1YIDA

Crystal structure of tryptophanyl trna synthetase ii from deinococcus radiodurans in complex with atp.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
331
structure length
331
Chain Sequence
ARPRVLTGDRPTGALHLGHLAGSLQNRVRLQDEAELFVLLADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGERVPAGFFVYPVSQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALYAPVLAEPQAQLSRVPRLPGLDGQAKMSKSLGNAIALGDSADEVARKVMGMYTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRLFGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tryptophanyl-tRNA synthetase
publication title Structures of tryptophanyl-tRNA synthetase II from Deinococcus radiodurans bound to ATP and tryptophan. Insight into subunit cooperativity and domain motions linked to catalysis
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
total genus 106
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1yidA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1yidA01
3H05A 1OBHA 4I6EA 4ARCA 5AHWA 3TQOA 4MW6A 3PNVA 4PBSA 2PG3A 3IUBA 1FYDA 3RBAA 3Q10A 2WQ6A 1J1UA 4UZFA 3ZJTA 4NX2A 1V8FA 1U3DA 1EFPB 1WXHA 2OQ2A 1GN8A 2HMAA 2EL7A 4NAHA 3COWA 3ZJUA 4MW0A 1IQRA 1J1ZA 4P2BA 1IVSA 2DUMA 1YUNA 2CV1A 1I6LA 3ZGZA 2CFOA 1XNGA 1N77A 4OUDB 1QJCA 1VBNA 1KKUA 4MUGA 4R2LA 3H9BA 3L92A 3I05A 4XFDA 4QREA 3SZ3A 1MB2A 2J09A 3AKZA 4U8HA 2YY5A 2ZP1A 1MRZA 3INNA 1T6YA 1LI7A 4UZEA 3IVGA 1Q15A 1SURA 3CA8A 5LFAA 3ZXSA 2J5BA 4MW1A 2PIDA 2DEUA 1O96B 3IMCA 1M8PA 1YULA 1GAXA 1OWLA 4HPWA 3KFLA 1K92A 3DPIA 3RK0A 2CUZA 5FNZA 1IFXA 2AG6A 2CYAA 1KP2A 2PFSA 4JXZA 3P0HA 3VGJA 1NUUA 1PG2A 5KHAA 3MLBA 5K0SA 5K0TA 5IHXA 1XNJA 3Q4GA 3HMQA 1U7XA 3HL4A 3VU8A 1TYBE 1KAMA 4I6GA 1MOPA 2NSYA 3DV2A 3F3MA 1ILEA 4AS1A 5J59A 1MBZA 1N75A 3DLAA 3N9IA 1T6ZA 1K4MA 4MVCA 3KT8A 2HGZA 1QU3A 1ZUNA 5KWVA 2A1TS 2O5RA 3C8ZA 1U3CA 1WOYA 1P7PA 4K0RA 1WQ3A 1NSYA 3PXUA 3IMGA 3FNRA 4JZYA 4MLPA 4DDMA 2PZBA 3M5WA 4ZT4A 2AKEA 1TFUA 4DNXA 2O8VA 1IQ0A 3IOEA 1WQ4A 4YBRA 1M8KA 4L2IA 1GTRA 3FIUA 3G5AA 2A1UB 3A2KA 1G8FA 4OJMX 3UMVA 2CV2A 4MVXA 1OWNA 3CLUC 3CVXA 3QE4A 4KR9A 1N2IA 1WXGA 2QUIA 2HZ7A 1XNHA 1WXFA 4WNYA 1N2OA 2QUJA 1H3NA 4ARIA 3LCJA 2YXNA 1N1DA 2JAXA 1TYDE 2CT8A 5J58A 4DLPA 3K32A 5KCMA 3TZEA 2DERA 2R5WA 3PNBA 1TYAE 1M1ZA 1XJQA 3GUZA 4JYZA 2CV0A 3FOCA 2J08A 4XSVA 4AQ7A 2QTNA 3HGMA 1NYLA 3FI0A 2VTBB 1JIJA 1N2HA 1H3EA 1MAUA 1KAQA 4NDAA 3X1MA 4PY2A 1LW7A 3QTBA 2YWCA 4EGAA 3OTWA 4YP5A 1MB9A 3FWKA 2A84A 2X0KA 4S1OA 1KR2A 2CSXA 2Z09A 3Q12A 3SEQA 5F23A 1BS2A 1EJ2A 1YI8A 1X6VA 2GM3A 5TGTA 4MUEA 4PBTA 4HJXA 3CLRD 2H2AA 3CLSD 2NZ2A 1QRTA 2GOYA 1KQNA 1V47A 3GMIA 2BYTA 4BWVA 5JBNA 2QTRA 1H3FA 2Z3VA 1M83A 2OV4A 4EF6A 1JZQA 4MQ6A 1KH1A 2XRZA 4KR7A 1OWPA 4R0NA 2A7XA 1N78A 3HV0A 4ZCQA 4MUNA 1QU2A 3MXTA 2QJTA 3AIIA 2I1LA 3IVXA 4MW9A 5LLTA 1CT9A 2CYCA 1QTQA 1YIAA 3VRHA 3QTTA 3X1KA 5EKDA 2WSIA 1GTSA 1YUMA 3AFHA 3X1JA 3KT0A 3H97A 3D6VA 4ZCPA 3FETA 4MULA 1N2EA 1PFVA 2JANA 1WY5A 2WB2A 3CR8A 3CLRC 3CLSC 5TS2A 2A86A 1JHDA 1G8HA 1OD6A 3COYA 1IHOA 4RPIA 1F4LA 2QUKA 1O95D 1KP3A 2V0CA 1LI5A 2E18A 1UFVA 1A8HA 1WZ2A 2IJGX 3FHJA 1N2JA 1N2BA 4YP7A 5DB4A 1U7DA 2DR2A 4G6ZA 1X8XA 3DO8A 1EUQA 3MUEA 2WQ7A 5IJXA 4EG3A 3N2YA 2IP1A 3ZJVA 4DDHA 4ND7A 3IUEA 3G6KA 1Y42X 1K4KA 3KT6A 1KH2A 3TQIA 3AG6A 1GZUA 4Q16A 3PRHA 1R6XA 2RE8A 3E27A 1R6UA 2G36A 1EE1A 4ZCRA 2D13A 3RK1A 3FH0A 1ZJWA 4F4HA 1KH3A 2DLCX 4QBTA 1T9GS 3SYTA 4KR6A 2RD2A 1MC1A 3ELBA 3N8HA 3ZIUA 5TEWA 1WXEA 1EFPA 1EFVA 1Q77A 4A91A 1R6TA 4QRDA 3H9CA 3NV7A 1ULHA 1ZH6A 2AZXA 3RFFA 1O95C 3JXEA 1NUSA 4GRIA 2A1TR 4MW2A 3UY4A 2QJFA 3UK2A 2D5BA 3A04A 3CVWA 4J75A 2J07A 3L93A 3CLTD 4OUDA 3CVVA 4MW4A 3PNYA 3ZUGA 1OBCA 1KQOA 2IELA 2EJCA 1KORA 3K9WA 3FG9A 2C5SA 1G59A 3MLAA 3HFJA 5HUHA 1D2RA 3ILVA 3P52A 4U63A 1NZJA 3SEZA 1M8FA 4KPUA 4MVWA 1PFUA 1S4MA 2GKSA 2E0IA 4U7JA 2A88A 3MMXA 1VLHA 2A4MA 3D6UA 5FO1A 1O96A 3A4IA 4ZT7A 1VBKA 3G59A 1JIIA 1HYBA 1PFYA 4ZCTA 4DDKA 1IQUA 2PXHA 1T6XA 5DK4A 1JEEA 5DASA 1FFYA 2H29A 1I2DA 4EFKA 4MW7A 3CLTC 2CYBA 4DE5A 3AL0C 4EG7A 3S3TA 3IOCA 5H16A 1O97D 5BNZA 1N2GA 4L2IB 2DETA 1OWMA 4MVYA 3P0IA 4J76A 4NZPA 1O5TA 3TS1A 1EFVB 1O6BA 1G8GA 3TNJA 2E89A 1COZA 4MUKA 3RHSA 4EG6A 3ND7A 1NI5A 3IMEA 1JEDA 4FZJA 3A05A 1TYCA 1JMVA 4EG4A 1NUTA 3ND5A 1WKBA 4MUHA 1ZH0A 4ZT6A 1EXDA 1TQ8A 1PG0A 3LOQA 1YIDA 1M8GA 2TS1A 4YP6A 1IH8A 2QJOA 2QTMA 4MAFA 2J4DA 1JIKA 2A1UA 1J20A 1Q19A 3SDBA 3IOBA 1F9AA 3BL5A 1O97C 5HUJA 4KPUB 4MWBA 2BTEA 3KT3A 4NAUA 4GU5A 3ZXIA 4YMIA 1QNFA 1RQGA 5LM3A 1IRXA 1TEZA 1F7VA 4MUFA 2E21A 2D54A 3CVUA 1QRSA 3IODA 5FO0A 3N05A 2ZUFA 1H1TA 1VBMA 4I6JA 2QUHA 4KKVA 1JZSA 2V0GA 5H7XA 1NUPA 3IDFA 1QRUA 4EG5A 4MWDA 3HZRA 4XFJA 4HJRA 3IVCA 1WXIA 4NATA 4F3RA 4CT0A 2B7LA 2DXIA 1J70A 1M8JA 4DJAA 4WSOA 3NBKA 5DEOA 4Q93A 1OWOA 3CLUD 4ND6A 3COVA 2X1LA 3P0JA 4TS1A 2VTBA 1GLNA 4JXXA 3COZA 1NUQA 4ZT3A 4CDNA 1N3LA 5J5AA 4RUKA 1I6KA 3SP1A 4MUIA 1U0BB 1O94D 3CVYA 3U1VA 1B6TA 4ZT2A 1K97A 3LE8A 1J21A 1J09A 4EG1A 4CQNA 3ND6A 4K03A 3UC5A 4H3SA 3GLVA 1NP7A 4MWCA 1PFWA 1MJHA 2YWBA 1GPMA 4G5FA 1JECA 1QQTA 4R2MA 2VXOA 4PBRA 1Q11A 1F7UA 3IH5A 4ZT5A 4MUJA 1O0BA 3UOWA 1I6MA 1T9GR 3AG5A 3NBAA 1NURA 3OP1A 4JFAA 4HK4A 3SZGA 1KQPA 3ISJA 3FY4A 1MAWA 2JA2A 4X0EA 4CDMA 4MW5A 5TEVA 3FDXA 1O94C 1EUYA 4ZCSA 2X1MA 4G5YA 1WJGA 1O0CA 2PZAA 1JGTA 1VL2A 2DPLA 3H99A 4MWEA 3RJZA 5HG0A 2X3FA 1JILA 2PZ8A 2XRYA 4EG8A 3TZLA 4E1AA 1DNPA 2ZUEA 2Z08A
