1YIDA

Crystal structure of tryptophanyl trna synthetase ii from deinococcus radiodurans in complex with atp.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
331
structure length
331
Chain Sequence
ARPRVLTGDRPTGALHLGHLAGSLQNRVRLQDEAELFVLLADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGERVPAGFFVYPVSQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALYAPVLAEPQAQLSRVPRLPGLDGQAKMSKSLGNAIALGDSADEVARKVMGMYTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRLFGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords tryptophanyl-tRNA synthetase
publication title Structures of tryptophanyl-tRNA synthetase II from Deinococcus radiodurans bound to ATP and tryptophan. Insight into subunit cooperativity and domain motions linked to catalysis
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 106
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1yidA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1yidA01
4MWDA 1O97C 2QTRA 5DK4A 1JECA 5HUHA 4QREA 1G8HA 5IJXA 2IELA 4MWEA 1IVSA 5EKDA 2A4MA 1M8KA 5H7XA 4AS1A 5HG0A 1KR2A 3TZLA 4CQNA 4MUKA 3IUEA 1O96A 3P0JA 1JMVA 1KQNA 3MXTA 4MLPA 3IOEA 1U7DA 4OJMX 1OBCA 4PY2A 1GPMA 4I6EA 3A2KA 1N2HA 4WSOA 3RHSA 3SDBA 2CV1A 2O5RA 4EFKA 2B7LA 1MRZA 3MMXA 4CT0A 2HZ7A 5FO1A 1A8HA 3FOCA 4YMIA 5KWVA 3CLUC 4CDNA 2A1TS 1NURA 4ZT7A 3RJZA 1N1DA 3OP1A 1R6TA 1N78A 1H3NA 1M8FA 1Q15A 1K4KA 2E21A 4HPWA 1N2BA 4DLPA 2WQ7A 3ZXSA 1XJQA 2PXHA 3ILVA 1WY5A 4F3RA 3PNBA 2WB2A 4PBSA 4DDMA 3COVA 4MVWA 4ND6A 5J58A 4E1AA 4MVXA 4MWCA 2VTBA 1M8JA 1J21A 1N2IA 1NUTA 4ZT4A 3H9BA 4MUEA 5DB4A 4I6JA 2WQ6A 1GTSA 2A1TR 4ZCPA 3ZJVA 1YULA 4DDKA 1EXDA 1QU3A 2J5BA 1F7UA 1QQTA 3PNVA 1JIJA 2D5BA 2PZBA 3HFJA 4DE5A 4EG4A 1EFVA 1O96B 3CR8A 2QUJA 1N3LA 2CFOA 3KT0A 2V0CA 3Q12A 1NUSA 2X3FA 1I6LA 4PBTA 2Z09A 1OWNA 1QNFA 2X1MA 2A88A 1N2GA 4JXXA 3UMVA 3RBAA 1Q77A 3IVCA 1J20A 1WJGA 3AG5A 3FG9A 3IMCA 3JXEA 4MVCA 3ZUGA 4DJAA 2AKEA 1OWOA 1WKBA 3ND7A 3FDXA 5TS2A 1ZH6A 3P52A 1WXHA 5TEVA 3H05A 1N2JA 1QJCA 3COWA 5BNZA 3VGJA 3MUEA 3UOWA 2CUZA 1T9GS 3ZGZA 3ND6A 1O94C 3GLVA 2R5WA 1IQRA 1TQ8A 2V0GA 2VTBB 1MJHA 1ZJWA 2DXIA 4JYZA 2IP1A 1WZ2A 1MC1A 3AL0C 1I2DA 3VRHA 5IHXA 1EFPA 1YIDA 3COYA 1U3DA 3TQIA 2CYAA 3CLRC 4KPUA 1OD6A 1U3CA 3A04A 3TNJA 4ARCA 1QTQA 1IRXA 3KT8A 1EFVB 1Q19A 1G8GA 3NV7A 2DLCX 2YWCA 4EG7A 1T9GR 2EL7A 2JAXA 4ZT3A 1KP2A 1VLHA 3CVVA 3GUZA 1PG2A 1NP7A 3AKZA 4AQ7A 1N2OA 1QU2A 1WXGA 3FH0A 4MW1A 1LI5A 1TYDE 1YIAA 1N75A 1U0BB 1LW7A 5LLTA 1VBNA 1R6UA 1FYDA 4QRDA 3IVXA 1QRTA 1MB9A 4HK4A 1PFUA 3P0HA 3INNA 4MUFA 1JEEA 1PG0A 4H3SA 3AFHA 2QUKA 3A05A 3N9IA 3NBAA 3PRHA 3N05A 1KH2A 1M8PA 4MWBA 2DETA 2AG6A 3FI0A 3FNRA 1B6TA 4EG1A 2JANA 2DERA 4MW6A 2E89A 3TZEA 1T6XA 1EUYA 1D2RA 1EFPB 1F4LA 2H2AA 3X1MA 2PG3A 4L2IA 1ZH0A 1NZJA 3CLSC 1R6XA 4KPUB 4JZYA 1ILEA 3RFFA 3QTBA 5FO0A 5FNZA 4EF6A 2IJGX 2XRZA 3N8HA 4CDMA 1KH3A 2J09A 4FZJA 2TS1A 3RK1A 1S4MA 4A91A 3VU8A 4HJXA 1I6KA 3ZXIA 1OWPA 1KQPA 3ISJA 4J75A 2HGZA 4NX2A 4PBRA 3S3TA 4ZT6A 4MULA 1GN8A 1OBHA 1PFWA 4EG3A 3K32A 2A86A 2ZUEA 2WSIA 2CYCA 3CVUA 3TS1A 4G5YA 1Y42X 4OUDA 3SZ3A 3BL5A 2RE8A 1F9AA 1KP3A 4EG5A 1NYLA 4KR9A 3IODA 1IFXA 4Q93A 1J70A 1GZUA 4MUNA 4MW4A 4NZPA 1YUNA 5DASA 5AHWA 3CLTC 2OQ2A 3H97A 4R2MA 4XFJA 2QTNA 4MUHA 2BTEA 4DDHA 3H9CA 1VBKA 3IOBA 3G6KA 4EG8A 3ELBA 2XRYA 4ND7A 2PIDA 2A7XA 1O6BA 1KKUA 1H3EA 4L2IB 3NBKA 1KQOA 1FFYA 2G36A 3CVXA 2CSXA 5TGTA 4KKVA 3DLAA 4K0RA 2OV4A 3FY4A 5LFAA 4R2LA 1J09A 3M5WA 1TEZA 1YUMA 5JBNA 3SEZA 1XNHA 1WQ3A 3X1KA 1KAMA 1K4MA 3N2YA 1ZUNA 2DUMA 4NAUA 1F7VA 1GTRA 1QRSA 2E0IA 1O94D 3FHJA 4TS1A 5J59A 3G59A 1WXFA 3DV2A 3U1VA 3H99A 1EJ2A 4U63A 3ZJUA 3SEQA 2I1LA 2DEUA 3SZGA 4OUDB 1VL2A 4BWVA 1XNJA 3HZRA 4MQ6A 3K9WA 4ZCSA 1O95C 4DNXA 1G8FA 2EJCA 3IH5A 1WOYA 1J1UA 1CT9A 3CLRD 2QJTA 1EUQA 3Q10A 3I05A 1PFVA 3KT6A 1O5TA 1U7XA 5H16A 1HYBA 1KORA 3Q4GA 2DR2A 1TFUA 1T6ZA 4HJRA 2Z3VA 1GAXA 5K0SA 2CT8A 4ZCRA 2PZAA 4ARIA 1KH1A 4ZCTA 1O97D 4S1OA 4XFDA 2PZ8A 3LOQA 1WQ4A 3PXUA 2O8VA 3L92A 4MUGA 4ZT5A 3TQOA 1IQUA 3HMQA 1JILA 2BYTA 1O0CA 2J08A 4NATA 3IUBA 2QTMA 3G5AA 3MLAA 4MAFA 4YP7A 3L93A 1NSYA 3P0IA 4QBTA 5DEOA 3UK2A 1JIIA 1COZA 3F3MA 5F23A 1P7PA 3UC5A 1J1ZA 1WXEA 4F4HA 1KAQA 4X0EA 1X8XA 1SURA 1WXIA 3CA8A 1JHDA 3ND5A 1DNPA 2CV0A 3HV0A 3ZIUA 3FWKA 1H1TA 2YY5A 3CLUD 1NUPA 4YP6A 1T6YA 2QJFA 1O0BA 2PFSA 2GKSA 4MVYA 1MAWA 3CLSD 2QJOA 4YP5A 1JZQA 4U8HA 3HL4A 2A1UA 1JEDA 1MOPA 4GRIA 3LE8A 2AZXA 1JZSA 3QTTA 4UZEA 4MUIA 2GM3A 1JIKA 2A84A 1K92A 3SYTA 3HGMA 4ZT2A 3A4IA 4MW2A 3MLBA 3AIIA 2DPLA 1OWLA 2H29A 4MUJA 1JGTA 4G6ZA 1M83A 2YWBA 1LI7A 1Q11A 2ZP1A 5KCMA 2NSYA 3LCJA 2D54A 1TYCA 4WNYA 1G59A 4YBRA 1N77A 3ZJTA 4NAHA 1PFYA 3IOCA 3SP1A 3D6UA 1K97A 2CV2A 2RD2A 1QRUA 1IQ0A 2VXOA 2X0KA 1V8FA 4KR6A 3CLTD 4U7JA 3D6VA 1N2EA 2HMAA 2JA2A 1ULHA 3KT3A 1XNGA 4MW0A 3IDFA 1VBMA 4UZFA 2X1LA 3RK0A 3IMEA 4RUKA 4EG6A 1M1ZA 1UFVA 2ZUFA 5KHAA 1I6MA 1X6VA 3IMGA 4NDAA 3AG6A 2A1UB 3UY4A 4I6GA 1NUQA 5K0TA 4P2BA 3CVYA 4JFAA 1OWMA 2E18A 1TYAE 4Q16A 3E27A 1V47A 3C8ZA 2QUIA 1MB2A 2QUHA 2J07A 4J76A 3KFLA 5HUJA 4ZCQA 1TYBE 3QE4A 4RPIA 1H3FA 4R0NA 3CVWA 3DO8A 1RQGA 3FETA 2CYBA 5J5AA 3DPIA 2C5SA 1O95D 2YXNA 4KR7A 3X1JA 2D13A 2J4DA 5LM3A 1MBZA 3GMIA 3PNYA 1NUUA 3FIUA 4MW7A 5TEWA 1GLNA 1MAUA 4EGAA 2GOYA 4JXZA 1IHOA 4MW9A 1M8GA 4XSVA 3COZA 4MW5A 1NI5A 3OTWA 2NZ2A 4K03A 1IH8A 4GU5A 3IVGA 4G5FA 1EE1A 2Z08A 1YI8A 1BS2A
