4PNHA

Crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
155
Chain Sequence
KKLVVLDRDGVINVSPDEWVALPGSLEAIARLNHAGYRVVVATNQSGIGRGLFDMATLNAMHLKMHRAAAAVGGRIDAVFFCMMKLIAERFEIDPADTPVVGDSLRDLQAGAALGFRPHLVLTGKGKKTLAAGGLPEGTRVHDDLRAFALDFLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D,D-heptose 1,7-bisphosphate phosphatase
publication title Crystal structure of D,D-heptose 1,7-bisphosphate phosphatase from Burkholderia Thailandensis
rcsb
source organism Burkholderia thailandensis
molecule tags Hydrolase
total genus 47
structure length 155
sequence length 178
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.1.3.-:
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4pnhA00
4Y2VA 3U7HB 5IS2A 1RRCA 2PKEA 2W4MA 4Y2UA 1WR8A 5AW9A 3QXGA 4YGYA 3WKDA 1O08A 3R9KA 3QUTA 3L8HA 2I54A 3ED5A 4QJBA 2QYHA 2G06A 5ALIA 5ALOA 5AVXA 3U7FB 4UW9A 4UARA 2ZBDA 1RMTA 3L8GA 1Q91A 1TJ3A 4BNDB 1VJRA 3KDPA 2NO4A 3WK5A 4DFDA 3TLMA 2BDUA 3MN1A 3OCWA 2WHEA 4NABA 3K1ZA 2HO4A 5AKGA 2Q4RA 1NRWA 3WK7A 2YMMA 4DW8A 4HGRA 1Y8AA 3N5KA 4ZEVA 4MWOA 4UAUA 1ZD4A 2G09A 4RETA 1QH9A 4OHFA 4UASA 5AVSA 1N8NA 1Z4NA 5AKIA 3WK4A 3L5KA 4YH1A 2G80A 3FM9A 5A3SA 2WM8A 2MSNA 3UMCA 5IT0A 4BEVA 1XPJA 3PDWA 2GHQA 5ALTA 4CE6A 3R4CA 2I6XA 5E0OA 3U7EB 5ALXA 4DWOA 1RQLA 2I33A 4Y2SA 1YMQA 3EWIA 1FEZA 1XP5A 2WF6A 3I1YA 5AW3A 3N8GA 2P9JA 3QU2A 3WKCA 3W5BA 2YN4A 5AHXA 2HDOA 1L8LA 1IWOA 3M1YA 4PNHA 1Z4LA 1Z4MA 2GHTA 1ZD5A 5ALQA 5AI0A 3ZU6A 2FDRA 4MUMA 2GFHA 3ZVMA 4NAVA 2FPRA 3OPXA 4G63A 5AIBA 3FGOA 5AK5A 2G07A 2HCFA 5AKLA 2R8ZA 5ALZA 2W43A 2C88A 1F5SA 4UMDA 5AKZA 1PW5A 4EX6A 3L0CA 3HYCA 3VAYA 5AK6A 2C9MA 1SU4A 4J03A 2ZOSA 4FYPA 3ZX4A 3NANA 3CZ4A 3NAMA 3QX7A 5AM1A 5T41A 2B0CA 3L1UA 4CF5A 3AR9A 2JAWA 1S8OA 4YCNA 3EF1A 5AIAA 3ZVLA 1Z5GA 5FP0A 3WGVA 1U7OA 3KOOA 3W5DA 4L57A 2GMWA 3ZWDA 3U26A 5A3RA 4GXTA 2FPWA 4OCZA 1L8OA 2HEGA 4OD0A 3OTQA 1YS9A 1ZOLA 4Y2QA 3FZQA 2YJ4A 2HOQA 1RLOA 2C4NA 2FI1A 3HLTA 5AVRA 2YJ3A 4EELA 4FFDA 3WKBA 3QNMA 4AP9A 1L7OA 2YFYA 4JB3A 4B6JA 5ALMA 4Y2JA 2RAVA 4L6AA 3ESRA 2HF7A 3QLEA 2I7DA 1JUDA 1WVIA 3QYPA 1YJ5A 4JDPA 3SKYA 4H1WA 1LTQA 3BA6A 1WZCA 1NNLA 3UM9A 1QQ5A 3PCTA 3WK6A 3WGUA 2ZBFA 3ESQA 2IOFA 2P27A 4HYTA 4UMFA 4HGPA 1Z4JA 4C4TA 3EF0A 4CNQA 5ALKA 2IOFK 2ODAA 3UMBA 1ZRNA 3M9LA 3UMGA 4NV0A 2EATA 4AS2A 3BWVA 5AKJA 4IFTA 4C4RA 4I9FA 2G08A 5ALSA 3N28A 2OA0A 2R8YA 1Z5UA 3B8EA 4Y2YA 5ALEA 3N07A 2PQ0A 3PGLA 3QUCA 2B30A 5ALWA 4EENA 5AI8A 4Y3UA 3SMVA 3L8EA 1L7MA 3F9RA 2NO5A 2B8JA 3KBBA 5AM2A 5ALLA 1LVHA 3DNPA 3SKXA 4EZEA 3QU4A 1Q92A 5ALPA 1Z88A 4BX0A 2IOHA 4UM7A 4XPZA 2OYCA 3FVVA 2YBDA 1J97A 5IT4A 1U02A 2OM6A 2OBBA 2JAOA 5AW7A 2B1RA 2YJ5A 2QLTA 4Y2XA 3AR4A 3D6JA 3R09A 3J7TA 4BKMA 1RPZA 3NASA 3OCYA 1SWWA 3A1DA 4UMEA 3EPRA 1ZS9A 2RARA 3L8FA 5ALFA 4I9GA 4IG4A 2ZXEA 3WK9A 2Q5EA 4KN8A 2HHLA 4UU0A 3ZUPA 1CQZA 3FPBA 3IRUA 3ET4A 5AICA 2IYEA 3P96A 2NYVA 4BX3A 3KZXA 4NFLA 2R8EA 2I34A 3QGMA 4Y2TA 3MMZA 2AH5A 1KYTA 1Z4QA 3CNHA 3L7YA 3I6BA 3NUQA 1ZD3A 1NF2A 3AR2A 2PR7A 4L6CA 4KX5A 1T9ZA 3IB6A 1RMYA 2CFTA 2YJ6A 2D2VA 3ZW7A 2O2XA 1O03A 2YY6A 1QQ6A 1TJ4A 3WKAA 4YIKA 3A1CA 3U7GA 2YMPA 3QUBA 5AM4A 2P11A 3KC2A 1EK1A 1YNSA 3KD3A 1TE2A 5AW2A 1CR6A 2HF2A 3W5CA 3W5AA 1YV9A 5AW5A 4ZEWA 3QUQA 3QU9A 5AK4A 4AS3A 5AW1A 1L7PA 1Z4PX 1U2TA 2B1QA 5ALUA 1RC8A 5AVYA 2BDEA 3OCUA 3QU7A 4KYTA 5ALYA 4UAVA 5AKHA 4Y2PA 3ZI4A 1RLTA 3SLRA 3OCXA 4Y2RA 4UATA 2FPUA 4UM5A 3N1UA 1ZJJA 4BX2A 3I76A 5AM0A 3ZTWA 2HX1A 3E84A 2FUEA 2ZG6A 2G0AA 3PGVA 3OCZA 2CN1A 5AKKA 1U2SA 4YIHA 3FPSA 3A3YA 4XE5A 5AI9A 5ALHA 2FUCA 2B82A 5AW6A 4XQ0A 1U7PA 1N9KA 1RKQA 5AW0A 4RESA 5AVUA 3RF6A 2ZBGA 3SHQA 2JGAA 5ALJA 2GO7A 2RB5A 5AVZA 4G9BA 5AI6A 1RLMA 2FPXA 3L0BA 1ZRMA 4GIBA 2MU1A 3E58A 2C8KA 2VKQA 3AR7A 2C8LA 5JJBA 5AI4A 1VFPA 5AVVA 3WK8A 4HGQA 3B9RA 2CFSA 3L1VA 4UU1A 3ET5A 5AKYA 2AUTA 5AVWA 2YMQA 3MC1A 1K1EA 2CFRA 5ALGA 2FPSA 4OFZA 4CF4A 1VJ5A 2EARA 4E88A 1L6RA 1WPGA 1ZD2P 2RBKA 2HSZA 1YDFA 4NWIA 2AMYA 5ALDA 5AESA 3S6JA 5AKEA 2G1AA 5AW4A 3WKEA 1Z4OA 1EK2A 4BEWA 4KNWA 3E81A 1TA0A 1Z4KA 1J8DA 4KNVA 4ZEXA 3ZTYA 4YCLA 2WF8A 1RQNA 1RKVA 3ZWKA 2BY4A 5AM5A 4CF3A 1S2OA 2AGVA 5AM3A 2WF9A 4HGOA 2X4DA 3NRJA 3SD7A 4J2TA 1MH9A 5AKXA 1TJ5A 1T5SA 2W11A 4F72A 2FEAA 3A1EA 3MPOA 3AR8A 4EEKA 2R8XA 3NALA 4BBJA 3ZX5A 3U13A 4BNDA 5AVTA 3DV9A 4YCMA 3I28A 3SF0A 5AW8A 5ALRA 2O9JA 2YMLA 3B9BA 5ALNA 4C4SA 4BYGA 2IA5A 4QQFA 2Q4TA 3AR6A 4DCCA 3AR5A 5A3QA 4XOUA 1XVIA 1AQ6A 2B8EA 2ZBEA 3E8MA 3U19A 2WF7A 3OCVA 1QQ7A 2I55A 4FE3A 5ALVA 3DAOA 1RDFA 3DDHA 4UMVA 3GYGA 3QU5A 1T5TA 1RKUA 4HGNA 2HI0A 3ZVNA 2P69A 3AR3A 5AVQA 1RMQA 2EAUA 2WF5A 1SWVA 3L0YA 5AK3A 1QYIA 4F71A 2JAUA 4O8CA 1Z4IA 2JARA 1X42A 3IJ5A 3RFUA 2WFAA 2DQSA 4HAIA 3ONNA 5AI5A 4EX7A 4KX3A 1L7NA 3NIWA
chains in the Genus database with same CATH superfamily