chains in the Genus database with same CATH superfamily
1MRSA 2GYWA 1Y0BA 1JHYA 5DM1A 2RARA 2WG2A 4JA0A 1ZEMA 4GR9A 5AHWA 3PPIA 3K96A 2V5VA 5FHRA 4CUKA 2R8PA 4D82A 2BFFA 1KTVA 2IXBA 1QPGA 3Q98A 4JKYA 3EW7A 1C7FA 2V7QD 3TK1A 2ZLBA 4NICA 4A10A 3OOJA 1YDMA 1YB5A 5AH0A 3DZBA 1A82A 5TIIA 3Q6NA 2CVPA 1GPLA 4MLZA 5KNDD 5KTOA 3BDVA 4IS2A 3TZHA 1IVSA 3QV1A 1NLMA 1XG5A 1XMVA 3O1IC 2YN2A 4HGNA 1C3LA 3ESCA 4BLSA 3L4BC 3MJTA 4PLWA 4IW3B 3HA5A 2C1ZA 4LJ6A 1TMKA 3OA2A 1VGVA 1GFIA 2CMDA 1AUVA 3TXXA 3QPCA 3X2FA 3I6ZA 1IU9A 3KPYA 4O4JF 3SIRA 3R0QA 5IJAA 5CEJA 2I55A 5L9AA 3SF8A 4B2IA 2W42A 4JD5A 4G07A 2K5UA 1W47A 3C2QA 2B0JA 1MO6A 2ZTHA 2ZP1A 2W2PA 3EB9A 1UAGA 5JADA 2E4AA 3MCZA 4DNOA 1JN0A 3SKVA 2D0DA 1U90A 2XD4A 4ON9A 1DWPA 1NMZA 4MV4A 1NMXA 4XGIA 4FCVA 4GKVA 4HG2A 4KRGA 3E05A 3OX3A 2IEDA 2G3YA 2GARA 1J0BA 4A0HA 1XZPA 1WZUA 2VF8A 5EIFA 5DHPA 2PYIA 1DX9A 1Z28A 2X8LA 1Z62A 5A04A 5LQMA 4XWWA 3ELDA 1TT7A 2ZIWB 2B21A 1O9BA 2HD4A 4Q4HB 4MGIR 4BIIA 3E5NA 4PX3A 4WGGA 1BW9A 2MINB 2VHZA 1IZ8A 3HN2A 5ECYA 4C3VA 4ZTUB 3VGJA 3OJFA 1Q1EA 3AVPA 3Q15C 2P6PA 3GGSA 1LDMA 2EKQA 2XUPA 2IY9A 4GWLA 3HL4A 4LOHA 1CF9A 2HEIA 1S9DA 1Q5PA 1GQRA 1ZKMA 2BGTA 2FMIA 3MMNA 2HPAA 5KZMB 2NSYA 1B6RA 1RBZA 2DPGA 2WBLC 4IGIA 1OXUA 3KSMA 2JZCA 4TM7A 2ZS9A 1SUIA 3LWZA 3UC9A 1N8TA 3W1VA 1N5JA 4KWHA 4R81A 5DPMA 2JASA 1RIIA 2HKIA 5CNJA 2A1TS 2VKTA 2O5RA 3OIYA 4YAJA 3EIHA 1DBSA 3HS3A 5E1BA 2Q62A 3MTGA 1Q7GA 2XD9A 3BRWD 4NHEA 1P7PA 3CCBA 4HT3B 2R7LA 3WGLA 2C5GA 4MYTA 1F20A 2GZSA 1PT5A 3N2ZB 3I09A 3RKRA 1SCQA 4EAAA 2IEYA 2JGFA 3P9ZA 4ZGBA 2BFCA 4C9BA 4UU1A 4L2IA 2JIQA 3ZX5A 2EHDA 1JKJB 2ZBVA 2HDNB 1E2GA 3OICA 4LBVA 2A1UB 1QRUA 1QOQB 3OESA 3CV3A 4ZYUA 1O94A 4IVNA 4DA4A 3R75A 3FMOB 1AUXA 2X8JA 3UMVA 4L4RA 2E82A 2OWDA 2P9FA 1Z18A 2R7KA 5C1BA 2GEVA 1PQWA 2GAJA 2ZJOA 4TMYA 1B1AA 3D5TA 1L5NA 1FU8A 1XYVA 5C7YA 3ZZMA 2QUIA 1DIOB 2BGWA 2D59A 2BONA 4XVQA 4LGMA 3Q8MA 1N8NA 3H8JA 3T3MB 1W1UA 4M87A 1UBOS 5CLIA 2QEQA 1N2OA 4IIXA 3WK6A 4IKPA 4KUHA 3VDRA 3K1JA 4B79A 5BOSA 5TF4A 2WT4A 3HCPA 3K94A 2QRGA 3EISA 2CT8A 2OFPA 2XADA 1SFRA 2VPYA 3A28A 3X2SA 4KQ1A 4AD8A 5ADVA 2JGAA 3LX5A 1KJ8A 1E32A 1NDHA 2D62A 2X0FA 4O2AA 2WJHA 5ALXA 3K05A 2IZ0A 2W2OA 3WYAA 1V8DA 3FCOA 3D0RA 3T41A 4CLDA 3MGBA 5FOTA 4W9MC 4BEBA 3PPWA 1ZOSA 3YASA 5KMGB 4OF4A 2FZGA 5L3ZA 2A0YA 2YIVX 4JEIA 2VTBB 4ZOCA 1WUHS 4KXMA 4ROSA 1QO0A 1U7PA 1E60A 2JGKA 3FVVA 4K87A 5AXCA 1LCIA 3X1MA 1UDWA 1GPAA 4ITRC 4XARA 5F52A 3TAUA 3GN2A 3FNGA 3V2GA 5LNK1 1U2PA 4YP5A 4V0ME 1L6RA 4ASUA 5DWQA 1WG8A 2FEMA 3GDFA 4GL2A 1I0IA 1MH9A 3KSUA 3NYQA 8OHMA 2YQ5A 2VXCA 4WERA 3U4AA 2OBXA 1MIHA 1YJCA 4GLJA 2FHSA 4M1OA 1GO2A 1MORA 2H2AA 3ANYB 2FI1A 3M6FA 2I62A 1P2DA 3SD7A 3SYMA 1L8LA 3V6MA 3TZBA 3L7JA 2OYCA 2FJUA 4BGEA 4MTCA 2G1KA 4LJLA 2X3YA 3DVRX 4F4JA 4JSYA 3H5IA 3DTVA 1QRAA 3ZZ0A 3P1JA 4Z4QA 4R2WA 1AB5A 3MERA 4AZVA 3GXOA 2WWIA 3B8HA 2Z3VA 5AUQA 5KPJA 1FIUA 4LJ5A 2P6RA 1J1IA 1DKLA 2C5LA 2HK7A 2V6GA 2VA9A 3Q3EA 4HH1A 5I9SA 4E30A 2QT0A 5JVDF 3GH1A 3G2KA 1U31A 5I01A 4S1NA 4GI1A 1H0HA 1FNCA 3DUFB 3R7WA 4OQZA 5I7VA 2P4QA 3Q40A 1W44A 1T2FA 2AKAB 3EIEA 3QBVA 4M7PA 2OB2A 3NHPA 4GLOA 4XFKA 5K3AA 4KQFA 4OG2A 1NVKA 2CVFA 3L8MA 3TBHA 3O21A 2OUIA 2QMYA 4BWGA 3PA8A 3H97A 1N9GA 4QGBA 3BZWA 4E88A 4MMYB 3CURA 2UU9B 2C1XA 3W7VA 4CDRA 2L0XA 1YO6A 2AG5A 3BL6A 1OFUX 3U7HB 4DV6B 2GSWA 2XRFA 5TV2A 1YNOA 3NHRA 1ZHOA 5GQSA 1VZ3A 5KQPA 2UAGA 1WMEA 3S2FA 4NCXA 4I8DA 3ZDDA 1CQJA 3ZLTA 2W2VA 4EHFA 3AEYA 1O95D 2AX3A 4UDNA 5KJEA 3U09A 1L7RA 3LKBA 3E1GA 3HYTA 5C4IA 1GYQA 4J0CA 1N2JA 1N2BA 2I6UA 3GUHA 1U7DA 1JHMA 2XWPA 2ZSIA 1GUAA 2XCTB 1X8XA 5D3QA 1RXSA 1NR1A 4DREA 5CG1A 5JROA 1DJOA 3GR6A 3ANLA 3CIFA 1PL6A 3O7MA 1JRLA 3PSAA 4O4JB 4UM7A 3VPBA 3SSMA 2ZYGA 5E8JA 2XTNA 2GUWA 5LLDA 5JJLA 3V1LA 3C8DA 4F9TA 2XCOA 3EUEA 3PTZA 3JQFC 1C29B 3H2JA 3AKDA 2ZSBA 1GZUA 3VXKA 4G4GA 5G53C 3TDNA 5ADHA 3KK0A 1C9NA 1RRKA 4IVRA 2D13A 1AXEA 3FH0A 3JWIA 1NAIA 2CJPA 1T9GS 1W5BA 5DIZA 3AVOA 1Y3FE 2ZITA 1MW8X 1W96A 2Y1FA 1H6CA 1WTAA 2MYNA 1AGRA 1EFPA 2JLQA 2FPGA 4XYBA 1EBBA 1R6TA 1GGJA 1O0SA 1GZVA 4QRDA 4ZIRB 1JI0A 5MGNA 3L02A 1GUYA 4D0GA 2CFIA 3W8RA 2JIOA 3EARA 4O0LA 2A1TR 1IN6A 5H59A 2KMLA 2QQFA 1XWFA 4BMZA 4INAA 1DB3A 4M88A 1MUUA 5EHGA 3ZU5A 2HJVA 4C2TA 4N18A 3GLHB 2VWHA 1B8UA 4NNJA 3RJTA 2AFHB 3A4LA 2B7CA 1PJQA 4QTTB 2C2YA 3ZDZB 4K26A 1EK1A 1UM8A 4IIVA 3WV4A 1RKUA 3D4IA 4X66B 4I1RA 4DW8A 4R7ZA 1TNDA 4J0DA 2C5SA 4FXPA 5KJ6A 4RVOA 3EXHA 4DLZA 3MS4A 2ZXEA 2Q5IA 3ICEA 3ABRB 3KVRA 2I54A 4GZ6A 4BASA 1G3RA 2PZLA 4O1IA 3RFVA 1TM2A 1T9HA 1XZKA 4PYIA 4JZKA 1P4SA 1AN0A 3D6JA 4MVWA 4X6XA 4Y7CA 3CE6A 3LT0A 1IBCA 1FNNA 3VO8A 2G5GX 4QATA 3OFJA 3AJAA 3DBOB 3GJRA 4HXGA 3FCXA 1C7JA 4U2DA 4D0LB 4OQYA 1HA3A 4UVDA 5FRDA 1K7CA 4G86A 2AWNA 2WSLA 2AFHE 4ZT7A 2R25B 3RYFB 4MSUA 4CT4B 1IK4A 3KSRA 1MLDA 4OHKA 3U31A 1SELA 3O8OB 3VHQA 4G0MA 1ZA2A 3AOEA 