDZA 1FQOA 5BORA 5IABA 3H99A 1ADFA 1EK5A 1GARA 2G1UA 3MQ2A 3G8CA 4C0LA 2WJHA 1T4MA 1TQ8A 3UB3A 3KHUA 4CG2A 1JFFB 2PL1A 1J42A 3A05A 5TJHA 2JLWA 1CRPA 3BRCA 2Q3JA 4IDOA 4UU1A 3PPIA 3CVYA 4S12A 4EVRA 1VHDA 1N8KA 2VNKA 3R20A 4NYJR 3TFWA 4EVQA 5B1YA 1EVJA 3GFGA 2P9ZA 4RVOA 2Q8PA 2BRUA 3BZWA 1MO5A 1XDDA 3B2QA 4HDQB 2PUFA 5THKA 4ZCLA 4LNAA 5LMUB 2G8NA 1RJFA 4RNCA 3NI2A 1DWPA 3WIVA 1PSZA 2XNKA 4XLTA 2CHUA 3ZNPA 2ANCA 1WMFA 4IJMA 4KYIB 1K2VN 2H63A 1Q0QA 4QOGA 3B9RA 1OFGA 3N7TA 5EC8A 5HE9A 2EX1A 1NXWA 2AOVA 2ZROA 4RZSA 4QDTA 3JQBC 4B3DA 1MO4A 2QUZA 4F6RA 1H4SA 5ALOA 4BVAA 5I5EA 4M1EA 1Z4KA 2ES4A 1YIDA 2AFVA 3QU2A 1CFJA 3L7YA 1LKZA 4IZHA 4A0GA 1FRZA 5CX1A 4CL2A 2P77A 4JYAB 1QGAA 3OEHA 4K8OA 5KTTA 4O1MA 2O20A 2V3VA 3LKDA 1Q7EA 2XI4A 2ID8A 2KWIA 3FPSA 2C57A 1J0AA 2AFIB 1UP7A 3OURA 3FWKA 4RADA 2WKQA 4RF2A 4EB0A 2IS2A 1LJUA 1NA5A 2OHHA 3O8OB 4S35A 4TTAA 2WVGA 1Y0BA 1PGNA 2JIBA 3VVLA 5TQ2A 2HA2A 3R4CA 2OO7A 3EX7C 4C4TA 3T3EA 1XEFA 4KPUA 5C4IA 1YBVA 1YOBA 3FYDA 1KAHA 5JQGB 3GLKA 4UTRA 2HI0A 3P1JA 3AJRA 1DTWB 1OXVA 1RYYA 3A2NA 5BSMA 4J4HA 1D09A 1RKUA 4WBSA 3TTYA 1EVIA 1M0SA 4YEDA 3OX4A 4QEDA 1X2EA 1TJYA 3IULA 4QWWA 4EFNA 2VA8A 1JFTA 3E5RA 4PGAA 2QR5A 3D54D 3VPBA 3WYBA 5IF3A 1NR5A 1UJNA 5DKFA 1Z63A 3I1YA 1J1IA 1QGOA 5JNSA 1LA2A 4FINA 3GG2A 3NHYA 1KAGA 2BFNA 1GGEA 3T0IA 4D8XA 4BATA 2CLLB 1PZHA 1SU6A 2JCYA 4BQFA 2BGRA 1MB4A 1EWYA 2GN2A 1ZA1A 2MR5A 2C9MA 3VZQA 4CCWA 4FFPA 4TUYF 2O8BA 1Z2OX 1NNI1 4XVRA 3H2ZA 2GEUA 4LE1A 2B99A 2V1UA 1EG7A 3E05A 2XMZA 3KHKA 1E1LA 4NRDA 1EFKA 4TUYA 1RWQA 3WSVA 3NJ4A 5CXSA 1DRUA 2R751 5CLQA 3N5KA 3TNJA 2EJCA 4TTJA 3UWMA 2OSVA 3P9CA 2BMJA 5HJ7A 5AJWA 3A04A 3W4JA 4UEQA 2MJLA 5JG7A 1SXJE 3T1YB 1LBSA 2FUKA 2FN3A 3PQ2A 2GO7A 1NBMA 4F93B 4R69A 3FIUA 2QJFA 3FLBA 3OTQA 3EZYA 2X77A 3E2PA 3ACCA 3Q6MA 1NQUA 2YFKA 1F5NA 