2A1IA

Crystal structure of the central domain of human ercc1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
129
structure length
129
Chain Sequence
NSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA excision repair protein ERCC-1
publication title Crystal structure and DNA binding functions of ERCC1, a subunit of the DNA structure-specific endonuclease XPF-ERCC1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 39
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03834 Rad10 Binding domain of DNA repair protein Ercc1 (rad10/Swi10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a1iA01
2M9MA 2BHNA 4BXOB 1J22A 1J24A 2ZIWB 2ZIVB 2ZIUB 4M6WB 4P0QB 2BGWA 4BXOA 4P0PB 4M6WA 2JNWA 1J23A 2JPDA 1J25A 2A1IA 2ZIXA
chains in the Genus database with same CATH superfamily
5IC6A 1ZGGA 2FPMA 4DFDA 4MX8A 3QKRB 2QPOA 2VNHA 3IQFA 1AH2A 5C5DA 2X23A 1XTUA 3Q9UA 6REQB 1K3TA 1QU3A 2XVXA 3M81A 2QMUA 2P1ZA 2JFBA 1MX9A 2Y6UA 2OO5C 4G5XA 3RS4A 3OT5A 3O74A 4P93A 4V39A 3H0EA 2BFWA 4EG1A 4FGWA 3R74A 1NBWB 1FMTA 2H17A 3PQ7A 1KY2A 3SD7A 4BDTA 2WJAA 5IC5A 5HQJA 1K8YB 1GPWB 1GQFA 5L3RA 4JBXA 2XSZA 1HC7A 1QRRA 1XU7A 1CFZA 1VE7A 1SXJB 3CH5A 1EGMB 3O3CA 4NYMR 2HCTA 5C4GB 3SR4A 4BC1A 4NAVA 1ZESA 1PG2A 3PD7A 2WW8A 1Y9EA 1YB4A 3WKEA 5B55A 5FL7D 3DHNA 2D0PB 4MQEA 4YP5A 5B1IA 1TZKA 3ZU3A 1ORHA 4JN6B 3UWSA 3WSTA 1K75A 2PH7A 4JT2A 3WWDA 5HIAA 4J4BA 1OR8A 2F8TA 1MABB 1DT5A 2A0XA 1ZZGA 5A0VA 4QJIA 2CCJA 2SNIE 3H04A 2RJOA 2RK6A 4IJKA 2DQKA 4L5AA 3N5KA 5HJ2A 5FNVB 2WTEA 3I04A 3K1JA 4PNZA 4KR2A 2QL5A 1F9EA 3OCJA 4EJSB 1Y9AA 1JIKA 1SH7A 2FSVC 2ILTA 2KX7A 3DFUA 4M1WA 2XB8A 2C2OA 4JEMA 3AY0A 3QPAA 3WXMA 1Y7HA 4HUQB 2FWBA 3O2QB 4FZ3A 4DADA 1KVSA 3PC2A 3DE0X 4D9GA 3KR2A 2ZYRA 4US2R 2O2DA 2ZIWB 3ESXA 1AKMA 4O4JB 4RFLA 5DGTA 1FTQA 4FR2A 4QEKA 5ALGA 4AFNA 5CAEA 3GMTA 4P7BA 4B3SB 1TGVA 2BKLA 3TQFA 4FOOA 4NYJR 4PYMA 5AW0A 3U3KA 4AKSA 2O7VA 4RGYA 3ZWKA 4ZVQA 2D5LA 2WMOB 1HG0A 3DBVO 3TLEA 4TOIA 5JJLA 4NV1A 1SEVA 5IDVA 4IJ5A 4D7AA 1QE0A 2YN4A 3QKSA 2FE1A 3CWZA 2VHUA 3U3JA 1OU4A 2C31A 4JS0A 4DZRA 2J8ZA 3OO1A 1A4IA 3HSYA 4MCAA 3IFSA 4Y9SA 3B36A 2H18A 4Y18A 4QFBA 5KVSA 3RCBA 1Z39A 3WIOA 4YXFA 2B4AA 5B3AA 1QS0A 3AI1A 2WHQA 3C14C 3FFAA 4RY8A 5CMLA 5F3DA 3BFXA 2PWBA 2BL4A 2EHDA 4TKMA 2ZXUA 1Z7BA 2FMHA 3VDMA 3OCWA 3D7KA 4DA7A 5A5DA 3Q88A 4A2CA 4B34A 3WYDA 1BMTA 3M4YA 3DLAA 4B40A 4O4LA 4J2OA 4K0KB 1PP4A 3HNPA 3ESAA 4KV9A 1A5TA 5FI5A 3EA5A 2QJFA 2HUNA 4D0LB 5AI5A 3LCRA 1OWMA 1SA0A 3RFFA 3L7LA 5IEBA 5EY5B 221PA 4R2LA 2VAXA 1Y37A 1F48A 1JQ5A 1ADFA 1EHIA 4U8HA 3NH9A 5B7GA 3FUVA 2QN9A 4OK5A 1X7ZB 4L6IA 1YQGA 5IBRA 4D56A 1JPJA 3AF4A 5T4BA 1FP6A 1Q50A 4JVSB 2O3UA 3FI9A 1YZFA 3GFFA 4KIWA 3OFSA 5CPFA 1E66A 1GQSA 2PIAA 3OLYA 3UKJA 5E2BA 3H8SA 1M0SA 2NU9A 3X0DA 1EXMA 1MHPA 1XJCA 3TQHA 1RQ2A 3U4DA 1S7GA 2C88A 4YJ2F 1KXJA 3AHGA 2R3SA 4I08A 1E96A 3OIUA 1NN1A 1V95A 4C7JA 1LK0A 1RXUA 3IUPA 3VU0A 1USKA 3K5WA 3L7IA 4DPKA 1E6EA 3I58A 3K1ZA 2FEKA 4R1MA 4V24A 3IUNA 2ET6A 5DHPA 3SQXA 3E9YA 1GUBA 1N3LA 1UKCA 1WNTA 3H3FA 2FF5A 1L7XA 3JQAD 3MIZA 2CDCA 3GFSA 5EJIA 1CXZA 3AXSA 4D02A 4D42A 3LQQA 4TQ9A 2H4FA 1JKFA 1QZUA 1VP9A 1YCGA 2IW1A 2PRIA 3ABOB 4QG7A 4UU7A 2J4CA 2BI4A 2OHGA 4Q3CA 3BL8A 2QTMA 2FSFA 3FZQA 4FMCF 2BGKA 4HGPA 3Q3HA 4S0XA 1O03A 4MVXA 4B2LA 4IVRA 3O8LA 4MVJH 1V1MB 1YU6A 1O94D 1ZEJA 1XQ9A 1T5LA 2OMKA 2P2GA 3GLSA 4FW8A 3ROEA 3VR5H 2X42A 3KXPA 4X65B 2ZSAA 1TT5A 4IOMA 2QTFA 3VR3A 5CFLA 3RS8A 2PSSA 2WOJA 4A3SA 4TXLA 5DF1A 1N33B 1HMYA 5FADA 2JIZA 3M1YA 4KRGA 3SJCA 3RU3A 1HUQA 4KSBA 4D9HA 3PGMA 4OL0A 1B2LA 2RCYA 3O4IA 3LW8A 5DW0A 3DF7A 3WLEA 4CM4B 4ASUA 3R0IA 1H1LB 6ABPA 3GAZA 4BNMA 4F06A 3DE7X 1VHWA 1E8MA 2IY8A 3GVIA 4Q3EA 1GPH1 1XTJA 1ZUD1 2NV6A 2QNRA 2VUSA 4GI3A 4WEOA 1EWKA 2MCFA 1XV5A 2DWPA 4I6GA 5HZHA 2GF9A 3DT9A 1K4YA 3DVQX 5LQUA 2IYFA 2QL9A 4G81A 4YGXB 3RROA 2OGZA 4IV5A 4BV9A 3PDHA 4V1CB 1Z0ZA 1AURA 4KSYA 1DG1G 2UYQA 3LW7A 4LQ4A 1YVRA 4OXYA 5EFZA 4BZQA 2UUBB 3E9EA 4X6XA 2POQX 1H1DA 4KXVA 5CX1B 4CI9A 5IWAB 1P72A 2QY9A 4DC9A 4I1PA 3UEOA 4DCNA 2EKBA 1CUXA 2QN1A 2YRWA 3ORSA 3OIYA 4PF1A 5LKRA 2H29A 3CU5A 4KIJA 1Y3BE 1GCAA 2E4ZA 4LBYA 2VOEA 5FEMA 2H92A 5CLLA 2WJYA 1AQJA 1ZOSA 2YXPX 2CC2A 3BD9A 2MR5A 3QBJA 4RDHA 3GRUA 4DM3A 1XN1A 3K15A 3S1AA 4J0DA 4AJHA 4M4SA 2E7ZA 4C04A 2GETA 2VP2A 4PGFA 2DQ4A 4HFJA 1THGA 3BRCA 4WBNA 1VI2A 3TIGA 4QYTA 4EL0A 1X1EA 5B2EA 4ARCA 1WXQA 2Y71A 1M7HA 2EJUA 3Q12A 4LHEA 4YDHB 4AZ3A 3QLUA 1TEHA 5ITWA 1O57A 1LTKA 5K1ZA 4BKRA 2QUIA 4ZAZA 1U80A 3BB4A 1OXTA 2CWDA 2QP4A 5BR8B 1JIUA 1LVHA 1JPUA 2BM9A 4KUGA 3RTGA 5IXSA 1OZHA 4IUDS 3BXXA 4R4JA 4BFLA 1B0ZA 1H3EA 1U5BA 3D4PA 4ZEWA 4PC7A 5BUQA 1FFXA 1BHSA 4M8NE 3W7BA 2OZVA 4JXKA 3D81A 1KI4A 3KQKA 3ECCA 2VI5A 3LXUX 4AX8A 1V47A 4B7XA 2PBLA 1DAIA 2J9YB 3QW4B 1FNDA 1GRVA 1L8OA 1IONA 1U94A 2FW8A 2J09A 4WLNA 2QJTA 2ZB8A 2ZULA 3PLRA 5ITSA 3G1WA 1G20B 3PI6A 1AXEA 4B6SA 4XQGA 1QH9A 2EBUA 3RQIA 1J5XA 4Q1VA 3ZHSA 1TAUA 4B79A 1R18A 3VTKA 1N36B 2AB0A 1KXZA 5EI5A 3RVDA 5FTJA 4EHJA 1Q3TA 4ADSG 1IRIA 2GZ1A 1U7ZA 2JH8A 3ZIAA 4Q4JA 2JFQA 1BMFD 1UFRA 2FW9A 2ZJ3A 