3CH7A 4TS3A 1XMIA 3RRBA 3U60B 3HDYA 2QTVB 1XDSA 4LPKA 5IT5A 4RH0A 1LS1A 1U5BB 4BVEA 4O6VA 1ODFA 4H59A 5E6UB 4LVOA 1OB5A 1I2DA 3TGLA 1PW5A 1SC9A 4K3VA 3MAGA 3GRRA 3K20A 3AL0C 4Q3KA 3ZK8A 4HVLA 5DM70 1XF1A 1G21A 1JBEA 4DPLA 4Z2AA 2RHMA 1B00A 2X2OA 3OT5A 4BWFB 5CA0F 4HVAA 1RXYA 5BR7A 1TFRA 3GRUA 1P73A 3ZKWB 3M4XA 5CDGA 2HSDA 1GT6A 2W6ZA 2WNHA 3CRW1 5FUYA 3EXAA 1I36A 3UHJA 4CI0B 2UUCB 4K9RA 4FDAA 1P9LA 1IOWA 4JUBA 1TGYA 3LBYA 4ZXFA 4F8YA 4Y2UA 2QVYX 3IV9A 1CIJA 3VR0A 4CIWA 2WF7A 1PQYA 3L8YA 1PSWA 5AKYA 3AERB 1NX6A 4GMDA 1U9IA 4JJ4A 1T8YA 5FFMA 3E3LA 2HFKA 3BFVA 5CK4A 4UOZA 5DN6D 1R9GA 1AQJA 1BX0A 2E5WA 2D5CA 1Y1LA 5IAGA 3RWOA 1NRXA 2A5FA 3SZUA 4G0WA 2GAOA 2QD3A 4KEAA 1RM5A 4TVBA 5FEMA 2B6HA 1IC6A 1BRTA 1Y8ZA 4N47A 3DE0X 3NJ8A 1YTUA 2ECQA 3B1VA 4F7WA 2QY9A 9LDBA 2ATEA 1VPEA 4FW8A 1XVVA 4Z8XA 3SDBA 1OXKB 1TYEB 2M9MA 4WINA 4MINA 4X64B 4AJ4A 2Q41A 3NRCA 4MKFA 4KPUB 4ZEOA 4DM4A 5KTPA 3JQBC 3ZXIA 1CZUA 4GWGA 2QL6A 4JFRA 4NDNE 4TX1A 3GJ5A 4A8TA 3PFHA 2AI2A 4OXNA 3DL7A 3EUFA 2EX0A 3VOBA 1V8ZA 3FMIA 3E22B 1QRSA 1I9CA 4PX9A 4BNXA 1Y89A 4J90A 1GCIA 1W88A 4I6JA 1TAGA 1ZD2P 2P0AA 4KKVA 5GVRA 3UJNA 3BF7A 3DE7X 3COJA 2N3ZA 1NUPA 2QPAA 3DVAA 1U4SA 1NLZA 3QUBA 4GPEA 4NESA 2UZ1B 4LTNA 2GDZA 4PPYA 1CK4A 1RTTA 2CL7X 3GEDA 1L9KA 4MICA 4PSDA 2QQ0A 1QVRA 1YR8A 3KXPA 3UOAB 1Z74A 3DBLB 2OGSA 3IAM1 3MF4A 3C3DA 3WGVA 2R6DA 5DDIP 3K72B 4EI9A 2VP9A 4FFNA 5T67A 2EIXA 4BQQA 5JVDB 1IN1A 5IT9A 3HUEA 3ZW7A 4ESOA 1R0LA 4OHFA 3STHA 1C7ZA 2ECFA 4IVPA 4ROTA 1EDEA 2W0SA 3LCMA 4NLLA 2PJUA 3TLGB 4HDKB 1L4EA 1CRLA 3CB4A 2FOLA 2GA9A 5C2JB 4MA0A 2IW1A 4Q48A 2A9PA 1C8KA 3MT9A 4HXFB 4PNZA 1ZQ9A 1NG9A 3CX4A 1GZHB 1N6LA 2ONJA 4BN5A 1NUQA 1A5SB 4G4JA 4KN6A 3HYNA 1IVNA 5IUKC 2VT2A 1HDRA 2XKBA 3L01A 1JSXA 3DMTC 3PGXA 3PX2A 1BA2A 5H9VA 3M1IA 3O90A 1ZJJA 1U0BB 3JALB 2HMWA 1R9MA 3D8TA 2ZT5A 1MOSA 4Z3KA 1A4RA 1AS0A 2QT9A 3CVOA 3EFEA 5IVKA 1OV6A 4DXHA 4K03A 3U3OA 1G6OA 2NZVG 2Z0MA 4QXRA 3FF4A 1M34A 3HR7A 1XZNA 4QASA 4Z9BA 4LYAA 4D8YA 1D0VA 2VK1A 3F6YA 4IJVA 3WL4A 3HLTA 3O5AA 1OGIA 2WD8A 4MVJG 4O0MA 3T5MA 4NP6A 4AQYB 2LCQA 4ZT5A 1GGVA 4R3WA 3FNQA 4A6EA 2XXJA 3JARB 2H1FA 3NBAA 1T9GR 3WB2A 1COWA 1JALA 3SEAA 2CXPA 3GLUA 5SZKB 2Z43A 1DJPA 2QORA 2WKSA 3ZWOA 5I9NA 1QCDA 2VH5R 3RVNA 4LGYA 4B3BA 4KX5A 1JE0A 4YYEA 5M7EA 3NONA 3H19A 4WTOA 1Z5WA 1E1CA 3EIQA 3Q7RA 4J0HA 4JLUA 3KL2A 4UEWA 4IQFA 3X1XA 4QUIA 3ZVLA 2F3UA 4MRRA 1JYFA 2HLDA 1TIKA 4NBRA 5BPFA 3OCXA 4ZMBA 2H51A 2VHTA 1VRWA 1NJ1A 3PG5A 1OMOA 4J0GA 2WINI 3ZEIA 1O0CA 1OBFO 4HDQB 3A31A 4L51A 2OR3A 3BM5A 5DHTA 4EJSA 2C4WA 1UKYA 5BN4A 3V8MA 4KK4A 3GL9A 1Z38A 2ZFUA 1AS2A 5H4GA 5KOJA 3ZXXA 5J3JA 1UC9A 1Q16A 1XPRA 2CVZA 4C89A 1UF9A 3SGLA 3KQPA 2EP7A 2YHIA 4Y9TA 4OAPA 3U62A 4BAZA 2YCLA 5HFJA 1NYQA 3CR7A 2X5OA 2XDWA 1SUWA 1UPAA 3GD5A 1YDHA 2HHJA 3PXDA 5I47A 4GI3A 4UZFA 2H31A 4ARZA 3ZJTA 4MUYA 4W9NA 3D3NA 1YQUA 4ZHSA 4IJ5A 2PX5A 3SU8A 1I7QB 4NARA 3TTWA 3COWA 3OMXA 3CN7A 4CF6A 4TMWA 3DAOA 4Q00A 3EUWA 1GG5A 4GECA 4RZXA 4YRQA 3K8YA 2A9VA 3G9TA 4FR2A 1W8IA 3AEUA 3LO5A 3EQ2A 3LW7A 1NI4B 4XOIA 2WWYA 1XU9A 2CXHA 4YUWA 1CKEA 1OBVA 1AN9A 1Q3HA 1LDGA 1PZEA 1SVOA 1VG1A 4CKZA 6ADHA 4OUDB 1C9MA 4TXLA 2C2GA 3RYIA 5FLXA 1NN0A 3NZEA 4V03A 4P3NA 5H70A 1TM5E 1SCNE 1IY0A 5HQTA 1QYRA 2ZYUX 3LRPA 4YJHA 4JJAA 5TF0A 1YJBA 2OFFA 5A3RA 3SZ3A 3E81A 4CF3A 3X1WA 1W75A 1AD2A 1D6JA 2NQTA 1ZIDA 2POCA 2LCFA 3FAKA 2P35A 3UWPA 5T4HA 1IE3A 1L7MA 1MRZA 2EV9A 2Z5LA 4FJ1A 3SC2A 3VTKA 4LRUA 1I24A 1SCDA 4HH3C 5ALUA 5JH7A 1C5KA 3HJHA 3VNQA 4FSXA 3AR5A 3JYQA 3ZPXA 1QLWA 1D0IA 3KQSA 4JT9A 2GBIA 3B1WA 2ODNA 4OK5A 2DERA 1X9GA 3GAZA 1M2GA 2ZPAA 3MGKA 5CHEA 1U0LA 1OZHA 1ZH8A 3REQA 3FVRA 3V8PA 1QIMA 1XELA 2GA8A 1JV2B 4UHFA 4XDGA 3LH5A 3G0CA 3WP1B 1FMCA 4HAOA 3ZHVA 2AG0A 5E8RA 3A25A 4OI1A 1KSJA 3MPUA 2XXBA 2GNAA 3VR3A 4L6CA 5EZYF 3W8NA 4N01A 4BS9A 1D6SA 3OHPA 3SNHA 2HWYA 1EB8A 6ABPA 5A4MS 1JJAA 4AKTA 2FKNA 3GFFA 3I2JA 2OXEA 4JAVC 1GKKA 4I08A 4NYMR 3FDIA 3UTDA 4ZYLA 4WZAB 3IUYA 1KEEA 2JW5A 3KJQA 4AURA 4ETMA 3F3MA 3JU3A 4R6WA 4EL5A 4YCMA 5KIAA 3KB1A 4BX9A 3HEAA 4U0KA 4B73A 3D0OA 2YWEA 4KUEA 4BB5A 2QTHA 1QCCA 1MHTA 3FOWA 3WKDA 1XLUA 4U4AA 4Z0PA 3TG2A 2ZJBA 3AONB 3CWCA 1XCJA 3ISTA 5FTWA 4E03A 3D1LA 5AR1A 2WU3A 2BHTA 2WB4A 1CJVC 4FTWA 4JBLA 4MIYA 5JCOA 3SS8A 5FFFA 4JS0A 3P5BA 2YNMC 3HCNA 1H4TA 3KSDO 1AKWA 1HETA 3VUFA 1IRIA 4IWXA 2R3SA 2BTOA 3QU2A 4URWR 4WZAE 3A58B 4YRRA 1WMBA 3W5UA 3WIVA 2VDKB 2C8JA 4IX1A 2P6MA 1QG2A 5KQLA 4Q9JA 4M3NA 1TM3E 1YQ9A 2QRMA 4JNKA 3TIVA 4CM8A 1GIAA 2GF9A 1G17A 2JAUA 1KFBB 2X4IA 1QH0A 4IH4A 1CXZA 4EZIA 2CV2A 3K70B 2CB9A 1DXQA 1GPKA 3B2QA 4R84A 3HDTA 1G20A 4KSBA 4GM4A 3V97A 1LSSA 2HZ7A 2D2IA 2OVBA 1YCHA 5FWXA 2OAEA 1SKBA 3PNSA 1NN3A 2TMDA 2YVQA 3AWIA 4WK6A 5BMVF 1LTHR 4ARIA 4BUJA 4BP3A 1QDUA 3LCJA 1N1DA 4GFDA 4H4DA 5K0JA 3IBFA 2ZIUB 2H4ZA 3ORFA 1YA6A 2H9AA 5ARCA 1FFDA 3P9CA 2PTHA 4J91A 5JRZA 1SQ0A 1B3RA 3KLNA 4BRSA 5T7BA 4U7DA 3KS9A 2CKDA 1R74A 3H0KA 4IDPA 4LWZA 5AHOA 2Q9UA 3T3HA 3WRVA 4TMZA 1U8UA 3PB3A 4KI7A 5DV9A 4BNWA 2AWOA 3ABIA 1N3IA 1QG0A 4AQ7A 3ZDBA 2J8ZA 3C7AA 5AVKA 1EP3B 4HFJA 5K9ZA 4ZDJA 5HK8A 1F48A 2EEZA 2JI7A 1CZNA 