3VH1A 2QUHA 1BMFD 3TDNA 5D6OA 3Q9LA 5U4XA 3S2YA 1GKYA 3FTNA 3SHVA 4Y2UA 5H3HA 4NQRA 4QEKA 4C3ZA 1NHGA 2KBEA 1ULBA 3Q8MA 1RZUA 2LRHA 1GGHA 2XI4A 5JCJA 3K53A 2QTBA 4YQFA 1RAHA 2O20A 2YY7A 3OZTA 1QFMA 1QZXA 1X7GA 1PFWA 4GICA 3GOQA 4XIJA 5J2TA 1Q22A 1UMDB 2ZETA 3GLTA 3IYLW 4IJWA 1UBJS 4CIWA 1J39A 3WX0A 3HY4A 1O8BA 4BNDB 1J0XO 3GFQA 2C5LA 3GX1A 1MTZA 4R9RA 3VVLA 6AT1A 1XL0A 2OHFA 3IDSA 1GG2A 1SCBA 2BMFA 1FRVA 1FFSA 5DRTA 5EPUA 2NW6A 3MK31 1KI6B 5E3IA 4TX1A 1C8VB 1MENA 4BWVA 3A11A 1IBRA 3AX6A 3NHAA 1SVIA 2NQ8A 3FOWA 2HNAA 2GQ0A 2XSZA 1XAJA 2E4WA 3E9QA 5K3FB 3NOXA 1FVFA 2LR0A 1Y8AA 3S29A 4DMGA 3HTXA 1V8FA 1QLHA 4MWOA 1D0SA 2CXSA 2VP0A 1Y7TA 4IOJA 2ZUCA 3DHVA 1VBKA 1QH9A 3IMEA 4Y6RA 3ROPA 3TW4A 4A8PA 3WLIA 1PZFA 2BKVA 3ND7A 1A77A 1AO3A 1K9SA 1GWNA 1EJ6A 1M2JA 5CPBA 4URXR 3TLEA 5EAIA 2N1MA 5CJPA 5C1DA 1SK8A 4J7CA 3CW9A 1BJTA 1I7LA 1EI9A 1FTGA 3L6CA 3PNPA 3LF2A 1D2HA 4X61A 3VHLB 4I55A 1P3JA 3R3VA 4PLPA 5FJJA 4HRAA 2RB4A 3I6QA 4Q0MA 3VU3A 4N0EA 4RZQA 3GJRA 4IIJB 3C7TA 3QBVA 2C5SA 4MHSA 5CHEA 1O0BA 4I9NA 3ZY2A 3OD1A 2YIMA 1LVUA 1E1RA 4X7PA 3LC7O 4EF5A 5LZ5A 2FV8A 3QVTA 1QE3A 2HPVA 2OWDA 2X4IA 4MGKR 2C7QA 3KT3A 1U3CA 2UZ3A 4J7UA 2P3LA 2AEJA 3PV0A 3ZGLA 4RTLA 1GARA 5AW3A 1HE4A 2N0SA 5J47A 4NPAA 4S2UA 4B34A 3JQ8A 4ZCIA 3HYNA 1GLNA 2ZPAA 4TTSA 1XQWA 3UH0A 4ARAA 1W1UA 1I5RA 3GJYA 3NNNA 5TC4A 2ILTA 2FDRA 2ZCUA 4UBKA 3ZVMA 4D9BA 4EAAA 3S8EA 3PF8A 1EFUA 4KXXA 1I24A 3RKSA 3DW3X 2LIVA 3LXXA 3KU4A 2F8MA 4E3WA 1RM5A 2HREA 3WLNA 5K3SA 4NYJQ 1PFYA 1Z0FA 2JGJA 3MG9A 4UCXA 1V95A 2CNNA 2WRZA 5DSXA 4TRNA 4EY8A 3CRMA 3OQNA 4E3ZA 3X1ZA 1Z2AA 1M8JA 2GCNA 2XYVA 3GN2A 4LC1A 1UDCA 1SUSA 3Q1LA 4M1OA 5DM60 4B3GA 4BAZA 1B2RA 2QJFA 3LFHA 4GG1A 3I0MA 5AUQA 2O8FA 5EQDA 2DULA 4DNFA 1YB2A 5GM2A 3DFFA 2D06A 4ZAWA 3VOBA 2WA1A 4B8ZA 1AB6A 5KOYA 1TUGA 4XM0A 1O5TA 2NPIA 2QLLA 3G6KA 1JHVA 4QBIA 2A6PA 4TGLA 4LXTA 4M1WA 2AHRA 3A2KA 4PPFA 4EJSC 1JQ5A 1G8GA 4BGDA 5C80A 1WQ1R 1QX3A 3OBBA 3OJ0A 2XA1A 3RAFC 3MGKA 4I55B 1ZGCA 1YDMA 4FIDA 4BZQA 2AI2A 1DKRA 5LXTA 3PCRB 4BFXA 1ZX1A 2OQ2A 4PXYA 4XIGS 3TFWA 2BSAA 2DHEA 3L05A 4JOCA 5EWMA 4RACA 1EFHA 5F1OA 2XUQA 3WYNA 2B20A 4BNMA 1GPJA 3DEFA 3S1AA 3CUKA 3DT9A 4FN4A 2MIIA 3FZQA 1IHDA 5HFNA 4G37A 4YAUA 1D2NA 3AILA 2D1SA 3O2NA 2NZUG 3KDSE 1Y9JA 4ZK6A 3GIWA 4LJSA 3TH5A 3WICA 2I4RA 5F98A 4XYBA 2FFQA 3BH0A 4NU6A 4MI9A 4RFSA 5BSMA 1VB3A 4RULA 3RWOA 4JC4A 3JQ8B 1FU7A 2MT9A 2OD9A 4BFWA 3CSSA 3QNUA 3PE4A 1JKJB 3V1TC 4FFDA 4BFSA 5BW4A 2YR0A 1ZVVA 3E5HA 2C83A 1WSDA 2WJWA 5CT5A 3ZPXA 5CITA 4Z3KA 1O94A 2EERA 1U8ZA 4TZ0A 3P0HA 1CETA 3CVJA 4YRBA 2C58A 3K0CA 3I4CA 3HCOA 3BZBA 3LMKA 3LT1A 2WWGA 3G8YA 4P4LA 3R74A 4JUAA 5D3QA 1KVRA 2NT3A 3IHWA 3KQPA 4EY5A 3O0TA 4WQMA 2Q27A 2D3TA 5TSDA 1FDSA 4FE4A 1FSGA 5BW8A 3HKCA 1P33A 2P8JA 1E2NA 4LE2A 3PTZA 2O8FB 2D5AA 5I4KA 2XEDA 3EH2A 3PEVA 1A3CA 2OHHA 2G76A 1GG8A 2G67A 3MLEA 2B78A 2ZRPA 4MKXA 5A62A 1HLPA 3I73A 3AUXA 2QHXA 2CKMA 3MIIA 3LLCA 3WGUA 2ZBFA 1IAVA 5BN1A 5L95A 3D4PA 1QHEA 1LWOA 2P6UA 3O0DA 3TTSA 2Z5GA 3MJFA 3X2EA 3I2IA 4AWAA 1ODSA 3FVTA 2NXCA 3AHFA 3GP5A 3T1OA 1KETA 3PPWA 5THQA 4HVCA 1Y81A 3ECAA 5LXTB 2Q7XA 4RPCA 5A9RA 2VSQA 4C0HA 1I5OA 1VHWA 3FETA 4KDRA 2VNIA 1Y7IA 2JLVA 3QTTA 5EWMB 3FVQA 4FFOA 4BYMA 5IBCA 3SYLA 2IF2A 1YKSA 3O03A 3S1AB 1MO4A 2WHXA 3ENNA 4F2PA 4CBVA 4MIOA 3QUCA 2N42A 2RIPA 3RRXA 1KY4A 1W0KD 3A1WA 1V7QA 3HKDA 3JQQA 4JXJA 1I2BA 1ULUA 3LPDA 5FPSA 5T4BA 2WICA 3GU3A 4RFSB 3OKCA 3AJEA 1Z7EA 3B3QA 5HUHA 3AL2A 3L7AA 1JLRA 1D1TA 4K3UA 3ZV6A 1YS6A 2R6ZA 3EVEA 3B7WA 1MQSA 1OZFA 1Q92A 1RXYA 3A1FA 3GJ6A 2Y99A 4FMPA 4D4MA 1Z88A 2FUKA 3TE7A 3I9FA 2H1IA 2P5TB 3N7UA 4G1EB 5ELXA 2H9IA 2GB4A 2AQKA 2ZBQA 3A2LA 4B4KA 1E2MA 2IU3A 2F8LA 1QK3A 1K3UB 2C92A 2P6RA 4RD3A 4FDMA 2O2DA 4Q4DA 2PS3A 5A0TA 5C3UA 5BWMA 1A71A 1X6VA 3HKCB 3M5WA 2Z2ZA 4JLUA 2Z83A 2R8OA 4QO7A 2AVDA 3QEOA 4TLMB 3MTEA 1XHEA 3ABIA 1OC2A 3NHSA 5FWYA 1I3LA 1V5IA 1MAHA 2RARA 2UUPA 2YOGA 1QGUA 4EY6A 4MWZA 3KAPA 4KIWA 5C8YA 5HUJA 4NX2A 2J9GA 3QKSA 1FX1A 2D62A 4LJ5A 3ITEA 2X5JO 4MMZB 3SFZA 2DTXA 2O52A 1Q1EA 3GAZA 4TYQA 5F3DA 4QUIA 2XTZA 5GOTA 1KC3A 1N3LA 3YASA 3ET4A 5JEEA 4U4AA 4XLZA 4DSTA 2CLEB 1GL7A 1MC8A 3KEOA 3PNMA 1YFLA 3SHFA 1MC5A 1E32A 4BKRA 4OXIA 2DE0X 1G4UR 4XGRA 4OB7A 1N2SA 3RC1A 5JCZA 5KC9A 5KWVA 1TQHA 3BH6A 4PG7A 1I2AA 5IT5A 1P2VA 3P2IA 1DFGA 3P45A 1M1NA 4HQ6A 2IODA 2YVQA 2IZ7A 3GPCA 4I8IA 1QRDA 3L7YA 2IHJA 4JJAA 1K5GA 3HKDB 2XE4A 5G02A 1KS9A 2ZSJA 3BA1A 5JU6A 1TGVA 3GD5A 3RRBA 5KTPA 2WFZA 3BWYA 2NTNA 1NG1A 2MSLA 2CK3A 3K9HA 3TN7A 2XCIA 2C5HA 2O2EA 3RIEA 2YY6A 4H6XA 4KYIB 1UAAA 3WZ2A 4QXMA 3P52A 4L5CA 2D7CA 1TW2A 4MV5A 4NV1A 1V39A 4XXHA 1QDUA 2QVYX 3CS3A 4MSUA 3F49S 4RIHA 4R0MA 4IWXA 2ZRHA 4QGSA 3RC2A 3EFEA 3TTUA 1A2QA 1PR6A 2G4LA 5TJHA 3V8EA 1ISJA 2HPHA 4KFTA 3VR3A 3D8TA 2HN9A 3IAXA 4QE3A 3E9RA 5E7IA 4WBNF 3K5PA 4HS4A 5BV0A 5ICGA 2JBHA 3NFYA 4YLGA 2QQGA 3W5CA 4YRGA 5DTQA 1NBIA 1YQQA 4TSKA 4I1OA 1UFVA 2GK3A 3IKVA 3VR6A 5SZHB 2EHDA 1NT4A 2W6MA 4BJHB 1D2MA 1PSZA 5FWYB 1IULA 3SS7X 4DVGA 3EEOA 1A8QA 4KYTA 3BXFA 1QGUB 2C7VA 1NV8A 3K1TA 1TXGA 1Y9EA 3IKMB 4OGWA 4BVHA 5C8YB 5C8VA 3QKSB 2ZR9A 2CVQA 1SVLA 3ZDBA 4EB6A 3ZZUA 4L85A 4MW2A 5ER9A 1XAIA 3V7FA 3U17A 5HF9A 4BX2A 3BMNA 5EOVA 2EKZA 3H3XA 4DUPA 1JNXX 2R7LA 3ZGNA 3ZR4B 2FCAA 2ZG6A 2ZYVX 1HEUA 2YVKA 3M6MD 1QHNA 2V1XA 3U7RA 4L4ZA 1SCKA 1U2ZA 3UHJA 4C6RA 3CLKA 5C5EA 4DV4B 3RYFA 4R81A 3DDSA 1EFDN 3DZCA 2PO5A 