1RHQA

Crystal structure of the complex of caspase-3 with a bromomethoxyphenyl inhibitor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 140
sequence length 140
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rhqA00
2C2OA 4IEFB 2H4YA 4PS0A 5IAKA 3PCXA 3H11A 1RWMA 3PD0A 1I4EB 4JJ7A 1SC1A 2XZDA 4DCPA 3V3KA 3DEKA 4HQRA 5IC6A 1QDUA 4JR0A 5I9TA 2H65A 1GFWA 2CDRA 1BMQA 4LSZA 4JJ8A 4N5DA 4N6GA 4N7MA 5IAEA 5IAJA 3DEHA 3R6GA 4AWAA 2K7ZA 1RWXA 1JXQA 2XYHA 4QUBA 3V4OA 2CJXA 1SC3A 3EDQA 2J32A 4HVAA 4N6NA 3OD5A 1RHUA 3D6MA 4PRYA 4QUHA 5IBPA 1CVRA 4JR2A 1RWVA 2C2ZA 3V4LA 4AWBA 3R7SA 2HBYA 1IBCA 3R5KA 1I51A 1GQFA 2QLJA 4QU5A 4ZVOA 3P45A 1I4OA 3V55A 1K88A 2J33A 4ZVQA 2H5IA 3NKFA 3ITNA 1M72A 4FEAA 4NOKA 3GJTA 4D3XA 4ZVSA 4DCOA 2CNNA 4NBNA 1RHKA 4QU0A 3R7BA 2WDPA 2J31A 4ZVTA 4ZVUA 1PYOA 4JB8A 5LUBA 1SHJA 2C2MA 3E4CA 3H1PA 1QTNA 3KJNA 3UOAB 4QU9A 4DCJA 2CNKA 5I9BA 1QX3A 4M9RA 4JR1A 3DEIA 4FDLA 1I3OA 2QLBA 2QLFA 4ZVRA 5IBRA 2H51A 1F1JA 2NN3C 3GJSA 4EJFA 5LU8A 2H54A 2P2CA 1RHMA 1RHRA 2FQQA 3PD1A 4NOLA 2H48A 2XYPA 5IASA 3NS7A 3H0EA 4EHFA 4NBKA 1RWPA 2CNLA 2J30A 4JJEA 2C2KA 4QUDA 4EHLA 3D6FA 1RWWA 5IAGA 1RE1A 1RHJA 3IBCA 5JFTA 2C1EA 5LU9A 1PAUA 1NW9B 4FXOA 4JQYA 4N6OA 4N7JA 4PS1A 2Y1LA 3KJQA 1CP3A 4D3ZA 3UO8B 3GJRA 5IBCA 1F9EA 2AR9A 4FGUA 1RWNA 2FP3A 3BIJA 2H4WA 2QL7A 4JQZA 5IABA 2FUNB 3RJMA 3P4UA 4ZVPA 1ICEA 5IANA 3D6HA 3SIPA 5LUAA 1SC4A 2H5JA 4IYRA 4I1PA 4EHHA 2CJYA 3GJQA 4NBLA 3DEJA 3QNWA 4PRZA 3SIRA 4EHAA 4QU8A 4EHDA 3R6LA 4D3YA 1RWKA 3H13A 3R7NA 4QUAA 1RHQA 3K7EA 3H11B 4NOJA 5IARA 4NOMA 4QUEA 4I1RA 4QUGA 4EHKA 3S8EA 2HBRA 3KJFA 1K86A 4QUIA 1SHLA 5IC4A 5K20A 2HBQA 1NMEA 2XZTA 4QUJA 2DKOA 2Y0BA 4AW9A 1NMQA 4HQ0A 1RWOA 1NMSA 2QL9A 5H0IA 3NR2A 3R5JA 4QULA 4EHNA 4QTYA 2XYGA 2QL5A 4QTXA 3EDRA 3V6MA 1KMCA 2HBZA 2CNOA 3IBFA 3S70A 3V6LA
chains in the Genus database with same CATH superfamily
3JXEA 2VNAA 4NYMR 4QNMA 4EQ6A 4F4FA 5T41A 4DT1A 3KDPA 4M0CA 5GVRA 1DQPA 3WQSB 4NYMQ 1YS7A 3KYCA 1N9KA 4P3XA 2WFAA 1ZX1A 1E1DA 3ND8A 5F64A 2ETVA 4V39A 4HLNA 1NATA 2JI4A 2XAUA 4YJGB 3UUGA 5J4KA 1LVGA 4MKRA 3ET5A 3E5NA 1XGKA 4LF5B 2CLLB 3H1AA 3URKA 1IHDA 1VIDA 2JZNA 1BX3A 2QJOA 3X1JA 2VYCA 3CN9A 4WK6A 3OIDA 3FBWA 2DGDA 3GPCA 3VXKA 3IEXA 5HJEA 1ZXXA 3LYUA 2XMQA 1YJQA 1U5CA 1OOEA 2LIVA 3MS7A 1ZVJA 4PYLA 1QK5A 3ENVA 2ZRLA 2PL3A 2WF7A 4AT1A 1J21A 5D5QA 3EXFA 5BSUA 1O9GA 2Z4TA 2H3HA 1XNJA 4RV4A 3QPVA 1R18A 1ZISA 3OIFA 4GMGA 1U8YA 3EDCA 4ZEWA 1EQ2A 5T6BA 4TKVA 1V7ZA 1YVEI 2C1XA 5KYTA 4JJZA 5AI8A 3HJNA 3KVRA 1O6ZA 3N59A 1H05A 1FVOA 3DDSA 4LISA 4V0LA 5JQGB 1NY6A 3VDMA 3DDCA 3GL9A 4P31A 1BQ4A 2NT3A 3GFVA 4DV5B 3U61B 4A03A 3BFJA 3COYA 3FSRA 3CUTA 3H4MA 5DSXA 4ZAYA 1WQ3A 1EAMA 3WB2A 5KU1A 1XRJA 2K5UA 2DRIA 4YAWA 2HLDD 5I47A 2JD2A 4M6WA 1I7SB 1KZ7B 4B6FA 4UOQA 2RHWA 1IHPA 4O29A 5LVAA 3ITKA 1OX4A 2DYKA 1JVBA 1IMJA 2ATIA 2FZGA 3E23A 3OCUA 5FR1A 3WSVA 2X0IA 2AEFA 5A0TA 2A4MA 1II8B 3E27A 3FXAA 3W7VA 1G20E 3Q3EA 5GV7A 1UJ6A 5C0OE 2GRAA 2VDLB 5KQSA 3K0SA 4WLFA 3IEPA 4Z4QA 2NPOA 3TQRA 5KPDA 1TM5E 1EFHA 2BSQA 4WESB 4PS1A 3VSEA 5BV1A 4K9RA 1N1DA 2A3RA 4ABTA 1H8ED 2WNSA 4M9ZA 4HXYA 4CMIA 4KQMA 4ZO9A 4I6EA 4BP1A 4FW8A 4NK5A 2HUNA 2IKSA 2IPXA 3HJTA 3IIIA 4RZUA 5DN9A 5JJBA 5LQDA 3ETJA 4L7QA 1I9GA 1UXKA 2YVLA 2YIDA 1Z0ZA 3FWPA 3I9V6 4MV5A 1OZFA 2RHCA 4A0HA 4TTTS 1PR3A 4YRDA 1OLXA 3IAEA 1WZEA 4IJWA 3V33A 3ZY5A 1KGSA 3F7TA 3MF4A 4RJIA 1E6UA 3ZVKA 1XCOA 4F72A 3WGYA 2X13A 2L42A 4B73A 1SGWA 2P5SA 4UBMA 1Y5RA 3OJOA 2FWMX 3ZXSA 4EF5A 2P6MA 4QU8A 1R00A 2QJTA 4UPEA 4WGGA 4R5HA 4RNCA 2JI9A 5EYPA 2J3DA 4YT8A 4DLWA 1U2DA 3V3TA 1JEEA 2Z09A 3AL3A 3L49A 5BP7A 4MIYA 2JH8A 1MOZA 3TRFA 4HF7A 1MAVA 3HMKA 4E13A 2NUTA 4BMNA 1G7TA 4R1UA 3LQRA 2PUFA 1KVSA 4H16A 4OEHA 3ZW8A 9LDTA 3RTGA 1WUTA 4R2HA 2OG2A 5KJCA 3VA7A 4W5QA 4HQ0A 4ZEMA 4IDQA 3R8CA 1DKOA 4BMVA 6Q21A 2G77B 4B9EA 2FPMA 3IO5A 5G53C 4HAYA 2FJ0A 2BISA 3BXHA 3LT4A 4LDPA 2CF6A 1OD6A 3QLUC 4NENB 3T54A 1SKMA 1QTQA 4OOFA 4LY0A 3UMVA 3FOWA 3AI7A 2FR0A 2D8MA 2VNHA 3P9YA 5KO2A 1F2DA 3B5JA 2D5AA 1JVNA 1GNVA 3A6FA 1O97D 3MWKA 4FQ5A 4P4UA 4RKRA 5CFMA 2AT1A 1XU4A 3CO0S 3EC1A 4O08A 1FPMA 1DUVG 4PFQA 1V9CA 3EHDA 3O3CA 5ADWA 5JDIA 4D6YA 1HUQA 4XLLA 4BBJA 3G7NA 3B3JA 4YQZA 4BO9A 1GWNA 4YI3A 4MUNA 4FOOA 4QODA 5FLEX 4COKA 1NHGA 3GQBA 5KX5B 4NBTA 2BY4A 1AKVA 2ZIAA 1N5IA 3BL5A 4DUGA 1QR6A 3WIVA 5REQA 2NAFA 5IYZF 1OAOC 2CVQA 5EWLA 1THTA 3FCUB 1D8TA 4U5XA 3SPXA 1OFIA 1MRZA 4JUIA 5CUQA 3W5VA 3UJ7A 3ZEIA 3GGCA 4HUQB 3WGKA 2KMLA 3PVZA 2LE0A 3DL4A 4Q1CA 1Z16A 2H2FA 4RH0A 2P3LA 3TPZA 1NVXQ 3SSMA 3ZLBA 5KTMA 4B32A 4RWZA 1IBSA 4INPA 4N5NA 4KQJA 4H9GA 1CUIA 1JQ5A 4PW0A 1JHQA 2H8GA 4X7PA 5K0NA 1KJNA 2JRCA 1JS1X 1C9DB 2OHIA 2QN3A 4J0FA 3WL4A 2ZUVA 3WXBA 5K4GA 2FY8A 2WZCA 3FDJA 5FWYA 1KIAA 5F1OA 3I73A 4J0DA 4XVQA 1RCUA 2YJNA 3RM3A 4B4KA 5LXTA 4IIJF 1OGIA 5A9TA 1OXKB 1Y6FA 1KI7A 1KP3A 1MF7A 4UDYX 3RRYA 1TEZA 2GH1A 1FDWA 3BD9A 4MDFA 1BVYF 4M21A 4M89A 2OPHA 1TW2A 1U1EA 3AR6A 1QGUA 4I55A 1G1MA 2JL1A 4U7TB 1AS0A 2G06A 2W2XA 3D8BA 1N2CB 3ZKWB 2RD2A 3DZFA 1BSVA 