1YIDA

Crystal structure of tryptophanyl trna synthetase ii from deinococcus radiodurans in complex with atp.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
331
structure length
331
Chain Sequence
ARPRVLTGDRPTGALHLGHLAGSLQNRVRLQDEAELFVLLADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGERVPAGFFVYPVSQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALYAPVLAEPQAQLSRVPRLPGLDGQAKMSKSLGNAIALGDSADEVARKVMGMYTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRLFGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tryptophanyl-tRNA synthetase
publication title Structures of tryptophanyl-tRNA synthetase II from Deinococcus radiodurans bound to ATP and tryptophan. Insight into subunit cooperativity and domain motions linked to catalysis
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
total genus 106
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1yidA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1yidA01
3CLTC 2NZ2A 4ZT3A 2E0IA 1NUPA 4EG3A 5DEOA 4NATA 1NUTA 3UOWA 1O97C 3VU8A 4U8HA 2QUIA 4MAFA 2RD2A 4JFAA 2PXHA 3HZRA 2I1LA 1T6ZA 5KHAA 3DPIA 1KORA 2CV0A 4ND7A 5LM3A 4EGAA 1ZH0A 4YP7A 3JXEA 2QJFA 4KPUB 4YP6A 4Q16A 2DERA 1MAUA 2E21A 5KWVA 1J1UA 3FH0A 1CT9A 3CLRD 3X1KA 1JMVA 4L2IB 1YI8A 2A7XA 3Q12A 4MLPA 3K9WA 1M8FA 1JGTA 1G8HA 1TQ8A 2A1TS 1O96A 3FIUA 5IJXA 1O94D 3UK2A 1JIJA 1V47A 1T9GS 2EJCA 1NYLA 3ILVA 4RUKA 1H1TA 3IMGA 3S3TA 4P2BA 1EFVA 1N2GA 2GOYA 1F4LA 4WNYA 1F9AA 1O95C 1MBZA 2ZUFA 3D6UA 2AZXA 3C8ZA 3RK0A 3M5WA 1IRXA 1WXEA 2EL7A 2PFSA 2CUZA 5HG0A 1XNHA 2PIDA 1GPMA 2R5WA 2AKEA 3G59A 1MB2A 2VTBA 4DDHA 3ISJA 4BWVA 2E18A 3NV7A 4PBSA 4ND6A 3DO8A 3HL4A 3MXTA 3OP1A 3PXUA 4EG1A 1O97D 4ZCTA 1M8PA 4NAUA 4KR6A 3MMXA 4F3RA 4ARCA 2HMAA 1O0CA 5TS2A 1M8JA 1MAWA 1N2OA 3CLUD 3ZUGA 1R6TA 3SDBA 2YWCA 3UY4A 3CVVA 1D2RA 4YMIA 1QU2A 5J58A 2WB2A 2X1MA 1OWNA 3N2YA 3CLRC 1N2JA 1KAQA 1N78A 3COVA 3CA8A 3RHSA 1OD6A 1TYAE 2E89A 4CDNA 2JA2A 4RPIA 2CYCA 2DLCX 1OWPA 4EG8A 1WKBA 2B7LA 1B6TA 3IUEA 2ZP1A 3N9IA 1JEDA 1N2HA 3DV2A 4R0NA 3MLBA 1VLHA 1KH3A 4UZFA 5K0TA 1H3EA 4NX2A 1MJHA 5DASA 4MW4A 1Q19A 4EF6A 4PBTA 3HGMA 1O95D 1U0BB 3IVXA 3VRHA 3RBAA 1K97A 3LOQA 1MRZA 3QTTA 1IQ0A 1EFVB 2GM3A 1VBKA 4DDMA 2XRYA 3PRHA 3D6VA 