2FQYA 4ZVNA 3LNTA 3U1VA 1QFJA 1E4EB 4MR8B 3SQOA 1JW9B 4KMSA 5JI3E 3GLIA 1CZHA 3NZEA 1J0BA 4GDMA 3B9PA 3UH1A 2EJVA 2IE8A 2ZUBA 3WJAA 3WL4A 3DO8A 4WBNB 4YCJA 4Q3CA 3EC2A 4BEWA 3AI7A 4M38A 3B70A 3TLKA 4IUYA 3H9UA 1C0EA 1XRNA 2XNCA 3EIUA 3HZOA 1JAIA 5IPFA 2R8EA 4P31A 4UU8A 1T2NA 3A9SA 4BX0A 1DTEA 2XE6A 3ILHA 1H93A 1JAZA 5BSGA 2F1IA 1F7UA 3DE4X 3G8BA 2YCBA 3KKOA 4WK0B 3TQOA 1P9RA 2Q3LA 3ANMA 3PUHA 1NNEA 4LW8A 3M5PA 1ZKDA 2PMDA 3L41A 4W6ZA 5HXAA 1ZG3A 5JNTA 3UPUA 2JNWA 2ZVJA 4Y2XA 2DQSA 1QQBA 4CW7A 4MIEA 4QWMA 2H17A 1I4TD 2NP6A 4MYDA 3WGVA 3IP9A 2WNHA 5JS7A 1WVMA 3IVGA 3VKFA 4L8LA 4PYRA 1UK8A 5EHQA 2SECE 3IP7A 5DYTA 1GN8A 1NDQA 4RSMA 4JGGA 3B36A 1P3JA 2JC3A 3QMPA 4ENQA 3B3QA 1T4CA 4AKIA 4FU0A 4MUMA 3UT5A 1SHJA 3T3DA 1P19A 2GRUA 1UDWA 3CLTD 2V5AA 2ZANA 5AUNB 5EUBA 1H23A 1J22A 3T52A 2XJ4A 4XIJA 3DYVA 1B8NA 2FMKA 1NOJA 2P75A 5JR3A 2JVJA 5FPKA 3WYEA 4AKTA 1YL6A 1CHDA 1TCCA 5AVYA 2G5CA 4BDSA 1BD4A 4PYMA 3TNDA 4IDNA 3CEHA 5JT1A 1QS0A 2G77B 2VOEA 3ND7A 4GLBA 1H2WA 4XVCA 3KSRA 3BL5A 2ORWA 3NBYC 4AK9A 4Z4CA 5LYJA 1V4VA 4A92A 1N9ZA 2OAQ1 2WTBA 4XSHA 2H85A 5CJPA 1YQDA 4OKSA 1ZD2P 2X8BA 1PL7A 1ZX1A 2RHCA 3CH5A 4NMXB 4PHTA 4X44A 2V0GA 3MUFA 3UAOA 5DHAA 2FW0A 3KCQA 1B6RA 3OQHA 2FW7A 1G17A 2A78A 4WV3A 3M9WA 3VVMA 4BO7A 4QU8A 1M2NA 1VMAA 4ZCTA 13PKA 4JP2A 4NAUA 3I2IA 3OCZA 5KNCD 2EFCB 1JFRA 3ASVA 1IN6A 2O7SA 4UE6A 4JEUA 2QAIA 3VI4B 1EHCA 1K88A 1IC6A 2I7TA 3CO0S 3GGPA 3IX7A 4I2NA 1XZJA 3OT1B 2P3OA 4FHFA 4BZPA 1KI8A 4F56A 4K1XA 1CUFA 4Z4QA 3V1NA 1J2UA 2ZUWA 4RFSB 3GLQA 1SIWA 3B6JA 3OZRA 5AW1A 2VJDA 2HSJA 2PZFA 2QW8A 5KTKA 2E85A 3BSYA 2CXHA 5E1MA 3IJRA 5JXJA 2BLNA 2YNMA 4KO4S 1VHTA 4G1FA 4C7OA 4LNUA 4LRQA 1TQHA 3RNOA 2DFLA 2CNWA 4LSZA 4AJEA 5I4BA 2TECE 3DEKA 3EZGA 4LOAA 1HDYA 1Z34A 4FOLA 3P20A 1OD6A 3DE7X 1CX9B 1V6AA 2G9UA 4NEGA 2WB4A 