2E7ZA 4JUAA 5H3HA 1OB2A 2GN9A 5J23A 3Q11A 4DSOA 1KZ9A 1BO6A 1N2HA 3W5BA 1DE0A 1JSCA 1ZRMA 4C06A 2AQ8A 4ZVPA 3NKVA 3JRNA 1R4NA 3QTBA 4LSMA 3A9UA 3TOSA 1YK1A 4HB4A 3C1TA 3Q5GA 2BHLA 3R3JA 2H5LA 3AYZB 4DEVA 1CDEA 1XTBA 5FOSA 1AHHA 2HO4A 4FK8A 4QXMA 2OK8A 1GRNA 1M6HA 2HA7A 1BS2A 1RJFA 4NBWA 4FBLA 2V1UA 2O0KA 3G0BA 1QX4A 4ZN6A 4TTRA 5ESDA 4QPDA 3SYNA 2WUFA 2OILA 3QVKA 2G4VA 3U4GA 3GMDA 3CLSD 3LKDA 3IR6A 5EJEA 4C5CA 5IM5A 2B20A 4FHZA 4RY8A 1GSHA 3UMGA 1V3VA 4D3SA 1PJ3A 4H7FA 1K8ZB 2ZBFA 4LXTA 4EL0A 4DANA 4WUTA 2GGSA 2W2KB 1JAIA 3TYXA 1UBEA 3DEZA 1M83A 3DQZA 4GR5A 3GRFA 5D7BA 5KYXA 3QKTA 1V96A 2XQVA 4IIYA 1BDHA 2WWFA 2AOUA 1NX9A 3K6KA 4NBTA 4PRLA 4DUYB 3AIIA 2ISQA 3FJYA 3L7BA 2AXQA 1JHXA 1GL9B 3TLZA 3IHLA 3TG8A 4IOJA 1RM3A 5D5HA 1M2VB 2YJ6A 3R3WA 4B3GA 5CVUA 4ENRA 2JC3A 1POWA 5C5CA 2GYVA 3WRXA 3ZCSA 1KA9H 3T3EA 3LT1A 3TL6A 4RSHA 1TC2A 3U44A 1VGRA 3H8SA 7MDHA 4KPEC 1P4RA 2YJNA 1PFVA 3F7OA 3T5DA 1ID8A 3HI4A 3PUHA 2G5PA 1U9JA 1I0LA 3PC6A 1C0LA 4PYQA 1Y1SA 4RFSB 5M34A 1J5EB 2GHTA 5TS2A 2CZGA 1Q1QA 2AMLA 4UREA 2FETA 4J6EA 4K9DA 2P1ZA 3ZCUA 2QAGB 4PANA 3I6MA 1SKAA 2DFPA 1I7NA 3NTXA 2QUKA 1L8OA 4MX8A 2PSEA 1KP3A 4G5QA 3TKLA 621PA 4NS4A 5JNVA 5K03A 4XPIA 1H9CA 1GITA 3CGGA 1W85A 1CUDA 2E4WA 3H1EA 2IJGX 2R96A 2VPWA 3VNSA 2D5AA 4M0KA 4CV3A 5C81A 3EC2A 3PHGA 3H2GA 3GP3A 4PYMA 4KWTA 1CZOA 4YQZA 3UWSA 1XTIA 3Q6IA 1ULAA 4LJ9A 2I80A 2V9PA 1B8OA 3PXGA 4DRXB 1M5RA 3ZE6A 3IERA 1XA4A 4M6WB 4NAVA 4BECA 4LXQA 4F2HA 3ROEA 3WE7A 2O2DA 2O5CA 4TKUB 4BKMA 1AH2A 1Z8NA 3ZZ1A 3KJZA 1HC7A 4R9UC 7REQB 5EY5B 2IV7A 4AXXA 3OC6A 4WKPA 3EZNA 1SULA 3P2EA 3PVZA 1LKZA 4OLAA 1XWWA 1IZ7A 2FG6C 2QZSA 5JALA 1OAAA 2WVAA 2FZLA 4TKZA 1E3JA 3VOSA 5CFOA 5LVAA 3SYTA 4OJTA 4B6SA 1PAUA 3INYA 3ND8A 4YA6A 1OW3B 4NI5A 2HT6A 1BJKA 1F8UA 5I7FA 1WO8A 4JB0A 1BROA 2F4NA 4IJWA 4PPNA 4BB0A 4F4DA 4LXHA 3OT1B 5IAOA 3RFFA 1TJ5A 4ZI7F 4P32A 1VL1A 4M8NE 5EZYB 2IBMA 5BO5A 3KE9A 5CM9C 1WA5A 2B25A 2QRUA 2FWBA 2PK3A 1DWQA 1PIWA 3Q3IA 1ULUA 3UTCA 1PFGA 4EMBA 3FROA 1X8LA 3WL5A 3CVWA 2FZCA 3HO8A 4CR7A 2AC7A 2VJNA 4ZZ1A 1VIYA 1YR2A 3HCWA 1ZQ1A 4OFBA 1D4FA 4DKXA 3UJCA 5BYKA 5ICCA 3OQNA 3A3PA 1HV8A 4ZEXA 4TWZA 3D3WB 5CIYA 1OBCA 2OO5A 5EPOA 1W6UA 4XDYA 4YIKA 5CD9A 1RWKA 2VPZA 4HQKA 4BP9A 1NVVR 4BN4A 1YACA 3VHRA 2PVCA 3SZMA 4C0WA 4OM7A 1XB2A 4XJTA 4RE5A 3HU5A 1M8FA 4BMDA 2IOFA 4MI6A 3T15A 4OV6B 5LR6A 3MB8A 5BNTA 1NSFA 4U7JA 3G8BA 3H2ZA 5C7LO 4QVIA 2A4MA 2P79A 3N8GA 5ITWA 1QVAA 5EHNA 3JQGB 3A4IA 1TT5A 4G56A 2Y9PB 1ZUNB 1L8QA 1VJ1A 1SOMA 2HWKA 3NBMA 3R4CA 5BNWA 1X1CA 1Z0DA 3C8HA 2H4JA 4IS3A 1KDPA 4JXKA 1Z9BA 1O6ZA 4J94A 5KAPA 3ZTTA 1JLSA 1W2GA 1IJBA 4IKOA 1E1RD 2DLDA 3W2TA 4QEZA 1Z4QA 2VBCA 4HSGA 3K9CA 3V8BA 4YRSA 1CUHA 1QR6A 4QOFA 2R1TA 3WIOA 2R60A 4IV5A 4EG7A 3B70A 4BDSA 3GCDA 4XWTA 1X74A 4F5WA 2NU9B 2O8BB 3FOFC 1I2ZA 3DC7A 3DR5A 5BMVB 2O54A 1KS2A 3ZTYA 2J85A 1WIWA 3KOXA 5IDVA 1I7LA 3E23A 4K3UA 4OCZA 5BN5B 3S2SA 4UPVA 5LZ9A 5IF3A 1CVRA 1NOKA 2W4IA 2W6JD 4FOPA 1RI1A 5EJ8A 3RUDA 4FMPA 3I9MA 2WTMA 3SHFA 5LPNA 5FWYA 3O4VA 1P3DA 2X7JA 1LLDA 4BO8A 1XP5A 3AEQB 4MCIA 3FDZB 2ZS8A 3F5QA 3PUYA 4G1UC 3RC1A 4BHTA 3T5AA 2ID9A 3EGDB 2ZWAA 3ABQB 4OQXA 4AWXA 3KB6A 1PG0A 2C7PA 3QPDA 1W4RA 1ATZA 2P9EA 1M1XB 2C2XA 3HB4X 2J48A 4FN5A 4BOYA 1B4DA 3MNFA 4HXYA 5FAKA 3TSCA 1RQ7A 1KJNA 4HFNA 3DHYA 3IPRA 1VE7A 4ZICA 1LDBA 3B7WA 1UWLA 4HWRA 2H7VA 2R66A 1QYIA 1RDFA 1SC6A 1DAHA 4EHAA 2DB3A 2GM4A 4MDEA 4WK0B 1RXWA 3A11A 3U4MA 2RI6A 3KT3A 1Z25A 4R2XA 2XNSA 1U7OA 2QZ4A 1OLSB 4CE6A 4JEMA 5FKJA 1M6EX 1WAMA 1GAWA 1KZ6A 1J0XO 3GP5A 4H1HA 5DYYA 1PDVA 2BSAA 4YACA 5HE9A 3RAEC 3I83A 2QL5A 3HYSA 3KNZA 1JHPA 3BAFA 1BEUB 4HNQA 3KQNA 2PUCA 3HDGA 3IKJA 5HKLA 3FB1A 3IQFA 3O75A 2EBWA 1ULSA 4MWDA 4DADA 4OXKA 4GC9A 4Y6OA 1DGQA 1TA9A 4FZ5A 4H60A 4QXPA 3ZIAD 3Q0EA 4FT2A 4UE6A 2XZOA 3S44A 5LD2C 5DI3A 3C3AA 1THGA 3IVMA 3QX8A 1GGKA 1ZUWA 5ECGC 2I22A 1OWOA 1OXVA 1SXIA 1Z68A 2NX2A 2ONCA 3HKDB 3NBZC 3OX4A 4I66A 5F3RA 4OXYA 4P9NA 2X1LA 3FIJA 2G1UA 3V46A 5EZ6B 2AJBA 4EUEA 4HNUA 1E5DA 4L76A 1TJ4A 4RNCA 4D8XA 3RJMA 3UGJA 1WM1A 4F06A 4J3JA 5L45A 3F9CA 2Q1WA 3RQSA 4LI3X 5J5AA 3DBRB 4NC9A 1BCSB 2JF0A 1JSRA 3CYFA 4DLSA 1UXHA 4W1QA 1SUBA 2H17A 2J7PA 2WMNB 1X2BA 3KFXA 4HNSA 1U0TA 5CLHA 3VI4B 4ZT2A 3ORHA 1H6AA 2IC5A 5BURA 4RS3A 2X8AA 1E6LA 1J90A 4DY6A 5CDHA 3EQ9A 1SBTA 4QDTA 4CFSA 3DXYA 4UXHA 2BCJQ 2PH1A 3BH7A 3UC5A 4MDFA 4RGYA 1FXWA 5J2UB 3X1YA 1EBUA 1JJIA 3FFWA 3CNLA 1DRWA 2YWBA 3WAJA 2W6QA 2VXOA 2IW3A 2O2IA 2YFHA 5DXJA 3BIXA 3CUKA 3FWHA 1ECBA 4NZZA 3CF6R 5JOQA 1ZONA 4U3JB 1GPNA 1F6BA 3EDQA 1PLLA 3TQRA 2YL2A 4D92A 1T3GA 2X4LA 3ZVMA 3A1WA 1L8XA 1D2AA 4YV7A 1U11A 2Q1TA 4V1CB 2X22A 2H8KA 1NRIA 5JEEA 5A06A 1ZRSA 1PU2A 2F8LA 4FLFA 4XB6B 4BFVA 2YVAA 1X70A 5AP9A 4CDMA 3AR3A 3PZBA 3BWVA 4QBFA 3IQEA 5JPDA 4OHWA 1ABFA 1U2QA 3IALA 3QWAA 1RRPA 4AJKA 4C7JA 1XKQA 4IDQA 2DTDA 1A50B 1CEXA 2AI1A 2NV6A 2PQ6A 1U8ZA 2PRZA 1IYZA 1DQSA 4QNRA 3OFSA 4X91A 4BEJA 2JJQA 4EIWA 2PU5A 2BJVA 2WEKA 4TYPA 3W5HA 5KB3A 4AIRA 3KE8A 2Z8YA 1LSOA 3GWGA 1ACMA 1DXOA 2IE8A 2V8BA 3OZTA 3UPUA 4MQMA 5JJKA 3T0GA 4CR6A 1RZRA 3F98A 3FGZA 2K2QB 4ZI7B 1JIXA 1BS9A 1NBAA 