4PNHA

Crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
155
Chain Sequence
KKLVVLDRDGVINVSPDEWVALPGSLEAIARLNHAGYRVVVATNQSGIGRGLFDMATLNAMHLKMHRAAAAVGGRIDAVFFCMMKLIAERFEIDPADTPVVGDSLRDLQAGAALGFRPHLVLTGKGKKTLAAGGLPEGTRVHDDLRAFALDFLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords D,D-heptose 1,7-bisphosphate phosphatase
publication title Crystal structure of D,D-heptose 1,7-bisphosphate phosphatase from Burkholderia Thailandensis
rcsb
source organism Burkholderia thailandensis
total genus 47
structure length 155
sequence length 178
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.1.3.-:
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4pnhA00
4Y2VA 1TJ5A 1U2TA 3L0CA 1J97A 3HYCA 5AK5A 3SKYA 3ED5A 3WGVA 5AIBA 2NO5A 2B8EA 2W11A 3EWIA 5ALEA 5AKGA 1L7OA 2HF7A 3M1YA 3DDHA 3QU9A 3MMZA 2GHQA 4G9BA 3A1EA 1Z4KA 2AH5A 4NV0A 3E58A 3MC1A 5ALPA 3L0BA 1U7PA 3L8HA 5ALRA 2RBKA 2OYCA 5AM0A 2WHEA 1Z4MA 1QQ6A 4F72A 2IOFK 2P9JA 3NASA 4CNQA 4EZEA 4UMFA 2I55A 2G0AA 4AS2A 2IA5A 5AKZA 3E84A 2CFTA 3EPRA 4FFDA 2GHTA 1ZRMA 3NALA 2BDEA 2ZG6A 1S8OA 2ZBDA 3WK4A 4CE6A 3KZXA 1RKUA 3QU7A 5AW7A 4BKMA 5AESA 3I1YA 3ZUPA 2R8ZA 3ZX4A 3OCWA 3N28A 5AVRA 2O9JA 2YN4A 1NNLA 4J2TA 1JUDA 3U7FB 2P69A 3KBBA 4BYGA 4ZEVA 4HYTA 5AVXA 2YBDA 2FUCA 3QX7A 2HHLA 3WKDA 4ZEXA 2YMQA 4KNWA 3WKEA 1Z4JA 3MPOA 2RARA 4Y2PA 1Z5UA 5ALVA 1RC8A 3NRJA 3QNMA 2G09A 4JB3A 5FP0A 2CN1A 3L7YA 4Y2QA 1ZJJA 2VKQA 4ZEWA 1YDFA 2WFAA 4IG4A 3WK6A 3W5AA 4Y2UA 1U02A 5AK3A 5AVQA 3DAOA 5AVSA 2WM8A 3MN1A 3SHQA 3ZVMA 1QYIA 4CF4A 2WF5A 5ALQA 2YJ5A 5AVTA 2AMYA 1Z4IA 4YGYA 2B0CA 4Y2TA 2EAUA 5AIAA 3R9KA 3SMVA 4AP9A 5AM2A 5A3RA 2FDRA 3GYGA 1L8OA 1QH9A 1RLMA 3OPXA 4I9GA 3I28A 3TLMA 2BDUA 5AI8A 2DQSA 5AKEA 1SU4A 1SWVA 4L6CA 2FEAA 2JAOA 5A3SA 4UU1A 1RDFA 2FI1A 3SD7A 5AVVA 4Y2XA 5AICA 4C4RA 3U19A 3U26A 1RPZA 1LVHA 4HGQA 4KNVA 1Z4NA 4Y2RA 3S6JA 3WKAA 3EF0A 5ALLA 4YCLA 3WGUA 5ALNA 2FPUA 3NANA 3QYPA 2YJ6A 2ZBEA 1RLTA 2HDOA 3PGLA 1RQNA 4XOUA 5AKJA 4NWIA 4BX0A 3N5KA 1Q91A 3RF6A 5AM3A 1RKVA 3L8FA 3FZQA 1Y8AA 4UM7A 1TJ4A 2I6XA 3I76A 3L8EA 3OCUA 5E0OA 1AQ6A 1CQZA 4KX3A 3QXGA 5AKXA 2W4MA 4UM5A 4C4TA 2OA0A 4UMEA 4BEVA 2FUEA 2HEGA 5AM4A 2P11A 3ET5A 1VJRA 4UMDA 2YMMA 4BBJA 1EK2A 4C4SA 5ALWA 1TA0A 2ZBFA 3WK5A 1XVIA 3A1CA 4Y2YA 3FM9A 2Q4TA 4FE3A 5AW4A 4MWOA 2HSZA 4OD0A 2Q4RA 3KC2A 1ZD2P 1ZS9A 1RMQA 2B8JA 4BX2A 2WF6A 2B1QA 4GXTA 5ALOA 1L7NA 5AK6A 2PQ0A 3WKBA 1T5TA 1ZD3A 1J8DA 4MUMA 1RMTA 1RQLA 2EATA 1YMQA 2G06A 3L0YA 1N8NA 3K1ZA 3ESQA 2O2XA 2C9MA 2G07A 3QUQA 4BEWA 3J7TA 3ESRA 5ALUA 2C8LA 3BWVA 4OFZA 2GMWA 3WKCA 3ZVLA 4YIHA 3P96A 3ZTYA 2ODAA 3IB6A 4CF5A 2JAUA 5ALHA 4UAUA 3AR9A 1TE2A 2JAWA 2WF8A 3KDPA 2Q5EA 3L5KA 1IWOA 5AW0A 4YIKA 5AW2A 1MH9A 2FPWA 2I7DA 3ZX5A 4JDPA 5ALJA 3WK8A 2YFYA 3DNPA 1Z4LA 4YCNA 2GFHA 4RESA 3OCXA 4IFTA 3SF0A 5IT0A 3BA6A 2YMPA 4UASA 3U7HB 1QQ5A 1XP5A 5IS2A 4Y3UA 1RRCA 4EELA 3E81A 3ZW7A 5AI4A 1L7MA 4H1WA 5ALIA 3B9BA 5AHXA 4KYTA 2HF2A 4QJBA 3HLTA 3U7GA 2HCFA 3ZWDA 1ZOLA 3QGMA 5T41A 5AVWA 1SWWA 5AW1A 3UMBA 3AR7A 3UM9A 1Z4OA 2ZBGA 4EX6A 3FPSA 5AI0A 4KX5A 2GO7A 3U7EB 3FVVA 2AUTA 3QLEA 4QQFA 4XE5A 3WK7A 3B9RA 4B6JA 3SKXA 3AR4A 3L8GA 3QUBA 2YJ4A 4EEKA 5AW6A 2I33A 3FGOA 1KYTA 4G63A 5AVZA 3IRUA 5ALKA 5ALFA 4XPZA 1QQ7A 4EX7A 2PKEA 2AGVA 1LTQA 2C4NA 2FPSA 3ET4A 4E88A 1T9ZA 1Z4PX 2HX1A 1O03A 4HGPA 1U7OA 2IYEA 3A1DA 4DCCA 4UATA 3SLRA 3ZI4A 3CNHA 4BNDB 3AR8A 2CFSA 2I54A 2YMLA 2OM6A 5AW3A 2G08A 3I6BA 5AW8A 4CF3A 4F71A 1FEZA 1YNSA 1CR6A 3OTQA 4HGRA 4RETA 3CZ4A 3FPBA 2EARA 5ALXA 2I34A 2B30A 3R09A 3QU4A 1XPJA 3M9LA 3R4CA 4KN8A 4Y2JA 2QLTA 2BY4A 4BNDA 2R8XA 3E8MA 3IJ5A 3QUCA 5ALDA 2HI0A 3AR5A 3NUQA 1YV9A 3KD3A 4GIBA 4FYPA 4YCMA 4PNHA 3A3YA 1L7PA 2B82A 3PDWA 3UMGA 4UU0A 1WVIA 1O08A 4DWOA 2YY6A 3OCZA 5ALTA 2NYVA 4AS3A 1VJ5A 4NABA 3ZTWA 1T5SA 2WF9A 3D6JA 5AKKA 4DW8A 3KOOA 3QU2A 4I9FA 4YH1A 5AM1A 5ALSA 4L6AA 2RB5A 4NAVA 4UAVA 3UMCA 3WK9A 2JGAA 3OCVA 2D2VA 1S2OA 2HOQA 3AR3A 2JARA 2FPXA 2RAVA 1Z88A 3PCTA 3AR6A 4NFLA 4UMVA 3NIWA 5AKIA 2R8EA 3NAMA 2B1RA 5AM5A 1VFPA 1K1EA 3B8EA 1PW5A 1WPGA 4OCZA 1ZRNA 3N1UA 5ALGA 1RMYA 5ALMA 5ALZA 1N9KA 4UW9A 5AKHA 5AW9A 4HGNA 2NO4A 5AKLA 2WF7A 2P27A 2YJ3A 3W5CA 1RLOA 5AW5A 5AVUA 3DV9A 2MU1A 3W5DA 3N07A 1WZCA 1YJ5A 4DFDA 4EENA 1NF2A 2G1AA 1RKQA 1YS9A 2QYHA 3L1UA 3ZWKA 2X4DA 1L6RA 5ALYA 1X42A 1Q92A 2IOHA 1EK1A 4O8CA 5AVYA 4J03A 1Z4QA 1F5SA 3F9RA 3VAYA 4OHFA 2CFRA 2ZOSA 5AK4A 2IOFA 5AKYA 2HO4A 5A3QA 2PR7A 4Y2SA 4XQ0A 1U2SA 1NRWA 3ZVNA 4BX3A 1Z5GA 1ZD5A 5AI6A 2R8YA 3ONNA 1WR8A 5AI5A 2FPRA 3RFUA 2OBBA 4HAIA 2ZXEA 4L57A 3OCYA 5JJBA 2C8KA 3EF1A 1L8LA 3L1VA 3N8GA 3W5BA 2W43A 3AR2A 5AI9A 1TJ3A 2MSNA 3PGVA 5IT4A 3U13A 3QU5A 3ZU6A 4UARA 4HGOA 1ZD4A 3QUTA 2G80A 2C88A
chains in the Genus database with same CATH superfamily