1WLYA 2R7AA 3JYHA 2TMKA 1BX0A 5EXPA 4K3VA 1IBMB 5BQXA 2FEAA 2ODPA 3EZLA 2ZUDA 1TKBA 4X92A 1X7GA 5EWMA 8MHTA 3QE0A 3FMVA 1Q17A 1UXKA 1DAFA 3K1TA 1U8ZA 2R5WA 1KI3A 3KQVA 4HF7A 3UH0A 5AFSA 1C9DB 3RJTA 1RCTE 1WMDA 4AWXA 2BTQA 1AQUA 1I4LD 3SZMA 2PX8A 3VVBA 4N5DA 2QG6A 4Q4CA 5DHFA 4U6SA 1KR5A 5CB4F 3PCRB 1WQ3A 2OZPA 5KTTA 1BEUB 2BEJA 1T34A 2GYYA 4GAEA 2QX8A 4GEKA 4ILEA 2EHJA 1JU3A 4HVTA 3KKOA 3W2GA 3QYFA 4CDGA 3NPMA 3H3XA 3HFGA 4GWLA 1ZP6A 2J7PA 2B8WA 1L7RA 3MB5A 4YXWD 3DA8A 4I4LA 3ROPA 3DZKA 1KYTA 2R6AA 1D4OA 4J4HA 4NEGA 4PRKA 4RNDB 4C0BA 4JP3A 4H1WA 4IKPA 3EXG1 4FLMA 2VP5A 5CB8A 2GXUA 3DDNA 4LV8B 3N2NA 5LKAA 3L6OO 2CDNA 2ZBQA 4KV7A 3REGA 4QJ3A 1N6OA 5K4GA 1AVTA 4G5SA 2IS1A 3D9QX 5CXXA 1W2WB 4UXJA 2WYHA 1P8AA 2EKDA 2IUSA 1D2AA 1NI4A 3H9EO 3S2YA 3SBXA 4N0EA 1QG2A 3GZJA 3IPCA 3BMXA 4Y2GA 4GOND 1U8AA 4RHCA 1R16A 3QA9A 2VTEA 4OYRA 2IITA 2C54A 3V8BA 3SDSA 3FMOB 4ZAFA 2QRHA 4CTKA 4IICA 1E79A 1Q0ZA 2OUKA 1PD1A 4ZKDA 4AROA 4U8GA 2WTNA 2HIMA 1NBHA 1IN8A 1OAAA 1SZJG 3SXUA 3T7AA 3NORA 4DMMA 2HL6A 1D2RA 1UC9A 5ESWA 4EI8A 2C4NA 2I4LA 1G3RA 2C83A 4QSHA 3N0VA 5E1OA 4DMRA 5DP2A 4Y9DA 2X5XA 4NLLA 4LYYA 2PUWA 1E5TA 4YJ2B 3GLFE 4NXNB 3WRWA 1P4RA 2LWIA 2YQ4A 3KTOA 4JSYA 2EJTA 1ZCFA 4CMKA 2RBKA 2I1QA 1ZGBA 5JH7F 1E2MA 2ZT8A 1BNCA 3DONA 1UM8A 3VPFA 4WEQA 3MRVA 3FLMA 4S04A 3FPBA 3KXIA 3BZUA 4RFSB 2R8OA 3CCCA 3E9QA 1CUAA 5GJVC 3WHKA 3F49S 3NIDB 4OIMA 3OPYB 2C4VA 3UHAA 4UAUA 1F2UA 3DBLA 5THKA 4GVPA 4JB3A 4NP6A 1WZUA 5BMOA 4UDNA 2JK1A 3NHSA 4UPEA 2XUZA 4O5AA 4QDTA 4NE9A 2Z6AA 1ZGHA 4UUOA 2V6IA 3PNLA 4YRBA 5D01A 3NPAA 1GHTA 1GUZA 2BELA 4K6FA 4NBTA 3PV0A 1D0SA 3OE7D 5ULLA 3RHZA 3CX4A 3GNTA 1B8OA 4TWBA 4DRXB 4PZYA 5DXAA 4Z9BA 3R20A 2ZYDA 2YXNA 3NJ8A 3A9UA 4HDAA 3RPEA 2OHJA 1U6JA 1TKRA 1XP5A 1FVXA 1SVLA 5LBIA 3PPWA 5KHAA 5FDFA 2AEJA 4BAZA 2CLIB 4ZXPA 1P2TA 3K72B 1PDOA 5B53A 3OE4A 4G0PA 4NBRA 2QZ9A 5AIAA 4OM7A 2EX4A 3UGQA 3WYCA 3HKBA 3M70A 1J99A 2QLMA 2BCEA 1QK5A 3LX4A 1C3OB 4DLPA 1UAAA 1QHEA 2JFYA 2FGJA 1MJFA 1SU6A 1U7HA 3HNOA 1CR6A 3IOMA 4J1QA 5HG0A 2WFLB 1RTTA 3FTQA 5IRCD 3WQBA 3U19A 3UJDA 2PQ6A 1NMYA 2PEYA 1YMQA 3JAKB 3W7AA 4PYQA 2AIRA 1DEXA 2PKWA 2CW5A 2WA2A 1TI7A 4P08A 3A1TA 4DWWA 4WRRA 3PEWA 1GGNA 3ZCXA 1HT1E 4BU1A 1ZIPA 3AVOA 3RC8A 5DU2A 1B0PA 5TRTA 4FHDA 2PGXA 2G1AA 3D8HA 4FFBA 4QUKA 3HZZA 1B8UA 3ITKA 5YASA 5K9ZA 3AUUA 3KQSA 3OHMA 4FJ0A 2NSJA 1A5SB 1KFKB 1PQPA 1SOUA 4GWGA 3O7MA 4JWKA 4D9BA 5EJ4A 4LZZA 3A6GA 3L04A 4ARBA 5K8CA 3V2UA 2FCAA 1CQJA 2PWZA 4Z4EA 2XBLA 2W00A 3CZAA 3D0RA 4PG6A 2QQ0A 3CXUA 1N6RA 3OETA 1JHZA 1K1EA 4GE0A 3MJCA 5HWSA 5EMLA 2VL7A 5DVZA 1PQUA 1KQPA 3CIOA 5CM2Z 5TY0A 1G66A 2OQVA 3AM5A 1CZKA 3WQRA 5AJHA 2I4RA 2ZWIA 1IATA 3QVTA 4LNAA 2C5FA 2PX5A 2VDMB 3LUGA 4EARA 4UDYX 2EF0A 1J4AA 3R40A 4ZODA 3L0DA 1ICEA 3EUEA 4ZRDA 2XUIA 2IDMA 4H7EA 2EVWX 1A77A 3CNNA 5I48A 5JSQA 1XEWX 2H54A 1ZBQA 1H4QA 3PQDA 3OQNA 1R0CA 2X19A 1XZDA 2Z9BA 4XXHA 1PV4A 4PRYA 4JX9A 2JARA 4A6DA 3R75A 2K5UA 2B5WA 4DT1A 3FA2A 4OK3A 2OV4A 3T3DA 4AS1A 1MT3A 4OXQA 1R4NB 1NV8A 3RRYA 5THQA 3HBAA 2G4VA 3PWSA 4XVHA 3U62A 4RTNA 3CKYA 5AM2A 1P0MA 2EERA 2NYVA 3NHZA 4ZCRA 4XB6B 4OP2A 4RV5A 4UUMA 2BFEA 3SQNA 4GW3A 3IDZA 3B1JA 2FY8A 5P21A 3UMVA 2FOLA 2BFFA 3KDSE 5REQB 2YYYA 4BWFB 1U1GA 2YTZA 4EQ6B 1IVNA 2VJPA 4M7PA 1WBBA 3WVNA 1QMPA 3K16A 4YPVA 3NC0C 4MA5A 1TUEA 2R6FA 2Y0DA 1UZLA 1J70A 1JKJA 1Z2CA 4L4UA 4LDQA 5IAGA 3ZHBA 1E3MA 2ISSD 2PSHA 2FA9A 4J16A 4CMCA 2GERA 3JQAA 3DUFB 4GPD1 4AKHA 3LOQA 3NRCA 2Q2NA 4PIMA 3VX4A 4BS9A 1Y6FA 4IW3B 2GLUA 4S35A 5DYGA 4FYVA 1H93A 1YR1A 2EL7A 3Q3VA 4I5GA 4M1QA 2AEMA 2V6GA 2F90A 1ETHA 2V7PA 2QY6A 2CMFA 1EEHA 3DVAA 1GGMA 1OFIA 3BE5A 4BGDA 4X7RA 3V32A 3ZDEA 1J1UA 1E2QA 2V7WA 5DM2A 3QX8A 3UTCA 4ZDWA 4LKRA 1J0EA 1RBQA 3LGAA 3RW9A 1DQSA 1N7GA 1YKFA 5HIMA 3W5SA 1FYEA 4ZGWA 3DAYA 5BRAA 4ALLA 1EU1A 1MCZA 4S1OA 4C6RA 4CODB 3WO0A 1QYWA 1R9MA 4B3CA 1AKYA 2L19A 1Q57A 2XUAA 3L01A 4B8WA 3HJNA 1X7XA 4CM8B 4MGZR 5I47A 3OF5A 5BN3B 2ESRA 3W8EA 1H3NA 2GQ0A 2WVHA 1PWEA 3D6VA 5DHSA 1H9AA 1IHOA 1P91A 2FZGA 3LFUA 1SCJA 2AK2A 4BAGA 1JJFA 1F8YA 3BGOS 4BZZA 4UHDA 2O0KA 3NTOA 4MYDA 4OJQA 4AS3A 2XXBA 1K86A 5FLXA 4B44A 1RIIA 2VWQA 5ECDA 2QL7A 1T2UA 1PTJA 3G0DA 4KK3A 1L1FA 3GJ4A 2J46A 2I6UA 2N46A 1NASA 4Q9HA 3IMEA 5G41A 5K6AC 4GQBA 3ZK9A 2CT8A 2JGJA 1G8MA 4XQEA 3PXCX 3NM4A 1EWRA 2VPPA 4NHOA 1NNUA 2D5IA 2QQEA 4EI2A 3TDNA 4UEJA 2D1SA 1ORIA 2V6MA 4FNOA 2Y8EA 4KXUA 4DV0B 1W73A 4X44A 5G1PA 3P2YA 3UJ6A 5DYTA 1GL7A 1YULA 4UULA 3SLGA 3Q7QA 2HT1A 4E4YA 4TMXA 3R9IA 1RPTA 1TYEB 5DBOA 3VYWA 4EA7A 1MO6A 5IJ0B 3RYFA 4FR5A 4M1ZA 4HWOA 5JANA 1RBMA 2VBGA 3TFOA 2WYUA 1XTPA 4WT7A 5CH8A 1SBQA 3HV2A 7ABPA 3OTOB 1NVVQ 3K3PA 3MAAC 4MNTA 3K0HA 1P0IA 3KYIB 1QH8B 2Z3ZA 3CRMA 5KYGA 1OX4A 1RYYA 1Z0UA 3IOYA 4KSCA 3E7PA 5IJAA 4ZJYA 3NM6B 3UMSA 1S6YA 3IKVA 5EUBA 5JCJD 1N8SA 4J7CA 3UQZA 1E9AA 4P3NA 4MPTA 4KREA 3B6MA 3JQBA 3DL4A 3UGJA 4QM6A 4P9NA 4EW1A 1KQNA 3TZCA 1W1IA 2BKAA 3QU4A 3RBAA 4I9GA 4DWVA 1XZCA 3RJZA 4MA0A 2R1ZA 3WE7A 3E8MA 3NOVA 2GUGA 3CLUC 4LOJA 2A5DA 4LTDA 2A84A 3P9CA 1E2LA 4YI3A 3R77A 4GX1A 4R1UA 1Z4NA 4RDCA 1L5MA 1HE4A 