2FN9A 4I6EA 2QZJA 1F5SA 3PNVA 3L1IA 3LY5A 5BWCA 1VFPA 2AVNA 4PTZA 1CQIB 3VKHA 4CNQA 2WQ6A 4P4SB 1FTWA 1LX6A 1BXRA 3HJAA 4NX2A 2I3DA 2KLBA 2NYAA 3AY3A 3L4BA 4O8CA 3SQLA 5IK2D 3FCYA 1H66A 3BVPA 2WAOA 4AKGA 2EWWA 2FLVA 4EH1A 3EZXA 4AX4A 4WBNA 4HDNA 4GVPA 4D6YA 4P2BA 4YX9A 4H7IA 4JT2A 1ZZEA 2JFBA 2BR5A 4PLTA 1I2CA 2RGXA 3REOA 1FW6A 3WL7A 1A76A 1R66A 5G41A 1RXVA 5KSYA 1UBMS 2QVCA 1XQVA 1Z0KA 2CXQA 4CIVA 2W0MA 2WSBA 1Z2AA 4V24A 3UJHA 1AJEA 1XALA 5BP7A 2F3TA 4JIGA 2V3WA 3TX2A 4HAUA 4CCSA 1M7GA 1EP2B 1JKJA 4Z5XA 3D6HA 3WBBA 5TQ0A 2VDQB 4TSFA 1OXBB 1RR6A 4G8JA 4EGCB 3OOYA 1P2FA 2J67A 2PRJA 4NSNA 5B3AA 4WX2B 4U7TB 1MOQA 3STWA 1V1RB 2IXTA 3UQZA 3WWOA 3D3QA 5BVHB 1VHLA 1YTLA 2RGEA 4LDNA 3DM9B 2C4KA 1UQRA 1B16A 4U6NA 3VTZA 5ALNA 2IEGA 1F1BA 1SWVA 1GCAA 1TKRA 2FEAA 2ZB7A 2D1RA 3BMQA 3RUAA 3WL3A 1PFQA 4XWYA 2WOOA 2OLEA 1WP4A 4IUDS 4YJGA 1JUDA 2GK6A 4XZ3A 4WKNA 3VU9B 3C3PA 1YKFA 2CLCX 3RO7A 4KDCA 3SXUA 4BU0A 5IXJA 3M6MD 4CIAA 4XDZA 1NP6A 3HDHA 3JASA 1TZ2A 3KTFA 4I4TF 1GNPA 4V0MA 4I1SA 3FBTA 1T25A 2ZS7A 4DRYA 1L3CA 2FJ0A 4MVJF 1QB8A 2SBTA 4HTAA 2G9ZA 2VUSA 4B17A 4F4IA 3UMJA 4MYHA 3K0CC 4IAOA 1E0JA 4ZVMA 1AB6A 1SZCA 5GINE 3RHTA 1GR0A 3IHWA 4ILEA 5ALEA 5KMGA 3ETLA 5EJFA 3BF8A 3H42B 1S8AA 1LRJA 2RBGA 2B7BA 3K09A 1UDBA 3UUFA 5BOVA 4E5PA 2VRCD 1ZD4A 3JAWB 4HDMB 4LZJA 4RPCA 1MBZA 3TOVA 5D8DA 3KQOA 4MV3A 2ATXA 5ELXA 2HNBA 3OM1A 3RODA 3B36A 1UT8A 3WLQA 4ZJPA 3CNQS 5REQB 2NN3C 1KZ1A 5C1DA 3GEHA 4PG5A 2NVBA 1OH7A 4YJ3A 1E1KA 2PMDA 2NZXA 1U63A 3ROMA 1OTYA 4POOA 4WQMA 2YVKA 1R0XA 3VNAA 5BSFA 4KYIB 1A98A 2PZBA 3M5WA 3EK2A 4TXJA 4TQ9A 1EVIA 4MMZB 1T5HX 1XDDA 2YYSA 1N5IA 5U4XA 4TMXA 4D45A 2HMSA 1TQDA 4GBJA 4A8JC 1SIOA 4IKEA 2L19A 4EP1A 3VMFA 4RZQA 3N6VA 1JKFA 2HF9A 3PQ6A 2H4HA 1A9PA 1HKHA 2WAMA 3H84A 3V9PA 5HW0A 2FRDA 1QVZA 1Y8QB 1IAQA 3HVIA 3RE1A 4ZQIA 1FX0B 2Y27A 3TIIA 1RKVA 2XNCA 4OSEA 3DUFA 1X7ZA 4HV4A 2CXXA 4HYYA 4Q1FA 2O2GA 4UNPA 5FCDA 4IX9A 3VVLA 4PQEA 4D4LA 3MB5A 2OD2A 1HWYA 3R0JA 5JISA 1OLUB 1BMFD 1YHNA 1N6IA 3CXRA 3TAHA 3AESA 3W9UA 1BFDA 1QO0D 3IA7A 2Q5HA 4CU2A 4YMGA 2QMZA 3EA0A 1V45E 5HS6A 2SKCA 2CLLB 1F8FA 2NXJA 2R9VA 1FP6A 3MRXA 4FLEA 4P86A 2W2LD 4CLHA 4M60A 1EFLA 1HFJA 2NYVA 3TOCA 4ASUD 1V2HE 5HJ7A 3SJZA 4CMEC 3IQIX 2RGNA 1NW4A 2PUVA 4OX9Y 1G0OA 1KQ3A 3ZE7A 4LOIA 3UXYA 3O47A 4N0QA 2R8EA 3VU1A 3EH1A 3IE2A 4ENWA 2P27A 3LTEA 4JX8A 4A2CA 1MAUA 3JQAA 2FFJA 1T2EA 5ENVA 3JCZA 4E5VA 1NM5A 2C2KA 2CWWA 1L1RA 4GF5A 1EP1B 1U2SA 1X3SA 1XDGA 2PVSA 3GNLA 4I50F 5CB4F 3PEEA 1T8WA 3EGOA 1WEHA 3OTWA 1RAFA 5FL3A 4F4CA 2FKAA 2V59A 3DDHA 3Q3GE 5BR1A 1SO8A 3V2UA 4BKUA 5H81A 5FR1A 5LDDC 2BFBB 2PGOA 2WJWA 3GRKA 4FONA 4Z7NB 4DBZA 2ESRA 3QWFA 3QFSA 2BZ0A 3X43A 2DC1A 4Y2PA 5G4LA 1TMYA 1Z7WA 4CM3A 3NBFA 1B6GA 2Y9MB 4FGSA 1VRVA 3GVHA 4MUEA 4BO0A 1DP4A 2MSWA 4Q9DA 3TLXA 2VSFA 3Q7IA 3MAJA 1HPLA 1FUIA 1JXMA 2OBBA 2XUDA 1DTWB 4IQ0A 3AM1A 2FSPA 3GMIA 3J7TA 4A92A 2C7GA 3WMGA 2C4MA 4H16A 1FS4A 4IOLA 3IEKA 2UZIR 5CU7A 1CNMA 1H8HD 5JBNA 1JB9A 4X1OA 4UHHA 1JQEA 3QHPA 4LCBA 3BQ9A 1X7XB 2AD1A 2R8BA 2C2MA 2TYSB 4ZIRA 2EYQA 5LB4A 1PWZA 4A15A 4IRMA 1B3BA 4CG1A 1P72A 1GU7A 4GP9A 5CFQA 1YF3A 2II6A 3MXTA 2JZNA 4CEJA 2QJTA 2Q07A 3AP2A 5LMZA 9MHTA 3UEOA 2X9LA 3ZWXA 2EWVA 1Z0AA 1YI1A 2QD5A 1TRHA 5KYWB 2B5WA 4ABTA 3NVKI 3B51X 3TLEA 4B44A 5JARA 3OOWA 3WY9A 5E3JA 1AZWA 3VMMA 1K7XB 1IXSB 1RLMA 2HQSA 4C4OA 4CQLA 2IXAA 3I6QA 1HFEL 3JZFA 2P9ZA 1XD8A 2YXDA 4A27A 4YV2A 5C8VA 1JG7A 1WVMA 3TUIC 2ZJ3A 2XUJA 1M2OB 4UMFA 3ZE2B 3GPIA 4Q5IA 2I2FA 1XEWX 4W63A 1AUPA 2VSXA 1QAOA 1SB9A 1RHJA 3RCBA 3HWSA 3I3SR 1KO8A 3I52A 4NV1A 3FGOA 4CJXA 4U2FA 3L04A 5J5CA 3CX8A 4TWIA 3EXEA 3K8ZA 4MVJP 1FFGA 2G07A 2P9QA 3JQFA 4HPJB 4BFYA 5I9BA 2YUTA 1LK0A 5LNK6 1AO0A 1NN1A 3HM2A 4D9CA 3AWDA 3Q7TA 2PZGA 5T41A 3I32A 5HNKA 1TD9A 3KM0A 5BWNA 1BVYF 1FLDA 5JZBA 1R5OA 1SAYA 2QMQA 2QPTA 3IP7A 1M2NA 3O8OA 5A2QA 2GYUA 3AZQA 3BZBA 4S0XA 2Z4RA 4WZZA 3B1ZA 3IPAA 4D9FA 2Z98A 4EX6A 4Q21A 1II8B 2UV8A 4CKBA 1U5BA 1Z6YA 4K8OA 4B6GA 1UZMA 4HDOB 2BGIA 5KKCA 3KYCB 3LFUA 5D3KA 4LRTB 2CZQA 5LYYA 4HYTA 2MYPA 4TVKA 5KQGA 4Y1RA 4BFLA 3A6LA 1GQ2A 3A6EA 3SR3A 4OKNA 5I7RA 3ZWPA 2DPYA 5E38A 3TDMA 2ASVA 1MC1A 1Q0HA 2OMKA 1QAMA 3O2NA 2PH3A 4Z4EA 1TZJA 2QRKA 2QRPA 4A8HA 3QLJA 1PJCA 5CYFA 5K20A 3R0ZA 2A4KA 4I4TB 3U7RA 2Q0HA 3I1JA 4CYMA 3WLSA 2EG9A 2RI1A 5EHZA 5HZHA 3C5WP 3BAZA 4X95A 2WJ6A 1RLUA 4MVJI 4G0VA 1N7IA 5BQFA 3U4HA 1Z2PX 3AK4A 1BVHA 2YZ7A 3UWOA 1W9MA 4QO7A 3IXMA 2PX6A 3V42A 4OFZA 4L4ZA 3V8RA 4MW4A 3I9OA 4AN4A 2PKYX 4H0FA 2KPOA 5E7QA 4RPGA 2QT1A 1UIMA 1LK5A 2GM5A 5JE8A 4D8UA 2UYHA 4FC6A 5J1SB 1ZN8A 2IU6A 4KG7A 1N57A 2OXFA 2OEPA 1FFSA 3KZ1E 1KDOA 5DW3A 1WPRA 3SYRA 4G2NA 2ORWA 1X86B 2BDTA 3P52A 4PGAA 4E2YA 2PSSA 3DHWC 4KPUA 1PFUA 3IUMA 3PHHA 4QE3A 4GICA 4C7XA 2ONKA 2O1EA 2KW5A 3VHLB 5JPCA 5CH3A 1XZMA 4RV4A 2ATCA 2E3JA 3B48A 3BK1A 3FPBA 1F17A 3CPJB 3MUFA 4I7EA 2MSCB 3E22A 3LCRA 2ERYA 3O83A 3QE3A 3IP5A 1GWNA 1HYBA 1CJCA 3UB4A 2YR0A 1P5RA 4HUJA 2IXFA 2PCJA 4KODA 1IAVA 3RNOA 3WQRA 1W5SA 5JZOA 3N86A 1AXRA 4CM9A 5K09A 2H85A 1RFGE 4KXXA 2ZB2A 4R2JA 3BHMA 3DBLA 2Z2XA 2VF5X 3R23A 3H04A 5CXXA 1QIFA 2R6GA 1E2LA 