1IQRA 1X6VA 1EFPA 1JZQA 2A1UA 3RFFA 2WQ6A 4MW7A 1ZJWA 4X0EA 1JEEA 3IVGA 1WXHA 4DLPA 3X1JA 3KFLA 4S1OA 1YUNA 3CLUC 3G5AA 3ZJTA 3FOCA 3A2KA 2VTBB 1NP7A 1V8FA 1O0BA 1LI5A 3GMIA 3L92A 4CQNA 4I6EA 4JXXA 4QBTA 1ZUNA 4EG6A 1PFWA 3HMQA 1QJCA 3AL0C 1KQPA 1KQOA 2PZAA 2QJTA 2CYBA 1IH8A 1KR2A 1J70A 2PZBA 2Z09A 1N2IA 2J07A 2QTNA 3H99A 3SEQA 1NSYA 4ZCSA 2TS1A 4YBRA 3IUBA 1G8FA 3NBKA 1JILA 3CLSD 4PY2A 4DNXA 2A1TR 1ZH6A 3CVXA 1QRUA 1YUMA 3FY4A 2BYTA 4ZT4A 1KH2A 1MC1A 1M8KA 1ILEA 2V0GA 1U3CA 2QTMA 3COWA 2VXOA 1YIAA 5HUJA 4MW2A 1N77A 1Q11A 4MUGA 1A8HA 4MUKA 4DJAA 1KP3A 4ZCRA 1PG2A 3MUEA 4KR9A 1K4MA 4OJMX 3IMCA 2ZUEA 3AG6A 4A91A 1GLNA 1F7VA 2A86A 1WXIA 1I6LA 4MUIA 3LCJA 4MQ6A 2YY5A 3PNVA 4MWEA 4MW0A 2A88A 3IODA 2BTEA 2IELA 1K4KA 4ZT6A 4F4HA 1WQ4A 1DNPA 2J5BA 2QUKA 3ZIUA 2AG6A 1EFPB 2A1UB 1TEZA 4WSOA 1O5TA 4HK4A 2OV4A 4Q93A 1JIKA 4AS1A 4MUNA 3FG9A 3ND5A 1QTQA 1TYCA 4MW6A 4UZEA 1NURA 1JIIA 1NUQA 5AHWA 1KQNA 1M8GA 3SP1A 3A4IA 1WZ2A 4I6JA 1VBMA 4KKVA 4XFDA 4J75A 2C5SA 5H7XA 4MUEA 3G6KA 2D54A 2J4DA 1G8GA 2QUJA 4CDMA 1GZUA 1NUUA 4ZCPA 5H16A 3NBAA 3CLSC 1I6MA 4HJRA 4OUDA 1RQGA 3INNA 4R2MA 5FO0A 2CV1A 1EE1A 1M83A 3P0HA 4KR7A 3H05A 1NUSA 4G5YA 5TEWA 1TFUA 3HV0A 1PFUA 4DE5A 4ZT2A 3SZ3A 4TS1A 2D13A 4CT0A 2WSIA 4FZJA 1KP2A 4J76A 1PFYA 2OQ2A 4ZCQA 3ZXIA 4MWCA 1MB9A 1QNFA 2O8VA 5FNZA 3IOBA 1WXGA 4NZPA 1OBHA 3K32A 4XSVA 2A84A 1IVSA 3FDXA 2JANA 1YIDA 3PNBA 4MWBA 3FWKA 3F3MA 1JECA 5TGTA 1K92A 1JHDA 4YP5A 1J1ZA 1KAMA 1N2BA 1WQ3A 2X1LA 3N05A 2DEUA 1TYDE 4MW9A 2H29A 5J59A 3COYA 3CVWA 2QUHA 1X8XA 1OWOA 4JYZA 4EG4A 1U3DA 3TNJA 5F23A 1S4MA 2NSYA 3IOCA 1N3LA 2CYAA 1OWMA 2G36A 4EFKA 1UFVA 4G5FA 1LI7A 1T6XA 3AFHA 1F7UA 3H9CA 1HYBA 1J20A 1Q15A 2HGZA 3KT8A 1MOPA 1H3NA 1LW7A 5DK4A 3AKZA 1FYDA 5IHXA 5TEVA 1QRSA 4HJXA 3KT3A 2X3FA 4G6ZA 3ZGZA 1OBCA 4MVYA 2A4MA 1YULA 4ZT5A 3TS1A 1NZJA 3TQOA 2JAXA 1VL2A 5KCMA 1R6UA 3FI0A 3P0IA 1WXFA 1P7PA 3CR8A 3FNRA 1R6XA 3IOEA 4JZYA 1XNJA 2D5BA 3U1VA 3FHJA 2H2AA 3HFJA 4QRDA 3CVYA 4PBRA 3H97A 2WQ7A 2DETA 1T9GR 3DLAA 3QTBA 1QRTA 4OUDB 1GTRA 3IH5A 3H9BA 4GRIA 1U7XA 1PFVA 1QQTA 4MVCA 2J09A 2PZ8A 2CFOA 2DXIA 3P52A 4R2LA 1XJQA 1EUQA 1COZA 3PNYA 2HZ7A 2IP1A 3COZA 3E27A 3IVCA 4MVWA 1N75A 4HPWA 3LE8A 5LLTA 2J08A 1OWLA 3CVUA 1U7DA 