1YIDA

Crystal structure of tryptophanyl trna synthetase ii from deinococcus radiodurans in complex with atp.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
331
structure length
331
Chain Sequence
b'ARPRVLTGDRPTGALHLGHLAGSLQNRVRLQDEAELFVLLADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGERVPAGFFVYPVSQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALYAPVLAEPQAQLSRVPRLPGLDGQAKMSKSLGNAIALGDSADEVARKVMGMYTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRLFGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tryptophanyl-tRNA synthetase
publication title Structures of tryptophanyl-tRNA synthetase II from Deinococcus radiodurans bound to ATP and tryptophan. Insight into subunit cooperativity and domain motions linked to catalysis
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
total genus 106
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1yidA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1yidA01
3AG6A 1OWNA 2PFSA 3FOCA 3L92A 5HUHA 3FDXA 1SURA 4WNYA 1JZSA 3P0JA 1MB2A 4EG6A 3M5WA 2QTRA 2O5RA 2X0KA 1KH3A 2PIDA 3SEZA 3TS1A 5J59A 2HMAA 3UMVA 2EJCA 3KT3A 3CLTD 1O95C 2H29A 4BWVA 3H99A 4ZT5A 5AHWA 4I6JA 4ZT3A 2CT8A 2A1TR 2I1LA 1O96B 1YIAA 4R0NA 4I6EA 1IQUA 3TQIA 1OBCA 2DUMA 2J09A 4JXZA 3A04A 2X1LA 1O94D 1N78A 1I6MA 2QTNA 2VTBA 2QTMA 1N1DA 1PFYA 2BTEA 4XFJA 5TS2A 3OTWA 3SP1A 4U7JA 1YIDA 1WY5A 3COYA 1TEZA 1VL2A 2GM3A 3NBAA 2TS1A 3CLSC 3FWKA 1JZQA 4ZT2A 1NYLA 4ZT6A 4EG1A 2DR2A 4L2IA 4MWCA 5KHAA 4JZYA 4A91A 1KP2A 2YWBA 1KQPA 3CVVA 4AS1A 3AFHA 1U7XA 3CLRD 4KKVA 4MUJA 1KH1A 3G5AA 4KPUB 1OBHA 3IVXA 4MUEA 5K0SA 4F3RA 1IQRA 5DB4A 1O96A 1WQ4A 1T9GR 4YMIA 5EKDA 1VBNA 1G8HA 3ZXIA 1FFYA 1N3LA 1YI8A 4EG5A 3KT6A 3VRHA 3MLAA 4FZJA 3I05A 3X1JA 4MW2A 3U1VA 1A8HA 3DLAA 2IP1A 1JGTA 3OP1A 1H3FA 1ZH6A 2CYCA 1KORA 4MAFA 2AKEA 3Q4GA 4RUKA 4MQ6A 1F4LA 3PNYA 1O6BA 5TEWA 2HZ7A 3RBAA 1M1ZA 1EJ2A 3Q10A 4MUHA 1FYDA 1IH8A 4MUKA 1H3EA 1KP3A 3GLVA 2IELA 1I2DA 4DJAA 1XNJA 1NURA 1T6ZA 4KPUA 4NAUA 3FG9A 4DE5A 2PXHA 2A88A 1J09A 1PG2A 2PG3A 1R6UA 3CLTC 4QRDA 3FETA 2NZ2A 3IODA 3FIUA 4S1OA 3H05A 3IMGA 1P7PA 4R2LA 3A4IA 3MMXA 2YXNA 3UY4A 2E0IA 1N2BA 3SEQA 2YY5A 4ZT7A 3E27A 1TYDE 4CDMA 4GRIA 2E21A 1GLNA 4JYZA 1N77A 1O97D 1IVSA 1K97A 1M8FA 2DLCX 1KAMA 1M8JA 3G59A 1O94C 4NATA 2DERA 1MRZA 1JEEA 4MVCA 4JFAA 1MAUA 4DDKA 1T6YA 2X3FA 1H1TA 4CQNA 1V8FA 2AZXA 5K0TA 5BNZA 1WXEA 1JECA 5J58A 2A86A 3CLUD 1F7UA 3ILVA 4EFKA 1JIJA 3CLRC 2A7XA 1NSYA 3PNVA 2V0CA 4ARCA 4TS1A 2QUKA 2D5BA 2PZBA 2A1TS 1YUNA 3IH5A 2GKSA 3N2YA 1IRXA 1EUYA 5IJXA 5IHXA 3ZGZA 4MVWA 1ILEA 1IFXA 1O5TA 2XRYA 1TYCA 1OWPA 3PNBA 1G8FA 4GU5A 4ZCRA 3HMQA 4XFDA 1OWMA 3SYTA 1COZA 1JEDA 4KR7A 4MUIA 1NZJA 4MW9A 3PXUA 1WXFA 4EG8A 4AQ7A 1O0CA 3P0IA 2H2AA 3S3TA 1N2EA 3TZLA 1XNGA 2CUZA 2JANA 2D13A 1GAXA 3CR8A 2DEUA 1GTRA 5LM3A 2CV2A 2WSIA 4HK4A 4EG4A 2D54A 1N2JA 1O0BA 4DDMA 4OUDB 4RPIA 2DETA 3ZUGA 1XNHA 3SZGA 2A1UB 1JIIA 5KWVA 5TEVA 1EFPB 3UK2A 2WB2A 1PFWA 3C8ZA 4YP7A 2DXIA 1IQ0A 1WXHA 3IOBA 2R5WA 1JMVA 2CYAA 3RJZA 1T9GS 1N2HA 3DO8A 2CYBA 1QRSA 2Z09A 4MWDA 2ZUEA 3TZEA 3FHJA 2O8VA 1K4KA 1TFUA 1J20A 3MLBA 1OD6A 4MWBA 3LOQA 1CT9A 2E18A 2NSYA 1GZUA 2CFOA 1DNPA 3D6UA 2CV0A 1QRTA 1O97C 1QRUA 3QTTA 2BYTA 1NUQA 1U7DA 3A05A 1MB9A 1X6VA 2A84A 4NAHA 4ND7A 1KAQA 3ND5A 1NP7A 1M8PA 5TGTA 3RK0A 3L93A 1WOYA 4U63A 4ZCQA 3H9CA 1LI5A 2A1UA 1MC1A 3NBKA 1Q11A 1N2GA 1EFPA 3COWA 4G5YA 4EGAA 3CVUA 1MBZA 3CLUC 2Z08A 4ZCSA 3VU8A 4MUGA 4Q93A 4J76A 1IHOA 3IOCA 4I6GA 1QU3A 1ULHA 1PFVA 1GPMA 2J5BA 4MULA 1JHDA 1MJHA 1MOPA 5F23A 1U0BB 3N8HA 2Z3VA 1TYBE 1S4MA 2VXOA 4MUNA 4F4HA 3PRHA 1TQ8A 1QNFA 3ZXSA 2V0GA 3ZIUA 5H7XA 3CVYA 3F3MA 5HG0A 3N9IA 3FY4A 3KT0A 2J07A 1N75A 4OJMX 4NZPA 4CDNA 3H97A 1NI5A 2HGZA 3X1MA 3SDBA 1WXGA 4K03A 3IVCA 4JXXA 2PZAA 2QUHA 1Q77A 2JAXA 3Q12A 1K4MA 3HL4A 2ZUFA 1YULA 2OV4A 2ZP1A 1WXIA 3AG5A 4MW1A 1J1UA 2JA2A 1LW7A 4NDAA 4MWEA 3RHSA 3SZ3A 3K9WA 2GOYA 4EG7A 5JBNA 4XSVA 3HZRA 3ZJVA 4YP6A 4QBTA 3RFFA 1V47A 1B6TA 3G6KA 4PY2A 4X0EA 3TNJA 2VTBB 4QREA 1Q19A 5FNZA 1ZJWA 1KR2A 1R6TA 1X8XA 4DDHA 3ND6A 1OWOA 3ZJUA 3COZA 3GMIA 4J75A 2RD2A 3BL5A 3MXTA 4L2IB 1Q15A 1WKBA 2EL7A 4KR6A 4H3SA 3HV0A 2A4MA 1EFVB 3KFLA 3LCJA 4UZEA 4WSOA 3RK1A 1WZ2A 2J4DA 2CSXA 3IOEA 1KQNA 1NUSA 1NUTA 1Y42X 3P52A 5LFAA 3N05A 1U3CA 2E89A 1K92A 3QE4A 1F9AA 4ZCPA 3HFJA 4ZT4A 4R2MA 4MVXA 1VBKA 3COVA 4DNXA 2WQ7A 1H3NA 2QUIA 4ND6A 4PBTA 3FI0A 4MW7A 1I6LA 1EE1A 4HPWA 4EF6A 1U3DA 3P0HA 4P2BA 1PG0A 1RQGA 3DPIA 1G8GA 1QTQA 1QJCA 5FO1A 4G5FA 1NUUA 1QQTA 1J70A 4KR9A 3CVWA 1M8GA 3ZJTA 2QJTA 1R6XA 1VLHA 2YWCA 4E1AA 1EFVA 1GN8A 5DK4A 1KQOA 4CT0A 2RE8A 4DLPA 1XJQA 1O95D 1NUPA 5KCMA 1EXDA 4MW4A 2WQ6A 3FH0A 5DASA 4MVYA 5LLTA 2XRZA 3ND7A 1F7VA 4MW5A 3MUEA 1WQ3A 1KH2A 1VBMA 3LE8A 1G59A 4YP5A 1GTSA 3IUEA 1WJGA 3VGJA 4NX2A 4OUDA 1JIKA 1OWLA 2PZ8A 1N2IA 1QU2A 4UZFA 3INNA 4EG3A 3FNRA 2QJOA 3AIIA 3IVGA 3IUBA 4MW0A 1ZH0A 3A2KA 3JXEA 1T6XA 3CLSD 2J08A 4K0RA 4YBRA 1J21A 3UOWA 2X1MA 2OQ2A 3DV2A 4MW6A 2IJGX 5FO0A 3D6VA 4G6ZA 3HGMA 3ELBA 3NV7A 2CV1A 4HJRA 4MLPA 3IMCA 4Q16A 3ISJA 1D2RA 4PBSA 1I6KA 3KT8A 2DPLA 1LI7A 1M83A 1MAWA 3CA8A 1UFVA 2AG6A 3IDFA 1PFUA 1HYBA 3AKZA 1M8KA 1EUQA 1N2OA 1BS2A 3TQOA 4U8HA 1KKUA 1J1ZA 1YUMA 2B7LA 2G36A 2C5SA 5H16A 5J5AA 3GUZA 3AL0C 3H9BA 2QUJA 3UC5A 1JILA 3CVXA 5HUJA 3K32A 5DEOA 3QTBA 4MUFA 3X1KA 4ZCTA 4PBRA 4HJXA 3IMEA 4ARIA 2QJFA 1TYAE 1ZUNA
