2A1IA

Crystal structure of the central domain of human ercc1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
129
structure length
129
Chain Sequence
NSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA excision repair protein ERCC-1
publication title Crystal structure and DNA binding functions of ERCC1, a subunit of the DNA structure-specific endonuclease XPF-ERCC1.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03834 Rad10 Binding domain of DNA repair protein Ercc1 (rad10/Swi10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a1iA01
1J22A 2A1IA 2M9MA 2JPDA 2ZIVB 2ZIWB 2ZIUB 1J23A 1J24A 4BXOB 2ZIXA 4BXOA 2JNWA 2BGWA 4P0QB 4P0PB 1J25A 4M6WB 4M6WA 2BHNA
chains in the Genus database with same CATH superfamily
5FOWA 4R8VA 2HN9A 1QVZA 4MUNA 1ZA1A 4D9JA 1R5BA 3WLSA 3ER9A 2XMBA 4R83A 1TUGA 3MB5A 2DCUA 1T5IA 1PN3A 2XCOA 1BQ4A 4YRRA 1BRMA 2WD9A 4P7FA 2PS9A 4QTTB 1R0XA 2OPHA 2GCOA 2Y6VA 4YCDA 3WNCA 4CKCA 1CUGA 1J6UA 3JQGA 5AVQA 4XDGA 4QQ8A 1P4SA 4QU5A 3ST7A 1LNSA 1YASA 2F43A 2VJNA 2XDYA 4B31A 1PV4A 3RUAA 3BFPA 2JFFA 5FBVB 1OWNA 4R5MA 2FFBA 5IMBA 5AD1A 2ZJ3A 1U90A 2WABA 3H42B 4AUKA 3ENNA 3EOAI 3DL7A 5GZ3A 2GRAA 4HBGA 1CUDA 1O95D 4NWIA 4NYMQ 4KIFA 1Z2EA 4OL9A 2IS6A 1V48A 2L18A 4QOFA 3UIEA 4B46A 3H19A 5DSXA 4A5OA 2BCJQ 3LDGA 3Q11A 2C7GA 2BFEA 3TZ6A 4CLRA 1ZITA 2YXDA 1IXSB 3FSJX 5JJIA 1X13A 3C1UA 4J4BA 4FNMA 1ULAA 3VZCA 2GZMA 2W8ZA 4CMKA 1GYPA 1NOKA 3FIUA 3OZWA 5H7XA 5IH3A 1YACA 1NJ2A 1RHQA 3CF6R 5KJ1A 3HWSA 1ZL0A 3IT0A 5FBZA 4WK2B 2WIGA 3DNMA 3DVQX 3PR3A 2QTAA 5TVGA 2PK3A 1PNRA 1CIVA 3ZHZA 4ZT2A 5HZHA 1EVQA 3G0OA 2HREA 4ZV4A 3R3SA 5FA6A 3L1VA 2J1LA 4CLHA 3E2IA 3S7ZA 4IKPA 4J91A 1FFXA 4ISCA 3ESAA 4P5EA 3TS1A 4BV2A 4EZBA 5CPBA 3WTBA 4BAUA 4MS3B 5G1OA 3S0JA 1ISFA 1DXHA 3TCKA 4Q02A 2KM1A 1NVVR 4I8DA 4PFJA 3EG5A 5H4GA 5KSPA 1VPVA 1KOJA 3VX4A 5I9LA 3U5TA 2NN3C 5JJLA 4J0IA 1XTTA 2PSJA 3KP1A 3BZWA 4ZVSA 3SC6A 2PEYA 3K32A 4EYQA 2ZXUA 3WGVA 3VZSA 2IF0A 2IXAA 1Y81A 3UZUA 2QUBA 4YY3B 1OPRA 3EVZA 3W9YA 2PWAA 3SIXA 3EUAA 1H9CA 5T7BA 5I4BA 3ZZUA 2GH1A 3ET4A 4XWKA 4FKBA 1EXVA 3DO5A 3BAFA 4HDMB 1V1MA 3GP8A 3ESDA 1RRVA 1NRIA 4YHBA 2N1MA 5HM6A 2GJKA 3B7PA 2QM0A 1D7AA 2HA3A 1CUIA 4BVHA 4DWVA 5BV7A 1CY2A 1DQRA 2OYRA 3UF0A 3K1ZA 4DIUA 5IFKA 1NQWA 4XD2A 2WWYA 1U8ZA 2PJUA 3H97A 2PD6A 4J1TC 1P5FA 2J85A 3DO6A 4JA2A 4WGGA 5DEIA 4TLEA 2HIMA 1KH1A 16PKA 4IMPA 1ZRNA 2W48A 3FBWA 1JTVA 2W2XA 1WXGA 1OLOA 4X91A 1WOMA 3F7MA 3ZHBA 1IHDA 3HSSA 4MS4B 4G0OA 1JXMA 3GEMA 1KTIA 1K4KA 5E1DA 5BVHB 5CA1A 1XZ8A 5F2OA 1HNWB 1TO1E 2NUAB 2NUTA 4ENPA 2GOYA 1XU9A 2IHKA 3D1VA 3HBAA 4FOSA 3BMQA 3TM5A 2OV3A 2QN9A 1O97D 3I3SR 4ZYYA 3ZVKA 1UKYA 1DADA 4AZ3B 3G0CA 5MDHA 4I66A 4PLGA 4UVDA 3JWPA 3T7SA 2EWMA 2JI7A 3DE7X 3NOQA 1FNDA 2DUUA 3MTQA 1KPIA 2BTQB 2RFLA 3S1LA 4PZDA 2K6GA 3JVUA 1XCOA 2YRFA 3L6OO 1D4FA 1ADGA 3OTQA 2NVWA 3CNBA 1CZLA 1K6XA 4O2AB 3KOOA 4CT5A 2IU0A 2GBPA 5F1KA 5EZYF 2ZRCA 4RM3A 3RUFA 3GJSA 4WJZA 2VP5A 3A4LA 2H7VA 3E23A 5DHFA 4TN1A 3GRYA 3NBYC 1L7OA 4B3BA 1TYBE 2NV6A 5LFAA 2ONJA 4FT4A 1W36C 2ZYVX 5KKNB 3RSQA 3N8KA 1U8EA 3E1KA 2V7TA 4P5PA 3SLGA 4CR8A 2CCGA 1U2QA 1LTHR 3TJZA 1TIBA 1RCUA 1XL1A 2HSEA 2R7AA 4HAWA 2DP4E 1RBMA 5GOZA 1ZH0A 3H2HA 5KIAA 4LJ4A 4QM6A 4X90A 1TKAA 4M9SA 1T6YA 4RJTA 4ALLA 5IM4A 4OIFA 1YR3A 1CTQA 4CPDA 3ICWA 4HZUB 4E3WA 3EPHA 4DLSA 2BR5A 3H1FA 4B87A 3PFIA 4F1WA 1BEEA 3COZA 5JYDA 1KJNA 3O90A 2YQ5A 5JRDS 1GNTA 2DPHA 4Q7KA 2DFTA 3YASA 4PTYA 4Z6KA 2G1PA 3I9FA 4C4YA 1BE1A 4R16A 4HQFA 3A9CA 5K0LA 1BX1A 2OG1A 3PF9A 5LJLA 3QGMA 3B51X 3T1HB 5D51S 1MOZA 3HR8A 4G0NA 4M86A 1MD9A 3UQZA 4DBLE 5CLJA 1NNUA 1Z29A 4ZK2A 4BQEA 1JPUA 4F06A 1IHPA 3KDAA 4P54A 3P9NA 2M6KA 3CQ9A 2PNFA 4Q37A 3S2FA 1SU7A 4WCFC 4BU1A 1Y9ZA 1IM2A 4YV1A 2HA2A 2C07A 2JLSA 4G8JA 4G23A 1YWGO 4M1MA 3OLQA 4Z7OB 3IEMA 4FFPA 1W36D 2HU7A 4O2BB 4RQUA 5CPFA 4DNOA 4GI1A 3K0SA 4LY6A 1MO6A 1KXZA 3IUJA 1DAKA 3DM9B 5CRIA 3JAWB 3RKSA 3PSHA 4KR3A 4QARA 5DK6A 3SJZA 1PJ3A 4JC5A 2VJOA 4DLLA 2EOAA 2JLBA 4BIIA 3ZH2A 2H0AA 3VH2A 4TZTA 3DW3X 1MORA 4CM6A 3EVGA 4ITRC 1AY0A 3LPDA 5JC1A 3AF4A 1UJ2A 3NGMA 4MWZA 1R9MA 4MNTA 4RF4A 5A05A 4CIAA 4KMRA 3IEUA 5DGTA 3BG5A 4FZ3A 1KTVA 2DTEA 3HVUA 5BW8A 4KKXB 4IZHA 2ZIWB 1X8XA 3AWIA 1KJQA 1G7SA 4KWEA 2OGZA 2FN4A 3E82A 3JRXA 4PTLA 3OZEA 3QBEA 1XN1A 1OKKA 3WL6A 4JP1A 5BNFA 1XMXA 3P7MA 3B2NA 3ZV6A 5KYXB 4MS3A 1HL3A 1C0IA 4RY9A 4ZO4A 2HT1A 3C24A 3DJFA 1ZWKA 2E18A 1VLJA 4D4JA 5B6JA 5KU1A 4R3UC 4JUFA 4YV7A 5I7UA 4XUDA 1TT5B 2H4FA 3ZI7A 1HMPA 1S8FA 2VDKB 5CLIA 1NVTA 2P11A 2FV8A 4AXBA 4YPVA 4TN5A 3A26A 4GM1A 3N7UA 4N7JA 4EB3A 4CL2A 2EGGA 5EIBD 2Y2VA 2YJZA 1AGNA 4XARA 1GTVA 1DRWA 2AYYA 4IMJB 4Z53A 4AW9A 3QF7A 2H57A 2P4SA 1G6Q1 1GP2A 1QGYA 2DPYA 1QG0A 3CTPA 3KZOA 3MTJA 4YJKA 3T9DA 3VAZA 1I10A 1DVRA 5FV4A 4HDMA 4IDQA 2ZRHA 2ZUBA 2I80A 1IVSA 3F8WA 2AQKA 1OXKB 2QTCA 5HJ2A 2VP0A 3HBMA 3ND7A 1UL1X 2D8MA 1KORA 3AUSA 3PNVA 4KQWA 4Q48A 1KKUA 3E3LA 4EZEA 1LLQA 3HB9A 3L7AA 1ZOSA 3HLKA 4OHZA 1JFRA 3A6GA 1P7WA 1Q0LA 2FQ1A 4I3GA 2NYRA 1FNMA 1CJCA 1Y7IA 4TVBA 4D92A 3U1TA 3QLUA 2RKBA 2I7TA 3N2NA 4BC0A 3DF9A 