chains in the Genus database with same CATH superfamily
4XCQA 5D51S 2GN4A 4N5DA 1OFVA 2Q3LA 2VCEA 1HDGO 5SZKB 4DLSA 1SUFA 4P7FA 4F9FA 3WNQA 2IUTA 2Q5QA 2ZXUA 5LA6F 1TI7A 3OT1B 4HAOA 3ADOA 1VCNA 5AKIA 2WWYA 3K4QA 3ROMA 4TZTA 2QMQA 4ESVA 1HFWA 2A14A 5B7NA 3BT7A 3NPAA 4HLDA 4KYVA 4L0CA 1N6RA 3LRXA 2IYOA 3NWOA 5JTTA 4CQNA 1IUKA 1P9WA 1KSFX 5AK0A 1JMVA 4Q3EA 1CUJA 2F48A 4RTKA 2C4HA 1XG5A 5CB6A 1U7DA 3C6ZA 2I9PA 3PNMA 2BMWA 1ZGHA 3L6EA 1Q0QA 5KNCA 4OFZA 4FHFA 1HE2A 2BBWA 1QG6A 3HGQA 3PWZA 4EHNA 1IZ8A 4CCYB 2HRCA 5B55A 4U5XA 1UMDB 5A62A 4TV8A 3EZGA 3FOCA 4FYYA 1VLJA 1L4BA 3ICCA 4YMIA 3VSAA 5DGDA 1ZRNA 1ISSA 3GDWA 3VV3A 1ZIDA 5TPWA 3PEWA 1M2FA 2XUIA 2CCGA 2IYNA 3ESZA 1YRBA 1DKPA 3G0CA 3C16C 3E5RA 4ANFA 4NARA 3CZRA 5IJ0A 1FQOA 3AUTA 1Q83A 4JOQA 1JU9A 3ZKWA 2WQ7A 4JJ4A 4MI3A 1M33A 1AXRA 2AYXA 3LYUA 2QIOA 3QWAA 2A59A 2GCOA 2C2ZA 3WFIA 3ZHBA 5AOCA 1A04A 4V0OA 3S8MA 4AF8A 1ZQ1A 2PZJA 4BMYA 5JNRA 3W2HA 1B74A 1F06A 1C29B 2AD1A 4WBNA 1PJTA 1UMCB 1NUAA 2B2CA 1J21A 3CNOA 3IL2A 1E3JA 2ZVDA 5I45A 2GK7A 3C4QA 2PYDA 4KGDA 1D6NA 2F1IA 4QPNA 2C7QA 4H4EA 1FFCA 1A72A 2PD3A 4I6JA 3FD8A 1IBKB 2C4UA 4BPRA 4NKRA 1QQTA 2OXEA 4EUKA 2VUIB 2UXCB 3FF1A 3W7BA 1BE0A 5DN9A 5EWJB 2WV9A 5C5DA 5LKAA 3KUUA 2FW7A 4M7PA 3CR8A 2XA1A 4L72A 4UHHA 4UM9D 1E2DA 1EFTA 1E9BA 2DBRA 1U9CA 4GPAA 3SG0A 3ENZA 4N5LA 1AGYA 1JE1A 2ZJ2A 4LXXA 2JFQA 4DYVA 3WWCA 1OFUX 3MBIA 4GR5A 3RFVA 3E1KA 4C6TA 5H5JA 3UHFA 3O4FA 2X9GA 3NHLA 3UMFA 4F0JA 4DCVA 4ROTA 1K9SA 1OYYA 5F1KA 5KYTA 2OOKA 5HM8A 3ZJYA 1TCAA 3QX7A 1OZHA 2RBEA 4NOKA 3TO5A 3ECCA 1HG0A 3HJFA 4PR0A 3JXEA 1RIIA 1AQIA 1JR3A 3FLMA 3VU3A 1N34B 4LOIA 2FWJA 2R6ZA 1I36A 1KMHA 3EH1A 4J9UE 1FSPA 4E22A 1KOGA 5F51A 5HKOA 2Q50A 4ED9A 2PKQO 2XEDA 2UKDA 5LBUA 1ZQ9A 3SC6A 4RHEA 3GRVA 3TI7A 2G70A 4ALKA 4BO0A 4MB2A 4UQPA 1ZN2A 1BHJA 1ZOPA 4GGMX 3WFZA 4ZHQA 1AURA 4OCZA 2PX6A 1M2VA 1X0XA 4BVJA 2ST1A 1J2YA 5MDHA 1L7OA 2WNHA 4NR0A 4Q02A 2IXDA 1E8MA 3SR3A 2FOXA 1Z6GA 3O5AA 3SPXA 1AZTA 3EUFA 3CRNA 2F9LA 1D04A 2HMUA 2VQDA 2PV7A 3QPVA 3VR4H 4LMBA 5EZQA 3RS9A 4LYAA 4CKBB 1PJ2A 2HDOA 2YOGA 3ZHTA 2IZ6A 4RKEA 5IAJA 2WSSD 4MS3A 2Y1GA 3KJEA 2H6EA 4N49A 4ZQHA 2FFQA 5DNCA 5LNK6 1BSVA 4YMHA 2OBFA 4C29A 1KQFA 3NYQA 5LP1A 5B1YA 5IHXA 1P45A 1U8UA 3TIGA 5AVRA 1K3UB 2YMLA 4FJ2A 3EA0A 3RQSA 3AVQA 4FFNA 3B13B 3DAOA 3H16A 4YO7A 4K81B 1E2EA 2QJWA 4RKYA 3DHNA 3M3PA 4D99A 3DHYA 1QCCA 3OTQA 2VT7A 3E5NA 4QTXA 3T7DA 5CB0A 4MV6A 1J07A 5JD6A 3KZVA 1MMFB 4DCUA 3RUEA 1AV6A 1H9CA 1JT2A 1MW8X 2DPHA 5AR1A 3CVVA 4FM9A 2GAAA 1FQWA 1RI5A 4H3HB 4FHGA 3F9CA 4M8KA 4OQZA 3RUCA 2OILA 1XYGA 3VI4B 3OZWA 4MYUA 2HBQA 4AKTA 1YFLA 5CDYA 1QPBA 2IYTA 5BW6B 4I2NA 1LI5A 3U26A 3KD2A 4UTPA 4PSAA 4CXMA 3KO8A 3GEBA 1IM5A 4D42A 1EFRD 1CC1S 3VR2D 3OFND 3CJTA 3DE3X 3I12A 2D5IA 3INNA 2GXSA 3WLNA 3V7NA 1ATIA 3U1TA 3RU2A 5KS2A 4UBKA 3NXKA 2XCUA 1UJ4A 1QCZA 2Z1DA 1MEJA 1SUWA 1HFEL 4WK6A 3RAEC 4BHTA 2QZZA 3VOTA 1INLA 1QVZA 4AQDA 1KU6A 1ZUHA 5L3SB 1T8WA 2RIRA 4V1CI 4PZPA 3H3JA 4I4TF 3FFTA 1CY0A 1LPAB 2DX7A 4TMYA 4YFVA 1Z5PA 4CUZA 1XEWX 4B6EA 3SQLA 1TKAA 1YE3A 1BXGB 3I42A 2EFYA 1K68A 2I29A 3A70A 4XTRA 3FKJA 1PLJA 2JVJA 4G1EB 5DIFA 4EA8A 1Y3HA 1VSTA 1VKRA 2GERA 2PG3A 4L2IA 3X1MA 2IS2A 5DGCA 2GXQA 2QU8A 2Y1XA 4KPUB 2PEYA 4PO3X 2HNBA 2VWPA 3P2MA 3LY7A 4EHIA 5FBHA 4EPWA 5FA5A 1OTYA 5EN4A 4EKYA 1S3GA 2I2CA 2QLJA 1RVV1 1EFLA 3E84A 2J09A 2O4UX 2TS1A 3H0CA 2HSWA 3DV0A 3I2GA 3JVEA 2I2AA 4MP3A 2DWUA 3HXMA 3LP8A 1YDWA 2VQEB 3IUNA 3I8SA 2NM0A 1GCUA 3TPCA 2XKAA 4DXHA 2F3SA 2OQRA 1NQWA 2VRBA 4I9FA 1NV9A 2RB5A 3TUIC 4H7PA 4YWHA 4A0HA 2VJYA 1U7UA 1U2TA 1A69A 3HKEA 1L5VA 1RI3A 1FVHA 1SWVA 2ICAA 2OO7A 2XTMA 1EEHA 3BMQA 3DQPA 3F8WA 1LXCA 3QW4B 4M22A 4L5IA 3SF8B 3R0QA 3N70A 4OYYA 4ZAZA 3SHWA 5EL0A 1I2BA 1K8XB 1RLIA 1F9AA 1I13A 3I2FA 3OZBA 1H42A 2EJVA 4GO1A 2Q3EA 2FI1A 2BD0A 4F97A 5IT0A 2HV8A 3OCWA 3RJTA 1EUDA 1IZ9A 1M1YA 2Q27A 1X1EA 3ABOB 3BSFA 4MV3A 5G0VA 4AY5A 5T4HA 5BPFA 4D3ZA 4RD4A 3THYB 4O3FA 1H23A 1UODA 1ZLYA 2JJYA 4HB0A 4LZZA 4NCJA 4C76A 4JIGA 1RADA 2JLRA 2R8YA 4QQKA 3O9VA 1C4XA 2OYRA 3L8HA 3GNLA 1VBKA 1YNOA 3M1YA 4WY8A 1SB8A 3A6GA 3ZTWA 2Q0QA 2XRYA 4OJKA 3VHLB 1FX1A 5TS3A 5JQWA 2JLAA 4K9NA 3IQZA 2B35A 1W96A 3BWEA 1MX9A 4U2EA 4H6WA 2QF7A 1O89A 4XD2A 2A33A 2R8EA 2ODWA 1FDOA 4YTEA 5F7JA 3TZBA 1GYQA 1KO7A 3IBGA 3V34A 4DPKA 4Q18A 4PPFA 4K0RA 4G07A 4OQQA 2IV3A 4GVLA 4DCOA 1CUIA 2FFBA 1NVVR 3IX7A 3OQMA 1R8SA 3HYTA 4IRUB 4UNRA 2QRKA 3CEPB 2LGJA 4KXUA 1WX1A 1P77A 1DOAA 3GCWA 2XPCA 1JHQA 2E0IA 2W2LD 4RMHA 5BN3B 2FPIB 2R1UA 3KYJB 3ZIDA 5HDBB 2Q2NA 5LC1A 1WXFA 3DE4X 1LVUA 3MTGA 4RHUA 4UXHA 4N5HX 2P11A 3MTEA 2ISCA 2BZ1A 3O2SB 3QOFA 4IQFA 4NE9A 4U63A 3SEQA 1TIKA 4XYLA 5BQ3A 1T9KA 2XHEA 3DXXA 4U6NA 2FQQA 4JC4A 3WNBA 2ZVPX 4OXIA 4ZCSA 1MX1A 2O57A 1ICIA 1L7EA 3T9DA 3UHPA 4KWIA 3KVYA 2OMKA 3MUNA 1DKNA 2IE8A 2HQOA 1YRQA 1T4CB 2NOAA 3FLBA 3W6UA 4G5GA 1QX3A 