3E3AA 4KWIA 5DZSA 3LBHA 3T7KA 1CRQA 1NUAA 2X7HA 3HE3A 4FS8A 1JIVA 4JVMA 4AWAA 4PPQA 5IWCA 3W5UA 1A9OA 4LZAA 1REQA 1JFVA 3C43A 1EQAA 1RU3A 3AKYA 1MD9A 2DE0X 4MS1B 3ZH2A 4HMPA 1I2MA 5CXUA 3IP8A 3RSCA 5CT4A 3REGA 4J1TC 4E5KA 4EHJA 4DV4B 3KWMA 1H5NA 2EBUA 3JR3A 1UFRA 3PT5A 4N8EA 4FVTA 4KMRA 1WXDA 1TYEB 5ENZA 2OP0A 2OWDA 4XAQA 2QQ5A 3I6IA 5JARA 1GPYA 4KZPA 1GPBA 4EUEA 4RTOA 4MB6A 3FZEA 1U9ZA 1SQ5A 1IG3A 2F9FA 4TQAA 2ZRFA 4BUCA 4DCCA 2KLBA 1KY4A 4FFLA 3UMFA 5J2TA 3FTPA 1QHHA 1Z8DA 3EGWA 5FBZA 2RK3A 1LPMA 2NSHA 4RS3A 1M34E 3UJBA 3ZCPA 3CH7A 4OP2A 1TCAA 2H54A 1S1MA 3E81A 3M5WA 4ND8B 4G5QA 1V41E 2JFZA 3BILA 4U9IS 3QVUA 1WUKS 1JMVA 2ZBFA 1P2GA 3PC7A 5CD1A 1UJBA 4UUNA 2VZ9A 1ECLA 3DO6A 5A7GA 3V4SA 2YXDA 1YMVA 4OTZA 2O52A 4JOQA 1XVAA 4GX1A 2DFNA 4FJ2A 3J81A 2OAEA 3WGQA 1AOXA 2JATA 3DLCA 1M2KA 3LW8A 5HIKA 2NXWA 4WDRA 2J3LA 3B12A 3SSNA 1WM1A 2J0VA 4DRYA 2JA2A 4PCAA 3LP8A 4AXXA 3IUNA 1JKIA 2E89A 2EU8A 1YB2A 3LVBA 3DFIA 3V4ZA 1BS9A 3IPRA 1Z15A 1FFXB 4BYGA 4I4IA 3UCXA 4ME6A 1N5LA 4J0DA 5CCDA 1JF8A 3QTTA 1L5GB 5KSOA 4G0NA 2NZ8A 4DKJA 3QNUA 1D9XA 4M0CA 1MV8A 1E96A 4MLZA 2IYWA 5CYOA 3JQQA 2HBZA 2QVYX 3X2FA 1RQRA 1SK8A 5COBA 3JATA 3MRTA 4QTUB 1BVHA 4O4HB 1YJBA 3M34A 2HY7A 2G8LA 3CBQA 3NKFA 3O4GA 3OCYA 3W7AA 2GO1A 4QT0A 3JQGA 2FDXA 3ZYCA 4XASA 5DIFA 1OWPA 5I7EA 5L4SA 1XZNA 3ZV3A 4C0KA 2D5LA 4XH9B 4QOSA 1NLZA 4E09A 5D51S 2B30A 2ZIZA 3I73A 4BNUA 4B1FA 2X1LA 2PGDA 3A6KA 3WS7A 3ZBUA 2PFSA 3F74A 3ZU3A 2HCTA 3Q8XB 1R0SA 2P9EA 4PCLA 5LZ8A 4IDGA 4QKQA 5KU1A 2V7XA 3U4QA 3IPCA 1A5BB 1IUPA 3W5AA 4R8MA 3LBAA 1KOLA 1I36A 2OFXA 5I5GA 2E4YA 1OVMA 3OX3A 1JBKA 1EJBA 1FRVA 2WSLA 2IA5A 2OGWA 3K9WA 2VPIA 2R65A 4PX3A 2FR0A 4J3NA 2PDAA 1QUFA 2YVLA 2FZCA 4Q24A 1G5TA 4RMNA 4POAA 3IDSA 3G1UA 1A0OA 1GDDA 1GPLA 3SXUA 3UEOA 4NULA 1E2UA 3Q8MA 2W2QA 5IARA 1ZD1A 