4DIBA 5K6RA 3Q88A 1E1RD 1JA9A 3P9SA 4G5XA 2PYIA 3CXRA 1CNEA 1SC4A 2C4KA 3NBFA 2J6BA 1J8QA 3DEYX 1T34A 3K2EA 4FHDA 1PS9A 4IGEA 4MS4A 3U9TA 5BVHA 3D7RA 3BF8A 4ZQEA 3L04A 5DBIA 2NUAA 2J0QA 4UBOA 5BV8A 5CA0F 2LP4Y 2CNKA 3QWFA 4UZEA 3CJQA 3QVMA 3WLLA 2IITA 4YRKA 1OFUX 5DWDA 3NTVA 4AZ3A 4ZAVA 1ZUD1 2FFAA 4H7JA 3D2LA 1OXSC 2VOEA 3VH1A 4WXHA 5FL7D 2A84A 2BTQA 4NYJQ 2NSLA 2IKSA 3TSZA 1XTIA 2PH7A 5DHQA 3SC3A 1E6UA 4LWOA 1YSCA 5KQMA 4RF3A 4O2AA 4OKIA 3HUUA 3U48A 3STWA 3V4VB 2JBHA 4LBZA 3O2NA 4M22A 4B80A 4HX9A 2AS0A 4IJMA 4C04A 1X8LA 3E03A 4OI4A 4TTIA 4EPTA 1ESCA 4H2DA 4TWRA 4QLBA 4UPEA 5EMLA 5LBTA 2PAFA 3PA8A 4N5NA 3GBPA 3WHPA 1FXWA 2EDCA 1GDDA 4GXTA 5TT0A 2G6TA 4ALIA 1Z4IA 1GO2A 1A71A 3DMRA 1O0SA 4URUR 4CQMB 2HK7A 2CHUA 1N0UA 1GPWB 3KE9A 1NQOA 2GZ2A 5CVVA 5JROA 4DV4B 1SKMA 4EARA 3VJRA 1J56A 4NEGA 2ZS9A 4PC3A 3SEZA 4B6JA 2NZXA 1IY2A 4OHBA 3W7AA 1BDMA 3LKVA 3V8VA 3T9EA 1VRVA 4NMLA 3OZFA 4ER6A 3KKMA 1NNEA 4Z4IA 3T1NA 4ME6A 3KKPA 4LRUA 1MB9A 5AI6A 2VK1A 4A91A 4YMTA 1VJTA 2O4UX 5HUQA 1L7DA 2QW8A 1O94A 1GN9A 2UYOA 4HZUA 2C5BA 1O54A 3DZ8A 2VWHA 4Q9IA 5D7BA 5BW6B 5J2UB 3RD5A 4UTXA 3L0IB 5TEVA 4LJSA 1NPDA 1O03A 2PKEA 3OP1A 2BGTA 4ENQA 1IOWA 1JSXA 2QJFA 4RVNA 2XZLA 3UO8B 1K89A 4IDHA 1EFAA 2B4AA 4L4XA 1AKRA 3H6HA 4AIIA 2DYKA 3GZJA 1ZCAA 5DOVA 3LRXA 2WAMA 5BSTA 6LDHA 2MMCA 3RROA 4KXVA 4L73A 1JL3A 1Z7WA 2WY2D 3CZPA 1K7EB 3DEJA 4KWTA 5L7YA 3ROZA 4BO8A 3M6IA 1B41A 2JGEA 3GJTA 4LF7B 4E32A 2Y1WA 1MPTA 3P32A 3R5XA 2CDAA 2PSHA 2QQ0A 1W5BA 4A9AA 4ARUA 4MLDA 4LFCB 3P0RA 4ON9A 3E5RA 5GVSA 2ZR9A 5CD1A 4LBVA 4PZEA 4I0WB 4O2BA 3I9JA 3BC1A 1Z7BA 2BJVA 5FJJA 2YOHA 4CLOB 2ODPA 4H1UA 3JAWA 1VBMA 2IPMA 3RIHA 5KTYA 2YKGA 1XA4A 1FVOA 3CX6A 1JG7A 1TGYA 1Z2PX 4KRFA 1OLUB 4JA0A 3OIDA 6CHYA 1LA2A 1QG4A 1P7ZA 1TEVA 5FUQA 2GPTA 4ZVKA 1CNMA 3WSWA 4JXKA 4OATA 4AP9A 3IBFA 4NMXB 2O2CA 5AVSA 2JK0A 3Q7QA 3FETA 4J9VA 4UHJA 5A71A 2Z2KA 3UMMA 1TO6A 2IOYA 1NUHA 3FDJA 3GN2A 4AIRA 4JYPA 3ADBA 2PE5A 1XRMA 4IIYA 1Z2AA 3TR0A 3R3VA 1UM9B 4JBLA 4TOIA 1ODTC 4JJ6A 1FUEA 5KYXA 2R60A 5FLYA 4C7JA 1YRYE 1VSQA 3FFTA 3LP8A 3GLFB 1T0BA 2GBIA 2WHRA 3RARA 5ES4B 4N39A 2NMVA 1P3JA 3D1LA 1NC3A 2D62A 1TTHA 3LYHA 6ABPA 1TT5A 3C3WA 1W0JA 3ABSB 4JL6A 5TS2A 5ALYA 3K6SB 1ZICA 3WKAA 5CDYA 2ZZNA 3WNZA 1RU3A 4DADA 1LDGA 1S01A 1NA5A 3OJOA 3U09A 1I3LA 2WWHA 4HCJA 5EHXA 1SRRA 2CLKB 2QP4A 2QX4A 5DM4A 5DXFA 2W0SA 2HA4A 4P53A 2R97A 5AWFC 4MQUA 1MW8X 4OJQA 1D2HA 4B6EA 3MCUA 3TYXA 1STOA 1FK8A 4TYPA 1RM3A 2X86A 3KC2A 2Y1DA 3VNRA 1XZEA 3GAFA 3DE6X 5FLEX 4BZXA 3MAJA 2FZLA 5ESDA 2B8TA 1WW8A 3ED1A 4NLLA 4UUQA 4YRFA 3PC4A 4BECA 2JFXA 2VUUA 4LSGA 5T8KA 2ZK7A 4R2XA 1EP9A 2FQYA 3LUGA 3ORYA 1IM5A 4RD4A 1KP9A 3FPFA 5EKSA 1AKEA 4W4TA 3VYVA 1NIPA 4J4TA 1MCZA 1MFZA 1B0PA 3TI9A 2DVMA 1TQ4A 2VHQA 3HYRA 4JHXA 3FVVA 4B3SB 3GDHA 3ZDCA 1XALA 4DCJA 4HAYA 3H99A 4I3HA 4IOMA 4QGBA 1KFJB 1DAIA 3K6JA 3B1VA 3N8IA 1U11A 3T5GA 3VU8A 1D07A 2CXHA 4ROTA 4E1BA 1E1LA 3MCVA 3OWXA 4MAMA 4GRIA 3ZJ5A 1R0SA 2X5KO 2JAPA 3DQPA 3RRBA 4D98A 5FPYA 3JAMA 3L7YA 2QQFA 4RDHA 5EMNA 4MQLA 1D0SA 1ECLA 5AO9A 2MSEB 3JRNA 2IW1A 1CYEA 1LC3A 3MT0A 4J2OA 4MV9A 4D3YA 4OFBA 2GYUA 4GFDA 4JVNA 4X1OA 5C31A 1MA0A 3ILHA 3JD1A 4BLVA 1OD6A 3HEBA 2ID4A 5CW1A 5G4KB 2CLFB 4K9PA 4GC9A 4R2MA 1FVFA 4Q19A 4G8CA 4UAJA 2BHRA 3AVWA 1ETUA 1E3WB 3BJIC 4PG4A 1GM5A 2FE1A 2GUGA 3ESZA 3T3GA 3IO5A 4JOBA 4ZYVA 3UENA 2YX1A 2WTNA 1SUCA 4KRGA 3W2EA 4B8YA 4ROSA 2BWJA 4PVCA 1N2OA 2A6PA 2BFCB 3CZQA 4Q9JA 3UPUA 3FHJA 4KE7A 2JJMA 3Q7SA 1NVUQ 4AMBA 4D8YA 5B4VA 4HB2A 1B0AA 1D4OA 1X3LA 1E9FA 3GBSA 2RGYA 3TXAA 4CQMA 2ZUTA 2AN4A 4NIMA 5ELXA 3MJCA 5LDGA 5KPJA 1WHSB 4OHKA 4DDVA 2QT9A 3FAKA 2C2KA 1D9ZA 4AZWA 2CHGA 4QELA 4NXMB 2VBCA 4Z9XA 5LL6P 4OXRA 4RJLA 3AY3A 2SKDA 4ZPJA 3DE0X 4YH1A 3UWSA 1EHCA 1YONA 4MQEB 2DRIA 2A9KA 5BN4B 1VG8A 4I5EA 4Y18A 3DSRA 4ZAYA 4HQRA 1LQTA 5B37A 1FJGB 3DZDA 2RHJA 4DPMA 3O8DA 2XNDA 4KJZA 1N5DA 5J2UA 1N2ZA 4H0CA 4LXXA 3JARB 3V7NA 2H0RA 2ICAA 1GCAA 1L0BA 2XA9A 3JV7A 4UE2A 3AF3A 2VHXA 1U3TA 2IIBA 1XR3A 2Q29A 3LZCA 1NKSA 3C6QA 1DC8A 3KR0A 4L72A 5EJGA 1WF3A 3IP8A 3Q6IA 4H4EA 4ARCA 2JL1A 3TSWA 2FU5C 2JJ1D 1E63A 1SKYE 2YWJA 3T9CA 1SXIA 1S0UA 3KDPA 3M4XA 1F0PA 1GZ5A 4HY3A 4I6JA 5KKAA 1G59A 4LWZA 4AQ7A 1S3GA 3RU2A 1PHPA 4W9MC 3PE3A 1P7CA 3FPSA 1DJPA 4RNDB 4DWJA 5CDGA 1ISPA 1JPNA 1ZOIA 1ZOOA 4A0HA 4ZHSA 3HI6A 4MWCA 3ZE6A 3GJ8A 1UPXA 4OXIA 1R9NA 1WUHS 2JHFA 4IQ0A 5CT8A 1IHUA 1Z8DA 4RGBA 3RRYA 5KJFA 3SQWA 1P5HA 2JASA 2WM2A 4DTCA 1N57A 4JXXA 2VRBA 4Z0HO 1A2BA 2R7MA 4H59A 1Z6AA 2CZQA 2GM5A 3G2OA 3SHQA 1NJ8A 4CLOA 4ZVNA 1M10A 1NJ5A 4EB6B 3UGQA 1ZM4A 3NIBA 4R6XA 3E0QA 4AMZA 1ONOA 2V96A 3MRXA 1LB1B 1VECA 4IUDS 1OLUA 2D1TA 5T4FA 2NSHA 13PKA 3IBYA 4J3NA 3ABZA 4DLNA 2IF2A 4LMRA 2V3CC 1PFYA 2B82A 4HN2A 3TMAA 3WWOA 1E2HA 3F47A 4TMVA 2P91A 2RIRA 2Z3ZA 1L4BA 4UHHA 4WT7A 5HBRA 3VYUB 4B76A 2I78A 4YCLA 4OX9B 2DB3A 2IYPA 4C20A 1GNVA 2W6ZA 1CJMA 1G20B 5FOTA 4URZR 5E1MA 3V1UA 4EY6A 2D7DA 2BHLA 3DYIA 1UM9A 4ICIA 1I1HA 2QUHA 4ISBA 5AVXA 1U94A 2QROA 4EUHA 3CPHA 2Y71A 4TTSA 3FNGA 4N5IX 3ZX5A 1GTRA 1PFWA 2ZSUA 4C5CA 3GLFA 1PV2A 2QE6A 