3S2IA 4CEJB 2P2SA 1EUQA 2N9UA 1KYTA 3A0RB 3D3WA 5EZSA 2HLPA 1P31A 2WP0A 4RF4A 1UBGA 4LNHA 5K3EA 4G5XA 3D4OA 2IHUA 3VGPA 4D0LB 1A7AA 4JI8B 4KDFA 3AUXA 1GAXA 1TU3A 4FFPA 3JYOA 4WFIA 5K0SA 2EKBA 3ZE1B 5CVCA 4BNMA 3NC4A 1YR1A 2CT8A 2EP5A 1F6DA 2WU0A 1YZKA 1AN9A 3TBKA 4CMBA 4EP1A 5JYCA 3UK6A 4EB8A 1Y5MA 4N39A 5JH7B 1IN7A 1QHYA 1T5TA 3A9SA 3LWZA 5TJHA 4DA7A 3QRWA 4Q1BA 4UBJA 3AR2A 1FBNA 1V5EA 5JCOA 5B6JA 6NULA 3AP2A 4HB4A 1T5IA 4O4LB 3NZEA 3MJTA 2QRNA 3QM1A 4WNAB 3D3KA 5KMGB 3M1IA 4DQUA 4G9EA 3H1AA 1GITA 3A1VA 3N39C 2B3DA 1QTIA 4CTOA 1A77A 2IU4A 2PL9A 3DMFA 4PLCA 1FP4B 2IYPA 3ROZA 3QFTA 1WVIA 4J7CA 4RZQA 3SS8A 3O1LA 4BVBA 4ZKDA 2Q62A 5I9LA 2A4KA 4GIBA 2AUMA 3KS9A 1TQ2A 1EM8A 3IC5A 4YRLA 2CNNA 4FGSA 3RW9A 3UXYA 1WHTA 3C3BA 4WXPA 3WBBA 3PXDA 1Y6QA 4GICA 5ALMA 1CYEA 2YOHA 2KYRA 4EKIA 4YRRA 4K2HA 2EJBA 4QAJA 4O4JB 2ECOA 3CH5A 3BWVA 4DLNA 3MM4A 1MOSA 3SBDA 3M6AA 1JSCA 1PJLA 3NHUA 1GNQA 2Z8XA 2JGDA 2B5WA 3IA2A 4NQRA 1LNQA 4PO1A 3ESYA 1MV8A 3UJNA 3K1YA 1L5YA 5AUOB 1CR6A 1PR5A 1VRVA 5DYTA 1Y5NA 4Y3UA 2AZXA 1N7HA 2FG6C 5AI6A 5KQSA 4IF4A 3S1AA 2XT9A 3ZV6A 4E07A 1CNEA 4G5RA 3EXHA 5EJMA 1JIUA 1ZOOA 5SYNA 1ILWA 2Q0XA 1FLNA 2OOSA 5KNDD 4NOMA 4OI1A 4D41A 1D2AA 2ZJZA 3HWSA 2FFRA 3A4TA 4KH1A 2BH2A 1SEPA 2MHCA 1R0KA 2EFHB 1JA1A 4QVKA 4MUJA 4R41A 2AN4A 3QXHA 2QN8A 4IJWA 4YK7A 5KJ1A 5DCUA 4M8NE 1MQAA 1NNLA 3A4LA 4L6IA 2FTKE 3P96A 3FYUC 4A15A 1I5EA 2H63A 1MPTA 4LNUA 5JS2A 1ULTA 3Q8KA 5D8DA 5FOXA 5JFGA 3PLAE 4EI8A 5IYZB 2IYQA 4TQUS 4I99A 3F5MA 3K8OE 5KX5B 3TF5A 2UU9B 1VJRA 1QXSA 4YCLA 1VE7A 3OCUA 4F04A 3PWKA 4IUBS 3H1GA 3GLQA 2BEWB 2NTVA 1XAHA 3ZE6A 3BS4A 2X4DA 5DMHA 3USES 4JUBA 2J6HA 2L42A 2ZI3A 5FI5A 1DX6A 1NOKA 2L0XA 3EVAA 5JANA 3AONB 4IS3A 1G7SA 5AK6A 3RANA 2YIJA 2QX7A 3ZNOA 3WWYA 1QVAA 4HEHA 2IEYA 2XYGA 1ULHA 2F3RA 4IW3B 4K1XA 4PSKA 2DQKA 2YDXA 3GCGA 3QELA 5LU8A 3BE6A 4FYKA 5JSFA 3ETJA 3OIFA 3W7VA 3EIWA 1E3TA 3W5SA 5ALNA 3F9RA 4EMTA 1Z5NA 2PZEA 4LV6A 4QNMA 3E9DA 3REFA 1P1FA 3MAAC 4FUTA 4KXNA 3I5MA 5I7UA 1XZCA 2PT5A 3NXSA 4X6LA 4XRRA 3O2QB 4KO2S 1NRIA 3HCDA 3WJ7A 1Q3KA 1UEXC 2NSJA 4DV3B 3PITA 1G3UA 3IMGA 8OHMA 5K7SA 3ZOKA 2QMOA 1GUYA 5FWXA 3SQDA 4TKVA 1ZAKA 1EQ2A 3AVUA 4V3CA 4JP3A 4PLTA 3K94A 2IBTA 4OQFA 2R1TA 1ZM4A 1XKXA 4Y9SA 2VQFB 3E27A 4Q03A 2WMYA 4QT4A 4MDEA 3AI7A 2IZ7A 2PMBA 3R24A 3CKLA 2QUIA 4EHAA 4WY5A 3K6KA 1VPLA 1WUHS 3GYBA 3JASA 4E08A 4RULA 4WZAA 3RSSA 1LS1A 1PSDA 1GGHA 1XTKA 2X42A 4CM8A 3KQQA 2HR1A 1GQ2A 4EM6A 1NXWA 2CNWD 4BVGA 2R7KA 1U8EA 5EKUA 1H2HA 2BIFA 2R8XA 2WKSA 1TM1E 3G0HA 3PFKA 4FBGA 1X8KA 3EDCA 3BBLA 3KUDA 3NT4A 3VHQA 3WGJA 2KX7A 5TQ2A 2DJIA 2Z0MA 4B3GA 3N0RA 4OHPA 3GOHA 4OXQA 3GCZA 4ETMA 2Z9CA 5F3RA 4MW7A 4XCXA 4JCCA 1WPGA 2XNKA 4UD2A 1QF7A 2X2FA 1EHCA 5H9WA 3WKEA 3LDHA 5EJEA 2B5VA 2GJ4A 1UBOS 3KKLA 4R2JA 4RGVA 5TR9A 5HNKA 1PR6A 2F9MA 4P4UA 4CIYA 4TL7A 1ZGAA 1ZGGA 4KRYA 4Q9LA 2B1IA 3UIEA 4RHCA 1JJVA 3I6IA 3Q9LA 1I0LA 2F1OA 2I3AA 2YXDA 3IVGA 4RZIA 3T3MB 2Z08A 3ET5A 4L5AA 2IOQA 3CNBA 3V4RA 2XJ9A 2C83A 3EQZA 3K96A 1LU9A 3NYWA 4D9IA 4EY7A 5I7VA 5K8IA 3I58A 5CAEB 1Z63A 3B6MA 3NJ8A 4L5YA 5HE9A 1DE0A 2ABWA 2OXFA 3DUFA 1U1IA 1LJ8A 3VZDA 4NFYA 2PE5A 3I5AA 3TTUA 3CRRA 1YH3A 4TXJA 3PE4A 1XHEA 1BGVA 2FW8A 3FRHA 1WXWA 1FTNA 1U8FO 3L8MA 4OD0A 4YUYA 4AS1A 1TPZA 1H0SA 4ZIRB 3VPCA 1ACJA 1MRSA 3TZLA 2D0IA 4A9AA 4CMAA 1W4ZA 5KYKA 1VLMA 4ILKA 3S2YA 4Q3AA 3K72B 1GT6A 1C8BA 1O6ZA 1MC5A 3OA2A 4XYEA 3TJMA 2H18A 3QE9Y 2GMWA 3DVLA 1OBCA 2OCPA 2PH5A 4DPLA 3DDSA 5JXWA 1N6IA 1WLYA 4GPZA 2DU8A 4QPDA 1L5RA 4TYPA 5DW3A 3GLHE 4X92A 1ZR4A 5JXGA 1E7SA 1X9HA 1E2HA 2FW9A 5T3YA 3EODA 3QENA 3PGVA 4XASA 5E38A 1Z5UA 1E4OA 3RVBA 1HYHA 4MQEB 4EFLA 4D6XA 1NP6A 2AEFA 4GPEA 1DRJA 2WD7B 2ZR9A 1J56A 3IS3A 4JNCA 1BU5A 1HOTA 2FZCA 4AN1A 3EBPA 5B3JC 1NQVA 5B7PA 1OFUA 1UBEA 4UPEA 1AY0A 1KI2A 4K9PA 4ZQEA 3HN6A 4EJ2A 5A4KA 1R0YA 2DFVA 2GJSA 4LCEA 4S1NA 3CH7A 1IONA 4UC0A 3U4AA 1FRFS 3QIVA 1G8SA 2YYYA 4Q24A 4COKA 4GKJB 1PJ8A 3PRJA 4I1UA 4B4VA 3BFJA 1CUGA 5JRJA 1W25A 1QYCA 3DHWC 1UZMA 2HPZA 3UQYS 3GJ3A 2O2YA 1SC6A 3MMPA 3UUWA 4GF5A 3COVA 1RQLA 1CXZA 1XD9A 3RUHA 1Z9BA 1UJCA 1VP9A 4WFQA 3B6IA 1ZXXA 3L02A 3NHAA 3OIDA 1YQUA 4B82A 1TC1A 1KYIA 1XMJA 2A67A 1X9GA 3WMFA 4WN3A 3II6X 1EX6A 3H5LA 1Y8RA 1Y6RA 4NBWA 4OHWA 1BJTA 2Q1TA 1SXHA 4EKDA 1P5FA 3HVUA 4YQYA 2HD4A 1NBOA 1AUXA 1JPUA 2OPBA 1BYUA 1UPBA 1L5HA 1NHWA 4DQXA 3EZ7A 2ZJAA 1XRLA 3KDSE 5DM1A 1RM5A 4YRMA 3ES9A 2WE8A 4FFLA 4NMWA 3WWOA 4EABA 1JFRA 1OFTA 1YB7A 3BGSA 3OECA 3WVNA 4FDLA 4UAVA 4OREX 1TF5A 1KIMA 1DZ3A 1RBYA 3NM4A 3L1KA 3DFMA 3KDAA 4TV8B 1AHHA 3JQCA 4WFKA 3T9FA 4DEYA 1TKRA 1E92A 2BGNA 4JEIA 2UVDA 4B44A 2V3CC 3SJBA 4Y9TA 3M2TA 3RSOA 3UM9A 5TPWB 1EFAA 1YQQA 3NHRA 3VBCA 4ZDWA 5ALTA 3AVOA 2DTXA 1YS7A 2RKBA 4QOEA 5IJ0B 1D2EA 4KN9S 3ZKWB 4EF5A 2HL6A 2JKZA 1PL8A 1TCVA 2RC6A 4EELA 3PUKA 1VHQA 3MYRA 1XXHA 1UXOA 4K9SA 3JZFA 4FFMA 1FP7A 2O1WA 2GCOB 5EGNA 5AVQA 1BCSA 2CLDX 2O7QA 5H59A 4CCSA 5K0ZA 1K6JA 1KR5A 2PWZA 3D1LA 1E60A 1ZHFA 2A5DA 3NQ41 4RPHA 1TO2E 1UWKA 3G2KA 4WBNB 2LKDA 1E8NA 3JWGA 5FUWA 4JYZA 4DM3A 2X5JO 1RI2A 3GRKA 4FSHA 4J29A 4AFNA 4D79A 4DHWA 4JJFA 3CZAA 3TLYA 4QXMA 4DNFA 