chains in the Genus database with same CATH superfamily
1L4BA 1LVUA 1A2BA 5CDSA 1CQJA 1RAAA 2PZMA 2O4CA 3FB4A 3K1ZA 2BTQB 2NO5A 3WGZA 3JAWB 1U2TA 4JLNA 3V2UA 1ZR2A 3AKCA 2YWFA 3BEDA 1W1WA 3R9XB 3P0JA 1RXYA 3NDIA 1ZH8A 1JJBA 1GT6A 1G4HA 1RM5A 4QAJA 3BWXA 1NVVQ 4A1FA 4BO3A 1N5OX 3M5WA 3E35A 1YNOA 1EAMA 4JYPA 4A03A 3NXSA 3MWEA 1CUAA 1SHKA 4G0NA 5BORA 4PLGA 2VQFB 1IY9A 3V8PA 2HYIC 3SXUA 4R51A 2XW6A 4G81A 1WUIS 1OMOA 2OENG 4PQFA 5FPKA 1OREA 3FW1A 2EGUA 1KO1A 1IUPA 3P9KA 3FKSD 3VM6A 4HDRB 1Y7HA 4QU0A 1CUGA 1II8B 2WAOA 2EOAA 2XDAA 3IE2A 1F1BA 3DVRX 2FPUA 3IIJA 4ZT3A 4F3YA 4Q12A 1PJAA 2CT8A 1NIJA 2A1TR 1JSLA 1Q2UA 1OAKA 3OURA 1Z62A 4R0NA 2F1HA 5L51A 3BHMA 3KSBC 2JFZA 5DP2A 3H42B 1KFBB 4X3CA 2RHGB 1BFUA 3LK6A 4EJSA 1R74A 4X5OA 3RO7A 4DYVA 1C4WA 2HO4A 4F38A 4TYPA 3UAYA 4AJLA 3H1BA 4EYEA 2LV8A 3O8OB 1G3MA 2BTEA 4OHMA 4XFJA 3B5EA 2BHNA 5T67A 2FGKA 5F73A 1IHUA 5KDDA 2P3SA 3QLVA 2YC2C 4PG7A 3LL7A 2HLPA 4BNDB 4R8RA 5EGNA 4NNJA 1T13A 3UZUA 5BMVA 4BYMA 1ZMTA 4L8GA 1QOQB 2ZB2A 4GKJB 8OHMA 1I3OA 4A2CA 4G8DA 2V9ZA 2XQKA 3BREA 3HDHA 3WWEA 2I3ZA 1FRQA 4HXYA 5CT9A 1E2EA 4LCJA 3NNSA 2AK2A 3Q88A 2JIOA 2NYRA 1FFBA 1HT3A 2G4CA 4G0YA 1SHLA 1THMA 1ULBA 2DCMA 2ZSBA 3LUJA 3IAHA 5T64A 3RS4A 4AXXA 2J9XB 1L5YA 2OBFA 5BURA 1KPHA 3EPLA 2CMHA 5JNUA 1DADA 4TTRA 2ZQ5A 3FYTA 2AIRA 2G6TA 3DWGA 4IH1A 4DSZA 2OV6A 1HE2A 1FRVA 1ZMOA 5TT1A 4DN6A 4RTOA 1FIUA 3I05A 1E6LA 2XMZA 3NYRA 5DHAA 4YR9A 3OQ1A 1VFPA 1JH8A 3GLGA 3E9YA 3QHAA 1G64A 2CDNA 1O5OA 5KWVA 2OE2A 2AKEA 1PNRA 4H18A 4NBTA 1VYTA 4V24A 1QONA 2NZWA 1AMNA 1A3CA 2B83A 1KDTA 1N8SA 1U28C 1Y6QA 1V5EA 4M1EA 4A10A 1U7HA 4DYDA 2E4VA 2LKCA 2RGDA 2CUNA 3MC1A 4JBGA 4MUHA 2XUFA 2W48A 3PQ3A 4J03A 1TQ2A 2PU7A 4PYRA 4LJ4A 4BQIA 4GL2A 1FTYA 2BE7A 1Y1KE 1OHHA 2WSBA 3D3NA 4IIGA 3ONVA 4DCJA 1PJTA 2FWRA 1QK4A 3DCJA 5DMXA 1GZ6A 1NQVA 4HL6A 1AXRA 4KK4A 4DE5A 4DIEA 4YT4A 5AKKA 4ZVNA 3B85A 3KQYA 3PVSA 4GKKB 3GDGA 3U4QA 3RIHA 3EGXB 3LW8A 4GSKA 2NZ2A 4OQPA 2C3YA 4UU0A 5EXEA 1UMCA 1X1DA 5CA0A 3FMVA 3QVUA 5EXTA 2Z04A 2I7VA 3G79A 2RGXA 5EJMA 4AD8A 3E2IA 1VXRA 3NAMA 4ZRMA 4ZHQB 1R0KA 2ZBQA 2Y2UA 2GTPA 1D1QA 1RP7A 3PNOA 3H9QA 2QT1A 3MTIA 3L8GA 3EY4A 3Q1LA 5CNJA 3HMKA 3SEQA 4D9HA 5KAPA 1CUSA 1TU4A 2VDKB 3IMKA 4BO1A 2VSOA 3PJEA 5E3HA 2PLRA 1X3LA 2W2NA 5DIZA 2G71A 4YT5A 3RSCA 4YXWD 4AZ0B 5EKTA 3GMTA 3STUA 5I7EA 1KF0A 3N7UA 2YMMA 2FUNB 2XMQA 5HX7A 1W2GA 3M1LA 2FA9A 3VHRA 5K3FB 1MRZA 3LCUA 3EODA 4CEIB 4BEWA 3TUZC 1R4ZA 1LKZA 3QELB 4XR9A 4Q9IA 1I10A 3PNSA 2GSDA 1R5NA 1ABBA 3LA6A 3LPAA 2HCFA 3WLHA 1M2HA 2CGEA 1M2NA 2ODBA 1TTTA 1WPXA 3MRXA 4K1LA 4MVJP 4PO9A 4TXJA 4BVEA 4FYIA 5HDQA 4ITVA 4I19A 4NICA 2HR1A 1O8BA 1V3UA 5HJEA 3U44A 1NDHA 1X19A 2RK6A 3MTBA 4QQKA 4RJIA 3QKSB 5DIFA 5EINA 4EKEA 3QE9Y 2IYLD 4JHXA 1V96A 2LR0A 4WY8A 2UVDA 1CVLA 1BROA 4TS1A 3PF8A 1HDZA 4W1QA 4E14A 1I4TD 2Y1DA 1SBZA 3TVDA 2R8YA 5AIBA 5AHKA 2CDBA 5FFFA 3WGUA 3FRJA 2JBAA 1JR3A 5LN1A 3Q7IA 3P4YA 4TLEA 3PICA 2XF2A 1YUNA 1E4EB 3P9XA 5JRZA 5DGCA 3HM2A 5CLLA 1HSZA 5IDVA 2R1VA 3LFHA 4KXNA 3JZMA 3PNBA 4J0CA 1QQ5A 4C1BA 3VDMA 5JBIA 5AKXA 1C0KA 1T9ZA 4ZQFA 3IUJA 3R6WA 4FUTA 4ZRNA 5BYAA 1W29A 2VN8A 3CUTA 1XKLA 2Q8QA 3R9KA 3ZE0B 1JEDA 3UB2A 2X8JA 1V35A 3H75A 4I1YA 2IY8A 2QGFA 1N6IA 1BXZA 3CH5A 1KAEA 3U26A 3GGDA 4YN3A 3TZLA 3NWEA 4TKMA 2PXCA 1E1LA 1I3NA 1KMMA 1U0RA 1VCMA 4H59A 1LK0A 5DI3B 4DZTA 5AI9A 2O07A 4OMUA 9ABPA 2ONJA 4N54A 1QSGA 3GLHA 3VI4B 1FSFA 4BZZA 3NKLA 1NTRA 2A58A 5IP5A 2OPHA 5JECA 5DSXA 4RFSA 1E4VA 1GNLA 5FTNA 4WFQA 5KYUB 1FYFA 3IOBA 1Z6AA 1DLJA 2R5WA 1K08A 1GEGA 3UXYA 4ZZ0A 1IBKB 1WETA 5EMLA 1E3DA 2CL6X 2KE5A 4LGYA 3DBVO 2VR1A 4X20A 1OLSA 4KQKA 3PKIA 3E7DA 4MVJA 3A9WA 1A9SA 3A3KA 2KPOA 2BSXA 1TFUA 3PPIA 1F06A 2VLBA 2P6PA 5CAEB 3CRW1 2G5TA 3FMOB 2D8MA 3CUYA 4KE8A 2OYRA 1VKHA 2C3OA 3SJAA 1OROA 1TI7A 2CWWA 1DNPA 2GPAA 1INLA 2QENA 2EEPA 1J07A 3OX1A 2B4TO 1QP7A 4LXUA 1K6XA 1T25A 5I7VA 4OQXA 3A8TA 4H3HB 3UCXA 3TSWA 2XWSA 4PPYA 2FWBA 3FKSA 4IGFA 1YIOA 2QHXA 1A9OA 1M8PA 4D57A 3LDAA 3CS3A 3FIJA 3DQPA 3RTBA 1GYRA 3SICE 1WP4A 1M33A 4IGIA 1FNDA 2VCEA 5EMNA 3TPZA 1NXPA 3AK4A 3HCPA 3UG7A 2J6BA 2HADA 2V7UA 3JYOA 3NDPA 2CL0X 1DCFA 1T3GA 2BHLA 1G7CA 1M34E 1YZGA 1A2OA 3VU8A 3M3HA 1UBOS 1TLLA 3ZK9A 1U9IA 2E5LB 3M4ZA 3THWB 4DQXA 4DL9A 5C5EA 1RIIA 1ZGCA 3IOCA 3CXRA 2HQOA 3NHZA 3JVVA 5ECDA 3L0YA 1ZG3A 4AUKA 2Q41A 1QGED 1TIKA 2ST1A 1GPLA 1MOPA 4JP8A 4M88A 2JGFA 3RYFB 3O8QB 4X6LA 5IXYA 1AHPA 1ORWA 1PQUA 3C8HA 1MG5A 1JI0A 2BDUA 3ITDA 3BGIA 1UR5A 2XSZD 4UU1A 1WM1A 2ZRGA 3TOVA 1DKNA 3LLCA 1PS9A 3ONDA 2HJ9A 3MB5A 2QE7D 4OJMX 1J9GA 2W8BB 1YBMA 3I5UA 3ICVA 4NZPA 3K09A 5AXBA 3WDKA 4I55F 5MN4A 3MIZA 1LQUA 2HLDD 3TZKA 2BUAA 4K03A 2B4KA 4MR8A 2VRCA 3ZHQA 1C7QA 1J2YA 1KJJA 5FULA 4Y1RB 3THYB 2HU8A 2W6ZA 1Z26A 3ZI0A 2WZDA 1N57A 4MGEA 4QC2A 1NFFA 4RYLA 2F90A 4KFTA 2QL7A 16PKA 3OT1B 5KZMB 1KK3A 1QCZA 3N28A 3AM3A 4F8YA 