3GOHA 1TJ5A 5IC4A 1ZUIA 4Z1OA 1JPNA 3KIPA 3X1JA 1UIMA 3O4VA 4DLYA 5A4DA 4AMVA 4WOBA 2XOEA 1TGYA 2EFHB 2C3MA 2Z56A 2QXUA 3D6TB 3BHNA 1DVRA 1T6XA 4BRSA 1YBHA 4RY0A 3ANXA 3RTDA 2CUTA 4R8RA 5C0OE 5ECWA 2FQXA 4U7DA 4IOJA 3G1TA 4G67A 2XCRB 3DZJA 3U4MA 5CX1B 1O96B 1VBKA 2ZT5A 3UAXA 1KY4A 1GNQA 1KS2A 1Z4KA 5B57C 1LA2A 5HJ5A 2Q6VA 3GJXC 4FCCA 5CXXA 3V42A 4KVGA 1ST3A 3E58A 4NJOA 4Q4HB 2B78A 3ELDA 2O2EA 2Q27A 2XCLA 5KJ1A 1YR3A 3BCHA 3GLQA 3G2NA 2OYCA 1UFKA 2B8WA 3ABSB 5EIFA 4EVIA 1OHHD 3UJDA 4OYHA 3KEFA 1F1BA 2WIAA 4WK6A 4MOWA 4BHTA 3RHSA 1QFMA 1PL7A 1MB2A 1VJTA 1XVLA 4R1OA 4FGSA 3M81A 1BFKA 2C0PA 2Z1DA 1YO6A 2VAWA 4HD8A 1QP7A 3CVXA 3DO8A 1R7RA 2PT9A 3DZCA 2G1PA 4N0DA 3JQ9C 5ER6A 1DAIA 3H19A 4RAQA 3IFSA 2I8CA 1GFIA 1V5IA 4FFDA 3WB9A 4LYFA 4CFYA 1SBNE 5BT8A 5GGYA 2FOIA 16PKA 1J2RA 1KJIA 3CCBA 3ITKA 4IJVA 1YR6A 4AO6A 4UHFA 3SVZA 2FSVC 1M5TA 1OTXA 2OEPA 2I2FA 5BVGB 1EX6A 3K9GA 4JCOA 2ZJFA 3DWFA 4OTZA 4IF4A 5A7GA 5HX7A 1E7MA 3EHDA 3DE6X 4IQGA 1TYAE 3IP3A 4M1OA 3CNBA 2EQ5A 5J5AA 1IBCA 4Y18A 1BXRB 1J0XO 1TJYA 3LX6A 2NUTB 4XWWA 3WLTA 2J9FB 1NVMB 2SCUA 2TYSB 2AL7A 1J09A 2VJKA 2YJZA 1T5DX 4RLFA 4X5OA 3WB2A 1R4NA 2N47A 3ENWA 3JVDA 2DRIA 1NVXQ 3J7AC 5CGQB 1GRCA 2HPVA 4X0EA 4DHEA 5JIBA 2NWQA 1TEVA 3RANA 2FSGA 4YUYA 4DLUA 1DC5A 3WKDA 1UZMA 5KX5B 3T5PA 1C2TA 3ZD7A 3TINA 3X0DA 1Z4JA 1UDRA 2QGZA 3MIZA 1PEKE 1QLWA 1R6BX 3WL4A 1NW9B 1DKLA 2AFHE 4A0QA 4D4IA 2YZGA 2JIZD 5C8XA 3GLGB 2KJQA 2QVLA 1Y4UA 2RH9B 3MGBA 3PWZA 1HX7A 3JXEA 5LP1A 3EYAA 2WFAA 4IG4A 4DIEA 3FROA 2PA3A 3AU8A 1Y8QB 4MWTA 3IQDB 4QDUA 3R7AA 3UJ9A 3D2LA 5IVKA 3EGOA 1CUJA 1XCBA 2QT1A 3HYSA 1M10A 1ODJA 4LGCA 3WDMA 3ZLTA 2EX4A 1JVNA 2JC3A 4IJWA 4LTMA 4RJJA 1NMYA 2HT6A 4YR7A 2BKEA 3ZZUA 3ILSA 3K2QA 4G9GA 3RYIA 2GHRA 3K0EA 3Q3JB 2J3QA 2IELA 2XUZA 3LCVB 3NTOA 3JALA 1K08A 3OZCA 2PMWB 4P81A 4YMWA 4NZOA 4MJ7A 1LWNA 4KE7A 3TRJA 1DS6A 1HRKA 3R1IA 2WG2A 5HZGA 5AI8A 1B0UA 3KUCA 4D4LA 1S9HA 5BV0A 1GCUA 3EQ7A 4O4JA 2W2PA 5T6BA 4AICA 1IIRA 4QXOA 1SU4A 2OGSA 3I3SR 5JADA 3OTHA 1OX4A 2AMLA 3RT7A 1GV0A 3HUFA 1IN6A 2EFCB 5HOEA 4QBFA 4JI8B 4C22A 4EY8A 2R96A 2WWTA 3ZK7A 1SQFA 1K92A 1PLJA 2AJDA 3ZDYB 2A59A 4XJSA 2ERCA 2NVBA 1A72A 2Z8YA 1K5DA 3K73O 4L7VA 5LZ2A 1S6YA 4GSYA 5CFNA 5JS1A 1Q1AA 3LHFA 3DLIA 3D7RA 3FR7A 1OZ0A 4JC5A 1KZ6A 1T3GA 4EEXA 1H2EA 2IDKA 3DMYA 3G0CA 3L6EA 3PFCA 4MLPA 2UZ1A 1KY2A 3AK4A 2JFZA 5EUBA 2H1CA 1RRPA 1EDOA 4ARAA 2LXNA 2ZBEA 2PNFA 3QX3A 1HT1E 2I9KA 4BWFB 5FTLA 4NWIA 2X9NA 3RHZA 3TWOA 4IDNA 4JBXA 1WPXA 1SQSA 3QTLA 1BH2A 3WXMA 3ICPA 2BD0A 4CIYA 1QX4A 4ZZ1A 5KWSA 1UQTA 2J5RA 4YCSA 2PGLA 5FI5A 1ZJ5A 3I76A 3FFWA 2G88A 3B3GA 1CZRA 1RADA 1VCMA 1UOPA 1AQ6A 1U90A 2C1ZA 1CUFA 3DYVA 2XRMA 4M55A 3ANLA 3ZH2A 4ZO6A 2YN0A 1HDZA 1NUTA 1E6UA 3LC7O 4AZVA 4CMCA 1D2AA 3FXAA 1QS0A 3LX5A 4GPTA 1Z0JA 1W5AA 3C3XA 4EBFA 4F3TA 4FS3A 3QWHA 3SXUA 4RSRA 5HTKA 5I9LA 2C9CA 3IESA 1JQ3A 3QMPA 4FU0A 4LC1A 2IV3A 4AMBA 4YRRA 4Q3LA 5IWAB 4XPIB 3QX8A 1PJ3A 3EMBA 4KE6A 1WCWA 4LVCA 1QLJA 3LCCA 4LHZA 4MGEA 4EK9A 5EN4A 4IXTA 4GWGA 2BHSA 3AWDA 3EISA 4X62B 1BCSA 4NZNA 4R8VA 5AM5A 5FUWA 1DPGA 3TMYA 3ZWXA 3WK5A 1CE8A 2E4VA 2HK6A 3A1CA 4C88A 3RG2A 1QSGA 2YH2A 4ME6A 4MK4A 5J5CA 4BMSA 3HCRA 1NXWA 3KJEA 4OD0A 4RZ2A 1ZS9A 2QF7A 5IMBA 5BO5A 2XMPA 1OXBB 4N0EA 3AB8A 5H3CA 1TZKA 4RTNA 1CF4A 1NXOA 2Z4SA 2IIQA 5TGZA 4C1BA 3M5CA 4R8SA 4Z49A 3QXSA 1ZI6A 4WXRA 4YS6A 4OXQA 3D1JA 3O31A 1D7AA 4D8YA 4L2IA 2HA0A 1L5RA 5AK6A 3GW8A 1P60A 3UUEA 4NZMA 5IH3A 3T7AA 1DBRA 5C31A 2KB0A 3LBYA 3MMNA 2GM9A 3EG5A 3GNSA 4MUMA 4BVGA 5ED4A 3CW2A 4OB8A 1YMQA 5FJIA 4E2XA 5EIBC 5CDSA 3IAHA 2BE9A 1E4EB 4BTLA 4FDLA 1W1IA 2FN8A 1UPBA 4QUDA 4MPTA 2ZWIA 3C48A 3D6UA 3QFRA 4BNMA 4MARA 4D46A 5DNUA 3UA4A 4Y67A 1ISPA 1PNVA 3MXOA 3AF5A 3PHLA 1BDJA 5H83A 2V1XA 2QTCA 2GPAA 3GL9A 3NXSA 4JBLA 3SYKA 5DN6A 3ZKWB 1N8SA 1RYBA 2C8VA 1SB8A 2XJ4A 3LLCA 4M0UA 4QRIA 5JISA 1OOEA 2NTNA 3A6JA 4QQ8A 1MAAA 1QM5A 2HZ7A 3E48A 3QI2A 4AN4A 1BNCA 3H87A 2IHTA 4PX3A 2WMYA 4DDVA 2XMRA 5F64A 1JAXA 1MP0A 4BFTA 2Q0HA 4QYIA 4HTFB 3O4JA 5EKXA 4YJHB 2WB4A 4QYSA 4AY2A 1GTG1 1NDUA 4S1VA 1BVYF 2X6QA 5D5QA 3N2GA 1XX6A 4FCVA 4CTMA 2FEMA 4D4JA 4U1RA 4HXYA 1ILWA 3GPIA 5IT5A 5LJIA 2DFLA 1Y33E 3L82B 1G5QA 1M2EA 4JB8A 2QRJA 2HA5A 2GAJA 3K72B 2PGJA 1I36A 2OP0A 4E94A 1X3LA 2D54A 2EVWX 4O4LA 3HVRA 4Y6LA 3OC6A 4JODA 4RCVA 2ZSBA 3AERB 5FBZA 4M9ZA 4KYVA 3RU2A 2Q1WA 3ZCPA 2VHTA 3FUTA 3OQMA 1YZHA 2A7XA 2FF7A 2RB4A 1JLMA 1ZWKA 4ZT2A 3EWSA 4Z54A 4CMAA 3K5PA 4XM2A 5CA1A 1YBAA 1J1IA 1KO8A 4PWZA 1B00A 2IDZA 5F7JA 3HLTA 4AC9A 2PXHA 1Z6XA 3T0GA 2P3OA 4IG9A 1XWWA 3RVPA 4MV9A 1DAEA 1ZOLA 2OB1A 2L42A 3QKWA 4TSFD 3OQPA 1Y7IA 2PZKA 2OBFA 4O8ZA 4ZZIA 4PGGA 5BQXA 3VPXA 3CLHA 1NU8A 3P4XA 1JRLA 1AB5A 1BROA 1FCJA 3NOOA 3T7DA 1J7KA 1P73A 1YU6A 2BEKA 3QY0A 3MJCA 2GA8A 4QNNA 1EG2A 2CLIB 4WKOA 5JVDA 5FUVA 1J4AA 2V6IA 4X6UA 5G2OA 4AKIA 4MSUA 4AULA 4PC1A 1LDEA 4C2TA 4JXZA 1T0HB 1I4LD 2QSJA 4FI3F 4WUTA 1PYDA 1FYWA 4Z8YA 3WFZA 3AHEA 5KZMB 1IOVA 2Q6OA 1EFPA 4TL6A 2I4LA 2HRQA 1OWNA 4BNKA 4TS3A 5EMKA 4PZCA 5EZ5A 3V32A 4ILEA 1E1CA 4WPGA 3A1DA 4ZI7B 1LQ2A 2WHQA 4XUEA 1M72A 2WAOA 4C0AC 1FMFA 1JPVA 2Y9PB 5JV5A 2HPHA 1E2UA 1TU0A 1UKYA 1HYHA 2X0EA 1YFLA 2IH2A 2X5JO 4OFBA 4NICA 5AW8A 2WJAA 2OTCA 3EZLA 4MVJF 1Y81A 2BMWA 3G0BA 3LXRA 2PU5A 3N8IA 3PGA1 5FT9A 2XEDA 3KTAB 4GDFA 3VC7A 1E2KA 3VR4H 1U0HC 3ROPA 5FADA 1QHFA 3LVQE 2HRDA 1EYZA 4H7IA 4KN8A 1N0IA 1NQVA 2JAQA 4NBUA 2OPBA 5B1IA 3T5AA 