4QWMA 1Z2AA 1T5HX 1VHTA 3ZX4A 2LUOA 3P9YA 4RO0A 3COYA 3PKIA 4D9JA 4GUDA 1Q57A 4PX3A 1IUNA 2HSZA 2V4ZA 1OXUA 2OO5A 2MSNA 2FPXA 3K9GA 1OREA 1ZK4A 3EZ2A 4YXFA 5HIAA 2VYQA 3AQ4A 2PEZA 5FR1A 3OQ6A 3QE3A 3PC8C 2C7RA 2JAXA 4LMAA 4ONEA 3KOMA 2JAWA 4C6TB 3G7NA 3VNUA 1GARA 2ZTVA 2WU3A 5IN5A 3IQFA 3WYAA 4OI4A 1PG2A 2GX6A 1Q0RA 3UV6A 3I9OA 3KTOA 2Q1WA 2OE2A 3LF2A 4YP0A 1XPJA 2RGGA 3ZHVA 1PZFA 3J7AC 2QL5A 2HMYB 2F90A 2CL7X 1SK8A 4CGZA 2VNKA 3HS3A 5GADl 1ZUIA 1SBTA 1UK7A 1DAMA 2RONA 2R6DA 3KOWA 1VBNA 3TRHA 1KMHB 3T4EA 2DMRA 5AJXA 2A1IA 4IWNA 2HK6A 1UOOA 3QKUA 2P9YA 4QRIA 3L0CA 3RSGA 2XVAA 3RWMB 2PX8A 2QUAA 4IIYA 1NVMB 3KQPA 4I5FA 4US0R 3GVXA 3SLGA 3QW2A 4QVIA 4ZHQB 4MV9A 1QVWA 1T43A 3JU3A 1M2VB 5CLJA 2H2HA 3PJFA 1I5OA 3CNNA 1QH8A 1ESCA 2YHIA 2AG6A 1T10A 3OD1A 3AY3A 3PPXA 4MHTA 2O8FB 2LKCA 2GQ0A 2LD4A 3GAMA 2OHVA 3RJ5A 3L4BA 5F21A 2XBMA 5DTRA 3L7KA 4JH0A 4MS3B 4LF7B 2DFDA 2W2VA 4DJEC 2X58A 2Q3FA 3IVRA 1I7QB 4D74A 3V97A 2VLIA 2X76A 4BAGA 4LQLA 4CLDA 4JR0A 4Y98A 4ZTZB 4YCBA 3UJ9A 5A4AA 2OFXA 4LHWA 2IPOA 3DXYA 3NNSA 2ZBEA 1Z6YA 5EJ6A 5I7OA 3KJZA 1ILEA 5FHQA 4RHTA 3FUUA 5G4KA 2F59A 4HN9A 1ZD8A 3N8HA 1T25A 2WU8A 3EMKA 3ZW8A 3IDZA 4RTJA 2I3DA 2FU5C 2OXTA 3DEJA 3TOXA 2PT6A 3G2PA 5LIPA 4MYCA 3RV4A 1DVRA 1GQOA 3T3EA 3KLPX 2PV0A 1X1RA 3P8ZA 3RUDA 4YH1A 1YL7A 3ZDRA 2HWUA 2OHGA 4OMFG 5D3QA 1IMOA 5J2TA 4G8BA 3ED5A 2Z58A 3T5MA 1MV5A 4URFA 5EIBD 1L7NA 4RV5A 3B9PA 1Y7HA 2BUAA 2YHUA 2ZRDA 1ZX1A 3QJYA 1H2WA 2UUPA 3BGVA 4KIJA 2XUQA 4PZLA 2OGWA 4UUMA 1HLGA 3FUCA 4JS0A 1BCRA 3VSBA 3IE1A 2C0QA 5AXAA 1IHPA 1SVMA 3DPUA 1O6FA 4IXWA 1KP9A 2BOVA 5KQLA 4U6QA 1L1FA 2O3SA 4KR9A 2ZIFA 2QK4A 3FHTA 1GCGA 3SC2A 1MIHA 4O0MA 1KBQA 1ZW1A 2M1XA 4C0QC 3SD7A 4CG3A 1OPXA 3VR6A 2OQ2A 4O4JF 4QFBA 4B4DA 4R2MA 3MLEA 2XA2A 4ZDJA 2AOWA 3ZZ1A 4PYOA 3DL2A 1FP6A 4JI7B 5DXJA 2VRNA 5KWEA 1VMDA 2ZIZA 3IEVA 2AW3A 2IEGA 2F8LA 3ZHSA 2Y0DA 2PIDA 4BQRA 3R7FA 1WV0A 1UBTS 5COQA 3HBLA 1ZZGA 2XWJI 4C1NA 4L2IB 2OCLA 3DFIA 4D8TA 4BDTA 4EF4A 2VFAA 3O91A 1RTKA 2P62A 2WPDD 4WBXC 5EPUA 4XGKA 1UZLA 1XLVA 2NUBA 1Z0UA 3IUSA 1SVIA 3G68A 4J0DA 5DXAA 1YZTA 5DI3A 5G0SA 5FPQA 2PS3A 3L8EA 3JQFC 1E9AA 3DV0B 4LZOA 4ASUD 2FEWB 3OZRA 4FMCB 4YWJA 5DMXA 4DEXA 2X0RA 2VZLA 2RHDA 3GY0A 1KI6A 2P41A 2Z2KA 1EE9A 3WLRA 4B3FX 5LN1A 4MJXA 3TTTA 1DJLA 5JW6A 3ZVNA 8GPBA 5IYZF 3CZMA 5KX5F 4D3YA 2ZE7A 3ZQJA 3GVCA 1GQSA 3O4GA 4NWIA 1UQRA 3CVJA 3FPHA 4ZC1A 2A3RA 5BORA 5IZCA 3HKEB 4QELA 4BNNA 3BMQB 3WC4A 3Q7SA 4H7JA 5DPMA 1T3GA 3X2SA 5K8CA 4P35A 1RJDA 1CRLA 1TO1E 2FSUA 2I1LA 2QWXA 4HFJA 5SV2A 2ZIVB 1RACA 3B8HA 5FORA 3S2GA 3PVCA 3HZRA 2FAXA 3K9WA 4YUXA 4DNXA 5FFMA 3E7PA 4H31A 1EUDB 4IVQA 1M1YB 5EY5B 1O4WA 4HWOA 1JTFA 4RTRA 4MYHA 1WMAA 2RJ3A 2ZBUA 1GG9A 3G85A 3JWJA 2Q5FA 1CIVA 4IV0A 3UMMA 1R18A 4G0VA 1DAKA 1SCKA 1AS2A 1PFVA 2YZKA 3L05A 4MS1A 2RH8A 4X9XA 2FOIA 1ZMTA 4NESA 4L85A 4PLZA 3BFXA 1RWXA 1QTRA 3FZGA 1CK4A 2YHAA 4O4IA 5HF8A 5JNWA 4IVNA 2PIAA 3I6MA 3L0BA 1BOFA 2XE4A 2D74A 4UOEA 2WHEA 1KDPA 4X8MA 3KPWA 1N6LA 4BLSA 1XZIA 3AFGA 3DZBA 5BR7A 5CA1A 3V8RA 4DA9A 2NO9A 3OX1A 2GPSA 3F9IA 3OWXA 2PA3A 3Q9SA 2DSNA 4MUGA 2YS6A 1ODKA 1GV1A 2XIJA 4D1YA 1PR0A 3OD5A 4CF6A 2CDAA 1K75A 10MHA 4AG6A 1RXCA 3JRNA 3NJ4A 4M0EA 3EVTA 1RLJA 1ESNA 3H19A 2C3MA 4U8GA 4ENTA 1Y34E 1I7NA 3P9ZA 1LF5A 1ZD4A 2GVDC 1X70A 2QYOA 3E7WA 2GTPA 4PZYA 4BNKA 2MMGA 1P1CA 3B7GA 4PG8A 1VQ1A 4XYBA 3AK4A 3FUTA 2EWMA 4WFJA 2ZBRA 1Z7YA 4Q1CA 1W5SA 2AN5A 3KQNA 1FFGA 3QWIA 3UPTA 2IODA 4CHTA 4DOMA 1DNPA 2AZMA 4Z6KA 1RFLA 5B12A 3T3OA 4AT1A 1U1FA 2ZI5A 3GX1A 4HB3A 4NBSA 4P31A 4QGGA 4DLAA 3EPHA 3DPSA 2BCEA 2O23A 5DW0A 1CS0A 3L18A 5CVUA 4D8VA 2IFTA 2VJAA 2YYSA 3N2GA 1R66A 4I08A 2EGGA 4WLFA 1MAWA 1ORTA 3NEJA 2QMEA 4PFSA 4UARA 4YP5A 5EHXA 5CCXA 2ZBPA 3D3WB 3HL4A 3PYLA 2D7JA 2SECE 2H2DA 5CM8B 1RXVA 2OZPA 3AINA 5KYYA 2QPOA 2J1LA 4BNWA 2CVZA 1W5BA 3KSAC 2QDKA 1U63A 3NDJA 5DTIA 5FUYA 3EQ7A 3UXEA 1UBKS 1V41E 1W36B 3RAJA 1Y8CA 1RWMA 4GC5A 1V6SA 4RXTA 3VO2A 1NM5A 2GF2A 4RDHA 2H29A 2YC2C 2VXYA 1Z2DA 3HVHA 1ZM2A 4OA5A 2XTZA 4QXPA 1RBZA 3KNZA 4TT3D 4W1PA 4XJVA 4NLLA 5DM0A 5H3HA 4BP1A 4RTLA 2EQAA 2COUA 4DS3A 1FNDA 3M4ZA 3C8HA 2XUJA 2B20A 4PHHA 1T1RA 1SKYE 2VWHA 3EWIA 2Z5LA 3O8LA 3LCJA 4B6JA 2J33A 1ZP6A 1E3WA 4X7MA 4CIVA 4EQ6A 3IULA 2WFZA 3GOQA 2REQA 3E03A 4IHKA 1HI9A 4BFVA 2E4VA 3F7OA 1V8FA 3LC0A 1NVFA 3QPDA 5IAKA 3VSEA 3OO0A 1M73E 1RXSA 2X0FA 1EM8B 3B5IA 3WGLA 4KHPB 4PLPA 1WHTB 3GYGA 1QIMA 4QDTA 4C4TA 3CVYA 3NHMA 4IG9A 1C8VB 1KK0A 1F8GA 3WGOA 2P79A 1FF9A 3AVXA 2W6QA 3HVIA 5F52A 2UYOA 4NYMQ 1X2BA 4RCYA 3AUSA 1BNCA 4M1WA 1JQLB 1GKYA 1XZPA 4IXMA 4X7BA 1WTCA 4GWKA 5B53A 4DNOA 4F5DA 3SYKA 1QHHA 2JGDB 3VX3A 2D8AA 4MPTA 4DMUB 2PUWA 4GH5A 5EUBA 2JLBA 1N5IA 2XR1A 2G80A 3NI2A 1NUQA 2ZT8A 4ZAYA 3KQSA 2ZSFA 4NECA 5AYVA 2C82A 3S1AB 3EXHB 3UGTA 1Q95A 1CQIA 3EGVA 3PKZA 1GRRA 4HGYA 4TVKA 3OCVA 5CT8A 5FOWA 4D0GA 4I3GA 4CWAA 1IHYA 3C8ZA 3U44A 1EX9A 1C0IA 2I3ZA 3BA1A 1GKKA 4K7JA 4MPRA 4TSRA 1E9FA 5SY9A 3RFUA 4EL5A 4NULA 1FTSA 2VA9A 3CPJB 3M5DA 4RTMA 4EHDA 3U1BA 2ZPTX 4LYFA 4PPYA 2ECKA 2IUYA 5EWLA 5ESXA 2ZPUA 4LNUB 4R2HA 3UMYA 3I6QA 4ZN6A 1BA3A 1V39A 3RAGA 5JC8A 1UZUA 2GCIA 