3IKJA 3W6PA 3DBIA 1XQ9A 3KKMA 4IO1A 1G0OA 2GBLC 3OCWA 5CYFA 5DTMA 2QXYA 4BBZA 1G291 1G5RA 4C20A 3C6MA 3I9OA 4QDUA 3FF1A 3U3MA 1JR4A 3A9WA 2HXYA 1C30A 2GN1A 4NESA 4IH1A 5B2FA 2UYYA 4DJJA 5DT9A 1NKVA 1TD9A 3KEFA 2W4MA 4YRLA 3TXAA 2GN8A 1XL1A 3P4UA 1T8TA 3AV3A 2WZDA 2YRWA 3EUAA 2HV9A 2NYRA 3NBXX 3JQAD 4XDZA 4Y9SA 1VI2A 3KPWA 3NWJA 3ZY3A 1Q3TA 5IANA 2DT8A 4ZICA 1IB0A 3MFYA 1N7JA 2ZTLA 1I10A 1RQLA 3PPIA 4IDCA 2CLMB 5JO9A 5EJ6A 5IULC 4HI0E 3QYAA 3CU5A 3PDIA 3AJRA 2JLRA 3PCRB 1QUFA 2G36A 4PQYA 4WZZA 3DE5X 4BFUA 4G4GA 2P0AA 4LYAA 5AYVA 5CAEA 5CMLA 3T1TA 4DZZA 2QNBA 2ZSJA 4D80A 3ZE1B 2VSOA 3QTTA 4BTEA 2QR3A 1WKCA 4HQKA 4B6SA 4DLNA 3DDOA 4TQ9A 2XW6A 5ALOA 4RAQA 4DV1B 3WMEA 1Z4QA 5CVVA 1DTWB 2WSSD 2PXXA 1FFGA 3JQGA 1ZQ1A 5KYYA 3AF0A 4AFNA 5CYGA 1E6EA 1M1NB 1R37A 1E2LA 2P91A 3Q3CA 3P0JA 3U81A 5EQTA 2EDCA 1JSXA 1YMUA 1K06A 2IIQA 2OV8A 2H4JA 5K3AA 2BHNA 1E1LA 2XHEA 3B3FA 3GLQA 4G8JA 5SV2A 2F48A 2I76A 3F0TA 4KJZA 2RGAA 3JX9A 1KPIA 5FQOA 2P3QA 2HOQA 1FU4A 1FQOA 2D4HA 4MGZR 3UICA 5CCEA 5A1TA 2Z83A 1ZM3A 2Q41A 3B1JA 2J6CA 4HNRA 2VUSA 4OQEA 4BVHA 1L2TA 1QCCA 4B82A 3CEPB 4JLBA 4N5LA 3G0DA 4KH0A 3L18A 3Q15C 5CVUA 2E4YA 3G02A 1FC0A 3UMRA 4Z0NA 3INRA 3DMFA 1E2EA 4O5AA 2XWSA 4DV2B 1Y7LA 3GVXA 2VDWA 1R5NA 1PFVA 5CA0A 3QEAZ 1FQKA 5E1MA 1DRKA 2O0HA 1UKZA 4EG8A 4KSCA 1OH8A 1L4HA 1PG0A 3D54D 4NU5A 4BFTA 5G4LA 2A6PA 2ZW9A 4I1VA 4R0MA 3HUEA 3AL0C 2JGMA 2B2XA 5E8JA 1EB8A 3LU1A 1VYVA 4F5DA 2JGDB 3IIKA 2AGVA 2B92A 5AM2A 2MHCA 4KQKA 4GI3A 1YBAA 2DHDA 2YW2A 4J43A 2J9FB 2ZWMA 1TECE 1VJCA 3G8BA 4L8FA 2DLNA 3IQEA 3KWFA 3MHPA 4X8HA 4C0HA 5F2NA 4JJ6A 3X44A 1WY7A 2A14A 1DDGA 1GGFA 1UJ4A 2UVDA 1IZZA 4Y3UA 4X64B 3CLTC 1CJMA 5AJVB 3IV7A 4MCJA 1XRLA 1Z2CA 4JVSB 3UFBA 3JD0A 5EUCA 4X1YB 2F2TA 2UYGA 4A8TA 3ZHTA 2O7QA 1RBQA 3ZXIA 7ABPA 4I4LA 3IA2A 1ZIOA 4QBHA 4E5MA 2C9DA 1VFNA 4PAGA 3OPMA 4ZI3A 5EMLA 2HD4A 3JTEA 5CXSA 1J23A 3WRYA 5DK6A 2GESA 1JI3A 1U2RA 4GVLA 2WAMA 2W2OA 2XCIA 5KJFA 3V9PA 1XDUA 2AUNA 1L9XA 3EVTA 3I5UA 4MR8A 5HGJA 2XZLA 2D1FA 4X00A 2YZNA 4DEYA 5C4GB 4D3FA 3QI2A 4RPKA 4KVZA 1OAAA 1V1JA 3K9WA 4R4JA 3ZLVA 4OX9B 1TAGA 1N7GA 2UYHA 1X87A 3GD7A 5LNK1 1L7MA 4IIFA 4JWKA 3WQRA 4QG7A 3COPA 4HEA1 1V5IA 3AZQA 2Q4OA 1B16A 3ZY2A 3HXOA 3ZDYB 3T1HB 1AV6A 4I5FA 3I9LA 3O5AA 4V1CA 2P7IA 1KY5A 1YI0A 2OA0A 2COUA 1EEXB 2B8NA 3EQ8A 4HAIA 4J0HA 4TL7A 2GBIA 1QE0A 4KNYA 3ZE6A 4YMUA 4DHEA 3LKBA 4L9AA 1D0IA 2P9GA 1ORDA 5IK2A 1VBFA 2XTZA 3OY2A 3AYZB 4K46A 1RXVA 1SVKA 3SCZA 2IH5A 5BQ5A 3KQPA 5BN4A 3CINA 2XCRB 1U7DA 1ADYA 1G7RA 1W8DA 1KQPA 4KFUA 4JXJA 3TSZA 1QLHA 2NW6A 1IHOA 4OJQA 4Z9BA 1G8PA 1YS4A 1O89A 3BWXA 3DUFB 4J49A 3SYLA 1ZJZA 3ORQA 2FN4A 3L7JA 3ZIUA 3M83A 3BWBA 5H4HA 3GJYA 1QAMA 3CGGA 5CNKA 4E5VA 4U7WA 4HNAB 4KHPB 2FUEA 1Z25A 2GJ9A 1GNLA 3AVPA 1D1QA 5CPBA 4ES6A 1N34B 5EIHA 3QENA 1E3TA 4BP8A 5EPUA 4BV8A 1OFGA 1Y6JA 2ZGVA 3PE6A 3PYXA 3WIOA 4EDFA 3I2IA 1JNYA 2CJXA 1SC3A 2WDZA 1BE1A 2ZE7A 3A4YA 3QITA 3R3VA 4HYYA 4XIIA 3H84A 3E8MA 1GY8A 1UJMA 2PIAA 5EAIA 1E6CA 3BF8A 3CUEF 3HJCA 4TKZA 3RKSA 3QUBA 3LDUA 4EKDA 4Q1VA 3VJKA 1AHHA 1M6VA 1RI2A 3OSUA 2BJVA 1WULS 2EFHB 1U2GC 5FF9A 1KOLA 2GZDA 2NYVA 4QL3A 2AHOA 2J33A 3MRTA 1O58A 3KVYA 1MEJA 4WLNA 5EPEA 4JMLA 3IR5A 3QJGA 2W2VA 5TNXA 2IU0A 3U9TA 1SEPA 3FTPA 4QICA 3SEZA 4C76A 5K8TA 3A9TA 4C1BA 4AYTA 1P1CA 2WF6A 4LMAA 1JIJA 1L4FA 2EQ5A 5H70A 3A9VA 5J1SB 4JI4B 2GBCA 3VKVA 3JRXA 2WBLC 3QBEA 1H65A 3IQXA 4KU4A 4M1ZA 4CEHA 3PPXA 3BTOA 2I8AA 3K20A 1JYFA 4NJEB 4M1OA 5CDFE 2W90A 4LF7B 4MPPA 4GG1A 2ZG6A 3HYNA 4FI3C 4XR9A 4JHLA 1F1JA 4BOYA 3ITEA 3ANLA 1K5GA 1R6DA 3CB4A 4GRDA 1SD5A 1SBYA 3E03A 4EMBA 1P2FA 4KVAA 1DZ3A 1LDBA 2VJOA 3O8OB 1W5FA 1NPYA 4QGFA 2D1RA 4NPHA 2WAOA 3SHFA 1FFDA 1B3BA 4XB2A 3WQHA 4Q1AA 4OREX 5T4EA 3VR4A 1N5LA 3INGA 3JVEA 4GI1A 4A6DA 4DQDA 2AK3A 2WEKA 2AG5A 2B7CA 1WQ1R 2GFIA 2H1CA 2A5DA 2ZPAA 5I9SA 3VR6D 3GBVA 4PPNA 3LUCA 5IBCA 1KTIA 4KPEC 4BIIA 3I01M 2QVBA 1CUEA 3OP4A 2BP7A 4PZPA 3D5EA 4UBNA 5KOHA 2X2FA 1I3MA 1G18A 5JADA 4CCYB 2WIDA 4GMXA 2VK8A 4FDAA 4UM5A 4ZMSA 1PWXA 1XMQB 2EEPA 1YGPA 3AUFA 3KFXA 3U17A 1UBNA 3GJQA 4OHUA 3Q88A 2B0CA 3GDOA 1LX6A 2C7VA 1H2AS 1KYYA 4AECA 3QFTA 4MKXA 2BGMA 3KZMA 2XADA 4KLZA 5I7SA 1N8TA 3H16A 1FSPA 1UCFA 2BFDB 2IYOA 3L8MA 1NFFA 2ZSKA 1Z3IX 3GLHA 2OBFA 3EZ7A 3JW8A 4Y98A 2ZJFA 4JT4A 4NULA 4MVJH 4TKMA 4WMLA 5AK4A 4YUZA 3AHCA 2DU8A 5JAUA 1VSQA 2F3UA 2R6R1 2H18A 4KCGA 2XGOA 4TLMB 1KYXA 2HBQA 3KJEA 5G1NA 4HMQA 3UG7A 4HDMA 3SM9A 1EX1A 3T99A 3SX0A 3GUYA 3UAWA 1QZTA 4CU5A 4DARA 4E12A 1WIWA 1SCAA 2W8BA 2NACA 2W2NA 1LF0A 5JD5A 1IAQA 1E32A 2HFKA 3PU6A 4MMZB 5A04A 4YAJA 1CULC 3K96A 4KX5A 3TI9A 2IV2X 2KHZA 5K6TA 1A2QA 1EIZA 4BGEA 4JQSA 3RHFA 3U3OA 1JU9A 221PA 4MKZA 4DCNA 4XWGA 3TD6A 1E4YA 2F43A 2QTMA 3F90A 5CR9A 4MLDA 4M3NA 1QPGA 2VYND 3Q72A 4CDMA 1WSDA 3MNFA 5HK9A 1T4CB 3TBKA 4EHBA 1FQWA 1IEXA 1YH3A 1YQXA 3EDMA 4H7HA 3SAJA 4CG2A 4XX0B 1GTJ1 1GQYA 2VRNA 2POQX 1H2XA 5I4IA 1A9QA 1LDMA 4Q82A 1CUSA 3UUFA 4IFBA 4CUJA 1XZKA 1MPTA 1PX0A 4ZAFA 2PUCA 4TV9A 5DBHX 2PGNA 2VTVA 2WHPA 3U31A 3WLSA 1D7OA 1ACJA 1ESMA 2NTNA 