2WUFA 3CX6A 1W581 3NDBB 3QG1A 3A3KA 1JA9A 3WJ7A 4G5GA 1JLHA 3KZNA 1EUZA 1VHWA 3MTJA 2ODEA 1XZBA 1P6QA 1M2OB 1CY0A 2VQ3A 1T91A 3ITDA 1U80A 3LZ6A 3RKSA 3LCJA 3UGKA 3WMXA 1JG1A 1IY9A 3O8QB 4H7DA 4OSPA 1W46A 1MO4A 3BFJA 3HWSA 2XSZD 4GI3A 2WHPA 3BMQA 3ILVA 5DTEA 3UATA 5C35A 3HY4A 2C5AA 1GNSA 2HIHA 3EEIA 1AZLA 4WCVA 2UVPB 1KI7A 1Q16A 3RGWS 5AD1A 2CV0A 1DQNA 1BDBA 4PONA 2V74B 2UUAB 3GELA 1ML4A 5AHOA 4MIEA 1PT7A 3QYFA 5C46F 1VJ5A 2XGMA 2BFDA 3GY0A 3MAGA 4LGVA 3SF8B 2FZKA 3T06B 2FSHA 2GD1O 3HUDA 1C0IA 1P5RA 3QU2A 4YUVA 4X94A 5ARBA 3LDGA 2ZP1A 2WJ3A 4JYMA 1Y6QA 3QI7A 3WNDA 4PX9A 1PGPA 2E2WA 2J7PA 2YXLA 1KMHB 3QKRB 2NXWA 1KYWA 3FNIA 3KSMA 3H65A 2JARA 3BDVA 1QHIA 4ZYVA 1VGVA 3K8QA 3IAM1 1E63A 2GJ9A 4NV3A 4V0KA 3GROA 2D74A 4TLMB 2VJMA 4UE3S 4A26A 4CR6A 3OTOB 1IZ7A 1JV2B 4MUAA 2FWPA 1G21A 2Z09A 2NZWA 3A1NA 3RSZA 4C0XA 1Q12A 5EE9A 2ZTSA 4GICA 4KO2S 1U8YA 2ZYWX 3G82C 4EW1A 4RDIA 2PJRA 2C3PA 3CU5A 4LS3A 3AW8A 4JQYA 3WGMA 5IAOA 4RTSA 1M2WA 3RYHA 1KJWA 1ND6A 1I2DA 2B3DA 3C2QA 5EPOA 1GLVA 3N7UA 1LTHR 2PUCA 2RK3A 3EZYA 1QV7A 3IKVA 2F17A 5FEMA 3UHAA 1PBNA 1TUBA 3WVNA 1GPAA 1BDHA 1B2RA 2Q3MA 4F6RB 3ADDA 1JE1A 2P30A 5F1OA 4AROA 1O94D 1CLEA 1GEEA 1QH0A 2Q3BA 3CVOA 1NAHA 2BFWA 1YJ5A 2PSJA 4G97A 4OFXA 3IQGX 1K8YB 1IBRA 2P9EA 2I62A 1NW5A 1VLHA 2QM7A 3NJRA 3EB9A 4QO7A 5F4BA 4BP8A 3ZGZA 3H2ZA 3O0TA 4A8JA 3WL5A 3O8OA 1I30A 1H85A 3OUUA 1EQ2A 4JP3A 1KSJA 2QN8A 4I2VA 2J3DA 3H18A 3LXUX 4MUKA 9ATCA 1VP9A 4UTOA 4KQ9A 1L4BA 1OIWA 3AB3A 2JD1A 4FTWA 4B44A 4Q7QA 1WSAA 4R1PA 2GOYA 3DEKA 1NUHA 5CM9C 2XY4A 3JZIA 5B2FA 1NUPA 4FYJA 2P2CA 1LRLA 1SN7A 2I0FA 1ZESA 5JYBA 4N9QA 5JG7A 2PGXA 5JY6A 5JSQA 4RL4A 2O4UX 2VK4A 3CUYA 5EFOA 4OBBA 3FY4A 1XPRA 1SVIA 1NRWA 2VA8A 4PQFA 3LRPA 4BX3A 3Q9NA 3SN6A 1LLDA 1KPGA 1ICIA 2C0CA 4U0KA 4EF4A 2GXSA 2J5XA 1PTJC 3JQ8A 4Z4IA 1EVQA 1MB0A 2NO9A 2G4VA 2CDCA 1JWAB 4CF7A 5K8IA 1K9VF 3UMRA 1YXMA 4J9VA 1YCHA 5ERGB 4UUOA 5JYDA 4E7PA 2UYCA 3B36A 3OP4A 4RVFA 1WA5A 2W93A 3HWX1 2LNDA 3BWDD 4X66B 2VAVA 2MSNA 2WG1A 4HNTA 4BQFA 2IIPA 1BN7A 2Q6TA 3DSRA 3PC3A 4YROA 1L0BA 2IITA 1DB3A 3G13A 4PC7A 4DCNA 1B8OA 4YJDA 4HGOA 1J49A 2NV0A 2PY6A 5J47A 1YS7A 2XZPA 2C7QA 2O8EB 1B4DA 2QBYB 4CL0A 1VMKA 1XMJA 2G70A 4QU5A 4G0OA 3RPEA 2X3UA 3ZNNA 2VHVA 1W52X 5JXIA 1H4QA 1RI3A 1Z7YA 3GDHA 3JQ7A 4G4IA 1R9NA 2PZAA 1T1RA 2ZTHA 2O57A 4QA9A 4DRXB 2VZ8A 1Z08A 3E23A 2WBLC 1AGNA 1SC6A 1D09A 4OL9A 1HI9A 1GNTA 4NKRA 3RVOA 3WYNA 4YO8A 4F2DA 4MR8B 1AKNA 3EK2A 3WIVA 5BV1A 5K3FB 1JA0A 3A1EA 3GLTA 4IDBA 1CQIB 3AESA 3IPXA 4IJQA 4X90A 2PQ2A 1IU9A 4P83A 3VYWA 4LJRA 3L8CA 1JFTA 3UJBA 2PPLA 4PYNA 1E64A 2E48A 2GR9A 1XQ6A 3HYTA 3ND7A 1LFAA 4U2FA 1BE8A 1ORIA 1HNXB 2QK4A 1DIAA 1JSXA 1TL7C 1T9HA 1TCCA 2HGZA 3N87A 1XMSA 4FYXA 1KSGA 3I2GA 3MEQA 3PNKA 4QKQA 5LSAA 1YA6A 1U1CA 4RENA 1JLLB 3EDQA 1CF9A 1RWPA 2B2NA 4YJGB 3A2NA 3JVVA 4BFSA 3ZYCA 1ZIPA 4B82A 2AF4C 4QARA 1IAQA 4U2KA 1DTSA 3LX4A 1OT5A 1VPWA 1F2TB 2VRWA 2BBSA 4X71A 2CFTA 2FV8A 2AK3A 3NW9A 3P2JA 4I55F 5HM8A 5TARA 4EAQA 3ESYA 2NSLA 3E2PA 1YQWA 2PHZA 3JAWA 3NALA 4Q01A 4BN0A 3MD9A 1A8QA 1Z2DA 1T36B 1Z34A 2IE0A 3BDIA 1O57A 5HF9A 5AR1A 5AK0A 2RDMA 4L8YA 2GM3A 5AW7A 4YJ2A 1I7LA 1D4ZA 1WMFA 3WY9A 4D97A 1LSJA 1RAHA 2W6MA 1VQ1A 3ADBA 1AUXA 1GGEA 4Y6SA 5DLPA 4OQLA 1IBSA 1NNLA 2WA1A 1QXSA 3GEHA 1UEXC 1R8YA 2F3RA 1F12A 5J2TB 1ZU5A 3WLLA 4ZMRA 3K2IA 1AK1A 4QBIA 4S3MA 3RYCA 2OFPA 1NMEA 5K8VA 3V1MA 1DMSA 3Q5GA 1KRWA 1XHEA 4GX0A 3S28A 2Q1TA 1ZVMA 4PG4A 3VC2A 1DUIA 3MBOA 4TV8F 1AMOA 4FHFA 1NZFA 4YCDA 2Z3WA 1C1DB 1PQYA 1T1SA 1FNMA 2XAUA 3C7DB 3DA8A 5EMLA 1XN4A 1L1EA 3UV6A 4L16A 3AUAA 4GXRA 3HUUA 2F8MA 3IUNA 3P4YA 5DXJA 4GMHA 4X60A 1XCOA 4OHZA 3ACCA 3C41J 1FUEA 2WM8A 3WGQA 1S1MA 1P1IA 5E4TA 1YJCA 1IHUA 2E4XA 1C9EA 4M37A 2G67A 1ISJA 3V1UA 3GUVA 3P27A 1PJSA 3FPJA 2NPOA 4FJ2A 1PBTA 4LG1A 1ZGAA 1LSUA 1XQYA 3IUJA 3PFWO 3BL8A 4KQGA 4GYWA 5ICMA 2H2DA 1BJKA 2OHOA 3QSYA 2D3TA 2PQ6A 3S3TA 2WJVA 4K5QA 4TTTS 3GYGA 3ZY6A 1U1IA 2PV0A 3FSGD 3VJRA 1NN3A 4ZRNA 3TTYA 3ESCA 1S02A 3JASA 1W8DA 3DOHA 4BWVA 2I2BA 2CUZA 2DQSA 4HWSA 1LJUA 5FQOA 3S5UA 2XMBA 1HQKA 4K6KA 1S0UA 5E2BA 4CKYA 2FEAA 3D81A 4KE9A 3ZIAA 2ZSJA 1CJTC 4Q12A 4LRXA 4TLLB 3AFOA 3BRQA 1GY8A 3GJYA 1CUEA 1HSZA 3INNA 4IGFA 1MFPA 2QZZA 3HKCA 3SYNA 3WYGA 2YOGA 1C7JA 3QJGA 1QB8A 1YZUA 4YMIA 3H97A 4CKBA 1F38A 1P1KA 3ZD6A 1JDUA 3QP9A 5F35A 1WXFA 1BGXT 1P1FA 2R4QA 4LJAA 4DCPA 1XTIA 2OBYA 3V1TC 2C59A 3GJ6A 4P4GA 2WVGA 3BOSA 4FP9A 2XR1A 2YJ6A 1HDIA 2C2XA 2IF2A 1GZUA 4BMZA 1CY6A 2VNHA 3U49A 1QZ3A 1CXZA 3LBNA 1JSLA 1XAHA 4Z0NA 1V35A 1V16B 1ZY2A 2HLDD 3D4NA 1GUAA 2W22A 3OWXA 4PBSA 2WNIA 4PHHA 4F7WA 2QQ0A 1HE1C 1XXLA 2I6XA 4LTNA 1T2EA 3C0KA 1YIOA 5BP7A 3RARA 1WDLA 2JFOA 2Z8ZA 3FWKA 4NU0A 1RLIA 3EY9A 1OFHA 1G18A 3UT5B 1YS1X 2HRRA 1F6BA 2W4MA 3P97A 4DWVA 5B6IA 3R7NA 2IY8A 3JYOA 2C0QA 3FUXA 2C4UA 5FOXA 3ZHOA 1XRLA 4P5PA 2PJZA 4MS3B 2ZUFA 2R8OA 2YS7A 2GO1A 5ESWA 2PE5A 2PLAA 3F3SA 3F3KA 4TUYB 4TX1A 4MR7A 2BTQB 3G2HA 3T1QA 4B2LA 4ETNA 2WU4A 1M1YA 5BW8A 4NH0A 1ATIA 1PQPA 1B14A 1M8FA 1UBEA 3CH7A 3D3EA 3LUCA 2BCGY 2ZR7A 4IIEA 3DFMA 3WGIA 1NI4B 3LK6A 1GNRA 4S0ZA 2NU8B 