1MO5A 4DE5A 3VC7A 3FRIA 4NENA 5DH9A 3IOCA 1KDYA 3QF7A 5KQMA 4J76A 4UUQA 1T0PA 2FPPB 2Q5CA 4F6LA 2QMEA 5J9FA 2ZGVA 3B85A 5TPZD 3TNJA 3ZNNA 4C04A 4H18A 8MHTA 5DBFA 1Y80A 2YJZA 4F3NA 2O2XA 1NI5A 5IT0A 1JHAA 2PV0A 1JZTA 4ZHQF 3PD0A 4EG4A 4KOEC 1QPZA 1SPBS 1QMGA 1C9YA 4LGVA 1F8XA 4ZT6A 2NV2B 3I6BA 3VO9A 3GDGA 2XTAA 3E9MA 2IPMA 1ZIPA 3M4JA 4F8JA 3L6CA 1TIPA 1GFSA 2FDRA 4DDWA 1JL3A 3DULA 5GZ1A 2DJ5A 1U8EA 3IOYA 2I8AA 1DEHA 1YVRA 4LSWA 2HTFA 4QQKA 4BLOA 3CZRA 4P36A 4ETNA 1U2GC 1UZLA 5K4GA 1I2BA 1XN1A 1DC6A 1HL3A 1E6UA 1PUJA 3MTQA 4PZEA 3M82A 2PU7A 1O97C 4CV2A 2ODBA 3I5AA 4M7WA 1H9BA 3W8DA 2BTEA 2JAQA 1GN9A 1TUEA 5FTMA 2A94A 3MK31 1EYZA 1ZCBA 3F71A 1RQGA 2QLTA 5GZ6A 3QKRA 5EJ4A 1LB1B 2PS1A 3G9XA 1B74A 4HQLA 3TTVA 2BEVA 3LXMA 5DNVA 3LIPA 5FO0A 4U1RA 4Z54A 1XZBA 3D4BA 5ALTA 4YWHA 1P9NA 4C21A 1BG6A 3HR8A 4WXMA 1CUVA 3T9BA 1RKXA 1FSSA 3IDFA 1VMKA 1ML3A 1T2AA 2W6MA 4TYWA 2HU8A 4AG5A 4Y3UA 1Z17A 4NATA 1JAYA 4DYHA 4R71A 3MLEA 4C20A 2Z2IA 4L4XA 4TV8F 3NCTA 1ESZA 3BGVA 3O4GA 1PL8A 4Y2JA 3DMTA 5EVCA 2ZJZA 3UJ9A 4QEKA 5L3QA 3K5PA 4KOAA 1DIHA 2QV7A 2QRLA 1JLKA 5TLSA 2IPOA 4DV2B 1VCHA 1R8XA 2VZ8A 2QZPA 3Q7EA 1P7YA 1R6BX 1A7JA 1TK2A 4BQFA 4EK9A 4GLLA 3WLNA 1GY8A 2FTKE 4Z0HO 1QVWA 4YP1A 5FBRB 3HWX1 3A1TA 2CJWB 1FLAA 1IMJA 4H3KB 4RMNA 1UPTA 1RFLA 1K8QA 1UKZA 4P84A 3BE6A 5HJ5A 3AVYA 5H1YA 5ALPA 1NTRA 4ND4A 1E2PA 1NNSA 1IVYA 4TZKA 3T35A 5HK9A 1C3EA 1SHLA 4P92A 3GHYA 3GOQA 2WJPA 5K3BA 5HKKD 3B1FA 4DWVA 4IJKA 3RT1A 3G0IA 5KTYA 1ZX1A 2OC4A 5B58C 3DWFA 3JVVA 4LFCB 3KWLA 1SEVA 4MWCA 3TH5A 3KYIB 2ATIA 4JQOA 3TUJC 3ZDFA 3SS7X 4XD7A 4YLEA 2Q27A 2O23A 2HLDD 1HDIA 1DO8A 1CYEA 1WF3A 1PYGA 3SLKA 3HJTA 3ZK7A 4MDHA 1VLJA 1HG0A 4Y0AA 3WMXA 3QBJA 1NURA 2IKSA 2WIFA 3NX4A 3RUCA 3W3ZB 1HZZC 4H6PA 3ZWAA 3NDBB 2OCYC 4W5RA 2CCKA 3C7TA 1RPTA 3RG2A 3U3KA 2DQZA 3ITNA 1ZGBA 4XW2A 1U7UA 3U3MA 3NH9A 2MIIA 3SSNA 2XMBA 3OBBA 2VG8A 2J3IA 3FDXA 4RLQA 3ED5A 4REMA 3IAM6 1Z29A 4A8PA 1WBDA 2XI4A 1XEXA 2XHZA 4QUJA 4CV1A 2CEAA 1VKHA 4KHPB 1OFTA 1WDTA 4RCVA 1KDRA 1YRAA 3AB7A 3M5PA 4AKEA 4FP9A 1RI3A 3BBPA 3TL3A 3VJMA 2KBFA 4C4SA 4UUPA 4G24A 3AW8A 2RBKA 1MOZA 5K0ZA 2YJGA 1VJRA 4JVSB 5DGXA 2DT8A 3QOXA 5DNDA 2WMDA 1LFDB 4A5SA 4PBSA 1EGMB 4H4CA 4LY0A 1AK2A 4R8VA 4X41A 4GLBA 1FE8A 4DLTA 3RBAA 4DMGA 3UW1A 1J1UA 3NXSA 4X6YA 1YB2A 4WZAA 7AT1A 4LV5B 4PV7A 3BTSA 1TKCA 2CXNA 4REOA 4K6GA 2YXPX 1SOWA 1XLTA 2DPHA 3I5YA 1NUHA 5AJYA 1CJSA 3K6SB 4ACAA 1ES9A 1V2GA 1EHCA 2ZIVB 3R5FA 3BKWA 2M6SA 3EGVA 4JLNA 1JTEA 4BN0A 3OX2A 2AR0A 2CLKB 3KXDA 4RABA 5EHXA 1NN5A 3DOJA 1YZGA 3BWDD 2CFOA 4FI3C 4ZZ3A 3CF2A 1NVEA 1Y4DE 3HA7A 1KBOA 3L6BA 3RG8A 2GQ0A 4TWJA 4BO2A 4YCBA 1FDWA 2HNAA 3JAMA 4PO3X 2NU6B 4WJLA 3GGCA 3Q3VA 2IYSA 3VR6H 2J5KA 1T5LA 2JH3A 3V1UA 2DYKA 5JSFA 3U40A 1NVMB 2R79A 3MJEA 3J81A 1S6YA 1WDLA 1OIVA 4WOKA 3PFKA 2FH5B 3KU4A 2CE7A 5LJIA 4FQ8A 3ZGVA 1EM8B 1KERA 1P5FA 1SIUA 3H2IA 2DOKA 3M3DA 3KOYA 3O84A 3PGA1 4D4HA 4WZBE 2XCUA 2C3PA 1NJFA 4ZAXA 1DC7A 4CKEB 2WAYA 4RYDA 4Q3NA 4C3OB 1ISMA 1EMDA 1JI3A 2K87A 2G67A 4RFVA 1R0BA 4EENA 1G64A 4DM7A 2ZT8A 2CNBA 4MQEA 5AW7A 1SZPA 1WPQA 3INRA 1E3MA 3MBOA 3D43A 4HNRA 2RJ3A 2HF7A 5BWLA 5JCPA 1LGYA 2ZWPA 4PWZA 1RHUA 2W90A 3WR5A 3EF0A 4UU7A 2XCRB 2O1XA 5GM1A 2PFSA 1WLSA 3O93A 4HDCA 5ITZB 2F43B 1W19A 2PGNA 3DFMA 3DMHA 3N74A 4H3HB 4N3NA 4GIBA 3WRWA 2PR7A 4INJA 1W0JA 1PSDA 2IHJA 5EI5A 4ZHQB 1PVVA 1D9XA 1QCYA 1ORRA 3QNUA 5C32A 2CNKA 2DLNA 4NTZA 5HKBA 4DNQA 2YNMA 3ZWNA 4TRMA 1YMQA 2O6HA 2CN1A 3NGXA 3GOHA 4YQYA 2GFQA 2WJYA 1NOJA 2ZIFA 2PR2A 3L40A 4O08A 1ECPA 2FUCA 2YQZA 4K9OA 4ZCLA 5D5PA 2JIZA 4D9JA 4AMBA 1ODIA 2NUTB 4Y7DA 4R1NA 4BVLA 1RRFA 2I7CA 2REQA 3EVFA 2QQGA 3VGPA 3ICPA 4YJ2F 3PYLA 4IWYA 4QU5A 1OVGA 1CB0A 5AVWA 4I2VA 4UC0A 3EWIA 2IZ1A 2V8OA 4E4TA 3UA3A 3LK7A 1RWQA 2B4AA 3GVCA 5KTKA 4UNNA 1E62A 4QOSA 4E22A 4OQNA 1YDEA 5KREA 5LOVF 3QMVA 2VJYA 4TN5A 1YMVA 5K05A 1CUGA 1HY3A 3TSAA 3F47A 1KYWA 1W2HA 5IN4A 1YT5A 1G8FA 5JHGB 3LYAA 2HWXA 2MSDB 1SG0A 2D06A 1XRMA 3AH8A 4W5OA 3LUCA 4BE4A 1I3CA 4XSHA 1TVEA 4E2FA 4RU1A 4YCLA 4GP6A 4KQCA 1VPWA 3I9JA 2C2HA 1JF8A 4TV8B 1GADO 3FHOA 4FHDA 4PLZA 3K4PA 4LYEA 3D2CA 1C0EA 2VPIA 2WAAA 2YHAA 5FPKA 2K2WA 1P1HA 1ZOLA 4LF4B 2BUBA 4OB8A 4X90A 1TQ2A 4C1BA 5BVGA 1P62B 3BTOA 3G7SA 4FMCF 1R8YA 1G5QA 3OCCA 4JP3A 2ZJFA 1M2VA 4L9WA 2GPWA 1QHNA 3DCNA 3REFA 3L18A 3LBFA 4ALKA 1Z45A 2F3QA 2ZRFA 3LDHA 1WPGA 2G71A 4D5GA 2VAPA 5HIIA 2VXBA 5AT1A 1UKAA 1C8BA 2V03A 3M49A 5KKNB 5GV7A 1QYCA 3IR7A 3DFKA 3VPGA 2FWMX 2HRBA 3HU3A 4LSZA 4RFSA 5D01A 1MX1A 1PDOA 2NXNA 1UDCA 3T4PA 4B75A 1B8VA 3W2FA 4TTQA 3MTEA 3BXFA 1NYLA 3ORYA 5B2ZA 1F0YA 1RAGA 3V3KA 4MQ4A 3QWIA 1KAQA 1OGYA 1EM6A 1AS3A 4NDAA 2JJ1D 4BX8A 1L3BA 4G36A 3RAPR 4FOLA 5DOZA 2A84A 3QJGA 2Q7OE 4BFCA 4HDRB 1XU7A 3MTAA 5ADUS 1NJ8A 3D4OA 3PGLA 4EBBA 3SVZA 3T6KA 5LP1A 3GAFA 1T3ZA 1QM5A 1JFFA 1NFQA 1ZZGA 1M0SA 1ZI8A 4DRXA 4I1YA 1XD2B 2Q0SA 4PINA 2HBQA 4ZTBA 4M6WA 4RTNA 4AUEA 2X6QA 4WCVA 3Q7PA 1UANA 2O8FB 3M6AA 4MYUA 1P4GA 2EXXA 1S3FA 1I3KA 2O7VA 1E7RA 4B4OA 2IYWA 4ZD6A 2OTCA 3HB7A 2C82A 4MR8A 3CU5A 4MZDA 1AK9A 3R8CA 2LKDA 1OX6A 5I4CA 3OIVA 1DIBA 1TA0A 3MQ2A 5IJ9B 2VAMA 4IIJF 3WGJA 