4OU4A 1Z5ZA 1KIMA 4KDEA 1WTCA 5SICE 4ZVOA 1YGYA 3TGLA 3OI7A 1NNI1 1E3WB 1G64A 2GHRA 1HDZA 3DKPA 2YUIA 3MMNA 4JASB 5HF9A 1ZCAA 4OGLA 1OTXA 4CPDA 1OZAA 3LGAA 1JDJA 2R84A 3NH9A 4D57A 1JTVA 3JQ9C 4HFRA 2GF2A 3HBJA 3GXOA 1ZJ6A 2PR2A 3AESA 4K26A 4DCSA 5AVTA 4IJMA 1GPDG 2TSYB 1FW8A 4WNAB 3OTGA 2MU1A 2XCTB 3ZCXA 1P61B 2EKBA 2P4EA 5K5EA 2XNCA 4H60A 3K8ZA 1JIKA 3PQCA 4II2A 3TECE 4ICIA 4YQFA 4LPKA 2GN0A 1JW9B 1ESNA 1KKMA 1V71A 3H6HA 3N1UA 4OYYA 3RS7A 1DBPA 3G88A 3EWAA 4S0XA 2NSDA 2H0AA 3AMVA 4P1ZA 4YCBA 1N5OX 1OC2A 4ZHSA 4ESEA 1B00A 2GNPA 4AJEA 2O0MA 1Z74A 3OJCA 1WABA 2IT1A 2XUAA 4B76A 1F2TA 5FBVB 5A4KA 4BGUA 1I2MA 2XOKD 1C8VB 4A0RA 3WG9A 3K73O 3AFGA 3RFUA 4D9EA 5EGNA 4AJ1A 4TRMA 4IRXA 1HYQA 3CBGA 1AC5A 4WOBA 5AHOA 5BSTA 5C5IA 1G8HA 3ROXA 2M9MA 4HWKA 1IMOA 2C42A 3B8EA 3ESAA 5AXBA 1JILA 1QLWA 4FE4A 3RKUA 4AROA 2YC2C 4RK1A 2H1RA 1QGZA 2ZB2A 5G4KB 3R5XA 1CJTC 2E48A 5DYGA 1HYBA 2CWWA 3EGXB 5FA5A 1G8SA 1ND6A 4K40A 2O1WA 2HRRA 1A5SB 3F5DA 1GGVA 2ODEA 3MOGA 3LLVA 4P98A 5AW3A 1V47A 1C3LA 1KQ3A 5DULA 3UUEA 3E82A 2HL6A 3THOA 2FSSA 1CY7A 1RYDA 1XJQA 2C5SA 1G3UA 4L5AA 4ZRDA 1MT3A 2ZROA 2H7VA 4F6CA 2Q07A 5EMNA 3P2OA 2FVXA 1MB2A 1Y4DE 4GP7A 2V9ZA 3H7IA 4H1TA 3ZGZA 1NM5A 1U3FA 1T36A 4NP6A 2PO7A 1P8JA 4LRTB 4F5EA 1Q0SA 3PDWA 4JV5B 1E2JA 5ELXA 5ALJA 2JLCA 2WHYA 1CV2A 3E58A 4PGAA 4H6WA 2FSGA 3Q5DA 5JAIA 2D7CA 4JJ7A 2IQIA 5JTUA 2ET6A 1CQPA 4D0LB 2UUOA 1T8SA 5CEEA 1W85A 5BOSB 1F5SA 2YR0A 1H66A 4AF7A 1CNFA 2KQUA 1T9ZA 2C3PA 1YDWA 1VBNA 3D59A 4EPTA 1MX9A 2AH5A 2RBEA 4RIFA 1ITZA 1UBOS 2ZRNA 5K3DA 1E3MA 3I8XA 1U3TA 3TTXA 4X3OA 4FC6A 2OTCA 1UJ5A 1M5UA 4BO6A 3H2KA 3L06A 2GCOA 1CK4A 3IQIX 1VRWA 1GAEO 3BEOA 1FRZA 3ER8A 2J08A 3GH3A 2BRUA 1N5JA 3LQKA 4IXDA 4BWVA 2Z58A 1IYZA 3T5PA 4AXBA 4DABA 1K88A 3G68A 4HWOA 4GX2A 1B23P 4LECA 4EPWA 1RBZA 3I4FA 3JPYA 4IQ8A 4OA8A 4HSGA 4JUBA 4EGCB 2ZRHA 3LYLA 3X2FA 5TQ0B 2I6QA 3K0AB 4J0GA 4U3JA 4H3HB 4LGYA 4LYDA 3GEHA 3U49A 1P4SA 1Z2OX 5TQJA 1LZLA 2G5GX 1ANKA 1GR1A 1RYEA 1XMIA 1PL6A 3CNNA 1K4YA 3HFJA 2J9GA 4G09A 2J09A 4P38A 3JZFA 5LQSA 2I71A 2IUYA 2B4YA 2VK2A 3CRW1 1M2NA 2PQ0A 4Q19A 1Q1GA 4PBSA 4X24A 4BE9A 1P39A 4ZVMA 5F2OA 3MXOA 4N0EA 1E3DA 2JJ1D 1JHDA 1A2BA 1ZUNA 1PSWA 4F4IA 1VKJA 1KDRA 4L6CA 4R84A 4QJIA 4RSHA 3FMOB 1JLRA 2AG8A 4DOMA 1QYWA 1SZPA 4Z4IA 4TWAA 1SD2A 1UXJA 2VPIA 2C04A 5J5AA 1WF3A 3TLXA 4WZAE 3HXLA 4DR2B 3LQ4A 3G9UA 1R0RE 1DSSG 2WKQA 5EL0A 5B1HA 1E3QA 1RZRD 5LR6A 4DG5A 5KNBD 1FLDA 1KSHA 4ZVKA 3IPRA 4N9QA 3H2YA 3P2EA 1YF3A 3HJUA 3PTAA 2FH5B 2WYVA 5EKUA 4DIMA 5G40A 3QELA 1P0MA 3DO5A 1NNLA 1JLLA 3FDZB 3L0DA 3QQPA 4LF9B 1NSTA 2JHCA 3D2LA 2IV3A 3WLKX 1YZGA 3SN6A 5LM3A 3VPSA 4E08A 2NU6A 1HO3A 4DIEA 3RSQA 2AW5A 1W96A 2C82A 1QF7A 3I42A 4BAGA 4XSGA 3I72A 1FNMA 4TMZA 1G59A 4M9CA 2DFNA 2QMHA 3EGCA 1ZI8A 3IP9A 3BMOA 1E6KA 3AF2A 3DB1A 2ZYSA 3PK0A 3ZD8A 4EG4A 4ZMBA 4DLYA 3KKKA 1FNBA 1L7DA 1WUHS 5FFNA 4AP5A 4ZPXA 2JI6A 2OBXA 4CFSA 1EE9A 2VN8A 4PPFA 3X1DA 4Z2YA 2VDNB 4XYMA 4DC9A 3SK0A 4NIMA 4PZEA 4KR9A 2LDXA 2VH1A 3LC7O 4C4SA 3N28A 4RHEA 4E5KA 1F8FA 3E9QA 4YO7A 3AY7A 5HKLA 5I3CA 2ZJ8A 1KZ9A 3KL4A 1NOKA 1UAAA 4AO8A 4U6QA 1D6SA 3MYYA 4MUKA 1LSUA 1PG2A 1ZBDA 3IAUA 1AUOA 4FMPA 3RYFB 5MDHA 4LOLA 1E2GA 3WDLA 4DVGA 1LXCA 4QREA 4CJXA 2NTJA 4GOOD 3OQMA 4CI9A 4IIXA 3Q7QA 1M0WA 3GI1A 2DFLA 4ZOBA 4DCVA 2C4UA 2P9JA 2ODAA 1ZD9A 4F60A 1Z82A 5KNBH 1XHLA 1IRXA 3QRWA 1QRDA 4IRMA 4E2ZA 1JLKA 3OETA 2E55A 3ND7A 4FR2A 3P0IA 4HAXA 2Z5LA 5CJJA 3OZBA 5IBQA 1C1XA 2QPTA 3CSUA 1KAGA 5K8JB 1FFBA 3IJPA 1GO2A 1KDOA 3NEAA 4NBSA 1P77A 4JVMA 4QBFA 3ITNA 3GJTA 4UPVA 2BHLA 1QFSA 1WXFA 2W6MA 4PE5B 4IIJB 5GAJA 2XB6A 4Y2UA 3G0CA 3S8YA 2A33A 1GSIA 1N6KA 2GARA 4PNEA 3CNHA 5ALKA 1AQUA 5ALVA 4KREA 2D2FA 2IWRA 2HA4A 4JJFA 3OEHD 3DYIA 5ULLA 3F49S 1USGA 4H0CA 4NTZA 4QLOA 4EGSA 1G3QA 2EW1A 5TMDA 2J1LA 4DBZA 1I3OA 3ABSB 4LZOA 4DUPA 2O1SA 2WJWA 4C6TA 2H51A 1LC3A 4OLFA 5EP3A 2OLJA 3CG4A 3KEGA 1V6SA 3SF0A 3TZEA 1BU5A 1FYEA 3WLHA 2VHTA 5C1BA 1N5KA 3LWNA 1OX6A 1V2HE 5CIQA 4EL0A 2CNLA 1U1FA 2ZJOA 1AX9A 4TZKA 1GIAA 1QSGA 5DNUA 2R66A 2GN4A 1KK3A 3PQFA 2XD9A 4OGWA 2IS6A 1LBIA 3EWIA 3KIPA 2DPLA 2EJVA 4RO0A 1J5EB 3RU9A 1HT2E 2GCNA 2GHIA 3EVZA 3MILA 3KEMA 4ID9A 5D3KA 5EVJA 1RQ2A 4GMKA 5ICGA 2CBXA 4FBGA 1DGQA 3O8CA 1E2DA 1ZU5A 1RD4A 2L18A 2VYVD 3AUSA 3I04A 3M6FA 3FUUA 1RKXA 4IVRA 3U3XA 4DQLA 4IEIA 1EFUA 2XNSA 2Q99A 3FMPB 3P4XA 4ALNA 4F4CA 2XUKA 3DVRX 5I8PA 5CLQA 3I8SA 4PV7A 3ZJYA 3N2GB 4AKIA 2MSKA 3QEOA 1H1DA 2VDPB 1AK9A 4WLEA 5IUNC 1R0XA 2ODPA 5JY6A 5GOTA 1YA4A 4A6EA 1YOVB 4DMRA 1L3IA 4FGKA 2PKQO 4IUBS 2JAXA 5AM1A 3T5GA 4U39A 4UM9B 3LHFA 2DTDA 1WM1A 4MV4A 2BGTA 2RDMA 3K7EA 4DEVA 2X0NA 1A27A 1AKNA 2W0MA 1NRIA 4DCGA 3PEEA 2AJBA 4K03A 4DUZB 1YU6A 2OKGA 3SMVA 5CLHA 3CLVA 3D6AA 2COEA 1WMEA 1YUMA 2ODBA 1PCXA 2XSZA 5IC4A 5J43A 1O0CA 4CUZA 4KLCA 5JI3E 1LK5A 4WA7A 5BSMA 4E70A 2WIBA 5CB6A 2OCPA 3DXFA 5FJJA 3L4BA 1T6XA 2ZBEA 5DNEA 4IMJB 4BEJA 4X92A 5IDXA 1KSJA 4RK7A 3H9UA 5B64A 3IIEA 3FTNA 3EULA 2SNIE 1IATA 4P4TA 3VSAA 2QYTA 5IHPA 1E2QA 2Y1GA 3CF0A 1UP6A 3AB8A 4ZYYA 8ADHA 3K8OE 