3WNZA 1E5DA 2Q4TA 3OPQA 3HFRA 4FE3A 3V4RA 1RJDA 3IE0A 5EGNA 3UOAB 5MDHA 3SQNA 1CIVA 1IQ0A 3DT9A 1N3YA 2QLLA 5KO2A 1XZIA 3ABIA 2QAJA 4C08A 1WXHA 3OJEA 1RYHA 3D6VA 1QAOA 4DR1B 4M1YA 1KY3A 4H16A 2AZXA 4PU0A 1C3OB 3R3UA 4YTEA 1G64A 4DR7B 4A6EA 5F5XA 2A35A 4IF6A 4OLBA 4IAOA 1QV9A 1T13A 2XNJA 5D85A 3HKBA 5CLQA 1LX7A 2WT4A 4JKIA 1VBMA 1CULC 4RK1A 2NG1A 3EW7A 5C8VA 3AW9A 5BR8B 2PKQO 3WGOA 2R00A 1W35A 2PWBA 2A94A 2POCA 2A0UA 1PFYA 2AQHA 3AB7A 4ETWA 2HMSA 3PP8A 1PU2A 3FSEA 2HTFA 4G1MB 2ODAA 3IUEA 5LIRA 3DLBA 3BJMA 3MINA 3N0WA 4HLDA 5TVGA 3IUQA 2BHLA 1YKFA 3PJRA 4EGFA 3IEUA 1NTRA 4GE0A 3KHTA 4LYEA 2V3WA 4PNPA 3RWMB 4B40A 3WLJA 2R66A 4JC8A 3VSEA 3IIJA 4RCYA 1P7VA 3COYA 1EK6A 2CHFA 1LNSA 2R8RA 3MWGA 1I0LA 3MA0A 3EX7C 1Z5OA 2IEZA 3E2MA 1IHXA 3HB5X 3WYAA 1OB5A 1DBQA 3G9QA 1R8JA 3DULA 5FUXA 4ETIA 3PLRA 4YCNA 1WEKA 2OORC 3ELBA 4HAOA 3MBIA 4ND7A 1PFWA 1U7WA 3BORA 1UK6A 2JI9A 2PUTA 1OBFO 2AIRA 3KKKA 2V7QA 4WFKA 2D6FA 4YO7A 1EE1A 3OIWA 5IAJA 4C6TB 2YJGA 2ZI6A 1O5TA 2X2EA 4UUBA 4AMGA 4Y3UA 5KOIA 1QYXA 1OH6A 2X13A 1P81A 1EP1B 1PJCA 2JI7A 1NFFA 2C2WA 4QC2A 1YVDA 4RHXA 4YQZA 5KYUA 5F3WB 4LNUA 2PAAA 1SC4A 4R71A 5BRJA 2NVOA 3W1WA 4S2EA 4BJHB 1CQWA 2A88A 5FA8A 3Q85A 3JAKB 1UJCA 1A2KC 3LW7A 2HSWA 2PYDA 3NIFB 4CUJA 4EJ0A 4KYTA 1C4OA 3O92A 1PJ4A 3B6IA 1OR8A 4LMPA 3PDUA 2KBEA 2ZRQA 3GGJA 2YYZA 3DLCA 3I5AA 5ES3A 3PXCX 5I4KA 1UFOA 1IY0A 4KQJA 2Q7XA 3DB1A 3VTAA 3UM9A 1Y8RB 5FPKA 3DGFC 3F5MA 1WUTA 4QEZA 4B3JA 3ZDEA 1XAJA 3IHKA 5LXTA 4DR3B 2M98A 4K9DA 4ZVKA 4L5AA 4TTIA 2J3KA 2JIMA 3AKCA 1NG9A 1XRPA 3QRWA 1FDIA 1YQGA 4Q1FA 4ZCRA 4A2PA 2VR1A 4NCIA 2IZ6A 1Y7PA 4MLDA 3AX6A 4PBRA 1KXJA 4AZSA 4GZLA 3M6WA 4L9WA 2B5OA 4ZAWA 1RXUA 3L07A 4NONA 4RSMA 4CV0A 3WYBA 2J0UA 3I3OA 3ET4A 3C3WA 5IZ4A 5IK2A 2YBEA 4C6HA 1NVGA 4HGPA 3DMPA 2O2CA 3GRKA 1M2VB 2HQRA 4JX8A 1T4BA 5DWDA 3GD5A 4ROTA 3CNHA 3TIXB 4IGAA 1AKRA 1Z6PA 3CLKA 3O90A 4D42A 4ZPXA 4DY4A 5KYXB 1YVUA 2ZSEA 5EJ7A 2MTBA 3SM9A 2HIMA 3NOVA 2WSLA 2ZITA 3EQ9A 3B6KA 2ZXUA 3I6BA 4JI4B 5LA6A 3I37X 4BFVA 2R1VA 3AM4A 4RETA 3O91A 3CZ4A 4NCXA 2PMBA 4OHUA 1F5NA 1QIHA 1I3KA 2EARA 4QBHA 4IIHA 1ZN9A 2PJUA 3A6GA 3OOHA 3NB0A 1YJAA 3L6BA 1KEKA 1MRSA 4ZMBA 2X2OA 4PAMA 4P6VF 4HMPA 3EVZA 1XZEA 1RAGA 1NJ8A 1DX9A 3T7KA 3Q9SA 2O0MA 2OT3B 4FFWA 1Q7GA 3GARA 3HCAA 1BU5A 2MHCA 1YZNA 2QJTA 4PHTA 1OU4A 1Z29A 2ECFA 2J4CA 2ZUBA 1NKTA 4MZDA 2A5FA 2C97A 2Y1LA 1MAHA 4QECA 4NMWA 4EJSB 5CR9A 4ND4A 4N9WA 1HLGA 1LBHA 5LU8A 1SUIA 1K98A 3EZFA 1A7AA 3JCZA 3VR6D 1UPAA 3EC7A 5IN4A 2CMDA 1H1LB 5FD8A 1CERA 2C98A 2C94A 2FP4B 5EIAA 3V3TA 3V4VB 1GCOA 2W98A 3SG0A 4AO8A 4R9VA 2CDNA 3GCGA 1WMEA 4F9EA 2GK6A 5JMWA 5TIIA 1P2BA 4WEQA 5A3JA 1FNNA 1UFRA 1WHSB 3Q7RA 3I5UA 3ACDA 3PRKE 4Q7EA 4BO5A 1GPH1 3JQGB 3N8KA 4I14A 1ZISA 4OATA 3GZNB 4L8VA 4UAVA 5J63A 4B9AA 2O3TA 4J6FA 4EM6A 4V1CI 4KREA 3CKYA 2YINC 3RVJA 2EV9A 1VHDA 4TL9A 2HOQA 2W6PA 3AVXA 3Q3EA 1T8PA 2FPXA 4J0QA 4OI0A 2OLJA 3E15A 5TQVA 1Z37A 3EVFA 3PCTA 3EQZA 2DM6A 1JFFB 1KR2A 5E7QA 3T5DA 4UEOA 1CUDA 4NFLA 3I61A 1ORWA 4WA8A 2P91A 3LBFA 2Q4BA 3CH4B 3HR8A 4EYSA 1PSDA 2Y3IA 2PUWA 2B1RA 2BN4A 4LRQA 4CM9D 4ZAYA 3IP7A 3KB2A 1K1EA 2WKWA 4K26A 2P7HA 1Z6GA 3N3AC 3MTBA 5JRDS 1D2MA 4UZEA 1BS9A 4AY6A 2NGRA 1RMYA 3TDMA 1OKKA 4MW0A 4E22A 3P32A 3KU4A 1R6XA 1N9KA 2JI6A 3FCAA 5HW0A 1TEZA 1N5RA 1IFXA 2ATEA 3D43A 4NENA 2HCBA 5B55A 3DL4A 3ZR4B 1S8AA 2A1UA 2XTNA 4FI3C 4MI1A 4RW0A 2VYVD 4JQSA 4ZV7A 1MX1A 5G0SA 5CDFE 1P2FA 5EJ8A 4QTTB 3H9QA 4YV2A 4HNVA 3M33A 3N59A 3SZLA 3KL4A 4UHEA 4F11A 2SNIE 4GL2A 2Y71A 4M6WA 3N07A 1WZCA 4KKVA 2A14A 1AKYA 2FNAA 2NU9A 2O0JA 1FJ2A 2QIOA 2X9QA 3OZIA 4RZHA 4WY5A 4AP5A 4BQNA 5EFZA 2QYHA 5D7NA 5A03A 2O2ZA 5T64A 1HWYA 2CXSA 3OZEA 4DQVA 5KNCA 1XJQA 4HCJA 1M0EA 2UDPA 3LK7A 2BDTA 4Y1RA 4V1CA 2AN5A 1HZZA 1FP4A 1R5JA 2G71A 3UVEA 1I6LA 1PQUA 4IVNA 1RRVA 2RHDA 2K6GA 1IVNA 2XMDA 5TEWA 2C92A 3WICA 1CQJB 1OWLA 1VHTA 4ARZA 1KS9A 3DVLA 4F3RA 1F5SA 1BN6A 3LKZA 2O0KA 4QDJA 4B7XA 5KJCA 2JEZA 1DGQA 4P0QB 1X15A 1XLVA 1JQAA 4I5EA 1ZK1A 4EW6A 3REGA 1ZHOA 2YWEA 4A15A 3OHSX 3LPNA 1W6UA 2QMQA 3QQPA 3DVAB 4PICA 4BLQA 1Q3TA 2CSUA 2H3EA 4YONB 1SHUX 2ZSAA 4M9SA 1T35A 1JZTA 1KZ9A 1FFAA 4QJIA 4YMVA 5H4GA 5CIYA 3IT3A 5E4YA 4UM8B 2PRKA 5JZBA 2YC2C 3CLSC 1KAQA 1MQSA 1SIBE 1KAOA 3B70A 3IUBA 4DN6A 4GOND 4WZBA 4FYHA 2B6HA 4HDKB 4HAIA 3IR7A 3U1VA 1B2LA 3VYVA 4BFCA 1XNHA 4RDXA 121PA 1NZDA 2XLCA 3BD9A 3Q5EA 2AFRA 3HDTA 4MV1A 3ZDZB 3LW8A 3PGVA 3NX4A 4EPYA 3OP1A 3IP6A 1Z0UA 3KKOA 2RKBA 4RS3A 1ZIYA 5F1YA 3DMHA 3OT4A 2R2AA 3NNSA 4MB0A 2FAXA 2RHBA 3WB0A 2DJIA 2PLNA 2EU8A 3D6FA 3VZCA 4B3DA 4V0MA 1KVRA 3QEJA 4FFBA 2C88A 3FWNA 4N0MA 1NVKA 4ASUD 2VKTA 5AK5A 1J97A 3H3FA 3Q9UA 4Q1VA 4ZQCB 1ESEA 3KYIB 3O2NA 3DE0X 2A9JA 3F7TA 3ECSA 3FTCA 4KWEA 4UZFA 1OVGA 4GNRA 2RD2A 1TZJA 4N47A 4BNVA 1XDDA 5IM4F 1SURA 2HWXA 3VBEA 4GUDA 3PD0A 1H65A 2GHQA 3DKIA 4XYBA 5I7AA 2JJ1D 3B6EA 2QRMA 1TKRA 2O14A 1WIWA 3IALA 2BH9A 2OHJA 1SIUA 1BYIA 1PR4A 1XJ5A 2W2TA 2WHRA 4DSOA 3ZDCA 4FK8A 4OHKA 3CQ9A 4ER3A 3CC8A 4BYMA 2Q50A 3QEKA 4QREA 5GIOE 3WRVA 2FG5A 2VNIA 3ELYA 3K15A 1NQUA 3G89A 5P21A 3Q8MA 2IFTA 4J3NA 4CLRA 1N78A 