5AXDA 5I9SA 3SC2A 4L5CA 3F8SA 1MZVA 3I01M 3BFJA 1Z22A 2XCLA 3THSA 1CUGA 2H63A 2PEZA 4RD1A 4Z1OA 1UFQA 3ESZA 3OOWA 5JI3E 3W79A 1E4OA 1NJ5A 4QT4A 1RWWA 1I4TD 2WF9A 3IBYA 2HBYA 2BEUB 4PZPA 1B26A 3P27A 1UBNA 2NAFA 1BMFA 1JJ7A 1KAMA 1SQGA 1U0JA 1UKYA 4L8WB 4YWJA 1JHMA 2C9OA 2H07A 4G85A 4P3KA 1G7SA 5LZ8A 3K0AA 3TW8A 4E5VA 1W7AA 3LPLA 4KO4S 5DBFA 1A82A 3O4GA 4HNHA 4X24A 2Z2IA 5KHLB 3VR2A 2ZJ8A 3NMUF 4HNAA 1UL1X 5TPWA 4MYTA 5T8KC 2Q1UA 4D79A 3A4LA 1EK5A 1CU1A 1UXIA 5DCLA 4EUSA 1II8B 3FDZB 4L3WA 2ZJ4A 4XX0A 2XNJA 1DELA 2D7CA 4N0PA 3AR5A 3OLXA 1V8OA 2WU8A 4FFDA 3WGKA 5FH9A 3UJNA 5ISMA 4B4UA 4M1MA 5GVSA 1NQUA 2A1UA 2AOVA 1Z33A 5IABA 3G6WA 4YIKA 5AD1A 3Q72A 4MPJA 1YNSA 1HM5A 2VXYA 3H65A 2PBZA 3KELA 3UMGA 5FA8A 3A6EA 5LL6P 5CH3A 1ILWA 2QTTA 1E58A 1JHAA 4B74A 2NSHA 3JZIA 3ZGNA 4WKNA 3IAXA 5AJVB 5ALIA 3CLVA 2MYUA 5BV7A 4O4LF 2FQQA 4N7RA 3HFJA 5AHXA 3RANA 4NTZA 4P7JA 2O9JA 1V5EA 2YIJA 3BBPA 4K5QA 4YXWA 3UT5A 5HDBB 2IKQA 3JQFC 16PKA 2PGDA 2R1TB 2EXXA 3DXZA 1UPTA 4RTOA 2FUG6 4I0WB 3WRYA 2QU7A 3SF8A 5LP6B 4PBRA 2QZPA 2W6PA 3TM5A 2MR6A 1UJ2A 3VHXB 4Z9YA 4GZMA 3VR6A 4WFKA 1EJ6A 1TECE 3E7XA 3TZLA 2O54A 1FB5A 1T1EA 4DE5A 2JBAB 2FQWA 3IBSA 2G4LA 2ZTMA 2OGTA 3KZ1E 1L5WA 5TSDA 1Y3IA 3TSAA 5C4IA 1L9KA 4XQ9A 3U6KA 1CRWG 3TZ6A 5AICA 6NULA 2D7DA 2BTOA 1JXAA 1GPAA 3HV0A 4JT9A 4MWEA 1L5LA 4EF6A 3EVNA 1PSDA 2I8AA 3ZJ5A 5CITA 4N6OA 1H22A 4WDRA 1G59A 1F2TB 1C80A 4Z86A 5L51A 2ZUEA 2GPAA 5BSMA 1C9NA 2ZIAA 1HURA 1I2ZA 1SVKA 4K40A 2V3WA 3BORA 2I99A 1J0CA 5M34A 5CA1B 1P3DA 5TF4A 2JLWA 2A9VA 1OT5A 3BAZA 4IOLA 3B8EA 1S0UA 4KYIB 4N40A 3AJRA 4NZMA 2D5CA 4JT8A 4GLBA 3T3NA 3T1NA 2CLCX 2B4QA 3GCDA 1SK8A 1DAMA 1UBFA 3ANSA 3OX2A 1VL1A 3OWOA 4K9QA 2EP8A 3T9DA 4DQUA 2RGNA 1CY2A 2BKEA 1AC5A 2GEJA 3GUCA 3Q4GA 2COUA 4JX8A 4O4IA 3LIPA 4YRJA 1KJJA 3EW7A 1DFGA 2W37A 1RPJA 4TVBA 5FUBA 3COZA 3THRA 4BAUA 3LWBA 2ZAIA 2O59A 1W29A 3TQRA 4DMGA 2QL6A 2QQGA 1ZINA 3C6ZA 2IS2A 2GUWA 3TRJA 5JATA 1FUIA 3N53A 1ZUWA 1EWQA 4YJDA 3LXXA 4OHMA 3W9YA 1BWQA 4IFBA 4LXUA 5I8PA 1O4WA 4QXMA 4XFKA 2OBYA 1IIRA 2YJ5A 5EUQB 4YLEA 2LTAA 1KJNA 1CQXA 5EXTA 4A1FA 2NQ2C 5K0BA 4BWVA 2O2GA 7REQB 1ZC3A 3ENKA 3EOZA 4MJ3A 1BW9A 4DUZB 2GR9A 1U7DA 1G291 1ZH4A 4FEEA 4GC9A 4IFEA 3R7NA 4K26A 5AESA 1G8HA 3CCFA 1SZPA 3L7MA 4O59O 3BH0A 3WYAA 1JDNA 3MT8A 4Y98A 3BXHA 3UCXA 1PJAA 2AXNA 4Z0PA 2C3MA 2XWBF 1PFVA 4JELA 1WCXA 1ULZA 2JAWA 1MIOA 4V0QA 2G17A 1F6WA 2MDTA 5SZIA 5G1OA 2YY6A 2WUFA 3JATA 1AGYA 4HDRA 2OBLA 3L49A 4EYSA 2H08A 3FVQA 1PL0A 4RIEA 1ESEA 5L3QA 4A1OA 2PNFA 2LKCA 3E84A 3Q6NA 1EFRA 3TI9A 1TTHA 4BO4A 1ZUHA 5KNBH 1KYIA 1UEIA 4WBNF 10MHA 3DBRA 3KOXA 5K8JB 1PJ4A 5SYMA 1Q14A 1V37A 2GD6A 2VHCA 2HFJA 3TBHA 4M1KA 1XXLA 3DDZX 3CE9A 1FP2A 4OHWA 4UBLA 3RAFC 2FZKA 4J0QA 2JCVA 4PC6A 1GADO 2YVLA 3HXLA 3O9VA 4AJJA 4U7TB 1VMEA 2SKDA 1PYGA 3O75A 4GQAA 4HLUC 4HQOA 4U6QA 1ENPA 3CH4B 4XCXA 3TSZA 3HO8A 5B1EA 1TMGE 4QA9A 3MCVA 5CUQA 2B7CA 1GA4A 4NDAA 4RPKA 2DQSA 2GI4A 4HZUA 2RHBA 3JVIA 4DR2B 4XVRA 4EHAA 1CBUA 1R6TA 4G5OA 1J8DA 1UKVY 3BIXA 3T1QA 4ZDIA 4J90A 1OLSA 4IIEA 3I2GA 5AJWA 3HB5X 3IXMA 1SCUB 5E9WA 3SMVA 1T0IA 1ULUA 2IIVA 2RBGA 3MMZA 2Z9CA 3OZTA 3QVMA 2QU8A 1X0XA 2P5SA 5HA5A 5SICE 4COKA 3AETB 4ER5A 5A04A 5HQ3A 1T8SA 3ZUGA 4DV3B 2C7OA 2GKSA 1DO0A 1NW7A 1T1RA 3IAM1 3CEJA 3AFIA 3RV4A 4NKRA 2HSDA 3KPWA 2DLCX 1GY8A 2O8FA 1G3IA 1W85A 5FOQA 2AT1A 2I65A 4RMJA 3W1EA 3PHJA 4Q9KA 2QRVB 4YUZA 4MS1B 4B84A 4QEDA 1ZQ1A 3GEPA 2G63A 1Q0LA 1V11B 3DEAA 4UDXX 4KODA 3QG5A 4QHSA 2WZCA 1E59A 1Q12A 1A95A 3QYJA 4AMVA 2FHSA 3ZDCA 1IM8A 2R5FA 3DP9A 3OP1A 1FFDA 1ZBDA 4M7OA 4JLOA 5HJEA 2H4JA 2H31A 4GLLA 5DE3A 2BAGA 1N9GA 2VZEA 2AFIE 3F3MA 5D1NA 2QAJA 2VZ9A 2XGGA 4CE6A 4MRMB 1J23A 2JVJA 3G8DA 3C6KA 2OO7A 3GMSA 3B12A 3KEQA 3O94A 5E0KB 3DE3X 5ERGB 3U7RA 5BV8A 4BX2A 5DBIA 2Z5VA 2PMBA 3HBMA 4F86A 4RAOA 4J0FA 2XYHA 2DBVO 1TZMA 4O2RA 3EQ9A 3IP1A 5EZYA 2ES4A 4A8JA 4CF7A 4B7CA 4WECA 2WPNA 1HT0A 5KOYA 3UT0A 1N57A 1SM4A 4JJ8A 3PFGA 4M9CA 1A5ZA 3WWCA 3THXB 1F4LA 5IYZB 2A92A 1WZIA 1T6YA 5B1HA 3ROZA 3KQTA 5IH3A 4EEZA 5AVKA 1H4SA 1WETA 3HCNA 4J0EA 2GZ3A 4OI1A 1XCLA 3CEMA 4BHTA 3QLJA 4IHQA 1Q1BA 3OF3A 4C6HA 2OT3B 4PNHA 1CUBA 4U9UA 4BPBA 4NFSA 1FEZA 2GPNA 3L2OB 1VHTA 2HNAA 5DGDA 2W5UA 1D03A 1VKZA 2IDZA 1BN7A 3ENNA 1UOQA 1VI6A 4BBAA 1K97A 3QE3A 4RADA 2VR1A 3RGWS 3SM3A 1R74A 3BQ9A 1C30B 2O6HA 1ZY2A 2WIGA 2FWIA 4P4NA 1XEXA 4C0WA 5I7HA 5ABPA 1TPZA 2B69A 2R751 2BM0A 3DTTA 4HY3A 5I7VA 3VC3A 3L79A 1NIJA 2HIAA 5I9LA 2JIBA 1PSWA 4FCTA 4RH3A 1MB2A 1GKKA 3WIVA 3WR5A 3STYA 3T1VA 1GTSA 1MAVA 1V6CA 1X3SA 5KMGA 1Z07A 1FMJA 2PDAA 3IILA 4GC5A 5HTKA 2CHUA 3AEZA 3HE3A 1YACA 2X0RA 2PAFA 1Z4JA 1DLJA 1KI6A 3P9IA 5C0OE 4RENA 2J45A 5F1KA 3V8VA 3QM1A 3JS5A 1T6BY 3ZKWA 2AD1A 3IURA 3SJBA 3BCSA 4W9RA 4I5FA 4FS3A 4D0RA 3NBXX 2FMUA 4WHMA 1AA6A 1H2AS 1R00A 1WHSB 3LBYA 1E0DA 3AF3A 5IUJC 4OP3A 1NAIA 1TJ5A 1LCIA 1YE5A 2HXYA 2JRLA 3MWDA 3ZIUA 1VYVA 5EERA 1WP9A 4D44A 4PXAA 4CKWA 3QMWA 5HMLA 3UICA 3RS9A 5L40A 1XCMA 1DG9A 2VUTA 2XCQA 2QRPA 1XGKA 1LPMA 2B1QA 4J07A 4LVOA 2OFWA 4TL7A 5H5JA 5IP5A 3T15A 1SIBE 1SPBS 2VHJA 3T9AA 1G5RA 4G0YA 