3TLJA 5E9QA 3JQRA 3EMBA 4GPTA 3W78A 5E4TA 1UP7A 1AKNA 4JOBA 4MTCA 1LBHA 4DJJA 3K2QA 4TXMA 3X1JA 1A2KC 1NBME 5LJIA 1VFNA 5GIOE 1FTWA 3O9ZA 1NW4A 5DSZA 3WSVA 2GPNA 4TV8F 1JEOA 1U5BB 2G4VA 3UTCA 3CH4B 4C04A 4E88A 3NEPX 2C4MA 1L4UA 3QELB 2D1YA 4MKHA 1FY2A 4MW9A 2W90A 3U31A 5ERXA 1ONSA 4OAPA 4D56A 4MHSA 4R68A 4CUKA 5BWOA 3QEBZ 2YKGA 2VNHA 3WK4A 4XDZA 1AS0A 5AW3A 1SCUA 2QRMA 4O02B 5EERA 1V5FA 4D9GA 3NETA 3MJRA 3OPMA 2HV9A 1JSXA 3FNBA 2J0SA 2E4WA 5H70A 2GUGA 5TSDA 3FMPB 1NLYA 4ZO7A 4QJBA 5FWXB 4AMBA 4R3NA 4YP9A 5HILA 1IIBA 1E2GA 1ONPA 3RU3A 4X97A 2R8RA 3TIIA 5A5DA 5KREA 1YZYA 2R1TB 4WBNF 3W5AA 2VO1A 3ZCQA 2VRCA 4XIFA 7AT1A 4OBXA 2I22A 2JZOA 1ZL2A 1M8KA 4U0KA 5GJWC 1D2GA 1G8JA 1GL9B 1U4OA 1C4WA 1PTJC 2GUWA 2P2LA 2WKQA 1T9BA 2ALJA 3KR0A 4RIEA 5EUQB 2BTQA 1TJPB 2IITA 4QTYA 4P3PA 4UU1A 4YT2A 1LS6A 2D3WA 4QYXA 4UVHA 5I01A 1K9VF 3JASB 1SIBE 2YJNA 3ORHA 4CMEA 4FTWA 4WZAB 2W70A 1PV2A 5EUMA 5BUCA 5K6RA 1RD4A 4CM8B 4KXYA 1JHPA 2J5XA 4V0LA 3SDBA 4FGKA 2ACVA 3ZY2A 1MAHA 3PGXA 3V00A 2B7LA 1TMGE 1WSWA 3U19A 4LYJA 3H6GA 2YWDA 3PNKA 1S4QA 5TQ2B 2Q3JA 2A94A 2DKFA 1SBCA 2A1TS 3GPIA 4W8OA 2HXSA 4MA5A 3ROXA 3G7UA 2P4EA 1ZZEA 5DHQA 3OP1A 5F2KA 1F0NA 3VZPA 4C7MA 1Z2CA 4P7KA 3RREA 4KNWA 1D09A 4AJPA 4KQ2A 5BQOA 1K6MA 2C3OA 2RK6A 1KE1A 5AVSA 2BM1A 1X38A 2D3TA 5ITSA 6REQA 4LC9A 1TLLA 3DH0A 3EZ9A 1Q74A 2ZCVA 3IUPA 3EGWA 5CM2Z 3STXA 2HTFA 4DDMA 5AW2A 4ND6A 1E7RA 1AHNA 4J1SA 4IINA 4HQOA 4X6UA 1NE7A 2LCIA 2XE6A 4ZCLA 1MJ5A 1V8OA 2VDUE 3G17A 2GLUA 1JPJA 5CEEA 1GZSA 5AH0A 3ORFA 2ECFA 4DR2B 2IIPA 4Q48A 3NOOA 3DUFB 1YHNA 3LX4A 1DBRA 4BQOA 3SYNA 5JPDA 2FWIA 3ORQA 1T1EA 2GZ3A 1DC5A 3HFJA 2ZWAA 3K35A 3TKAA 5LB2A 4YYZA 5DCYA 1K27A 3EZLA 4MO2A 4NYIR 1RQXA 2GEUA 3ZLJA 3T7KA 3TR5A 2VPPA 3LDGA 1KKMA 1Z0ZA 3SQNA 1V26A 2A0FA 1F4VA 3TTYA 1O6GA 4BQSA 4DB2A 2F1HA 5F9FA 5ES4B 1OWNA 4GLFA 1U0HC 3RYCA 1V11A 2ODNA 4MHOA 4EX7A 4F2GA 4XM1A 3BH7A 5K51A 4G9BA 5HGJA 4JXXA 3SHVA 3BJMA 1BMFD 3T0GA 1WJGA 4ZZ0A 2AKEA 5LZ7A 4X1IA 4PM4A 4JHLA 5C4IA 2W6CX 4XIIA 4WY2A 3AKCA 2JA1A 2OCGA 4PSCA 3WICA 4ZI5A 3HG7A 2EIXA 1YVRA 2IEZA 3OKCA 1OLXA 4I1OA 2P3SA 3RHZA 3VJRA 4P0TA 5NULA 1VA4A 4XM0A 2Z6VA 4KUEA 3SFVA 3C97A 1ZM3A 5HCUA 3RRNA 1SXJC 4H60A 5CT6A 1DC4A 4UCWA 4UXIA 3W2IA 2A0YA 1XYVA 1Z62A 3BXGA 4FXPA 4LHZA 2V7EA 2ZS9A 4KR0A 4ZV9A 4BFCA 5JBQA 5CNIA 1ISGA 2O6LA 1LTHR 2FF7A 4QJIA 3SAJA 4E1VA 2ASVA 3E2IA 3PFGA 1KAGA 1Y9EA 2BFCA 3SMQA 1D3AA 3R8FA 2IPLA 4H7FA 1WZ2A 1V8PA 4BAUA 5D7BA 1HLDA 4B85A 3K71B 2B94A 3PGJA 5DLEA 4I4LA 1Y8AA 4PLYA 1J2TA 3UFBA 2FMXA 5A4DA 1NVKA 1TMKA 2CUTA 4C6HA 2BGJA 3CLRC 3R20A 4KYTA 1DKQA 3MIZA 1ZXBA 4UFOA 3LKVA 4JN6B 1Y37A 1ADBA 2B61A 4L7QA 3CV3A 4H1TA 1EKXA 1KGDA 1L5HB 2HRBA 5EXTA 5IXSA 3NM5A 4AAYA 3R3XA 4GNRA 2VQSA 4OXRA 1UAAA 1Q7GA 4FGZA 2V7UA 3JAWA 4FZ3A 4EG7A 2M1ZA 4KOAA 5E0OA 3V4VB 3AJEA 4N0QA 3QH4A 4NAVA 4NFLA 3PFHA 4US1R 1F8YA 2IF2A 3L0PA 3IVAA 1J0BA 4M9UA 4DR5B 1NXVA 4DF3A 3LVBA 4L76A 1FBTA 3NHZA 3LGXA 4KGZA 4UVDA 1RJFA 3VR3D 1U4NA 1U0BB 4FFSA 1C3EA 1XQ9A 3FUXA 4JGGA 4CMIA 4DQDA 2QP3A 1R6UA 1YZVA 4PCUA 4F8YA 2VP2A 2Y1OA 5JY6A 1MB9A 1W8IA 4JI1B 3M6WA 4R0VA 1PG0A 1CRZA 4N7BA 1F8FA 5DI9A 3NAQA 4MV8A 3W3AD 4N76A 1XXHB 3B6JA 3EZNA 4B35A 5CNJA 2JLSA 4GSYA 3IAXA 1BCSB 1VL5A 2H2FA 1TADA 2P1DA 3TW6A 2P67A 3TB6A 3ABZA 3IPLA 1LK5A 1NVGA 1Z2EA 3PEVA 2OMEA 4JL5A 4DQ0A 2DFTA 4O1HA 4Q7JB 4EJFA 5C9ZA 1RKUA 3A4VA 1PYOA 3ZLUA 3A3YA 3HTXA 1WWKA 3L1HA 4KX5A 4QU0A 1EK5A 1RPNA 1SWWA 1CULC 1JSLA 2L69A 3AUYA 3LS2A 5G02A 5GJBA 1VG8A 1ONOA 2WWGA 3P2JA 2PUAA 3REOA 1A97A 4D9HA 2FWMX 3TJRA 3E1GA 5ARCA 3S70A 1J90A 3NBXX 1MP0A 3JZIA 3M3HA 4K40A 3C3JA 1C30A 3UW3A 2WR8A 3IEXA 4D3FA 3W2FA 4J0KA 4MVJA 2ZTMA 2DM6A 1KEPA 1T0PA 1AUVA 1V96A 4UUQA 5ES3A 5A05A 4YI5A 4N3AA 3GLIA 1CF2O 5H8WA 2X2OA 3PX7A 4G25A 4IIVA 2JCBA 2G88A 4BQQA 2FZVA 4G0PA 5ILGA 2BPOA 4HJXA 2WV7A 1YBAA 1Z3CA 2FX2A 3EULA 4JU8A 1QG0A 1QKKA 2C4TA 5HMLA 4DUYB 1SIWA 1ATZA 4V0QA 1NR7A 3ISJA 2H4HA 1YAJA 4QPJC 3UCXA 3ETHA 3ZCSA 1RRVA 2BBOA 2RKWA 1RHMA 3K32A 5KC8A 4ZCIA 2EZ9A 4RF5A 3A1UA 4LISA 3AO0B 4FWBA 1XXLA 3SZ3A 5IVKA 5CTAA 3IP7A 4WA8A 2MR5A 4IWYA 4EZEA 4XJSA 5AUNB 3HWWA 3D4IA 3CX6A 1N5OX 3N2NA 1YUNA 3RDPA 3L4SO 1NBMA 1VKHA 4WMLA 2QX6A 2QYTA 2H1SA 3D2AA 4JGIA 1QH8B 2YHIB 3QG5A 5FP0A 4BQNA 1GAEO 2DGDA 3U5ZB 3ILHA 2OV1A 4FE4A 2CXHA 1EVKA 2AEEA 4NPHA 1UOPA 4RK6A 2FFJA 2Q4DA 4DUGA 4HNUA 2ZUCA 4BNIA 1SCAA 3M6IA 3MQ2A 2ZQ5A 4II3A 3AI3A 3U81A 3A26A 3DF9A 1IK6A 1VHJA 3AETB 4RPGA 2CNLA 1O1YA 2DKNA 4N9QA 4F56A 1U3UA 3M6VA 1VE5A 5CM9C 3BQ9A 3I04M 4B6OA 2CSXA 2AMFA 2J5QA 1FDSA 3NVAA 4R8MA 3LO8A 5G4KB 5BSRA 4FSDA 5LYJA 4Z7QB 4PQRA 3S99A 1ZEMA 2O1SA 3WL4A 1Z6AA 3PFFA 3T12A 1YHZA 1Z8NA 3FPLA 4OSPA 4RJKA 2PRIA 4LOHA 5CP8A 5JAOA 2VPTA 4JJGA 3S5UA 2FR8A 4FPXA 3LP5A 1WBBA 1YJ8A 1Z4IA 3BERA 5J2TB 3UT5B 3WRYC 2MYPA 2C84A 3V8QA 3V8PA 3ZX5A 2DG2A 5JE8A 1Z16A 3U1VA 2ZYDA 4HAYA 1E3EA 4D0RA 4XQGA 4CIAA 1BCRB 2YTZA 3NUQA 2DEUA 1Z22A 2ENWA 1VL2A 2XRMA 4BWVA 5JNUA 4RGYA 1UL1X 1QANA 4ZC8A 4FCCA 4LVNA 1IOWA 3O4JA 2TMGA 3SC2B 3AOGA 4FHDA 3WDMA 2DHRA 2NO5A 3KLBA 3DFKA 1QE0A 1XA3A 3R4VA 4TMVA 5F35A 3UK7A 1NASA 3GLGE 1D7OA 