1L8LA 4OP2A 1AGNA 4DCPA 3QPDA 4KEAA 4Q34A 1JAYA 1XROA 3WZLA 1VCMA 1R27A 5KCZA 4GMFA 1PG5A 2F64A 3MBIA 3RSZA 1W46A 2ZT5A 5KNDA 1NXSA 2R8OA 4DLAA 1MJ5A 1YCFA 3H4IA 2XA1A 3NEYA 3LQ1A 3GEPA 4MR7B 4OHCA 2PPLA 1T29A 1W7AA 1IBCA 1BX1A 3OCJA 1K7SN 5B4TA 3WBBA 1MIOA 3W0LB 1WHSA 4EA6A 3BGWA 3LWDA 5DVZA 4DANA 3AKCA 3AM1A 2IIVA 2R48A 2ZYIA 2Q21A 2IX9A 2WVHA 3T1OA 3KKOA 1U65A 4GZ5A 3WE7A 2HGZA 4PIVA 3WTBA 3R09A 1U28A 4DSUA 1JIVA 4DSAA 1YR6A 3ELDA 1IE3A 2ZFUA 2ENUA 2Q2OA 2YS7A 4PYOA 1N2XA 5TXGA 1Z47A 4D4LA 4FZ3A 5CB0A 2ZVJA 4UBJA 2R6GA 1GZ3A 4MQEA 3HCRA 3TSAA 4BP9A 2RG1A 5JHGB 3SS8A 2NXNA 3B3AA 3DTVD 3PGKA 3ROGA 2FW7A 2CZGA 2KLHA 3LLCA 1IJKA 3D2CA 4N54A 4EA7A 3R0ZA 4I66A 4C2BA 4Y1GA 1LF5A 1O4VA 3D1LA 3QVJA 4U2FA 4UZFA 1USUA 5D86A 3M1LA 4OVKA 4WRRA 2C2KA 4JKYA 3KALA 3UB4A 4CTMA 2WM9B 4KQIA 3L0OA 4RDCA 4K6HA 3DEYX 4AZWA 3FVRA 1WSAA 3UW3A 2VZLA 1BMDA 3KB1A 3T3HA 3FRJA 4XUDA 2GFHA 3IJ5A 1VLQA 2H4FA 3LY7A 3Q3VA 3V1LA 1TLTA 3EIUA 1VMKA 1QMPA 1CRLA 1QHHA 3AU8A 2I2WA 3DBHA 2OFOA 4IS3A 3WWPA 3VHQA 1QVAA 1KAMA 4M1TA 3EMBA 3S99A 4BRWA 4DLBA 4JMPA 1RXSA 3EGIA 4DG9A 4L3WA 5B30A 5DCWA 1ISPA 2C5FA 3VUEA 2ZRFA 3KSDO 3S2FA 4V3CA 4C7MA 1H2RS 2AQKA 1GR0A 2Y0PA 1CEEA 1NAHA 3DO6A 5KYNA 5D7NA 2BUAA 3BQMB 2C95A 3TM4A 1RWKA 4R8LA 3QWBA 1GNPA 2AE1A 2B2CA 3HKBA 1DFHA 3WDMA 3QOYA 1TQDA 5DOZA 3KZXA 5TGTA 3JAWB 2C2YA 4HWGA 4XLZA 4JYAB 3L3BA 4NNOA 3HY3A 1KZYC 1UXOA 3IAXA 1JFVA 3QVVA 4L8YA 1U0GA 1XXLA 3GDGA 3KOXA 5TPZD 3WLNA 4J75A 1YQWA 5JNVA 3TKAA 3SR0A 2FMXA 3LVFO 1URPA 5CFPA 1O96B 1HE3A 1XEWX 3KV1A 2H31A 4PPYA 2VUTA 5L9AA 1OH5A 4TTSA 2ORVA 3NT5A 3MTIA 4HZUB 4RACA 3K35A 1W76A 1ZVMA 4OUDA 4F85A 3GP5A 2QY9A 3OLWA 4FJ0A 2BTQB 2FR8C 1W5EA 1XD2A 3CX6A 4FHFA 1W29A 4OATA 1XRPA 5CIYA 2D0PB 4C7OA 1AIPA 3CZ5A 1CB0A 4EM6A 4YJ3A 1ZMXA 1EZZA 4YRPA 4N1AA 1Z88A 1GOTA 1REQA 1B2RA 2NU8B 2PD3A 3QU7A 5A2QA 2FUG1 4LOJA 2DWUA 4PQEA 1I7DA 3W5SA 4P3YA 1A98A 4RF3A 3DDHA 2AC4A 4AVYA 4C21A 1CHDA 1T4BA 4KGXA 2MR5A 5JPIA 1D1SA 2X7JA 1RWVA 2FPXA 1J9ZA 3VAAA 1V8PA 1LDEA 1Y7TA 3KM0A 3VTZA 4HQ6A 4GWKA 4AWBA 4LPSA 1KMIY 3BZWA 4O4LF 3IQFA 1X74A 4V0RA 4JI6B 1OYOA 4EFDA 2QN6A 1PLKA 3CSDA 4F3TA 2QVLA 1IN1A 3TAHA 1XYGA 3UK0A 1Y3FE 4YJGA 1VBKA 2BI8A 3VPXA 4NH4A 3KYJB 2IOQA 2YJ5A 4HRXA 3I6ZA 3OQPA 3GLUA 3N8HA 3A2MA 1U94A 3UCXA 1G1AA 3A70A 4UMVA 3PHLA 3VV2A 3N2YA 2FSPA 2FPIB 2PFSA 1QX3A 3GZ4A 4KMMA 4PQFA 1SZDA 4PSCA 4BNTA 4M98A 5JSKA 4FDLA 5FULA 4BJ5A 1OT5A 2PQ2A 3CYFA 5HPYB 2OBNA 5D3QA 1T0HB 2P2CA 4PG5A 1PF7E 2IOYA 4I4TB 2C2HA 1P0PA 3TPFA 5KWSA 2YIJA 3JD4A 1I4WA 1XYVA 2J0SA 4M53A 3T95A 4AJOA 5FWXB 3I5MA 1JKIA 4P5DA 3IBCA 1YJAA 4ZT4A 3T52A 521PA 3NLLA 4DDUA 1OIXA 2NU7B 1PNVA 1XP8A 1L1FA 3T5TA 2ATXA 3ECSA 5JATA 4KDFA 1KO1A 2X4GA 4LNHA 4Q4CA 3L02A 2CMGA 1CVLA 1DAFA 1NURA 1OAOA 1QYCA 2FP3A 1SR8A 4ZHQA 1LBSA 3TLCA 1DX6A 5L8VA 1UP7A 4HH3C 1Z2DA 3B78A 3L0IB 1MNAA 3VH3A 5T5QA 4UUPA 3F97A 2BEUB 3UAVA 5LC1A 1EDBA 5FB3A 4BV3A 4BAZA 2VHEA 5SY6A 1SELA 3I0ZA 4Q48A 3F47A 5TSDA 1VSUA 3FPAA 2PEYA 4O4IA 3R6LA 3MINB 2OXIA 4A2WA 4LMBA 4RWEA 2IHBA 3U56A 4YPVA 3MJRA 5DNAA 1KOJA 5LYYA 1M73E 3KV3O 5CD9A 2O3RA 5CH5A 4CF6A 2ZKIA 5GONF 1VC2A 1D3AA 1H6BA 1VFPA 2Z8ZA 2NV2B 4OI4A 4JXZA 1EIWA 3EBPA 4C0KA 1O5IA 1A04A 1FXSA 1R12A 1G98A 3PXBA 5HM6A 1N3IA 5HBGA 2UZIR 2E89A 4MQLA 1GLGA 2VHVA 3K1AB 5LMUB 1I5RA 5DI3B 4YP9A 1G6OA 3NOOA 3PYLA 3UH1A 3NIWA 2Y1FA 3QLEA 1PD1A 5EXTA 3WLAA 3UMMA 5CGZA 3FLMA 4UUQA 1LV8A 2J48A 1WPQA 4BKQA 2AW3A 5F2KA 4DMHA 1NNSA 2F67A 2ZYVX 3PD0A 1RRFA 1SHTX 1RYYA 5LZ7A 2KW5A 2YXNA 2ZRKA 4UE2A 1GFZA 4NBWA 3ZQUA 2KX7A 2NSHA 4FSXA 3OU2A 1ZW6A 1C9KA 2XV1A 1BMQA 2R8RA 4MB0A 5L3ZA 3VOBA 1ZNWA 1E9RA 1II0A 1U81A 4LC1A 3OIVA 1JHZA 2VF2A 3ELUA 3C3DA 3N3BC 1L7QA 1RYBA 1SCJA 2NAPA 3LXRA 4D56A 3AUYA 4HEHA 1OY1A 3ETLA 4L9SA 2E18A 1XVTA 3MD0A 4HQFA 4AICA 1AO3A 2ZYHA 1DJNA 4F04A 3K09C 1Y9ZA 1KEUA 2B3DA 1Y42X 5CLIA 4ZK2A 3O8BA 3BTVA 5KTSA 1K98A 1JQEA 1OKKD 3WNVA 3U6BA 2HDHA 2O2GA 3PP8A 3AGPA 1SCDA 2JJMA 1MCZA 4I9NA 5L4SA 1JG6A 4RTLA 2XB2A 1XVAA 1U0JA 5E6RB 1DXOA 4TMXA 1V39A 4MH0R 2G7MC 1RJEA 2ZAGA 3D3EA 3JQRA 3U4IA 3ZI7A 5EESA 4X8LA 4ZVRA 3KFLA 1LNQA 2O3TA 4CIVA 4E03A 4FX5A 421PA 4HDKB 1ZINA 5HIAA 3GFFA 3A9RA 4RZIA 4JS0A 4XD7D 3PD1A 3UJ8A 3UM9A 2IIPA 3EB9A 2B8JA 3O92A 4TVBA 1X7DA 2R6DA 3BSSA 3MMPA 3HSSA 1RMTA 2IP1A 3L1VA 3LBNA 1NUPA 3R6TA 4MICA 3FVWA 2P9EA 4FHEA 2GA9A 2V7EA 1FMCA 2NZVG 4I6JA 1ZQ9A 4GXTA 3VNVA 4DNFA 3AM3A 3N2NA 4W99A 2VL7A 4JX8A 1X80B 3OE1A 2R751 1USWA 2VEDA 3ADKA 4B2LA 3GRPA 3ZVMA 3QYPA 2DHQA 2DFTA 4K81B 1CT9A 2W6JA 4GDMA 1G8AA 4BZPA 3RBZA 3RFTA 4TMYA 2N3ZA 1A5TA 3NPAA 1KI1A 2KI5A 5DE3A 1DNPA 4YRJA 3JWHA 3O1IC 1BWPA 2IYAA 1E3LA 3MUFA 1I2AA 4MGEA 4G37A 1D2MA 2WIFA 3UJ9A 3FRIA 1GTL1 2XKBA 4JBIA 4K9LA 3ABOB 4PN3A 2BH9A 3FUTA 1J8FA 2PNJA 1NZFA 3RS5A 2P9CA 1H2HA 4QDKA 3WYGA 3AVTA 2O5EA 2B78A 4OB6A 4AJIA 1VRCA 4B6EA 4ND3A 2IXGA 3RVOA 2IIBA 2ARKA 3VPCA 4EWLA 2DWCA 2HO4A 4ZT3A 5FUWA 4EKGA 1A9TA 4MGIR 1OBFO 5CM8B 3GDHA 1NKTA 4ZOLB 5DXFA 2AG1A 3AW8A 4CV2A 1SVIA 4Q5IA 3KPYA 3O93A 3WGIA 4LDAA 1OX5A 2GTHA 1CQIB 