1W5TA 1WPQA 2WJHA 1DGQA 4H6WA 1M1NB 2EKPA 2HYIC 4RK4A 1Z7WA 4RESA 1WW8A 2QVGA 1A97A 4PY2A 3KVNA 3SI7A 2W2OA 4G24A 1L5MA 2F3PA 3BXXA 4GVXA 2X8JA 5AHKA 3R7WA 5KJ6A 2ZBGA 3PXXA 3PD1A 1DC5A 2O0HA 1E2EA 1X2BA 1NONA 4ZTUB 2OPBA 1U1CA 4V0ME 4G9BA 1JIXA 1FFGA 1MHPA 4QHTA 1AMNA 1UOOA 2KE5A 3DMFA 2A92A 3L0BA 1A2BA 1KAGA 3AWDA 5TQ2A 3IR5A 3KWFA 1AKRA 1Z25A 3I9KA 1IQUA 5FOXA 2R86A 1XJ0A 2YX1A 1NTRA 1USWA 4JBGA 4MWTA 4UHCA 3UTDA 5JJBA 2QL7A 3JVEA 1N5RA 3TSWA 4AKHA 2Y1FA 4MJLA 1IEVA 1KPIA 1WG8A 4L8VA 1KE1A 5DX0A 4KYUA 5ITZA 2IZ5A 2EDAA 4YNBA 3RFCA 2P8SA 2AUTA 3E5RA 1IU9A 3O9ZA 1AA6A 3B1KA 2XBMA 2FNAA 2Z4SA 2PFKA 4F45A 2VXBA 4OAPA 4QD3A 2RGNC 2CV1A 4YQEA 2GVDC 1X13A 1CQIA 4M8IA 4BU1A 4E88A 5BW5A 1DKPA 3S2GA 1YRLA 4I14A 4RMHA 1WD7A 3TUZC 3ILVA 2Z3ZA 1MAAA 3CB2A 3HVHA 3C3DA 4OHXA 4RNCA 4Z0NA 4C4YA 3S6JA 3A9WA 1E2DA 3CEAA 2AJBA 1Y3CE 3M6FA 4KLNA 5LQRA 5C5DA 3K15A 2JASA 1P0PA 4EB6B 2FSVA 4DCUA 4B85A 3LUCA 4L75A 1JHXA 2NOAA 1AUVA 3BMNB 3PDHA 4RBNA 1E4VA 5JNWA 4MRVA 1UK9A 1M6NA 1D4AA 3VZSA 3RYFB 4EB8A 2DUMA 1XZPA 3IUEA 1YJXA 3MFYA 3O95A 3TJRA 3VOTA 1TJ5A 3P8ZA 4TLEA 4W1QA 4AM8A 4LTMA 2PMBA 4ZICA 1OA1A 3MPOA 4GHWA 2G82A 3MCTA 5KZMB 3LSTA 3B70A 2BM1A 3F4KA 3ZE7A 3OF2A 3R7WB 1CUZA 2R4QA 3ZX5A 2X8JB 2Q9AA 3IUQA 2FVYA 4JV5B 2EDCA 3ORFA 5KVAA 2J0VA 2ZKIA 3ZNQA 4A10A 4Y6PA 1OKKD 4EIWA 2C7GA 5KNBA 4MVWA 2RKOA 4JI8B 3WG9A 3IHKA 2HU8A 5TQ2B 1E2JA 4JIMA 3M81A 1W8IA 4FYXA 2NQ2C 3A6FA 1MX1A 3VUFA 5K6RA 2YWBA 1U0OC 4QDKA 4AI6A 1J4AA 2QTMA 1U94A 3JQDA 1FLAA 1QZ3A 2HA7A 4MYRA 1H5UA 1KTVA 1XA3A 1WABA 2O0MA 5ITZB 2I80A 4JGBA 1NLFA 3GJXC 4O4JA 2OPHA 2XZLA 3VH2A 3GAAA 2VZ0A 1EG2A 1RAEA 2JGKA 4YRLA 3V2GA 4UD6A 3LNTA 1VBNA 4PZCA 1EEXB 4L07A 1PJTA 6NULA 1M2FA 3ZGVA 3HJFA 1CQIB 3OZRA 4O8CA 2XA2A 2ZIEA 4OIFA 3TAXA 2VSOA 1R15A 4KVZA 5P21A 5BMOA 1XK6A 1N2CE 4RD2A 1OXMA 1QIIA 2ZI4A 4CFYA 1T1RA 1TGYA 1E3TA 1F0NA 2ZBPA 3ESZA 4C0LA 3ZHCA 4F84A 1YZFA 4QYTA 4RTNA 2J31A 1M5RA 1O96A 3NKFA 1Y1QA 3AINA 2ZU6A 4PRZA 2PX4A 3EVZA 4WCFA 2AUMA 3TF5A 4IXDA 2QP9X 1LS1A 4RPHA 5FTNA 1UKEA 1FDIA 3GT3A 5JSKA 2V65A 1N8KA 2V58A 1Q50A 3AVQA 3D6AA 4DDHA 4HQOA 4A5SA 1WR8A 1L5VA 1ZD9A 3TR6A 4ZN6A 4B47A 1KPHA 1Z3CA 3B5JA 2R11A 1P4RA 2ZJ8A 2X0EA 3TSAA 1C7EA 1G5HA 1NY5A 1RI3A 1Q15A 3HDGA 3R9KA 4QJBA 1O8CA 4WD3A 3P1JA 1EXDA 1KQNA 3BYZA 3F2VA 4URVR 3WGMA 2P4SA 2PFSA 4KGDA 3O4GA 2PCLA 3ASZA 1ADCA 4AKSA 4P3PA 4W8HA 4BNNA 1KFBB 3H0EA 3PICA 1AKNA 4FHEA 1A7UA 3QKIA 4POOA 3CEJA 3IEXA 3TIGA 3OBIA 4JLSA 1DMSA 1R0RE 2FN4A 3WK5A 3DGEC 4ND5A 4QNRA 4XDHA 1W5EA 2WOOA 4IOLA 1STOA 2ZTVA 3BGWA 4L7VA 4X91A 5TEWA 4BZZA 1G6KA 4JQCA 1OWPA 4JP3A 2VA8A 2H9AA 4PO9A 1KXZA 3JAKA 3CR7A 2MWMA 4KODA 4UXJA 4H1TA 4ZAFA 5F73A 1AQIA 5C18A 3JQRA 4HMPA 3PITA 3DKVA 4Q3LA 4MV9A 1AS3A 1LSSA 4RD4A 4JFRA 4PLGA 3HY3A 2JIDA 3DNMA 4O4JB 2CD7A 3U3MA 2PUCA 1G8JA 4AKGA 4GKBA 4C29A 1ECJA 5IKXA 3L02A 3WJ1A 5EJ9A 5J3JA 1ONBA 2FHSA 2UZAA 4ZCPA 2E5WA 2PGXA 3D8RA 3TLYA 4ZDKA 1TW3A 4IJ5A 3T5MA 1NURA 3W6NA 1T3ZA 4MW5A 3MTBA 4TM8A 3EVGA 5DXAA 3FM9A 3HXMA 2QJWA 2XMSA 1E9DA 2WM8A 3A1UA 2WG0A 3I5AA 5TEVA 3ZCRA 1O9BA 4TUYA 4DA0A 2ACWA 2TSYB 1C30A 3GUYA 4YRJA 5DW3A 1KIFA 3GLIA 5DYGA 1B93A 1O96B 4WCFB 1WEKA 3E7XA 3KXIA 5TF0A 4DGSA 4LRXA 3UV3A 1S3FA 1TAQA 1ZUD1 1I6MA 2BCGY 1THGA 2JCGA 3DWGA 4HPXB 3WP1B 4PN3A 2IV7A 1A1SA 2HV8A 1FTSA 1QG2A 3GROA 4GUDA 1NVGA 5ILGA 3WYDA 4EEXA 4NE9A 4AN4A 3NJ4A 4R8VA 3R3XA 1XIVA 4M7PA 5FOVA 1B76A 1R0LA 1I1OA 1L4BA 1YIOA 4L4YA 4XVUA 2GD6A 3FIUA 1XMOB 1Z4MA 3F7TA 3PRJA 4JI0B 3PNOA 1EK5A 2ZW9A 1Z45A 3CR8A 5TT0A 3N53A 3NPAA 4F7DA 5HIKA 2WB2A 2XCUA 3C3EA 3HYRA 1RS0A 1Z16A 1LBHA 3H4VA 4RHFA 5DBFA 5DT9A 3FTQA 4KK4A 1ZI9A 3TWOA 5ALZA 4HQNA 1EB9A 1ML3A 3RBAA 4OGLA 3RFXA 1PL8A 4YPOA 4C0JA 4U6NA 1TVEA 1GGMA 3F78A 3KU1A 3NRCA 1QCCA 4KSYA 4TQUS 2GT1A 4UMDA 3RHTA 3JAKB 1G9XA 5JISA 1HNWB 3G8DA 4EYQA 1E59A 1FP2A 1ZIXA 3G2NA 1O97D 1UJ2A 5IYZF 3WLHA 4JXKA 3V4RA 2HDHA 2NZJA 1CYDA 4NHOA 3OU6A 1U90A 3RD5A 3U1TA 2PX5A 4WZZA 4KQKA 2POCA 4BP1A 4RPLA 3HJRA 4IFBA 4U7PB 1MFPA 5PGMA 4QUGA 5A3JA 1IE3A 3DA8A 3FUTA 3LH5A 4D0LB 4UHBA 1HX7A 2P65A 4M22A 1Y6JA 5JAQA 3ZOKA 3ZUGA 5E4YA 1LTHR 3UPTA 3W5HA 3D2CA 1OXUA 1ZBDA 4BLRA 2CYCA 4DDMA 1AKVA 4Q01A 5SY4A 1G18A 1QORA 5KJEA 1U8CB 1HWYA 1DUIA 4DKXA 4IIEA 3U5TA 4N65A 4CLEA 4TUYB 2C2HA 1ZW1A 4L57A 1C30B 1JQDA 5K51A 4XWKA 3CC8A 5B2FA 2Z9BA 4HNRA 1VG9B 1IEQA 5A3RA 3GLIB 2ZR8A 3H5OA 4MUIA 4LJRA 3ZXXA 2DPHA 4CV3A 2ZUVA 3GCXA 1WBJB 3AY7A 4GMXA 4P5EA 4OUKX 3THXA 1X3SA 5K8VA 1KEKA 1UL1X 2C4HA 2MINA 5EMKA 2HOQA 1GTL1 1NBHA 2JIRA 2PWBA 3PHJA 2E89A 3LC2O 2W6IA 4WASA 1G60A 2VCYA 1GPMA 2XDYA 3VISA 4FX2A 1O0SA 2XGJA 3WLTA 3P2KA 4E11A 2YJ3A 1Z18A 3BL6A 1SC3A 1VYHA 2IU6A 4YUWA 1EXMA 3QKRA 1KY3A 1TL7C 3TQCA 1RAFA 2VK2A 5JE8A 2PRYA 2VUSA 4S12A 5JIBA 5EVJA 1HM5A 3L93A 2D7JA 3L92A 4B31A 4KLRA 1XLVA 4C5AA 4CGYA 2NO9A 3B1YA 5B6IA 3RC8A 2RAFA 4QOIA 1YJQA 4JITA 2H2AA 5IASA 2DC1A 2IUFA 3IQDB 1BTOA 1DE0A 5CXSA 2QVXX 1X8JA 1DX4A 5JWOA 1H2HA 1L8XA 2AJDA 1PEAA 3QLJA 1BVRA 1IJKA 2V9CA 1DRKA 1TVKA 2I3AA 3F46A 2YV3A 1DOZA 4Q12A 2R7KA 4PC2A 4WMLA 1GTZA 2IV3A 4F5YA 4HGPA 4Y9RA 