4QJ5A 5FORA 1GPMA 4F2PA 1PFGA 2ZSDA 4MWBA 4TM8A 3UMYA 3K4HA 3ESRA 5TS3A 1JZQA 2HJGA 4DJTA 5JDCA 3PJFA 4DSTA 3E5MA 3HN7A 3NNNA 1JQDA 1WS6A 1NJGA 2JFXA 3L9WA 1IN5A 4ZAYA 1VCHA 4GZLA 4F4JA 1R66A 3ZJUA 1GT6A 4HNGA 2IPXA 4LXXA 1M0TA 3PF9A 1OY1A 3HJUA 4BNIA 3K1AB 4G36A 4I50A 3OLQA 5K20A 3LLSA 1BHO1 1WZCA 4ZV9A 1US8B 3LSYA 3DKRA 4YNBA 3NKVA 3LS2A 5ED0A 2C5BA 4QXAA 4MTLA 5D84A 1USUA 5HOEA 1YRHA 1JF8A 1DTEA 1KWGA 1FFEA 5IASA 1QBKC 2PQMA 4WGFA 3R7WB 4E46A 5I9MA 3ZPXA 1YTLA 3FE2A 3NDJA 4XB2A 4M99A 3KEMA 2HA4A 2ODNA 4TVSA 4YAKA 1HTTA 1RWOA 3SBEA 2VJOA 3WDSA 2D13A 2W2KB 1ZEMA 2P62A 1NLMA 2X13A 1XOIA 3WZMA 3N5CA 3DV0A 1TGYA 3LTEA 4K05A 3DEJA 4F11A 5JAHA 2ZYIA 3FOBA 5KYWA 1E7RA 4Z7QB 2ZJBA 1JZSA 3T4PA 2VP3A 3W05A 1YWGO 1U4OA 2BLLA 3ETGA 4FBLA 2NTEA 4KRYA 5ALUA 5EWLA 1SU7A 3NHPA 3BVPA 4H17A 1ULTA 3NASA 1J7JA 2QLTA 5LOVA 1IN1A 4X54A 1Z4LA 2XRZA 2E37A 3VKVA 3VMMA 1K9SA 3PRKE 5IDQA 1BFKA 4A0SA 4EH1A 2RHMA 3CNBA 3VNBA 3F46A 5JC8A 1V16B 1JHVA 4EB0A 1G5QA 3VYSB 4K46A 2BGNA 1JFRA 4KVGA 4TYQA 3TRFA 4BGEA 3QI7A 4DHWA 3GELA 4NE7A 4HH0A 1SHUX 2H0AA 3MWEA 4M86A 1PI3A 3UOAB 1G7TA 2X5OA 2EZTA 3EJ6A 3QOFA 4GBJA 4CXMA 3CF2A 1KU0A 2AI2A 3GBSA 3KE8A 4D5EA 1FNCA 2GN8A 1R5BA 5KOIA 2P3QA 3VJKA 2OCBA 4L4SA 4DAOA 4NZYA 5TJ9A 4BMNA 3VOSA 2RGDA 3L4JA 2BMDA 1SWVA 3ISJA 5SZJA 1AXGA 4GX0A 2BBWA 4WJLA 1Q0HA 1QCDA 2GTPA 1A5BB 2H1IA 4B2YA 4DLNA 4ER6A 4EM6A 3SVLA 3MG9A 2R8XA 1LPPA 4QSMA 4HYTA 5CYFA 4Z7OB 2DKOA 1AM4D 2GEDA 5FJJA 4DANA 2C3PA 2OBXA 5IJXA 3NNSA 3JVVA 1BE0A 2BFDB 3WB9A 2W48A 3IDOA 4GR9A 3KZXA 4FYPA 3T5TA 4BJHB 4AF7A 4Z9XA 2FDRA 4XSHA 4QOJA 3U26A 2QROA 3N7AA 3V8QA 4R68A 4D3ZA 4ZHQA 3WQHA 1KOFA 4E1VA 2Q6IA 3SKYA 2TSYB 5CBPA 1UC4B 1YK0A 1CJUC 2ANBA 1QVZA 2ORVA 3SNKA 5AKHA 4PX2A 1FRQA 1CUSA 4X93A 5B6JA 2QTCA 4I1SA 2YJ4A 1F8UA 1FYVA 1DPGA 3FGNA 2Q4OA 3N2GB 5AJTA 3BD6A 3O2JA 1RYMA 2VTKA 3NBZC 2BEKA 3PDJA 4MPDA 4MLZA 3IIJA 3ZY5A 1SXJE 2QLFA 4DLKA 5HR5A 5JJBA 4EYOA 2AN9A 4DS3A 5EJ5A 1GSHA 3H2KA 4PQRA 1ORRA 2Q07A 1Z2OX 4PX3A 2R7MA 4ZOCA 2E89A 1B6GA 2K7ZA 1NMQA 4K6HA 3GD7A 3L0BA 4M8SA 4BNUA 1EQUA 2UZ4A 1T6ZA 1KRXA 4YJGB 2P4QA 1XXHA 3F5QA 3QMPA 4PZAA 2GZAA 3PKJA 3VU9B 4KQCA 2WSLA 2CLEB 5DV9A 3PPVA 1JA9A 4B4OA 4C7XA 1PK8A 4A8HA 3PDWA 3EQ6A 4JU9A 1OBVA 3C5CA 3CX6A 1VLQA 1B93A 2BR5A 2E85A 2FZCA 2QGFA 3KTAB 4IMPA 4A5SA 4O2BA 1EHCA 1M3SA 3D2LA 1TA0A 4JOCA 4FMCB 1E2KA 3VSAA 1IOLA 1KIMA 3TIFA 1F51E 2GJAA 1Q74A 1IHDA 2FPPB 2Z5GA 4LGYA 4W5NA 4CL0A 3EXFB 4F4IA 3QEMA 4I1RA 4IXMA 1PZMA 2P2ZA 4QGGA 1EFDN 5GIOE 2UUOA 4ZVPA 1M1YA 5M5BA 1FXWA 1ECLA 2ZJFA 1DAHA 3NAMA 3I6IA 5DXJA 3TZBA 4C5AA 2V1UA 4JXJA 4FHGA 1FSZA 2IZ5A 3TGWA 3VZCA 2DP4E 4Q12A 4BTVA 1Q1NA 5HUQA 3I9KA 3YASA 1N4AA 1RE1A 1Z0IA 2E48A 2AG5A 1HMPA 3FVRA 3IQHX 3PYLA 4IH1A 4L15A 5DHTA 3D6JA 1UBOS 3M1AA 4FE3A 2NZWA 1LK5A 1BE1A 3EIXA 1SQ5A 1JQLB 2OFXA 3HA7A 4WOPA 4BVJA 4KTVE 1OBHA 3I5UA 3ZI7A 1PGNA 4H1TA 2WLSA 4E6PA 3KT3A 1E64A 1K98A 2KJQA 4CV0A 1RQGA 5B36A 5JBIA 5F7JA 4BGIA 4LVNA 1P81A 2XAUA 3PT5A 4FSHA 1NZJA 2F4NA 4OREX 2GJKA 5EE1A 3FVWA 3RG2A 4BV3A 5LQAA 3OIDA 4JL5A 4AIIA 1RQXA 2QX9A 2H4ZA 3EF0A 4JJZA 4EG3A 4R1SA 4WOKA 3T1OA 4CF5A 3I72A 1M8JA 3PC4A 5TPZD 1DXOA 1KH1A 3IDFA 3LLVA 3E9DA 2VWHA 1R15A 4E21A 5FAKA 3EGDB 1K27A 3FNEA 5JSUA 1ORDA 1Z26A 2XGJA 2ZQ5A 3GMDA 1RZRD 4JNCA 4MVYA 1UT6A 3OJCA 2ZZMA 2OOKA 1MAHA 2GPJA 3U3DA 2FN9A 3W2TA 4YCLA 4NSNA 2Q99A 3CA8A 1KGDA 3QVLA 2YMPA 4LXGA 3PJDA 3OEHA 4HXGA 2HMYB 4JQSA 1SGWA 3FX2A 4C5CA 1JEYB 2G9RA 1KK1A 3T7TA 4DUGD 3RLFA 2GF2A 4XWAA 5FA6A 4MUGA 3UGKA 5A2QA 1VGVA 1FP4A 1CJTC 3Q5EA 1T1JA 1U0TA 1UANA 3UWMA 1JEOA 2FEOA 2XMSA 3H86A 1M83A 3IBCA 3KDAA 3RT1A 1MVLA 3U7GA 1Z18A 3AL3A 1H2RS 2DY1A 1Z8DA 1EM8A 1JBQA 2OA0A 4BFUA 4ENSA 4XIYA 5FWNA 4CCWA 1NNSA 2YBEA 1FY2A 3I01A 3MS2A 2WTUA 2WM2A 4MVJA 1GDDA 1MOZA 1CE8B 4G4IA 3W4IA 4XYEA 5AKJA 3VR5A 1KQFA 4Y1RB 1WXHA 3T35A 4EI7A 3HFSA 5LU9A 5CW1A 1U7OA 1A69A 1G8GA 4EECA 3JYOA 5MFZA 2ZXFA 4QLOA 1P0CA 1QH1A 1AGNA 2VT6A 3LPMA 4LI3X 4MITA 1QIIA 1HLPA 1P80A 2Q5HA 3KD2A 4ZA2A 2H3EA 5ADHA 1ZHOA 2H7YA 1FS6A 2IP1A 3DMNA 3O91A 1E61A 3FUTA 3QWFA 4WNYA 4G65A 1PO7A 3X1JA 4EPRA 2CVQA 1I13A 1E89A 1XJWA 3GJ6A 2FN7A 3H13A 3IPYA 3QOXA 3UWDA 3EEQA 4G0XA 2RGXA 3N58A 3F6YA 2GD1O 5CVDA 4BFWA 2YWHA 4A03A 2QVYX 2VPTA 5F1OA 3OIWA 4BP1A 1TLFA 4DYVA 3CE6A 5CLJA 1A2OA 5EZ6B 4K28A 2CF6A 2LDXA 3MA0A 2LDBA 4IIDA 2YWEA 5BXQC 5BWBA 1ABBA 1L5SA 3ZCVA 3OWHA 4CQNA 2X8JA 3GZNB 3R6TA 4FYKA 1NW4A 1CUDA 2HJ9A 2V8BA 2ZR9A 3S5JA 1IJKA 1WW2A 4GRAA 4RJIA 5E2AA 3I1IA 1H5QA 2FSPA 2GXAA 3IQGX 3V8PA 4MQUA 1SUFA 1BQ4A 2EDAA 2WKQA 3ZHUA 2AMFA 1R8SA 4KQGA 3HCPA 3LYAA 1OD6A 2DUUA 2PZJA 3Q3JB 4BP3A 2VYVA 2OKCA 3Q2IA 4F97A 4A0RA 3NOXA 1G0OA 3DMTA 3EXIA 3G8BA 3RB8A 3ORYA 1Z7YA 3UG6A 3AM1A 2O2SA 3O8DA 1N3IA 1QHXA 3WLPA 1FNMA 2ZYHA 3KKZA 3BMNA 1C1YA 1QDUA 3JAWB 1W76A 3PXEA 3EXHA 4UC0A 3DPSA 4ZVLA 3AEKB 4FSXA 3U60B 2ZRDA 1YJBA 4M8LA 3B48A 3SWWA 3OJ0A 4JNKA 4B76A 1P7PA 4C0LA 1M6EX 2RHOA 2BY4A 1KHHA 5HFAA 2ZCJA 1H85A 3O73A 4LBZA 4IF6A 5KTNA 4BZWA 5KVVA 1TTTA 5DSTA 4HWPA 5F7ZA 1Y8QB 4LJ8A 5LMCA 2Q4EA 1FZTA 4O4IF 1YVDA 5DDIP 5HP4A 