4H3SA 5HUHA 3ZJUA 3MLAA 5J5AA 4U63A 4MULA 1PG0A 3GUZA 3SEZA 3BL5A 4NAHA 4MUJA 4JXZA 4E1AA 2CT8A 5FO1A 4MUHA 1WY5A 4ZT7A 1N2EA 1EXDA 1I2DA 4ARIA 5EKDA 4EG7A 5K0SA 5JBNA 1BS2A 4QREA 3P0JA 3TQIA 3CLTD 2PG3A 2DR2A 2V0CA 1QU3A 4KPUA 1GN8A 4AQ7A 2QJOA 3ND6A 2DUMA 3Q4GA 4MWDA 3SZGA 4MW1A 3A05A 4I6GA 3KT6A 3QE4A 1ULHA 1GTSA 1IHOA 3UMVA 1Y42X 4L2IA 1M1ZA 1JZSA 5DB4A 1KKUA 1IQUA 1SURA 3RJZA 2QTRA 3X1MA 2XRZA 4MUFA 3AIIA 3IMEA 3N8HA 3UC5A 3ZXSA 2DPLA 2X0KA 1FFYA 4K0RA 4U7JA 2YWBA 3AG5A 3TZEA 3VGJA 2Z3VA 3SYTA 3ELBA 1TYBE 2Z08A 2O5RA 1Q77A 1O94C 3A04A 4MVXA 3GLVA 1EJ2A 3OTWA 2RE8A 5LFAA 4DDKA 5BNZA 3I05A 1J09A 3IDFA 1GAXA 3ND7A 2IJGX 1G59A 2CSXA 4EG5A 1O6BA 2YXNA 4NDAA 1WOYA 1N1DA 4K03A 2CV2A 1O96B 1KH1A 1WJGA 1H3FA 1EUYA 1T6YA 4MW5A 3ZJVA 2GKSA 4XFJA 3KT0A 1NI5A 1I6KA 1VBNA 3Q10A 3TZLA 1J21A 1IFXA 3RK1A 3L93A 3FETA 1XNGA 4GU5A
chains in the Genus database with same CATH superfamily
2D4HA 2GEKA 4Q4CA 3SYKA 5BO5A 4Y9SA 1R16A 2XNSA 2XJ4A 4NEGA 4C22A 4LMBA 2QLMA 3IB6A 1KYXA 2RHCA 3X2EA 1FMTA 3GLGA 3KWMA 2IUUA 4U8HA 5MHTA 4ZO9A 2CXRA 3WMEA 1OGYA 4B71A 2V6GA 3MB5A 4ND1A 2YXEA 1QSGA 4ZAGA 2ETXA 4HFJA 4Y8VA 2WK1A 4XSHA 4HNRA 3U56A 2QR3A 1L7VC 4NQRA 3C6MA 1QFJA 1T2FA 3GLTA 5GIOE 2PU7A 3MQ4A 2DQ4A 2W6NA 2G9ZA 4MX8A 2YBEA 4R2XA 5SICE 3SHFA 4HDMA 1D04A 1ECLA 1IBRA 3JQEA 4RK7A 4G0VA 3B78A 3EVCA 5EZ5A 1FTNA 1IOLA 1FFBA 1SCDA 4KPUB 5DOZA 4ZU6X 4IHAA 4B83A 3E0QA 4QTXA 5G3ZA 5CURA 5U1PA 3V9AA 1N1EA 1E2IA 3C87A 4EENA 1J8VA 3IQHX 4NHEA 2FSGA 3IQWA 1JF8A 1CT9A 3KSRA 3UFBA 4HMPA 3UJ3X 4ZCIA 4Q3KA 2B3TA 2OD2A 4IJQA 3X1KA 3DLPX 2MYUA 2QZZA 4IJVA 3HLTA 4E0BA 2CFIA 4GR9A 2O50A 5EZ6B 1MUUA 1AT1A 3OIUA 4X64B 5B2FA 5BY2A 2H1LA 1JI0A 1O96A 3RS8A 1D0SA 1JIJA 2OXEA 1GL7A 3FWZA 2DMRA 4LDRA 4ZZ1A 3KAQA 2DBVO 4X65B 2ZWAA 2JCSA 2ZRFA 3DCIA 1E9EA 4P2BA 4M0PA 5G1OA 2GOYA 1ORWA 3EOAI 5AVXA 5JAMA 4MGZR 3TM5A 1TKBA 1L8XA 1VLQA 4RE5A 1CZRA 4BQPA 4XDZA 2X9NA 1R4AA 2KJQA 3K1JA 4PPNA 5J63A 3AHEA 3RHFA 4CKEB 5A02A 3ZCTA 1EINA 1XRPA 1KGDA 4MJ3A 2X2FA 1M6WA 2ZSIA 1EZ1A 2NAPA 2PS3A 3ZJYA 2P4QA 1XEXB 4HLUA 1RWBA 2GJ9A 3LWZA 3R5KA 2ZRLA 4TQAA 4RD3A 4LF9B 4OSOA 5DM60 2ZJOA 1BVHA 1DARA 3DL7A 3KR0A 5CU7A 5AJHA 3OKAA 3WMFA 4RW0A 5DYGA 2C7OA 1H1LB 5JE8A 4C5BA 1M8PA 1W47A 