2ZXFA 3LWBA 3RASA 1ZK3A 4TRNA 1UK7A 2IWHA 4NEQA 1EZ1A 5TC4A 2DBVO 1YI8A 2PUHA 5I7AA 3RRMA 2HX1A 3ZLJA 4CMCA 1A9XA 3KD2A 1TUGA 3PHHA 4RMNA 3SJAA 4ARCA 4B3CA 2NMVA 2AV6A 3JSAA 3GCDA 1ADJA 3ZYZA 4MCHA 5EEHA 4HX2A 4BQQA 1N4AA 5DH9A 4AD8A 2AOWA 4HOYA 3K5HA 5JYBA 1XQ6A 3ASZA 1O95D 1S02A 3FYUB 1DIGA 4EIWA 4RSMA 2QTWB 1FFWA 2A7QA 2I3ZA 2Q6TA 2WYOA 2DJ5A 3L82B 1M1NA 3GEEA 4F5ZA 1GFSA 5CCBA 3AEZA 4C0WA 1XZHA 2CXXA 1MOSA 3LA6A 3CISA 4HFNA 3WFZA 1J39A 4EW1A 1I4DD 1TTHA 3FNGA 2QX7A 4C0SA 4AG3A 4JD5A 3FZEA 4M88A 1CR1A 2LBPA 4PY2A 4F5WA 4ZQFA 1PGQA 1KFEB 3UFXA 3GIDA 4HEJA 1E8MA 2VAMA 4Z4FA 1YL7A 4FLMA 4YLEA 2C97A 2Q5HA 3A28A 1KWGA 3F46A 1RNLA 1DXHA 3WOHA 5CTAA 3OQIB 4DCJA 3OSZA 1JE1A 3E2MA 1VL0A 4BPRA 3O8QB 4BNYA 4AF8A 4QRIA 1CJSA 2E5FA 3NQ41 3U19A 2I33A 1G2PA 2VDJA 3GEDA 3LX6A 4GAEA 1LB1B 2HDNB 1QCYA 3AI2A 1CDDA 2ZRMA 3H2IA 3IPAA 1ODLA 5JSHA 2W5UA 3N7AA 4UE3S 3T4XA 4DV6B 1AJEA 3FBGA 3PX3A 1DJOA 2I3AA 4X1IB 3VKFA 2VI5A 3VU3A 3K0FB 1M2JA 4FMDF 5HR5A 5B4VA 4LJAA 3HEMA 4HDRB 4LZAA 1JMVA 4WTOA 1O5TA 1QIIA 2JGDA 4GKBA 1S7GA 3RS0A 4RVOA 1P7ZA 3FNBA 3RK4A 5E1OA 4D9FA 5C7YA 2GGSA 5C8XA 2YZ2A 3SYTA 1U2GA 1NOJA 4JT8A 2JK1A 4F9TA 2XMPA 2XMRA 2YHBA 5F5NA 1IXSB 2Q7OE 4RZHA 3F5MA 4D0NA 4PFKA 1YTUA 5JC1A 1D4FA 1KAQA 1PBTA 1MW8X 1ZH4A 3TG8A 2OLEA 4Q00A 2Q7XA 2ZS7A 2JJ8A 1OHHA 1OBCA 3H86A 1ETUA 3STTA 3O3MB 4ZYTA 3DVAB 3W8FA 1G8GA 1OZHA 4X1YA 1LSOA 5G2OA 4EBBA 2ZSDA 4MRMB 4ZKDA 3TPCA 2NT4A 3BHNA 2UUBB 4IILA 2FEKA 4KN8A 4RHCA 5JCJD 2YWEA 1F17A 4XSHA 1PR1A 5D85A 2CLIB 2PWPA 4JDPA 2R87A 4KQ2A 4X1KA 4P2BA 4UCXA 3O3OB 4A2PA 4FCCA 2EGGA 4Y2GA 4G85A 2GUGA 4MV3A 4NCHA 4YS6A 1XD9A 3LOUA 3G2IA 5CX1B 3VFDA 1NMQA 1TMYA 3VOTA 1BHSA 2JJQA 1IPEA 4I50F 4P7JA 1GPJA 1QVWA 5KDLA 3OPNA 1SUPA 2P9ZA 5DTEA 1YHYA 4D4KA 3EDRA 3GZNB 3NT4A 1ABEA 3FJYA 2OZPA 3W2GA 5FV4A 1NXPA 1SUAA 1UH5A 2ON6A 3BC1A 3BMQB 4D82A 1HDCA 2VKQA 4JP2A 1YNSA 1E58A 1SXJC 5B2ZA 1UBHS 2FI1A 2HQRA 1C7EA 2XWJI 3BMNB 3FSGD 3I9FA 5TT1A 5JXHA 1NBWB 3CVOA 3KLPX 4EB8A 1BMFA 2D2IA 3C8ZA 5LP6C 4LZZA 3ZQJA 3B1KA 4TKLA 1J7JA 5EQFA 2Z8XA 3QFFA 4MLZA 1HBJA 1TDJA 1Q17A 2Y71A 3SICE 4XDYA 2HT6A 1TZMA 8OHMA 3U44B 3SJUA 3GH1A 1QRTA 3JQBC 1O87A 4R98A 2O3QA 4D9IA 3CZRA 1ZMOA 1DKRA 2Q3HA 4L75A 4WJKB 4X85A 3WICA 3QLTA 4BTLA 1R4MB 2L82A 4ND1A 2RKBA 3V2IA 3PQEA 3QSYA 1ZZGA 2W9XA 2ZDHA 1HNXB 3DZ8A 4M0FA 5CA1A 4HYEA 3PF8A 4DV4B 4JI7B 1F2UB 1FSZA 1Y1TA 2Q5LA 3HE3A 2EQBA 3NHLA 4HQOA 3ZQ4A 1XU7A 4BLPA 6REQA 5MFZA 1WBDA 1OH6A 621PA 3QX7A 3ZCRA 1NL3A 1NGSA 2WINI 5B4UA 1Y81A 4WXEA 3IVGA 3OX2A 4YJFA 3PGLA 4CTKA 5K6RA 3MT7A 2JLWA 3G85A 2A5GA 2ZS9A 4BNMA 3DCNA 2YH2A 3C43A 5FTKA 2QW8A 1BJKA 2BAGA 1ISRA 4LXUA 1WB4A 1L4GA 3IV6A 3HBMA 1N6IA 1U9CA 5EXDA 4G5QA 1QZXA 2H11A 5IDYA 2AOXA 5TQ2A 4KXUA 4G0WA 1WAMA 4BHTA 1SJ9A 4V2UA 3ZGOA 5ITZB 2FG6C 2UZ0A 3TGPA 2D7DA 3RB8A 1NW8A 2IBSA 1H2BA 3ZZNA 1KK0A 3QNMA 2H1LA 1E5XA 1KJZA 3WMGA 5AJYA 2P78A 2XT9A 3GMDA 2DFDA 3NTRA 3ZZ1A 1NIJA 2FLWA 2VF4X 1DXQA 1EFKA 2C1EA 2Z5VA 4FFPA 5COAA 5DN6D 5K0CA 2LGJA 1NW9B 3GARA 4ARBA 3DAHA 2Y67A 3WGZA 2ZZMA 2AZDA 1MO5A 3SQMA 4CKEA 3P9NA 2XYRA 3WC4A 1GITA 3U62A 1G7SA 4NU8X 2OXTA 3GU3A 3SYRA 2LKCA 4M0UA 1XPUA 3L4JA 2H4WA 3GOHA 3Q2IA 4HDSB 2YMPA 4Y2VA 1HG0A 4IX9A 1EGAA 3SBXA 3FAZA 3O4RA 1GL3A 2AYXA 1FL9A 1K4KA 2RSLA 1BE0A 2TRSB 4YAEA 3KXKA 2WSBA 3NGMA 4ZCIA 1TO6A 2GT1A 2PRYA 3OA0A 3O8OA 5CXQA 2FYTA 1IWOA 1FYVA 1M5RA 1BNCA 5ALSA 5HW0A 2O2YA 3EZNA 3ISJA 4G0OA 3G1TA 4HR7A 1SVSA 4H1UA 3QH4A 3R0XA 3IODA 4GLJA 4OH7A 4RAOA 1JUDA 1PVOA 2JIRA 5L7TA 2MMGA 2OBYA 3PA6A 4TYPA 5DHRA 3AJDA 3CUWA 3TOSA 2HMVA 4QPCA 2VP2A 5COQA 2CHQA 1QYXA 3M82A 1FFCA 3FPKA 1OWMA 1V43A 2GYUA 1V3UA 3O31A 4JB3A 4E7PA 1B4DA 1T9HA 4LJ5A 1LJLA 3UMCA 4ENVA 3ZDCA 2AMLA 4MVXA 2J9RA 2FW0A 4QTXA 4WFQA 3W6NA 2JKYA 5JW6A 2D4AA 1YC5A 4UD2A 3HM9A 4IAOA 1W5AA 4FZ5A 5FI3A 4HMPA 3TNFA 4UPDA 3PSHA 1ZK2A 2BFDA 2XY4A 3AJAA 4RIGA 3B70A 1CY8A 1YDHA 5CT6A 4DDTA 3U09A 4TWIA 3OZDA 3DWIA 3GMSA 4JVOA 3ROTA 1M0TA 1G8FA 4L72A 4P3PA 1HYEA 1UIRA 3T3DA 5E2BA 3A3YA 3QWIA 2WVGA 4AAYA 1J0AA 1RM0A 2K7ZA 3R44A 1RYFA 1DMRA 4TS4A 3FLEA 4ZV9A 3OC6A 2NO9A 1QMGA 2GEJA 4N6NA 5C1OA 1JZQA 2YJ6A 3I0MA 4G8DA 4RJ2A 2D2XA 2N75A 1M6WA 4RE5A 3R7SA 1FMTA 1RS0A 3M4YA 1VG0B 4BVJA 1K3FA 1VSBA 2E3JA 4MEAA 2VJBA 3DHNA 1PT9A 1QP0A 4EMSA 4UZSA 2HIHA 3MJHA 5J47A 2R96A 3DULA 2IF2A 1SEVA 3B1XA 4JKIA 1BGWA 2DP4E 2AVNA 2EAUA 4O8CA 2EV9A 3FY4A 3CURA 3V2UA 1T4CA 1PWEA 4G0QA 3WDKA 4RDIA 5EIWA 3ZE7A 2BHSA 3HCPA 2FP4A 4XX0A 4BJHB 3WGVA 5KYXB 1W9HA 1QLJA 4HLUC 5H9WA 4P7BA 3CSSA 5IW8A 2MSNA 3PFHA 5MN5A 4O0LA 1P5ZB 1JJVA 3MEQA 3O0DA 1FDOA 1GCUA 3EDYA 1OREA 1JHXA 2HO5A 2HRCA 2P77A 4OYRA 3BJZA 1EWVA 1P45A 1TADA 3LJKA 3NIFB 3BH6A 1ZSVA 4IHKA 1BXRB 3KSBC 3ASVA 3UJ3X 3T5BA 3BCHA 4MTLA 5KTPA 4FNOA 3RC3A 4RL6A 4Y30A 1T2EA 1CF9A 1B14A 2ZYGA 3QX9A 4HX9A 2DWOA 5KREA 4MYCA 4QHTA 3THYB 2CLDX 5AT1A 1Q7BA 2JCBA 4IDEA 4CF5A 2N1BA 4WNAA 4YPOA 3MJVA 1N7IA 1R4AA 5B6JA 5JJIA 1D9ZA 1XDWA 2C94A 1W48A 4CQMB 3K70B 3CEJA 4X84A 1F51E 1YS9A 4FZVA 2JFZA 4M8NE 3BORA 4LY9A 3E61A 1J5XA 1QTRA 