3O03A 1A97A 3NS7A 3O4VA 4BX3A 4DCVA 4N6GA 3INTA 2QE6A 1S7CA 4HMPA 3TE6A 4DV6B 4EQZA 2ZRPA 4WESA 3S3TA 2X8AA 1AZTA 1WVIA 4NYIQ 2YDYA 3EG5A 3QXGA 4A5OA 3EDCA 1MB3A 2QD3A 4IUYA 1L3BA 5F4ZA 2LCQA 1YZQA 2I4OA 5C2JB 3UAXA 2RGGA 4URYR 4A6PA 2BJVA 3W5DA 3CF4A 1DMSA 5G53C 2QS9A 1HNWB 1PQWA 2ZB2A 3QIAA 2IUUA 1IAVA 2QMHA 4D0GA 3GEBA 1YIDA 4CM6A 3IQXA 4P6VF 2C94A 4YK7A 1G20E 4D9KA 1SXHA 2XB6A 1LBSA 2BPOA 2DZDA 3PD0A 1R8QA 4YRIA 5FHQA 4HQNA 1XKQA 4M60A 4H7PA 3K70D 3PC8C 3FYHA 4RA9B 2F8SA 1HO3A 4DR5B 4F4FA 4KK4A 1MO3A 1T2EA 2NNWB 3V4FA 7MHTA 2OD7A 3W8DA 1PGJA 4C76A 1TCAA 2E18A 3KYDB 4U3JB 1CP2A 4II3A 5F2EA 1N5JA 1TLTA 1OILA 1O6GA 4JKYA 4QBHA 3TVDA 4NCJA 4BNTA 3VPHA 3DQPA 1J5EB 1E2UA 1U99A 5HDQA 5FI1B 2GK4A 5AVTA 2O05A 1RWMA 3THOA 3DT6A 1TD1A 2HSGA 2PXCA 2VS1A 3GNLA 3HR8A 4RD2A 1KAGA 4J3FA 4YS6A 3DS8A 3TQQA 1O96B 2BP7B 4Q82A 2Y0BA 2HCFA 4L4YA 4BMXA 2P2NA 5CURA 2GPWA 4US0R 1IY8A 2J3MA 1X39A 1NWHA 3LBFA 3GN1A 3QGMA 1IG3A 4DYDA 3GRVA 3RNOA 2XGOA 1EFVA 3H8VA 4KMOA 3VOTA 4DMUB 3P5BA 4POOA 3KQLA 4AX4A 1IM2A 2OPHA 3LY8A 5ADUS 1ZA2A 2FE4A 3BMQA 1ADBA 1J7KA 1JNXX 1QMGA 1RABA 2DHCA 2GKOA 4HAIA 5ECWA 2C00A 4OHCA 2R6ZA 2WQ6A 4GKJB 3G0OA 5JISA 4QC2A 4RHXA 2J0SA 1TAGA 3ANLA 1N2CB 4KIGA 1KYQA 2P91A 2X1MA 4HXEB 2IT1A 3JTEA 4CKCB 5JFTA 4DTCA 3I9NA 1QFZA 1GTL1 2GRUA 4G4SP 2V7BA 3TUIC 1ZGCA 4L1KA 1N5KA 2DX7A 2RB4A 3ENWA 2PWAA 1RVDA 1QK3A 4JCOA 3ZGLA 1EXNA 2B99A 1PS0A 5H3LA 2GZ2A 5ALPA 4FS8A 2QPLA 3VKWA 2WBLC 4IQFA 4BEWA 2O2EA 2QTVB 2I8CA 4M0PA 2V9PA 5ALDA 4JK3A 1A1VA 2B9VA 2NT3A 4KQ1A 4Q18A 3SXPA 4ZD6A 3V7FA 3PYXA 1CZLA 2FX5A 2FSHA 1BMDA 2XUPA 3VNVA 1LDNA 2V5UA 4E09A 5F78A 1FXSA 4G0UA 1QZXA 3I0ZA 4INAA 4I9NA 4W5JA 4WZAB 4HNSA 1G4UR 3E81A 3C4JA 4MWCA 5DEIA 1ZD3A 3GP8A 3EPKA 1BHJA 1QFJA 2FSGA 4CHTA 5I3CA 1L4GA 2XUDA 1DGQA 3VC1A 4DRYA 1TVKB 3A6DA 3FDIA 4NK5A 5M7EA 3TF5A 3K71B 3VZBA 1XD2B 4TWJA 3EC1A 4ZCSA 3KX2A 4CF3A 1TMKA 4ZT3A 1XQXA 2WU4A 3EYAA 3QEBZ 3H7AA 2X2PA 4KIUA 1BRMA 3HP7A 5HRUA 3SDZA 2HHCA 4HDNB 1SC6A 3IIEA 3C5HA 1QORA 1GZUA 4QFCA 5EZYF 4Y67A 4MB0A 4D9FA 5MFPA 4LHXA 3AQIA 2MINA 1EJ2A 3TR5A 4QE3A 1QB8A 2CJWB 2ZBVA 5BP7A 1I9CA 2YHAA 3HEMA 4TXHA 3ZBTA 1F60A 1L7EA 1MTOA 1RRKA 1RS0A 1SFRA 3NT2A 1PR5A 2ID9A 4GXRA 4MSUA 4XR9A 2QD5A 5IZCC 1KEKA 1M1NB 4V2UA 1PX2A 1R4MB 3BTUA 4HB2A 4KH0A 4NZPA 4GVXA 3TEFA 3AFMA 4DREA 1TYDE 2BMJA 2YL2A 5CDFE 2R25B 4X62B 3BWYA 2PD3A 1PR1A 3L18A 5T4HA 4PC3A 1BHQ1 4ZI5A 1KO4A 2VPWA 4TS3A 3REQA 5JCOC 2KHZA 3FFWA 5KDOA 2IXBA 1NVBA 3DZ8A 4C7VA 3GXOA 3AUJB 3GB9A 1MNQA 2YOFA 2OBBA 1XMXA 5GPBA 4J1SA 2GNPA 3E4DA 5ALLA 2JGMA 1NBMD 3QELB 4OYYA 4RIIA 1PJ8A 3LCCA 3NTLA 2ECKA 4LY3A 1SXQA 1DBSA 1Z47A 1AHIA 5JY1A 3KYBA 3CTMA 3ZBQA 4EK9A 4J4TA 4BNDB 4M46A 2ODAA 4IJWA 2H00A 3PCTA 2WP0A 4DJDC 2OCAA 2NV0A 1GQYA 1SUSA 2FFQA 2DJIA 1JE0A 4HWKA 3WLOA 2D62A 1ODSA 1WHTB 4O6VA 4XARA 5B7PA 5IWCA 1TF7A 4DCUA 1DC6A 5FT9A 2WYIA 4I14A 1Y1QA 4PSDA 2BMAA 1NAHA 4BLVA 3DFIA 5A4JA 2QZSA 5CPBA 4AZ0A 1ZUNA 4HLQB 4NK4A 4ZVMA 2XBMA 2VK4A 3GVHA 1GQRA 2QN3A 3SHOA 3GQBB 1P19A 1QYCA 4BPRA 1A5AB 2B3TA 2EFGA 2GH1A 2PRSA 5T41A 3QEAZ 3Q8MA 3U7QA 3SVTA 4B3JA 3I8OA 2WWIA 3O0TA 4P80A 2R8PA 2X7JA 4G5YA 4RHEA 3UB4A 1VZ3A 4CL3A 3OD1A 2WFMA 3EMBA 1Z0JA 4PHHA 4LHZA 2WG1A 2ZYWX 4BKPA 5AW6A 1EBUA 2O1WA 1NVKA 4JOBA 3ET5A 3P94A 4DG8A 5FF9A 2XEXA 4M21A 2OP0A 1A9YA 2X76A 3TCXB 3NDPA 3NC4A 1Z5NA 5LB2A 2ZUWA 1U3TA 3PFNA 2GSWA 1XQ1A 1UJBA 2AN4A 2PV7A 4M0LA 1TUBA 3CO0S 5AW7A 4UQPA 2WM8A 2YASA 2YIVX 2FP4B 5K3SA 4WWHA 5IVKA 4TUYB 4WA7A 5AKXA 1QP4A 3LHSA 3NTQA 4RD3A 1M1UA 2ACVA 2R8YA 4K6GA 3IO5A 5CNJA 3RSZA 3IE0A 4CM7A 1ELOA 2WTMA 3LLMA 1W5TA 3PZBA 4E5YA 4I8DA 1HDZA 2AD5A 2PZLA 2FKAA 3TVYA 4H6PA 3UWPA 3M33A 5KSYA 4W8OA 4Q7QA 5TPZA 1LI5A 3ZTTA 3QUAA 4BNJA 1D04A 1RM0A 2YHBA 1GZSA 2ZETA 3PRJA 4I50F 5CX4A 3SKXA 2QLLA 5AVYA 3FUWA 2QE7D 1HQYE 2Z8ZA 4ND4A 2Z4RA 1RZRA 5L8VA 4RIFA 1B15A 3F3KA 1KYZA 5GV8A 2AUTA 4I99A 3HFRA 3GAFA 1GA6A 1OXBB 1I33A 4FC6A 5DTQA 2P75A 5E4JA 4UTNA 3EEYA 3PEUA 3B3FA 1TJ3A 2W11A 2NZ2A 2W6JD 3KVOA 3LQ4A 3NNDA 3VO8A 4AP5A 2Q7XA 4HUTA 1IPEA 4QGFA 5C1DA 3HJHA 4CIVA 2F48A 4JBLA 4ZGBA 2O5RA 1B1AA 4RXUA 4IBOA 2PX4A 1ZAYA 4WCDA 3K5IA 2F43B 3LH5A 1W94A 3WGUA 1MJNA 4WKGA 3C8ZA 3SYMA 1PN3A 3ETCA 3IA2A 4W9NA 5G4KB 1D3AA 2H5JA 3JU3A 3QWHA 4GBMA 2IXAA 2VK2A 3HRKA 2W4MA 4XYLA 5LOVF 4EUEA 3KLMX 1C7EA 3N7TA 1E62A 2I6TA 4C6TA 5K05A 2JASA 4GUDA 5CHEA 3L77A 2C5LA 2HD4A 2FPOA 4H3SA 4FBGA 3V2IA 3WGOA 4A7PA 2J85A 1C8BA 3A6JA 3WK6A 1GUDA 4K2AA 1ZSNA 1NJ1A 1EGHA 4HCJA 4LW8A 3UC5A 4HAVA 5GZ6A 4BMYA 3DLHA 1CYEA 4RZXA 1I7LA 2YH2A 1VECA 2ZP1A 3M83A 4YYEA 3ZCSA 1CEYA 2BFNA 3IELA 4OH1A 2AJTA 3A1DA 4HQFA 4GKVA 3RR2A 2GCOB 3NOQA 3QMVA 4GYYA 5L4SA 3F1LA 2YINC 1J0BA 3A9TA 2M98A 4J8PA 2WC1A 3NVMB 2Q6LA 2I3AA 3BWDD 3CJTA 3VR4H 1HQCA 5CYPA 2FW7A 3R3YA 4UNRA 1G8AA 3P9RA 4UNNA 2CHGA 5DT2A 4JLBA 3G8YA 4FW9A 5DLDA 1Y7TA 4NULA 5I8ZA 1A3CA 1CF9A 1EEXB 1SMKA 4JR1A 2O1EA 3LZDA 4WK4B 3TBKA 2XKKA 4X3CA 4QRIA 1FFBA 5HQTA 2DHDA 4KQJA 1E0JA 1MQ8B 1QS0B 2NYAA 5ALHA 5KYXA 4FGKA 5DIFA 3B6ZA 2X3FA 1BO6A 2YDXA 1Z15A 4XUGB 4B0OA 2VSFA 1FNSA 2PRYA 