2MINB 5EKTA 2G0AA 1E2IA 1GQQA 4INPA 4UJ3A 4Z99A 3VMFA 1YL6A 3AEKB 3L92A 4UHJA 1OAOC 3EXHB 5JPCA 2GEKA 1D6SA 3LBAA 4CMGA 5EJ4A 3K9HA 3A14A 3PFHA 3RSCA 1Q95A 1SVLA 1EWTA 3TN7A 5H81A 4ZV9A 4Q4AA 4UDXX 1XU7A 2DB3A 4LJ6A 4NZYA 5CVVA 3R9WA 3OJ0A 5AUNB 1CX9B 4O4HB 3WK4A 1P4HA 4HDSB 1M6NA 2OCBA 1NNUA 3FD8A 3T41A 3JQ9A 4L0DA 1OWPA 2BFMA 3OZXA 3A2MA 1UKVY 5CW1A 2DLDA 3VO2A 1CNMA 4QTXA 1L4LA 2BJVA 4BJ6A 1X7DA 3NEAA 3K9QO 4OQQA 1RVDA 1NXPA 1C50A 3DKVA 1JUDA 1J0CA 1T5LA 1ZJZA 3G2PA 3KBBA 3SIRA 4PHGA 1NXXA 1SC3A 4AL4A 1E6CA 3OPYB 2H2FA 7MHTA 3GLHA 4ZEXA 1F8YA 4KHPB 4XYLA 1KI9A 2IVZA 4A5OA 2GEFA 1DKRA 3BG5A 3OEEA 5CT8A 3U80A 1PJLA 1QYDA 5ULLA 4YT2A 3O21A 5ALVA 4QYWA 2G09A 4NZPA 4EMTA 1L4NA 1K86A 3FRIA 2XUAA 4GWKA 4YY3B 1PFVA 2WMNB 2W83A 4OB6A 3EAGA 1BQEA 2QTGA 3D3WA 2VG8A 3SR4A 1B7GO 1PJTA 3HKDA 4MV6A 4ZZ2A 4E33A 4CTKA 1UPCA 4DIBA 3R5FA 1QRDA 4V38A 1NSFA 2YJ5A 1R0RE 3KQOA 4F4CA 1EFVB 3KK0A 2RK6A 4K6MA 2E37A 2WE8A 3M83A 2ZQZA 4LXUA 4RPGA 4M99A 5E4FA 4DQLA 4UTRA 1V95A 2BGIA 2J1LA 5F2EA 2ZJYA 4DPMA 1U3FA 4EITA 2RGDA 1OGYA 4C05A 1BOOA 4C4YA 1PZEA 4QHYA 1L8OA 3C43A 1QCDA 5A4FS 1WB9A 3K92A 4DY6A 1ADCA 4IVQA 1E8DA 1SHLA 3LMKA 3I5MA 2W2LA 1DWUA 3OX4A 4P4LA 4E12A 4ER7A 1JDBC 3HLYA 2H9YA 3L7JA 2ZCUA 3C7CB 5DW3A 4AURA 1BWRA 5EVCA 4NYIR 1ZD9A 1IN8A 1NU6A 2QQGA 3U19A 1GCIA 1IE3A 1NDQA 4TKMA 3VH4A 1NVAA 3F8WA 3W4KA 4E5KA 5LDHA 3W7VA 3WKAA 1GA6A 4AJOA 1A8HA 1FP7A 4DMKA 3F46A 1XN1A 3S4YA 1M8KA 1R9GA 2OXFA 3AVPA 2FPUA 1XEAA 2H7VA 1PNRA 1EB9A 1AKTA 4XGNA 4QHTA 1TZ2A 3WL6A 3UWSA 5SZJA 1M2GA 1XC7A 2H0QA 2ZRAA 3ZWVA 4A92A 4CGYA 1Z62A 2EGGA 2XF8A 1U99A 3IP9A 3VJLA 2C7OA 1S2NA 2ZWVA 2Q5FA 2W00A 1QO0D 1W88B 4KZPA 3G2IA 1GT91 1O97D 1Q3HA 5AVKA 3EN0A 2VYNA 4W5JA 5H80A 1Y9EA 5BN5A 3A4VA 1SMKA 5FO0A 3LBHA 5ADWA 1VJCA 2IEGA 3JYHA 1P80A 1ORHA 3G8BA 4MV8A 1P3Y1 5IJ9B 1SXJB 4NI5A 5I7EA 2GSWA 3H5OA 5GJCA 5FI3A 4H7JA 4C4TA 4O59O 4JL8A 4TOIA 4RKEA 1G0NA 2X4LA 3DFKA 2HN9A 4HWGA 3RYFA 3ZWYA 3IDZA 3DOOA 2FY8A 4HQKA 1JIQA 2NU7B 4NF2A 4KUEA 3OLVA 4ATNA 3AETB 5C32A 4DEXA 2QRZA 4LXXA 3KVNA 2YXBA 4ZVNA 1Y3IA 2D00A 1O8BA 3ET5A 4JJFA 3VPSA 1UMDA 4PQRA 1CKEA 3KLOA 1EGQA 1SQ5A 1P0CA 4GNKA 3IAXA 1J8YF 3B5JA 5DM60 4GX1A 2OQIA 1A88A 4KVZA 4ML3A 3KSDO 4HQOA 4X7PA 2R1TA 1EUCA 4Y2YA 5ELMA 1ISIA 3H11B 4LTDA 3R5XA 4TMYA 4DMGA 3GNTA 5LIPA 2O3UA 4DR2B 4M9RA 3HCCA 2JCYA 5DMXA 3E6AA 3PQ6A 4LFAB 2FXIA 2QRGA 2FSPA 3MSXA 4KIJA 4L9AA 4KHZA 4TROA 3TEJA 3TLYA 2J0QA 1J1ZA 2PAFA 2C61A 3NM6B 3O47A 5CD9A 2B1GA 3GD7A 5EIOA 4CDNA 1YB6A 1JQJC 3EQ6A 1DHTA 3ZI7A 3EIFA 1P4RA 3RJTA 4CM1A 1VIDA 3UK6A 3V8QA 4I0WB 4U7GA 4E5UA 1VL6A 4GOOD 1YVPA 2Z5VA 5KSYA 4QICA 3RREA 3AFHA 5B1EA 3B9PA 4QYMA 3C8DA 3K1ZA 3STVA 4KOEC 4MVWA 1ODFA 4TXHA 3QX9A 1IOZA 5SY6A 3R5JA 1ZGCA 3KJFA 3HRIA 4TMTA 3VV3A 2XGOA 2J4DA 5KMGA 5JNVA 1M5RA 2YV2A 4TT3D 4IH9A 1I3OA 2C4KA 3EXHC 4OJNA 3OU2A 3PFNA 4TQGA 3ZVLA 2XNSA 4XDGA 4BQOA 5AP9A 3ZQKA 2C9BA 4ZYYA 2HPAA 2O8BB 2P2YA 1O4WA 1JSRA 3BF7A 3NWOA 1RI2A 2BFPA 2EZ9A 4M0DA 4O63O 4Q3OA 4MIKA 3LT5A 4REMA 3R8CA 3UOWA 4WECA 2HMVA 4DIUA 1ONNA 4R31A 2O7NA 3DDZX 4Q4DA 1YDMA 4N3AA 2F90A 3FTEA 5IJAA 2ZYGA 4MVJE 4Z5XA 2BL4A 3SHFA 2V6BA 3TW6A 1N9GB 3MCTA 3N0XA 4TTJA 4RESA 4PO1A 5LBIA 3QA9A 2CV2A 4EHKA 4G0XA 3FVRA 4IFTA 2GCOB 3EC2A 5C4IA 2RAFA 4GM0A 4I1UA 4U0JA 5COBA 1HO3A 1TW3A 4RE5A 2FKAA 4K6FA 2BPOA 3T9EA 4DJTA 1FX1A 1P7WA 3EEFA 3ZDBA 1PQ4A 1AS3A 3K09C 2ANCA 1U8ZA 1UP4A 3UH1A 4D45A 2HGSA 1BW9A 3MWYW 2PGDA 1K5HA 4OHVA 5L53A 1KVUA 1M6WA 3B9QA 1X80A 4H1WA 4BP1A 1ZSYA 1ZK2A 3MWJA 1Y82A 5AHXA 1E99A 4PYLA 5SV2A 3DZDA 3H5RA 5B58C 1GQRA 5FBHA 5AXCA 1T2UA 3AY6A 4JBYA 4N3GA 1Y98A 2IHJA 4Y9DA 1ODKA 2ZIFA 3U3RA 4AQYB 5HRCA 3H8WA 4I1IA 1EUDA 1SHZA 1GG8A 2DGDA 3H0EA 4X7MA 2CLHB 1EM8A 3UMBA 4ZGBA 2JFFA 2XWJI 3L7AA 4XD2A 4BV2A 2ATVA 1BOFA 1TTPB 1ZCZA 2YTZA 3RSLA 5DM4A 2E9SA 3AYZB 2DP4E 3GHHA 2PEZA 4S24A 4XIIA 3PWSA 1SIOA 1Z6ZA 3TQHA 5C7LO 5JBQA 5F3RA 3B9RA 4M38A 5DDIP 4DLNA 1IEQA 4B6JA 4EARA 3JWJA 2HQBA 2X3FA 3LHKA 3LX8A 1PUXA 4BNUA 4G01B 5D6NA 4CWAA 3BERA 2WMDA 1Q7BA 3EZ7A 2YJ4A 4P58A 3T9DA 1VMIA 2ZIUB 4QFMA 4F2PA 1FA9A 1GDTA 1C41A 4ZO8A 1IEVA 2GPNA 3EBLA 6REQB 1KDTA 4TMVA 2P8SA 2WDPA 1N2JA 3NR2A 3VAZA 1T9ZA 1GQFA 3VSBA 2RJNA 1A8IA 1QH1B 3TUJC 4HH1A 2WJ6A 4R7GA 5TT1A 4JBGA 3SLRA 1AZWA 5BOSA 4BGIA 3LRTA 1FXSA 4FC7A 3PVSA 3AVOA 2EIHA 4RVUA 3AUXA 1U8CB 3TJMA 2OD7A 4YT4A 1QE5A 2C7VA 2XT0A 5C8YA 4EMSA 3FOAA 4YLGA 4BV8A 2XWPA 5TPZD 4E70A 4LE2A 3IEXA 4UOEA 2ZJZA 1K66A 1Q22A 3NAGA 3KM0A 2W6QA 2B2CA 2W6JD 1KIAA 4JLVA 1T8TA 2A0YA 5EWLA 1OX5A 1TAQA 3FDZB 3H8SA 2A33A 3B1YA 1ZHFA 2IZ7A 5A71A 4D56A 3RSGA 2HSGA 2R62A 5EXSA 5FFMA 1LV8A 3GJQA 4HEQA 1SKBA 3GRFA 4D3DA 3EXG2 5EJ6A 1S8NA 3N2NA 4MWSA 1E32A 2GTIA 5LDGA 1C3VA 5LUBA 4O2AB 1Q0ZA 2OBLA 3TI9A 2CF5A 2CUKA 1TIPA 4PNHA 4QLAA 1HQCA 3QEMA 4BAZA 3U60B 1T6BY 3QPWA 4C0JA 4C7OB 1W96A 2GRJA 2VT6A 3FPAA 1YB2A 1QG6A 2QPLA 4GMKA 4MWZA 1TD1A 1HLFA 1DBWA 1KDPA 1OWOA 2NM0A 3QELB 5BPFA 2VNAA 2NYVA 3BDAA 4IDCA 2QTZA 4XIGS 3DG9A 3DOEA 3O9VA 3PR1A 3QIVA 4FGWA 3P52A 4ZJUA 2JDID 3A1VA 2GX6A 5T4EA 4YH1A 5AM1A 1C30A 3MMXA 1ENOA 3PRYA 