2D1SA 3DM5A 3GUVA 1HUQA 3M4NA 3PKIA 2OFFA 3K6SA 4FS8A 1PZHA 4UTRA 3UK1A 1E69A 5IM4F 1TMKA 2FPGB 3TCNA 2MOKA 2ANBA 2C9MA 1X94A 4MX8A 2ZYWX 3AHCA 3BZUA 4WY2A 3A4YA 2W7TA 1UXGA 2L42A 1GFZA 1BVRA 3GEIA 1NL3A 1E5DA 3UMVA 3CZRA 3VR5H 1M72A 1A9ZA 2Y67A 4NJOA 3AI3A 4TMXA 2ZE5A 4I50F 3K1JA 2PPVA 4FFBB 5LUAA 2I22A 3TTUA 2PSDA 2C4HA 1FTSA 1XPUA 2EZTA 2B5OA 4OJMX 4CV1A 1DLIA 2YRXA 1K98A 4ZC8A 1KFEB 5FBRB 2YDYA 5EYPB 4NBVA 2IDZA 3JQ8B 1XRSB 3ME5A 4WLEA 4EG6A 2ZANA 5IKEA 2F1KA 4ZQFA 4I6EA 3U3DA 3FNHA 2D2VA 3AKYA 2ZWVA 3DVSX 4A82A 4B6SA 3WIVA 2VTEA 2ZXEA 4S04A 2ZSHA 1V35A 1Z73A 5U4XA 3RIYA 3NVKI 2XZPA 4R2KA 1GL3A 1JHAA 3UMJA 3LCCA 4UDXX 2BDTA 2WV9A 4TM7A 5F77A 4ARVA 1SZCA 3GJZA 3W6OA 3RK1A 4E03A 4TYNA 4DLBA 1Z5UA 1A88A 4QJ4A 2YOGA 3V97A 3WWPA 2NZ2A 1J24A 1KR5A 2VQFB 1HRDA 3I9V1 1C1XB 1QCYA 3RSGA 4I4LA 4B6PA 2Q4RA 3KT8A 2FKNA 3NTLA 4GG1A 5ES3A 2PUFA 4FOOA 5BQOA 3JQDA 4GMGA 2Q5QA 3QLEA 2BPOA 2NO6A 2RKOA 2H1IA 4CQLB 4CIXA 1CUAA 3O8OB 4WFQA 1EM8B 1C3EA 3GX1A 3PV0A 4XYBA 4JUDX 5B7NA 1E7QA 1CJSA 2ARKA 2BGLA 5G4KA 3IEXA 3N8DA 1NW5A 3L6RA 4RVCA 2GAFA 2BBTA 1GUBA 1AK2A 2YHBA 2XXBA 2C8KA 1MIOB 1Z0FA 4HB4A 3PDIB 4IUYA 4YP5A 1L1QA 3K9FC 1E3WA 2E55A 4DG8A 2C5SA 2CLMB 3V5NA 3K5WA 5A4KA 2MR5A 2QRUA 3K0BA 2D3WA 3I8XA 1XD8A 3WBFA 1KVQA 2WWWA 1ELOA 2BFCA 2JEOA 4GPD1 2ORWA 5CJPA 3LJKA 4AURA 4B2YA 1XD2B 2JDIA 2QN1A 1D4ZA 2QLLA 3EPRA 2P5SA 5CLFA 4RZUA 3BFXA 4G9BA 4D9BA 4PHHA 4MARA 2Y2UA 1E6KA 3EVCA 1OI3A 1Y9JA 2GXSA 1CUBA 3SHFA 1BXKA 1T2UA 1WHSA 1C41A 1USUA 1W581 2Q4BA 4OBEA 3HDQA 1SQGA 2I7DA 4NCAA 3FTPA 1GTMA 4KN5A 4KPGA 5AXAA 3DFUA 3C41J 3FCEA 1AURA 1D1QA 3AFHA 3DB1A 3ETHA 3K5IA 4MYCA 1ISGA 4PO1A 1KGSA 4MQEA 4UATA 3VR4H 3B85A 5AFSA 4FD3A 5BN4A 2Q2NA 1TVMA 3AP1A 3LHFA 4FGSA 4JBHA 2BLLA 3E9EA 2Q8NA 1P9WA 3BHNA 3CZMA 1C2TA 3OZVA 2EG9A 1C7JA 4GOLD 5DLEA 5CLGA 3EH1A 1PD0A 5DP2A 3R7BA 4KACA 5JR3A 1DIGA 2GD1O 3JARA 1KVSA 3QXXA 1OSNA 3DW1X 3UJ8A 3KBOA 3HBJA 4HK4A 3VOBA 4H0FA 4HVAA 1T25A 1XKLA 3RTEA 1UFKA 3R8XA 2ZUDA 1YDWA 2JJYA 3A2LA 4KVFA 4WJLA 2UXCB 4HWSA 2P9CA 2IUTA 2IZ1A 3WGNA 1T24A 1Y6JA 3NHBA 2JH9A 4YV2A 1Q0SA 4GQAA 3H0EA 4Z0PA 621PA 2IE0A 2CMGA 2QNRA 4ER7A 4D43A 5A4DA 1I33A 3DV0B 2Q1UA 2IP1A 4XH9B 2VRCD 2I87A 1XXHE 3QXGA 1OGIA 1TM1E 5IT4A 1BWSA 2C9ZA 4LHZA 4O59O 2G70A 4HHEA 5LB4A 3JSXA 4YYZA 1PJ8A 1WVMA 5DCWA 4G5RA 3JWJA 4OQEA 3U1BA 2FOIA 1WP9A 1HNXB 3M7IA 3ORSA 4QPNA 3SKYA 4NV1A 1LW7A 3QG5A 1W29A 3U1VA 3ITKA 3ZGOA 4EB6A 4FNAA 1DT5A 3QEBZ 2OVFA 4GKBA 4O2AF 4S0ZA 3AFIA 4DDMA 3JU3A 1EX9A 2RHTA 5B57C 1L1FA 1NBWB 2YV2A 1Z18A 2HIHA 3CJRA 4PX9A 4YCAA 5EPUA 1CY6A 2FUG6 4NBKA 1U5CA 1PJCA 1G9SA 3FCYA 3QI7A 1ECGA 5DYTA 1PNTA 2QZSA 3TNYA 4XX1A 2YWFA 5AKGA 2VWQA 1KMCA 3P9RA 2M6LA 4JU8A 1G20A 1CWUA 1R8SA 3HCDA 4B3MB 1C7RA 2C9BA 3BD6A 4RESA 2XZDA 3W4KA 3ZQ6A 1QG2A 1E2PA 3ESCA 4F96A 3I32A 5E4FA 1IJBA 1U0NA 2AUTA 1OOEA 2GHIA 3DB2A 1OQAA 4B43A 2ZVQX 3A4TA 4GZLA 4MWTA 4UAUA 3OX4A 2H9YA 1JG1A 3HB4X 4HLNA 4G09A 4MQ4A 5FO1A 3ZWOA 5JAUA 3RVLA 3U81A 2LUOA 2LVBA 1EWVA 2DFKB 4HLDA 4I14A 3U7FB 2FPGA 2R65A 4LV5B 3QLUC 4D56A 5IDQA 2EEZA 3PRHA 1OKKD 4KXQA 2C54A 1R3DA 3ZXYA 5GZ1A 3TINA 4BN0A 1CQIB 3DMPA 1E2KA 3K8YA 3RVKA 1KYZA 4FFBA 4KFCA 4D4GA 2QM8A 2DR3A 4CEJB 2F3PA 3R1IA 4I08A 1N2CE 1LPSA 2QV7A 3S5JA 3BSYA 3O4IA 4ZJZA 1Z4JA 3E81A 4J2TA 5F5XA 5JUWA 4P3XA 5HRUA 1P4AA 3IC5A 5EYPA 2A5DA 2CLDX 2IXTA 2PX3A 3L1UA 3L79A 4KIWA 2P5TB 1M8JA 1ZOLA 3JQ8A 5D5QA 3NTUA 3ZXUB 5JWOA 2WPDD 4GAEA 4H3KB 4ZYWA 1TM2A 1VJRA 4P36A 3ONWA 1FJHA 5K0GA 3H5OA 4ABTA 2CFTA 3WMWA 4AF8A 1J4AA 2FX2A 4DQLA 4PZUA 5TQJA 3VTZA 4AN1A 4PYIA 3CZAA 1DBVO 1AKWA 1P75A 2AMFA 2DKOA 2YUTA 2Z56A 1G6KA 1HDRA 4IXMA 4KN9S 4OAOA 4O2BF 5GGXA 4S1VA 3SM9A 2P4EA 1LBEA 1NOJA 4N03A 3LBHA 4TSRA 3SKXA 1W87A 5M5BA 4ZI7F 4MKIA 3CLKA 4G65A 1C1XA 4A8TA 4RJIA 5J4VA 1GKYA 1L1EA 3NYIA 5IX8A 1V5IA 3OECA 2I4OA 2QZPA 3W2TA 2BEJA 1G63A 4CQLA 4R8MA 3O8OA 1E7YA 2ZT5A 1EM8A 1IBMB 5A0VA 1ORDA 3AUUA 1VLVA 2I4TA 1P0QA 4JBGA 4F8EA 3V9PA 5I9SA 3MT7A 4MGHA 3FB4A 3I2FA 1EZ1A 1XVUA 1N7IA 1EXMA 2YJGA 3RU3A 1MIOA 1O94C 1BJKA 5L3ZA 1DBRA 3M6LA 3PDIA 5CT4A 4LFAB 2VNSA 4EGQA 2ADMA 3PWZA 3SJCA 1FOEB 2JIQA 3ZHXA 1UIMA 1JAYA 1RJDA 5BORA 5DHTA 5EOVA 1V5WA 2H5LA 4BU0A 1OWOA 4ALMA 3D7MA 4G81A 1XD2A 4HTFB 1DAFA 4L9SA 2DR2A 4D5EA 1J1IA 3NBXX 3CX8A 2ZTUA 3WZMA 3HKDB 2WP8J 1Z5GA 2XE4A 3DCYA 4L5CA 1D8AA 3BFVA 2QK4A 4KG7A 4FYIA 4LBWA 4UNSA 4QRDA 1GUAA 3U3MA 3WLNA 2V4ZA 4B9EA 1Z2CA 4PTZA 2IEBA 1G5HA 3MWYW 1UJ6A 1WB5A 3PQEA 5CUQA 3U31A 1XT6A 3WWYA 1G6HA 2R2GA 3L77A 3QBDA 1JGTA 4DWOA 2OSBA 3GJ6A 4MMYB 2DERA 5IJ9A 1DU4A 2FUCA 2CV0A 4M36A 3TJMA 1IBLB 4S05A 2Q3HA 1I1OA 2ZYSA 2W2VA 4J43A 4OL0A 2MSCB 1ENYA 4K86A 2QVXX 1OGYA 3AJRA 4KBYA 4KKVA 4DANA 2WJ4A 4NF2A 1T43A 4B3GA 1XHEA 3BXXA 3OX3A 1S2GA 1XZLA 5TMBA 2HNBA 3O1LA 4YLEA 2CBXA 3VPAA 1RAFA 1TTQB 4K9NA 4LJ5A 4EFLA 1N77A 4MUBA 4QBIA 3C7TA 4AC9A 4R8RA 1YVUA 5PGMA 4BGEA 5JIBA 2FE4A 2JFGA 3NHYA 4B3CA 3IIMA 3TEMA 5EE9A 3Q3VA 1O94D 4KZKA 1HTWA 2Y27A 1IEQA 1AN0A 4OFWA 5EY5B 2C31A 2VFAA 4LNHA 3RUPA 3DV0A 3M5DA 1TZ2A 3V8QA 1YA8A 3QF4B 5DBGA 5KNDA 4B3RB 4O1IA 