3ZVMA 4MWEA 1YDMA 1SOMA 1CC1S 2WE7A 2AX4A 5GJWC 2XWBF 1S2IA 5KJEA 2X0DA 2Q5FA 3P1JA 5I7FA 5JBNA 3GJ4A 3OZAA 3RD5A 1VGQA 4YP6A 5A71A 2JH9A 1S2LA 2R6FA 3C6QA 3JATB 4KQMA 4KXYA 1W4LA 4D46A 3KQUA 5JE8A 3X1WA 1L4FA 4YI3A 2WWFA 6ADHA 5EKSA 3WBBA 4PLCA 4R9SA 2QD5A 1A9RA 1CUDA 4WBNA 2EG5A 4L4RA 4QOGA 4RTMA 4IMIB 1L6IA 2ALJA 2BGNA 5KNDD 1XDZA 2NXJA 3ZDYB 1B15A 2Z8YM 2QN1A 2ZRNA 3O5AA 4BTLA 1TGYA 3N74A 4KXVA 3UK7A 2EJWA 1XAJA 1FYVA 2JJ8A 2W6OA 3ORSA 3D6FA 4H9GA 3UM9A 3WB9A 2BVNA 3STVA 3TGPA 3U6KA 3G0CA 2BEKA 1L5VA 2WTXA 4CV3A 3TX6A 3G85A 3U37A 1P5HA 5E0OA 4M8KA 2JHPA 2P9ZA 3QPDA 1NR5A 3RM3A 2CSXA 4C3ZA 5AKZA 3OHSX 2JAHA 3B6IA 4ND1A 4QO8A 1GFWA 1W9MA 4D4MA 4U5QA 3FPGA 3K73O 2HRBA 4MR7A 5AHXA 4DG8A 3DNMA 3N05A 5AW9A 2UKDA 2TMKA 2R5NA 3I5AA 2D1RA 1IHYA 3LOUA 2E3JA 3BJRA 3GXBA 2NW6A 3LJKA 4MVXA 3K2QA 5FI3A 5JU6A 1YQEA 4XIYA 2A78A 2PWPA 3I2IA 1FDIA 1E0DA 4JA2A 4QEZA 2PT9A 4JJAA 3Q0IA 4KLZA 4S12A 1KBZA 2C8LA 1MV8A 1NNUA 3DHNA 4TTIA 4HLUA 3ANLA 1WVIA 4BGEA 1Y9ZA 4YXWA 4Y9UA 1EE1A 2FSHA 3D8RA 4KWEA 1YRQA 3DBHA 5K8CA 1YB2A 5DULA 1GP2A 4HPJB 1QJCA 3ER9A 2OILA 2C2MA 3R1IA 4KWIA 3P4UA 4TS4A 4QDOA 1MEEA 3JYQA 3KD2A 3B3QA 4B8ZA 3LLUA 3LQQA 3LXUX 3W9YA 1M0SA 1DC8A 2SBTA 2LNDA 3V6LA 4YC7A 4CLRB 1QIHA 4UTVA 1RDFA 3CLKA 4GOKA 2X6QA 2KJQA 2CY0A 2VWGA 3O6VA 1EBBA 3L9XA 2V3CC 1E2FA 3Q7RA 5IN5A 2BBOA 1UPFA 3VI3B 1EHYA 4MVYA 2OQIA 3RR2A 1XTVA 2I65A 4WA7A 4AECA 4BASA 2VT6A 2NVUB 4F97A 1S7GA 2EJBA 1E6CA 3GEIA 4W9NC 5FPYA 3B6EA 2X0RA 4O2BA 1G59A 3UAOA 1ECPA 1QK3A 1FSSA 1K98A 4XB6B 3VH1A 3ZOKA 3QPAA 4FYXA 4KKXB 2HW8A 3UJ8A 4KIFA 2WIFA 3KEQA 1ZXLA 2IUYA 5A3VA 3OF5A 1JHAA 3DT9A 4KLRA 4XYMA 3PWZA 5IT5A 1NV9A 2OCYC 1ORHA 2VJYA 2GJSA 4JLVA 3W5HA 3ZBTA 1WNTA 2ZYRA 3A1EA 3DGEC 4HZIA 4MW0A 2GILA 1J49A 5IPFA 5AOBA 3HE3A 1ZOOA 1VCHA 1DAEA 1R27A 2J08A 2W9XA 4P9NA 3UOGA 5DWVA 4PSVA 3AHFA 3T5DA 4EJFA 4KREA 4MARA 1AKEA 3OJXA 1RWOA 2FPXA 3EN0A 4ZVVA 1A7KA 1ZWKA 1CY7A 3E9CA 4EUHA 3VU9B 2MINB 2H1OA 3AM5A 1NRIA 4XE5A 1H2FA 1IY1A 4L3WA 3GFOA 1FFDA 3GUCA 5DM4A 4CMBA 1ZNZA 4QUGA 3MWEB 2V7PA 2BM9A 3JQ8A 2RGNC 3PHIA 2DPXA 3BFXA 3SXUB 4U00A 3ZIAD 5JMTA 3K2EA 3I0NA 1N8NA 4HWPA 4P4UA 1I94B 5BRJA 1NLUA 2HSEA 4P0TA 4X92A 1T1EA 1CQIA 3NBMA 4KOAA 3W9SA 5AFSA 3BGWA 5I7AA 2XKJE 4QDKA 4XIGS 1EUQA 1N2OA 3K70B 2DBRA 4KDRA 2YOHA 5AXDA 3TQOA 1VE1A 4AICA 5FEUA 5IWCA 1JH9A 1K3UB 1KKUA 5UKDA 4D99A 3TNLA 2R8BA 4PPNA 4NV0A 1M72A 4ZGBA 4DR3B 1WQ1R 1XL1A 3CSUA 3SJCA 5HCIA 4EJSB 1BD3A 1HMPA 3I62A 2NUAA 3Q0TA 5TC4A 4HZUB 4X44A 4BX9A 4MUFA 2DC1A 2A3NA 2ZSAA 4R7GA 2VHTA 3BWMA 4TQGA 5DLYA 5B3LA 1TVCA 2WJWA 1SPBS 4P0PB 1QLWA 2JRLA 3K16A 3FOCA 1DBQA 1MTZA 3EQ7A 2ONCA 2GZRA 2RI6A 3OFJA 6LDHA 4KN8A 4D3FA 3EGCA 4PO8A 2ZT6A 4U7WA 1UXHA 5BMVB 3EUFA 1F12A 3Q3GE 3VU3A 3I30X 3GNTA 3PUYA 3DQQA 2O0MA 3QLVC 1RKXA 4PNPA 1JPUA 1OZHA 1BYIA 2GYWA 3O4FA 4RABA 4K6CA 4UBKA 3SS8A 3FVVA 1PS0A 2PZGA 4TMTA 5JI2E 2QTAA 3AR7A 3CLTD 2VQEB 3H19A 5CB6A 1O95C 4K8RB 4LXQA 4AAYA 2QOEA 5JRDS 3AI1A 2GA8A 3E1GA 2ANCA 3W3ZB 2O7QA 3G82C 4DR1B 1Y48E 3CW8X 3ZBQA 4N41A 2PY6A 2O8NA 3G02A 1PNVA 3P2IA 5BSMA 4OLFA 4CKBA 2ETXA 3QIVA 1RXWA 3WZMA 1NVFA 1NVEA 4P4SA 2PEYA 1VSBA 3QEJA 1KK2A 3ENWA 1RKQA 4JCCA 2XUOA 5BN3B 4LPKA 2XSZA 2X58A 3KU4A 1UMKA 2VNSA 4NK4A 3FLAA 2I7CA 2BWJA 3GLGB 3X1XA 2WYWA 5D7BA 1Y6RA 2G08A 4AG5A 4J2OA 2BBSA 2P6MA 1QK5A 2QE7A 4JB3A 3RAEC 3L7BA 2X1VA 4LWOA 1NG1A 4OLHA 1P31A 5FXMA 1AHNA 3NLLA 2HA5A 2HLDA 5TJHA 4OLBA 5FH9A 3LO5A 3NWOA 1YI1A 3JV7A 2VG8A 4RGQA 1NYLA 3OTHA 4RX1A 4UHJA 2DR2A 1OH7A 4KPFC 4QQ8A 3VKVA 1T5LA 2VEDA 4AIRA 4CMGA 2WJGA 2B4RO 2WLSA 3P96A 4TRNA 4UAJA 1U7XA 4YDSA 1GL6A 1W76A 2WF8A 3AIMA 1VDMA 2WP8J 1GRNA 1VL0A 1M2VA 5J2TF 1E2BA 4KE7A 4TKZA 1NWCA 4P93A 2DVMA 3EG5A 4IIJA 1PT5A 3T61A 4LOHA 3G2NA 4F71A 3U4QB 2CXSA 3KPJA 3LRTA 4H7HA 4PQYA 3UWDA 3HP4A 1OYWA 4DHWA 5JY6A 1UMCB 2ZYUX 2DBVO 2J3MA 5CA0B 2ZUBA 4DRYA 3HTXA 2XVMA 3ZZ1A 1G8HA 2VDMB 1E9EA 3DE6X 3HZOA 4JAVC 3AILA 4WEQA 2AOXA 1EXMA 1SCDA 2FKAA 4TXHA 5NULA 5KNDA 2XOKD 1NGSA 2VHZA 1AS0A 3VRHA 3LY5A 1NDQA 3GRVA 1VE6A 2E55A 3P4XA 1NM5C 1WZUA 1WMSA 3PRYA 1AUPA 1EINA 4N3NA 3MGGA 3PGA1 3HV2A 2GXSA 3DKRA 3IV7A 4A0QA 4U7HA 1P1IA 4MAFA 3GFVA 5CXUA 4KK3A 4D9FA 3D1VA 1TAGA 4WLVA 3S55A 4Z4IA 4B43A 3M6WA 2FJ0A 4ZQIA 3OHPA 1N0HA 3ETGA 4BEBA 2V4ZA 3IEUA 4JGGA 4XVHA 3QI2A 4YRBA 2C4VA 3KTDA 2HQ1A 5BWCA 3KUDA 5C7IO 4GBED 1F2DA 4HH1A 2NNWB 5I4BA 4PC3A 3LXMA 4IQGA 2JLBA 1R0LA 4R1NA 3HB9A 3LHDA 5FADA 5DCUA 1P7ZA 2PMFA 4FJ1A 5HFNA 1NJFA 5DYIA 4LDZA 4NPAA 2NVOA 3X2EA 1E2LA 3W2HA 3U44B 4ED9A 1X1EA 2C4NA 1JB9A 3O75A 3WK4A 3ZY2A 4L0DA 3OETA 4QLAA 3MJEA 4R2WA 3WRYA 4Q37A 3SIXA 2YDXA 3FVTA 3NAQA 3CNNA 2O1SA 1G41A 2EQBA 2I4NA 1G20A 4NCIA 1BN7A 1KR5A 3ZV7A 1KI1A 4UM8B 5EXDA 1ZONA 3MJFA 4EI2A 3MAAC 4QL3A 4DB4A 4NNPA 2QDKA 3G49A 2VPYA 5I7WA 3MGKA 3ED5A 2R1VB 5BNTA 2YZ2A 3LSTA 1P61B 2QW1A 3MS2A 3M0EA 1CS4C 1E1RD 4M37A 3WYBA 5C5CA 1N6OA 2X23A 3BMCA 5MN5A 5AICA 5F9HA 5DBFA 4DDKA 3CZAA 5FUQA 3EFEA 5E4FA 2DF8A 2GN4A 4K05A 3GARA 3HUDA 4R5MA 1ZBQA 4NHEA 2V5UA 1N25A 1RBMA 3SXPA 4YUZA 3BBPA 3HXTA 4JI2B 3LQKA 4Y30A 2J3IA 3I9V6 1RR6A 5A4MS 3ESYA 1QQBA 4PTZA 