2I4MA 5K4AA 4CNQA 4C2TA 2GAIA 2IOFK 3EGEA 3H6GA 3IAS1 4LK3A 2C4UA 3RUDA 2NTEA 4MA4A 4ZALA 4BNXA 4R1OA 4S1TA 4AS2A 2X8LA 5JFOA 1GU0A 2VQFB 5HR5A 1N0IA 1R0KA 4MQ6A 3WLRA 3LZDA 1OAAA 5JRDS 5DTJA 3LUPA 5FJIA 2J85A 4RVSA 1VP3A 3TZEA 2HW8A 1LLUA 2JJ2A 1G291 3DD5A 5T8KC 1F9EA 2GHRA 1CWUA 2Y66A 2VBFA 4MQ5A 5FYQA 2JIMA 2IL1A 4HWKA 3THXB 2JFGA 5WRFA 1RJFA 2FR1A 4AQDA 2Y68A 2MINB 3GNTA 1NY6A 2QYOA 3AQIA 3I04A 1NXXA 4RIGA 3ROEA 3B6JA 3KG2A 4P5PA 3RI3A 3A4NA 4OJQA 2HJVA 3L7MA 1KEWA 3O2SB 1JKMA 2EGUA 3D3KA 2HDWA 4HDRA 2W90A 5B37A 3UAVA 1DT3A 3DM9B 1CDOA 1U7UA 2CDRA 4MIKA 4AZVA 2G7ZA 2CNDA 3QWAA 3RVOA 3QKRB 1YACA 3HZOA 3U62A 3NW9A 4UM7A 3EFBA 3CLSD 1NLUA 1WB4A 2R84A 2Z3WA 1H0KA 1KI8A 5EN4A 1QRRA 1T2NA 4O3FA 4G4IA 1U4SA 1BD3A 2P7IA 2A59A 4KVAA 2OBBA 4H60A 4C7MA 1A9PA 2CHVA 4A2CA 3DSRA 2VHCA 2B69A 2XF8A 2Z8YM 4Y2XA 4EMUA 4EI7A 1USKA 2JS7A 3LKDA 3AP3A 3LP8A 3UMFA 2VNSA 3UMVA 5CVJA 3DWEX 3OCYA 3U3KA 2OK8A 2Q9CA 2OBMA 4FDTA 4YP0A 3JZDA 5EP4A 2VRCD 1GCAA 5LVAA 4H1UA 4FGUA 1TVKB 4PIVA 4DPMA 2P6NA 2IYAA 2ZYHA 2KM1A 1Q17A 1R0YA 3N70A 4OG2A 1N5LA 1VL8A 2G6BA 1RM4A 4IQ0A 4O4HF 2IYEA 3JYHA 2H5LA 1ZLYA 4DJFC 4E33A 2BH2A 4UTPA 1SUIA 2ZYGA 1J25A 1UBRS 2VDMB 2XUGA 2YHIA 1ZINA 1A9OA 3BKWA 2GGSA 3CXRA 3GI1A 3LJKA 1JQEA 2ZAGA 3LHSA 2QN1A 3PIRA 4GLJA 2AOVA 4OOFA 2LZ0A 2GCEA 1CFJA 3QGMA 4IGFA 4X94A 1RJGA 4Z9YA 3W77A 1QX4A 4BATA 1GU7A 2YYYA 1P5RA 2ZRNA 3GUVA 3L04A 5LSAA 4AW9A 3A04A 5DE3A 1XALA 3ICEA 4UQLA 3OVMA 2ENWA 5JARA 1K75A 4F4FA 1NF2A 2CUKA 2W6OA 2VJCA 5FUWA 1ONNA 2C4MA 3WYFA 2VZLA 4ACAA 4DA7A 3WQSB 1U0EA 1U8XX 2G5CA 1YS7A 5EEGA 1MXFA 4UCWA 1PEDA 2ZIFA 1LC0A 3PKZA 4U0JA 3VX4A 1Z26A 4HO1X 2I87A 4PCVA 1JAYA 1P6XA 2XUDA 4HDRB 1JH8A 4CMHA 1T9AA 4O4IA 5FUBA 3ND5A 1M0SA 3PXEA 3F3SA 5C4MA 1WNTA 4EJ0A 3AI7A 2X0NA 3NNDA 1MB4A 2P9CA 2QZZA 3MB5A 4HJRA 1QAQA 5D7NA 3OIFA 4LPKA 1AZWA 1CDEA 1XWFA 4KUGA 5AM4A 3KQWA 1CZKA 3KC2A 1HNXB 3VI3B 5CLIA 4Q34A 3SJAA 1DJNA 3IP8A 3URKA 1ODFA 4WCDA 2G9RA 3LFTA 3UBMA 2JHGA 4UNPA 2HF2A 4OL0A 1YV9A 2XIQA 4REMA 4X54A 4A0HA 3NG1A 3G2PA 4ZQIA 3VVMA 4Z1MA 1GZ3A 2WUDA 4G2NA 3WFJA 4YO7A 3SSOA 4Z5XA 1H2FA 3WSVA 2X8WA 3QKTA 1IQRA 5CEFA 5FTJA 2PBLA 1Q3KA 2XMDA 4UUMA 5IBQA 3BCUA 1XKTA 1RIIA 3LX4A 1VHQA 2V55B 4XIYA 2CNLA 1CUGA 1MO2A 5C1IA 5GJCA 2X2OA 3B9QA 1T0PA 3H8JA 1ZK0A 2B98A 1BC5A 2YS7A 3N1UA 1G2QA 4A0GA 4RD1A 3OZAA 2HX1A 1XTQA 4RVUA 1L7RA 1E5XA 2ORIA 2VDOB 3EG9A 3R5KA 2WUEA 2PUTA 3IR7A 2FFAA 2YHIB 1I33A 2C4WA 4KCGA 4YIHA 2FKNA 3OT1A 4ARIA 3WB1A 3O3MB 4R05A 5J5VA 3ZGOA 4M6WA 3SZ3A 2V0CA 3ONWA 1HXHA 1SCAA 2A2ZA 2C94A 3MAAC 3HYSA 4OV6B 3SP1A 4DDTA 3D6TB 3G85A 2A3RA 2BONA 4MR7A 1SY7A 3RSLA 5JMPA 4UUOA 2DX7A 3DEZA 3RF6A 4HNUA 5BQFA 5DN9A 2JGAA 4FFLA 5EHGA 2AFVA 4LVNA 4HB0A 1NQUA 4ZDIA 4MVJP 1YUNA 2GO7A 4CDMA 3AEUA 5GVRA 1IPEA 1K8XB 1YQWA 3SOZA 2VUTA 2QUIA 1U0TA 3W8NA 5FLXA 3B1WA 3KTDA 1JSXA 1QYXA 5H0IA 2A1TS 4CMAA 2R00C 2O3UA 5AVVA 3TGWA 1W94A 3BWDD 1N5JA 1UXJA 3IIIA 4PAGA 1XR3A 2ZJFA 3PL1A 3R4VA 3M0EA 1FMLA 4RDIA 3H87A 1MAWA 3FIJA 3JYQA 2IU4A 3PENA 3ZCSA 4M99A 1Y33E 3I0NA 1LC3A 3N6XA 1JPVA 3RK0A 5CA0A 4ZDJA 1GYQA 3UO8B 1PYOA 2FEKA 2C9ZA 3ZKWA 4ZWNA 3C5HA 2PUAA 1YDFA 1EVQA 1ZC3A 3L1JA 4E1VA 2V97A 3T3PB 4QTYA 1X80A 4GNKA 4YQYA 2EOAA 2I91A 5AJYA 4F85A 2Q1XA 5J2TB 3CIFA 1GOTA 2PT9A 4HAZA 4IXTA 1JDSA 2DBRA 4X45A 1FE8A 3UB3A 3M2PA 1DAEA 1DHRA 1G4HA 1RQNA 4GL4A 5AJTA 5ITSA 2H85A 3IP7A 2I9PA 3O3OB 5K0NA 4DREA 1VHLA 3EG9B 3BQMB 2C1XA 2ZWPA 2Q4EA 3JQ9A 4KR6A 4I1YA 4OGFA 2BJVA 1CIPA 2HJHA 3OT1B 4WZAE 1A7KA 4ZCRA 3QPDA 1CZOA 2J5RA 4K9OA 4M6WB 5TV2A 1CG6A 4JBWA 4EEZA 4OJNA 5B3LA 1SIWA 2OD7A 1ZAYA 1ECCA 2QIOA 4MR7B 4URHA 2F90A 3C6BA 3WLQA 4OLAA 2FGKA 3H9QA 4GOXA 4HZIA 1YZNA 3VYWA 2OGTA 3LGXA 1KS2A 3ASUA 1T4BA 3ZQUA 2EW8A 3FCAA 3AEUB 1Z07A 4XAQA 1J90A 1QVAA 1U81A 2Q49A 4LZZA 1E2HA 1NFQA 2BW0A 4Q39A 3RBXA 2C3OA 1T29A 3BGSA 3CKYA 3QQPA 5FQOA 1EXNA 2ZS7A 4NU5A 3LD9A 1NNUA 4J6FA 4KAFA 5T6MA 2ASVA 4FE3A 1DCMA 1NUHA 3L82B 4NBWA 2QOEA 1SHLA 3ORSA 3U81A 4IKPA 3ITNA 1MG5A 3T54A 3UAGA 1HDZA 1T5TA 2YHSA 4I50F 5EZ6B 1XKLA 2ZYTX 1QHSA 2XNDA 4Y2GA 3VGJA 1BE6A 2XADA 2WF5A 4B3SB 1VMDA 3VH3A 5LJLA 4JC8A 1R6DA 5HS4A 3CB4A 5CA0B 1C3EA 4OJYA 1WUHS 3NM4A 2NACA 4NH4A 3ZKWB 3D7LA 4ITVA 4ZCSA 1IN7A 1CDDA 1DBRA 1X80B 2O7VA 4YRDA 1L1EA 4CT0A 4DCNA 3EBOA 1NF9A 4NBVA 3C8DA 3O1JC 4L50A 4PG4A 1R2QA 4DYHA 2FTKE 2X23A 5G4KB 4AFNA 4AJNA 5JQGF 2QI9C 4MR9A 1GLGA 1HEIA 4WY8A 2TMYA 4IF4A 3FNEA 4EF4A 5F12A 1KDYA 4RE5A 2YYSA 4N7MA 2XHZA 4P92A 1RRFA 3RJMA 1A50B 5A4FS 3MS4A 3H0CA 3IHTA 2ODTX 2H2DA 2UUCB 3FI9A 3N8KA 1QIMA 2ORYA 1KAOA 2BISA 4I1RA 3F6CA 4WA8A 4LRYA 3R76A 4DQUA 1L5QA 4M37A 4KDFA 1YIDA 4OQMA 1R0ZA 2Y1DA 3TIFA 2WB4A 1SCQA 2EGHA 2NNLD 3ETEA 3U3OA 1CF4A 5FUXA 1JDNA 5CXUA 4EI2A 5T4FA 4NJMA 4R40A 4IRMA 2PGDA 2QENA 4F3YA 2HHCA 2R44A 2EFHB 1BN7A 3B6IA 3BJZA 3LCVB 1GPUA 3MN1A 2DKOA 3QVLA 4BNFA 2VYFA 5EXDA 4AF6A 2WHEA 2P6MA 3N2EA 4UJ3A 1AUXA 2AL7A 2FZ5A 3PLNA 4OATA 3SZUA 3FHTA 4F04A 2DPGA 5JNRA 2HFJA 2CMKA 2GN4A 2H18A 3JPYA 4RD0A 4V38A 5JHGB 2YJTD 1M2OA 1E1LA 4LW8A 5DFAA 1BKYA 4B3JA 2D0DA 2WHPA 1VMIA 1J8YF 3R5SA 2AIRA 