1T2DA 2XMZA 4PYRA 1OB2A 4YH1A 1MC4A 2QK4A 4O0MA 2KBFA 1L5GB 4ZTUB 1UMDA 1BVYF 4GMDA 4BFCA 5DM1A 2DR3A 1Z4QA 3I4CA 2NYRA 4ZHQF 4LRQA 4J91A 4O4LB 3CTPA 3N8DA 4AMYA 3HCAA 4EG8A 1E60A 1L4BA 2AG6A 2K87A 4HVLA 4YWHA 2JPDA 2P2DA 3CLTD 1SA0B 3HP1A 2BFCB 4F84A 4QQFA 2GZHA 4IRXA 3BG5A 4K8OA 1P1HA 1Q20A 3VH1A 1DXQA 4PN7A 2ZIFA 4EPTA 1OZFA 1I5EA 3EVBA 1G8FA 4IL5A 2VEOA 4MMYB 3I64A 3L0PA 3TM4A 4FB4A 2BGUA 4RW0A 3H16A 3AJAA 3IEVA 3STVA 1T43A 1MO5A 1P7VA 3E9MA 4CF4A 3R9XB 2DH5A 1SEPA 3GUVA 2WICA 1VFNA 2ASVA 3K9WA 3LA8A 3E1SA 5BQ5A 4OBBA 4UTVA 4YJFB 3FPAA 3VOBA 4AG5A 2FTKE 1Y8AA 3RYHB 2R84A 5J59A 1I51A 3PWKA 4BLSA 2I55A 5CDHA 4NYJQ 1FLVA 3O4HA 4BYMA 5CXUA 3BSFA 4GDFA 1K8RA 4CEHA 3UFXA 4RSHA 3MINA 1VPWA 3P7MA 5TVKA 3SU8A 3U44B 2AR7A 3D5QA 1UUFA 2AOTB 1MVOA 1EP3B 1EUDB 1G3MA 2A5JA 2PT9A 4ME6A 4IVPA 4R6XA 2I54A 5EEGA 2ZANA 3EBLA 3FPCA 4MMZB 1TLLA 2XLCA 1ZG3A 5EKXA 2WWGA 3FHJA 2I7CA 3QPUA 3V3KA 4BLRA 2QTZA 2PUFA 1JQBA 1GYQA 1YQTA 3KJXA 4EW6A 3IEMA 2PG3A 1I4WA 4YAFA 1NQOA 1VL5A 4BO9A 4JDPA 2Y0EA 5I7WA 5C53B 1XN4A 5CIWA 2D2EA 1TT5B 1XTZA 3NHWA 5DSXA 1FXWF 4MVJI 4ALJA 4INOA 3FRJA 2PUEA 3TTWA 4REOA 1HZZC 3ZDFA 2SHKA 1W36B 2ORED 4RLQA 2VUUA 5EP2A 2C61A 4KG7A 3RG8A 5HRCA 1XTKA 3GZTB 1NC1A 4I55B 3BB1A 4GDMA 3PX7A 2PGAA 2BISA 3GRPA 3LCJA 2DRIA 2EOAA 3NO4A 4QYSA 1VSQA 1TZ2A 5C52B 2HRRA 1L7MA 5BMVA 2OLEA 4N3NA 4NFYA 2Z3WA 2A9OA 1Z0KA 1NLFA 1PVVA 2CXOA 4HDKA 2JI9A 1UJ5A 2FZEA 5M2QA 4XR4A 4R3NA 5F12A 2OR3A 4ZYZA 1JG3A 2E1PA 2VAMA 2VA8A 4ZALA 4BN0A 2O8CB 1BDHA 4YRRA 4ESOA 1JILA 1P77A 4OUDA 4Z7NB 3MLBA 4GP9A 4KMSA 2D1TA 1QIMA 3MQ4A 2CKDA 5KSPA 3RODA 3AXTA 3FDXA 3GRRA 3B9RA 1A88A 4WZBA 5BYKA 1G5IA 4HQKA 2O8DB 1N2ZA 1DQPA 3GUUA 4E14A 2VP4A 5F5NA 3SE7A 1WKVA 2VUIB 3TX2A 1U2PA 3S4YA 4F4HA 4CCSA 1FUUA 4MUMA 4X6UA 3QBEA 1OXKB 1W9HA 4TL6A 1L4HA 3F6SA 2PXAA 1QPBA 3R6DA 4OKIA 5AW8A 9ATCA 5EHZA 3AERA 1E2GA 4Q3AA 1Q19A 2C7GA 3JXEA 5FKJA 1RP7A 3TS1A 1ZIOA 3KFVA 3OM1A 1HQKA 4YAJA 3B3JA 1EFKA 4ROSA 4XDHA 2AQHA 4IINA 1UDWA 4B83A 4WBNB 1DRUA 3LP6A 1PR9A 5T5QA 4IO1A 4WX2B 4Y2YA 2Q1WA 3C6BA 3TXXA 3ZQ6A 5HX7A 3IP7A 4NCIA 4QVIA 5BOSA 2IUTA 3RRNA 2E49A 1TW3A 1K3UB 2PAAA 4JGIA 5A6SA 3AJDA 3C3AA 3V2GA 1ML4A 1RSZA 1OGIA 2JLYA 5G40A 2ONJA 4D3FA 2A35A 1M6VB 1JEJA 4NJMB 4XX1A 1SUEA 3AHIA 2Q5FA 2WD9A 2PZKA 3U6BA 2ZRIA 4PGAA 4MVJF 2FF7A 2DERA 3HM2A 3GNSA 4BNGA 5FBKA 3IQZA 1Z3CA 4X66B 4M6WB 1WCIA 2FRDC 4BB0A 3HYTA 4JODA 5C3UA 5FFFA 4CMAA 1MG5A 5JS8A 5GZ3A 3AO0B 2CHEA 3B6IA 5DTEA 3VKUA 3UJHA 4BOYA 1P6QA 1NW3A 1U2EA 1R27A 3BT7A 1Z2AA 1XKTA 2NG1A 4MROA 4XGIA 4XM1A 5SY6A 4CEIA 3R3JA 1P4HA 1WPRA 3BX1A 1Y8RB 4BN5A 1ZR4A 4HGNA 5EIWA 1LRKA 5KOHA 4G8DA 1J2JA 2BTEA 1IQPA 2Q45A 3BXFA 1NX9A 4R9RA 3A6PC 2Z2XA 4Q4JB 5AHWA 1PCXA 5CT6A 1BS9A 3N6RA 1Y6GA 1GG5A 5FQOA 4UD6A 3Q5GA 5C8XA 1TD9A 3LWDA 1U1IA 4IG9A 5EHQA 2HU5A 2ZDHA 1TKAA 4IDDA 4IS3A 2ECQA 1WKCA 2ZVDA 1JFTA 1J39A 1SZCA 2XNKA 2Z8XA 2D00A 1MX1A 2AMJA 3NBUA 3PDUA 4B7AA 1O94C 4TLEA 2HBZA 3H9QA 2BTQB 3PD1A 1A71A 3SSNA 5JXJA 1JKIA 5JAUA 3F6BX 3FLBA 4MJXA 4LJ6A 3W78A 4MUIA 4BVGA 4ETMA 1JVSA 2B8NA 2KYRA 5LZ2A 2Z6QA 3FNQA 3RU9A 4XD7D 3U1TA 4ZPJA 4HT3B 1NM5A 1XRQA 1LXCA 5ILOA 1R0BA 4CV1A 5KNBA 2WU1A 3TTVA 3KAKA 4WNCA 1WQ1R 3W4JA 3P2MA 3AT1A 4OJYA 5LYJA 4KPFC 1FPMA 1X7YB 4P3YA 4UFNA 5JJKA 4FFRA 1KZYC 3TB6A 2NQTA 3WI7A 5JNSA 5FWYB 1PLKA 1WL8A 2EFJA 3THWA 4XFJA 5AVSA 4CV2A 4ZYVA 1JTEA 2ZROA 4KOEC 4AMUA 3U4MA 1P5RA 4HX5A 4B3TB 1RI4A 1C9YA 2NV2B 4WOBA 3R7SA 1W4LA 3UHFA 5IDXA 1RYZA 2WSYB 3AUXA 4MUJA 3ROTA 3BMCB 2FWAA 4JENA 5I7SA 2OHHA 3ICQB 4TN5A 3DCYA 1A8SA 1JEQA 2AS0A 3QPDA 1E9BA 4PPQA 3NJRA 3WRXA 3ILXA 4ZCTA 5DTMA 3OHSX 1XAIA 1OJLA 1GWNA 1XZEA 2JAHA 2WSIA 3SXUB 5U9CA 1E0KA 4QPPA 2RGRA 3DP7A 2YV2A 3F1KA 2J4DA 3RF6A 1OC4A 3I0MA 3GFBA 4PIVA 4YALA 2H2HA 5C8YF 2VF7A 2WB4A 3EC2A 3C24A 4FHEA 5B1DA 4YT2A 2PKRA 3NG1A 1GP2A 3DH0A 3JWPA 5D6NA 5KKNB 1NJ2A 3ZV4A 5I6DA 4HD8A 3T5MA 1D8AA 5HYVA 4GP7A 3ILYA 4YP0A 4CKEB 1ZWLA 4CQLA 5SV2A 4IIYA 2P35A 5F77A 3CN7A 4P31A 2YZMA 4ZEMA 4HADA 5J4LA 4PQFA 3EAGA 3HJGA 4RSGA 3K05A 4BLTA 4BX8A 2ZYSA 3ZLTA 3P9NA 4DHEA 5HBGA 1F8FA 3A1VA 5SYAA 5F9FA 1ZK4A 1X42A 4J1NA 1T9ZA 2FZ5A 3L92A 4S12A 3S2ZA 4GM0A 5CW2A 2ZSBA 5BSFA 4J2TA 3I9V6 4XGRA 4FVTA 1YZKA 4Z4IA 1Q1QA 4HQ0A 4AJOA 4FGSA 4Z4GA 2VBFA 2Z08A 1ZVKA 1KJ8A 1R64A 3NWEA 1OREA 2GBGA 5F21A 3OIVA 5KYTA 2ZT7A 5EMNA 5BNFA 5LR6A 4EY6A 1XZJA 4K86A 1CDEA 3RYCA 2E4YA 2EKQA 4YMSA 4ZYLA 3AI7A 1L7NA 3NVAA 3GH1A 5FUWA 2EFEB 3ZDZB 4BKOA 4NABA 3D1JA 1LLQA 5FOTA 2R9VA 1RRMA 3I39X 2XHEA 4U7PB 4KQWA 5LUBA 3T7EA 1JALA 2NADA 4C2TA 2ALJA 1I3OA 1QPGA 1ZK0A 1P2DA 2X0JA 1UZUA 2JFWA 2XCOA 4DLLA 2HADA 4RTQA 1QLWA 1RDFA 2OOSA 2XQIA 4YMLA 4TMTA 5D5HA 3Q5DA 4TS4A 2AVNA 5UKDA 4MUEA 3RF7A 3FKSD 3LT2A 4GYKA 1NOIA 4ZAWA 2Y05A 4TKVA 2ZB7A 3PTZA 2WINI 1M0WA 4AO6A 2FPIB 3B6JA 1WP4A 4PY2A 5JHHB 1AB5A 5TXGA 5CDUA 1M9NA 2ZBGA 1U63A 3TL2A 2N47A 2XB4A 1LDYA 1MPTA 3WDKA 4BFYA 3MPUA 2F1IA 4JKOA 2C97A 1GQ2A 5CTJA 3W5BA 2TECE 5BV0A 1W46A 1FMLA 2JGAA 3DV9A 3VU1A 3WL5A 2E5FA 1UDCA 2HHJA 4RS4A 3ZHCA 2EEZA 3IYLW 4EGQA 2P27A 3BM5A 5DNUA 4PHGA 2ZE8A 4WKBA 