2PJDA 4H6PA 4O8ZA 1RXEA 4J2TA 4MVJF 4WFKA 1J9EA 5FPSA 3H0KA 2IP4A 1F8GA 1WUIS 2ISQA 3AXTA 3KTAB 4MV1A 4S12A 3A1DA 3QBTA 3FZYA 1EVJA 3R75A 3WNZA 3TCNA 4AURA 1Q6ZA 3TTVA 1G9SA 2G6TA 2VP6A 1I80A 2IVZA 3FRHA 3KKQA 4ITRC 5L7YA 3T3OA 2IPLA 5D1HA 2HA5A 4YEDA 5EOVA 2C96A 4A10A 3NDJA 3NBYC 3VBCA 2HQBA 3COZA 1F5NA 1ISFA 1CRZA 1ORRA 4D45A 1M2EA 1E61A 4LWZA 1GT91 4A8JB 2YJ3A 2IYXA 4AY4A 2OWDA 4CW7A 1P6QA 2LCFA 1UZLA 1D6MA 4PX3A 2D00A 4MAMA 1M66A 5HA5A 4WGFA 4QTYA 3BRWA 4OSOA 1XVIA 3BGIA 5G4KA 3URMA 3X43A 5TJ9A 2M2IA 1BDIA 4CIDA 4IUCS 3V4PB 3O1LA 1A9SA 1IAVA 4M83A 4UMFA 4DJEC 2ZAMA 3PQ7A 2W43A 3U48A 4HNUA 1QG6A 4TTPA 3OFNA 5AP9A 3AU9A 3IDAA 1VG8A 2EFCB 4L76A 5CFLA 2XECA 3ASUA 5IJXA 4DVJA 4F56A 4YRRA 5A6SA 3U7GA 2LWIA 1XR3A 1UODA 1XLUA 1BCSB 4PO3X 1S2DA 1Z8FA 1G21B 1E9AA 3D8NA 4N6GA 2RH9B 2CW5A 3F7MA 3VSDA 4FUTA 4BBPA 3DWFA 3I23A 2QMUA 2QY6A 4UTOA 2Q27A 1PWZA 1E18A 2EFJA 1DXYA 2OVFA 3ZLTA 4ALLA 3M6LA 3BM5A 4G23A 4KODA 3VR0A 2QD4A 3AEUB 3UYKA 1P1BA 2HH9A 1QGOA 1ZW1A 4RV5A 1HSZA 4FFLA 3GGSA 3QKTA 3EZGA 3GFSA 2QXUA 4BYMA 3ZJTA 2XBMA 2CGEA 1U2SA 2Q9BA 5AKKA 5DV9A 3IEIA 4BWGA 2WA1A 3IHTA 5LL6P 4KDRA 3CUUA 3G2KA 4OCZA 5DF1A 5BNFA 1HDRA 3HPRA 1KMHB 1PS9A 3A6KA 1E2MA 1E0JA 2IXDA 4QHYA 4RZSA 3SHVA 5KWIA 2BKUA 1TIPA 2ZUCA 1XX6A 2WAAA 4PSAA 1F20A 5JD6A 5JO0A 1QAQA 1K5DA 1IZYA 1HE1C 4HATA 1CLEA 5G0SA 1C0LA 2A9VA 2OV6A 3H9JA 3HNOA 1YQDA 4RSGA 2MSEB 3JU3A 1CC1S 4XM0A 4FK8A 4YRCA 3D43A 4BDSA 1RQ7A 2PD4A 1WD7A 3C6XA 2JDID 4OY3A 4X5OA 5AXAA 2PRKA 1L5QA 3V1TC 2Q4DA 4DLXA 1KRWA 1DQRA 1G20B 1NMXA 4CM9D 1A8HA 1BH2A 3D5QA 1S2MA 1Z0AA 3DD1A 3HSKA 1XJ5A 3HCAA 2H2WA 3JRNA 3UY4A 3EWSA 2KWIA 5GM1A 1XDGA 4E2YA 1MXFA 4MHSA 1GV1A 2CF5A 3R20A 4K6GA 3SSNA 3ZK7A 3C74A 3WGHA 3VO9A 3IL2A 1CR2A 3GAMA 3K0AA 5FBKA 2QD1A 1CUZA 3NJ8A 3P2JA 1L5NA 2IZ1A 1J33A 2CD9A 1ZGBA 4HO1X 3RIMA 2AFRA 1X1AA 1R9GA 1ZXLA 2ZETA 4G1BA 5LQUA 2ACWA 1OH7A 3Q6NA 3ZNPA 1TZCA 3K9GA 2C29D 3TRJA 4KQ6A 2H1IA 4Z4HA 2DQKA 3AKDA 5JYEA 3S29A 1HDOA 2VJCA 4PAMA 3OCZA 3LBAA 4PLFA 5J9FA 1U7ZA 3DOJA 4HN9A 1VI5A 1UJNA 5F3DA 5GONB 4A92A 3UWSA 1TA0A 1JBQA 3ADCA 3DBRB 1AXRA 1ZAYA 4O1HA 3OQ6A 5AWFC 1E5LA 3OLCX 4IH9A 4NONA 1DE0A 2PANA 5FQNA 4KRXA 3U13A 4AJPA 4BWFB 3HCCA 1KH2A 3C3JA 1U0NA 2QPLA 5EPOA 4BC0A 5FPTA 4C0BA 1VDZA 3PDCA 4MS1A 3LGXA 2PBRA 5A5DA 1QZ3A 2JPDA 5F4BA 1TE2A 2FMTA 3BIFA 4N3BA 5FNVA 2MDTA 3M0EA 2C5HA 4KLRA 2W4IA 3N70A 3NRCA 3S8EA 3OZGA 1IXYA 3BA6A 5TY0A 1QKIA 2ACVA 3MBKA 4MHOA 3F71A 1Y82A 3ZY6A 3PC7A 3LZDA 1NMSA 3LC2O 1VKZA 3QHQA 4OGGA 4PTLA 4E51A 1G4UR 3UHJA 3BE4A 3DR3A 4MS3B 3O83A 4F4HA 4WT7A 3OF2A 4AP9A 1E6LA 2XVMA 3FDZA 3HO8A 1MW9X 1UFVA 4CDGA 1O08A 4F97A 4RS4A 5HZMA 1DIBA 5B6PA 1F9AA 3BHIA 5LWHA 1JB1A 4DCUA 5LA6B 2GETA 3OHPA 3C70A 3S2GA 4M8IA 1NE2A 3WKAA 4PHCA 2R8PA 2PS3A 1K7XB 4C7JA 4MLPA 3VPDA 4PR0A 4N5DA 5CT5A 2JFWA 2BR4A 2OM2A 4UE6A 4CZ2A 1J25A 1QTIA 3EZ2A 3M4JA 3TW0A 3KETA 4WOPA 4UDOA 1U3UA 2D1YA 1KZ6A 4GOXA 4B7ZA 3WS7A 1OA1A 1M8FA 2IHYA 1CVRA 1Y4AE 1MEEA 3OKPA 5H81A 1OI2A 3LO8A 4P3NA 2YTZA 2VHCA 1BCRA 3UAZA 1QNFA 5BV2P 3P0RA 3F6YA 4LOKA 4UVGA 4BNKA 1MXHA 4AS3A 3B3QA 4KXNA 1CYDA 4IDDA 4I8DA 1AO0A 1X94A 4J7UA 4YCCA 1HNNA 2ZB4A 3RYFA 2A30A 5CK5A 3TDKA 4P0QB 4C14A 5C5CA 1JJIA 4DIFA 2YC4C 2IBTA 3A1TA 1GILA 2C2MA 2XVAA 1GL9B 3F6PA 4YRAA 4QGBA 4EYEA 3DR5A 1LRLA 1TCBA 2R6AA 2Z6UA 2JCVA 4FLEA 3SIWA 3NTUA 2QSYA 1OMOA 1L9KA 5K4AA 1ZVVA 1MX5A 3HU3A 4DR4B 2PT5A 4Q15A 4MKIA 3RHSA 5JTTA 4M9UA 3C3EA 1E69A 3KBOA 4QOSA 3L92A 1WY5A 2CK3D 4FGWA 4ZU6X 4AKEA 4IIJA 5B1SA 1QQBA 2Y9PB 4DGSA 4QDZA 4KQXA 4KQCA 4V0SA 5AW7A 3I61A 2CBZA 3QXSA 1K5HA 4FHGA 4KVFA 1GA6A 3WXMA 1M1YE 3I52A 4L07A 4MUGA 1XXHE 2ZYRA 3X1ZA 4YAUA 1VB3A 1J90A 4K05A 1W0JD 3LFUA 2DUNA 1KDYA 1SUSA 2F3TA 1KEKA 2JGLA 3QPUA 4R3UC 2GEBA 1UBFA 4FILA 1OXBB 2XB8A 3VC3A 4CU2A 2DQYA 2WTBA 4HL6A 5ILGA 2ZU6A 1YZYA 3DBLA 4Y0AA 3ORYA 1WBJB 1GPLA 1X70A 5K0TA 1N25A 2WQZA 3T5DA 2BJWA 3W5HA 5B55A 2DR2A 2MIIA 4KB5A 4WK2B 4CEJA 4ZI2A 4B85A 4LSMA 3RS3A 1A5ZA 2Q3CA 5DGHA 2FJPA 4NMHA 5ADUS 2NO6A 1NBIA 1EJ0A 1J7KA 3ZWQA 2PWAA 1BTOA 1L7RA 2OHJA 2IDKA 3E7XA 2NYAA 4UBIA 4LWQA 2H63A 3GLIE 4DLSA 4UEJA 2QN8A 1NUSA 4JA2A 5DW0A 1GCOA 3F6BX 4OXRA 1G2OA 4WL0A 3THXB 3BILA 5IK2D 3EA0A 3LY9A 4HFJA 4M7PA 3LH5A 1K7CA 1FLAA 5U4XA 1PFQA 1V3QE 4Y2RA 1XZNA 1X1BA 3ODGA 3WWEA 5EQDA 1CNEA 1DCMA 2MYPA 2VP4A 4EPXA 4EGAA 3JZMA 2E9SA 2HWXA 4I5GA 1QIKA 2MSWA 1GQ2A 4QOJA 1FLNA 5FUMA 4PYJA 1HWYA 1C2YA 3IULA 2WIKA 2C0QA 4CVNA 4G56A 2HW8A 2VJKA 3K32A 5CHYA 1MDBA 3NYRA 4LRXA 4LXQA 5J2TB 4I3GA 4G24A 1FVHA 1A2OA 1GQRA 2R8EA 1SFRA 1EA5A 2CVFA 2ZANA 1IK4A 3D3QA 4FBMA 4IINA 4Q1EA 5AI9A 3RSHA 4TYMA 2PUJA 1M1XB 2BDTA 2VWGA 4PLHA 3FTFA 4XPZA 5B2EA 3TE6A 2UU9B 3T0GA 4IF6A 3E8SA 5IM4A 5I7OA 5BR8B 3HFGA 3R2JA 4MV9A 3DGFC 1EG2A 5HKKD 1L7VC 2Q3FA 4P82A 4BEWA 2YBDA 4LDQA 1SRQA 3JQ7B 5T4BA 1DLIA 3P2MA 5DNCA 1F12A 2C61A 1JPUA 2GD2A 2FSVC 5EP4A 3AP3A 5PNTA 3MD9A 4D3XA 4XPIB 2RONA 1QIDA 1NJ2A 1A9PA 4FMBB 1E9VA 4KIFA 4CR7A 1FMFA 2FX3A 1E9EA 2VP9A 2VHXA 3M49A 1SKYE 3OLVA 5AQEA 2JLXA 2QWXA 3AY0A 3WGGA 4AG5A 