2HMYB 1BKYA 4N5MA 1JDPA 4FBGA 4C0AC 1FC0A 3LCVB 1QH9A 1L5GB 4NK5A 3W3AA 4WOBA 4UKDA 4G23A 3AF5A 4JMPA 1XR3A 3HA2A 2O52A 3CJTA 1Q44A 1JDBC 1RWVA 4NCNA 3U7EB 2A9RA 2ZU6A 3KTAB 3R5KA 3ETDA 4IF4A 4MW9A 1QP0A 1GOTA 1QORA 4QUBA 5FI3A 4CEIB 3VPCA 5AICA 4I1UA 4K2AA 1CEQA 1FVOA 3O2QB 2FPRA 6LDHA 1R18A 2VDWB 3O8NA 5FEUA 5DOVA 2KHZA 2BFWA 4JJ6A 3THWB 2AZMA 5AK0A 1BVUA 4C43A 3D6VA 1XC7A 3M1YA 4AF8A 2J3KA 4F56A 4ZCPA 4MULA 3RBVA 2QN6A 1N2EA 4PGGA 4LAFA 3H4TA 1JLLB 2W2TA 1E2JA 1E5TA 1GGNA 2X9QA 3MS2A 3FJ1A 4N5LA 1ZD1A 3P0RA 3WC4A 1ENPA 4ESEA 1E9SA 2AE1A 3FVQA 4Y6PA 3U7QA 1ILWA 1T3SA 2CKMA 1U2DC 3R44A 2QSUA 4PAQA 2G9NA 2HNKA 3BEOA 3WLEA 2PPVA 2I71A 4H15A 1KDVA 4H7DA 1ETHA 2WSSA 1NF8A 4YFYA 1UJNA 3GD7A 4YP7A 3EYAA 2COKA 3N2IA 1WF6A 4O5AA 4G6ZA 1YJAA 4TL8A 3QWBA 5DTRA 5HILA 3SOPA 3WGQA 2XB9A 1YDFA 5JY6A 1KZYC 2RB4A 1A8QA 3E7XA 9GPBA 1SXJC 4TLCA 3G9QA 4ZO6A 4AJPA 4QQFA 2GN6A 4DDHA 1ONOA 3G6KA 2FW9A 4FFBA 2AL7A 3LGSA 3LA8A 4DY4A 1FYFA 3BJZA 1V7CA 1N7HA 4M7OA 3K0FA 4ZQCB 3UO8B 1R6XA 4D79A 4L8FA 3E27A 5JMTA 5KNCD 2Z6QA 1E1QA 4AJNA 3VZQA 4FNAA 1QHXA 1RWXA 4YYZA 1ZJWA 4QBTA 3QXXA 3B6KA 1E66A 5BRAA 3ELBA 3TRFA 5B7GA 2ZSAA 3N8HA 5E2IA 4IQ8A 1W581 1JIUA 2XT6A 5U9CA 1OA1A 3P9IA 1K3UB 4G1CA 1LRLA 1XMJA 4G67A 1U2RA 1YBHA 3X1ZA 1MGOA 3W2GA 2R4TA 4YC7A 4JBHA 3GFTA 4QBHA 4PTLA 1EWKA 1PEKE 3OZBA 4O4IB 3LWNA 3AEQA 3X0DA 3TIGA 3BB4A 3FDZA 4B1FA 1C50A 1H94A 1DAPA 5LKRA 1Z5ZA 3ZDYB 5K6RA 4J75A 1YVEI 2W6ID 2XA1A 3GA7A 1RQXA 4H31A 2BBTA 3QFHA 2EGHA 2X0JA 4JUFA 1FFXA 4QECA 2QL9A 3JQPA 4FMBB 4WGFA 1R88A 4PCVA 2YWHA 2PH5A 4DNFA 5B12A 5BV0A 3VHXB 1WKVA 4EUSA 3TE7A 4HS9A 3FWNA 3NWEA 1W4CA 1BHO1 2XYVA 2GERA 1HBJA 3JWPA 4Q05A 2FQ1A 4YJ2B 5JSUA 1FJGB 4QGSA 4O2BB 3ZDRA 3OETA 1E9EA 1OLSA 2BLNA 5CH5A 4DILA 1LEHA 4ACBA 3BMNB 4NE7A 1ZOIA 4M9CA 3I5UA 1CPYA 1O96A 1RLTA 2A35A 3G2MA 2BGLA 2VTDA 3EWAA 3KAQA 3QMPA 3UYLA 5C8ZA 5LOVB 1RKQA 1IATA 3AETB 1KVTA 1SBYA 2NSDA 5LZ4A 4OHOA 2QGZA 4RZ2A 4ZCTA 3WGKA 4DDKA 4RTRA 1NA5A 1OZFA 2C8KA 2WJZB 2GD1O 3E4CA 5FPYA 4BFZA 4XM2A 3LDUA 5EWLA 1SXJE 4OYLA 2ZULA 3HEBA 4I4CA 3FPAA 4DSNA 3HNPA 3ZS8A 3ZJYA 4KB5A 3RIHA 2VC2B 1Y48E 1I7DA 3PD7A 4OI0A 4EW1A 3QLVC 1VKJA 3B6MA 4WK4B 4UOEA 3CZ9A 3ZQKA 2R6ZA 2VNSA 1N2GA 1K98A 5CD1A 2IZZA 3TXYA 3HKDA 2P5UA 3DZIA 4UMDA 4P4GA 2Y1DA 3EFOA 4JELA 2PRIA 3QGMA 4FMCB 4RXTA 4QRIA 4M1KA 1SCUA 1RBQA 1M74A 2JFFA 2AYXA 2WC1A 1JFTA 3SPXA 4PGHA 4R98A 1O4VA 1LI4A 1CTQA 1PEDA 2EKBA 3BTVA 3LVFO 4M9QA 3S70A 3N8IA 1VFNA 3SXJA 4AY3A 1CC1S 4EI2A 1M72A 5HRCA 3DBRA 3GLRA 3IMEA 3TIXB 1BCSA 2W6CX 4KREA 4ERNA 3SAJA 1FL9A 2D7JA 1H23A 2ZYWX 2ILVA 3PQCA 5EWMA 1EX6A 5I4IA 3WLAA 2OBYA 1LTQA 2P2NA 4QU8A 1AM4D 3BCUA 2IH5A 4MVJD 5IVHA 2OQRA 1M8GA 3RS7A 4IMIB 4XD2A 2H3EA 2ORED 5DF1A 5BV7A 5L3VA 5CH8A 1DJNA 3HXLA 5BV2P 3LYUA 1GR1A 1R9NA 1CHDA 4RMIA 1J0EA 5LMUB 1SD1A 1VSTA 1Q7BA 2FG5A 4HSEA 1NULA 2XODA 2ZRGA 2RGCA 5A4IS 1NNI1 4CLOB 4GZLA 1Z2EA 1DAEA 2P69A 1Z6ZA 2YWRA 1O2DA 2HJGA 3BL5A 5ICFA 2CK3A 3A1VA 3Q9NA 1J0AA 1W0CA 1XGKA 4JU9A 3TRKA 4DR1B 2YH2A 5CDSA 4Q1BA 1DADA 1Y7TA 4QJ3A 2PXAA 1ZJYA 3L7YA 1N2XA 3GGOA 4N4AA 1UK9A 2WHRA 4KXFB 3SN6A 4E32A 1J8MF 1H8EA 3FHLA 4LZZA 1MJNA 4FEGA 3LBAA 3TF5A 2XOXA 2EOAA 1MN6A 2I5PO 3TNYA 3KKNA 4AMGA 1UPBA 2HRDA 1W4BA 1KY2A 1CR4A 4O2LA 4HJRA 3NANA 4GPAA 1JNXX 4G0NA 4V3CA 2ZBUA 4R1MA 2CXSA 2OD7A 2V97A 1J5XA 2DUUA 4HRYA 4N7JA 1ZCJA 3NKLA 1XF9A 4JVNA 3TSZA 4F85A 1B43A 2DXIA 2ZBEA 1EE9A 1Q1AA 1V5FA 5IKOA 3EDYA 4AK9A 1G1AA 1Z0FA 2PMCA 3CLUD 4FEYA 3BK2A 4KVAA 3KZCA 5JMPA 5MFPA 3COVA 1FYWA 5LU8A 1B7GO 4LUCA 4ARUA 1X1AA 2FZEA 1ORIA 1QFMA 3VX4A 3W05A 4C7MA 2VFAA 4TTSA 5EZQA 1V48A 3H1BA 4CKWB 2BSQA 4CEHB 2ZCUA 5JBQA 3D7NA 1Y37A 4IH9A 1MGPA 3EEQA 3N1UA 4MA5A 4BUCA 4CXMA 1S2DA 2O4UX 1FDRA 1YNSA 3NEPX 3EIXA 1R2QA 3EBPA 4QTYA 4H1WA 1QGAA 2OXRA 1GZ7A 5HGJA 2WHPA 2GVNA 3ZV7A 2CHEA 4ILKA 4HLDA 2AMVA 1J09A 1ZD5A 3FUCA 5DTMA 4B8WA 2PEZA 5J4YA 4UTVA 1V4VA 5JSZB 3AF6A 1KEZA 4LTMA 4MEBA 3RTGA 4P34A 4H3SA 1VHDA 2QRZA 3GT3A 3RLIA 4AKHA 2OC9A 3OAAA 4PGMA 4E2XA 4P0QB 4GKKB 4YDHB 4E12A 4DIKA 4F1WA 4M0DA 5CPBA 3RTDA 3T1VA 4DGQA 1UZAA 4BFUA 1JECA 3OJLA 1ZSYA 4EEZA 1OPRA 1JQAA 5CDTA 4MV1A 3O82A 5H82A 3AI1A 3RIYA 3T54A 4CMJA 1PEAA 3OPNA 3WI7A 2QXYA 4HR7A 4ODIA 4U6QA 3V7YA 4RX1A 3BRCA 2H0AA 4HWTA 2P90A 1QAQA 1VDZA 2AFIB 4TWRA 1J23A 2EBFX 4M8IA 4B6EA 4QRHA 2ZRJA 1A9OA 4KSYA 4YBZA 1RZRD 4YONB 2ZRBA 5EQDA 2I2WA 2WTUA 3R9XB 1SRQA 2D4AA 4IZIA 2ZAOA 1HURA 2OKGA 4LNAA 1GUZA 4NBNA 3ZGOA 4AULA 3KZMA 3VBCA 1XEAA 2ACVA 5EJIA 4B3JA 1FOEB 1TUIA 1ZUHA 3NOVA 2TMGA 4QT0A 3OJEA 3EG9A 1P60A 2X1MA 4ZCSA 2ZYDA 5EXEA 1VL2A 1K7YA 2MWMA 3H99A 3LGAA 4FHGA 5JTTA 1YE5A 2O6LA 3H6KA 4EKEA 3ZW9A 3BWEA 1X9IA 2P91A 3MVEA 4CN8A 1RHMA 4GYYA 1JILA 1E3TA 3AFGA 2JGEA 3DJYA 4NMMA 2GF0A 4RV5A 2XNDA 3ONDA 4E1AA 5LL6P 5BORA 1OAKA 2AFIE 4LWPA 1G6Q1 4WA7A 3X2EA 2QTWB 2VJQA 4PS1A 2O7QA 4MW6A 3NB0A 2OHGA 4L8GA 3MCWA 4ZVKA 1TTHA 4NWIA 3V00A 2BFAA 4JXZA 2W00A 3VSEA 3JAWA 4Z9YA 1PD0A 1N5RA 1VPLA 2LDXA 2HMAA 4KMMA 2VA8A 3IKVA 2FFQA 4MWOA 3QVJA 1ODJA 3RF6A 2H1WA 3USES 1P1BA 1ENZA 1Z0SA 3DEIA 4KRXA 2BELA 2XA2A 4N9WA 1V11B 1J1ZA 2H06A 2QWXA 