1QYVA 3AKDA 1EE9A 5K3FB 4GMXA 1CUZA 3M9LA 3QEMA 2HK6A 2WICA 1WBBA 1WOMA 2XKBA 5D1HA 3CZQA 3VR3A 1UK7A 5TLSA 1KOFA 2EGHA 2I4LA 5F33A 1SHKA 3NXSA 3WHKA 1B2RA 3PGKA 1IG0A 2Q8QA 2OWDA 1SG0A 4S0XA 4NMLA 4O33A 1R9NA 4F12A 3RRBA 1W85A 1QU2A 5J58A 1W88B 2PSEA 3CX7A 3FYDA 3IO5A 3Q5GA 4JI3B 2PZJA 4B75A 5JZSA 4R1OA 1SQFA 1JR3D 1PU2A 1OZGA 2Q7OE 3ELUA 3A6EA 5EHXA 3GFTA 5IT4A 5KVSA 3RSQA 1OD6A 5DSZA 2EV9A 4BVBA 2FZ5A 5LDDC 3H9QA 4MR8A 2HXGA 2A5YB 2OXFA 3FN4A 3I4FA 3OM8A 4KSCA 5FI0B 3VR3D 4RPIA 4DT1A 2Z8XA 1GVNB 2DLCX 4GPBA 4ABYA 1X15A 3QKTA 3AR3A 3BRSA 1ISRA 2Y27A 5CIWA 5DSTA 2BGIA 3ZE9A 1YD7A 4BFYA 4Q7MB 4DLBA 2UU9B 1N34B 3CBQA 3I5AA 3GCXA 1F1JA 1X1BA 1TZMA 5LIPA 3FLBA 3HKDB 1PTKA 1Z63A 4HAVA 4WUVA 1U7UA 3N59A 1TIBA 2W00A 2O1SA 4A0QA 4JQYA 2CLFB 2R87A 4O2AA 3ZHZA 5ITZA 1X7HA 4BAGA 4YLYA 2ISCA 1D09A 4EF6A 3BWXA 3E7WA 4PBTA 3Q8MA 3Q5EA 4CDRA 3PDCA 1OXTA 2QBYB 4QWWA 5H9VA 2IRWA 4TKVB 3THWA 4YRRA 1RQNA 3GH1A 3HCDA 3MIIA 1OLUB 1KERA 5FBQB 2AFIE 3OLYA 4BGUA 2FZGA 3K09C 4MEBA 1E3MA 1GFSA 4KH1A 2OGUA 2QLLA 1GUBA 2CN1A 3QGMA 4XYLA 2YRXA 1P1HA 3BXZA 2OFOA 2WJVA 1YFJA 2Z4RA 1E1QD 1C80A 3ZU3A 1S1MA 3HS3A 3IIKA 1DIBA 1NHWA 2VJKA 3FD8A 1KVQA 4IGIA 1MH9A 3V1UA 3WYAA 1E7RA 5JSYA 5CA1B 3GP3A 1VGVA 3WIBA 2ET6A 3RIHA 3MW8A 4BL5A 4CQNA 4O1MA 3IDSA 3OMXA 1CVRA 1VC2A 2CNLA 3GRYA 2RGEA 2Z58A 1FZQA 2J6CA 3TTTA 3ZDDA 4IGEA 1QJCA 4AZ3B 2PRSA 4A8HA 1DKQA 2I7XA 5CX1B 4Y2QA 1XIVA 1J70A 3AV3A 1AQJA 4M46A 1RJFA 1BE1A 2PX8A 4DJ5X 1NSYA 4FQ5A 1AMOA 1FSZA 5LSAA 5LL6P 3CSDA 3QLUA 3T5PA 2IHNA 1DAKA 1Y1LA 2P68A 3T5DA 3GAMA 1PEYA 1BRTA 2ZAIA 1NDQA 2C9MA 3O21A 3BFJA 5CDGA 1BDMA 4KJZA 1ISFA 5I6DA 3CKYA 1OAKA 3BWYA 4K87A 2R9VA 2G83A 4NLLA 1K5GA 3PXXA 1T4DA 3TVTA 5KTYA 5LJIA 5EJ6A 2IZ1A 2JJQA 2R1UA 1QF9A 4GP7A 1I7QB 1YRHA 2RK3A 5ALIA 4ZJZA 3JYNA 3CZAA 1EK2A 4PWZA 1JPJA 3OHSX 4MI9A 2OGZA 4OGLA 4YAIA 3OOHA 1A8HA 2PV0A 1X8KA 2XA1A 4CLXA 5SY6A 5HKOA 5AVQA 4MPPA 1QVAA 4NXMB 3EUAA 3AYXB 1XEFA 1MX1A 3KQPA 4DY4A 3GRZA 1YTUA 4ECAA 2ATVA 2XCSB 2DE0X 2JHGA 3ZXYA 2PMCA 1LPOA 2VSNA 3ZHTA 5EJ5A 2GD0A 3E1SA 4RC9A 1YRQA 2BFCB 2BI8A 3G8DA 4KKXB 4EKYA 4XW2A 4KITB 1CUBA 1BXGB 1P6UA 2ATCA 3SFTA 4RIIA 2XE4A 1AY0A 2XDQA 2R25B 1CZKA 1XPOA 2PO7A 3AETB 2AYYA 2UYHA 1J22A 4M6WA 2HEIA 