4F3TA 1FFYA 5FWAA 3K9FC 4LIPD 4GDFA 3DV2A 4IO0A 4KWTA 2YV5A 3KJQA 2G07A 1EJ6A 3NHKA 4N12A 4RH0A 2P68A 3GZJA 3K72B 2MYUA 3KWFA 4IICA 1P4RA 3VPDA 2F43A 4GF5A 1X1RA 3WDLA 3WNCA 4C88A 1QMPA 3ICWA 2O3TA 3PBKA 4Z7NB 4MQFB 6REQA 1PWXA 3FMVA 5DO9A 2A9PA 1E8DA 1GPMA 2B2CA 3FETA 4XD7A 3TSAA 3ZGOA 4MUYA 1VRWA 4Y3UA 3U3DA 4UDNA 3JAWB 3OT4A 4LDAA 4MV7A 3QITA 2IYUA 4MDEA 3M6MD 1W4ZA 5B1SA 1QK5A 1Z5VA 2ORED 4QPNA 2A86A 1EM8B 1Y8RB 2QJTA 5E6SB 4AL4A 4DLYA 3EDMA 3LQYA 1H2AS 3PXAA 5I7OA 5F7ZA 1F2TA 4L0QA 1Z0FA 3RSZA 5IKEA 2IL1A 3C3AA 4Y9DA 1I24A 3V6MA 1A96A 4IDDA 1NU8A 1THGA 2DFTA 4P4SA 3GA0A 3AHHA 1PUJA 3O91A 3QUQA 8OHMA 5CJ2A 4I4TF 1EWVA 1G8JA 1PR1A 3IBYA 3ZS8A 1R6BX 1BMFA 2QTFA 2AOXA 3QHPA 1CY4A 1MQ8B 4IDEA 2C78A 1L1QA 4I4TA 1ZUHA 1GQOA 1DBRA 2AQHA 2QRMA 3CEMA 5EOVA 5EIOA 1OFHA 2NN3C 4INJA 4D4MA 5KKCA 1KMHB 2O8FB 4DUGD 1RHRA 4OOFA 1QAQA 2DFPA 2CXSA 3CM0A 4P0TA 1QX4A 4MZXA 1GU0A 2UVQA 4QJ3A 4AS1A 3O0DA 5IZ4A 4B4VA 2X76A 2GOYA 3D6NB 3OZXA 3HHEA 3R5FA 2X58A 5A0TA 2X2FA 4L8VA 4MRRA 3B9BA 3GV0A 3ORQA 1U4OA 3DZJA 3AYXB 3NCHA 3QJYA 4D98A 4RXUA 3DL2A 2G09A 2YWFA 3CRZA 4EB6B 5A2QA 1B0UA 1T0UA 3JQAA 1SVLA 1YZQA 1OT3A 2Q0XA 1DIBA 1XXLA 2NOAA 2J33A 3JW8A 4WXHA 3ZWWA 2MSLA 5F51A 4BKOA 5FV4A 4JY7A 1SXQA 1FBTA 2VXBA 1CUYA 3NBMA 4NWIA 1DWQA 3WLTA 2P6PA 1XYYA 2P5UA 1PR3A 3AIOA 2X41A 4OMUA 4TYPA 1Q77A 3S1AA 1I4DD 3LZDA 5AVQA 5AW7A 2GHRA 3MQ4A 4B46A 1U0HC 2WM9B 3ZBQA 5GM1A 4IKEA 1CY8A 3D6UA 2EBFX 3D2BA 3DOJA 3RVDA 3HO8A 3HBLA 2XDAA 4NJEB 5JVDF 4IQ0A 2HGZA 4ENUA 1EQ2A 1JJFA 2GILA 2F6RA 3FVQA 3IE2A 2GEJA 1SEVA 3QNWA 4UVEA 5AI4A 5TPZD 3TD6A 2Q6OA 3UCFA 4NZMA 4WXMA 5JVDA 4XUCA 5AESA 1QF6A 4ZQGA 4URWR 3IBSA 4BZQA 2CXPA 2VQ3A 3Q3CA 2FFJA 4KBGA 5K0NA 1JQKA 4I8DA 5HMLA 3V8RA 3GP5A 3HBAA 2QVGA 1EP9A 4PHFA 3QTLA 3WSTA 1DAIA 2XZOA 4H7EA 1ZQ1A 1W30A 3RBVA 3TZQA