4PYQA 1T9GS 3GRAA 3LGXA 4D9IA 1UDAA 3LH5A 3HBFA 2QUJA 1CY2A 5KOJB 4INOA 4EHNA 2OAP1 4UNSA 2JGAA 2VHEA 4FSDA 3ANMA 4LZPA 2ZANA 4MJ3A 4QRHA 5C1IA 4BQEA 4DDUA 5ICSA 2YJTD 4DR5B 1EVLA 2AK2A 1UJ2A 4AJIA 3LJKA 4KR3A 4FGUA 3C8UA 5GJWC 2VBIA 3LAWA 4ZJYA 4IUDS 3LUPA 5FPTA 3PXGA 1UOQA 1AKEA 3FNGA 1NVDA 3NAMA 3OTGA 3GT7A 5TQ0B 4PF1A 1ACLA 3VH2A 2VP9A 1MORA 2LV8A 5DOZA 2XRFA 3E7XA 3S44A 2GF9A 2N3ZA 1DRKA 4EG0A 1JQBA 1VE1A 4COOA 2HDNB 4KEAA 2A0WA 4P7GA 1MJGM 3AXSA 4HXGA 2O3JA 3HP7A 4MRNA 4HQFA 2QX6A 1LI4A 3QYJA 1WVMA 1G60A 4M4SA 4LY6A 3RU3A 1QMGA 3SR0A 1I94B 1KJYA 3L1KA 3OD1A 5AW5A 3IBYA 3I9JA 3ZHBA 3K71B 4PGHA 3NDRA 5HDBB 1MZPA 2CD7A 3ERCA 2E7ZA 1XWFA 2O59A 2WYIA 4MA5A 4LA4A 4JITA 1XELA 3MWDA 2LE0A 2Z58A 3QPUA 5DNAA 4O02B 5FBKA 4ESVA 1F7UA 1AGRA 2YIVX 2JFBA 1XMQB 3JQDA 5BRAA 3FNHA 2PTHA 3C5CA 4G0YA 3ZWKA 4LF5B 2ZB7A 4MUHA 1IATA 1TKCA 2HJHA 2ZE6A 4W8HA 3HYNA 3FOFC 3F2VA 3KFXA 3A9WA 4DLZA 1N2EA 2NW6A 2ST1A 3K0AB 2QDXA 1CYDA 2QTRA 2JLVA 4J03A 3OOYA 5CNIA 5H5JA 3DCIA 1HE2A 3ZUGA 3MAJA 3O82A 3NEJA 4RFSA 1ISMA 1KEVA 1U9IC 4N03A 5A5VA 1UPUA 2EZUA 2NU6A 4R16A 1VKRA 3QKSB 3UBMA 5HQ3B 1VYTA 4A03A 5I51A 5AK4A 1MKYA 1QGAA 2AVDA 3U7IA 1MR3F 1E3TA 3UJ8A 2PR7A 3E9NA 4LK2A 4XVHA 3NKLA 3R0QA 3OJWA 4YXFA 3ZVNA 3DOFA 2I99A 1E6LA 4IP0A 3KSUA 4I1RA 1MJHA 1PFGA 1V3UA 2N42A 4IJUA 5GJBA 4F5DA 2VIIA 4WOKA 5E2IA 4HNUA 5AW2A 1N1DA 1UBSB 1YBVA 4LMAA 4FFSA 4RTLA 4BMOB 1R3DA 2OBBA 4I50A 2AT1A 2QLJA 4K0RA 5EZYB 4M3NA 4E7OA 1NM5A 3HA3A 3G5TA 1KRHA 3NGMA 5JXHA 1L8LA 3W2FA 2JJYA 2QJFA 3KBOA 4GXNA 4KPGA 4YUAA 2ZRDA 1TJ3A 4MQUA 4HDCA 3IC5A 4WZAB 5FDFA 4WDRA 3H2KA 1SOWA 1P2GA 4QYTA 2XPCA 3OA0A 5ELLA 3RFVA 4LJ7A 1GRNA 3L7BA 3W9UA 1KQNA 4L85A 2PD3A 4B81A 5KVAA 4NPHA 1P0IA 5JY1A 4D3YA 1HV8A 3L8YA 1TM1E 1P77A 2XHEA 3QE2A 4JMPA 1GN8A 3EFEA 3VYTB 5A0TA 3ZDAA 1CP3A 3AL3A 1L1QA 1T25A 3QSGA 3V8MA 3L7MA 3AGQA 1IZ9A 2W8BB 3QU9A 5M29A 1FX0A 5BOVA 4QODA 5A9RA 3PVCA 4P33A 3ZGXA 3OD5A 3J80A 4YRSA 1JDVA 1OLOA 4YRFA 4KKXB 3RUAA 3MF4A 1ZIOA 2GUWA 2J6BA 3FUVA 3E7FA 4GGMX 1FVXA 4KWHA 4DSUA 3ZBPA 3I0NA 2QAGC 2BHRA 2M1ZA 4FOSA 4RBNA 2JFPA 1Z28A 3MS7A 1N2CA 2AB0A 3MIIA 5CW2A 3UJPA 1DBSA 2EHJA 3RG8A 1MXFA 1E2HA 1UWVA 1VTKA 4HXFB 3SIWA 5ALPA 3SZUA 3L0BA 4ZQEA 5I3CA 1JNYA 1KQPA 3WV4A 3L8HA 4DYVA 2EW8A 4A5SA 5BUSA 4RXMA 2G9QA 2I71A 2IVFA 4IHKA 1RYZA 1OT3A 4YREA 4ZHSA 1PG5A 2C78A 2DR0A 1X3SA 3V8EA 4MI6A 5JCOC 1SUEA 4S35A 1I2ZA 3AUTA 2ZYUX 5JD3A 1Q7CA 3EY4A 3JWGA 4B1FA 4DDMA 3MOGA 5IBCA 3T94A 4G84A 2IA5A 1DIOB 2Q1YA 1IPFA 4ZC8A 4BUCA 1LBTA 3HY6A 3GRUA 2ERYA 3JD1A 1JEJA 2XMGA 2XUJA 2P68A 2VTDA 5KTTA 5JPDA 1HDOA 2CD9A 2VJBA 5EKUA 4RPLA 1YJXA 3SF8A 4DHWA 2W8ZA 2DMRA 4GGOA 4GPIB 4BKMA 2A9RA 3LXMA 3I4CA 2FN3A 4HI0E 1GTJ1 2GF0A 2PZMA 2OHGA 1H6AA 1WS6A 5DFAA 3AF3A 2LUOA 4FZRA 4JQCA 4LJSA 4UTPA 1AGXA 1T3ZA 1G20B 1U3VA 2VRNA 2YBDA 1HF3A 4J4TA 2H4WA 3KYDB 4X1KB 3UKOA 1OXTA 4DIKA 1GFZA 3REOA 3BHJA 4GC9A 4NBSA 4J0EA 5CP8A 5DNYB 4M9CA 3TKLA 5DM2A 4H7HA 3HBNA 4ZVMA 2JJQA 1MF7A 2B6NA 3U48A 2REQA 1O54A 1YB5A 2DUWA 2YNMD 2J85A 3ON5A 1AF7A 4Y2QA 1YE3A 3II6X 1SUPA 4O4IB 1QMPA 2C00A 2ZRLA 3R23A 4JGBA 1GSAA 5A2QA 5K2MA 3D5QA 1LNQA 4QUHA 1Q1QA 2WP0A 1VL5A 1GTMA 1WZIA 1QGOA 2ZDGA 1G9XA 2VHQA 4E3ZA 5KAMA 2IS6A 1KP2A 5CDGA 2NXJA 3WA7A 3GR6A 2H6EA 3I01A 3HMQA 5A5FA 3NBYC 2FWRA 4M1EA 4G36A 4CM4A 5D87A 2BMDA 3LY7A 1XZJA 4KXWA 1K6IA 4J0GA 1Y4DE 5G0WA 3U4CA 4K9PA 3LZCA 5TY0A 3W3AH 4AK9A 1JU3A 2FQWA 2JCBA 4IFEA 2X41A 1D03A 3MFYA 5G4KB 5C53B 2XRZA 1RBMA 3L7DA 2ENWA 2PVSA 1H69A 1UXKA 1GL3A 5I5GA 3K6SA 1YKGA 5FWNA 3L18A 4ZOAA 2QE7A 4N49A 4B8ZA 4A1OA 1FNBA 1W94A 3ANTA 5KTSA 2QX9A 1SUBA 3M3PA 1YMVA 3NRCA 1JFSA 5C5CA 3EOZA 3K1YA 1FLAA 4HGQA 1ECGA 1AVTA 1QK5A 3GAFA 2QUHA 4HEA1 1DKMA 1CBUA 1MEEA 3OEYA 3O8NA 1ZMOA 4YCAA 4ZYWA 5JXWA 3DHYA 3P0JA 4JD5A 4M1QA 4ZT3A 3FMOB 1K3UB 5GOZA 4FBGA 4LZZA 2COEA 4QXRA 4AM8A 1P0PA 1CVRA 1WXEA 4ZZ0A 6GPBA 5LKRA 4ZCIA 1RLTA 3H9GA 1LDBA 3F97A 1G5TA 3AU9A 3CH5A 3E8XA 3EMVA 3PGLA 1ZH2A 1U2GA 4PR3A 4WNAA 3ESZA 2I2WA 1S9DA 5F73A 3WADA 4E11A 1H23A 4TN5A 4WCDA 1OF1A 5KREA 3PPXA 2BUCA 3GJ0A 4KGZA 1CUGA 3PEUA 3D64A 5G0VA 5JS6A 3HO1A 1OCEA 2Q9AA 1JJBA 1CPYA 4TWJA 2FW8A 4D0LB 4XWKA 1XPOA 3QXGA 3DO5A 3FB1A 2RI6A 4UM5A 4KFCA 1SPXA 1RZVA 4R1MA 1P8JA 2GZ3A 1NMQA 2VAPA 3L01A 3DZKA 1TKAA 3DBOB 4EFKA 3N9IA 5KKNB 1X1TA 5DBOA 3O5AA 3LFTA 3ZZNA 4O2BB 1GIAA 3D8RA 3HI6A 2VZ0A 3OKAA 1CU1A 1OPRA 4QG7A 2CVHA 2NACA 2X1LA 2FE1A 1HOTA 3ENKA 3C7KA 3L4BC 1WV1A 4IJ5A 3WJAA 1DFGA 1E62A 1WSBA 1GKLA 1JHRA 3KCNA 5BYAA 2PZJA 4G26A 1SXJD 2HSZA 3LZDA 4OX9B 3RRXA 3NVKI 1D8TA 2CLSA 2J87A 2B9EA 3PNLA 4TQ9A 4BX9A 1E89A 4CCYB 5B12A 2Z2XA 2B1QA 2PRJA 2EFEB 3W1VA 4NL4H 3VOBA 1P8AA 2YZMA 3UCEA 4R68A 4P7JA 2DERA 2Q5QA 2NVUA 1E1QD 5IBQA 2EBUA 1OBCA 3PKZA 1J8DA 1FY2A 5KSPA 1GGVA 4R3WA 2D1TA 3BMOA 3QUAA 4X1YB 2XAAA 3DM5A 1LZKA 1GCAA 3R0IA 1CNEA 1NVBA 1GGFA 2X9VA 1ORVA 3TVTA 5L51A 1JXMA 3OKFA 1SBHA 2IQ5A 1KIMA 3GT4A 1K8XB 3BWVA 3L77A 4B4DA 2R4TA 4TWAA 5DSZA 3PUZA 3IMCA 3JQ6A 4MPRA 4TYMA 3A4NA 2PUBA 1LUAA 4Q4JA 2CNOA 3NT4A 1QRTA 4Q5IA 1E5XA 3K6JA 3GFRA 3LD9A 2AFIA 3USCS 5GAJA 