2A1IA 1IZ8A 2V6IA 2W0SA 5HP4A 1D7AA 4CM7A 4X8MA 5A1TA 3DBHA 3KYIB 1HQCA 2OT3B 4JVLA 4ZI7A 3SM9A 2IHBA 2D74A 3VC3A 1SVWA 4BZPA 3DONA 1DV2A 2GBIA 1FNBA 4BWFB 1ID1A 2VHTA 1AK9A 3AW9A 5GY7A 3SQNA 2JF0A 4HQRA 4EL5A 4NAHA 5LIPA 1YBAA 2A9RA 1JA9A 2GHQA 2O48X 3BBPA 3ROGA 4CE6A 3RSCA 5HPYB 1NC1A 2KSQA 3Q72A 2GM9A 1E94E 2GEDA 2JIZA 5CYPA 3TOCA 4D92A 3IAAA 2GDZA 4MR9B 3P9SA 1O3YA 1E2BA 3T7DA 1P4GA 4MINA 3CR3C 2G0NA 4ZCQA 3LCJA 4CQMD 1F2DA 1NVKA 3CWZA 1P0IA 4LC9A 2CHQA 4XQEA 2UUAB 1HDGO 1MV5A 3CA8A 3AW8A 3QBDA 1WWKA 1IVNA 1BYIA 3PI6A 4D41A 5K7SA 1FVHA 3B85A 3PXGA 3AGPA 3ZJYA 4BY9E 4K88A 1QLWA 1OFUA 2PU5A 1PTJA 1XRSB 2I62A 1CD5A 1FS6A 2NXJA 1VPVA 1MB3A 1NN0A 3MS7A 4CQLA 1TVMA 1X1RA 1ZJ4A 2I22A 5AI0A 1Y5MA 1PZEA 2O2ZA 2Y77A 3AO0B 3BHJA 4PZ9A 1YXMA 3VVCA 4E30A 5AIBA 5AK5A 4XFKA 4W9MC 2JDIA 5IAGA 2XV1A 1KH2A 2R8ZA 4NJMB 5JY6A 2GTHA 2BHSA 1P9RA 3ZBTA 2CMGA 5KSYA 3NDPA 3M1LA 2HSJA 5KTSA 4L08A 5TDHA 1SG6A 1UDBA 3L6BA 4WEQA 1U9YA 1UBEA 3U60B 2IFTA 3G7UA 3TQOA 2JLYA 2VI5A 5FDFA 2BELA 1R8YA 5JASA 5L3SA 2HA5A 3PX2A 3I0ZA 3VJKA 1M2OB 1TOAA 1A9YA 3PIDA 3GDWA 3DF7A 2QZ9A 2WHPB 4RQTA 4YS6A 4ZRNA 2Q4BA 1KKMA 5IZCC 5T41A 1KY5A 2WUVA 1GL9B 1BOFA 3DBHB 3P9YA 4EKYA 4ZI7B 4BFTA 4MRRA 3U09A 1G59A 1XPUA 3EF1A 3A6KA 1EVZA 4ATNA 4F6CA 2F3SA 4YRAA 1Q6ZA 2GXQA 1DQYA 3G0GA 3PWKA 3Q9SA 4HN4B 1ZCZA 2WA2A 4DIBA 2Q3EA 2VPYA 3ZWDA 5HW0A 3BGOS 4XVQA 3L7BA 4P7GA 3A1SA 1QO9A 3OTQA 3WLAA 1Z37A 5BSUA 1LZKA 2GYUA 3CUSA 4MPTA 1FS4A 5CFPA 1PYDA 5ERGB 4FX5A 3LDGA 5KMGA 4N8EA 5HE9A 4BTEA 1ANKA 2ETXA 4F5WA 2E18A 1SQGA 4H7EA 2OGZA 2VSYA 1ZK2A 2KHZA 3QELA 4GVPA 5LMUB 1EWYA 3FCEA 5IFLA 4D9NA 1K08A 4EHJA 2Z95A 1UAYA 2FOIA 3NIGB 3S2FA 2XITA 3HLTA 1P6QA 3DMNA 1MQAA 3MLBA 1L6IA 3OTHA 1XI2A 2PBRA 3HJBA 4MUFA 1EVIA 4I8XA 4CQLB 2PEZA 1O95D 1BQ4A 2H5JA 3NFRA 4QUKA 3PC2A 4EUEA 1B43A 2YHBA 1I51A 2ZYSA 4A2WA 1T1JA 1HE2A 1XE3A 2GAFA 2QRPA 3C7CB 3VNQA 1PP4A 3KXLA 4UTZA 5HRCA 4P82A 4HVTA 5DP2A 1JWAB 3CTPA 4OQZA 4OHPA 2NWQA 1ZOPA 4I6EA 3TDKA 4DSOA 1E2FA 4KWTA 1YR8A 5KYVA 1MRNA 1USGA 2VAPA 3ESRA 3GMTA 4L6AA 2HF7A 3QLEA 1NAHA 1ZH4A 1U7WA 1Y6RA 2B35A 3C1UA 4MARA 2A0FA 2ONJA 4B6OA 4R2JA 4AROA 4KO8A 1RYDA 3IIJA 3ADKA 5J43A 3ESXA 3WGJA 2BGGA 2NP6A 3VFDA 4QOSA 5L3SB 4XWGA 3QXHA 2HM7A 3FY4A 1MOPA 2IEZA 2GN6A 2OBYA 3IOYA 4FGJA 2L17A 4EFKA 4BN0A 2IBMA 4ND1A 4F7WA 4WLOA 2CSXA 4DR1B 4F9TA 4ZO4A 1DQRA 1JI3A 1JT2A 3OTWA 1K6EA 1TU0A 4GXRA 3SF8A 3V7NA 6CHYA 3RTGA 3IO3A 1JDBB 3EVFA 1EHIA 4DA6A 5ICSA 4INPA 3QVSA 4O4LF 2NV6A 4RDXA 4UZSA 5C4IA 2YZ2A 4O5AA 1FU4A 1KJZA 5C7LO 4FW8A 1YOBA 3R20A 4JYBA 5DDIP 3WADA 5LMCA 1XRJA 2C95A 2QM0A 2ZTHA 3PJFA 1HYBA 4PYRA 3MA0A 1SU6A 1H65A 5CT9A 4AECA 4WXEA 1WMFA 2YY5A 3LIIA 1QIGA 3TUIC 3VQTA 2F1RA 3Q11A 4QGAA 2LTAA 4DJTA 1C8LA 4FT4A 4KGXA 5KMGB 4GBMA 2DWPA 1ZIYA 1PDVA 1E9AA 1V8OA 1XZJA 3MSCA 2RHTA 1VKNA 2NU9A 2OORA 3QELB 4MEAA 4R9UC 3WAGA 2NO5A 1KYWA 3HWX1 3ONFA 2ACVA 3W5VA 3RVKA 4B82A 5BWOA 1LVHA 3HN6A 5K0GA 3NBAA 3U7QA 2L42A 3OFKA 3WQQA 2NTJA 5H02A 4ZEMA 3B20A 1X1TA 5I48A 4FW9A 5F23A 4WACA 2CXQA 2P77A 4WUTA 1NP7A 1T13A 4NPHA 4Q4HA 5CPFA 2Y1KA 3EZYA 1SVSA 4OHVA 1KSGA 1LI5A 4LF6B 5HM8A 1RXEA 3CXUA 3GJ3A 3OAAD 1LVGA 3DLCA 2RH8A 721PA 5ENZA 3HUUA 1JSCA 2BEVA 4XJSA 2NSHA 1RQ2A 2I3ZA 3Q7PA 3PEFA 5JG7A 4JNCA 4LYGA 1OB5A 4RIIA 4M49A 1SB8A 1ST2A 2DY0A 4F5ZA 3EPRA 2Z5VA 3OZBA 3ABQB 1SXJC 4OKSA 1RKXA 2REQB 2JCVA 1AK1A 1CEXA 4IG4A 5EE9A 4TMVA 5HF5A 2QX9A 4NXMB 4YYEA 1UFOA 1MEOA 3SF8B 2I2DA 3V4FA 1XYGA 3RASA 5KHOC 2YZKA 2DFTA 3HH8A 1CQZA 3FPBA 3IRUA 3FFXA 4IUDS 3HCNA 2FU5C 3PZBA 2NPFA 4PNEA 3EA0A 2XX3A 4I5IA 4N3BA 4YMSA 2WNSA 3NHKA 2A5YB 4P3NA 1NKSA 3DHWC 3EVTA 4M1QA 1BGVA 2OFFA 2YVAA 3EY9A 5FHRA 3UZUA 2ZRMA 1VJDA 2D1TA 3HVRA 1EE1A 3D6MA 1SAYA 4FZ3A 4HYYA 4F1WA 1UMKA 2JJ8A 3HU1A 3L1IA 3OMLA 1WUKS 1TJNA 3R7LA 4L5AA 6PFKA 3PA8A 1IJEA 4IRXA 1CT9A 1C1DA 1LZLA 3T5CA 4PW0A 4UQOA 1HK7A 1YZUA 2NU9B 3GLGE 1T1IA 5EI5A 3ZHSA 5C7OO 1QIDA 4FTWA 4D9GA 4I1SA 4LVCA 1E1QA 4DMFA 3SIXA 1E6KA 2NUBA 3P20A 4HXGA 4PYJA 3IE1A 2HHAA 3U7QB 3ZW7A 3EX7C 4UJ5A 5SV2A 1G7CA 2FW6A 4HB4A 4URYR 1QK4A 2O1XA 2GKGA 5AP9A 3LUAA 4EA9A 1LSUA 3IJPA 4Q4HB 1G20A 5BNFA 4XGQA 2E21A 2EBHX 2W37A 4C5BA 3JTMA 4FLFA 4RJIA 4EVIA 3RRNA 2QGFA 3LX8A 4C07A 2Q3MA 2JI8A 1GN8A 1USUA 2W2TA 1G1AA 5JV5A 3DMTA 5I4BA 2X9LA 1NMQA 1PBNA 1JLLA 1KYIA 2BEVB 3H9BA 3UNXA 1PWHA 4KGVA 3AFIA 1NDUA 3PDJA 4JH0A 5MDHA 2QXUA 1UPUA 4NMHA 2H1FA 1T24A 2I7CA 3TYXA 3IAEA 1RM0A 5F2NA 3MWGA 4Z9AA 4H4CA 3OCUA 1OH8A 3A6JA 4QM6A 4RC9A 3T1YB 1GQOA 1T9BA 3E8SA 3PQFA 3TCKA 4XWAA 4B4UA 1AH2A 4DLTA 4E14A 1WXQA 2YWRA 4ZRMA 3KJGA 4KFUA 1WNFA 5CFMA 3H4IA 4NOKA 4WI1A 4HADA 1X39A 4FWTA 2HK7A 3S2SA 3ADOA 4YJ3A 1E9CA 5BPFA 3KXDA 1OXTA 1TC2A 5CVUA 2GPTA 1UKZA 2P3OA 2A9JA 3VNAA 5BV2P 3I9NA 1G8MA 1CQXA 1N9KA 3DH0A 3P0RA 4HQLA 3OKAA 1ZGBA 2CNWA 4GPD1 1J00A 2FUG1 3N05A 4PQRA 1SVKA 3JWPA 4RSMA 4BB0A 3TPCA 3AKEA 1C1DB 1GFZA 3KYCA 1UQTA 3SC6A 3PFIA 3RPEA 2OLEA 4KE6A 3EDYA 3LSYA 4K6FA 4C6TA 4D4KA 4DRYA 1LDBA 5JPCA 1N33B 2X5NA 3B2QA 2I65A 5JSYA 1THMA 2GXAA 1KIAA 1X9GA 5HGJA 3THSA 2HA6A 1T6ZA 3O1IC 3STUA 2VHVA 3H84A 4GIBA 