4RMGA 3UVEA 3KQHA 3W8RA 2HPAA 4D43A 3LD9A 2JS7A 2AYZA 3LP8A 1MOQA 2DQKA 3PRJA 4NCJA 2B25A 4JJEA 4LZJA 1O77A 3DUFA 3WYNA 4RFSB 1G2QA 2JFHA 2ZBRA 2IP2A 3R3HA 2FV8A 1ZIPA 4YRQA 1CUJA 3F6CA 3QV2A 2QZ9A 4KHZA 4A4DA 4R3NA 1UAYA 2PZBA 1ZW1A 3ZDRA 2HLNA 1S8OA 5J63A 4HDSA 3QE2A 2R6GA 4FFDA 4X20B 1OLSB 4YQFA 2PUFA 1H22A 4XUCA 4FMPA 1BA3A 1UQRA 2FSFA 3B2EA 2IH4A 4L6CA 1ILEA 5E7IA 4TWRA 4O5AA 1JEYA 1C1YA 5ALRA 1T9KA 2D00A 5EN4A 5FKJA 4N0EA 1KVRA 3CG4A 1TNDA 4UBIA 4ZKDA 4AMZA 5KBYA 5G41A 3LHSA 2IX3A 2LXNA 4I1PA 3TMAA 1LXCA 1Y5LA 4IYRA 4Z8YA 4BL5A 2CUKA 1ZIOA 2VDJA 3HFRA 1P33A 4AJ9A 3ZIAA 3ZH2A 4Z7QB 2QD4A 3WGKA 3S3TA 3BQ9A 3HADA 2WG0A 3IHWA 2JGDA 1FP2A 4GQIA 3C6ZA 4P3PA 1PWHA 2BR4A 2O23A 1DOZA 2PXXA 2Q2NA 3PENA 1N2JA 5CMLA 1O0BA 5H68A 3TFWA 3SVLA 3GEHA 3UKJA 3A28A 4MWZA 3KLNA 5JFTA 1UM9A 1Z7EA 2JFWA 1NJ6A 4G89A 2QLNA 3FNQA 4GHWA 3L3BA 4DDWA 2QRKA 4MB0A 1IWBB 2CJYA 5A0VA 2OGTA 2QP4A 2VKTA 2WKRA 3HP7A 2IYRA 1DWOA 4RJJA 3CJQA 3LKVA 4AKSA 3U19A 1XYYA 3K9LA 4PG8A 2WINI 1QR2A 3OO0A 5D5HA 2CFCA 3K8ZA 3MFYA 1Y82A 3KLOA 4DDVA 1GN9A 1BFDA 1FP1D 5THQA 1KS9A 2ID4A 3MWDA 1EE2A 4GOOD 3PKZA 4Z0HO 2B0CA 4LK2A 3AHDA 4BMDA 3WGJA 1QX4A 1YXMA 4W9RA 3ASYA 4D80A 1TB4A 3HN6A 4CLDA 4ISBA 1VKZA 4J90A 4MRNA 5FPSA 3AVVA 4UD2A 4X62B 1XKQA 4EEZA 2Q46A 9GPBA 1U3VA 4AO8A 4BP8A 3TDNA 4AS2A 3TJMA 5I51A 1JRLA 2PU5A 3DKKA 1VG1A 3SKXA 1GTJ1 5DM2A 1UKEA 1L5KA 1IK6A 3N5KA 4CF6A 5FI0B 5I7HA 4FM9A 1HI9A 1RWMA 3CRNA 3EEIA 3VPAA 3VVCA 2GEBA 3PQ8A 1N6KA 3VPXA 4R0MA 4F2WA 2PWZA 2EW1A 2QAGB 1NVUQ 4QQFA 5AJXA 2PX0A 2O2IA 4K6MA 5ESRA 1Z2AA 3K6JA 3NJ8A 4KYVA 3TBKA 2CLSA 3CX6A 4KQIA 4WBNB 4RTRA 2P5SA 2O9JA 1QU3A 3WDSA 1PT8A 4D5EA 1JHDA 5C7LO 2QG4A 3F6BX 1WZNA 3IEPA 1RVDA 4B7UA 4BRUA 4DA7A 4UAGA 3GQVA 2AC4A 2JVIA 4KTVE 4TUYA 4YRGA 5BN3A 1GUDA 4G5XA 3S2GA 4L4UA 1VJ1A 1ABEA 2P3QA 4KYTA 4B6SA 3L4EA 4V3BA 1X86B 1X9HA 4EVIA 1EWVA 1Z8HA 2A8YA 1MVLA 2B7BA 3R41A 4DLTA 3LECA 4WT7A 2QYHA 4ZU1X 1PO7A 3GV0A 1D0SA 3IHTA 3D3QA 5TMPA 1B1CA 4JI7B 4NCBA 2V9CA 3IVCA 4YACA 2XE4A 1MR3F 5AOCA 3CZ5A 3I6YA 4CIWA 2GHQA 1U81A 2QX6A 4HDOB 2O3QA 5ALEA 1YULA 4N40A 3CM0A 1OT5A 3JQRA 1TA9A 1CUXA 1RU3A 2P2GA 2OXFA 5G3YA 1TZMA 3T7CA 4FDMA 4MR7B 4R71A 3PKJA 4YI5A 3T7DA 2JLVA 1GFIA 2G5CA 3DMFA 1Y9AA 2I4IA 4OUKX 4TM8A 1MQAA 1U11A 3ZHRA 4BAUA 4EHAA 1IOWA 2I4MA 1BMFD 3G6KA 2W6NA 4HWTA 2XOKA 4IGAA 1D3AA 2I3BA 1Z5VA 2Z4RA 2BDTA 5HJ7A 3OQPA 3A37A 4NK5A 3EZ2A 5AXCA 1RWPA 2WF5A 2M6RA 1QO9A 2ZIXB 4ND8A 5JZ9A 3DBHB 3O94A 2P9CA 4RXTA 4TKUA 4BTEA 5KSOA 4J75A 1SUBA 4C43A 1XPUA 3AVPA 4D96A 1PS8A 3SWWA 3CUWA 2JFXA 1HG1A 1I1NA 1DB3A 2JD2A 2ZSKA 1QQAA 1CJVC 1EEHA 1XTBA 3B3GA 4N12A 4F5DA 3BB4A 3KFLA 1L8AA 2PUAA 4LHEA 4OYRA 521PA 3BE8A 4GO1A 3AQIA 3RJ5A 1M0TA 3QUAA 1CY0A 3F3SA 5A4AA 2YOFA 2IS6A 1JKIA 1ONSA 1T8SA 4N9WA 4EECA 5GINE 3JAMA 3H9GA 2I2CA 1JU3A 1NUTA 1YL7A 1D03A 3CF4A 1SBQA 1Q83A 4QUJA 4G1VA 4ZI7F 13PKA 2J3EA 4R7ZA 4HV4A 2PH1A 5IDXA 2CBXA 4FD3A 3DOEA 3FFBA 2PPVA 3DPUA 5ANRB 2QZJA 1PLKA 5CCDA 1L4EA 1P6XA 2DR3A 4E6PA 1S7CA 2OCGA 4RKRA 4X1KA 4MRSA 4ZT4A 3UJ6A 3HM9A 2FSPA 3HNPA 4G0UA 5B3KA 4GVPA 4L9SA 1J39A 1RM0A 2VNAA 4Y2UA 2FX3A 2DRIA 3FUVA 2VPIA 1C0EA 4MDHA 4OHUA 2A0KA 1KVUA 2G9UA 2BEJA 4IFIA 2QUIA 4YHBA 5AW1A 1IUKA 5MGBA 4MW7A 1EM6A 4CF7A 1LX6A 4IBOA 3ETCA 4MCJA 4UREA 3ITKA 2ZUVA 2B99A 1U3DA 4N49A 5JCXA 4JZKA 1CHDA 1E1RA 3FHCB 2GF2A 3MMZA 3ONWA 2R8EA 2HU5A 3BCHA 1C8VB 3F5MA 1D2NA 1GNTA 1MOSA 1DFIA 2IYAA 4GLBA 3N2EA 3RUAA 3IESA 3WR5A 1DKQA 1X13A 3F4LA 4I9GA 3UTCA 4MV6A 1EWTA 3LIPA 1X14A 2PH7A 4ZAWA 3RHTA 1MO3A 1Z4LA 2IE8A 2OM2A 2ZWPA 5DTIA 5K8UA 3JQ8B 1NT4A 3KCNA 3AFOA 3GJQA 4CMCA 2JJQA 4L3VA 3JWHA 2F2TA 3B9BA 4LVUA 5HOQA 2CHGA 3HO8A 4U9UA 1CQIB 4OBEA 2H9YA 4C7XA 3MTEA 4B4VA 1CJSA 1Y1QA 1KOJA 2QSJA 1B0AA 3E7PA 1JQKA 3EC1A 3H8JA 3Q5DA 4JK3A 4R31A 3SYRA 1X2BA 2C9YA 1N34B 3JYPA 4HMOA 3UJHA 2ZULA 3NI2A 2OR3A 5K03A 2C8VA 2MWMA 4WNAA 3UNXA 1B93A 2SKCA 2PZ8A 3DOHA 3HKDA 3UYLA 2YZKA 1RWBA 5JSFA 1J2JA 1QV6A 3FNRA 3GJXC 1R4NA 3K72B 1BZYA 3EIQA 1M6NA 4RBNA 2NUAB 5K6AC 2BC9A 3IQGX 3MTJA 4BMSA 3DGFC 2D1FA 4N4AA 4E21A 1FCJA 2P0YA 4IXTA 2PS1A 3A4LA 1E8DA 1NYTA 5A3JA 4HMQA 4ZVQA 5AJZA 2B5WA 4PS1A 1CZLA 5HM8A 4GZ5A 5CGQB 4FFNA 1AGYA 2IJGX 1FW6A 2KQUA 1IEXA 1P6QA 2WJYA 1JJIA 3G2JA 3U81A 5JPCA 1RXSA 4M0UA 3V4ZA 2F3RA 4MJ3A 1NJ2A 2ZR9A 1VB3A 3L6EA 3GLFA 4MDEA 3AU9A 4XVCA 1DC5A 1O6CA 3ZD7A 3ZHXA 4F4CA 3U7QA 1Q0PA 1LFAA 4UE2A 4DKXA 3I9FA 2GXUA 3ZGNA 4P58A 1F2TB 1XQVA 1Q0QA 3WMGA 2NACA 4CU2A 3AMVA 5KQRA 2RAUA 1ZUHA 3CNLA 3ZC3A 4F9GA 4RF5A 5JC8A 1GWNA 1Q1QA 4BJ6A 1ZESA 4MQFB 1J1ZA 4PR0A 1Q3TA 4B3RB 1P4GA 4A6DA 2YW2A 4CKBB 5D2CA 3MT8A 3WGTA 2W42A 3JQBC 1NXWA 5HF9A 3TOCA 2P40A 2E2WA 2X8WA 1PHPA 1QWSA 2XWQA 2FEXA 4I0WB 4PLWA 1MH1A 3TSYA 1XZGA 2C8KA 5LD2B 2P7IA 4ZYLA 2IHBA 2AR7A 4RD4A 1SCUA 1EAYA 1YB6A 3AKEA 4JLOA 1AXGA 4OIMA 1VIYA 4DBZA 4DA0A 3VZBA 3NYQA 1FF9A 3EBPA 2Q9CA 1HGXA 4RK7A 4G3XA 4OREX 3FFTA 4EG6A 1YJ8A 4BMPB 1WB5A 1U8UA 4LISA 4CFZA 1XQXA 1NSTA 3QFTA 4JASB 3LW7A 5EESA 1E4YA 3J81A 4G85A 1SPXA 4ARBA 1SR8A 2EJCA 1M5UA 1KJNA 2D0OB 3GT4A 3QMWA 4UNSA 3RU2A 1J24A 2GAOA 1W4AA 4RZXA 5AHWA 4ZT5A 1LJLA 5KYYA 