3KDSE 3NBKA 1QDEA 2Q45A 3WB1A 3C3CA 3E1KA 3AFMA 3MJEA 5DTMA 3KR0A 1XT6A 5CPFA 2FWNA 5P8WA 5K8TA 1P5HA 5K6AC 4PQGA 4EDHA 5TB5A 2ZQ5A 4CRWB 2DTDA 1M8JA 3E22B 1P1JA 3KWFA 4RH0A 4L5CA 3S99A 4R8MA 2HMUA 5HIAA 4GVLA 4M1MA 4PZ9A 4OM8A 1FP1D 1K7EB 4DAEA 1UP6A 3F1LA 1QC5A 1GKUB 1L7DA 2I1VB 1FMTA 4K87A 1GRVA 4LOKA 5TLSA 4UXHA 1Q1ZA 2QN7A 3KPUA 3ZU2A 4ZQIA 4CLXA 4MRMB 3PD7A 3MRSA 5BSMA 4BQIA 2OORA 2H7XA 4ZU6X 5BW5A 4XD7D 4LYDA 4OYYA 1SXPA 1QWOA 1KEZA 1BQ3A 1RHQA 1TDJA 2Y76A 2G83A 2GPWA 3U4GA 2OCGA 3VZSA 1S2GA 2BR3A 2GLUA 4PPQA 5EP3A 1J2JA 4RTQA 4EFDA 1A7UA 4F93B 4URXR 1F7VA 2ZBUA 2JGKA 4HB0A 3MERA 1R0KA 4MS1A 1V43A 3MXTA 1X7WA 4CQLA 3K0SA 2HK8A 1HTBA 3K1AB 2NPIA 1X86B 2C2KA 1X8JA 4BPBA 1XTVA 4RF3A 3CVVA 2UZ4A 1Z4OA 4D4HA 4L95C 5GZ1A 5CHEA 2ZRBA 7GPBA 3C5VA 5HFNA 1A4XA 5IAGA 3PFBA 1Y37A 4XB2A 4GFDA 3VU9B 2RHOA 2JGJA 3Q6NA 1XF9A 5CH8A 3KVVA 3LKBA 3E1SA 4YFYA 5T4BA 3OKCA 2DCMA 4YX9A 3TZQA 4EEKA 3S0JA 1V7CA 4V0NA 1Z38A 1ZH0A 3MCWA 3Q2OA 5CB6A 4YRTA 1KYVA 2XUHA 3N6VA 2ODBA 4KDFA 4AG5A 4DWWA 4MWGA 1ZIDA 4DYHA 1LTQA 1UMCB 1UKAA 1X7HA 2ZT8A 1HLPA 5L95A 1CYEA 1NW3A 4RZ3A 2OO5C 2YRXA 5C2JB 1A4RA 1SM4A 3KZOA 1RM5A 1DRWA 5DX1A 4ZIRA 4XAQA 1WW8A 2C5GA 1G1MA 2Z04A 3IULA 2I54A 4KPUB 3ECCA 1JZSA 1ESNA 4YPOA 3S2UA 1X7XA 3V2IA 5EJEA 3L0ZA 1RC0A 4KW7A 3GC6A 2Q7DA 1CDEA 1JQDA 1XMXA 2FX5A 3AKYA 5DHUA 1JT2A 2QP4A 1KDYA 3PC8C 3RAFC 3DMTC 3I8SA 3SS7X 1MO2A 1QKIA 3GEIA 2HA4A 3A6FA 3Q3VA 2VPXA 3RDPA 3E9ZA 2CEAA 1CZKA 3GAMA 3MK31 1DX4A 3QU4A 4RY2A 3VM6A 1Y3HA 5CB4F 1W85A 1A9QA 1YRYE 1TT5B 1BHSA 2O50A 5DCUA 4QQKA 3T4EA 3WNCA 3P4UA 4UUPA 1QH8A 3I2IA 4ANFA 1D6NA 1FU8A 1I4EB 2EBFX 3CG0A 3E8MA 3H1TA 1XL1A 3KZMA 4DGSA 5JNUA 3DD1A 4N5DA 3F96A 2E5FA 3OA2A 4MAAA 5J1SB 1JR6A 2QMHA 3TL2A 5K3CA 4D9FA 4X65B 2NZXA 2DLNA 3HYRA 2CJXA 1TFUA 2Y6UA 1N5IA 2O20A 1U0TA 2H2WA 3I64A 2XKKA 5HBRA 1R8XA 5CBKA 2XWBF 1GTL1 3FNQA 3IMEA 1S89A 5JWRA 3REQB 2NUAB 4QWMA 1IHYA 3M6LA 2W2KB 3LQRA 5LQSA 1U65A 3C45A 1E2EA 2JFYA 3HP4A 4GI5A 3TLXA 1M9NA 4O3MA 3I53A 4JI2B 2ZB4A 2EEPA 3WMRA 2VT3A 3ABQB 3SVTA 1U3TA 4B8WA 4QWWA 1EBUA 1H8ED 5CURA 3L8ZA 4ZOCA 1X39A 3V6LA 3K4PA 4UFOA 3UENA 1II8A 1J21A 3DL7A 4YACA 5GWXA 1LZLA 5I9SA 1JEQA 1BHJA 1BXGB 1XZPA 4AQDA 1ZGGA 4Z1MD 3RVDA 1N6PA 5GPBA 4YASA 2J31A 3TM5A 4P9NA 2NQ8A 4BXOA 4IMPA 2Q4OA 1MH1A 4CEJB 5KQRA 3ETNA 4LFCB 5FL7D 2NO6A 3KP1A 4W4TA 3W34A 2NLOA 2ZPAA 5T4FA 5SYAA 2CVOA 2PD6A 1G8GA 2J3EA 3MW8A 2IYPA 3OQHA 5FAXA 1M2KA 2PT6A 3D7LA 4TWRA 3ICQB 4F4FA 2BFNA 2EF1A 1QKKA 3DDSA 4D8VA 4W5OA 1RZ3A 2CXTA 3CW9A 2ZIXB 4Y0NA 1YK1A 1D1TA 2IYRA 3VPAA 1J2TA 2BZ0A 4RFVA 1WUYA 4F86A 3FYUC 1E6KA 3GT0A 2E87A 1YB4A 1TO2E 3G5AA 4PZUA 3CEHA 2Z57A 3M3DA 3M6XA 2JZNA 4U6QA 1TLFA 2H59A 3F6CA 4BATA 3HU3A 3G23A 1ZOPA 3KFLA 1U2EA 2P7IA 3E9RA 4DV5B 1Z0DA 2NT4A 3L84A 4QGAA 5B2EA 5CVDA 1BRTA 5KQSA 2JGFA 2DHQA 1Q0SA 3AZQA 3Q8XB 4LVOA 2JLZA 3L7IA 2YICA 5L6LB 3S27A 1H3EA 1NF2A 1DBVO 2RBEA 3A1TA 1WETA 1FE8A 1XRRA 2E5WA 3MUOA 5IEBA 3TBFA 1DHRA 4FMPA 4HDNA 1YQ9A 4C0HA 3ZBTA 4XQGA 3C1TA 3O4GA 1I33A 1IK4A 2ZUVA 3BZUA 2VPPA 3SJ7A 3UNXA 4PC6A 2JFNA 2XVAA 3CSUA 2IC5A 4DM7A 3NS7A 1KIFA 4O8CA 1TPYA 2I4OA 4HC4A 1TJPB 4XASA 4FFLA 3CRNA 2H9IA 3AEQA 4YJ3B 1OXVA 4LHEA 1NNI1 1QJ4A 5F76A 3IIKA 4C29A 4JI7B 1B8VA 1RT9A 4WAUA 4BKPA 5HKLA 4IDPA 1W19A 5BNTA 1FS5A 4WY8A 1QHEA 4YV1A 1YQTA 2ZAGA 2ZRFA 5HS6A 5LBUA 4BFXA 5HJ2A 5HIKA 3FPEA 1A4UA 1EWYA 3BXFA 5JALA 3AP2A 4HX9A 2WQ7A 2V58A 4YUZA 2FZGA 3H1EA 4XUDA 1PR3A 3CX4A 1GARA 3K6RA 4QXMA 3RFCA 2PUAA 4B4UA 4HLCA 2QD2A 4R6XA 4YJFA 3T15A 3O2JA 3EAQA 2CL5A 1EE9A 3Q15C 2RGWA 2YVLA 1Z25A 4KXYA 1P31A 1DJMA 1WQ4A 1VPDA 3NHZA 2XVMA 4M88A 1L5WA 1ZLYA 2WZQA 3BQNB 4R1TA 5IAEA 4CPDA 2GETA 2QW1A 3PHGA 1WD5A 2XXAB 1IEWA 1Y6JA 3WO1A 1PJAA 1WUJS 2Y66A 5FWYB 3ROFA 4ARSA 1NOKA 5C9ZA 1VE6A 4HNAB 5C37A 3ZW9A 2BUAA 1N4DA 1S3FA 1YAJA 4C01A 4CG2A 5IFLA 3P9YA 2IEBA 2AN4A 3K5HA 3I1IA 5JFOA 1OB2A 2AMJA 4GG1A 3CR8A 3HV2A 3LLUA 4I99A 1P2UA 3HJBA 3K2BA 4ZVVA 3LXXA 3QKUA 4I4NA 2JH8A 4P80A 3IV6A 4XLTA 3LF1A 4KFSA 4MWDA 2YN2A 2RG7A 1NVVR 3Q0EA 2FPPB 4RCZA 1DOHA 1JF8A 4OXYA 4YDQA 3FYSA 4YYEA 2QMUA 3U4QB 3W2GA 1QAMA 3SEZA 1KU6A 3LQYA 3ID6C 1X14A 4PIMA 4Z9AA 3UUFA 3D7NA 2YWJA 2Z4TA 2A84A 3ZVRA 5LP6A 5ADHA 5JD4A 1Z6AA 4X8HA 1H2BA 5JWHA 1MFZA 4NV0A 4QDKA 4AIIA 2WE7A 1RJGA 4B3MB 1TQHA 4IIBA 2ZJAA 2XKJE 1SHJA 1HPLA 4OEHA 1VPEA 2ECKA 4XLZA 4YPVA 1OHHA 2C5SA 3DBHA 2X7JA 4L73A 4AG3A 3G17A 7REQB 4ILKA 3UYLA 1M66A 3P19A 4DILA 4DBLC 4RKFA 1OI7A 1CIJA 1QPBA 3BMCB 4LXTA 1IJEA 3R0XA 5IASA 1ONOA 1DKUA 5DVZA 5KYWB 3VXKA 1RJEA 2XGJA 1OLXA 3LIPA 4CNQA 2JLCA 3O74A 1B6TA 2HU2A 3M6UA 1VSTA 4M54A 4BVKA 1GUFA 5JTUA 3WYFA 4QM7A 2PGIA 4QOHA 4NCJA 5HF6A 1EP2B 2J33A 3STHA 4EJ6A 3C3BA 4LWPA 1D4OA 1E3DA 3DV0A 3G9TA 3I0ZA 5DULA 3UWDA 3EPRA 5KYYB 2B1JA 3VR2D 5YASA 3FOCA 5KNCH 5CG2A 5LOVA 2QG6A 1B73A 2I2CA 2XD9A 4QFBA 4K9SA 5BXQC 3H1PA 5JE8A 2CL6X 2WU1A 4GR5A 3BL5A 5UKDA 3U7QB 4JJEA 5DXAA 4H18A 3SNKA 1OAOA 4LXQA 3V8BA 1V3TA 1U7UA 1Y3FE 5H59A 2HHCA 1BCRA 2NSHA 3GVIA 3UWMA 1WUIS 2G1UA 2QU8A 1AZTA 1I7PA 3H16A 4NU5A 1U0EA 4YCBA 3RBXA 3VHXA 1VLLA 1G20E 4P38A 