2F55A 3T7RA 1E5QA 4OFBA 2FVYA 4COOA 1QSGA 2IVZA 3KM0A 2X86A 4P2BA 4V02A 4C4RA 1L7OA 4K1XA 3V55A 2Q2WA 2CYCA 3QLVA 2LCFA 1R5JA 4HEJA 2J3HA 3HPRA 5BYBA 5KNCH 2FWJA 2RHLA 5AVRA 3G89A 3WA6A 2CWWA 1UXOA 4JHLA 1WDMA 1S2IA 3D3KA 3PPIA 4JGBA 4UM5A 2QAGB 4UBKA 2M6LA 3D7RA 3LPDA 1OTHA 3ZLBA 1ORVA 2CXRA 5CLIA 4P4LA 2OV6A 1O08A 4KQKA 2QUBA 3B1KA 4DT1B 4MA4A 1BGWA 4NBLA 4YMGA 3HR4A 1YCFA 4R1PA 3FGZA 1JVBA 4HNRA 2LXNA 2QMZA 1QAQA 2C96A 3DAOA 5LNK6 4P83A 4O2AA 3PPYA 5INTA 1B74A 3PNOA 3A3YA 1WXEA 4BB5A 3PB3A 4LRYA 2MMCA 2BFEB 1NYRA 3C87A 1F20A 3MLEA 5ALTA 4OHKA 4U2BA 3HUUA 5JAPA 4E5NA 1JMVA 3OCUA 3Q41A 3C5WP 4W8GA 5LUAA 2HA5A 2OLKA 4B7UA 2PTHA 1WA5A 1T4GA 3N6VA 3DOFA 3R3SA 2G0AA 4H31A 1RAFA 1UOOA 2J67A 3OOEA 4N54A 4W6QA 4W63A 3L0YA 4X8LA 4CIBA 1LFDB 1LQ2A 1W0KD 4YRNA 1CNFA 3PS9A 4QTXA 2F17A 2Q2OA 3BXEA 2VZ8A 1ZVMA 4JC4A 1LLDA 3WGGA 2GPTA 3KBOA 4JB0A 5JO9A 1KH3A 2HSZA 3HSKA 3OA0A 4DV7B 4DC1A 3LQ2A 3W04A 1N2EA 2W2LD 1P2BA 4O8ZA 3HWX1 2ZLBA 1FNBA 3M9WA 3MXTA 5D8DA 4GSLA 1RACA 1L4YA 2NO1A 3LTNC 1XVUA 3MUOA 2Y1FA 3WYBA 2NPFA 2HZ7A 4M0EA 3HPQA 4IIJF 4PSKA 1FQJA 1N75A 3IKTA 4F5WA 3U49A 4Y0AA 1IN4A 1T8WA 3LOUA 1Y1LA 2G77B 2NZYA 2H1WA 4LRXA 4QNNA 3TTSA 5DNCA 2OO5A 4CL8A 1NVUQ 4G3XA 2JGKA 2JD0A 4TTIA 5HCUA 4BIMA 1PT5A 4TRJA 3G9ZA 1IWPB 1CZOA 3HR7A 5F3RA 4D45A 4Q66C 5CDTA 5JCZA 5F35A 1A9RA 4C4SA 2PZFA 1U04A 2WJZB 2LD4A 4JC8A 2VHWA 3R4CA 4RVUA 5LC1A 1UZMA 5CNKA 1PF7E 3ZN2A 3PRHA 4K9SA 1IC6A 4KXLA 4NG5A 5AM4A 5ICSA 2EYUA 3DR3A 1VGRA 4HLCA 4UASA 1O97C 1P73A 5JSZA 2J9GA 4OHBA 1E7SA 1W75A 2OYCA 3UENA 2Y1EA 4NVRA 2ZWMA 3JQ7A 3ZKAA 2V97A 3IMFA 2P3SA 4XAQA 1XRRA 5CDGA 4HAXA 3RIGA 2ZSEA 4UMDA 2ONCA 4I1IA 4UE2A 4YJHA 5LWHA 4WN9A 2JFFA 2QMQA 3DM9B 1YR2A 2B20A 3BEOA 3RDPA 3QV1A 1PW5A 4NJEA 2DLDA 2EDCA 4QUIA 1NMXA 1ODCA 2B8TA 4QL3A 5TDHA 2JJ2A 3F3YA 4YAIA 6Q21A 3O9ZA 2SKEA 2IYZA 1TA9A 2Q46A 2FSVA 5FV7A 3EGWA 3QVJA 1NSYA 2PUVA 4BNHA 3OZIA 4EW3A 4CLOA 1WLSA 1QYRA 5CDSA 1DRKA 3FCSB 3NTRA 1X8JA 1FVFA 4G09A 3ZE2B 5TQ0A 2DETA 1JUDA 5JJIA 3MTBA 4N03A 2QYHA 3N39C 2QEQA 5DNVA 2CXHA 3OF2A 4ARVA 4Z4HA 1S8FA 2VXBA 3BD8A 2IZ7A 1Q44A 5ES4B 1DINA 2W71A 4BBZA 3WA7A 2HMSA 1H5NA 1XTTA 5TQVA 1L1QA 1U0EA 4FR0A 4R31A 1XAGA 1QDLB 2CNNA 1FBTA 1IWOA 1QBGA 3SSAA 2ZIXA 4C7OB 4MW9A 2W6MA 3L40A 4TSKA 1KGSA 1U65A 1LZLA 1Y98A 5GJCA 5K0ZA 5L6LB 3L4KA 4UJ3A 1R0LA 2A0WA 2HU7A 4YVFA 3NOOA 4CLEA 5FPKA 1JLKA 3U09A 1NNI1 3GJYA 4XTRA 5FP0A 4B5LA 1ZNXA 1CQIA 4RESA 2WEKA 1GEEA 5E0OA 1K7SN 1U6KA 3AF5A 3D3NA 5ENDA 3JSXA 2H5LA 2V7TA 5IJWA 3C39A 1TRHA 3F90A 2XE4A 4UHFA 4BVEA 1K2WA 4G07A 5HK8A 2QV7A 2PWYA 2F9MA 5CB6A 1P5HA 1EWVA 3B2EA 5TEWA 2OC4A 1RWQA 3T4UA 5EIEA 3JR7A 3JWJA 4AS2A 4MV9A 1CS4C 3B5JA 5DW3A 1NN0A 3AR3A 3QFFA 3KLPX 2P0YA 3PC6A 3PFKA 2XD4A 4YV2A 3SOPA 3O1IC 1ZUIA 1V96A 1WWKA 5DWDA 3T34A 1HV8A 3VPXA 4BQPA 4CNQA 3K6SB 1WNFA 3P4UA 3UAVA 4EMTA 2O0LA 3RSHA 5EMJA 4C43A 4UBIA 4J0JA 3I32A 2QTBA 3PHBE 5D00A 3RUFA 1EVEA 5DK6A 1ZZEA 3QVXA 1E94E 3ITDA 1DT3A 2VXCA 2ZRAA 4FGLA 4I3GA 4E70A 4PAMA 2VDWA 5LZ4A 1II9A 1DHTA 1OBOA 3FJYA 4HNAB 2XQFA 4RK5A 4Q01A 5BOVA 5TPWB 4UU8A 5JQGA 2D2VA 1K2VN 1XMPA 3AR6A 1UT8A 1G6KA 1UKBA 3NHUA 4F6RA 2VLIA 3HYCA 1I6KA 5LVAA 1OWLA 1E5VA 4EHFA 3GH3A 2DWOA 4MS3B 2R7LA 3OQIB 3QRWA 4CIDA 4BKUA 3FZYA 1JA0A 1DP4A 3F6CA 5L4NA 2I1VB 5MN4A 3LO8A 1NTOA 4ICIA 4DSAA 1U28C 2PQ2A 4DVGA 1W49A 2WMYA 3CSUA 4G25A 4XD7A 4AY2A 4G97A 3FCXA 4GMFA 4MWSA 1DTSA 2JCSA 4J9UE 4TS1A 3W7VA 1ID1A 3HKDA 1O0CA 1KPHA 2F3SA 3ER6A 2NXEA 4GOMD 1A9PA 2DUJA 4KQIA 1RNLA 4L08A 1EHYA 3P9ZA 1XCGB 2H8KA 3TZEA 2I67A 3UT5B 2CE7A 2WJ4A 4X97A 1G9SA 3DKKA 5ARCA 1ZU5A 4QBFA 1VOTA 1YR3A 5EKTA 5T6BA 4TYNA 1QIEA 1HRDA 3IOEA 4QULA 5KAMA 3NGLA 2HSWA 2ZUVA 2UZ1A 1FDTA 2B83A 2V6JA 2VKQA 3ONFA 3OKAA 5KYUA 2R65A 2VJMA 1U4SA 3HCBA 2ZRKA 4ZJZA 4QUDA 1Y5LA 2Z0MA 1XYVA 2G80A 3RVOA 3CWCA 5I3ZA 3M6MD 2A0FA 4Q16A 4JHXA 4Z54A 4IS2A 3ETEA 1JHQA 5K2MA 4CT0A 5L95A 1GZ7A 2WWWA 3IVCA 2BT4A 3FNBA 3QQ5A 1E1LA 2RGBA 2GBLC 5FUQA 1A9XB 2C04A 3OFVA 3VDNB 4L0MA 5BVGA 3ZCQA 4LE0A 3REFA 2UYHA 5ALFA 3L8CA 1R6AA 3H1AA 2HA7A 1SC1A 1KPIA 2FOXA 3OA2A 4IIXA 4MW0A 1A9XA 3AESB 1GXSB 2DF8A 5K8UA 4PV7A 3A58B 1BFDA 3MGAA 3ZZ0A 4ARSA 1EMDA 4FE4A 3ZX4A 4AJ4A 2IYWA 4Y0VA 2ADFA 4JI2B 5JDCC 1M2OB 4TTJA 2P11A 2I7XA 4RK4A 4EYQA 1IM5A 1QP0A 4DWJA 3E58A 2O5CA 3UNXA 3P9XA 2ZVQX 3SBDA 4P3OA 2I22A 4D8VA 4WLEA 5SZHB 4HS4A 1MEEA 1EWTA 5KYKA 2J5XA 2H9AA 4B6RA 2MSEB 1V1RA 3BEDA 4ZI2A 1BU8A 3SP1A 1WF3A 3MMSA 1B7GO 1QRAA 4YV0A 3L6EA 4D80A 2IYYA 5DHUA 2IWHA 2PA0A 3GGPA 3UJ3X 4YCSA 5BMVF 3GJ5A 3UMFA 3N1UA 3R09A 3FTEA 4NE2A 5D2CA 1G38A 2F4VB 3P0EA 5BSWA 1QC5B 3IIMA 4DR3B 4RM3A 1GZ3A 4II7A 4MP6A 4ZQFA 4TRRA 2YW2A 5IEJA 5AKEA 3PFHA 2Y99A 1SUPA 2YVUA 1X77A 2H7CA 4CCYA 3D3WB 4TQGA 1VFPA 2B36A 2DU8A 2BI7A 5FBHA 2WF5A 4R5HA 2W2VA 1HEIA 4K9KA 4KX3A 4L9WA 1II0A 4UJ5A 3Q87B 3M5DA 3Q7EA 4HWRA 3FOEC 3FOFC 2GSDA 5HCNA 2ZUTA 1ZSVA 1SIOA 3IP6A 4Q4AA 1ZM7A 3UPDA 1B42A 4CUKA 1P8JA 4DNPA 1PSZA 3D7LA 4GSYA 2ZRQA 3M3DA 3LUPA 3ZDXB 1OI3A 5TNXA 3HN2A 3RJ9A 3JQRA 1HEYA 4CM9A 2J0QA 3CW9A 1EDBA 2HLPA 2QOEA 2XNHA 2XQJA 3QKTA 4LMAA 