3NVMB 2HJGA 2J0VA 2QE7A 1GQSA 1Y1RA 3C3DA 1S2MA 2GA8A 2ZIXB 1Y37A 2POQX 1Z7YA 1J9GA 2XUGA 5DYYA 3EJWA 3F7NA 3WLFA 3R0VA 1GU1A 5FNZA 4HGRA 4UEQA 2EL9A 3CZ5A 1DQYA 3OT5A 1XLWA 4Q7QA 3QIVA 5JU6A 4JV5B 4BNJA 5FA8A 3D6VA 3KQTA 1N4AA 2ZTVA 1P73A 3LX8A 1P4RA 4DC0A 3JR3A 5ALLA 1KSHA 1SCKA 3K20A 5LMNB 2Z8XA 3EXFB 1MAAA 4EBFA 1YVPA 2B8WA 3GFVA 1E62A 4ZZ1A 5TR9A 5HF5A 1R0KA 1CERA 1QP0A 2ZETA 2CDRA 1VL2A 3AW8A 4ZT3A 1LRJA 2EJBA 2GAJA 2JC3A 3N9IA 3PEEA 3QOXA 3IOCA 4WH0A 3DDZX 3KCNA 5BYKA 2G07A 3PIDA 3JATB 3WS7A 3U0VA 2X2PA 1R9JA 1YCFA 3QI2A 3HGQA 2BFMA 3QMMA 4R2WA 1O9HA 1YIAA 5DWQA 1C29B 1SKUA 1UZAA 3WTCA 3B1WA 4A8PA 4MIOA 2ZJOA 1PUXA 1YBAA 5FT9A 1P80A 3MPUA 3RS0A 3WMFA 3MD9A 1NBOA 5T8KC 1SFRA 1WD7A 4MEBA 3W8FA 2EJCA 2ZRNA 4AJLA 2YY6A 1Y4ZA 1GUYA 1GAXA 4UEKA 4TX1A 1WL8A 1YJ8A 3COSA 2I1QA 3SHVA 1QLHA 2PRYA 1IC6A 4II3A 3VUFA 2GEVA 5DP1A 4DSNA 3H84A 3QEOA 5JTUA 1HDGO 1YS2X 3TQOA 3UWDA 1BG6A 1U99A 3H05A 1CQIA 4BN4A 4FFVA 1OX6A 2JGNA 1XJQA 1ZX1A 4RVHA 5EP4A 4ZRMA 4EY5A 2X9QA 4CEJA 2G1UA 3UHAA 5LIPA 1HH4A 2AW3A 4IDFA 4KYIB 4AJEA 2HIGA 1W0JD 2SICE 4JLAA 2WJJA 1U0GA 2YYAA 3CF2A 4KUEA 3OMXA 3OVMA 3WL4A 1PGNA 4CG2A 3VISA 2WUGA 2J3HA 4FYMA 1SUEA 1FU7A 1R16A 3QMWA 1W93A 3OE4A 1RIIA 5FTLA 3DR5A 2QN2A 3N53A 4UEWA 5CVEA 1KZ7B 3IERA 2ASEA 2JA2A 3H7AA 1A72A 3HZZA 2WZDA 1NP6A 2OBXA 2UUOA 1QPGA 5EMMA 4R4JA 3R7SA 3TTXA 2Y4NA 1PS0A 4MCJA 4IKEA 1V26A 3OT4A 3EUEA 2PO5A 1HNNA 2VZ9A 5GWXA 3W77A 1PSDA 4N18A 4UVHA 3AEQB 5YASA 4US2R 1ESMA 1XQWA 3GAAA 1KAOA 4XFDA 3BFJA 4LVCA 4RJJA 1U1CA 2B9EA 2HUPA 2NNWB 2Z4RA 3HGTA 3LX5A 3D4BA 4MKHA 1NF3A 1P2DA 4OQ4A 4M88A 4R0MA 1DG1G 2FXVA 2ADFA 2KJQA 5C5EA 2J6CA 1VCIA 1QRAA 1TXGA 5EG5A 3T7KA 2GKOA 3EHDA 4LRXA 2FPXA 4EJ6A 1EJ6A 1N32B 4ZEWA 4YRCA 4RQAA 2G76A 2KQUA 4DEXA 5ENZA 4EHBA 4O4JB 4B34A 3C6ZA 5HCNA 2F2TA 4YBRA 1HLDA 3H8SA 4MV0A 1M34B 3EZXA 5HILA 1OJLA 3GNLA 3OPQA 3IXLA 1RWQA 1Z88A 1RWBA 2OBYA 3EH2A 4K6HA 2WTEA 4G0YA 4RIEA 4BBZA 3EGVA 4B6RA 2W2TA 4HTFA 2P0EA 3WLRA 4FWIB 2DBRA 4YDSA 5ESWA 1M67A 3GLHE 1KE2A 1GITA 5CEFA 3VH4A 1PQWA 4GBGA 3R5TA 1SU6A 1DRVA 1XO1A 3HKDA 2X0DA 4C3OB 4DRZA 1NF8A 3L9XA 2HR1A 3PFNA 3AETB 1NATA 2VHYA 3UWPA 1ZIPA 1D4AA 2FR1A 4QUJA 4LVUA 4UE3S 3DGFC 1FS6A 3MWLA 4YJGB 3GA0A 4TVKA 4ETMA 4F8JA 3TK1A 4ARAA 1X9GA 5LQJA 2W6OA 4OD0A 1E58A 5JFTA 1VMIA 2J45A 4K0RA 4Y2XA 1U1DA 4M55A 1X1BA 4LF9B 5HPYB 4RCVA 4H60A 1PFVA 3OTGA 4LK2A 3ZWXA 4CQMD 4DZTA 3OX1A 3GCGA 3T99A 3TW8B 5AR1A 5A4AA 2G7MC 1OA1A 4LE1A 3RO7A 4XIYA 2AN5A 1B1AA 5A5EA 3WGIA 1K68A 3SQXA 5CCBA 2GN4A 2GVDC 2ANCA 4TRMA 5AOAA 3WRXA 2BE7A 4ETWA 2IOFA 3VZDA 2OP1A 5KVQA 4R1SA 4BIMA 2OM2A 1WCV1 4FW9A 1MRZA 5LNK1 1UCFA 3LCVB 4J7AA 2EFCB 6GPBA 5KOHB 4CYMA 1AA6A 2XNDD 1ADFA 2RBKA 2EATA 3ENWA 1Y1LA 5CT6A 3K92A 5FXMA 3TL2A 1VKNA 2QTTA 3QF4A 1KEKA 2JIDA 2R9VA 3FUWA 4IFIA 3IKJA 4A7PA 4OK5A 4MB6A 2ZIXA 5C5DA 5LLSA 2N0SA 4RD3A 4EY3A 1N8TA 2FPWA 4CTJA 1EFKA 2GK6A 2SBTA 1TJNA 3F78A 3ZLBA 4LF5B 4UC0A 1USVA 4HH0A 3BXEA 3I8SA 4H1WA 1AV7A 1DIAA 4CMIB 2Y0DA 3NDJA 2J30A 1K27A 4BQRA 4DN6A 3AWDA 4IUCS 3JQ6A 3RVPA 4E5KA 1GZ3A 4XIIA 5EJ6A 5KWVA 3O4GA 3ZCRA 1OGJA 3WGMA 5JCJD 1B43A 1TW3A 1VDMA 1E9SA 2Y1GA 2WTXA 3EXFA 5SZIA 4YAKA 1H6AA 4PGMA 1TCVA 2D5IA 3H9GA 4F7WA 3ETJA 1VZ3A 1KEVA 2QB5A 1L3IA 2IPNA 4N3NA 3ROXA 2GPJA 3G0IA 1UBKS 2YW2A 3JATA 4F4FA 1RKXA 1LXCA 3N0RA 3TVDA 5KNDH 4HNQA 3NDBB 2VDRB 5BSUA 4BKMA 3RC8A 4KXXA 1KJJA 4GSYA 1SIOA 1XCJA 4FFOA 4KO2S 4DR4B 2H2HA 4CIDA 4PZZA 1KF0A 3PFCA 4L5BA 3ODGA 2TYSB 3QRWA 3AF6A 4IV8A 2CGEA 3HRIA 3VYRB 3KXPA 3KOMA 4JASB 1NJ1A 1ESNA 1AQLA 2QUJA 3GN1A 1OT5A 4R7TA 3TE7A 5M34A 1DP4A 2XSZD 3WC4A 1A1VA 3P2OA 3L7OA 3HCEA 4MYRA 2GXUA 1PK9A 3R40A 1BGVA 2R47A 2XR1A 4EG4A 1H0SA 5F23A 5J4KA 5J5VA 1T29A 2AOVA 4IX9A 3R75A 2OFPA 4JL8A 4XR9A 2P1RA 2CLOB 2C3MA 2P4QA 4W1PA 4HDRB 4C7KA 1MAHA 1RJFA 1H1LB 4RL4A 1HK7A 2C04A 3OHPA 3RS4A 5JMOA 2ZIUB 2ATVA 4Q7JB 4RMJA 2PL1A 4YRJA 1Z0JA 1AUVA 3H83A 1OV6A 2WNHA 4HBZA 2QQGA 4KAAA 2W6PA 4RYDA 4ARBA 4JLPA 3R2JA 3UCFA 3C3JA 3IT2A 2CD7A 5BR1A 3BCHA 1OI4A 3FCOA 4Q4LA 4B81A 1Z7GA 4BV3A 2B20A 2Q1SA 2VHWA 1U2ZA 1T8YA 2WU1A 3GPIA 1VFPA 4MUEA 1USIA 2PGLA 2A1UB 3HI4A 3MT9A 3ESBA 5FPQA 1AUOA 5A5FA 2V5UA 4OLJA 5KQGA 5JANA 4ERXA 2DY1A 4TL8A 2FWAA 4OQNA 4QATA 4YCNA 1TU4A 4BWYA 2XMQA 2PSSA 3Q8KA 1GILA 3N59A 5E7JA 2JLXA 3AV3A 1Y6ZA 3D3EA 2QZZA 3AEQA 3PC3A 1CUWA 5GM2A 1HXHA 3WMGA 1V4BA 5K0CA 5AJWA 5IAAA 2VYVA 3VR6H 1YUNA 3AFNA 3WMXA 2A5JA 2XHEA 5KSWB 2ORIA 1MO5A 4IGIA 2PT5A 2AQHA 1KIMA 2GO1A 4UVIA 4JVSB 5P21A 3U6BA 4XOIA 1UPAA 2DQ4A 2ZRJA 3OZSA 1IEWA 1K5DA 2DX7A 2ZRLA 5AKKA 2CL0X 3E84A 5FAKA 2CV1A 3G8DA 4Z2AA 4E14A 2OXFA 3PB3A 4O4JA 3P9CA 1KQPA 4QQRA 4IJUA 3F5SA 1Y3IA 3NW9A 5EWLB 3SQDA 3GU3A 2R8YA 4PSKA 1RZRD 1Y8ZA 1UBNA 2PGJA 5GY7A 1T5HX 1M34A 5KHLB 1CEYA 1Q1EA 1CUXA 3RUDA 4JBNA 1RADA 2CMKA 2XLCA 2EL7A 4HMQA 4DQ0A 2I6FA 2JANA 5JE8A 1ZR2A 3L8MA 1W2WB 2P6UA 3JYLA 3SR4A 4E88A 2CFSA 2O6LA 3FM9A 3I5UA 3TLAA 3DMTA 1DQPA 2JATA 1XMIA 1NPTO 2XUIA 4XWWA 3BHIA 3IAUA 3LLUA 1ML4A 4G89A 4HNAB 3AETA 4L8FA 4WIAA 3KTOA 5K0TA 3IIJA 5LYJB 3QFSA 2RGCA 2Q3FA 2ZWOA 