4D4MA 4DF3A 5TS3A 1RLTA 2G88A 2G9RA 2B5WA 1JBKA 5FL3A 1GADO 2QBYB 2HU5A 4LVUA 1P2SA 1P4AA 2YHSA 4J1SA 3JAKA 4NKRA 1P5HA 3TLBA 1H3NA 4W7HA 3RI3A 4KV9A 1KI2A 1C8LA 4L16A 4A3SA 5EKSA 5AVJA 4GPTA 5C4IA 3DT6A 3IQZA 3PQ4A 4K1XA 4UVDA 1ES9A 4HNQA 2PMBA 3VKGA 3RSOA 4KUGA 1TAHA 5KUTA 1FIUA 2VHJA 2VPWA 2QD3A 3LHKA 2AI1A 1IPFA 4IYJA 2IY8A 4OAPA 1UFKA 2FZLA 3GFQA 3R1IA 3V7NA 4PLWA 1OV6A 4KXMA 2A9RA 1PWYE 1QO9A 1RKQA 4HJXA 5ECDA 1WEHA 3DXZA 5E8RA 3BBPA 1CUVA 1EFPB 5BVGB 3NHSA 4M76B 2V5VA 4QUKA 4P32A 3ACDA 2B94A 3ZG6A 1O6GA 1TUIA 5LQAA 5BUQA 3PEUA 2PGJA 4R54A 4OK6A 4TRRA 4GSYA 4M2LA 3GJ7A 1ESEA 2JBHA 1S3GA 4Q03A 4QXMA 2EWWA 3V8RA 1ECBA 3IIJA 4KLAA 2UUAB 7REQB 3EVBA 1R8SA 5HJ2A 1E9FA 2YNMA 3DL2A 3R3UA 4NLLA 3QVXA 3WP0A 3FMVA 2OC4A 3T3GA 5IKPA 1P7WA 4D46A 3WK6A 1K7FB 4FT2A 3SVZA 2OMKA 4UUMA 4B09A 4IX1A 5JNWA 1VCHA 4DC1A 3BXPA 4OMUA 1B1AA 3ZY4A 3LT5A 4KI0A 3T9FA 4BQEA 4I50B 5CA0F 1CUXA 5KJ6A 5I01A 4YMGA 1NSFA 2NQ2C 4YHHB 4EEXA 4HWSA 3BQ9A 2YFYA 3CM0A 1P1KA 4LZPA 2I7VA 3LCUA 3BE5A 2GD0A 4GSLA 4OFWA 2Q8NA 3IPYA 4Q1BA 1SHZA 2BBWA 4RKWA 2HU2A 4UUNA 4YR7A 2BEJA 2IXBA 4LV8B 1E1NA 4URZR 3FE2A 1JR6A 5FAXA 2WU8A 3GZTB 4H1VA 2HBZA 2ZWAA 4RIIA 1S3SA 2B61A 2IODA 4KRYA 3L46A 5JAHA 5F7JA 1NU6A 1XN1A 1DAPA 2V7BA 3O26A 4GKVA 2WLTA 4TVKA 1GYQA 4FD2A 1FP6A 4MI9A 3JY6A 2IEIA 3IS3A 3BN3A 1NNUA 2WTUA 3FYCA 4ZQCB 2RH4A 3S40A 1T4MA 4DGQA 1NRJB 3GJ8A 3EOZA 1IVSA 4P4SA 4QOIA 4WERA 1OWOA 1KI6A 1PEDA 1ZCJA 1X7XB 3DM5A 1PWHA 3P2YA 4Z7OB 1W36D 3L6OO 4D9GA 1F2VA 1B8PA 2Z2JA 3AF1A 1W0CA 4MQMA 1O97C 3KXDA 2DBZA 4GMHA 3T7KA 1Y3IA 3T7CA 3CJTA 3HBAA 1U0LA 3I9JA 2RGXA 2C4HA 5FOSA 1ZRSA 3WIUA 3WZ2A 5HKBA 4FWIB 3Q6IA 3RYHB 4OKSA 1SA0B 2B83A 2BEWB 1ONSA 4MWEA 4ZJPA 1OU4A 5BQOA 2WT8A 1FP1D 3RK0A 4BC1A 2XMCA 1WUJS 3HU5A 3OZRA 3A1VA 4NX2A 1TQ8A 1LDYA 4ZU3A 4AM8A 1MAUA 4KIUA 4WLOA 2B30A 2Q4RA 2FB9A 1QYIA 3OPYB 1KYVA 1TT7A 3P26A 5DJ5A 4D42A 2GK3A 2NU8A 2PMFA 2C00A 3DEFA 3L77A 4IM7A 1EHYA 3ZCSA 3R7FA 3U37A 2QX4A 3ZHUA 1UFQA 1TK3A 1G5IA 1R8QA 4WW0A 1ZRNA 2ZIEA 3W3AH 1E5VA 5JROA 1F6DA 3K6SB 1ID8A 2WIGA 4CMKA 1YB6A 1YT5A 2VAWA 3E4DA 1OI7A 1QG4A 3G2QA 3IE2A 3LP5A 3QVGA 4MYDA 4ZWNA 4Q9DA 3M4ZA 1Z4LA 3U4QA 1JLMA 3IYLW 5DYWA 1XEXB 1ABFA 5G3ZA 3VJRA 1IUPA 1PTJC 3CWQA 1QNLA 3PXEA 4XGRA 3Q9SA 2VA9A 3IP6A 5BPHA 4IMRA 3H5NA 3GMIA 4DYHA 1U63A 3UJDA 5EIBD 4GO1A 2FETA 1FTGA 4QJBA 2E7ZA 3FETA 3EVFA 3GG2A 3JASB 4FXOA 4QYIA 3RSGA 3W8NA 2I7TA 4IVPA 3RFCA 5JZOA 3TMYA 4BNLA 1MHTA 2FPIA 1N7HA 2QRLA 3AHJA 4HXGA 3VDQA 1JG7A 3EE6A 2H4HA 2NZYA 2V7VA 1JT2A 1OI4A 3K09A 4IHJA 4MP3A 4F96A 2O2JA 3KYDB 1IG0A 3EBOA 3I6YA 2BGNA 3LCJA 4JQZA 5ITSA 2WKRA 4P86A 1N36B 2X1LA 2B34A 2B8EA 3X1XA 1ZGAA 3C5CA 3IXLA 4ER0A 2ZRIA 3SYNA 3VPBA 1XLTA 3FYDA 4I4TA 3OWHA 5B3JA 1IOVA 4AJJA 3ZHRA 3LUPA 1QKKA 3QEMB 1MJGM 2CXHA 4RS3A 1TQ4A 3DE0X 3SX2A 1BFDA 3I3SR 3ZDFA 4YGYA 2ZCVA 2IS2A 4R01A 5L3RA 4EFLA 1WCIB 2NU7A 4NNPA 2M1ZA 2BZGA 1ZCBA 4D25A 3ILXA 5H82A 3PG5A 1EP2B 2PVSA 5C1PA 5J2UA 2Z2YA 2X2OA 2G1AA 2Z3VA 4P3OA 2BWJA 5EWJB 2JFVA 1X39A 5IH7A 1RLOA 3ANMA 2DQZA 2O07A 3FUCA 1ZONA 5AVRA 3LXUX 3D9QX 2JLSA 4GSKA 3WJ7A 1GPAA 3U7QB 4AW9A 4ZYLA 2H7YA 2WWXA 1AGYA 2YWRA 2XYVA 1FZTA 1A69A 2BEUA 2H00A 5CVJA 3U0BA 3MWYW 3O75A 3U4HA 1DEHA 1JFFB 2EFYA 3V34A 5IN4A 1J00A 1USVA 1IDN1 2I2DA 4XTCS 3ILYA 4C6SA 3QVUA 4CLRB 4N3CA 2Z9BA 4I3HA 3MINA 3WZMA 2H4YA 1KQGA 1K7YA 4UNSA 3NC0C 1R0YA 2QX9A 1DLJA 3KCNA 4QFDA 5AIBA 2VPTA 4CMAA 4G5YA 1M2FA 2DUMA 1YBFA 1VE9A 4HX5A 4QYMA 2HKIA 3L7LA 2X3YA 4XGKA 3A10A 4L22A 4AWAA 4BL5A 3IKMB 1P62B 3JARA 4WSOA 3A4NA 1K9VF 1M2WA 1P5FA 3GJ0A 3Q41A 1LKZA 1LDNA 1W2HA 4XIGS 1UMKA 1U2TA 1K6MA 5BR7A 2NO4A 2MYNA 3DKRA 5AVYA 1CUBA 1MA3A 2GBFA 5UKDA 1LLQA 1BOOA 4LYGA 5KNLA 4TLDA 3DLPX 1QO0A 1ADFA 1CCWA 2IVFA 3DQZA 2M6SA 2ZPTX 2QLJA 821PA 1KZHA 2ID8A 4NV3A 4ZO7A 1E7MA 1U8FO 4XYBA 1V8ZA 3IUSA 3TSWA 1IJEA 4V1CI 4GQBA 3UQYS 5TE9A 1POXA 2H2AA 5HEKA 1W0KD 2B1IA 2KLBA 4EVIA 2L2QA 4YRSA 1R0WA 2FHPA 2R44A 3IRVA 4EPYA 3A14A 1B42A 1Y9DA 1XZMA 2OUKA 1R15A 3P94A 3RAFC 4FP9A 5K1ZA 4REQB 3SIXA 5I7HA 5BQXA 2JEOA 3K9FC 1QM5A 3B1FA 3IKTA 1G5QA 3A31A 1GPKA 3IBGA 3IXMA 3LF1A 1X9HA 2F1IA 1N3LA 1B3RA 3K31A 4FFDA 2ISCA 2WMOB 1M8PA 4X6UA 5BNWA 5CA1F 4UU1A 1RHRA 5FYDA 3C2QA 4YH1A 5ALHA 3RBAA 2JJYA 2LDBA 2WA2A 1ZJWA 1ZI9A 1JH8A 2N1MA 1KDTA 1HQDA 3KKZA 1CZLA 2X9VA 3CGWA 3BYZA 4ZAVA 2W93A 2ORYA 3ME5A 1XZAA 1GL7A 2IJGX 1QK4A 4PC1A 4RVSA 2JEYA 4X60A 1G3MA 4EGQA 3E5MA 1MQ9A 4FFSA 5DBGA 3LM8A 3I9NA 2JFOA 3FCOA 4RL4A 1YMVA 1T13A 2EL7A 3HR4A 1NC1A 5E6RA 2NVUB 1NQXA 2DG2A 3KQVA 5BYKA 1T35A 1EXVA 4OHBA 2DWQA 5CDSA 5HIJA 1GZDA 1N6RA 2QB5A 5ICEA 1CKEA 4FYKA 4RK4A 5C3UA 4OHVA 3SU8A 1AB6A 3FNFA 4EX7A 1P3JA 2XE6A 3DLIA 4U8HA 3LTEA 4A0FA 1GZSA 3O4FA 1NFRA 3KYBA 3PR1A 3E9YA 4HS9A 4HZIA 2IELA 2P4HX 5TLSA 3O6VA 1NXQA 5EHZA 1RAEA 1LTHR 3HKDB 3I32A 1XRQA 3HBLA 4X71A 2RGGA 4OBWA 1CS4C 1QB7A 3LUDA 1L5HB 1QGAA 2GD6A 3OD1A 5JANA 1NP3A 4EP1A 1K6JA 1RHQA 2YQ4A 5ILOA 3PFNA 2BH2A 2UXCB 1X80A 5DXJA 1EE1A 5FHQA 1JT9A 2OORC 3JQ8A 3QU4A 4NR0A 4OQXA 2BZSA 4QUGA 3ZJ4A 1PGNA 