2NZ2A 2CVFA 4ESOA 1L9XA 4GXQA 3NTQA 1XZDA 3J80A 3GEGA 4GGMX 1FJXA 5JO0A 1VTKA 1NUPA 4DVJA 1G20B 5E1MA 3FNIA 1S8FA 2NZWA 3CZPA 1XZCA 4IS3A 3OZCA 4RZSA 3G02A 3N59A 4OXKA 2NSDA 3OX3A 4QXRA 3SBOA 3ZWMA 2EGGA 5J40A 5CYGA 3BILA 1JLLB 3ELDA 3UBTA 5LA6A 2V3WA 3TGLA 2FPSA 3D59A 3ZG6A 4BQEA 1MX5A 1MX3A 2XUZA 4F96A 4JS0A 3BXOA 5DEIA 3LT4A 4BVGA 3NDIA 3JQFC 2P9YA 3DLHA 4HQFA 4GRAA 1Y6QA 4WEOA 1NPTO 2CVPA 1E5DA 1DWPA 3CZQA 2PUDA 1VECA 1U0JA 5K03A 3GCWA 2CDNA 4M88A 2Z4TA 3IQHX 3SK0A 1J8DA 3L4BA 3DGFC 4KNVA 1OVGA 5FXMA 3CU5A 2REOA 3BEOA 4JKOA 3SIRA 3WXMA 3WE7A 3H1PA 4IG9A 2ZYUX 3IPCA 3IVXA 1QCDA 3A4MA 4PYIA 3WGNA 3ROZA 3D2BA 1PK8A 1Q1ZA 1JIQA 2VO1A 1M8PA 2J3QA 1HYGA 2J3HA 4YJ3B 2WG2A 2WWHA 3R3SA 2BVNA 2HMAA 3EAGA 4K28A 5I7AA 4F72A 4YHHB 3LOUA 2WVGA 4LDPA 1QR6A 3A1EA 1L5NA 5IU6A 3AR8A 1WMAA 2PKQP 3O3NB 4FMBB 4LFAB 1NW3A 4FR0A 4U00A 3KYCB 4ZPJA 4C6TB 4J49A 2AF4C 4HATA 3K0CC 5CU7A 4LBYA 4WLNA 2C5EA 3O2QB 4NCJA 4B46A 3B12A 4ND2A 4NS4A 1G4AE 1FFDA 2PSHA 4EG0A 5A3QA 1FQJA 1QO0A 2HCTA 2QJTA 1CE8A 3UMMA 1JR3D 1HT0A 2IDMA 4KGZA 1JS1X 3WB0A 3X2FA 3AVUA 3PQ2A 5IP5A 2H4HA 1KAHA 2VXCA 2JI6A 5I7HA 4IEFB 2OC9A 2F1HA 2OO3A 3AHEA 5H4GA 3WYEA 3ZGZA 2OG1A 4PQGA 3FCYA 4NFYA 3H65A 5BNTA 2H5IA 1IOVA 3A1TA 3L1KA 2YFHA 4IS2A 4RLHA 3LVRE 5IDVA 4FGSA 3TKLA 5DNAA 1E3SA 1JE0A 2FVXA 3OO0A 5DN6A 1SOUA 3HMKA 5LA6B 2D7DA 2JVIA 2CDCA 1PKEA 1Z4IA 4RHYA 3RSZA 4RZUA 4RMGA 4A2PA 5JCJD 3SS9X 2EZ4A 2O2CA 2ZS8A 4IXNA 3TJZA 3WL3A 5JLJA 1U0HC 1SKMA 2ZRBA 3DOFA 3L6DA 1DV1A 3EIXA 4TLLB 3P26A 3HK2A 2IVFA 2P9HA 1Q7GA 4QATA 4X8HA 2ZJ1A 2FOLA 3LPNA 3NIWA 2BMAA 5EUCA 3L40A 4ZCLA 2UZ4A 4YBRA 1KEUA 4FFRA 3ROXA 1ZSNA 2RHCA 2VJLA 1Z8DA 3IMKA 1UC5B 2PT6A 1J09A 1A5ZA 1N6KA 3OHPA 3Q98A 2ZATA 4UXIA 5LBIA 1W59A 1OH7A 2PMCA 2YS6A 4FJ1A 2H8KA 4J43A 1LDYA 4URFA 1AX9A 5EXPA 3WYBA 4CI9A 4GBJA 3OUUA 1HTWA 2B4RO 1TYZA 2QG9A 3QYFA 4GS5A 1W85A 3LUKA 4XCVA 5M34A 4UHDA 4LY6A 4AUMA 1ZK4A 4UARA 3ER9A 2EJTA 5JSZA 3V4PB 1XAGA 5BR1A 3A3OA 2XSZD 3UAZA 5IAEA 1JEDA 1TJ3A 2WEKA 4N6GA 4OM8A 4JGGA 2WR8A 1WETA 4MJXA 2BCJQ 4DLAA 4DRZA 4WZBB 2OZLA 2XHEA 1ZH0A 1YQUA 5T7BA 4G07A 1E9BA 4WPGA 3L7LA 2NYUA 3GLHE 1CEEA 3VU0A 2ZSDA 5IAAA 4RTKA 2RH4A 5DYNA 1CE8B 1PZNA 4DJAA 4X3CA 1ZITA 2C2GA 3NU1A 2ZIGA 1NRIA 1YE3A 2R66A 3E4CA 3KZNA 4A23A 2BFAA 3K3PA 4XRGA 2XRZA 1AOXA 5CDSA 2WYWA 2GZAA 1EUZA 2H07A 2HYDA 3FB4A 5AWFC 2EX1A 1MTOA 3T94A 1MP0A 5K05A 1E1RD 4ENQA 1OBVA 2PZLA 4YRPA 2DBZA 1PFKA 2Z4RA 3WK4A 1E3JA 1PDOA 2VYVD 4FHCA 4IQGA 2QSJA 4M1SA 2EZUA 3T7KA 2FWJA 2EKLA 3U9TA 3ROQA 1F2VA 3W8RA 1XPJA 4GC9A 4CLRA 1CUHA 2VHQA 2I9KA 4TVOA 3NDRA 1Q84A 3GXBA 4JBHA 1II0A 2HBYA 1TKAA 4IJQA 3G5TA 4TV9F 2Q0QA 3IQFA 4JT2A 1P3Y1 1X3LA 4MROA 4UC0A 5H9VA 5EWJA 3IT3A 1U3FA 3I6YA 3PG5A 5EYPA 2RC5A 3UKOA 4I4IA 3ZU5A 4E46A 1QGZA 2GCOA 3UOWA 2CEKA 2Q2OA 4B3XA 5JH7F 4F4DA 3AEQA 3PSHA 4LS3A 3U6KA 1ZXLA 5AUOB 5KVQA 1EP9A 5JRZA 3ME5A 3D4OA 5C32A 2QRUA 1WXFA 1L8LA 1M7GA 1BKDR 1W85B 2HCJB 4H18A 2OTCA 4PNHA 4ALLA 1PCXA 4NNOA 3QHPA 1M2VA 1PLKA 2P2DA 3NDBB 1OWMA 5JSZB 1DPFA 8LDHA 5KNDA 1JLSA 3TFQA 4MRSA 1I30A 4FQ5A 5JJIA 1JFLA 2ERYA 2RBEA 2RONA 3IMCA 4LMAA 4RW0A 2GLTA 2ZAOA 1J49A 2OZLB 4FU0A 4RV9A 3QMWA 2XDWA 1FFBA 2C88A 5LWQA 3DDWA 3EH1A 1RXUA 1T9KA 3RVRA 4GSKA 1XVTA 3L0CA 3NEYA 2FCRA 4IXWA 1E0JA 1W36B 4N9QA 2WVAA 3QLUA 1RE0A 5DCYA 3JQ7A 1E1CB 1B6GA 4J1QA 3UK7A 3WMFA 3NC0C 3M5CA 1KMMA 1O6ZA 2FX3A 4IDCA 3WGZA 4YRIA 4X7RA 4RM2A 1F06A 4D8YA 5CYFA 1ZL2A 5J4LA 1U7DA 3JQGA 4YTEA 4ESVA 2JK0A 2QAGC 1E7RA 1Y7HA 4G89A 4J2HA 2QB5A 4NYJR 3HL4A 4PWYA 3MWYW 3JQBC 3LK7A 5TX7A 1XLTC 3AVVA 2O5RA 3PKIA 1XCLA 4CLRB 1YJAA 3VPGA 4RLQA 1N6RA 1BNCA 1T8WA 4L72A 5CDGA 5G0TA 1E2KA 4JJ6A 3NBUA 3OFVA 2VRBA 3FCCA 4OMUA 1N0WA 4YJHA 4C7BA 3P97A 5EWJB 1P74A 1RQ7A 2H1CA 4LISA 1O94D 4RKQA 5EYPB 4C20A 2O3QA 2V7VA 2GCOB 2YJ4A 3N2IA 3R6TA 2HQBA 3LZCA 3OPNA 4C22A 1UBTS 1ZUHA 3NVAA 3AVTA 2FDXA 3AEQB 4MQBA 4AZWA 2CEAA 4EFNA 1NOIA 4B4OA 1PJCA 4OHWA 4PPYA 1PF7E 4L9SA 5E1OA 3UJCA 3SYRA 5AVRA 1ZM2A 3E0XA 4PLFA 2FWIA 2X1LA 2Q50A 1KJNA 1M2VB 2Y1OA 3DZ8A 1TMYA 5EIWA 2DHRA 4Y9TA 3QNMA 1EFRD 3VMMA 1VMEA 4M0PA 4GI1A 2GD0A 3ST7A 3NORA 4U7DA 1KMHA 2O8DB 3B1XA 1X15A 5A5EA 3I9V6 4B71A 3II6X 4R1NA 4BO9A 2O2SA 2HMTA 4Y6OA 4QRIA 4B0PA 2C1ZA 5ALMA 2C9CA 3RNOA 3WA7A 2BE9A 3IEIA 3T5AA 1G16A 3C7DB 4HD8A 4MYCA 1ZMOA 1PJQA 1A9ZA 1EGMB 1G5RA 3OZSA 1AF4A 4ANFA 4D8UA 4DGQA 3ZW8A 3OP4A 1BQEA 1CUCA 3OG9A 4B6RA 1H2BA 3CCFA 1Z15A 4GEGA 2EZ9A 3PF9A 4LGYA 3WQRA 3U61B 3NHLA 1O87A 3JQ7B 4CKEA 2LUOA 2O7RA 3PCXA 4RSHA 4EG3A 3CUYA 4FGLA 4GR5A 4Z0PA 2C98A 4FVTA 4JUBA 1JAXA 3GARA 5A9TA 1ZQ9A 3ESQA 5FTKA 2P27A 3JQGB 4YT4A 1ZLXA 1WXHA 2IELA 4YREA 4DV1B 2DCUA 1A04A 1U9CA 4QDJA 3T3NA 4FD3A 2PTHA 4EPVA 4LTDA 1J6UA 1IXZA 1TA4A 1V9SA 2E49A 2GTPA 3KCQA 1KE2A 5A5DA 4JN6B 2PIDA 1UANA 4P86A 2G25A 4QARA 5K3DA 5E9AA 4UE3S 4YJHB 3QVMA 1MD9A 1Z0AA 1GNQA 3HJCA 1L5RA 4YK7A 2Z43A 3FYHA 2V5AA 2BGWA 3I01A 4WDRA 4N18A 4Y3UA 2AHOA 1BDBA 2GA9A 2I76A 3UHFA 1ETUA 1L7MA 3V4SA 4GP6A 4IIGA 4HNVA 2W8ZA 2Y93A 1NYTA 1DMRA 1UPTA 1E7QA 5EC8A 4LFCB 1N3IA 1UCFA 2PKCA 3IUPA 2FN9A 4Z99A 1I2MA 4JZKA 