3TNDA 1L9XA 1LLUA 4G67A 3I6ZA 4YJGA 3A7EA 4MW2A 2COUA 4MHTA 3FYHA 1BS9A 1NYLA 1U6JA 3EZYA 1W6UA 3TBHA 3QEKA 1SKQA 3MQ2A 1NR5A 2JDID 4L16A 3WP1B 4H15A 1J09A 2XTZA 5DWVA 4K9QA 5I8ZA 3RT9A 1QIJA 3NC1C 4N0EA 1R8XA 4MV7A 4FTWA 3TW8A 3A06A 4WJKB 3L0SA 1RJEA 3QVUA 4Y8VA 2Z2JA 4YFYA 3VJMA 5FO0A 2JAWA 3STHA 1C8BA 2YN2A 1K2VN 5H81A 4B71A 4D2IA 4BRSA 1II8B 2OO5A 2XNHA 4UKDA 3IDAA 4BMDA 2P4UA 3AVPA 3DEFA 3TD6A 4NESA 3WNDA 1OB2A 2FSHA 3PJEA 4PAMA 4URHA 3NBUA 4A6DA 4Z9BA 4ZAFA 5BP7A 5KOHA 3UH1A 1QAQA 1E98A 1G8KA 3IP5A 1V8OA 4EGSA 1TUEA 4AJ9A 4PCVA 2AD1A 2F4VB 4ETIA 4XVQA 2VZ8A 2EFHB 5FUYA 5LDDC 2OESA 1KRXA 3ETGA 1GKLA 1P2SA 3MELA 1RAEA 1T8PA 4DLZA 1GZ6A 3IP1A 4ARZB 3C74A 2FRVA 1WSDA 2GCNA 2E21A 2FPKA 4AKIA 3T61A 5F64A 3ESRA 1OIWA 1YZUA 1PTKA 3IELA 4M7WA 2DWQA 1RAIA 3I76A 3QLVA 4LZJA 2P9FA 1DAOA 4PLVA 1OTXA 4YVFA 2A9JA 5C80A 2P77A 5JYBA 2Z5LA 2XX3A 2I29A 2QTWB 2ZBEA 3LVQE 4ZAZA 2XCSB 4QXPA 5IZCA 5EHZA 4E1VA 4U5QA 2A92A 3K94A 1GRRA 1JWBB 1E5XA 1O5IA 1VE1A 2FOLA 2G17A 2Z2XA 2DPMA 3F7TA 1ZNYA 1L8QA 3FSEA 3ZW7A 5ARDA 1H3NA 2XUJA 4A15A 4B8ZA 4LSZA 1SKAA 3OLZA 1EX1A 4CIWA 1CY1A 5IJWA 3K2BA 1L5LA 2AEJA 3SLKA 1J42A 1JBQA 3S4YA 2IOQA 1NU6A 2OUKA 1XRJA 3ZJVA 1TIKA 3BL6A 4JOQA 1HX7A 1J2UA 1EDEA 1Y33E 1E2EA 3BA1A 1GPYA 1LU9A 3KR1A 3KSUA 2EFYA 1SC6A 4RPIA 1CSEE 4UMDA 3L1HA 4K9DA 3W8DA 1U1FA 2XUFA 3WGQA 2HL6A 5HUJA 1JT2A 1RWPA 1XCGB 3DP9A 3BJMA 4FLFA 4NE9A 1VCMA 5D2CA 4WNYA 1RXVA 1TGVA 2XXAB 4EPRA 2HO5A 2IPXA 4E94A 2E5WA 3DJYA 4HDRA 5IUKC 3RAFC 1H1LA 1I2ZA 4ZI2A 4OSPA 1AZTA 4L4RA 3UGTA 4OB6A 4JR2A 4C3ZA 4NBNA 3LTEA 3O75A 5AOBA 4LHSA 1OBOA 4KQ1A 4BE4A 4M0CA 1G0NA 4NK5A 4ZZ3A 3EVTA 4LGYA 4F2WA 1CU1A 3HHEA 4W8GA 2IUUA 4QSMA 1XUOA 4X3CA 4BNVA 1E1MA 2BFPA 4DDKA 1F14A 3CLUC 3LCUA 4QUBA 2G06A 1BSVA 1X92A 2Q5HA 2QX6A 2RGNA 3EZFA 3IAS6 3VC3A 1PGOA 4NS1A 1ZINA 2LE0A 2KPOA 3LLCA 3H8JA 1BX0A 2FN9A 2VTVA 4PZPA 4XM1A 2PV0A 2A1UA 2G1KA 4NABA 5C34B 4BJ5A 1Q7EA 1Y7LA 4TYWA 4H1VA 1OXMA 4Y1FA 5GOTA 4RLQA 1CRLA 1V71A 1E1NA 4YLYA 3I3OA 5AKHA 4BXOB 3DCIA 4DKXA 3K9WA 4DUYB 1ZAKA 1Q50A 1W59A 1Y9DA 3P9IA 2EIXA 2IH4A 4MWEA 5JNUA 2GF2A 5DLYA 3N2YA 4W1RA 3BOSA 4A0GA 4LOKA 5T3UA 2BMWA 2IH2A 2WE8A 1XJ0A 3HK2A 4IYRA 1AS0A 1UWVA 1PJSA 1LKZA 1RSZA 1N7GA 2JEZA 1IG3A 5HK8A 1KSFX 1PYGA 2Q8PA 1ZNZA 4UQOA 2AN1A 2GJAA 3CVVA 1VHQA 2W2PA 4B44A 4CMJA 1QWOA 1QIDA 4MEAA 4ZKEA 1XD9A 1FBTA 4C4OA 1YS7A 2V54A 2GZ1A 1O3YA 2WOJA 4QNRA 5D5PA 4AMGA 5LM3A 5LQNA 5EWLA 3E22B 4KE6A 4UDOA 1VHDA 3W5HA 3DMNA 2PUAA 3R24A 2NTEA 2HCFA 3ZWAA 1BROA 1EDOA 3A1WA 5IT9A 3Q3HA 3I62A 3H4IA 2QRPA 1JMVA 1Q3TA 3UC5A 3A8TA 3EDMA 4DM4A 5I7EA 8OHMA 3OMLA 3B82A 4MHSA 5DSTA 5E4YA 3KQVA 4ZAXA 5F33A 4Z4GA 1WD5A 3ENVA 1QP8A 3H8VA 2EP7A 5KNCA 1YZNA 1RABA 1SM4A 1XHFA 1B26A 2JHGA 3UV6A 4F6LA 2IYUA 4ZCTA 2DH6A 4M8LA 3RJ9A 4HNAA 2F3SA 2J32A 3CO5A 1AX9A 3MIZA 4MO9A 5LYJA 3BX1A 4UQLA 4BFYA 1EE9A 2P2ZA 3FOWA 2WQZA 5K8IA 5LU9A 2R00C 2VDQB 1EBUA 1YJXA 2IEYA 2R7KA 3KPJA 4X45A 2ZSEA 3SVLA 1SIBE 4C01A 2RIPA 3WIUA 2C97A 1ML3A 3I30X 2E4ZA 4L15A 3OPNA 5D85A 3FTCA 5EPEA 3STYA 3L7JA 5KJEA 4EKYA 2I91A 1D6SA 1A7KA 1QMPA 1SQ6A 1WXQA 2AX3A 4HRYA 3UAXA 5JXWA 3EZ2A 3GL9A 4Z9FA 3EAGA 4AG6A 1I7LA 2G9NA 4M9XA 4QZVA 4HF7A 4KN6A 3LGXA 2IK8A 1OB5A 4IJ6A 1II8A 5K3BA 1H4VB 3KG2A 3LUAA 1WUYA 1WTCA 3AH8A 4R1TA 5AXDA 1K06A 2IELA 3UH0A 1NI5A 3EA0A 1E2DA 4URWR 3QJYA 2FWBA 1DC6A 3F49S 4XUGB 1HT0A 3C1AA 4UTZA 2E4VA 4CEIB 2GXQA 4FI3F 4B6GA 4FWTA 1AN9A 1T8UA 3AVYA 2PU5A 3FW1A 4YP9A 3NIDB 4ZTBA 3GFGA 3FWKA 3UJDA 3EXG2 1X7YB 3QPAA 4JMLA 4W82A 4ARZA 4JI8B 3EW9A 1U9JA 3DZHA 2FP4B 3AILA 1KI6B 5FI5A 3AO0B 2JJ8A 5EMHA 2HBQA 1NMXA 4A36A 4HYEA 4WZAB 1JDBB 2P7HA 2WIBA 3BILA 4R5HA 3V8PA 1OBVA 4LNAA 4F3TA 3L8EA 3EIOA 4R2HA 3G7UA 2JG3A 2QZ9A 3LHIA 2NIPA 3W3AA 1DCFA 3DBOB 3A1EA 3H18A 1QK5A 1UP7A 4IAOA 3ZHOA 1FYDA 2OVBA 2E1PA 2A4MA 4ND3A 3OWOA 3VNQA 1DSSG 2PX0A 3MJDA 1KI7A 2YV4A 3G2IA 4L0CA 1MXFA 1Q11A 4RKYA 5JD4A 2P9HA 3L8DA 1VPTA 4W5WA 1ZZGA 2YIDA 3L7KA 1OASA 3BIXA 3H9EO 4JAVC 4OHVA 5F7JA 1XIVA 4BNXA 2BISA 3PKZA 1QLJA 1UXJA 4Y3UA 2Z43A 5CNMA 4ZCPA 3MCTA 3PE6A 4FE7A 1FRVA 2QLNA 4GXRA 4WINA 3JSAA 2VTKA 2GK7A 3IB6A 3S68A 2IIQA 3F8SA 2H1WA 3LECA 3QNMA 4N7BA 5F4BA 3F2VA 3T4EA 3EC2A 2HQBA 3GA7A 3PQ2A 4BBAA 1RI3A 2AHRA 2GCPA 4ZEOA 2Q4EA 3OCJA 4ZFNA 3F6PA 1XYGA 1MTZA 1I3KA 3IOMA 1LY1A 1VKOA 3PHCA 1QE5A 4PRYA 2WLTA 4V1CI 3GLFE 4M0PA 5AK5A 5TGDA 3V34A 5ICEA 5MF6A 2FSFA 5HTKA 2XXAA 4PVDA 1D2AA 1JT9A 3U4HA 2XUKA 5JEEA 4OBWA 5KAMA 4QIHA 2EU8A 2VSYA 2QMHA 3OQJA 2ZS8A 3L1KA 4FI3C 1XRPA 2P9ZA 4LYDA 3T38A 4HDCA 4FZ5A 2X7JA 1SEVA 3F71A 2AR7A 4UZFA 3AV0B 4OP1A 4RV9A 3L49A 4BFUA 3KZNA 3EMKA 1IK6A 1CFJA 4IVPA 1F20A 4BFSA 1N6KA 5LC1A 1LTKA 1V7QA 2NAPA 1CUVA 3OLXA 2ZBVA 3EZ6A 4ND5A 3SJUA 1IHOA 3IOYA 3JYNA 1D2EA 1V7CA 2RBGA 3C3PA 3L0PA 4GYKA 2Q2QA 5AJVB 4CZ2A 3TKAA 2C3UA 2D7JA 4O63O 5JISA 1PD1A 2OD9A 2Q1TA 1B42A 4AUMA 2QX8A 1LBHA 4NCBA 2CBGA 3S99A 1YZ3A 1KRWA 1BU8A 1RE0A 2VEOA 1PEDA 3B12A 5TXGA 1DAMA 4TKLA 2J6IA 1NQAO 4MVJG 4EFKA 2GBCA 4BXOA 1VCOA 1CRZA 2F9MA 3KZVA 2I0FA 4M0FA 3WGOA 2PDAA 1NXWA 4LRYA 1N1GA 5I9MA 2ZCUA 