2WJJA 4N03A 2WT8A 4IIJB 1NMEA 5JCPA 4IXWA 4R5HA 2TMGA 1LRLA 4HG2A 2QW8A 2ZPTX 4WZBA 4BVBA 1FUIA 5AKJA 2WSSD 2VNJA 1N9GB 1QC5A 2C0PA 4UHDA 5DN6D 1SRRA 3N76A 1H4TA 3IT1A 2GKGA 3P0EA 2XRMA 2J09A 4Z7NB 3GP8A 5BNFA 4DMRA 1DBSA 3UJAA 1QBGA 2OBLA 4JLPA 3NHKA 4KQCA 2VXBA 2XLBA 4QX6A 4TLAA 3TQCA 1BW9A 4ZTZB 4ON9A 2VP4A 1DMSA 2JLXA 4PYJA 5A5GA 5F21A 5I9BA 1GGNA 1ULZA 4D0NA 2R6HA 4IHAA 1TEZA 4URUR 4CLXA 1YA6A 3INGA 2X7JA 2XB2A 3REQA 3O3CA 2GHTA 3C97A 3Q9LA 2W2TA 3F7NA 3LCCA 4XD2A 4FXPA 4BIIA 5IASA 2QTHA 1NA5A 1FDVA 3ZLBA 2BIFA 4X9XA 5KHAA 4JZYA 4A91A 3DBIA 3THSA 3LX6A 2EJVA 2RB4A 1DC6A 4RH1A 2M6LA 1WR8A 1U99A 2BCEA 1FXUA 3F0TA 1W6RA 3HWX1 2BELA 2IY9A 4PO1A 2VHQA 3HBMA 3IVAA 2ZI9A 1OBHA 1VLMA 2VP6A 1L5FA 2XA9A 3NIWA 2Q5QA 3L7LA 3A9TA 4HLNA 2Y05A 5DM0A 5FLEX 3SC2B 3X2FA 4BBZA 4LC1A 4PHCA 4C5BA 3FZNA 3WGIA 4Y6SA 4LA4A 6NULA 1BMFA 4QPCA 1V4BA 3INYA 3TAHA 1QTNA 3VC3A 1P2FA 1XD9A 4QG7A 5F2OA 4D98A 1BHQ1 1G20B 3KZKA 3R4CA 4OB7A 4I14A 3KQPA 2UAGA 2YZ7A 2O54A 2QORA 3AB3A 4LHZA 3O3MB 5AVVA 2K7FA 2GF9A 1Y3HA 1TU0A 3HRIA 2Q7XA 3BGDA 1MMFB 1UPXA 2VLIA 3GVPA 4P84A 2GD2A 3BMCB 2FSSA 3EXHA 4EY6A 3OQMA 2FW6A 1IOLA 4ND2A 1XF1A 4AJEA 4CM1A 3UUWA 1G2OA 2JFUA 5MGNA 4RH3A 1DO0A 1DT5A 3A4YA 1T3LA 1WKVA 3EEYA 4QZVA 1ORIA 5HZHA 3PL1A 1P1FA 3V1YA 1I2DA 4Z49A 4C1NA 5T4HA 4RTNA 2CCKA 2PRKA 1NLZA 3AT1A 2Z6QA 1T3SA 3T5AA 4NFLA 5LMCA 3I5MA 1J09A 3AU8A 3BH0A 1MT0A 3DOCA 2GRAA 5EP4A 1P1HA 3H05A 4RPJA 2V1XA 4XCQA 3DMTC 2NV2B 3ZLVA 1QYIA 1R0YA 2IYYA 2G3YA 4H6PA 3PJRA 2H00A 4PCAA 5AM2A 4I5GA 2E0IA 3CJRA 4HDSB 1SUIA 4OHOA 3ROXA 3GRRA 3P71T 5DHRA 4CDMA 4O5OA 3RFUA 1N5DA 3S4YA 3ODPA 5C51B 4J9VA 4J3NA 4M9CA 3NBFA 4HAZA 1A4XA 2E21A 1GLNA 1JEYB 4IL5A 4OA5A 3TQRA 3VVLA 3DOJA 2A5GA 1LEHA 5ELLA 1ZGAA 1H66A 4NH4A 4B3TB 4D79A 3SR4A 4E15A 4JVMA 5KDOA 4EQ6A 1SO8A 1HE5A 4MVCA 2PKRA 4UTRA 1X7WA 4FONA 3OTOB 2VIIA 4WOBA 3R7FA 4QUHA 5J9FA 2F55A 4ACBA 5LKAA 2HRZA 2X3FA 5HCNA 3UKDA 4TV9F 2I62A 2JGDB 4C6TA 3G8CA 2HDNB 5BYJA 4X65B 1WXEA 2QN3A 3NONA 1A50B 2J9FA 5JDCA 2PK3A 4RY2A 3GC6A 2IPMA 1E1CA 4QG3A 2TECE 4D6PA 2PYZA 4Q0MA 1UM9B 4OYHA 1UT5A 1IZ9A 2ATXA 2OV2A 5LP6C 1D1PA 2ANBA 3Q3HA 1P17A 1V6AA 5U4QA 2QR3A 4PZCA 3RW9A 1C0LA 2CLMB 2GDZA 1KHTA 2PZJA 3NTXA 4M53A 4ZOAA 1Z5GA 1JA1A 3BE6A 3MVEA 4Y18A 1IHXA 1DG1G 4L74A 3S70A 3FCEA 4FYMA 2C96A 2JCVA 1CK4A 3RG2A 1X80A 1ZQ1A 2W90A 4IX9A 3D6TB 3FMPB 5AOAA 3RQSA 3PUXA 3MWDB 1KFJB 2GVDC 3OM9A 1W96A 4LBYA 4DGQA 1XDBA 4PPQA 2NTEA 1NXSA 5FBVB 5G1OA 5HE9A 1UAAA 2GAJA 4B7XA 2LIVA 2AR9A 4EVSA 2E6KA 1TPZA 4PN7A 1UXJA 4DCTA 2WUEA 4GDFA 1ZDMA 1OZAA 3NCHA 3H5RA 5K2OA 3F6EX 3DR3A 2Q1SA 4LSMA 5DNAA 2CUZA 3ORQA 1VECA 2D13A 4K28A 1L5HA 3BDIA 3WL7A 5KJFA 3GAMA 1NXQA 4R84A 2I1VB 5SZKB 2Z8XA 1SUEA 4A8JA 5LM3A 4A7PA 2I3DA 4TV8F 1FW8A 1W85A 2A9FA 3DR5A 5CLFA 2C04A 5I9TA 3ML1A 3C16C 8MHTA 3IALA 1NI3A 2EYQA 1PZXA 5D3QA 1ORVA 1DPFA 4AZ3A 4RZQA 2DXIA 1Z88A 1JFSA 1TQ4A 1P4RA 3MFQA 4M8LA 4N5DA 4RA6A 3KQTA 5AHRA 4M55A 5EVJA 4GC9A 3RVKA 3RYCA 3CKYA 3OQHA 3PEVA 3GFFA 5D86A 1DBVO 3B9PA 1PYDA 2RH9B 2X2EA 2CBGA 3ZGYA 5G40A 5KQGA 4NCAA 4TUYB 4W1PA 2ZJAA 2IZZA 1CT9A 3H5LA 3I2HA 4BNFA 1SWWA 1KDRA 2BDEA 2QLTA 2ZVDA 1GZUA 3EPRA 3F5DA 1Q57A 3DBLB 2BGIA 2XQVA 3H8WA 2YQ5A 5FLXA 3HRHA 3BWVA 1ZOSA 3GXOA 4YP1A 4NU6A 2YXPX 4YVFA 4JH0A 1B43A 1MO4A 4U8GA 5LOVF 4U6SA 1KAQA 3H2ZA 4RK4A 2FR0A 3QQPA 3U7EB 4HAYA 4ETNA 3QXXA 1NW5A 1XRMA 1Y3IA 1SULA 3LC1O 1EVQA 3DMYA 3ORRA 3AUJB 2VP2A 3I61A 4KV7A 3RU9A 4Q3BA 2B3DA 3GJ3A 2E6UX 1O6GA 1T2NA 2WNSA 2WSSA 5REQA 4ENQA 2Z1DA 1TADA 5KVSA 3C4JA 1GPUA 3ZDAA 4Z2AA 4TYWA 1ZA1A 1DEHA 5DN6A 4XLZA 3PXGA 1HEUA 3BG5A 3PX3A 5JLAA 2QPOA 1RRPA 1GPH1 2GBGA 2JATA 2RH4A 2JFYA 4KP7A 4L08A 2GBCA 1KZ7B 2PD4A 1TPYA 5I48A 1L8XA 4I6GA 2R7MA 4Q39A 4HX5A 4MZXA 1GPMA 1KAHA 1SVOA 3DEHA 2J30A 2A5JA 2P5YA 4PYKA 4CGYA 3WISA 4DNFA 5H83A 3K3PA 4Q4AA 2V6GA 1JF8A 5GGXA 1LPOA 1YAJA 1S4MA 2VK4A 3F46A 4TKVA 3BL8A 3E53A 1O9HA 1UBTS 1HC7A 4FEYA 4MYHA 2B2NA 3EIOA 4K8OA 4LAFA 1DEKA 4PPFA 1XMVA 4UUPA 3HBNA 5TY0A 3R3VA 5AQ1A 2CNNA 2Q2WA 3IP6A 1IBMB 1BEZA 4EAAA 2OB1A 4UARA 5J4LA 2R1ZA 1XMOB 4FIZA 4OQYA 1LDBA 4C4PA 1JWLA 2SNIE 2ZJOA 1IXKA 4FJ0A 2VA8A 3RAPR 1MNAA 3GBSA 3WLMA 4BVFA 5K3EA 2DLNA 3HL4A 1XHEA 5HDBB 3UANA 1F0YA 5L9AA 1SQ5A 1P7VA 3RJ9A 5A6VA 2FEOA 2WF6A 2P3LA 4WBSA 3HVKA 3FTEA 4RVFA 4GICA 4IRUB 2JA2A 1ENOA 1FBNA 2X0IA 3QBVA 3RRNA 4IWNA 1GJRA 1DVRA 1GT91 4PZLA 3STYA 3NTVA 1G9XA 5CYPA 2WZCA 4CIYA 3RH0A 4YAIA 1BHJA 1VYVA 2WJPA 4HY3A 1K6IA 2FVYA 4AMYA 4BJ3A 3DXYA 5AKIA 5DTEA 1I9CA 3ZW9A 1CEQA 2DH5A 1VYHA 2P4QA 3DP7A 5FNZA 2GTHA 1H6BA 4RM2A 1E98A 5J4HA 2ZTHA 1TVKA 5TQ2A 2CB0A 3D7RA 1X1AA 1TM4E 1I0IA 4HRAA 4E09A 4L6IA 4HNVA 3F9CA 3PFWO 3HXOA 3VDQA 1YGYA 4R98A 4XD7A 2WWXA 4C21A 2DE0X 3OZGA 4I55A 2FG7C 3BULA 3VNSA 1ZP6A 2P2ZA 4WSOA 4YPOA 3PDJA 2AMYA 1UDCA 1R0SA 3IT0A 1FPMA 3OG9A 3UA3A 2WA1A 4JVNA 2DQ4A 4WEOA 2ID9A 2FRXA 5A7FA 3H87A 2GD1O 2WV7A 4JY7A 3ROKA 2IEAA 5DHPA 4OI2A 3BIJA 3WIOA 3CUKA 3NKVA 3R3YA 1XCGB 1QZXA 4NBVA 1YR7A 4ND3A 2E89A 4IM7A 1J2TA 1P7CA 2GJ4A 3H0KA 4FPXA 2K2QB 1JE0A 4RIEA 3DLHA 3RC9A 2ZE8A 4ALJA 1C1XA 1DIAA 1VJCA 3HKDB 4CM5A 4CKWA 