1M2HA 1Y4UA 1Z5VA 1FU8A 3DDNA 4BTLA 2HRCA 2W6CX 5ALPA 2G04A 5IDYA 1HNNA 5HRUA 4IPTA 2ODNA 1YL7A 2X8BA 1WTAA 1O6BA 1RLJA 3DB2A 1UADA 1XZFA 1WW2A 2HB6A 4HAVA 4NCHA 4BB6A 3ODGA 3QLVC 4ZVMA 5LZ9A 1AXRA 3RK4A 5EZQA 3BKXA 2R7MA 4RZXA 5FL7A 4S3MA 4LHSA 3K70B 1KNXA 3A6GA 3LUBA 1D1SA 3J81A 3AR4A 3TRHA 1RQGA 1NNI1 3BWBA 3D6JA 2UYCA 1EM8A 3WIOA 5L6LB 8ABPA 4ODIA 1F8UA 1B1CA 1O7JA 1GT6A 1P1FA 3OJOA 1EA7A 2QXYA 4M0CA 2X8AA 3F5SA 5HK9A 3FPHA 3HCFA 4CKEB 4UBIA 1KORA 2IPXA 4H0NA 3HG7A 1M1YE 3N0WA 4KO1S 2CLMB 3KJXA 1IHOA 3LM8A 3S28A 3AFMA 1H93A 3NTXA 2HU2A 4G0ZA 2LW7A 1ZUIA 3RM3A 3UCXA 1JFSA 2HKIA 5EKSA 2C2XA 5E4JA 3W6OA 3ZUPA 1N77A 2PZBA 1MJ5A 2EYQA 3AF5A 4OYYA 4UUQA 3JD3A 1Q2UA 4FCWA 2DXIA 4DMKA 2QTGA 2A8YA 2C9OA 3FR7A 4TXJA 3HBNA 3JD4A 3KZXA 4Z7NB 2IH5A 4YV0A 1F48A 3L9XA 4QQNA 4MVYA 3D4NA 2B9EA 3R0QA 4JQZA 1ZMXA 4XWTA 1R0CA 1ZAKA 3AHJA 1NJFA 3ROTA 1W581 1DG9A 1PJ3A 3MMZA 4JLJA 2ONCA 1QBGA 5FI5A 3WXBA 3DC2A 4R2MA 2EFGA 3K1YA 3LK6A 4ZQEA 4NR0A 2GZ1A 1LLFA 2Z3VA 2ZJ5A 3I6BA 3NUQA 3CM0A 3R9XA 2QSYA 3IEVA 5KYXB 4L6CA 3ZY4A 4WVLA 3CY6A 4KX5A 1YQTA 4D3SA 3VR3D 5I9MA 1IUNA 1GGNA 4ISCA 4HLCA 1SUAA 5AXCA 4J16A 3UJDA 5CRIA 3DR3A 1Q7RA 4XVRA 1V1MA 2Q28A 3H19A 1EKXA 5D2CA 1CUIA 3VR6D 1N7HA 3QA3E 4C76A 1GNLA 1P45A 4GXNA 5E6RA 5D51S 1Z2OX 4OP2A 3ZY3A 1H69A 1Q11A 4TM7A 1U6KA 1ZEJA 3IIEA 4V0MA 4DC1A 4HNQA 2DP4E 5COBA 1P2BA 5KWJA 4AKTA 1OIVA 1Z0UA 3N2GA 3U0BA 1LDNA 5LKRA 1DG3A 5JFGA 3STHA 4RJLA 1P1BA 4B73A 2OVFA 3IBSA 4RCZA 5IMBA 5GGYA 1UZNA 4J8PA 3PWTA 4OF4A 1HDEA 4EI9A 3Q15C 2PXAA 3LLUA 3K31A 1Q57A 1TIBA 1EM8B 1WSWA 4FI3F 4WBNA 3R0VA 5CD1A 1K68A 2FW9A 2IOYA 4U1RA 4FBGA 1T2DA 4X1IA 1EQUA 1NR5A 2NAFA 2W70A 2J9FA 4D99A 4B4VA 3PVZA 4EA6A 5A2QA 3QXSA 1VL5A 3C4JA 3KKKA 3NVDA 1ZA2A 1M5UA 1BJKA 1DJQA 2WSBA 3GVXA 2QZSA 1RR6A 4Q7JB 4URZR 5ERYA 1KOGA 1V7CA 3PGXA 2PV0A 3GEEA 1FK8A 1OZ0A 3MUFA 5LP6F 1P7CA 2QTHA 1CVIA 2M1XA 2CLOB 4G5XA 4OH1A 4PIPA 3PGVA 3MW8A 3WAKA 4CL8A 5T3YA 3TBFA 3GLQA 3Q7EA 2DFVA 4W7IA 3WAJA 1Y5NA 2XYRA 1SIOA 1CULC 5A5VA 2AYXA 1RYZA 2H1SA 4XTRA 2OYSA 1C41A 4GX1A 4XE5A 5ALHA 1HE3A 1OFHA 4LHVA 4X97A 2QTRA 3ZCUA 3IDFA 4LOLA 3SLGA 1H9BA 2VP3A 1NGSA 1DO8A 3HJTA 1HYQA 1N4AA 2WWXA 1LBSA 3PHLA 4HG2A 4RZ3A 5K0JA 4LYJA 4Q7MB 3AL3A 4X6LA 3UC5A 3VO8A 4AXBA 1H4SA 4YVFA 1DKLA 3L7CA 4J1SA 3BIXA 4Y30A 5CMLA 1GNPA 2Q1YA 1ESMA 4KXMA 4H35A 4HY3A 4YP1A 3UK6A 2CJWA 1QLJA 1V1MB 1S7CA 1E89A 2EL9A 3HWWA 5CCDA 3ICVA 2QJOA 1NMZA 2WABA 3D1LA 4LZAA 1BH2A 1JTEA 5E6RB 2WZBA 3UVEA 1T91A 3ACDA 4TXMA 4B32A 2IBTA 3CF2A 3ELYA 2II6A 2W2VA 3HYTA 4Q4LA 4BUJA 3HA7A 3FPAA 4PYOA 1XMXA 5IBPA 1YGPA 3N2GB 4GL2A 1JFRA 4X3OA 5AKYA 3OP1A 3CGGA 4DLBA 2VDWA 2UAGA 1MOQA 1S8AA 1K2WA 1K4KA 1SBNE 4FOTA 4L28A 3DYVA 5EZYF 4AKIA 4KR9A 1NU8A 4WLEA 1QH8A 1VJGA 1JMYA 2A88A 2PSJA 2E1PA 3HEBA 3BTVA 4WBNB 1T4CA 2EARA 1T5OA 4FR2A 2CUZA 2ZDQA 5K1ZA 3TRFA 1W88A 4LXIA 3V7YA 3UA3A 4AXXA 5K0EA 2OGUA 4CFZA 1KFKB 4X1IB 1CRLA 3U16A 1QG0A 2J9FB 3I9LA 5BWBA 4P33A 4PONA 1KFJB 2HMWA 3WKEA 3UGKA 2GEKA 1UC4B 2VWHA 3KJQA 4XUGB 1ZC4A 2I2WA 4L9WA 5KB3A 4WXHA 3WNVA 2V8BA 4K0RA 4Q21A 1N2CA 2XXBA 1O1YA 3KUUA 1HF3A 1HI9A 2QNBA 4K2AA 4YAOA 2Q6LA 4ZYZA 1N2IA 2BY4A 4DMUB 2VJKA 5KNBD 3TKAA 4CF3A 4F8YA 5AM3A 1V7ZA 2F48A 3M6LA 3QMVA 3R7SA 4ALJA 1GDHA 2FN3A 1CTQA 3O3CA 2RI6A 1T3HA 2I4TA 2VR1A 3DZJA 5AKXA 2O6HA 1H42A 1II9A 5CB4F 1C29B 5ADUS 2Z2XA 1LPOA 4GYKA 3QG1A 3VR6H 4EEKA 3RYIA 1IQPA 1J1IA 1JTVA 1LW6E 5KBYA 1I3CA 4A6PA 4DWVA 3WMRA 4QUAA 3KSUA 1ORRA 4K9QA 1Z0IA 3H11A 2OOKA 3L6EA 4C78A 3K0SA 5BV7A 2D4HA 3H8SA 4JUCA 4MUKA 3K94A 4AJJA 2EVWX 4YA6A 5JD5A 1T2AA 4J0IA 1S2GA 5EQTA 2C5AA 3Q3IA 1S01A 4LBWA 3E1GA 4DCCA 4GLLA 2CJWB 2D54A 5JTUA 4YMGA 3FMVA 3BL5A 2ZBEA 1PR1A 1T2FA 1UWLA 2FUG6 1QQ7A 1XTVA 2Z2KA 3NKLA 4MQEA 4NDZA 1IY9A 4ND3A 4XSGA 3ZLVA 4F38A 1EBBA 3DDHA 5K8UA 1RWXA 2BHLA 3OJXA 5G1OA 3OLQA 3W7AA 2VDWB 2CF5A 2ZREA 3NB0A 3VAAA 4DNQA 4G0MA 1YASA 1VI2A 4P7JA 1P5FA 4RE6A 5E9QA 2B8WA 1QH8B 4EHKA 2B9VA 5IJ9B 2NO6A 1OI7A 1T4CB 4BKOA 1W88B 1XEXA 4RMIA 1EX1A 3S55A 4CIAA 4X5OA 1L7VC 2HBZA 2OILA 1YBFA 5I9IA 1WXGA 3LXMA 1HZZC 5KUTA 1POWA 1PR9A 3RS5A 5AI5A 2NVWA 2PXCA 2E1RA 3QOFA 1H0HA 3MRSA 2X0IA 1X7HA 1CPYA 4FC7A 4O0MA 5KVVA 3FBTA 4HHEA 1PWEA 4AJ2A 4BVAA 2IH4A 1D8AA 1VIMA 1DQPA 1N2CB 4BJ6A 4DQVA 1CZUA 2PKEA 5DOZA 2H59A 3JCZA 4PXAA 4QFCA 1KOLA 4UHFA 2D5BA 1Y9AA 5JI2E 3OWHA 4B1FA 3P0FA 2YRXA 5BYJA 1VI5A 3F7MA 4Q4AA 1DBVO 4YAFA 5ARDA 3QZUA 1YNOA 3RADC 1QNLA 2GYWA 3UWOA 4CF7A 2PJUA 3O82A 3QW2A 1ZVMA 3ETJA 1XMPA 3L7JA 5ALOA 3D9QX 3UGJA 3KJIA 3RYIB 3G0OA 4N0MA 4AU1A 1BDHA 4YRNA 1TMOA 2BHTA 3D2AA 3L8GA 4BRSA 5J63A 3H11B 4Q24A 3CVWA 4N0PA 2VBGA 4BUCA 2PE5A 2YXEA 1SBHA 4EFMA 2FRDA 3O93A 4EPYA 1DADA 3D02A 1KJQA 2Q3FA 4XW2A 1W76A 3N76A 2R6AA 4Q02A 4RGYA 3A6EA 4UVGA 5LYJA 3ZWNA 5IAJA 1EWVA 1VGVA 2FW7A 2HA0A 1WLYA 3R23A 1GADO 1H2XA 3QJ5A 4MQEB 5IARA 3VBEA 4K6MA 1NRWA 3U4IA 1BEUB 3WK7A 2JEYA 3WMEA 1II8B 4UAUA 1DAFA 1ZHOA 4YCDA 1NXSA 2H7CA 1SD1A 1V26A 2R96A 1PK7A 1Y1TA 1SEPA 2VYCA 2JJ1A 3E23A 1DBSA 5IN5A 1I7PA 3FDFA 2GPAA 1P1IA 3TW6A 3M82A 3IE0A 5JS7A 2ET6A 3M6AA 4UUNA 1XEXB 3QHQA 5G4LA 