5ILOA 5C7IO 4KRYA 1EEHA 3NDPA 4XGKA 4F7DA 1CS4C 1GG2A 1UK7A 2IYRA 1Q0PA 1BQ3A 2OZKA 3IV6A 4UMFA 4CMBA 3UJ6A 2CXRA 4DJDC 2Z5VA 4RZ3A 3T41A 1NJGA 4R01A 5I48A 5ALFA 1Y5IA 4KAXA 2PZAA 3IUBA 1PNVA 4FCVA 5ALQA 2QTVB 3E22A 3I9NA 3P2JA 4BNLA 1G8JA 1QHHB 3M33A 2CEKA 4TRJA 5HGXA 1NBHA 1AK1A 2C7RA 3O1HB 5C1OA 3WIDA 3LS2A 2EW8A 2YJ5A 2NADA 3IIKA 2F7SA 1QPBA 4X95A 3ANXA 3RSSA 3VV3A 3WRXC 1KVUA 4KX3A 3FTDA 1EWQA 3FWNA 1WF6A 3ELBA 1GY8A 1LBQA 4KQ6A 2OHFA 4GMXA 4INAA 4R0NA 4C4XA 1WE2A 3ZVNA 2AKAB 5F9HA 3MS2A 4J0GA 3ESYA 4PE5B 2BVNA 1I4LD 3IDZA 4BO7A 5J47A 4RV4A 3EWNA 1T2DA 2NXNA 2F00A 1AGXA 2O3TA 2W6JD 3DHEA 3MW8A 1N6OA 3WRYA 5I9IA 4HXGA 4W5JA 5K3SA 2A59A 2WUFA 5ESXA 2PFGA 1UDBA 3G2QA 5K03A 2WB2A 4TLBA 1DJNA 3KELA 1RFGE 1RTTA 3KDSE 5DZSA 1C8VB 4QEZA 4REMA 2BE9A 2G4VA 2R8RA 2BI7A 5E8JA 2AW5A 2WDZA 2I7VA 3ZD6A 1N3IA 4M1YA 4GL2A 2HM7A 1UQRA 1PYOA 2YVUA 3KAJA 3I2YX 4RTRA 4B74A 1OLXB 1AHIA 3FX2A 1OU0A 3G2HA 2F59A 3VQTA 5J58A 3H5LA 3WLPA 4IWNA 4M8KA 3QX8A 2ERCA 5DBHX 3RAGA 4LJLA 1LSSA 2Q9CA 2WYIA 5B2EA 1QU2A 2J3LA 2V3WA 3AUAA 4Y1GA 4CEIA 2Y9PB 1H42A 3F9CA 3FMOB 3IILA 3KJQA 4WACA 3SGLA 4E5SA 1OBFO 2H51A 2VDNB 1ICIA 4D74A 2RHGB 4IHJF 3OTOB 1IZ8A 2R8EA 5BO5A 2YN4A 3H04A 1AXRA 1X7YA 4BNHA 3DV9A 4DV5B 4BVAA 5D86A 5D6NA 1HT1E 2WU8A 4DGSA 5CVDA 2FP4A 1KI6A 1T36B 5GP1A 1PL7A 4HEQA 3TIVA 3ZJ4A 4BLQA 1G17A 1XN4A 4WZAA 4EUFA 1FU8A 1EVYA 4EYSA 1U2RA 5AXBA 5J1SB 2GM4A 3GLGB 2FW9A 3IUEA 4O4JF 1MJGA 1E1QD 1BE6A 2XJ9A 2YFHA 4J1NA 2B7BA 5HMMA 1FDOA 3MRSA 4R05A 3HTXA 3G9TA 1K6MA 4DC1A 1LNZA 1J0CA 2WYHA 3GH3A 4J90A 5IBPA 1Y89A 4A23A 1SPXA 5IDXA 1QFYA 2XZTA 4LWPA 3CEAA 3PFHA 4PAGA 2BL4A 5L3VA 4KR7A 2CUZA 3V2UA 2WU3A 2AKEA 4L9RA 1KEPA 2BONA 1CB7A 1XJCA 1E0KA 3M81A 4MIKA 3T1QA 1SBHA 2XCLA 2WA1A 1TD9A 2BEVB 2A57A 2VH5R 5KTMA 1YV9A 1JJIA 3KWLA 1SKBA 2WM9B 1HI9A 5EIFA 1CQPA 4KRXA 1JRLA 4LEIA 4MRAA 4TMWA 4OJYA 1F1BA 4DCVA 1XP5A 1L6IA 1FDTA 2AR0A 4Y9UA 3RVDA 2ID7A 2VPTA 1QGOA 3MLAA 3NIWA 1WABA 3V2IA 1ZXXA 1FMJA 4FGJA 5CG1A 4BNKA 2V4MA 5A6VA 4UMVA 3DR3A 5A02A 3ZV7A 2IP4A 1DBWA 2A67A 1K0UA 4WAUA 2MTBA 3A6ZA 1I6LA 5A4IS 2E4AA 5IBRA 4EJ2A 1P91A 2DT5A 3BSFA 3MAAC 4IG9A 2C7OA 4J49A 3LUCA 1M7GA 3K73O 5CK5A 3GLGE 2AWNA 3A3OA 3DD1A 4HWKA 5H16A 1Y3HA 3OIGA 1W8DA 4JLKA 5A1TA 4B4WA 3JS5A 4DLKA 4IDDA 1WVGA 4R8SA 3UMBA 4B4OA 2OB1A 2O7QA 2P6OA 4FMPA 4BRWA 5KQRA 4UHEA 1JIJA 2PXXA 4I7EA 1QYIA 2XHZA 2EGUA 4OHYA 5E7MA 2ZAIA 4B4DA 4N76A 3CNLA 3PXCX 4ZQIA 1DBPA 1SXJB 5U4QA 1WVIA 4JOCA 1QYXA 3ZHCA 3EMDA 4JGGA 5CCXA 7GPBA 2JKVA 1NOIA 2J3MA 4FK8A 1TECE 1DFGA 4NE7A 4AM8A 3L41A 3HJRA 4LN1A 3REGA 1O4VA 2CHEA 2GQ0A 5B6PA 4F4CA 2VXBA 1LDYA 3B9PA 4IJWA 2KLBA 5KVSA 1TF7A 3TLYA 5IRCD 4ZU1X 4JITA 4R98A 3AVXA 1N5MA 5CM2Z 4HEJA 1H93A 2CFRA 3QOFA 3H65A 1P0CA 1QP4A 4DYVA 4XCVA 3DMTC 1VGRA 5ALMA 1A77A 5JECA 2ZXFA 4X84A 3TF5A 1ZCFA 2NZ8A 2Z0MA 3LOQA 3VO1A 5CMLA 5BT9A 3RT1A 3R6TA 3X1DA 1IN8A 2IU3A 3N0XA 3VHLB 3GD5A 5E38A 5DSZA 1RYEA 3NI2A 4D8VA 2UUBB 1X7WB 3BXZA 3PYXA 4Y2UA 1U2SA 4RA9B 5LQCA 3BGOS 2WWIA 3TTTA 2IE8A 1GA1A 2R8BA 3NT4A 4I4NA 3TSYA 2H07A 3ZHVA 1DV2A 2I2XB 2WVHA 4WCDA 4ENSA 5JS6A 1KP3A 2QTVA 1RZVA 1D0VA 4PC6A 3B2QA 2C2GA 4YT5A 3M6WA 1NI4B 3ADDA 1QHHA 3AEXA 4RQTA 3HJFA 1KJYA 2AMYA 5BQFA 4JT4A 4P3YA 2OHIA 1ZU4A 2GEDA 3H3XA 5C18A 2LZ0A 1C7ZA 1NT2A 2CDBA 2WHQA 2ETVA 4PC2A 4Y98A 3AUYA 2Q62A 4GDMA 4QHYA 3C4VA 4MZXA 1ORVA 3KPYA 3AL2A 3QFCA 1QGDA 2WEKA 4U7PB 5CX4A 1Z75A 2OILA 3MFYA 4LYAA 1Z4OA 4WHMA 1PDVA 3K1AB 2EX0A 2F9LA 2PX2A 2IL1A 2WVJA 3E7PA 3R0QA 4PINA 4PR3A 4RKFA 2FMTA 5GJBA 5E0KB 4DUZB 4MVJI 1I9GA 1BO6A 5HRCA 3UNXA 4IICA 5EMKA 5JTTA 4TRNA 3LXMA 1IBRA 3ET5A 2ZAGA 1P0MA 3NHKA 2RGWA 4GMDA 3G1UA 1LF0A 1ZISA 1NURA 2VJLA 1NVBA 2NO1A 4YP0A 4C88A 2DLDA 3E9YA 4V02A 2PUJA 5CBKA 1FSGA 1KO4A 3FY4A 1C50A 1HEYA 2AVDA 5J3JA 2RCYA 3K1TA 3KVOA 4GEGA 3QLVC 3WA6A 1L5KA 1CIJA 4NONA 3RU9A 2NPOA 4MI6A 1RQ2A 3RIXA 3AEUB 4ZQCB 2BGGA 1OLXA 1VQ1A 4IEEA 3MCAA 4MJ3A 4XDYA 3H5RA 5ITSA 1U4NA 1E79A 3LWNA 2LBPA 3VSAA 3BICA 2I2FA 3X1ZA 4LGCA 3KJNA 4E46A 2R6AA 1FFYA 3SMVA 1NSFA 1OAOA 4FQ8A 1DGQA 1TTPB 4B75A 3BE4A 2QD3A 1CUFA 1MIHA 3QA9A 4G6ZA 3K30A 4A6EA 4BQQA 2KI5A 4CMHA 5I7OA 1PKXA 2HF2A 2VJMB 2Q5IA 2AI3A 3D4OA 2Q27A 2C4TA 1MX1A 5FOQA 1DIRA 4LXTA 2C96A 1ORWA 4FYJA 4ZO6A 2HQ1A 4Q3CA 5MGBA 2Z6QA 3SZOA 2G1JA 4QYXA 5KYKA 1DDGA 4H7IA 521PA 5E9QA 5CXUA 4UJ5A 3I9LA 1T36A 4QXMA 2ODQA 3FD8A 2Q6IA 5TPZA 4CXMA 3IAXA 3GJ7A 1E3MA 1NDUA 2O0HA 1YRBA 2XAAA 1W52X 3VDNB 1OZFA 1QFSA 4OOEA 2E6KA 2WMNB 1C4WA 3A05A 4RHTA 4EHKA 1ZK3A 1M6NA 1SUSA 3SSAA 3GV0A 3BAZA 3DLPX 1RWNA 5K6AA 4O4IB 3O1JC 2IQ5A 1H2HA 4U0KA 4XJVA 2GPAA 5DTEA 4GLJA 4RK4A 3AM5A 5MFPA 3CLTD 3NPMA 2IU4A 1YB1A 4OBXA 1XJWA 4XM0A 4HVCA 3QUTA 2FEAA 2BEVA 3UMYA 3DDOA 4RCZA 1UJCA 4NARA 4WV3A 1J90A 4B7CA 4R69A 1NXOA 3QX3A 3P2EA 1ZGBA 3V1KA 5LYJF 1G8GA 5A5GA 1V7PC 3G5TA 2WJ6A 3RFFA 1S8OA 1JMYA 2RGNC 4F2HA 5HKKA 4GKKB 4DZZA 4LCBA 5C1PA 2R96A 3AOGA 3IESA 1GAJA 1EX6A 1XNGA 1QVAA 1YJBA 2ZYGA 3H1TA 4H4DA 4R9VA 5AKZA 4E1AA 1USWA 3NHMA 3SEAA 1Z6ZA 3WZLA 2I55A 4JQCA 2C77A 2GZRA 1CLUA 5G0UA 4F4JA 1N8KA 3FOCA 3E9MA 