2YJ5A 1Z7WA 2PNFA 3M6XA 2ZM6B 4HUQB 3I5XA 1HZZA 1R4NB 5BUQA 1MC8A 3B5JA 3PA6A 4J07A 1W5SA 2OFXA 3AHHA 2ACVA 2CZQA 3EXIA 4TL8A 1YWGO 1AE1A 1RJWA 3QMVA 5I8WA 1J8MF 5DHSA 1LC3A 4O29A 1PG0A 1UOQA 4JQOA 3DPIA 1NX9A 3LC2O 3PI6A 4QT4A 4ONEA 1PT7A 3DV0A 3GROA 3K0CA 3W1VA 4BV9A 1APBA 3AZOA 3T9AA 2GZ1A 3LUCA 3CVUA 1HNZB 2O8CB 5BV8A 5TF0A 1AN9A 1MHPA 3NFRA 4QKQA 4RE5A 3UW3A 3GLFB 4LJ5A 3CUVA 1VLQA 4NZZA 3ZHOA 1UH5A 4BAGA 1GZ7A 3U7QB 5EWJA 1HXHA 1TMYA 1E1QD 2Y92A 4NFSA 5F3WB 2EBUA 2EZTA 4RD2A 5HKKD 4RQBA 1F7VA 2YWJA 2EARA 4Y2XA 1FFSA 1KH2A 1MDFA 1N0UA 4Q3CA 1V39A 1U1CA 2WTNA 2ZBDA 3PNPA 5CK4A 5BSTA 3DULA 3HB0A 3N2NA 3IUEA 3CEPB 3UGTA 3HU3A 3D5EA 4YMHA 3MNFA 3PGMA 1N2IA 1ND6A 5AI6A 3MZ0A 1CYEA 3V1NA 5F7XA 3FZQA 4RZIA 1HEIA 3IB3A 1EX9A 4AF8A 4EHBA 1T4CA 2RHLA 4PF1A 3O2QB 1DBWA 2F1KA 4BB9A 5GIPE 1TMOA 1E9VA 4FDUA 4RFVA 3AJEA 1W35A 2JGIA 3G89A 4F72A 2AN4A 4JLSA 2R1TA 4MDFA 5DOZA 4GKAA 1LBEA 4NEGA 3UUGA 1HV8A 1SJ9A 1IWPB 2B20A 4EW3A 4G6ZA 5JCJD 3NPAA 1JDSA 1WMAA 2ZITA 4HS4A 5EMJA 3RS9A 2XE8A 4BQFA 2I33A 1FS4A 7MHTA 4N8SA 4UUMA 3ZHZA 3EZNA 4PGAA 4MMYB 3OCCA 1F5SA 1M83A 1LI7A 2WFMA 4L8WB 3ZWXA 4CKCB 3R9WA 4F5YA 4AJHA 1KY5A 4R81A 2IV3A 4GE3A 5I4KA 5LU9A 3BRWD 3WE7A 5HQJA 4XAQA 3QFFA 5SV2A 2ACKA 4O3MA 5EIOA 3M3DA 4B79A 1B8UA 2JH3A 3KJXA 5AVTA 2ZJ0A 1L5SA 3HU5A 3I6MA 4O6VA 3QZUA 3TZ6A 3DA8A 3E7FA 1OTHA 2QL5A 4HGYA 4DRXB 3AO0B 3L4JA 1FJXA 2QY9A 3PYMA 4WZBB 1B2RA 2BI4A 3T95A 5A02A 2DWCA 3NX4A 2B7LA 1M0EA 3LOPA 1QC5B 4HWGA 5FPQA 4K0KB 3UC5A 4UKDA 1M2KA 2O19A 3C7AA 1L4GA 3SLRA 1W19A 5IC4A 4ZZIA 3GEGA 4ZDJA 5ABPA 1J97A 2OHIA 1ZX1A 5IM4F 4BQRA 3MLEA 1EVLA 2NSJA 1ZUNA 3AG6A 3R3XA 2WHRA 3KV3O 3L92A 4HFMA 3O4JA 1SURA 2XQGA 3LX4A 3ZYCA 1RS0A 3H5NA 3JD2A 4LYGA 1L8LA 1MVOA 2FPRA 3QVMA 4BQOA 4PCVA 1DOHA 1PJ4A 2O3SA 2QV7A 4ZQEA 5BV7A 1NF8A 1JQAA 3K0HA 1TTHA 1BDJA 1NQTA 2FETA 2WJ3A 3QU5A 2WPNA 2Y1XA 1PJZA 4QXAA 1JVNA 2A94A 2I6UA 1XK6A 2YZGA 3NALA 4MKHA 2PH3A 5JNWA 2VSQA 2BGLA 2HEIA 2DFVA 2Q45A 3DUWA 5KYTA 3DCYA 4MGHA 4RETA 3RT7A 1YZHA 2IHVA 4HVTA 2PVPA 1Z07A 5B4TA 5E6UA 2AV6A 4IHJF 2G9NA 3F74A 1NULA 2OCAA 1WULS 3HWSA 3FVWA 4HH4A 2H0AA 5KU7A 4Y9SA 4D4LA 5K8IA 1GUAA 4E4TA 1RBYA 4ODIA 2HLHA 2XX3A 4HWSA 4L9WA 4I6EA 1S0UA 2H1CA 3DAGA 1RYDA 3FAKA 4TLLB 2WIJA 5BO5A 2EQ5A 2ESRA 5KKNB 1ZVVA 3OTQA 5IJWA 4IKOA 3IDSA 4QNMA 5E1OA 3UCEA 3RWMB 4GMGA 1P4HA 1V11A 1C41A 2DPYA 2VTVA 3CN7A 4JJ6A 1XXLA 2D1SA 3IQHX 4I1VA 1YRHA 4YO7A 4DY6A 2WWIA 4QQNA 2UYHA 4TWJA 1CY4A 1C3XA 4RMHA 1YIDA 3KAQA 4ZAVA 1JTFA 1DI0A 2GM3A 1YK0A 4MR9B 5IC5A 2E4ZA 1JE1A 1OXSC 4B1FA 3K8QA 3PITA 1E6KA 3ST7A 1ZKMA 1QUFA 4ZMBA 3OLXA 3RKSA 1GQRA 5IVKA 1SD5A 3LUGA 4FOLA 4GEGA 2O7VA 3HVRA 4M0DA 1P73A 1Z35A 2HIHA 1RYFA 3HJGA 3AFHA 1Y4DE 3DFFA 1TQHA 5E4YA 2FMTA 4J1TA 1BQEA 1M2FA 1E2GA 1OIXA 1XVIA 5JIBA 1DXHA 1R9GA 4IDNA 4DWJA 1YU9A 3LP6A 1J90A 1RPNA 1USIA 4KN5A 1D2CA 3VH4A 3EGDA 3AUAA 3O91A 4RKFA 3RUCA 1X8LA 4XWGA 5DB4A 1JT9A 1ZXBA 2YN2A 4L7QA 4CG1A 4DEYA 2WJAA 2PVSA 2RHDA 3HKCA 2Z1MA 4K9MA 1C80A 4ND4A 3K0SA 4M1SA 4IIDA 1IN1A 1E20A 3DS8A 1BH2A 2C98A 3JYHA 4DY4A 4UOZA 4JI0B 3W3AH 2HXYA 1JTEA 3LPLA 1FMFA 5BNIA 1CUUA 1KJ9A 2CDRA 3M89A 1YK1A 5I8ZA 2V58A 1JGTA 3OP1A 2ZIGA 1GKKA 4IG9A 2OLKA 3QLUA 5B53A 2H63A 3FSJX 5KU1A 1DQRA 1E32A 2IIBA 3P9RA 4OM7A 3FI9A 2HQRA 2DKFA 1QRRA 2WAAA 3RSFA 2OWDA 3E9ZA 1JJ7A 2WHYA 1X7WB 3I01M 5AK3A 2YNMC 1UBSB 2QVGA 2Y1WA 2EU8A 4A8PA 5JYEA 2ICAA 3KXKA 3H6GA 3T9BA 3WL5A 2AFIA 1GGMA 2HF7A 3HACA 1P81A 2HDWA 1GSIA 3D0KA 4J4BA 3CC8A 2J9FB 4XDYA 1D7AA 2V65A 1GU0A 3LUPA 3P2KA 4IFTA 4QQRA 4D3DA 1E1CB 2QN2A 4QDXA 3LBYA 1AQIA 3CPHA 4BFWA 2VDNB 3VMFA 5T7BA 1FQKA 1KOGA 3EFBA 3IP7A 5L7YA 3L2OB 5TPWA 4PIMA 5HK9A 1SIOA 2RGCA 4CDRA 1AS2A 5KQMA 3KJIA 4ZD6A 4ER6A 1OXKB 4I5DA 3VC1A 1RXVA 3H7IA 2ZI3A 4GBJA 1SC9A 5FFMA 5CEEA 2YKGA 4B35A 5GVRA 4Q9DA 5CA1F 4NV3A 1XN1A 3ESZA 3Q11A 2AUNA 1J23A 4JMPA 4LQ4A 2YV3A 1MQ9A 1X80B 4GPBA 1C50A 4WY5A 4A0RA 4LYJA 4ES6A 4TN1A 3IIIA 4HYEA 3ELWA 4QFCA 4R8SA 2B21A 4KIUA 5F3DA 4JYZA 1M8JA 3I8SA 3ZWNA 1Y4ZA 3AFNA 3F6PA 3G59A 2QN6A 3LTEA 4X94A 4KI0A 1SK8A 1PRYA 3ROTA 3V32A 5J47A 2HNBA 2QYTA 5JS7A 4HRXA 1UKAA 3KKEA 2Z8YA 2CB9A 2XIJA 4RVDA 1ADCA 4EHNA 1W73A 3KZOA 1E1QA 4KAAA 3C7CB 2JFOA 5ALXA 3TI7A 3TRHA 1CQPA 5HKKA 5K0TA 2VDRB 2PSSA 2QAJA 3PV0A 5BOVA 4G0VA 1JLHA 3MUOA 3WWCA 4J16A 2R7KA 2ZTUA 3NOVA 4CL0A 4OHYA 2XDWA 3ILVA 1W85B 3EUEA 4GNKA 1TD9A 4PG6A 3WL8A 3I9V1 2JAPA 2WAYA 4MAMA 3FE2A 3TNFA 3E4CA 3C8DA 4AP6A 3NBYC 1T3ZA 1D2AA 1Z06A 3TOXA 1PGJA 1EFLA 2PD3A 3OT4A 4AZ3B 2XA1A 1EUCA 1WX1A 2PUHA 1Z6ZA 2XD4A 1RM3A 4KACA 2ZJ6A 4YRAA 2OKCA 5HGXA 1NJSA 1S1MA 3E9QA 3P0FA 4EKGA 3RYCB 3ITEA 2I6TA 1MH9A 3G7UA 2ZI6A 3QNWA 4E70A 1Z56C 4YFYA 2X4IA 2X2OA 1KI2A 2B34A 5ELMA 1DV2A 2ZSIA 4MS3A 3S27A 1EYZA 3AR2A 5JCJA 2QVZX 3TLEA 4KBGA 5THXA 5JJCA 1ZD4A 2XTJA 4I08A 3ZCRA 4E3ZA 5HKLA 5DSZA 4YMVA 121PA 1UWVA 1W36C 3OQOA 5FBKA 1U1DA 1COZA 4DA4A 2H1HA 3VPFA 1W1IA 1Y8AA 2XZOA 3A1FA 3E58A 3IA2A 3KPWA 4HGZA 3BRWA 5HGJA 5DCWA 3IDAA 4R40A 3K9FC 1JX6A 2GJKA 1ZK0A 5EMHA 1GTRA 1HTTA 1DINA 2I3AA 2WSIA 4HGPA 3QX7A 4A27A 1BE1A 2DFNA 2R62A 3RAJA 1L4YA 3GCGA 1BIFA 4B3SB 1E9AA 