5E6UA 3WK5A 1NQVA 4EYKA 3UW1A 4OK6A 3M6MD 3TLXA 2J9RA 1S96A 3O8NA 3HKBA 3NX4A 5EAIA 3CE9A 2ECOA 5AM2A 4F21A 1P33A 2REXB 2JD2A 2R85A 4QOIA 1TEZA 2C4TA 1US8B 5CB4F 5CCXA 1NMXA 1OBOA 2EFHB 3L6OO 4RA9A 1YU6A 5T64A 4RGYA 2M9MA 3FMGA 2ZU0C 5LQMA 3K5IA 3NV9A 1NURA 4DG8A 4A73A 3MBOA 4W6QA 3UYKA 3K4QA 3BQNB 3AHGA 3MB8A 2Q1XA 3ROZA 2JL1A 4F8YA 3RS5A 2F00A 4NJEA 1BH2A 2EGUA 4P4SB 5T6BA 1RAAA 2CL7X 4PQYA 2QTAA 1C50A 4LXXA 3EE6A 3SZUA 3ICQB 4KL8S 4ZO6A 5G41A 7REQB 3NBAA 3EVTA 4LYFA 1HFJA 2ZUWA 4FXOA 3LVQE 1JG2A 1R0RE 3L0ZA 5AJXA 5AJUA 3OZEA 4LY9A 2GJAA 1RPZA 1GEEA 3L8ZA 3U7QB 3UHAA 1MMFB 3T06B 1KARA 2DQKA 1X39A 2DKNA 1LQUA 1A71A 3FSJX 4J4BA 4RESA 2DTXA 4O3MA 3DMPA 1BWSA 3HYLA 3LBAA 4OFXA 1XMXA 1NE2A 2WSIA 3A8TA 3SIPA 3VZSA 2H5JA 4X91A 1RVV1 1LVGA 4UUBA 4REQA 1SK9A 4CW7A 4AULA 1KPGA 2QX9A 3CCBA 3ESXA 1P7YA 1T9BA 1X7YB 2COEA 3GAAA 1U7OA 3KPJA 1IEQA 4L0DA 4Y9UA 2ZYSA 3TJMA 2G25A 4LYYA 4MOWA 2VT3A 1H6AA 1K68A 1IVSA 3F5DA 1YIDA 1EIZA 1YL6A 5FNVB 1HTBA 1D2CA 1Q7BA 2HI0A 5AXDA 1KY5A 5TGTA 2YR0A 2G4VA 3P94A 1XSEA 1BE8A 3GR6A 2HV9A 1V9SA 1AK1A 3LHIA 1EYZA 4GOND 3W4JA 1TYDE 5CM2Z 3TOXA 1HNZB 1ZOPA 2GGSA 4KWEA 3FVRA 3MWDA 3OWOA 1TYEB 4XXHA 1PZFA 2Y2UA 1KZ4A 1MEJA 3RSSA 1W4CA 4D4MA 5E0KB 1U8TA 4YR9A 4YVFA 4UM7A 5IT5A 3PC7A 5CNKA 1HZJA 3L01A 1EXVA 1TD1A 1Z6AA 3MINB 3I2KA 2B34A 3AFHA 4AG6A 5KVVA 2JZOA 2Z98A 3WGTA 4OQLA 2CC2A 3C2QA 4A7PA 2WHPA 1JKFA 3AKZA 3DL2A 1NKSA 3LFUA 3OSUA 3IKLA 3KT3A 4GLFA 3SDSA 3WSTA 2R7KA 4B3IA 5C8XA 4EUSA 2EFCB 2Q5LA 2ZBPA 1YASA 5D7NA 2HYDA 4RTPA 5BXQC 4B2YA 5LYYA 1JLMA 4Q4HA 3ITDA 3AMVA 1EM6A 4HGPA 3S99A 1UC4B 3IXMA 1AKUA 4CF6A 4JB3A 3AVTA 5KJEA 3STYA 3H1PA 1EQ2A 4XGQA 3NEAA 2GBIA 2OHOA 4Y98A 1UKAA 5ALUA 2A8YA 1STOA 2R751 3BE4A 5JNVA 4EATA 5KTRA 2H2AA 3K71B 2OR3A 4BHTA 4ZGGA 3ZPXA 2ZJ1A 3Q7PA 4IGFA 4QRDA 3G85A 3UBTA 3EMDA 4U02A 4DA7A 1Q7GA 3A3PA 4UVGA 4ZZ2A 4MMYB 2OV8A 5JXJA 4UCXA 3D4PA 3IP7A 1F06A 1KSFX 3HLKA 3JV7A 3QLTA 1NJSA 2PZ8A 3W5VA 1C3EA 1EKXA 2A0FA 5EPUA 4TWAA 2F9FA 3D8SA 4IJMA 1NF3A 1WA5A 2WZDA 1KDYA 1XJQA 3B2QA 2CHGA 3LDHA 2EWVA 4QYIA 2BISA 3OWXA 4Q82A 4D3DA 5FOQA 4QU9A 3G2KA 2H3HA 2O7QA 3W6PA 4F1WA 1V4NA 3IJEB 4J0IA 1NWHA 1ZNQO 1XNQB 5TC4A 1L2TA 2BF7A 5EI5A 1NXOA 1NIJA 4M2LA 1U0SY 2JCYA 4IUYA 