3W8EA 1R8YA 4I5DA 1A8HA 4WKBA 3WDSA 2HYIC 2AK3A 4M9ZA 4XCXA 3K70B 2XBUA 1V3VA 5EKTA 7MHTA 2IHVA 2EHJA 2VRWA 4J7CA 4KGXA 4RORA 2GHTA 4KU4A 3UJCA 2PGOA 1IZ0A 4Y7CA 3HXOA 3PGVA 2N75A 5CYOA 4AZTA 3HPRA 4DA7A 4GRAA 5JCZA 2J5RA 4L85A 3A4IA 5DCLA 4H1TA 1ODKA 4BQOA 2WICA 3LP6A 1TEZA 1G38A 4FE3A 1UFOA 1SXJA 1GG5A 2O3JA 1ZIOA 3U17A 1EQUA 4CFYA 5REQB 3AK4A 3FLBA 3M6VA 2AJ8A 1PG2A 3L02A 4JQSA 1WZUA 3NRJA 1YQWA 3R6GA 2HCJB 5LZ2A 4HV4A 5IT5A 3C8HA 2B1JA 3U60B 2E37A 2NLOA 5EJEA 3P26A 2PJRA 2AA3A 3RWOA 3U3JA 4DGQA 5IG2A 2GEJA 4FUQA 3FDZB 3ZWNA 5A03A 4U7WA 3KFVA 4E5YA 2ZJ8A 4L7QA 5JZMA 4F4IA 1WPGA 1THTA 1XRLA 2DOKA 1ZVQA 2VXCA 3MTBA 1K8QA 4RMIA 3ZCPA 5JMWA 1L5QA 2VH2A 4R1OA 2NZUG 2JGRA 4CMAA 5ESRA 4DV3B 1UC8A 2J0EA 4OOFA 3VVMA 1YD7A 1AS2A 1JPJA 1H0HA 4D3SA 1X7WA 1DKQA 3MPOA 3AVUA 4RA9A 1KBZA 1GPAA 3KAQA 2YIMA 3OOSA 1EH5A 1W4LA 3V4FA 2H2IA 4KVAA 4ZGGA 4DUPA 3AHGA 4AECA 4JVMA 4W1QA 5LKRA 2XCTB 2D00A 3HY3A 4Y6GB 5A7HA 4GKAA 1LPMA 3LQ1A 3MUOA 1L5NA 1NI4A 2RAFA 4LDRA 1T4GA 4A27A 5IDYA 3ZDYB 3U7HB 1J1UA 2R4UA 5AICA 2E48A 4GC5A 2OEPA 4KW7A 4BVLA 4PBRA 4DCTA 5MGNA 4XVHA 2RK4A 2AF3C 3HCNA 3CBQA 4RENA 1OZAA 3EF1A 1HDEA 3RFTA 2WQ6A 3VA7A 3GRPA 1S9DA 2W6CX 1HC7A 1O9BA 2FQXA 5AVVA 2YCLA 5SYNA 4ENWA 3K1AA 2VP9A 5M2QA 3NNDA 4R1MA 1OTYA 3WB2A 5K0BA 3HH8A 3T7EA 5MFZA 1ZU5A 1ENPA 2F3TA 3D7SA 3L7CA 3AVQA 4L9AA 4XLLA 1WCIB 4GOJA 3QFHA 4GPEA 1XP8A 3ZU3A 4V1CB 2IVFA 1CNFA 2MSWA 2HHAA 4YO7A 2H1HA 2WSIA 5KNBH 2W00A 3L8CA 4LGVA 1XLUA 1GAQA 1HDOA 1NE7A 4Y2JA 3LD9A 4REOA 1YVDA 3DYBA 3NYWA 2IZZA 2V55B 3CONA 3L92A 1QHYA 1VI5A 3AFGA 3BIOA 4Q3OA 3OQ1A 4G1EB 4JSYA 1SBCA 1K3FA 4JI3B 1DFIA 4Y6QA 1W4ZA 4P35A 3WR5A 3OQMA 1B6SA 1BS2A 4RVSA 1CCWA 2FQWA 1MAVA 1XZNA 5EAIA 1TDJA 2P9BA 3AEUA 4PNEA 4DB4A 1A5ZA 2YQ4A 4DA4A 1FDUA 1RRPA 5AVWA 4BX9A 4M98A 3VDRA 2BOVA 3EWIA 4Y2PA 3UK6A 2AFRA 2VT2A 5BOSB 1N2HA 3LBFA 1JVBA 2FUNB 1CS0B 2JFYA 3AIOA 3KLPX 2HV9A 4LK3A 1IB0A 1QIIA 1UPUA 2VJMA 3NWJA 2W2OA 3SN6A 4B6OA 2EEPA 2AG1A 1J20A 2MYNA 2ZDHA 3KJHA 1HBJA 3NJ4A 4LYYA 4WD3A 1SB9A 4YFVA 3QELB 2QRNA 2CLSA 2Q6VA 1QMGA 2WG2A 5CHEA 5FWDA 2EX1A 3OP4A 3U80A 4BJ6A 4OQZA 3LM8A 1XZFA 2A7XA 2P0AA 1V5FA 4FR2A 1JDNA 1CQZA 4BKPA 4DEYA 3PR2B 3LUJA 3Q8XB 4N8DA 1DKPA 4U2FA 5AVRA 5FTMA 4WERA 1NHWA 1T6BY 1TK9A 3U19A 2ZWMA 2PN1A 2IPOA 1RHKA 1JIKA 2Q5FA 3HU1A 4B3FX 1Z6TA 4AWAA 4ID9A 1K6JA 2CW5A 2XQJA 2PGDA 4X44A 1YFLA 5E2IA 4O4IA 3UB2A 2P9EA 3D3QA 5TSDA 4RDCA 3QVLA 3OFJA 4D45A 3WYGA 4EG8A 2VDPB 8ATCA 1TZMA 1QDLB 2L69A 1DO2A 1V2HE 3A25A 3NRBA 1JXAA 3PEUA 3KHSA 1P74A 5IK2A 4ER0A 2CT8A 4AY5A 5D3QA 4NH0A 4H0NA 3F1KA 3KQSA 4IRMA 2ZR8A 3MK31 1EGHA 3LA6A 3X1JA 1GGVA 5D01A 2XQFA 2PKCA 4LWQA 2VOJA 1K9SA 4WOCA 4L4UA 4ND1A 2QU8A 3NEYA 4KQ2A 4NYMR 5B64A 3E8MA 3A27A 4OHXA 5TMDA 5JJBA 5HBGA 5B55A 4ZOEA 3WXBA 4YRBA 4L51A 4P84A 1QRRA 4YCSA 3BJZA 3VRHA 3GJ0A 1W49A 4YRDA 4Z4CA 1GYQA 3FNFA 4LY0A 4NCXA 3KYDB 1XYVA 1K2WA 4D8TA 3GGPA 4KO3S 3ZEIA 2PH3A 2Z30A 1MQSA 2HX1A 3E9QA 1TQHA 1XKXA 1RLIA 4LQDA 4X6XA 5EQTA 3T9AA 7YASA 1E1KA 5BW5A 1A7AA 4JC8A 2VCYA 2H08A 3AYXB 3JY6A 4AX8A 1G9TA 4BKRA 2A9OA 1RM0A 3ZGYA 3U7GA 3NAMA 3COWA 4YGXB 5COBA 1QYVA 2I7CA 2VDUE 4U7GA 4ND2A 2IYEA 5ETJA 3TRHA 3ZOZA 2I1VB 3RJZA 4YXFA 5REQA 4AY4A 1NYTA 1M75A 2GAAA 1FMFA 5LR6A 1CEXA 2OBFA 3DCJA 1MH1A 1UT6A 1KARA 2ZI4A 2H1CA 1BW9B 1CETA 3I9OA 3FOFC 1IVNA 3HZHA 1HETA 2YIJA 1CKEA 3FDZA 5CNKA 5IAOA 2J87A 4M8IA 5AIBA 4AF7A 2GRUA 1RRFA 3ZE2B 1XLTA 1GAEO 1E18A 1B1CA 2J8ZA 3EB9A 2JVJA 4U00A 5IC5A 5JZBA 3KQHA 1GGEA 1TM5E 2GN2A 2WD7B 3ZNNA 3IKTA 4IDOA 2Y3IA 5H9VA 3TBFA 3WRYC 3AL3A 2WK1A 2HI0A 3L46A 1JBEA 1E2UA 1TC2A 1VIAA 3ITNA 3O4VA 3D6JA 2HSDA 4K6GA 5TRTA 5MN5A 2GPBA 2ZATA 3TG8A 1JR3E 2XB6A 2YASA 2VSXA 4YMSA 4DF3A 3HKCB 1UUFA 2CC2A 1BMFD 5BV2P 3ZDQA 4BO6A 2AZXA 2GAOA 2GSWA 4WL0A 1CDZA 2IFTA 3R5JA 5IXJA 2IXBA 2G09A 2IYWA 2OCGA 1XXLA 3REOA 2Z1DA 1E6CA 1R4MB 4OXXA 1ZVVA 4GWLA 4NBUA 3NORA 1IUPA 4JCCA 4DBVO 5FTWA 4U1RA 4URVR 2ATEA 2QNBA 3A28A 1O6GA 5KDLA 1NQUA 1V39A 3G7SA 4NS4A 3ETCA 1Q1BA 4QBHA 4FBLA 3OUZA 4IQ4A 1MJNA 2WJWA 1WCIA 4V1CA 1JKFA 2QYSA 2D1QA 4AB1A 3NAZA 3Q10A 3HBFA 1ZVJA 1KJ8A 3N7TA 2VPPA 4LHYA 3FYCA 4RSGA 4ZCLA 4YO8A 2QN6A 5C32A 1PYDA 1BKDR 2VI5A 3KPVA 1D0IA 1ND6A 2LGJA 3FHCB 4EPWA 3L6UA 4XGIA 2PRJA 3BEOA 3SS7X 2BFAA 3PEFA 1L4KA 3CH6A 4GNKA 4S2EA 4X7MA 3RRFA 4MJ7A 3CVYA 4KPUB 1JDBC 4NZMA 4F5DA 4F4UA 3FBGA 1FTYA 4FDMA 5CM9C 2D54A 1YC5A 3D3WB 3GJYA 3GT4A 1KDRA 3OCUA 1QJCA 3U0BA 4CETA 4UAGA 4WCFB 4NCJA 4CGZA 1JDTA 4D4HA 2GERA 2M9MA 4G37A 2IRWA 2B2CA 2X0IA 3H2SA 4V0MA 3UCXA 3T3DA 5ICCA 5E6RB 3HB7A 5BOSA 2IHYA 1ADBA 3GO4A 3JAKB 4E13A 4Z7NB 4BLRA 1QOQB 4GOXA 4RHCA 1KZYC 1J21A 2NXWA 5DTMA 1CS0A 2NTNA 4E5VA 1NBIA 5JHHB 5HA5A 5K3FB 4G8DA 1QUEA 1R5OA 1J49A 2I6UA 4MGIR 3QELA 4KSBA 1SIWA 2C7BA 1II9A 5F35A 1SUPA 2IZ0A 3C6KA 4XJXA 3QZUA 4DMMA 2XQGA 4ER3A 4XSVA 5F3WB 5C4GB 4AG5A 4IINA 4W8HA 4J4HA 3UXYA 1ZUNB 2ZYHA 4M9QA 3IODA 3D5QA 1KIFA 1JLSA 2O8NA 1GQ2A 1JS1X 3WAGA 3CRZA 5DGHA 2X76A 4ESOA 4UEJA 5BNWA 1URPA 4UXIA 3BXFA 3DAHA 4U63A 1JB1A 5TY0A 4TS3A 3DLIA 1Q2XA 3MJHA 5AHOA 5BSKA 1XTQA 