2QYSA 4RVFA 2I7XA 4ZOLA 2C31A 5CB0A 2VJAA 1V1MB 5KHLB 2HW8A 4X24A 1M2HA 3LF1A 4KYTA 4XJVA 1R9JA 3Q0TA 2IVZA 5IN5A 4AMVA 1N0UA 2AI3A 2GS9A 2VJPA 2VTKA 3ETCA 1SH7A 2WNIA 3FPFA 3OE4A 4XE5A 5KOHA 4WVLA 4LG1A 2RHCA 4R01A 1PLJA 1Z7BA 1WBJB 2OK7A 2BGKA 2LIPA 4Q12A 2X7HA 3L92A 5CNKA 1IBMB 2WMYA 5AJHA 3A06A 1KP9A 4G89A 4MCJA 1IOLA 4OB7A 5EIBC 1SUEA 2DHQA 5JASA 2Q46A 5EMHA 4BGIA 5HGXA 3TO5A 1BD4A 3WHPA 4AIIA 1ZNXA 3FSRA 1KU0A 3JZAA 3ZE8A 4ZI3A 1Y8QA 3H83A 3HO1A 1Z75A 5COQA 4GNRA 1ZYUA 2WJAA 2DY1A 1Z26A 3FCCA 1VL0A 1E8MA 4F04A 2HCRA 1YRYE 5T64A 3II6X 3PEWA 1LF5A 2R68A 3P71T 4MCHA 1CVLA 2IKQA 1W30A 5CCXA 3VO2A 2ZM5A 2DPMA 1CWUA 2VWPA 4FD2A 2AZTA 4C4RA 1ZN2A 1D1PA 1H1LA 4RLSA 2Z9CA 3RHFA 3ZHQA 1EDDA 2NO6A 4B81A 2F00A 3CISA 2W9XA 2ST1A 4KMRA 1R10A 3VH4A 1B6SA 4ARBA 3B7GA 2Y1GA 1RAHA 1T10A 3R5TA 3GNQA 4W5WA 4YRJA 2VHYA 3W2IA 3UV7A 3LKZA 4F21A 5AKJA 5MDHA 1MJ5A 2HSJA 2ZJ2A 3ESQA 3LIIA 3RVLA 2IXGA 2QM0A 3ZHOA 4M36A 4TGLA 1J99A 2EIHA 1UKBA 1ZN7A 3NHMA 5KTMA 1NT4A 3KT8A 4A8JA 4J3NA 5JT1A 3H3XA 3SHTA 2B8JA 1K89A 1BH2A 4E94A 5G40A 4J49A 3TTYA 3KELA 2RHOA 3AUXA 4WOCA 2DUJA 2BFBA 1LZLA 4Q3CA 3KR1A 4PYRA 2GBFA 1JWBB 4JZYA 2H07A 3ASVA 2G63A 3MTIA 5ESXA 1KSGA 2PZEA 1TOAA 3EBLA 3U5ZB 3KBBA 1UBLS 3AEKA 4TTTS 4WY5A 1XDWA 3H2KA 3MD9A 1J07A 2DBVO 4DFDA 3SYLA 5B3JC 3FIUA 2AIRA 3DT9A 4KUGA 5BSRA 3HI6A 4LRSB 3LD9A 1GGHA 1SXPA 3SVLA 1TAHA 1E2IA 1VZ2A 5D1NA 1NXQA 3QV2A 4TV9A 4GL4A 4KJZA 4R8RA 5EPUA 5HBRA 4E5NA 3WBKA 2B37A 1GNSA 2G40A 2RIRA 3N2GB 2VAVA 4IBOA 4JL8A 3D4LA 3MCVA 4NZMA 5JQWA 3DFFA 4DQUA 1UJCA 3BE8A 5AKEA 3BS4A 1VB3A 4K1LA 1D2MA 2KB0A 1TKBA 1V5IA 3DDWA 3GY0A 5A9SB 2OOSA 2NVUB 2QTAA 1NATA 2H7YA 2F64A 4EGFA 3T3IA 5K45A 5K4HA 1YKGA 2YICA 3JQAD 3OA0A 2IEIA 2NO9A 3FKQA 5KYWA 1JJBA 4YRBA 4PQGA 1JA1A 1UMCB 5HCUA 3C85A 1C0KA 1ZMXA 1TYAE 1JU4A 2EAUA 1ZL0A 1BKDR 2C3UA 3OPMA 3C87A 5ICGA 3WBFA 1R12A 3CMMA 4AUKA 3A3OA 2VCEA 4M0LA 4TN1A 4LE1A 1INLA 2HQRA 3QM1A 2IDJA 1V16B 2XE6A 4M1WA 1U5CA 4PG7A 1G38A 4CETA 1J22A 1H3EA 2PL1A 4G8DA 1Q7TA 4LBYA 2G4LA 3WLKX 2ZTSA 3NKFA 4G5XA 3DW1X 1PR5A 4RKFA 3LUDA 2ZAIA 1ZNZA 4EGAA 1WCIA 4W7IA 4WW0A 1GZ5A 1U04A 2VBGA 3I8OA 3MRVA 4RSRA 2GRAA 1ODKA 2XX3A 3F3YA 1KR2A 2WF9A 5ALIA 1X8JA 2ZRAA 4E5DA 2RB5A 2VZ0A 3TRHA 1FDUA 1YQQA 1APBA 3O8QB 1XQ1A 2GM3A 3S68A 4ZC1A 4NBLA 2OLJA 1CE8B 3GQVA 2J3QA 5BYJA 4W9RA 4EVIA 3IS3A 4WNAB 3RIEA 2ZI5A 5IMSA 3FWPA 3BXPA 3LX4A 5EA2A 4EA6A 2G9UA 2IYTA 1G2OA 4UHJA 1AKYA 2C5EA 1ISIA 3D1JA 1V8BA 1CY2A 5K2MA 2AC2A 3WGHA 1RPZA 2QTRA 1N2CB 8LDHA 1K0FA 2OV4A 2QZZA 16PKA 3CZCA 3GO4A 5K8JB 4EF6A 4MQ6A 5F3WB 1DU4A 3KALA 4HP8A 3TVTA 5IRCD 4KR7A 1CF2O 2O05A 2Q0QA 4QJ4A 5IDYA 1QHEA 3CNBA 3WGNA 3ZUPA 4BCDA 5JD4A 1HSOA 3IHKA 1H65A 3LNCA 4UVEA 2J0UA 2F3SA 3L9XA 2IYEA 5AK3A 1PUXA 4EHKA 4KGXA 3RTCA 3W7AA 1HNXB 2DVMA 5BUQA 1NU6A 1ZWLA 2P11A 1IN5A 3QTTA 2HA5A 5C1OA 5IC6A 3IP6A 2Q2QA 3BOSA 3QA9A 3C8UA 1EFRA 4AS2A 3PTAA 1M2WA 1OXSC 5CEFA 1N2CE 1YCFA 2WU8A 3LF2A 1WY5A 3PCXA 2IHNA 2F2TA 2Z95A 1YXMA 5EJ2A 4AKIA 3ZV5A 2WJ3A 1CY1A 5EGNA 2JLVA 2BZGA 2ZBDA 3OF5A 2DRIA 4AL4A 1N33B 2E6KA 3M2TA 5IJZA 2F8TA 2YC2C 3COSA 1G18A 5DJ5A 2RDMA 1NVAA 4CMCA 2OE2A 5ES4B 3KQLA 3BFXA 2XGMA 4OVKA 1RP7A 4M7RA 4GX0A 6Q21A 1KJWA 1KWKA 2XUIA 2N0SA 1EG7A 4ENTA 2DQ4A 1I5EA 3I62A 2O2CA 4IICA 3BA1A 2F1KA 4M0UA 5CCDA 2INGX 1ETUA 2FJPA 4I46A 4Z8YA 3B2EA 4LDPA 2COEA 5LC1A 3DDZX 4QQNA 1GV0A 3OZCA 4FGKA 5HIMA 4BNKA 4C14A 1VSQA 4DMFA 4D8VA 3G0HA 1UJ5A 5GOZA 2R00C 1O7JA 2VEOA 3KFVA 4LZOA 2I2CA 2ZE6A 3P4YA 4Q03A 4PQYA 2Z58A 3SJUA 3NBYC 5A4DA 1A71A 3X44A 2FEOA 3PENA 5EP2A 5A3VA 2B5OA 2HAEA 1K7EB 3WSWA 3ZCXA 4YREA 5J63A 3PHBE 3GP8A 1JHQA 3RK1A 3FYHA 3OUUA 4Q7LA 1UCFA 4JR1A 4D9NA 3GLFE 1HE5A 2XF8A 3AHFA 1CR1A 4P5PA 1L7AA 1KYTA 2FPPA 3L7KA 1J8DA 3RUFA 1SJ9A 5TEWA 1L9XA 3TIFA 3UUWA 3WAKA 2CDRA 4A91A 5BSWA 3N3AC 3WX0A 4BZZA 4IFEA 5GTDA 1CY8A 2QI9C 1E2MA 2PLAA 2QGFA 5C8YA 1FYEA 3N76A 2ERXA 4YDQA 2ODEA 4CQMB 2ZSHA 1CY0A 1NUSA 2E9SA 3TLBA 1RAEA 4GRIA 1D6MA 1F2UB 1PZNA 2P5YA 3BIFA 3PPYA 3L82B 1CUZA 4M1TA 1SMKA 1QH8A 3CZAA 2B30A 4R0MA 4ER7A 4OIFA 4UM9D 2J6BA 3AQIA 1K68A 3L93A 3OFND 4QUDA 2WR8A 2X1HA 2YIJA 1T2CA 1L7QA 2QM8A 4N3GA 1ISGA 5K3FA 3ZI7A 2BRUC 2XDYA 4N8EA 5FQOA 1CJMA 3T4XA 1VJDA 3E5MA 2C5FA 1WB9A 2E4XA 2QN9A 1GZ3A 5AW5A 1IULA 3LUKA 1L5HA 2RHRA 3E70C 1EZ1A 5EP3A 4HQRA 1DHTA 3REGA 3SQMA 4BE7B 1JR3D 2HTEA 5E7MA 4TT3D 3WJ1A 4WY2A 1HTWA 2WT9A 3F5FA 4JBIA 3BKXA 1WDWB 2IQ5A 3C3MA 2PWYA 2CMKA 4OSPA 4YAOA 4DSTA 5KVCA 7MHTA 4DHEA 4KWIA 1S4MA 1CSEE 1YVDA 1ZD9A 2E0IA 2Z5GA 3MWDB 3PUWA 3UMBA 3PP8A 1AMUA 2R85A 5AXBA 4LE2A 1NONA 4TKVB 3ZBQA 4PZPA 1NV8A 3JTMA 4TUYA 4ZJZA 1D7OA 2C4TA 4MGKR 2IHBA 3V3TA 2MMCA 2D5LA 1WCWA 1K8XB 1SBNE 1YQEA 1PFYA 4Q4AB 1VYTA 3KAJA 2H63A 2HA0A 4R1QA 1T6XA 1QGED 3LDAA 2VHCA 2HC9A 4OQQA 1VBFA 4JLMA 4DQXA 3THSA 1XQ9A 1JHRA 2COUA 2CUTA 3N0TA 3ELYA 3FJOA 2PN1A 3S81A 3KKQA 2O19A 3ZCTA 2OCXA 5F7XA 3INGA 4ITUA 3KLBA 4OLFA 2Q3JA 4HX2A 5BNZA 1U3TA 4FYWA 3O8RA 2GEKA 5FOVA 3RVQA 5H0IA 3PUVA 2GTHA 2PO5A 4K88A 1DG1G 1EEHA 1M6VA 2SHKA 3TS1A 1DOHA 1O6BA 4LYHA 1UMDA 2E89A 4F86A 2Z2KA 1GPYA 4EDFA 1D09A 1UADA 1F2DA 3QUTA 1U2GA