1NVVR 2Z2JA 4NZMA 5DN6A 2PN1A 3EEQA 5AOAA 2NAFA 3G7SA 3QVWA 4H3SA 2KS6A 2Y0CA 3SX2A 1PG0A 3VNUA 4Z0PA 3WKEA 2AUMA 1WE2A 4LBWA 1EFLA 5J4YA 3Q7IA 1CQIA 4JMLA 5K8CA 3WYNA 1XKLA 4JDPA 5IJ0B 3UUGA 4F3CA 4OATA 1Q7RA 3ILXA 2H63A 4MUHA 1A5ZA 5ES4B 1KPHA 3BXFA 5B3JA 2IODA 5EWJA 1CFJA 3VC1A 3I04A 3UA4A 4NCNA 3QFTA 3GGCA 2JFZA 1E9CA 1YDHA 1K6MA 3DMGA 4ZODA 2L19A 4ENRA 1K5PA 1NXXA 3ORSA 2KB0A 2DR2A 2FWRA 3HJAA 3QPBA 2IYSA 4KXMA 2WPDD 5KREA 5IDXA 2OBLA 4L74A 3NVKI 2QRHA 1GN8A 3G1WA 3HU3A 2V7WA 4AQ7A 1G2IA 3K9NA 1CUJA 2XWJI 4MWDA 3KVOA 4TSFA 5K3BA 3E22B 2PLRA 1U2GC 3KKEA 4MW1A 3VHXB 5JZVA 5KWEA 2RHMA 1ECFA 2FN9A 3W3AA 3IOYA 1IZZA 3CWZA 4NH4A 3PNOA 5J5VA 1AZWA 4NV1A 1WETA 3RVKA 4XWAA 5CFQA 1T2EA 3IELA 4FD3A 4JB2A 3T1NA 1NRJB 1ZBQA 1UT8A 3ICOA 1JTEA 4O29A 4BJ6A 5BUSA 3WV4A 3VXKA 2VPTA 2BPOA 5FXMA 4ZICA 1EEXB 4BV8A 1HT1E 1QB7A 3TOZA 1JVNA 1VSQA 1RADA 5F5XA 4J1TA 2V7QA 4JU8A 1GG8A 4O2AF 3ESCA 4R01A 4TSFD 3OHMA 4E12A 4Z4IA 1O6CA 2GTPA 3I12A 1R4ZA 1S2MA 3W3AD 4AX8A 1E2FA 2YC4C 3D7KA 2I2XB 4WZAA 1ZD4A 2VT7A 2OV6A 4HVTA 5BSEA 2OLJA 2Y93A 4W99A 5AKXA 1JKJA 3NCHA 1YJQA 4Y1RA 1DFGA 1RXEA 2XUDA 4FX5A 4UUAA 1V35A 4NYJR 5DHSA 3QM1A 3UG7A 1DV1A 4DCCA 3F90A 2RGNA 5EIWA 1PJZA 4XJTA 2OO3A 1T35A 1N1DA 1LVHA 4PYJA 4DILA 3FVTA 3AOEC 2QYOA 3FYUA 5DYNA 2HA6A 3TO5A 3F9RA 4B44A 4DXAA 3BGIA 3SYLA 1A76A 2IYLD 2IV7A 2RK4A 5BVHA 1NN5A 1SUIA 1ONSA 3FB4A 4B43A 5F7XA 3SEFA 1R88A 4WNAA 3TZLA 2R4TA 3U6BA 4WLEA 3RK1A 2CUKA 3G5TA 2IH2A 1XNGA 4C0JA 2FTKE 2ACVA 3ROGA 5LP6A 1NVTA 2R8OA 1QYWA 2E0IA 2Y1FA 3EQ7A 4OJNA 2COKA 5DBEX 4BVKA 1QO0D 3IVMA 5T41A 2CV0A 2VT2A 4FN5A 4JJEA 3DDCA 1O97C 2EXXA 3NONA 3ABSB 3TX2A 3TQTA 3DVAA 1FMFA 2XEXA 4FZRA 4MAFA 3RIXA 2PXHA 5KHAA 4B09A 2G6TA 3ETNA 3EIFA 4J6EA 1PJAA 4G1UC 1N7IA 4R9UC 1IPHA 3RAFC 3BX1A 3DD5A 2N1MA 4YJKA 2CLKB 2CLOB 2EF0A 4QXQA 1DBSA 1H4VB 1KL7A 4LPSA 1W35A 4LX8A 4MKIA 4AUEA 1QUEA 1RMTA 2CGEA 1YS2X 1EDEA 4U7DA 3MERA 5I4KA 4J7CA 1OB2A 1I80A 4TLLB 1JG4A 4FFVA 2BR3A 4LYJA 1SBYA 5IH3A 2ZI9A 4A8JB 4F4JA 2H9IA 4D8XA 2I3GA 4CEJA 5LMCA 3RVQA 5HF9A 5E7MA 2B21A 4JGBA 1ZR2A 2V96A 3TW8B 3UAGA 1N2SA 4RPKA 2I4OA 4BNMA 3K9FC 4E5NA 1I33A 1K0FA 1U9IA 2OC9A 4BN5A 4OLBA 3LX8A 5LVAA 2GRUA 3FIUA 5IJXA 2ZIUB 4GC9A 3ZX5A 1UZNA 1G291 3DP9A 