3EGCA 5AJTA 3LXRA 2OLEA 1WMEA 1CDOA 2A5YB 2G0AA 2PCJA 1XKQA 2VZ0A 4HNUA 4FBMA 4PR0A 3OEED 1Y7HA 2IHZA 2P3SA 4P2BA 5IVHA 3C87A 3IPYA 1Q12A 2CFCA 5AM4A 3U4CA 1OFVA 4DABA 3KV1A 4O8ZA 2EWWA 4CQNA 1RYZA 4CM9A 2HMAA 2NU6B 3BCUA 1OC2A 1GHTA 3I01A 3JQBA 4AAYA 2DBZA 4MYTA 3WLMA 4B1FA 4E22A 3K0FB 1G0OA 1KRHA 5IW8A 4RAQA 4F71A 4X5OA 3DHYA 3BULA 3VNSA 2JKZA 1P61B 4FDVA 1PFKA 2YMLA 3G85A 3QXSA 2R84A 1YDHA 3IEKA 3KYDA 4FXPA 3Q9UA 1H2WA 1WEKA 3TPCA 2GM9A 1DEHA 1L5WA 5K09A 3S2SA 1L7QA 4DLPA 4PG6A 1WKVA 1PQYA 3A32A 2BMAA 5L9AA 5DX1A 1DDIA 3WSTA 2MR6A 2YZGA 3EBLA 4GMKA 4TTQA 2AZTA 1JQAA 1Z4NA 4L1KA 2R5NA 4QRIA 3SHWA 2VT3A 1FTWA 4FEEA 1ECJA 3ILVA 5H3CA 3DOOA 3WFIA 3X2EA 3ZQJA 3EEQA 4ZOAA 5EUMA 1MR3F 1NI3A 4D4KA 4YROA 3L0BA 4F5WA 1ZD3A 5FPTA 3W5AA 3FPLA 4UHKA 1JB9A 3VJKA 3EFBA 3D64A 2HHCA 3N05A 1UBOS 4MIYA 3K1YA 4LE2A 4W5NA 4G4SP 1BW9A 1UXOA 5FULA 4ND6A 3UHFA 2G9UA 2IEIA 4QRHA 1BMTA 1R0CA 3OI7A 3KLBA 1MHTA 1S4MA 1MENA 3ZDAA 2AFIB 3QP9A 1SN7A 1I3CA 2IXGA 1I6KA 4M1QA 3HJBA 3SZUA 3VDMA 4QFCA 2C7PA 5KQSA 2YXBA 3I04A 1RYBA 2C95A 3LLVA 1M5TA 2R1ZA 2KHZA 5LBIA 1MX9A 1W0KA 3L1IA 5CFRA 2WD7A 5FRDA 2BD0A 2E3JA 2QJOA 2EERA 2Z2IA 4ZA2A 4F2GA 4BNFA 4O02B 2PUHA 4P33A 4B6FA 5FBLB 4HT3B 4CIYA 3P0IA 4XGQA 1YBMA 1GV1A 5TMPA 1NN0A 2QIOA 3W7BA 2WHPB 5BY2A 4U6QA 1A2OA 3O8QB 3C7KA 5K5EA 1LPAB 1RKUA 4FHGA 3HKCA 3O21A 1Z82A 1NJSA 2IY9A 1U7XA 2C3OA 4WY5A 2P2NA 3RVBA 2GN0A 4FIZA 3ZCVA 3WQSB 4M0EA 4FYHA 4BFWA 2NUBA 3KKEA 3AR3A 1R4MA 2A8YA 1P4HA 1ZUHA 1P7PA 3PTAA 4C7MA 5TVKA 3ZWMA 2YW9A 4LYFA 3IOEA 1NLFA 3ULKA 3T0GA 4DJFC 2XA1A 1OI2A 3TQFA 3NOVA 2CWWA 4GX1A 2DEUA 2XOKA 5KBYA 1OAOC 2I76A 3B38A 1KH3A 1JHYA 1GCUA 1VPEA 3E2PA 2O8EB 2Z4TA 2V7PA 4HVLA 5DYIA 3EIFA 2A4KA 3PS9A 3VPXA 3MC1A 5CM8B 1D6JA 3NUZA 1WU8A 4Y9SA 1QFJA 1G8HA 5CFPA 1UBSB 2JFWA 2QVLA 3PJDA 3X1XA 4EENA 1V96A 5JSQA 4NAVA 2IEZA 2PUVA 2VWGA 1PZEA 2RDMA 1CUYA 4JDPA 3PEYA 3ZPXA 3C5WP 2OR3A 4Q24A 4PCLA 1WW2A 1ZI8A 2XNCA 2YVKA 4G2TA 4KPUA 3EYWA 4DVJA 3IL2A 3UAOA 3L7NA 3I6YA 3RTBA 2PUEA 2AH5A 1S3SA 6REQB 4OQLA 4PGAA 4Y2GA 3X2FA 1BHO1 3IX7A 4DHEA 4LS3A 3D3WA 3GCDA 4AROA 5HW0A 5JWRA 3FA2A 2WPNA 3N07A 4OGFA 4BP8A 3CH5A 3U40A 2B37A 2FF5A 4HOYA 5JD3A 5K6AC 1E20A 2EFGA 3IFSA 3SIRA 1PQ4A 4LXHA 2WIDA 2HUNA 2W2NA 5E6RA 3JAKA 4MKZA 2B25A 2CXUA 2YJ3A 4K6KA 5DXJA 4JT9A 1W8IA 2YWGA 3A0RB 4QGAA 5K3FA 1C3OB 1RP7A 3MMSA 5ISMA 2O9JA 1B73A 3H1PA 3OCWA 5TLSA 4JI4B 1KI8A 3PEWA 2BYTA 3UJHA 1E79D 1ZGCA 1K08A 4L8GA 1OH8A 4UFNA 3G9QA 4NP6A 4UBLA 1CC1S 2YR0A 4RHFA 4KK3A 5MN6A 4YR7A 5J1TB 4LOAA 1ZUNA 2H9IA 1IQPA 4IGKA 1U7OA 2KE5A 3I9MA 2PA0A 2R8PA 5EHGA 5IARA 1AO3A 2ACKA 3UWKA 4F5ZA 1JEDA 5LN1A 3RS9A 1JW9B 1NY5A 4Q3EA 1KMNA 1E94E 2YJ6A 4KFSA 5HF6A 2J4DA 3WWZA 3H4VA 2EBWA 2WSYB 3CGWA 4L8VA 2TS1A 4UM5A 3SSOA 3UAZA 2JI6A 2P90A 1BDHA 5BR8B 4PLZA 3CB2A 4XPIB 4XEUA 2FRXA 1OH6A 2V9CA 3A6JA 2YJTD 1IOVA 2Y4OA 2X13A 5TPZD 2MHCA 1QAMA 1HYQA 1K7XB 1KBOA 1VLZA 2EKBA 3E7DA 2IHUA 3DHNA 2R86A 4GM0A 3UAYA 4G56A 1QU3A 3BK1A 4I5IA 1BWRA 1C7FA 1X3SA 2BC9A 2MSDB 2PGNA 2VEDA 1ZKMA 5AI4A 4DIEA 8AT1A 2VPZA 3C45A 3UOAB 1LBSA 2VSQA 5BVGB 3KT3A 4E5UA 3OJFA 3SS9X 1KA9H 1ZJ6A 1SXJC 4AO8A 3QU2A 2NU6A 1A4XA 2ESRA 3DOHA 1QKKA 3I39X 3GMIA 4FR5A 3D31A 5HF8A 3AINA 4MVJA 4V24A 3ISTA 2Y77A 5F73A 4BOYA 5LKAA 2EKDA 3K0FA 2VJYA 4QD3A 1ZJYA 4R8LA 1VE3A 1OTHA 3I52A 2VCHA 2VSFA 1KS9A 3P9KA 2IP2A 3SWWA 2HPZA 4G5FA 3HCWA 2KLHA 1Y80A 2WNIA 2PKWA 2WW8A 1LVGA 3AR8A 1Z3CA 2CXOA 3DMHA 3NCTA 3ID6C 4H7EA 3O6VA 4WEQA 2NOAA 1U1IA 1UDXA 3C15C 1UF9A 2X2FA 4GICA 2R7LA 3A6HA 4TLAA 3C14C 1LDNA 1MG5A 4WNIA 3FPBA 3NHUA 2I65A 3MMZA 4RD6A 4DOMA 3VVBA 1RHUA 1HE3A 3E3NA 4AU1A 2BRUA 1ISHA 3MRTA 4CT0A 5LLDA 2X8BA 2NVOA 3LDFA 1EAYA 4PS0A 2VJCA 4YIHA 4FDTA 1DPFA 1GPMA 4PIVA 3VOAA 1WPXA 3HKEB 2XTAA 1QGED 2FWNA 3ENQA 3NTQA 2IOFK 1UQUA 4ILKA 4BTLA 2XOXA 2JLRA 4Q1AA 4JVLA 4X7RA 1AUPA 3TNLA 4EGJA 2CMDA 5C2JB 3LRTA 1PWEA 4DQVA 2VCEA 3V1MA 2AUMA 2PTHA 2GWHA 3MD0A 3ZCSA 4C76A 4CKEB 5HX7A 5K99A 5KMGB 3UQYS 4RTKA 1X74A 3AR7A 1RLTA 2GK3A 3OOJA 3HFRA 4TUYB 2AFIA 1NW6A 1MJFA 1NX6A 3CG0A 1WPRA 5H02A 1WY7A 1TZKA 5CDUA 3OPMA 3ETEA 2D2IA 1XZGA 3CEJA 3O03A 1RYNA 4EGAA 3S29A 3VM6A 3E6AA 3GUZA 1FYXA 4O4IF 4B3DA 1UPCA 2AN3A 4BLUA 4QUEA 3ELYA 1Q0UA 2JJ2A 4UDYX 5FBHA 3FRJA 4QREA 5A1JA 1QF7A 4OYYA 3UC9A 4BO5A 4WLOA 4RACA 3U61B 1X77A 3OM1A 3TEFA 3ROMA 2X5XA 2VPQA 4AS2A 2WHPA 3VZPA 1VI6A 2AFHE 3AM3A 2DUWA 3O8QA 5JMTA 2QJTA 1F9EA 3A37A 4TSKA 1E7WA 2Q3BA 3PX3A 1BNCA 4EATA 5JNVA 2C92A 3KXIA 1E7MA 5AW7A 1SD1A 4KHZA 3R7LA 4KFRA 1NVVQ 2OOKA 4BX0A 2FMXA 3WQBA 4F92B 4EWLA 2LKCA 2X0FA 3H5TA 3TD9A 2R4TA 1XTKA 4B84A 1V0JA 2WSSA 1AKTA 1XQXA 3HYCA 3VO8A 3JXEA 1LCIA 1HRKA 4WXPA 4A1FA 3F5MA 4Y67A 1AUXA 2O5RA 2ZI5A 5GIOE 4DXDA 2QG9A 1HPLA 5DCUA 1G20E 3PHGA 4P98A 4DV7B 1VM6A 1C3LA 4BPRA 3D7NA 2V1UA 5KS2A 2O8EA 1FVXA 4CG1A 1ZS9A 4YHHB 4HGNA 3LDAA 1QE0A 4OUDB 5T64A 2HEGA 3AL0C 3RBXA 2PUDA 2DTXA 1LPPA 2JBWA 2B4KA 1CY4A 5GM1A 4AO7A 5C53B 2OE2A 1DI0A 2WM8A 1GRNA 3H2BA 5DNDA 5IC6A 5ADUS 4US1R 1T9DA 2PMKA 3ITEA 1T4DA 3HJTA 4P4NA 1S6YA 3EDOA 1XZJA 5LCXA 5BPHA 6REQA 1DUVG