2Z43A 5A9RA 1VKZA 2JRLA 4PN7A 4L5JA 2VIIA 1JXQA 3ODPA 1DAPA 1OT3A 3TLCA 1Q0TA 3U7GA 1FE8A 2XADA 5A0FA 1D9XA 1YKSA 3CJQA 4QRHA 4LDNA 1WKVA 2F3PA 3HM2A 5AVTA 5IWCA 3PWTA 4O2RA 3LXXA 2NYUA 4JWTA 1B8NA 4XFDA 3WAGA 4FEYA 1D6JA 1XTUA 3PXCX 4TSFA 4E30A 4DKJA 5KTRA 2RHGB 4G41A 3B53X 1Y4DE 2LDXA 2FUKA 3DF7A 1NW8A 1U2GC 2VP0A 1J9ZA 5DI3B 3KKPA 1XRRA 3W2EA 3CURA 2E5LB 2QTMA 3I9KA 4PAWA 5JJKA 3OY7A 1JKIA 1KI6B 1PJSA 2ZLBA 3N8KA 4R1UA 1P1KA 4RVFA 3T0IA 4DLLA 4C43A 4S12A 1JIIA 1UZNA 2B5OA 3WK8A 5F23A 4XYMA 3FR7A 1Z4KA 3HBFA 2ATCA 1AX9A 4MIYA 2QQ0A 2FVYA 3F67A 3JQ7A 1TRKA 2C92A 2ILVA 3ZVRA 1IZ0A 1VA5A 1EFKA 2VTVA 1UAGA 3SS9X 4M21A 2YWRA 3A1WA 3A14A 3CLUD 1FC0A 1NUPA 4G4SP 3IQGX 4G2NA 3UCEA 3OFKA 3L82B 4MYTA 2VC2B 2FZ5A 1RYFA 4BMXA 1Q7RA 1U0TA 5GWXA 1IY2A 6Q21A 1Z75A 1QJ4A 2Q46A 4BFYA 1JZQA 4BRZA 4MS1B 5DHAA 3AR5A 2AI3A 1QIDA 4KQCA 3TRIA 4ZK6A 3ILSA 4JYBA 4UJ3A 2A78A 4IUDS 3HLYA 3L9WA 4O4IB 1QR2A 5IZ4A 1T9HA 3KE9A 2E87A 1KYZA 1GAJA 1UP6A 2A7QA 3KU4A 1D0IA 1HK7A 1K92A 1M1NA 1V43A 1I4DD 2GF0A 2IXEA 2IYSA 2M2IA 2Q41A 3IE2A 3OE1A 3WIUA 3VISA 4EK9A 3RSFA 1SPBS 5A5GA 1I1QB 3NLLA 4FOSA 3T5GA 1OU0A 3PKJA 5CA1B 3KZMA 5HQ3A 5F9HA 2GN2A 3BAZA 4M88A 4B47A 2AR9A 2OUKA 1AZWA 1ZMRA 4AZWA 2JCXA 2D00A 1F2TA 1P9LA 4JBGA 4K6HA 2LDBA 2IYXA 4PR3A 2OC9A 4EY8A 1N77A 2V7BA 3EYAA 2HHCA 1S96A 2H0RA 1ORVA 1D0SA 3HHEA 1A2QA 1TDJA 2WHPA 1KVTA 2WY2D 4BLPA 3DBLA 1QVRA 3L8CA 4HBGA 2GHIA 1Z34A 2VXOA 3FSRA 1DBIA 1TB4A 1ZU4A 3ANMA 3PXAA 4GBMA 4N0PA 4UE3S 2IBSA 3KUXA 4RQAA 1DCKA 1PFGA 2GILA 2I99A 4TM8A 1FSGA 1MTOA 4TLBA 1DT3A 1J8YF 2D5LA 2V3VA 3MMNA 2P5UA 2WNIA 1K6EA 2I7XA 1QWSA 5AVVA 1HZZA 1A96A 4EEKA 5BT8A 2X8BA 1R4ZA 3N76A 3NATA 1PWZA 1GGKA 3A9VA 4ITVA 5AJUA 2OT3B 1CE8A 4GMFA 5FBLB 2FGKA 1DLIA 5JASA 5T5QA 1CS0B 2EZ8A 1MO2A 5F77A 1ZFNA 2WLSA 3N2GB 2XGGA 2YBEA 3HA2A 5ALDA 4BFZA 4IIUA 3A1EA 1E6UA 2AZ4A 1F12A 3D6NB 3KHSA 5KOIA 3GJZA 3JZMA 1VPEA 5EZYA 3K20A 3LFTA 4A23A 2H4WA 5BWNA 3BHMA 2G9UA 1G5RA 1NHGA 5KYYB 2IEIA 3FDIA 1B6SA 2GI4A 2DUJA 1GZ3A 2IY9A 1K8QA 3JPYA 1TYAE 1JW9B 5EJ8A 4ZVMA 4ZZ3A 1Z07A 3QHPA 1WG8A 1UPTA 1UFRA 4DAOA 2FE4A 4WKCA 2Y77A 3LCRA 3O8BA 3RTBA 3N7UA 1GA1A 5CBPA 1LTKA 3COSA 2GBLC 4G1FA 4CU2A 3EEIA 4GI1A 4ZYZA 4EITA 4H4CA 1Q1AA 3QE2A 3GNQA 1WMDA 5JCJA 3SC3A 4LK3A 1DINA 1KETA 3TYXA 3E7FA 5COAA 2HKIA 3PLNA 4WKBA 1VB5A 2BFBA 4QSHA 4Z3KA 1DTSA 1JJ7A 3FMGA 2QD1A 2DWPA 1E3WB 5FL7A 1EZZA 3IQHX 4EQ6B 4LX8A 3MJFA 4KR7A 3AR3A 5K45A 5FOSA 1AGRA 3CB4A 2REQB 1FSFA 2A8YA 2AX3A 3JQ6A 4MTLA 1ZU5A 1W5AA 1E9DA 3GFGA 3NTLA 4CCAA 1EDDA 4D3SA 1P5JA 3I2IA 4HP8A 2YINC 9LDBA 1J8QA 2WTAA 4TZ6A 1HDZA 1MN6A 5EIWA 2JFPA 4NPAA 5CURA 3QXCA 1M8GA 3MCAA 1WA5A 4OOFA 5B5SA 4PSUA 3VKGA 1ZXLA 3D81A 4LIPD 5DXFA 5K0FA 3VUFA 2OBMA 4BO9A 1RJWA 1SBNE 4KQEA 2ODAA 3AI1A 2ZJ7A 2ID7A 3E7XA 3PK0A 1ZRMA 2FLKA 2XQVA 4TKZA 3TXAA 5HKKA 4HQLA 4G5FA 3CRQA 3S68A 1L1EA 2QP9X 4BN5A 1VE6A 2Y2VA 3FDFA 1G5TA 5HUHA 5DK4A 1J06A 1KNQA 2UDPA 1Z5ZA 3G2LA 1L5KA 3RH0A 1G8HA 1ACMA 4FS8A 1A9XA 3MRVA 3ZI4A 1E1QA 1E0SA 1CQIB 4F2DA 1YASA 5K3DA 3HXKA 1P4HA 3EOAI 3D8SA 1S01A 4R6WA 1KYXA 2YHBA 3U44B 4P7GA 3WADA 5KJEA 4WCFA 1JI0A 2X2EA 4X24A 1S8NA 4E03A 5BW5A 1DMRA 1NY6A 2CJXA 1K6IA 5EJGA 3F6CA 3PTLA 3SIXA 5EWLB 4Q3LA 1WDKA 3EK2A 2R3SA 2HC9A 5G1PA 4QTZA 2WSMA 4Q9HA 4IDAA 2ACWA 2O5RA 4HFNA 1D0VA 4E2ZA 5IKPA 3UXHA 4I55A 3M6XA 3U7HB 1AK9A 1CP2A 3UYLA 3ASZA 2PY6A 2DBZA 4O0LA 5U4XA 4CDNA 4OQPA 4RD2A 3O8CA 1R0BA 1NF2A 1X1TA 1EA5A 1N1DA 3D1VA 1H3NA 3TG2A 1GY8A 1T13A 3PIDA 2OBNA 4UPVA 4RTSA 3DR3A 5CX4A 4IIBA 1VKJA 4NQZA 1V6CA 3CZCA 5EYPA 1LCIA 1KO4A 1NXPA 3NBYC 4LX0A 5TF0A 2A0UA 4DMRA 5KVSA 1S2NA 3TFWA 1FFAA 4FHCA 4PBSA 4OKIA 4CN9A 1JU4A 4ENWA 3UH1A 1SCUB 1X7XA 3F5QA 3JWIA 4CF7A 1LB1B 4I8IA 4IX1A 3KKNA 1QQBA 2PMFA 5LDHA 4MDFA 2WG1A 5LZ8A 2I7TA 3BTUA 3CMCO 1PHPA 3MJ4A 4MUMA 2CXRA 1FFDA 3BREA 3C41J 5J1SB 2VK1A 2IRWA 2C00A 3D0KA 4J0CA 4YMWA 2G4LA 4B3CA 1U2PA 5SY4A 1GLVA 5E7QA 3P32A 1T4DA 2OM6A 2HWKA 5K0CA 3E8SA 1IPHA 3H8SA 2BTQB 4LXTA 5HZGA 3TZKA 2FEAA 1E5QA 2NSHA 4IDNA 2GM9A 4X93A 1LI4A 1XWWA 2CDCA 2NO1A 2X3UA 3PT9A 5ICFA 4YIHA 3RFCA 3WYDA 4U3JA 3C7TA 4BDSA 3L1UA 2Z09A 4ZXPA 3K0AA 3Q7RA 2I1QA 3HRHA 4JWKA 3ZWXA 3ZWNA 4EHLA 3PI7A 4UCQA 5BMVF 5K20A 1W36D 3GEPA 3STTA 4CKXA 2BM8A 3FG9A 5C3MA 2RHJA 3OZDA 4UOQA 3D59A 4OAQA 3MVEA 1M2JA 5E1BA 4B74A 1GRCA 3TECE 2JATA 4KPGA 4XQCA 4YJ2F 3LX5A 1SC3A 3FZYA 1YVEI 2GDJA 4JROA 1NVVQ 4L28A 3ZCUA 3W79A 5IDQA 1T3SA 4OHYA 6REQB 1HKUA 1KHTA 1T9GS 4GX5A 1RZRD 4G56A 3OURA 3IIIA 3LQQA 3PA8A 4RIGA 4O1IA 3PS9A 1LPSA 3A37A 3LC7O 4DLVA 1KJJA 4DQKA 3FNEA 1XZNA 2GPAA 2Q1UA 2Y4OA 1AV7A 3I28A 3FPJA 3UAYA 4B6GA 1YS2X 3I6BA 2Q4RA 2O8FA 1JJFA 2ZZMA 2P9EA 2BFDA 3IXLA 2V4MA 4G26A 3V6MA 4XWKA 3IBYA 5GOZA 1Z6PA 4HWSA 1CQPA 3K1ZA 1SH7A 2R7AA 3K6JA 4XGNA 1CETA 3EPPA 1JNYA 2HMWA 3FFWA 5D87A 1R2QA 1TA4A 1QHEA 1K7YA 1NLFA 3TNFA 2DULA 4RJ2A 3EWAA 4QE3A 2QDXA 4Y2UA 1XNRB 2GN6A 4IXTA 3ZY5A 2JC3A 4BZZA 2Y93A 4BVFA 5JS8A 2QY6A 4LA4A 1YS9A 4JVNA 1S1CA 4M1SA 5DLPA 1RXWA 1IJFA 3WS7A 1QG4A 2ZULA 3KELA 5SZHB 4X85A 5HTOA 4KQWA 3A8TA 3G0GA 2B4YA 4RDCA 3RYCB 1V11B 4AWBA 1WZUA 1G60A 2GA8A 2GEBA 