5AHKA 4MKZA 4IJ6A 4II7A 2JFGA 3S2IA 3CXUA 1UC4B 2FGJA 1NYLA 2I2XB 1HLDA 1Q50A 1QP4A 2UKDA 3SC2B 4N01A 5LQUA 1GOTA 1ZEMA 1QFXA 4JC0A 1AQNA 3USZA 2JIZA 2RKOA 5HIJA 2W6NA 1T2NA 3OF5A 4K88A 3NRJA 1J25A 2VDWA 4GOJA 4NXNB 4WVFA 1PT6A 3DONA 4R01A 3T9BA 3TNYA 3GLIA 2HHHB 2IBSA 3ND5A 2Y1DA 1LK7A 4KLRA 3L49A 3V4FA 4E13A 1GSOA 4EVSA 1XDBA 3GLGA 1Y3DE 1RAAA 2FJ0A 3CZMA 3PFGA 3C16C 3ZWPA 2OB2A 2RH5A 3G2LA 1R66A 3K0FB 2FPIB 4X7RA 1SD2A 4CQMB 1E0JA 2ZRKA 3OE7D 3OUZA 1N7GA 4LJKA 2FW0A 4KAFA 4YRDA 5F2OA 5GQSA 5KNBD 2H11A 3SQWA 4Y2TA 4F4HA 3CZAA 1ULUA 1VLJA 2ZZKA 1F6DA 1HT3A 3KAPA 1IXKA 3KLMX 4N6GA 4X7BA 3RO7A 1ZQ9A 3BMNB 4GR9A 4AP9A 1K68A 5A3RA 5FLXA 1BXZA 3TTXA 4QTZA 4YUXA 4WIAA 4RWEA 4A6PA 3MM4A 3HDGA 1BD4A 4Q9IA 5COQA 3AIMA 3TEFA 4MIYA 4MR9B 4RA9B 4MDHA 1KDZA 1VL2A 4RA6B 3TFOA 2ADMA 2GNOA 1P9LA 2RHTA 1DSSG 1N3BA 3IPLA 4EB3A 3TLGB 2H9AA 5KSZA 1UFQA 4ZKDA 2NN3C 3K70B 3BA1A 2BFBB 1XEXA 2PS1A 5BVHB 2IYUA 5KC8A 1ZMRA 2ZR9A 3DZIA 5EUQB 1M7GA 5TQJA 3E82A 3FNFA 2I8LA 3N70A 3B38A 4V02A 4U9HS 3HN6A 2IHBA 5EJGA 3TMKA 4BBPA 1ODTC 3GG9A 1T0PA 1L1FA 4XJTA 1X19A 1C80A 2C4TA 3I0MA 1DXYA 3LUFA 2DKNA 1TCVA 5B7PA 3V3KA 1WUHS 3KB6A 2A5DA 3LL4A 5DGXA 1US8A 4HB4A 2V55B 1L5LA 5LKAA 1K4YA 4L76A 4ND8A 1RQNA 2JJMA 2HLNA 3BTUA 3EGDA 2QL6A 4KQXA 4MP8A 1QPZA 2PBFA 2Q3LA 4ESHA 4YMLA 1EGVB 3V8PA 2G04A 4D9CA 3AOEA 4ZYXA 4P7KA 1YIDA 4OJKA 1T8WA 1N36B 1MN6A 2CJPA 5M04A 2KYRA 5FIUA 5H3LA 1MTOA 3IT1A 3UXHA 1SU8A 2DJ5A 4QD3A 1HEYA 1UBHS 2SHKA 4LN1A 4D3XA 5L3SA 4CGZA 1CY1A 3GT3A 3PC2A 3IMKA 1TQDA 2LP4Y 3DEZA 3PLAE 1P1CA 4HMQA 1QX3A 3FKQA 4I55A 3FG9A 1KMCA 2LBPA 1U11A 5D1NA 5TRTA 3VZRA 4G0PA 2C7PA 1TUIA 3R7BA 2P40A 3I8OA 1X7ZA 3QM1A 3HY3A 2VSFA 1ZC4A 2I67A 3JZAA 4PCUA 1N4AA 3DGEC 4HUTA 1AH2A 1POWA 2YHIA 2W5UA 2ZW9A 2J48A 1VKOA 2CVPA 1ZM9A 4XZ3A 1UL1X 2Y1OA 4DZTA 1KAMA 2FVXA 2NXEA 3HZRA 3T1OA 5E6SB 2WV9A 4R8LA 1XYGA 1E6MA 1GADO 2WYWA 3T9CA 1T1EA 4P7FA 2XCSB 2IP4A 2R47A 1PGNA 1DE0A 2P9GA 2WLTA 3Q7EA 4MWOA 1NBIA 3CX8A 1Z8FA 3K9CA 1VRWA 4TKVB 2WFLA 1POXA 5DO9A 5FQNA 2OQVA 4CEHB 1ZVKA 3IJRA 3QLVA 4F60A 3WS7A 2UZAA 2XUFA 1FRNA 4MVJP 5DGDA 4EHIA 3R3WA 5C7OO 4CLOA 3EFOA 4C06A 4U9UA 1L7XA 4N8SA 4TXMA 1F0NA 2NO0A 2KE5A 4PRKA 4U6SA 1TC1A 2W0SA 4XWAA 5BN1A 3G0DA 2BHNA 2IPNA 2FHSA 2PQ0A 3PSHA 2FH5B 1HQYE 3X2SA 1ZD3A 3RRNA 4MO2A 2GM5A 4AYWA 1TU4A 3U4HA 4PLZA 1K3TA 4MV7A 4PZDA 4EHAA 1Y89A 3EDRA 4YAJA 5HTOA 4G1UC 4ND2A 2R6R1 2X22A 5ADVA 4UVDA 3JQFA 1XKQA 4PW0A 2W37A 5CA0F 3EZGA 5GONA 3CX3A 4RDCA 4MW4A 2PWPA 1FFYA 4JOQA 3RFXA 2V98A 4CKEA 1C8BA 3B78A 4F4UA 4QPZA 3F7MA 4RLSA 3ONDA 1GPDG 3FYDA 1IHOA 2DWQA 3L5KA 1ZAYA 3KU1A 3D6NB 5DYWA 1MH9A 3MELA 1BVRA 3T4XA 3W4IA 1PL0A 1G59A 4DQXA 1CNFA 1VE7A 4PCVA 4KIFA 1Z4LA 2EKBA 1CHDA 1N5MA 3Q98A 3WGYA 3WXBA 3CVJA 1CUVA 2BEWA 1VG0B 1C8VB 2Q3CA 4Q0MA 1I6MA 2XVZA 1FPQA 3BSSA 1IN5A 1EXNA 1G8SA 3FLMA 1RHKA 1NJSA 1N2BA 5HEKA 5C80A 1EJBA 3VNBA 3ITNA 3T5BA 1N7HA 3CRRA 1X77A 4KQ2A 3Q40A 3RWBA 3W5IA 4BGUA 4Q02A 1PQWA 2VDRB 4F96A 3ZDDA 4NK5A 1LTKA 4YJ2F 3V4LA 5LZ9A 1Y5NA 2ES4A 3L5OA 4NATA 1BMFD 5CMLA 1QKJA 1DAGA 3ZLVA 3H7AA 3RFFA 3AH8A 1JIUA 3NHLA 4QUGA 1PDWA 2VWGA 1A8PA 3NLLA 3RVSA 2I91A 2MT9A 4DXDA 1CY7A 3GFPA 2DFKB 2J6HA 1CS4C 1AXRA 2A57A 4KXMA 4RZSA 4TSFA 4AJJA 3AHDA 3ED1A 3BMXA 2OFXA 4AMYA 4C07A 4A82A 2VP5A 2HJWA 4I8IA 1WBDA 1EH5A 1WULS 2FSUA 2OGWA 3LPMA 1L3IA 3G9UA 3P0IA 4LJLA 4EO7A 4F4DA 5JARA 2JEYA 4LV8B 4UBMA 2VT7A 2ZYHA 4DLTA 5JSYA 3U6BA 5F5LA 2WTMA 4QQFA 2VCEA 3EVCA 1Z17A 4MUEA 1NVVQ 2IPLA 4J2OA 4UHKA 1C9KA 4GU5A 2GYVA 3WK7A 3TX2A 5DISB 5A6SA 2H8GA 1CUCA 3K53A 2RCYA 1SVOA 4IGEA 1M6VB 4K9RA 3CFYA 4F9GA 4OF4A 2NYAA 2ZRCA 3L8GA 1TTQB 3G88A 2Y1FA 4KXFB 2YDXA 1VSBA 2M6RA 3EASA 3LQ4A 2HV8A 4JFAA 4LHVA 4RMJA 1W5SA 2WV7A 3RR2A 3GGPA 9MHTA 1G0OA 1RCFA 2H1LA 4Q3NA 4E88A 4JENA 4V2UA 2LCQA 4J0IA 1XD9A 1HOXA 1ZRHA 3KX2A 1RCUA 1VJ0A 1GFSA 2IXGA 2J0EA 4GSKA 4X61A 3BWXA 4EB6A 5KTPA 3ILXA 3BK2A 3F6PA 2VYFA 4EJFA 1TVKA 1ZKMA 1FTGA 3VZQA 1GKIA 2FU5C 2QTVA 5H3HA 5BR7A 2BSXA 1A71A 2CGEA 3OOSA 3PNBA 3SX0A 5FULA 4DMMA 1KFEB 5E8RA 1RLUA 4XWGA 2G08A 4DBLE 4F92B 3BWYA 4LYHA 2YKGA 5A7FA 2WWWA 1MAWA 4EZBA 1ZBQA 4FW9A 4JB2A 4QPCA 5J9FA 4RZXA 3SYMA 1Q83A 2CC2A 2F1RA 2X3YA 3JARA 4KDEA 3RS9A 4W1SA 721PA 5TGDA 4B73A 5FX2A 4XVRA 3VH1A 2B30A 3K6KA 4L2IB 3M9LA 4EUEA 1A97A 3CF6R 5AO9A 4B6EA 2CE7A 1F2UA 2QRUA 2RHMA 1YGYA 1U3CA 1JDSA 2WUEA 3BF8A 5LNK6 4Q18A 5K3AA 2DPLA 2XGSA 4BNDA 1V45E 2X1HA 3ABOB 4MIOA 1ZITA 2IPAB 1KQGA 3D8HA 1OZGA 2XSZA 1IXZA 4MI9A 4DAOA 2EYQA 3KV1A 5JZVA 3AEZA 5H1YA 3NTUA 3TNLA 2C5LA 3SM3A 1L8QA 3UMGA 2VBFA 2AYZA 3KKPA 5DCWA 2N9UA 1P7ZA 4CKWA 2B4YA 3RYTC 3FZGA 3SEAA 3Q8LA 2KLBA 4IKEA 1E9CA 1L7BA 3KL2A 1E60A 3EG9A 4H6WA 1W0CA 4JNKA 2W4IA 1JFLA 2ZTMA 4OSEA 5CVCA 1H0SA 4IIYA 3ZV4A 1Z63A 1MVOA 5D84A 2PLRA 1IJKA 1B1AA 2WF9A 3OZFA 2R751 3L7LA 1P2TA 2CNWD 3AI2A 4I9FA 4X64B 3ZCRA 2ZWAA 1ZUD1 2BFAA 1H8HD 1YIAA 3KPWA 2AA3A 2Q46A 3PEEA 5CLFA 4HZUA 3IQFA 4D9JA 2FPKA 1XLTA 1DOAA 3SBXA 2YCLA 2EFGA 2HBRA 4O4LB 3M4JA 2PXCA 2JFVA 2Y0EA 2OXIA 1SCBA 3CKLA 3V2GA 2P2NA 3O3MB 3F6SA 3RK1A 1FDSA 1WDTA 4WERA 4BO3A 3PQ8A