1JV2B 1YBVA 3AH8A 2OHHA 2J5RA 2R66A 2NYAA 3L84A 5HILA 5BR1A 4HRVA 1JFTA 1EWRA 1IQ0A 3AF4A 1XAIA 1ULAA 3IVMA 1CUYA 4I46A 3TSCA 7GPBA 4NECA 4ZQHA 2YVKA 3WYFA 2WYVA 2DY0A 1J33A 2FDXA 2P41A 4OAOA 4WKBA 4EVQA 3AJDA 4V1CA 3V4RA 2WW8A 4EUSA 4XPZA 5LIRA 3LPDA 4UUAA 2GK7A 5KWEA 1L1QA 5JSZA 4TKVB 2EFYA 1J20A 5DLDA 5JS2A 1ZW6A 2XECA 4JP2A 5I9MA 5D3MA 2HNAA 1J5EB 2XMRA 3MIIA 1OGYA 5JNSA 4I36A 1R2QA 3AEKA 1WMFA 3SFZA 5KUTA 1HYEA 2LRHA 2C78A 1KSHA 3ILYA 4KN6A 5CXQA 1FEZA 3B3FA 1C1DA 5K8VA 1Y4AE 2WR8A 3IQZA 2W00A 1QRUA 2MU1A 2N75A 2FXVA 3ELUA 3NWBA 3MW8A 4I1SA 5FI1B 3FNIA 4PRKA 1O57A 1ZCBA 1PBNA 3WQRA 4EGJA 3C3JA 4ND7A 1Z7YA 4UMDA 1OFUA 3WNCA 5C5DA 3FHTA 1YDHA 3RK0A 3KC2A 4HNTA 4DV2B 4IICA 3DEIA 3WNQA 3EMKA 3PPXA 2Z3WA 2D06A 3W8FA 3NBKA 2I9PA 2XKAA 4B44A 1MJFA 3D6MA 3W4JA 5ER6A 4UPEA 1YR8A 1S9DA 2AJDA 3KJFA 1DQYA 3QJGA 4FZRA 4LDRA 1ZM2A 4MB2A 3SJ7A 3UK6A 3ZU2A 1U94A 1QF7A 4B8WA 2HMYB 2OL4A 1KPIA 2ERCA 3TH5A 2IDKA 3U48A 3TSAA 3ZHBA 4LBWA 1PFVA 2NU7A 3JU3A 4AWXA 1LH0A 4RQUA 1EU1A 4UE3S 1A9ZA 1U2EA 1TVKB 2X40A 1TCBA 1SCAA 1LF0A 1N2SA 2Z58A 5B36A 4HBGA 1U7OA 2YVLA 4M87A 4OK3A 3OMLA 1ZK2A 1RXIA 4MZDA 3QRWA 2GF0A 1V6SA 2IXTA 4J94A 4ZQBA 5F1PA 4AZWA 4C89A 3FY4A 1ZJJA 3R5FA 4BMXA 1J8DA 3U5ZB 3KFVA 3RRXA 1EFHA 4I55B 4P54A 1N8KA 3X1MA 1G5TA 1QIEA 2FHPA 4NCNA 3C6MA 4CM6A 2AVDA 4JLUA 1G8JA 4A9AA 4EHFA 3GH1A 1EB8A 2GR9A 2ZGVA 2JAXA 2I66A 2FZLA 4NBSA 1KVQA 2OD2A 4KIJA 1WXIA 3ZK7A 1MW9X 2AN3A 2NAFA 3PR1A 1P29A 1KE1A 4EOGA 3OEYA 2FPKA 4E08A 1IZ8A 3RHSA 10MHA 2VQSA 3A1VA 4G2TA 2IPNA 2Y93A 1KOLA 5JS1A 4A0FA 2JHGA 3ZY4A 1AUQA 4HDKA 3FX2A 2MSWA 3HHPA 3T9CA 3QU2A 1C1XB 1T5OA 2B8EA 2VQ3A 1PQYA 5BSGA 5K0GA 5F33A 3Q9UA 2B5VA 2QR2A 1BXGA 2CJXA 2L69A 1EMDA 4IDPA 1JQJC 5LB2A 3EPKA 5C18A 1X8XA 1DIOB 2QS9A 5EP3A 5B1IA 5LB4A 2O5EA 3HY6A 3ZE7A 1JFRA 5F5NA 2HSDA 2Y0PA 4YJDA 2LD4A 3AI2A 3OKFA 2Y4NA 4O3FA 4PSKA 4QBKA 2SKDA 3DV0B 3EIHA 1ZD8A 1L4LA 4L0CA 2PBZA 2AFHE 4KNYA 1VLZA 3WL4A 4MHTA 2R2AA 4B33A 2WZQA 4OEHA 3ANYB 1S4QA 3COJA 1AKRA 4MXDA 5JCOA 1PL0A 3EA5A 3FSGD 2RGRA 2R6ZA 4XWYA 5JS8A 1LBHA 3VV2A 3E70C 4RAOA 4KQ6A 1XEXA 3M1IA 5EWJB 1TQ6A 3I1YA 2DWPA 2GRJA 4O2AA 2XEXA 3IAM6 2ZRKA 1FDOA 2OEPA 2GK3A 2GDJA 2Y76A 1QPZA 3FTPA 3FGPA 2V3WA 1BKDR 1ZUIA 2XT6A 3BHNA 3SFVA 3ZI4A 1IN8A 3E3LA 1M6EX 2WM8A 5DK6A 4KQWA 4KHPB 5AM5A 4ACAA 4DLNA 4C0HA 4OK6A 1DRVA 1BX1A 5M2QA 3VTKA 4Z3KA 3QX8A 3AR8A 1R4AA 3YASA 4IGKA 4RJTA 3TLCA 3LKBA 2ZEJA 1XV5A 4IDOA 1IL0A 1T4CB 2ROQA 3GA0A 3N3BC 1FYXA 5TNXA 3V4OA 1DOAA 3M2TA 3VTZA 4A6EA 4B3IA 1WSWA 4EF6A 1KI6A 2B1QA 2PCLA 3C0KA 4JKYA 1LNSA 3OU6A 4LDPA 1H93A 1QTQA 1F3OA 1DX4A 1WHSA 2BN4A 4J0FA 4K6GA 4RHCA 2R1TB 4WLOA 1M8GA 1RACA 2GUWA 2OKGA 2X41A 3DOOA 4Y7DA 5M29A 1TC2A 3D0OA 4Z5XA 1D4AA 1WW8A 2TRSB 3BGVA 5IVIA 4B87A 1T4BA 2TSYB 3V1LA 3OWHA 5EIFA 3PJFA 5K01A 4CT0A 3OKCA 4Z1MD 2A33A 5B7PA 1XJQA 2AXNA 1JG3A 4GLFA 1NUPA 3EEQA 3OHMA 1H2RS 4GQAA 2ECFA 3LI2A 4NARA 4MICA 5EIXA 4NMLA 2WQ6A 2B69A 1E6WA 1M1YB 1EVEA 3FTNA 3O47A 4LX0A 2OCLA 5T5QA 1I36A 2PUWA 1M54A 4K9DA 4RWZA 2A14A 3II6X 3IJEB 1RIFA 4J0GA 3RV3A 1WQ3A 4NIMA 3TSOA 2EP5A 5KQPA 4BAZA 4A8HA 2AS0A 2Y77A 1QIJA 3A27A 4RVSA 3L7MA 4F9EA 4UTPA 1ESCA 4F85A 3DHWC 4F4IA 1ZJYA 4TL6A 1X38A 4YJGB 3WGOA 4IXMA 1ZLXA 2BHSA 2HHHB 1URPA 3AIIA 5IK2A 2G07A 4OSOA 1J42A 4Y2GA 2Y1OA 5AUNB 5AVRA 2CNDA 4IV8A 2BGGA 2FFRA 3SAJA 3HSYA 1JLRA 2UYYA 1I3KA 2AI1A 1FX1A 3ZTTA 3NHRA 5JAPA 1M0WA 4WCFA 1ZUNB 3A1UA 4MPJA 2J4FA 1KFEB 3CUUA 1KO5A 3N39C 2QTVB 4NS1A 3SKYA 1U4NA 3KKOA 3EBLA 3TTTA 5AVUA 1A4RA 3ESDA 4LG1A 3NV7A 4YRNA 2VHJA 4HJRA 1R0ZA 2ZSEA 1GY8A 3L9WA 2RARA 3FPEA 1EE9A 1AIPA 3KFXA 1D2RA 1CZNA 3I2YX 1OC2A 2DPLA 4PX9A 4B8YA 1RYMA 3F78A 4NPCA 3VZSA 4EDHA 3OBIA 5KWIA 4H1UA 4MQMA 4OQMA 4ENRA 4K81B 1DFGA 5CDGA 4MS4A 2YN0A 1W8IA 1UJCA 1VMIA 1UPAA 3PLAE 4KVGA 3QF4A 2HMSA 1MPXA 2I71A 4Q1AA 3G13A 4I99A 3X43A 3I9LA 1XOIA 3OZUA 1AQUA 1IY8A 4V0QA 5DLPA 1I1OA 5IAKA 3ZWOA 4DNQA 4LFBB 3SSAA 2WMOB 2XBMA 1QYRA 4ZN6A 3C45A 2C9MA 2QAIA 1KDZA 5C5IA 1DBIA 1EGVB 1DX9A 1UMBB 2HMTA 1VYUA 5T3UA 2QUJA 1S8FA 1MX1A 1R8YA 3KTOA 3AFGA 4HDNA 3E84A 4RELA 3JD4A 2ZU0C 3RFVA 2OVFA 5DEOA 4YMLA 1Z0FA 4R1OA 3MERA 5FR2A 3V8QA 4PBRA 3X1KA 5LUAA 4ARAA 1WZCA 4PNZA 3KKQA 5A4JA 4MGYR 4XWOA 2WEKA 1JKMA 1K63A 1OWNA 1Z08A 3Q3VA 4HN4B 4ZOBA 4GPAA 1QX3A 1BGWA 1U0EA 2WUVA 3ED1A 2ZIAA 4WNYA 1Z4PX 5KOJB 2HPZA 3LC0A 1L7PA 3GDFA 3LS2A 4B0PA 4MYCA 1KRWA 1RQXA 1C3OB 3EC2A 1NWHA 4NHOA 4KAXA 2A0WA 5EI5A 1E5QA 4JX9A 2IWHA 2P9FA 2G09A 3SE0A 1M34A 4CW7A 1YR3A 4H3KB 4P98A 3TD6A 4LZZA 3F3YA 2QRUA 1A7JA 5IT4A 4FQ5A 3TR0A 1WXXA 1F51E 2FFBA 2P35A 3ENZA 1A72A 2HMUA 1X7XB 4OHBA 3USES 3IAEA 3OIDA 4C08A 2UYCA 2KI5A 4FR2A 4D9JA 2QQGA 3FR7A 1SOVA 2H29A 5BSWA 1PWXA 3PC4A 4ZOLF 2ZI4A 1RD4A 4YRPA 3SBEA 4BO0A 1R5BA 1T6NA 1UBJS 1WABA 3EGDB 1FPQA 1JKJA 3JWPA 9ATCA 3BRSA 1BFKA 3EWNA 3OEHD 1QANA 4S1TA 4F0JA 1USWA 2FHSA 1T5BA 2RK4A 1W52X 3DMGA 3HKCB 3PD7A 3CX7A 3D0RA 4MRRA 3U7JA 4DR2B 3H86A 2RAPA 1SQGA 4W7HA 1UBFA 3EB9A 3ZCUA 2OWEA 2P6NA 4M76B 4F2DA 4K2AA 4TGLA 4M0KA 1K8RA 4UHHA 1G8SA 4MV7A 4L5YA 1KEEA 4ZCPA 3KZ1E 1SXQA 3G2LA 5IFKA 3K70C 3IQEA 1ISJA 5LL6P 