5KNBH 4HX5A 1TKRA 4WL0A 2MSNA 1UODA 5AFSA 3C3PA 3X2SA 1XTRA 4TKUA 5CFZA 1H2WA 4AIIA 5FA6A 2PANA 3H75A 3QLTA 1FYDA 3H86A 4MW0A 4YECA 5I45A 3U4MA 1H2ZA 2EFJA 2H51A 4U6SA 1SVUA 3ISTA 4DWOA 5KSOA 4IQ8A 4QPNA 4MDFA 5SYNA 2JJQA 4XD7A 1VE3A 2AEFA 1DUSA 5HWSA 4W5HA 3VR1A 2QT0A 4A4DA 2J0QA 3G2JA 1C0LA 3TLJA 3O73A 1ZH2A 2Q8QA 3AKYA 3ZWBA 5JLAA 4Q4AB 2P9JA 2OV1A 3QYJA 3M7IA 2LKCA 4GBGA 1U80A 4LYHA 1HTTA 3W34A 4EPTA 5LLDA 1L5SA 5TPWA 2RHWA 1WU7A 4LDNA 1NVVQ 4HMQA 5A6SA 3UJ3X 4PHCA 5B58T 1UJNA 2J7KA 3KV3O 4LRTB 4RKRA 1HO3A 1TB4A 2WU3A 3H3FA 3RQIA 4D74A 2FPRA 2Z6AA 3UXEA 3L46A 4QXPA 1LLCA 5AKLA 3A10A 3VJMA 3AXSA 3A31A 5B3KA 1HLDA 1J8FA 3GGSA 3ZS8A 1O89A 3QFTA 2YNMA 3H1TA 1QVZA 2V1UA 2V8OA 3E22A 3L4EA 1PW5A 1QKIA 3NYQA 5LYJB 1A4IA 1NXTA 3EEYA 4ZARA 1T26A 2VXOA 3SAJA 4ZKDA 1X38A 5EJEA 4ZRDA 2FEWB 1M7BA 1T8PA 2AG8A 3ASVA 2E4VA 4XDYA 2R1TA 3IVAA 2IYNA 3GRYA 1C3LA 5IYZA 5IDQA 5JW6A 4IFIA 3NHRA 3GMIA 1PT8A 4GLOA 5FTMA 2PKRA 1N36B 4DQ0A 2X0DA 2JAHA 1AM4D 1BS9A 4WRRA 3MD9A 1RP7A 2JIPA 3BS4A 1BDMA 5J4HA 3NUGA 3CZMA 3IQZA 2HADA 3DMGA 1JDUA 2FWRA 4HBGA 4K9RA 4KQWA 1OXBB 5ITWA 2VPQA 5EPOA 5FD8A 4TKUB 4Q1VA 2AN5A 5FI0B 4K87A 3SEQA 1P9LA 4UVHA 3ROFA 3W5UA 3T5GA 1ZMTA 2WILA 2XQIA 4YPFA 4E5VA 3BWCA 1YS9A 1FUUA 1IFXA 3ND8A 4LJAA 4PSKA 2V9ZA 2EEPA 2ZZKA 5DGIA 3NMUF 2J3MA 4JB0A 4OSEA 1KYXA 4M8LA 2R1ZA 1GAWA 2VP5A 1K66A 4PZ0A 1QWOA 4Q19A 1EP3B 1AA9A 2JVJA 3K9CA 1WHSA 4OGGA 1IHUA 4R41A 3DFZA 3EXG1 4DA9A 1C9JA 2XUPA 5F7ZA 4NBRA 1WMEA 3NWEA 4L1KA 2B34A 5TPWB 1D0IA 4QEZA 5A6SB 1P81A 3JWHA 1SBZA 1LBEA 2I6FA 3UHAA 4EHNA 2O59A 4ZZIA 2NVBA 4OQFA 3KEQA 4CL0A 4G86A 5B64A 1ESDA 4K1XA 3GJTA 2JKZA 3EHDA 4JB3A 1L4FA 3PFFA 3PA6A 2WT9A 4QJIA 5GINE 2ON6A 5DHQA 1KJ9A 5F9HA 5H16A 3NHMA 4YACA 3SU8A 4J6EA 1EG7A 3NOQA 3E22B 4HWRA 5FUYA 3X1JA 2P2YA 3UWKA 3PNQA 4AMUA 1S8NA 1F12A 1W6RA 3LL7A 1ODTC 2A9OA 2UYOA 3RIHA 5GJBA 1HURA 1RC1A 1W29A 4BP9A 1GKIA 1M2NA 2R1TB 3RHSA 1LTQA 1TADA 4TSRA 5IYZB 2A1TR 5LZ8A 1R6TA 2C0PA 2JJ2D 3DULA 4FJ2A 4K26A 5K0TA 1E3MA 2IS2A 2ZIUB 4U5QA 2B1IA 3VTZA 2IOFA 4O1HA 4ZYTA 2PYZA 3UF0A 4W1RA 2BGRA 2PX0A 1X1DA 3SKVA 2FDCA 3M9LA 1N32B 3P4XA 3AJ8A 3HEMA 5FA5A 3EUEA 3KB8A 3JQ9C 5DWQA 1D5WA 2I4IA 4GDMA 3LUGA 3QOWA 3N75A 2E2WA 4ZQHA 3CCBA 4HNGA 3QEJA 5KTTA 3FMOB 3C4QA 3TSYA 4Y9SA 4D43A 2R8YA 3HXPA 4Q48A 3X1MA 3N07A 2WP0A 4MS3A 1Y6GA 4LX8A 1DTWA 4DHWA 2R8RA 2XAUA 1PDWA 5H4HA 1WHSB 5JAUA 1QQAA 3JVVA 4RJKA 3EGVA 3T06B 3MT0A 2XMZA 5AM2A 4ZT5A 3EIOA 1QV6A 2PSEA 1PLJA 4B6GA 1LNSA 2GM4A 4N6OA 1OAOC 3EGDA 1K7FB 4WX2B 5GMOA 1X14A 2JGNA 5EGSA 1E3LA 2IOHA 1WCYA 3ZIAD 5GTDA 4DB2A 5CFRA 2HR1A 2WMYA 3DE6X 1LPNA 5NLLA 1LI4A 2BDTA 2JEOA 1JQJC 2HRZA 1JZTA 3BFXA 1I5EA 1UBKS 3OLVA 4RWZA 2QN6A 3K0AA 5LB2A 3PJDA 4D9MA 3IL2A 3ZKAA 1OOEA 3JD1A 4YV1A 4BKMA 5B30A 1JPJA 1N92A 5TT1A 2PVPA 3RTBA 1ZN8A 2CXTA 2G1JA 2FA9A 5ALFA 3KR0A 1T5BA 1UKYA 3NHYA 4FEEA 3R7DA 4AYWA 4Q1CA 2FZLA 4D9HA 1VKHA 3PXUA 5TF4A 3KX2A 4EUFA 3ORQA 5BO5A 1G2PA 2PSSA 4G8BA 3SFTA 4IDDA 1E2QA 5EIXA 3OQVA 5GIPE 3HFGA 1QFSA 1WU8A 1ODKA 3C98A 1HFJA 1C8BA 3ONDA 3I39X 1W96A 4D1YA 1NE7A 3KOXA 1PKXA 3CCCA 3D81A 3O92A 5LQMA 4C0BA 2ZTSA 3WGKA 3KQTA 2QM7A 1IM2A 2A4MA 4PAMA 1H9AA 5DX1A 5EMHA 5SZIA 4XOIA 5EIEA 2AH5A 5AXBA 2HSEA 2HTFA 3NEAA 3O4JA 4J1TA 2HUNA 4V0SA 3CNHA 3D8HA 4MS3B 2WJYA 1G8FA 4IJVA 5LWHA 3FRIA 4OY3A 3ZWOA 2H9YA 2XJ4A 1DTWB 4RA9A 2C96A 2PR7A 4YEDA 1U3GA 5IWCA 1LV7A 10MHA 3CRQA 1C3JA 1HT2E 3NHUA 3DLTA 4BVKA 1IXYA 3ZHZA 3H97A 3FUVA 4XQGA 5GONF 2D8AA 4XYMA 2Y9MB 1HC7A 3FPKA 4ENRA 4U02A 3Q7IA 1WDWB 3F0TA 3OCCA 1WKCA 4RPKA 3ZCQA 3EGDB 4UCQA 1P7ZA 1VCIA 4O63O 4YAJA 3VO1A 2IE8A 4ZT6A 3RHZA 4A36A 4D3DA 4ZOLF 1PBTA 3MT8A 1VYTA 1R7RA 2O5VA 3HBFA 1T8YA 4ZZ2A 4QO8A 1J06A 1DKOA 1Q7TA 2WKQA 3A9UA 1MORA 3K0AB 4EYOA 2B6HA 2XBUA 2OBXA 1X8LA 2Y4OA 1AHIA 1DBIA 5D3ZA 3MLAA 4FONA 4HNHA 3V8NA 3JWEA 1EHYA 1CU1A 5IZ4A 2JLSA 3F9CA 4IX9A 1P2DA 3TEJA 3S68A 3KQKA 4ME6A 5K8JB 1S9DA 4GWGA 2OO7A 1ZRHA 1JJIA 2P62A 4JEUA 5B2ZA 3UCEA 3QU7A 1V8BA 1QAOA 3IKLA 4JQOA 4NCXA 2HJ9A 5KX5F 4IUCS 1FW6A 3E53A 1PG2A 5EZSA 4EG6A 4LYEA 4ZMSA 1R00A 3UWSA 4OI4A 2WMOB 3AG6A 1SXGA 4LGVA 1IL0A 3RAGA 2HQRA 3EJ6A 2Z8YA 3GRKA 1R4MA 3I83A 2DVMA 1N9GA 4NEGA 2JHAA 2BYTA 4TTPA 4DE5A 4TTJA 2DFNA 1ST3A 4JAVC 5MN6A 2DUWA 4JL5A 2Z56A 4E6EA 1ZVKA 5CM2Z 1BWRA 1JBQA 2B82A 3ILYA 5AW6A 1D0VA 2PA3A 3CVUA 5JO9A 1PTJC 4FYVA 5C34B 1N2BA 2VSNA 2ERCA 2JZCA 3IV6A 2H1HA 5K9ZA 2YOFA 1ML4A 4MWBA 3RCBA 1H22A 2AEEA 3A6ZA 2QDKA 3Q6IA 4I3FA 4P93A 4Q82A 4WZAA 1GGKA 4RA9B 4YHBA 4D9JA 3T5BA 4C89A 3IH5A 1Z6YA 4UREA 3C48A 4U9IS 4CN9A 3B51X 5CJJA 5AI6A 4MUBA 1I13A 1C7RA 4XR4A 3AUKA 3JZAA 4HXYA 3CHYA 1VJTA 2R65A 1XLUA 4U2FA 1OR8A 3CPHA 4X65B 3STVA 2XRMA 3Q8WA 2PZKA 2G9NA 4OOEA 1XHFA 4NFHA 3ELWA 1TA9A 2PX6A 4UU1A 1ADJA 1K5PA 4BNLA 2GKOA 2BKEA 4LJ7A 1H2EA 5AJUA 1P2UA 2P0EA 2BTQA 1JHAA 4WXYB 4YUXA 2PLNA 1QHXA 3DTYA 3K9QO 1OUMA 3NRBA 3RNLA 5KOJA 1P7PA 2FJPA 2CFRA 1KR2A 3E3MA 3ZE9A 4JJEA 4YRMA 1I94B 1J7JA 1JVNA 5GZ1A 3ANTA 3GJQA 3K9LA 4IVQA 4PVDA 2R47A 2X42A 4BVJA 2A0UA 2JI4A 5M7EA 4NWIA 3NAGA 1BZYA 2BV3A 3MWJA 4CGZA 4KH1A 3N39C 4FDLA