2CHVA 1TRKA 2HPVA 4PGFA 3R9KA 3CZQA 1KOGA 2IEAA 3EGOA 1NOIA 4HLQB 5FPHA 5FXMA 1VHTA 2C8KA 5ERYA 3GJ5A 3BMCB 3CWZA 3UATA 3WX0A 2Y1OA 2YHAA 5EZ5A 3TQCA 3GC6A 5C51B 1U6JA 3E9RA 1DBWA 4GEGA 2AQHA 1R0LA 3NX4A 4ILEA 3ODPA 4KQEA 3UWPA 5F3RA 3HYSA 3SXUA 4L28A 4OI2A 3VH1A 4BECA 2BSAA 2E4ZA 1BVHA 1YASA 1Q7TA 3ZWWA 1WTAA 4YRTA 1GKIA 1QG2A 1YCHA 1OYYA 2Y6UA 5FO0A 3L7MA 4ZOQI 3M9XA 4RJLA 2P9HA 3TIVA 4DPMA 2Q62A 3ADPA 3D0KA 1QFYA 4NDAA 1BYUA 4KHZA 4ZOLA 3SHQA 2OPBA 1VMAA 3NVMB 1C7JA 4FQ7A 2JIZA 2GDJA 1SUCA 3L7BA 4JR0A 2OZEA 3H18A 4FDTA 3RARA 3ONWA 1I1HA 1KNQA 2FPRA 3K92A 3FGPA 3MTQA 3PYMA 1EK5A 3VKUA 1UBKS 2WT4A 3MT8A 4WNCA 4YYEA 3KNZA 5KNCH 3BXZA 3QE3A 2FW8A 3OZTA 3EFHA 4TTJA 4XJVA 1SU6A 1UUFA 1NASA 2GJAA 1A4XA 3A36A 1H23A 2QRHA 4FN5A 721PA 4KXYA 3J7TA 1DS6A 2YINC 4U2GA 2X0DA 1ST3A 2P79A 1D5CA 1GL6A 2BMAA 4H6XA 4XQGA 5DCYA 2JVJA 2QJRA 3P45A 4D92A 4XGNA 3V55A 4TQGA 4MP8A 3WP1B 4DY4A 1SVOA 1W88A 2VOEA 4HAZA 3HKCA 1R5BA 2HF8A 4Y6GB 5KOJB 1OLOA 3CNLA 1DKLA 1WXEA 4D2IA 5JI2E 3QE9Y 2WWFA 1YS1X 3FYUA 1KWKA 5KU7A 3VR4D 4R6WA 4E3WA 5CVDA 1R0SA 3DAGA 5E9QA 4H7DA 3ZD9A 3ZN2A 3I8OA 2DULA 3EJWA 3PRYA 4DMCA 1SOAA 1SXJA 1KH3A 2AMVA 1JG4A 1T26A 4W9NC 3BICA 8AT1A 1J8VA 4G9EA 3D4LA 4CHGA 1JXAA 5T8KA 4F7DA 1AHIA 4Z1MA 2ODWA 1VJGA 3D31A 3KP1A 3TG2A 3H8VA 5KDDA 3EBLA 3HB4X 1YNOA 4YFYA 1EVKA 4C3UA 4EY5A 3ZLUA 1NVWQ 3B8HA 3EYWA 5AM0A 3GDWA 4LHWA 3SMQA 5JYDA 4DT1B 3X0DA 2R1VB 2IZ5A 1ZA2A 1U0FA 1M10A 1COWA 3N2LA 1VCNA 3KT8A 3EW9A 4WZAB 1KJ9A 5HTKA 3TL3A 4A73A 3IMEA 2AR9A 4G0YA 2IHVA 4MIOA 3H5AA 3CTPA 1IUOA 3IHLA 3Q40A 2DHRA 1H8HA 2VF7A 3O8QA 4D9MA 2BV3A 4KMSA 1PHPA 5H59A 3RFXA 3REFA 1L6RA 3K0KA 4UUBA 5AVKA 1B41A 1VIVA 2Q3BA 2VK1A 3FLBA 1TZKA 1NP7A 1B2LA 1JP7A 1MU0A 3LK6A 2XEXA 1L7BA 3LRXA 5BQFA 4WDRA 2PZMA 3E3AA 3LKVA 2DTEA 1X7ZA 1PJ4A 3D6UA 1CY0A 3KYIB 3K0FA 4DR5B 1I2BA 3ES9A 3PI7A 3U1TA 3K72B 4TKVB 2ZCJA 1TVCA 4X41A 4M8KA 3Q1LA 4FBLA 4I9FA 4B6RA 5BURA 3OLYA 4LVOA 5KCMA 4UTXA 3U5ZB 2NNLD 3KAKA 4R41A 4QRDA 3B9QA 3NEJA 3A9SA 3WK7A 4HP8A 2HRZA 5ICSA 1LS1A 3P2KA 2VBCA 4AL4A 2IYTA 2W98A 1ZH0A 4BO0A 2HLHA 4C2AA 3MB8A 3GRFA 3ZWVA 4M6WB 3GFBA 4EHNA 5HCIA 3LUGA 4WV3A 3TFOA 2IYSA 2BI4A 1N6NA 2NVBA 4KYTA 3EZYA 1QCZA 3CNEA 3OUTA 4JJAA 1LW6E 3DVAA 4IDGA 1Q0PA 2C5GA 3LY8A 4XRRA 3B6EA 4R8VA 2JLVA 5FUVA 4M9QA 3CS3A 2EX0A 3LPAA 3OLXA 4TTAA 4LK2A 2X2EA 3AF3A 4YIKA 5ERXA 5FUXA 3T94A 1FVFA 3V8EA 2G9VA 1AKRA 3C7TA 4S0ZA 1P9LA 1E2BA 3W6UA 4KI7A 3HABA 4GL4A 1U6IA 3AXSA 1XEWY 2VUIB 2ORIA 3DEHA 3JQPA 3OOYA 5CX1A 2BCEA 4CMIB 4BN0A 5C46F 2ZKLA 1FUIA 4F45A 4LG1A 4UFPA 3TRHA 1AA9A 1E4OA 4BDTA 1J2EA 2QUZA 4JCCA 4O2AB 3NGLA 3KR9A 3KPUA 1R0KA 1U98A 2P4UA 3GZNA 4RVFA 2IGBA 2OFFA 4ENRA 1OLXB 2EBFX 1SQ5A 1TM3E 3BMQA 1VMIA 3QA3E 1EDDA 1RPAA 3JYQA 3A6HA 4LJ6A 3U4DA 3U39A 2F9FA 1TUBA 3BMNA 2WV7A 4J90A 4IP0A 5AM5A 2XQIA 3DDZX 4JAVC 1NN5A 3R0IA 4ZV7A 2WD9A 3SKYA 5LIRA 2WIJA 1OVMA 2LRHA 5EYPB 2AEJA 2I5PO 4H35A 2ZIWB 4J16C 1HPLA 3IP7A 5JAQA 5A7HA 3EFBA 4F8EA 1NDHA 1VJ1A 1YA8A 1FY2A 2QTTA 3HWWA 3IDQA 1KK2A 1PNTA 2BGLA 2GZRA 3BUSA 3I1FA 4MQFB 1WDKA 3DF9A 4Y6OA 2B6NA 2P9QA 2XIQA 3UB2A 3CF4G 4D99A 2QLTA 5TF0A 3GT7A 5FI0B 3UMFA 2DETA 2Y1XA 2BUBA 3QFSA 5JCZA 1NMYA 1F2UA 5KTOA 2CFSA 1W5SA 3CLKA 2UZ3A 2XLBA 1QF6A 3VNUA 4TN1A 2GNAA 1NVEA 1DAKA 1UC5B 3HN6A 4R2JA 1YB5A 1CZKA 3HS3A 3SQNA 3MUNA 3BWCA 2GN6A 5JFGA 1KNXA 2YV3A 2QQ0A 3M3HA 3WTCA 4R3WA 3Q3JB 1V3TA 4Q66C 1CP3A 3SKXA 3O94A 4JLMA 4MNTA 2GASA 3ZCUA 3LECA 2PGDA 1XNHA 2ROQA 1KK1A 1LJUA 4TLBA 5J63A 3UMSA 2F1KA 1Z4IA 1ICEA 4L7VA 4JOSA 1IIRA 2B2NA 3GQBB 3TTWA 4AKSA 1QDLB 3ED1A 2IOFK 4E1VA 4DM4A 1K63A 2VDKB 2YX1A 1M76A 2PSDA 2YOGA 3DCYA 1VCIA 5HIKA 1TNDA 2G4LA 4GYKA 1IM5A 3H3FA 4NJMA 2PSHA 4NBLA 1E1MA 3W34A 1XNGA 3HLKA 2V3WA 5EWLB 4X3CA 4LE0A 3EXG1 1LPBB 3FTEA 3LP8A 2OHFA 5J4YA 1UJ2A 2VTBB 3MCVA 1J2UA 5CH3A 3IUJA 1HKHA 2HHJA 3TXXA 1NBMD 1GTG1 3QF4B 3HZHA 4GX5A 4NU0A 3RIEA 5LZ9A 4TGLA 3WAJA 2AX4A 3ENKA 5DTJA 3SZLA 1J2RA 1ZH2A 2H0RA 3VI3B 3OT4A 4BJ6A 2QLLA 2GM3A 1L5YA 4L8LA 4JIMA 2OB2A 4LI3X 2YYAA 1I7QB 4J3NA 4NFYA 3S2EA 2HJVA 4D6PA 3PCTA 1YR9A 2J4CA 2QUJA 3G0GA 4LYFA 5AVOA 4MDEA 3O7MA 2OAEA 3AVOA 3D6VA 2RJ3A 4HAWA 4KWTA 4PSVA 4JLSA 5JRZA 3RADC 4AKHA 3OAAA 1RJ9A 4ATNA 3PV0A 2AFVA 3B82A 3RUEA 1XF1A 3LCVB 3JYHA 4MZDA 1KARA 3NCTA 1VSVA 3OHSX 3Q11A 3IILA 4X44A 4ALJA 3RYIB 16PKA 2Y6VA 3CPJB 1KKUA 2YFKA 5AK3A 4KFCA 3D6NB 1RAGA 1HTTA 5A4DA 1VL8A 1AXEA 3CKMA 3CFYA 1YRYE 3W2HA 4CLEA 4X6XA 4CODB 3UMYA 2BMVA 3INYA 4YCNA 2P41A 2FFBA 2FZWA 4R1SA 1C4WA 121PA 1XO1A 5IF9A 3AFOA 2QUKA 5IBPA 2A92A 4JOQA 1XU9A 3SQDA 3TKYA 1IY1A 5FYQA 5KINB 1KDVA 1T0UA 4LJ7A 2M6RA 3MUOA 1UWKA 4LTNA 4HUJA 2AI3A 2HMTA 2XBLA 3HQ4O 4BN5A 3PDIB 5IKXA 2WM8A 3C6QA 4JDUA 1Q95A 2F8LA 4CEIB 4IXTA 1OE0A 4FYIA 1UDAA 4ZVSA 1YZUA 1K5PA 2I1VB 2X8JB 4PCVA 3TUZC 1GUAA 2IHKA 2QNRA 1PDOA 4PLCA 1T9GR 1W4CA 4RGVA 4B7UA 5DLYA 4E0BA 2NV6A 4I6GA 4L27A 4M7WA 1EEHA 3GJXC 3BD8A 1KI4A 3JQGB 3UV7A 4DHWA 4EFMA 1IY0A 5KYYB 4LF4B 3LDHA 4KKVA 3RRFA 3H4TA 4ZQEA 3DMTC 1DI0A 5K51A 4UTVA 4O2LA 1JAHA 4HNGA 1Z2EA 1KXZA