2JHFA 4JD5A 3NRJA 2GNPA 4IQ4A 5DNUA 1I24A 4IZHA 3OT5A 2GK6A 3QUQA 4LECA 5EKUA 3WYEA 1EFTA 3LVBA 2CCJA 3FWKA 1EX1A 2NP7A 5M5BA 2LW7A 1ZCAA 1FTWA 4DMCA 4EG1A 1RMYA 1R0RE 3VYTB 1V7ZA 2AXPA 4WWHA 5DOVA 4ESEA 3MMSA 2H7CA 4DLVA 5BP7A 4RTKA 1VE7A 1GVHA 2R00C 4WIAA 2VF5X 3WTBA 1NVBA 1RRGA 2AG0A 4HWRA 5DNDA 1L5OA 2GWHA 2YMQA 3QVOA 4BGVA 5J2TB 1FMJA 4NWIA 2HWKA 3KHSA 2J3DA 1BCSB 4F3RA 1IQRA 4JJ7A 2Z43A 2L82A 2VDLB 5DN9A 4AKTA 1CETA 3DH0A 4XTCS 3L1UA 3A58B 5TPWB 2V3VA 4YMIA 4FFBB 1NN3A 1OI3A 4M98A 3VR4H 4MP6A 3O9VA 4C29A 5HCUA 1RHMA 3Q7TA 3PIIA 2AJBA 1USUA 2VJPA 3LX5A 3FWHA 1Z25A 3PUZA 4QYIA 4IOJA 3K4HA 1NBMD 4P1ZA 5SYAA 2E4YA 2XLCA 4FHZA 3W3AD 2GLTA 3OI7A 2QG6A 2DG2A 4XGIA 2BTOA 1W5FA 5JI3E 5J1TB 2BKUA 3R7BA 4KWCA 2H9AA 3QOXA 1YDEA 2FPPA 4FCVA 4MV4A 5H81A 1XVLA 5BYBA 4ZEMA 4G4GA 4EZEA 3DM9B 4M9ZA 1U0OC 3FSGA 4F06A 5KYVA 5TEWA 1X8JA 1JJFA 4YRZA 2W2MA 2HWWA 3ZDXB 1MB0A 3ECAA 2M32A 1CR4A 1UL1X 3G9UA 1Y63A 3TGWA 4WI1A 3VDRA 4OXYA 3VPGA 4OATA 2ZSHA 5JYCA 4POAA 4P81A 3ABZA 1A9QA 2ZIEA 4NENA 4I8XA 2O0JA 1UBEA 4F2GA 2XODA 3HSSA 3RIXA 4H60A 3H2YA 1R6UA 1FFAA 1OXVA 4YA6A 3IBGA 2H5LA 1HDEA 3FIUA 4BNYA 2Y1KA 1Z6TA 1S96A 4E33A 1XZQA 3WLNA 2GEUA 4LE2A 3LWZA 4V0OA 4PZPA 2XMSA 3WDMA 1YQXA 2DT5A 3OZWA 5IEBA 2QVBA 1YCHA 2ZDGA 2YINC 2PKCA 5ES4B 3BN3A 5CJPA 3AZQA 4ZC1A 1K0FA 2X5JO 4I4LA 2YFHA 1OPXA 3ICWA 5GTDA 4D45A 1WTAA 2JIRA 2DERA 4E13A 2H48A 4Z1MA 4NU0A 3WA6A 3TRDA 3ITNA 2GEDA 4JFAA 2OCDA 4X61A 5JFGA 4JIMA 4GOLD 1SEPA 1I3LA 4WDRA 4TROA 5CYOA 3U3MA 3WYDA 2H1WA 3OKAA 2NAPA 1B8OA 2B3TA 2BHTA 4FHDA 2WUFA 421PA 3DC2A 1YZVA 3TEFA 4PQEA 1E2PA 3NH9A 1Z0AA 4WGGA 4XWWA 4LNUA 3RE1A 3GFBA 4HWOA 3GJSA 3J81k 2Z6VA 1JECA 1EVZA 3N2LA 2HCRA 3S0JA 1BCRB 1GPKA 1Z75A 4HNUA 3UWPA 5D01A 1KEKA 1I7SB 3PZRA 4EFKA 1DP4A 1QF6A 1NXVA 1UOOA 1VMDA 2P91A 2FGJA 4L9AA 4WBXC 2VJNA 4R01A 5GPBA 2C7RA 3N2ZB 3SY8A 1A9PA 4KZPA 2A0YA 3IMFA 1AV6A 5FOVA 2C97A 2J85A 2QQ5A 5KC8A 2AEMA 1NW6A 3WXMA 5DM70 3OZBA 2UZ0A 2PDAA 4LWQA 1YMVA 4V1CB 2RGBA 4JYCA 2Z2JA 3N2YA 1ECJA 2ZI5A 4QDTA 5JDIC 1ZWLA 4H7IA 4YIHA 5JSZB 2R86A 1IFXA 3L7DA 4OGWA 3TLBA 1RRCA 4R1UA 3PWTA 3VC7A 3ZS8A 2VEOA 1RYBA 3DSRA 4WZAB 2J31A 5D5PA 2EZ4A 5E6SA 1NRXA 4OLJA 1BWPA 2R4TA 3E1SA 1STOA 3MWFA 2OUIA 4XFDA 5EIHA 1MTOA 2EGGA 3SYTA 5BSVA 1YUBA 4KR7A 2ZXFA 4MW9A 3WX0A 4PHHA 5IARA 5DCLA 5A1JA 4DV0B 2JZNA 2PQ2A 2EKLA 3HBFA 2PLWA 4F92B 1Z6YA 4G9EA 4TV9A 2XYVA 2JANA 3V2IA 1DTWA 1ISGA 1ZI6A 3QLTA 3JALA 2O8FA 1O8CA 5CEJA 2D54A 3PUJA 4QUDA 5LQJA 4F3TA 1ZN2A 3AONB 2PHZA 4FNAA 1VCOA 3BF7A 2DETA 5IM5A 3C8MA 4PAGA 2FNAA 1XNHA 2J4CA 2W37A 3CU5A 4DIUA 2DHCA 5JROA 3Q8MA 3MHTA 5CDTA 1TJNA 3AV0B 3RBZA 4KLAA 2FPWA 4YP7A 4CNQA 2PT5A 3LZDA 3UJNA 2GHRA 3F90A 1MENA 5CX4A 1JMVA 2CYAA 2WYIA 3G7NA 1L1EA 2OK8A 4N8DA 5ICEA 4RORA 3W1EA 3WKDA 4ALLA 3B13B 2VUHB 2OG2A 4JENA 1F4PA 1GTZA 1PFGA 2NU7B 1GGEA 3Q2OA 2V1UA 2ZZMA 3B82A 3UC9A 1QRSA 1FJGB 4IS2A 5C8XA 1YOVB 2V4MA 1JSZA 4H7FA 5J2UF 4MWBA 2B92A 1ZVQA 3IURA 3OPYA 3VA7A 3ADKA 1ZHOA 3CR3C 3RARA 2YWXA 5EJ4A 4GLLA 2HNKA 4PZYA 3MD0A 1K3TA 4JVSB 4C3UA 5IKPA 1JYSA 4AROA 1QO0D 3WKEA 2RHHA 1T2CA 2ETVA 5AI4A 4EY4A 2W93A 2Z98A 1NIPA 5JD4A 1E61A 4DSNA 3A05A 3HB1A 2NQ2C 5EG5A 3LUHA 2P79A 5KI6A 2QMOA 1T5SA 2NXNA 4CTOA 3EWSA 5SZJA 2Z5GA 3IKLA 1X0XA 3R3JA 3U61B 2HHAA 2GSWA 4U63A 1NC1A 4JC4A 2QTBA 4UVGA 3SHFA 4E5SA 1XZPA 1SC3A 3OEHA 3VISA 4FHEA 1A04A 1LI5A 1KSFX 1HLDA 1P5JA 1TW2A 2AKAB 2CXOA 2PKQP 4UEJA 2ZPUA 1Q3HA 3DKIA 3FKJA 1Y1TA 4HDKB 4NG5A 3ZY5A 5CFLA 4S05A 3KYDB 1H0KA 1IN7A 1QYDA 3M83A 1Z6QA 2B1IA 4IIUA 5EE5B 2W7TA 2LCQA 1AMOA 2AEJA 4R2IA 3ETHA 1IHOA 4L95C 5F2EA 5FX2A 5GV7A 5EXPA 2PGDA 3DW1X 3T9EA 1JB1A 1W5EA 1YZKA 4MULA 4OHXA 2C00A 1QGUA 4PLPA 1ZFNA 1K1EA 1DKUA 4MTCA 1L4HA 4RIGA 3VUFA 3T1HB 2GMWA 1CB7A 1GILA 1BDIA 2XGJA 2YDYA 3L49A 4FDVA 4RF2A 1E3MA 4PTYA 3IQDB 4DVGA 1TQ8A 2QIOA 3EIFA 1EP2B 2OHOA 3ICCA 1SBTA 3TLXA 2FOIA 4KL8S 4AK9A 2I4OA 4B3HA 2NXWA 1OLXA 3CONA 1SA0A 2OESA 2RK3A 3PUIA 1OBVA 5LOVA 1U1FA 1AO3A 1XTQA 3IFSA 2W6ID 1ZMRA 3Q12A 4OKSA 4INPA 4G01B 1E2HA 1YDFA 2QL9A 4MQBA 4EPWA 2JLRA 2B78A 2C3PA 3H1EA 1SUCA 5TE9A 2CDCA 1M6VA 2KBEA 1RLOA 3Q8XB 4GFDA 4DV7B 3RS7A 1H2ZA 2AJCA 3WP0A 5JNRA 1XI2A 5IF9A 1REQA 2LE0A 3L05A 3P9NA 5T4FA 1E7RA 2VYND 2ZKLA 1Z4IA 1X7YB 1PR0A 2BZ1A 4DMUB 3OOWA 3KOUA 4G67A 3TTVA 1NBMA 1T8WA 4B76A 3TNJA 2VTBB 2W2KA 3W3AA 3TKAA 4MV0A 2XUQA 3OA2A 4DCPA 4AQDA 1B7GO 3OQ6A 1ZJWA 2YRXA 2ZTLA 4XARA 1JHPA 1QB8A 2HREA 4DDHA 3ZCVA 5LWHA 2Q3CA 3X0DA 4F4UA 4LCEA 2WU8A 1N36B 4YCAA 1SVKA 1UMDA 1QCDA 2DWOA 1XRQA 1XZIA 3T3PB 3MPUA 1BG6A 4YAFA 1HZJA 2D62A 2QAGC 1YZYA 1YFJA 1MVNA 2IYOA 4LRWA 2Q5JA 5AVXA 4BZQA 3X1ZA 3IKVA 3BMQA 3FNFA 2J5KA 4U9HS 1CIVA 1XPOA 1CJBA 3LGAA 1JDVA 3PC8C 2VI5A 2I1WA 3VKUA 1RWVA 4PXSA 3K30A 1NF3A 4ZI7B 4R3UC 2BP7A 1JDJA 3J80A 2HY7A 3UW1A 2ZYGA 1V1RB 3CUSA 1QZUA 2BMEA 1XTTA 4ITRC 5IJ0B 3PDIA 6REQB 3PCRB 1YZUA 1L5LA 2I29A 1SOAA 1II0A 1K7SN 1K9VF 1QH9A 2CVQA 1ONBA 2REBA 2V6MA 2GGSA 2VPZA 4D9BA 1S9HA 2OHFA 4CFSA 2PWYA 4K6KA 3K1YA 4OHPA 4DNXA 1RLMA 2BEUA 3A1DA 1SXPA 3DDUA 1YHYA 4M54A 1RI1A 3LDFA 4R83A 2NV6A 3LQ1A 4K9KA 4TTTS 4W5WA 5CPBA 3AINA 3RRJA