1N2OA 5TGZA 4LDRA 5G0TA 3ROPA 1M2HA 1Q91A 2WIKA 1QU2A 1G42A 2WM2A 2I6TA 1DAEA 3LP6A 3Q9UA 4OK3A 3SOPA 1YQWA 3KEQA 4UTXA 1BKYA 4X1IB 4AROA 1QRTA 2G0NA 4URXR 4HK4A 1E79A 1M0WA 3QIAA 4OXNA 5J2TF 2XCIA 3UO8B 4CM9D 4EW3A 2HF9A 1ZD1A 2HUPA 2H1FA 1ZMOA 2RGCA 1OLXB 3E82A 3I0MA 4G4GA 2ZYIA 1N8NA 4PEVA 4I19A 4ND4A 1ZS9A 3HVJA 1BX0A 4TMFA 4ZU6X 1J49A 5K0LA 4QYTA 4B7XA 3KHUA 1W5EA 1HMPA 4B40A 2D6FA 2MINA 1UP4A 3GJ7A 6CHYA 3FI0A 3FNRA 1UBNA 3VTAA 4EPYA 3ADKA 3HO8A 4GI3A 5AVWA 1P4RA 1Z39A 2BFCB 3DVRX 2J7KA 4L3OA 1ZN9A 2ZUUA 4UHBA 3HPRA 2CGEA 3OHPA 4OXKA 3GARA 4WK0B 3PUVA 3RB8A 5KEIA 4H7IA 2Q8QA 4TXNA 2ZAOA 3HJCA 1QNLA 4D46A 3MBKA 1F4LA 1QZXA 3E23A 3FTNA 3DSRA 3OX4A 1MENA 4Y2SA 5KOYA 4RA6A 2RJNA 3I5YA 3B1XA 2PGIA 1IHUA 3I4LA 2KE5A 4G37A 1A4XA 1UC9A 3LBIA 4YQEA 5ALKA 1JS1X 4COOA 1TT5A 4HLUA 4X00A 1E2QA 2B34A 2XY4A 3JAWB 3O3CA 4OP3A 4ER7A 1QHIA 4IIJA 5JMOA 1S5PA 3EVEA 3ZBQA 1EBUA 5B57C 5IJ9A 2JGLA 2ZYAA 1APBA 3KKEA 1C9EA 1RQNA 5M34A 2FHPA 1U28A 1AG9A 1D6MA 1OWPA 2DWCA 4DR1B 3NP9A 3VUEA 4PBRA 1N6OA 2HT6A 1FP1D 1KI9A 1TECE 2NYRA 3G9ZA 3GRFA 3LQ2A 3SNKA 3VVMA 4CMIB 5I8WA 1P6UA 4BMNA 2RHCA 1WDMA 3CF0A 1SKYB 1CW2B 5ELMA 4KSYA 1RFGE 3WYNA 1Y42X 4JBIA 5C8ZA 1M0EA 2RH5A 3I76A 3GZJA 3ACBA 3T7EA 3V8EA 3HB1A 3QGMA 1Z74A 3KUCA 4P6VF 5JIBA 1UXHA 3K9CA 1G0NA 4FJ0A 1C7FA 1IFXA 4AZ0A 1T3LA 2V9PA 4L4UA 1BVRA 3DB1A 1QYIA 1SVUA 2ORYA 4C21A 4F96A 1N2ZA 2DHCA 2VNSA 3L7OA 1PLKA 3DMDA 3C3WA 2JGKA 4Q37A 1V5WA 4TRMA 4F5EA 2X9VA 3OHMA 1UKZA 1OIXA 3RFXA 1R16A 8ABPA 3HC7A 2Q07A 3ELBA 1TNDA 2O6HA 4Y0AA 1FVOA 2MYTA 4CFZA 4TGLA 3CNQS 3WYBA 5BOSB 1E0DA 1ODJA 2JHCA 1TW2A 1PGQA 3CCFA 1FU8A 1KKUA 3MD0A 3Q8WA 1IY8A 1P72A 1VI2A 4FKZA 4LRUA 4O4IF 3O8OA 5DO9A 3FSGA 3GCXA 1AO3A 1C30B 4IOMA 421PA 1U0SY 1DBPA 4AJOA 2H9YA 1DV2A 3GFOA 1CY8A 1HNNA 1YQ9A 3S28A 3LQRA 1HOXA 3JQ9A 4FUQA 2O8CA 1FFEA 3H1FA 4I50A 1MOQA 5CA1F 1GZ5A 1ZYUA 3I1JA 5CG2A 3GLFE 1U7PA 2ERXA 3HRIA 3ROKA 1VKNA 3SEZA 4UOZA 1P9OA 5HOQA 2C9ZA 4QOSA 3WWPA 4NDZA 5JVDA 3AM3A 1DBSA 1K4MA 1A3CA 3FNFA 2Q1XA 5AWFC 1K5DA 1T1SA 3IOMA 3N5KA 3EMVA 2XZPA 4JD5A 2MSDB 5LPNA 3FHJA 4Z0PA 1T5OA 1CFJA 1J9GA 1J2JA 1R4MA 3EGEA 3K15A 4YAWA 5LCXA 2PUFA 1OZGA 1M66A 2PKRA 3LZ6A 1G4UR 3OEHA 1CVIA 3Q3HA 2JBAB 4PGMA 2D06A 1WHSA 2JD2A 4ODIA 3ZJUA 1DL5A 4AUNA 3N0VA 3WV5A 3ZD6A 1WB9A 4DV1B 4L1KA 2PUTA 3GJ6A 4YCCA 1G20A 3GROA 1GZHB 2PGNA 1XF9A 5HRCA 3IH5A 2CLSA 1JG7A 3MRSA 1WOYA 4BNZA 3IJEB 1N33B 1IMJA 4R5HA 3AQIA 3O21A 2QJTA 4GYYA 4PG7A 1T2NA 1FLDA 1OIVA 2GM5A 4IGFA 4LN1A 1UJNA 5IC5A 3I05A 1AKEA 5CVJA 5AK5A 3S6JA 4DM7A 4XOIA 4CQMD 4R2XA 3ANLA 4B8ZA 4PRLA 1OFIA 1XJWA 2Z3VA 1NQAO 3D0QA 4Q01A 1R37A 3KVVA 1QP0A 1I10A 2WT4A 3LCMA 4Y1RA 3S2UA 4ZJYA 1IZYA 3O03A 1CJCA 3D4BA 1AJEA 3R6TA 1O97D 5HQTA 3KALA 4RVGA 3TQFA 3SEFA 1RHQA 2YR0A 1IYZA 3EOZA 3N2EA 2H5EA 3PTAA 3Q7IA 4G1BA 1U81A 3L92A 4KMSA 5DF1A 4A8PA 1VG0B 5LYJB 3DLBA 3J81k 1YRAA 3E3AA 3U49A 5D3ZA 2EF0A 3PDIA 5EINA 4E46A 1EX7A 5CXSA 2XBUA 5GZ3A 2D2IA 4BTLA 1KQGA 3W4JA 4F93B 2ZDHA 4ZVTA 4U7TB 5KQMA 1KJYA 4QBTA 1P6QA 4Q12A 4EJSA 4Y2HA 4PLWA 1J8DA 1NFQA 3NIDB 3NS7A 3QF7A 5EXEA 4DNPA 5BV8A 2B9VA 2R8BA 3EXFA 2HDWA 3OFSA 4FHEA 1QHGA 1F2VA 2FV8A 5FUVA 3HJBA 5J4LA 2ENUA 2FEMA 3RM3A 1H6AA 3PD7A 3WIEA 3ZW9A 1GA6A 1Q0ZA 1IM8A 1R3UA 2BUBA 5DGHA 3X3HA 3PXBA 4IGAA 4DPMA 4DDUA 5L7WA 3LT1A 4B48A 4CF5A 4O33A 3IJRA 4HMQA 4ZODA 4HFRA 1KXJA 1IM2A 5ANRB 5E95A 3G6WA 1ZNYA 5JAQA 4F86A 4W9NA 1DIOB 1AA6A 4MVYA 1CIPA 2BZGA 2QG4A 3K9NA 4Z9XA 1N4AA 1A7KA 3RRMA 1W49A 2COKA 4FYHA 3GFQA 5T8KC 1E1RA 4HF7A 4TS3A 4DAEA 5I4IA 3JY6A 3IR5A 4FOTA 4DJFC 4Z53A 1M1XB 5K0NA 1JWBB 4TRRA 4K88A 1JH9A 3WLMA 4ZQFA 2MT9A 5BT9A 1MQSA 2OYSA 3T7AA 4OV6B 1W1WA 1G0OA 2XJ4A 5CDHA 2GAFA 4IH1A 1CUEA 3OEWA 3TOZA 1R12A 1JEYA 4EO4A 1I4OA 4FW9A 2IF0A 2WF6A 4R9RA 4WLUA 1YZNA 5AMXA 3NH6A 1C4KA 3QF4A 2E4ZA 1I51A 4JX9A 1NNUA 3SXPA 4LFBB 4FFOA 1OLSA 4EGJA 1LNZA 2XTAA 2O59A 2P75A 2D5CA 3O0DA 2ZUBA 5HK8A 4JJIA 5FUQA 2X8LA 1DKMA 2MJLA 3M6LA 2HJVA 3GRRA 1C3VA 5A5VA 2W5UA 2VPIA 1AU9A 1XLWA 2DQ4A 2VTEA 1EX1A 3TXXA 4F72A 2Z2JA 4GECA 1KMNA 1T3HA 1U7OA 4ETWA 4FT2A 4LBWA 2E6KA 4KLCA 1O08A 4PQGA 3BUSA 2JAQA 4L22A 4MW0A 3JQ7B 1O58A 5C4MA 2YICA 4UZFA 2MCFA 3I53A 3FUWA 4U7PB 1FNMA 3ZDYB 4DVJA 2GZRA 4I4IA 3JQGA 3NM6B 3V1KA 3PDUA 1TAUA 1BHSA 3UJ6A 1YRLA 3D6HA 5I5EA 1VHLA 1SN7A 3ZKAA 1UFVA 3J7TA 1GUZA 1NT2A 4GEGA 2WWWA 1J42A 4M60A 5CW1A 5B37A 3W5UA 2JH8A 3RIMA 3R8XA 2FPPA 3PIRA 4BO2A 4EKNB 5A4MS 5ESDA 3N2LA 4NDAA 1NRJB 1YKGA 4LRYA 4WXHA 3WOVA 3OM9A 1Z0FA 2QTLA 3OLCX 4PQFA 2CNKA 4Q9DA 3ASVA 2EX0A 1S2DA 3KPUA 3TOVA 5HMMA 1UZAA 2GBCA 4GG1A 5LUBA 3GMTA 4DJ5X 2PRSA 1L8OA 1SXIA 4N18A 4YONB 3TTWA 2FR1A 2WTNA 3OBBA 1RWQA 1M1NB 1HFKA 1WBJB 1C2TA 1MB2A 2OG2A 2QUHA 4QG7A 3UOGA 4BE9A 3BWCA 4FQ5A 1H1LA 4ZO9A 3QFSA 5K3FA 3K0KA 4BUZA 5HQ3B 4Y6SA 4AZ3A 1WQ1R 3C6YA 3JD3A 3QBVA 5AQEA 5IKOA 2IHJA 2YRXA 1TYBE 2VWQA 3LHSA 1LDYA 2ZB4A 4XJTA 1F2TB 1PR9A 2OLKA 3E22A 2J9ZB 1DCMA 1JAZA 1VXRA 1VPTA 3CUSA 5TPZA 5JZOA 1EESA 1U9ZA 4GL4A 2ILTA 1EP9A 5KVCA 1KMQA 1Y6JA 1LDNA 4BFSA 5DWQA 2WHPB 2D4HA 3JYNA 3HFRA 4B3TB 1EXMA 3HADA 3DBLB 5FTWA 1XHFA 3G2IA 3JRXA 1I3MA 1RJ9A 