2FR1A 2LCIA 4HYYA 3R09A 3ZN2A 3R5SA 1NTOA 1VKOA 4J90A 2P3LA 4WZ6A 2FSHA 3OTQA 5E3HA 1WUIS 5IRCD 1N5LA 3DZDA 4WY2A 1A8IA 2QDXA 3R6TA 4QGHA 4HFMA 4GI3A 3TMAA 4BNXA 4DR3B 4FMDF 1LPBB 2C1XA 4B34A 2BM0A 2XAAA 5KYUB 4B0PA 4B3CA 4M1ZA 5FP0A 4MYRA 3LV8A 3SBEA 2VUIB 3M5WA 4BNGA 1J97A 3OCCA 3PL1A 4LJKA 4BNNA 3BWBA 2C2WA 1XNHA 2PRKA 4F4UA 5AUOB 1HURA 1RCTE 4LZNA 2PAAA 2PL1A 1BCRA 2GN0A 3F8WA 1FP2A 3VA7A 1BGWA 2VTBA 4EIWA 4XM1A 4JYPA 3UWOA 1ZR4A 4GAEA 4PBSA 3PDJA 2ZCJA 1FW6A 1UAGA 3ZD6A 4ZMSA 1NPTO 5F77A 3B2NA 3M5CA 4Q3NA 5CPBA 3ZH9B 5AVKA 5BOSB 2ZJFA 2YOFA 3AEQB 2Y4OA 3WRYC 3EBOA 3WJ2A 3HBFA 2AX4A 2Q1SA 2CLLB 2ZITA 4LWQA 5HF5A 2BIFA 1C8VB 5HOEA 4C0KA 5EHZA 3EIHA 1IEWA 1Q84A 2LZ0A 4AY6A 5KZMB 2ZETA 5EEGA 1I3CA 4LE2A 4BMZA 2I8CA 5F9HA 1J0DA 1H0RA 4R7GA 2AQ8A 2PUGA 4PPFA 6Q21A 4GC5A 4N4AA 2C5FA 1TW3A 3CLRC 3Q11A 4O08A 4PC6A 2AF3C 1J07A 3L9XA 3NTXA 4ZQHA 1CUYA 4H6XA 3JWIA 1SUDA 2OMEA 1TJNA 3TR0A 2WBLC 3RUPA 4M87A 1X7WA 4G86A 1N6HA 1O95A 3WQSB 1GLGA 4YMGA 3HEBA 1KKLA 3Q9UA 1LV7A 4B40A 5ADVA 5JI2E 4QOHA 4G0UA 3DV9A 1JIVA 3HN6A 1P6XA 3HXKA 4I4TA 3BMXA 3AV0B 5DTEA 4C14A 1A5SB 5ICMA 5JV5A 5BPFA 3J81A 1P9OA 3BEOA 3DT8A 4IQFA 2EKQA 2XVAA 1YWGO 4L5JA 3M6FA 1KH3A 1O9GA 1ODCA 4KVGA 4WZBA 1OI3A 1D1SA 1N0IA 2JGMA 2PGDA 1M9NA 4UHDA 5BUCA 3W5AA 2H7XA 1QYIA 2AVNA 1RTTA 4I9HA 5F2OA 5DASA 3L9WA 3PPVA 2OBNA 1OLXA 2X7JA 1C8LA 3PIDA 2C9DA 1Q19A 2W6PA 3SXPA 4E09A 3W5DA 1IEVA 4M0FA 1LDBA 4DKXA 1O95D 5I8ZA 1NPDA 1R0WA 3H8JA 2IIQA 4TZ0A 4Q21A 5AKJA 1DG1G 2O5VA 5TRTA 1IHUA 3CUSA 4PG4A 3TMYA 2HIAA 2BKUA 4EHDA 2RIRA 4KOEC 2HR1A 1Z4PX 1U2DA 4YMLA 3TTXA 1NDUA 5FWXB 1FP1D 4WLFA 5G2OA 4OOFA 4C6SA 4DVJA 4M0CA 4X0EA 1OBVA 1EFCA 1IM5A 1OVGA 2CJWA 5FUBA 1G2QA 2EX0A 2GBGA 3SI7A 3ELWA 3HJTA 1P2BA 3NBYC 2H1VA 1ZW6A 4E32A 4CMJA 3AR8A 5DGIA 2HJ9A 3BGDA 5ER6A 2O19A 3FGPA 3PFFA 3W7VA 1VHJA 2IYUA 2GZAA 2C9CA 1PKEA 4K9NA 2CVFA 4D0LB 3MMZA 3A58B 4JVSB 4PF1A 4LF7B 3TUJC 1K7FB 4TLBA 1ZHFA 1ZUNA 2FUCA 1PFWA 4U2KA 4X7PA 1CERA 2Q46A 4JOBA 4AT1A 2W4IA 5CFRA 1A2KC 3DMFA 4IRXA 1DKMA 1FYVA 4IDFA 4R69A 1K9SA 3SJBA 2CF5A 5KNBD 3TTSA 3AVOA 2GBLC 3ROTA 3ROQA 4YJGA 4YDHB 2WV9A 5DTMA 3JQAB 4Z54A 2PZBA 4WNIA 1CEQA 4QAJA 2PPVA 3TZBA 4CMCA 3AC0A 4TVBA 1KZ9A 1G3UA 1H85A 4DBLC 1FB5A 