2YXLA 5D6OA 5L3QB 1XRLA 4JP8A 2PUDA 1Q95A 3WGLA 1GG2A 4QPNA 1OFUX 4G63A 2NAPA 5EIHA 1Z2DA 4G26A 5CFNA 4N3BA 4R1NA 5G4LA 3DM5A 5LQJA 1Z9BA 4G6ZA 3BA6A 3EZNA 3X43A 4RV9A 1CFJA 3TOZA 3WWOA 2PJRA 5AI0A 1CS0A 1CUYA 1RFLA 2B94A 3PXBA 1UBEA 1NRXA 1OVGA 4I7EA 3G5TA 3DOJA 1ORWA 2IYPA 2W98A 4IDQA 2H4HA 1TU3A 3FR8A 4UM8B 4HAYA 1MO4A 5IZ4A 2V0GA 2YN2A 2X7XA 1G9TA 3I3SR 4EYKA 5IS2A 1P75A 3VM6A 2ECFA 3CUSA 2DFDA 1MW8X 3NBAA 3PNPA 4J49A 5EIFA 2E0IA 2QUZA 4F3RA 2V9ZA 2PH3A 4YUYA 5AOCA 3JVEA 2PSJA 1SBYA 4LF6B 1OLSB 4N8DA 1TM4E 1Y3DE 1ZM9A 1K7CA 2JRCA 3R5FA 5FOWA 3WGNA 5HQ3B 1RXSA 2WJ6A 3QE4A 4NR0A 1MXFA 5K0FA 3A9SA 4O4HA 2YNMD 2A9KA 2BVNA 5IAEA 4BEBA 2JLXA 1GNTA 5DOVA 2WAXA 3K4PA 3LF2A 2NU8A 3TJZA 1D2EA 1ZK1A 3MTEA 4MKHA 1OYOA 3G5LA 1GJRA 1P9LA 1MC5A 2R8EA 2XVYA 3W9BA 2CVOA 3L5OA 1RJFA 4PBSA 2WT4A 5AJZA 1X1CA 3S5UA 3SR3A 4HYEA 4DIMA 1LX6A 3FYCA 4UOEA 3B6EA 3B20A 2W8BA 1RZVA 3ZK7A 1N2IA 3ASYA 4FXOA 1LK7A 4MKZA 4KKVA 4O5OA 3WKDA 3KUXA 3L6UA 5CJPA 4XYMA 2RHCA 1B14A 2HDWA 2QI9F 3DYVA 5M3BA 1L8QA 2GVNA 2ZJ0A 3AEXA 7YASA 1W0KA 2G25A 2JH9A 4D81A 1E0AA 3AF2A 4D8TA 3IDAA 4TV8A 5A0FA 1UJ4A 1X0VA 2EIXA 3ICCA 4KP7A 3C3DA 3E6AA 4NHEA 4Q3LA 4BQNA 4HB3A 1SVMA 4BNKA 1S9DA 2VJNA 4RVGA 4EFNA 1NGSA 2AUMA 2B4KA 3IHKA 4PZCA 2WHPB 1HE3A 4XUEA 2Y3IA 3EVDA 5C1OA 4YRGA 3OO0A 3MJEA 2JFNA 1KERA 1B4DA 4MWTA 2P9ZA 3IBTA 2AZDA 4ARZB 3DBOB 3GJXC 3DZJA 1HTWA 3OZWA 5LYJF 1MW9X 1KE1A 2RONA 2OK8A 4JC5A 5BT8A 2NMVA 3M4XA 1MH9A 1FJGB 2CE2X 1YZHA 2FOIA 1NJ6A 1W9MA 3TAHA 3H18A 3ZI4A 4OX9B 2VTBA 4FYMA 1YA8A 3D1VA 4F2WA 2NO0A 3U5ZB 2IZ0A 3BCHA 3MTQA 1T8TA 1UWLA 4YRPA 2QBYB 1H0KA 2GNOA 3PUHA 4ZZ1A 3WK4A 3ZYCA 1SNYA 3PL5A 3DKPA 2DGDA 3CUKA 4I36A 4X1KB 3O8BA 2NGRA 5EZ5A 3W5IA 1BE8A 3X3HA 5AJYA 1JXMA 3PXXA 3GLFA 3MWYW 4I8XA 5T3YA 3EIOA 3FKJA 1G98A 1H6BA 2ZW9A 3EPLA 2AC2A 3JD0A 2RHHA 4D8XA 3RJMA 3I3OA 2CNWD 3FWPA 2IS4A 4NENB 1S9HA 1K6JA 4F93B 2WG0A 2B1JA 2I7DA 3OQ1A 4B1FA 2VXOA 1G2PA 1DTWB 1N2CE 2AOWA 3C8MA 3R0ZA 4HOYA 3RVNA 2BMFA 2I29A 4OSEA 3ICWA 3SYTA 3UMCA 1HDOA 4MIOA 3PTAA 4YMHA 3AEUB 1ODTC 1OI7A 4ZIRB 1O8BA 2PX6A 3MJ4A 4ZAGA 3W90A 2NSLA 3UPTA 4JV5B 1MA3A 5TR9A 1VIVA 1I2CA 3BRWA 3CR3C 3NWPA 2V7GA 2Y1CA 2B7LA 5AWFC 3BQMB 2ONKA 1SKUA 2HSJA 3MWDB 1PKXA 1ZX1A 3KSDO 3ORHA 3OIFA 1SVNA 2GBIA 4JQZA 1ZNZA 4OHOA 4DWOA 3HU1A 3C5EA 3U3XA 3N0XA 4PXSA 4E1AA 3FPKA 1SOVA 3PGLA 4WZAE 4ESHA 3QG1A 1KJQA 3M3HA 4N76A 3EPHA 2CBZA 2ZAOA 3R5XA 3FKQA 3CHYA 4YRAA 3NBYC 2FDCA 4R01A 2Q3BA 3RTCA 2Q1TA 2YHSA 1I36A 2HLDD 3ZGVA 1TM7E 5D1HA 5MHTA 3MAGA 3AJ9A 4QFMA 3I6QA 4K3UA 4XYBA 4EVSA 2DFVA 5C5CA 1LVUA 3DVLA 3HWRA 2X6TA 1P33A 3L6CA 4AVYA 4HPWA 1RWXA 2HHLA 2M2IA 2Q7DA 1FSSA 4OU4A 3UH1A 1EVLA 4UEWA 1X8XA 1XTQA 1CUHA 1VJTA 4F4CA 3TLGA 4EF4A 1XQVA 1EJBA 3MNFA 4XE5A 3UBTA 1R8YA 2HLNA 2ZJ2A 3FYTA 3O9MA 4TLAA 3ZWMA 2EGGA 2QM3A 4WSOA 1WULS 2F1RA 1SG9A 4EJ0A 3KOYA 1PWZA 4MV0A 4HXYA 1AY0A 2VHTA 4GI5A 1TU4A 1JLLA 1MT0A 4HPJB 4F72A 3QTTA 1ID8A 1VBFA 1V3TA 5HSGA 2JGDA 5FR1A 1XLVA 2WYVA 1SU8A 4UTZA 3M0EA 5HXAA 3IJRA 2BF7A 3ULKA 3C70A 1O6BA 3OZUA 3M2PA 1W48A 4IOJA 5I4IA 1MX5A 2COKA 3QWBA 4IDOA 4A2PA 1HXHA 3V1TC 2QSUA 3T94A 4LF8B 1JSRA 2QXTA 5J3JA 4N47A 2H1HA 1Z5GA 3A3OA 4IWYA 2ZIUB 1GFSA 3OZFA 1V3QE 3D6TB 4S1WA 5LOVB 1JFSA 1D6SA 4FB5A 1CIJA 3R8XA 1OC2A 4G1CA 1GZ4A 5EJMA 4KUEA 3G79A 4TVKA 2GVZC 5HJ7A 1A8UA 1EPUA 4QFDA 4DLTA 5JY6A 5CXQA 1AK2A 4BFXA 2OD9A 5DM4A 2CNKA 3CG0A 3GRCA 4A27A 1HYHA 4S0ZA 4HNTA 1U5AA 2HQBA 3BULA 5GJWC 2KBEA 2P0EA 4MI6A 4OGGA 1DEKA 4NDNE 1YL7A 2I2XB 4G0NA 1Q0TA 1L4KA 2CJXA 3JD3A 4TYWA 3W8RA 2JL1A 2KMLA 1RPAA 3L8HA 5L9AA 2VNIA 4CUJA 1QZZA 1SQ0A 1STOA 1F5SA 2Y2VA 4DBLC 1XIVA 3T5CA 4QO8A 3X44A 1MC8A 3TSYA 1UBRS 4RA6B 3RVLA 3LA6A 1VJDA 2HNBA 2OBMA 4O2AF 2IPMA 1XR3A 3GLHE 3ABIA 5K99A 5TGZA 4GS5A 4BL5A 3D2AA 2F59A 3IXQA 4NATA 4EEXA 5JFOA 1Y48E 3V6MA 3I9OA 1GAXA 2ZE7A 3C1TA 1SXIA 3EQ7A 1M6NA 3AKZA 5JALA 2DHRA 3H5WA 3FTNA 1XPJA 2I3DA 5KCZA 1NMEA 1RXEA 4RK7A 5TMEA 2FZLA 3DB2A 4S1NA 2IFTA 4BNLA 4LMPA 3AV3A 1ZH8A 3U40A 3HY3A 4ZCIA 1YL6A 1APBA 2BYTA 2DT5A 2PMFA 3COPA 4F96A 3WX0A 4YRQA 2GPBA 3TSWA 2XB2A 3EEFA 1YRYE 3DE5X 3E9ZA 2J6HA 3KPUA 1X9GA 3V4LA 1F0KA 3FNIA 5KYNA 4NNJA 2LVBA 2Z58A 2ZTSA 5ALYA 4B4VA 4HX9A 3DUWA 3T5AA 3HO6A 4D2IA 1LTQA 2H4WA 2YC4C 2ODBA 2ZJAA 1ZIYA 1RQPA 2RGCA 3W0LB 1QIJA 5U1PA 4W5TA 3OT1B 1CP3A 2N1BA 4BATA 4JXXA 4FX2A 3K32A 4H27A 1OLXA 2W2XA 3FM9A 1FFSA 2I1LA 1WD7A 2WV9A 3IC5A 3TAXA 5HW0A 1Z2EA 3NYIA 2O5EA 3DOOA 3PL1A 3LNCA 3KTFA 1HNNA 3EQZA 1DCMA 4JYPA 2C5EA 4EMUA 3H4VA 3HHEA 1HDGO 1RWPA 3V3TA 1KYYA 4JCCA 3RVPA 3PC7A 3QNUA 2GBPA 4UOQA 1KORA 5FD8A 5AW9A 3ANTA 1HLGA 1X1BA 2FU5C 5GONB 3V4PB 3G88A 2G07A 3A6ZA 2C8JA 4OJKA 1R6BX 2CV0A 3SX0A 4U2DA 2QJWA 1XXHB 3E22A 1XZKA 3F67A 1PNQA 1Z34A 4P7FA 1E2FA 2BFMA 1P29A 2GVDC 1THZA 3K96A 1ODIA 3VZQA 4B3IA 2HQRA 3IR5A 5AW2A 4KPUA 2IX3A 4J0KA 3R9WA 2FW6A 3IAAA 3KJEA 3T41A 4BO2A 2YIMA 5KDDA 1Y4DE 3RSLA 3H11A 4KN9S 2J08A 1SC4A 1TT7A 5E7QA 3VR4A 3LZCA 5IW8A 5C35A 4DJ5X 1KMMA 2Q9AA 3FPEA 5C8DA 1RWBA 2G9ZA 3C43A 1JR2A 1OXVA 1TQ6A 4LRWA 1VM6A 2MSCB 3ZXIA 4YT5A 3PDIA 1PT7A 3MCUA 2ONZA