1TM5E 2RARA 2UYYA 3BCHA 3B2NA 4P34A 5TQVA 4AP9A 4BGEA 2F43A 4LG1A 4UBIA 3VAAA 1NW6A 1UDBA 3MTBA 2HF8A 3LBFA 4YI3A 1OILA 1URPA 2JHFA 3P94A 1NI3A 4GR9A 1W75A 3DO5A 5KSYA 5EQDA 2CLIB 3OQVA 5CLLA 2ZSEA 2G7ZA 4O4HA 4PYQA 1CE8B 4XX1A 5ALLA 1LX6A 2WLTA 3VJLA 1OZFA 1Q14A 1NATA 2AQKA 2RAFA 2OAQ1 3DXZA 4BC1A 2JIMA 1YTUA 5HJ2A 5TB5A 4AY3A 4RENA 3ESRA 2G08A 1Q0PA 2F3QA 1BS2A 1GSOA 3B6EA 3HEBA 5EZYB 1ZIXA 5TJ9A 1GUDA 3GI1A 5GV7A 4B31A 2CN1A 4YGYA 4R0MA 2ZZNA 1ISMA 2YL2A 1C9JA 1SQ6A 3DQQA 3SFZA 2M9MA 3Q8MA 9MHTA 4DBLE 3GLTA 3QI2A 5F4ZA 2JLCA 2NZ8A 2OZKA 1CEQA 1SZCA 1G5PA 1HG1A 1U0NA 2AXPA 4N12A 3TBHA 4B83A 2Q3BA 1ISPA 4TN1A 2ZAIA 2NZVG 3AY0A 3EVFA 4ND2A 2ZPAA 1O94A 3QEOA 5LBIA 4BX2A 4E3WA 5CBPB 3RAPR 3AHFA 2XODA 2WF8A 1NBWB 2BC9A 3AW8A 1KIAA 4H59A 1U8YA 2F55A 4YUAA 1K08A 2X4LA 4J4BA 2ONJA 2BFBB 4LF4B 4I6EA 1P44A 2V96A 3OZAA 5H3CA 5B36A 5JHHB 1KE2A 2PRJA 5H4GA 1F3LA 3GXOA 3ICPA 4ETNA 1XCOA 4TUYA 2BKEA 3JTMA 1Q0UA 4JU9A 4EDHA 4YLGA 1BVYF 4GSLA 3HBJA 3VPDA 4FI3C 5DYNA 1ZHOA 2Z6QA 1NX9A 2N3ZA 2CXXA 2HQRA 4K46A 4OHOA 4RCZA 2VDPB 4KUHA 5KC9A 2XTJA 4L74A 3JR7A 2JRCA 4M1YA 2RI0A 3UW1A 4G0ZA 3GLFA 1F8XA 2IXBA 4G4JA 3RRZA 1W4LA 2Y3IA 2BFMA 4CETA 3TRKA 3W6NA 1F3OA 2PXHA 1OHHD 1DJNA 1WY5A 2EDAA 2YZ2A 5I9MA 5C1PA 2QZJA 4CQLA 1NKTA 3ZWKA 5FDFA 1E77A 4HATA 2WB2A 2RG7A 5IASA 3RUAA 3FMFA 2JD1A 1FXWF 5EPOA 3RVJA 4NOLA 4RY8A 4Z1MD 4BN4A 2HDHA 5EXPA 3UAGA 5ALRA 1A5AB 1JQBA 3D7MA 3OSZA 4IXNA 4M8SA 4GP9A 1YUBA 4EARA 1A9XB 2YFYA 4Q7KA 3HI6A 1XVTA 1OGYA 5JC1A 3AEXA 4KO1S 3COJA 3M1LA 3KL2A 4QULA 4WKOA 4OUKX 2I2FA 2IPMA 3PNVA 5DHRA 2G3YA 2IPXA 2IZ5A 3C6XA 1U2RA 4BVLA 3C5CA 1K7XB 4D9NA 4EG4A 2X0JA 4WCFB 3P0EA 3RRXA 1NX6A 5BQXA 1IN6A 3CX4A 2IA5A 2BMFA 3B1WA 3L6BA 2QR2A 4C14A 1AGNA 2IP2A 5K99A 1XOIA 1NUSA 2WEKA 2QLFA 2YV2A 2ZYGA 5LQUA 4CIXA 4BGUA 2R1ZA 3VR5D 4B6QA 2ZB3A 1LF0A 5JCPA 2FDXA 2QTAA 1QNFA 1KMCA 3HUEA 1WW8A 1X8JA 2FJUA 2I71A 4G1VA 4LJAA 4MB0A 4XGIA 4C0XA 4DW8A 5EJ5A 4NHOA 4Z4QA 3F6BX 4EMBA 1I32A 3LVRE 2C77A 1GZ4A 5DNUA 4AMZA 2NPFA 4DRXA 2PQ0A 1HETA 1WXHA 5EJAA 1NN5A 1LK7A 3R5TA 3COWA 3HB9A 1QKJA 4KIGA 3MQ4A 1BXRA 5CNMA 5EYPB 3G5MA 4D2IA 1W47A 4HVCA 5I51A 4QIHA 3RGWS 1DHRA 4G0NA 4RNDB 4UDXX 5HFNA 1KOFA 2DPXA 2OAEA 1QZ3A 3BXHA 3FB1A 1K5HA 4LHYA 3GP8A 3FVTA 2JJMA 1H5QA 1X7XB 1GVNB 2QTBA 3FYDA 3GLSA 4HC4A 1OY1A 1PYDA 5JRZA 4C6RA 3F6RA 2F8SA 2DXIA 5DTEA 2ZJ5A 1VJ0A 4N54A 4J16C 3E53A 2WJZB 3IMFA 3KQTA 4CR7A 4ZHSA 2GH1A 5CX1B 4ALJA 2ZSDA 3UQZA 5TMPA 1RAIA 4TT8A 4QU5A 1PI3A 1OJLA 3NOXA 1I6WA 1PYGA 4MQMA 2PUCA 5FHRA 5G41A 3VPSA 4B4UA 4MZDA 1HDCA 1JWAB 1PF7E 1FS5A 1IC6A 2J3HA 1JQKA 4NCXA 1VB3A 4DLYA 5CHEA 1DBVO 1PT8A 4DARA 4ER6A 3AJAA 3NV7A 2GZAA 3DE7X 1XEXB 3IT3A 1CUDA 1RE1A 2XAAA 3LYAA 4U2KA 3L4JA 1KMMA 2IH2A 4YCDA 3H2KA 4U3JB 2CLOB 4BCDA 5JDIC 1YDMA 1T15A 2CNBA 3K0FA 3K0AB 3BFPA 3ZU5A 2R00A 4YACA 3OOWA 1G19A 1JQ3A 5ETJA 3LK7A 1KJNA 4DSAA 1X80A 3V4PB 2BR3A 1NGSA 3TM5A 1FXSA 3PXXA 4AK9A 5KQGA 4Z8YA 2ZM6B 2I7CA 2G0AA 3CSDA 4H08A 3DDNA 1L7PA 1NN0A 3EVDA 4OYLA 3LLUA 3DMTA 1RCFA 3AFHA 4QO7A 4HQKA 4FB4A 4QNRA 1TTHA 3CBGA 1XDBA 1GUAA 3SMVA 3LWDA 4YV1A 3GAZA 3GK3A 4YS6A 3S55A 2PXAA 3BZWA 1AQLA 4HQNA 4M1KA 4E94A 5IN4A 3I3OA 3WL6A 5BV7A 2C1EA 1N7GA 4L08A 1T26A 2WU1A 2WOJA 1FLVA 5C53B 2BFDB 1Q5PA 3AF4A 4KXLA 4ZWNA 1VC2A 2WSSA 1D2RA 1BFUA 1E4YA 3I9JA 4LYEA 3U09A 4DB4A 3H04A 2P2GA 1BU8A 5FO0A 3QYPA 1RAGA 4II2A 1O6CA 3WZ2A 2Y1EA 4XEUA 4QJ3A 1MGOA 1PGOA 1RLMA 3MT8A 3OCCA 4R6XA 5THKA 3MPOA 4DIBA 3U9TA 4BBJA 2ZVQX 1OXTA 4KGVA 5DCLA 5KWJA 3O2JA 4M7WA 3NJRA 4B17A 5K4GA 2W9XA 5JY1A 1IIRA 1QS0A 3HB7A 4W99A 5GIPE 1H4TA 2X5NA 5DTMA 1U8TA 2EP8A 4MKZA 3TZHA 5L4LA 4PSDA 1C1XA 5EKXA 3GT7A 3HCRA 4GPD1 3T9CA 4M1OA 4PFQA 1BG6A 3BPSA 1HQKA 4FBMA 4FYMA 4BB0A 2QEQA 2XH8A 4DMLA 2J9GA 3KHKA 4DYDA 1B41A 1ENPA 4X6YA 2ZQZA 1F48A 3HFSA 1NXQA 5EIAA 3VR2A 1JBEA 3OFNA 4OHKA 1J0CA 1YKFA 1ZNZA 3GEEA 1SU8A 3K30A 3LD9A 4NZPA 3R7DA 1K6XA 4UHEA 4BKPA 4ZI7A 3WNDA 3ITEA 3EQ2A 1I2CA 1CUHA 2MINB 2R2GA 2GN0A 3DJYA 1FYVA 4Q7MB 2PJRA 2NQ8A 3TI9A 2ZXFA 2XVZA 3THOA 3DOOA 3ZWCA 5KHLB 2VYND 3DNMA 3SX0A 4P86A 1IHDA 4NCKA 4V02A 3OC0A 4WNIA 2A7XA 1GFZA 4AIRA 1GRNA 2AW5A 1UPUA 3R7AA 5FQNA 1ZNQO 1JQ5A 3PPVA 4A82A 1M6WA 3RPEA 5JADA 4FD3A 2ID9A 4RA6B 5J9FA 2DECA 1ZCBA 3L77A 2CHFA 2OECA 2ODQA 3BFVA 3PCTA 2Q6LA 3NCHA 4KV9A 5ITZA 4GP7A 3CF4G 4TOIA 5KHOC 1TT5B 1FUYB 4WLVA 1CUAA 3D8NA 4YP1A 1GLGA 3IERA 2KM1A 1MR3F 4IIJB 2AOUA 4R2LA 2PSJA 1B6RA 1MC4A 1PKEA 4ZVQA 5DNAA 4QUKA 3TIFA 2UYHA 3GA5A 5IJ9B 2QRLA 2QSJA 3BMOA 5GJVC 2QW0X 2OXCA 3F46A 1P2BA 3KDPA 3X1KA 1M7BA 1W87A 4JOSA 3DBVO 1CNFA 5EI5A 3U3OA 4C4OA 4EO9A 3L8DA 4TMXA 4NL4H 5DBOA 3BB3A 1HEIA 2OEPA 3G59A 2P9BA 5JATA 3R0XA 2IYRA 2WVHA 3FR8A 3WRXC 2HJSA 2XQIA 3SZGA 4MRRA 2ETXA 3TRJA 3VKUA 3EPJA 4JJKA 4TLMB 1IHXA 1FMLA 3LQKA 5JECA 4J0GA 3KXDA 2EJCA 5CIQA 1L1QA 4AZ0B 4WOPA 4BYGA 1SHJA 4YMTA 5JMTA 5A4JA 3VO1A 2Q5IA 5JEEA 2J9YB 3GL9A 1C7EA 4WXRA 1XCPA 3FJOA 3IPRA 1Y3DE 1C0PA 2O0KA 4WNCA 3UMSA 5BSFA 3NIBA 1BOOA 3T1YB 2DFPA 1Q1GA 3HR4A 1IXYA 2JIOA 2NT4A 4QQFA 2DR2A 3VR1A 5IDXA 2OBYA 4AVYA 4RJTA 1HLPA 2H8KA 2ID8A 3GWZA 2G63A 1USUA 1QORA