2F64A 1L6IA 2UVPA 3NXKA 4IGAA 3RFVA 4RULA 2ZZMA 2H11A 1T1JA 4N0MA 3QFSA 2WWFA 3VZRA 1MC8A 2OILA 2VXBA 3E3MA 3HB4X 5D3ZA 5K0NA 1H6BA 1VIYA 4DHEA 2OB2A 2XGMA 1XRRA 3L79A 4DNXA 4PTLA 2CXSA 1EG7A 3O4RA 1QRUA 4P54A 5SZJA 1PGJA 3HCEA 1PJ2A 1TM1E 2Q4TA 1SXJD 2JKYA 3FGNA 4A2CA 5HUJA 2QPLA 3AO0B 3TI7A 4ACBA 3DZJA 3X2FA 5I01A 4KLNA 2VDWA 4CFZA 1WUHS 1QHNA 3TTYA 1C3OA 1P29A 1PG2A 1W9MA 2ZRPA 3UB2A 2XMBA 4QYMA 3GZTB 4ARZB 3FGOA 2C9YA 3SICE 2JD0A 3DAFA 5AW8A 4YN3A 2O8DB 3LCVB 2R6HA 3TRFA 3EQ6A 1AA9A 4QJ4A 4X63A 3W2EA 4CIAA 3F3SA 3LDAA 1NG9A 1PFQA 3ZWXA 2O8BB 2ECPA 2HJWA 1CQXA 1NC1A 3AR6A 1HNWB 2P35A 4R05A 3RUIA 1N8KA 3CRQA 3EG9B 3WRXA 3DXFA 1OYYA 2OQIA 3NNNA 1GRCA 2BHTA 2IHJA 2P40A 4FS8A 4GLOA 3S2ZA 3MQFA 3QUTA 3E18A 4UVDA 5JRZA 5JU6A 2ZJ8A 4DCVA 3BK2A 4KRXA 5F3WB 5KNDD 4YCNA 2YFKA 2YHUA 1L7OA 3N2ZB 2FSIA 1DQRA 1IPFA 4OGGA 3ZS9A 1QTQA 2F67A 4MEAA 1YA6A 5U9CA 1X2BA 3E84A 4G01B 4BPBA 1A2OA 2A0KA 3UXYA 4N5LA 4AJPA 3ID6C 2Y0DA 4D99A 4OOEA 2BEUB 1DEXA 2JDIA 1E7WA 4KN9S 3UUFA 1E5TA 3QYAA 5FYDA 4L1KA 1WNTA 4DWWA 1C7QA 4HT3B 4GX5A 1FXUA 4RA6B 5JY6A 1DOZA 4ZAFA 5TV2A 4KNWA 2HT1A 2B5WA 1TM3E 1K0UA 1XAHA 3PXGA 4B5KA 4MV7A 4AJLA 1Z5PA 3EVBA 3GEDA 4RCZA 3N2GB 4RIFA 4EKGA 4K9QA 5J9FA 3JQ9A 5JZ9A 5DOVA 4PLYA 4GGMX 5F78A 1XHFA 3P0HA 3DCJA 1XK6A 1K63A 1F6BA 1NN0A 1V7QA 3HI6A 1R5NA 4G5YA 3UANA 3WNZA 1Z47A 4GR5A 3WRVA 4IO0A 4CT5A 3DOJA 1DJLA 4RSRA 1T8WA 4QTTB 1L8OA 4BEJA 5FUMA 3T0IA 1HYHA 3L0OA 1N0VC 4PPQA 5LMZA 1GZ3A 3FZEA 4HGOA 1G0NA 1UBUS 4J76A 1U7TA 1XTVA 1XCGB 2ADFA 1WAMA 1XZHA 5JNRA 5HEKA 1S8OA 3JS5A 4WVFA 4D98A 1YB7A 2F3RA 3HJNA 4W1RA 5IARA 4IIXA 3ZW7A 3GT4A 3GQVA 5BOVA 2Q8NA 5JD4A 1HL3A 2ECKA 2W2MA 3BKXA 1FFWA 2AXEA 1X9GA 3W5BA 2L17A 1OFUX 4MROA 2C9BA 2HLDD 5CK4A 2GM4A 1YONA 1RE0A 1DDOA 5EYPA 3VDRA 1ZBDA 2I66A 1J8FA 5LP6F 4UEWA 1T2AA 4XYGA 5HJ2A 2QVCA 3AJ9A 3KYDA 4KH0A 5J23A 2AG0A 2LUOA 2YMMA 1QOZA 1CQJB 2H29A 1BE0A 3CRZA 3PENA 4LJSA 1BO6A 3HCNA 3L0DA 2IFTA 2OTCA 1ZXXA 3PCTA 1ZI6A 821PA 5ENZA 1BXRA 2R5NA 3LLCA 3VH1A 5HW0A 1VJTA 3FBWA 4JJKA 3T9EA 1UF9A 1MT0A 5A1JA 3CONA 1WKVA 2H1HA 1ELOA 2A94A 4JLOA 3HL0A 4HQLA 1MABB 1LW7A 1JFFB 2VRWA 3QU7A 5KBYA 4F6RA 4H1TA 5EEHA 1F17A 1RLJA 4G6ZA 1T8PA 1ZIOA 3EEYA 5TDHA 1BMFA 3RCBA 1GCUA 1HG1A 2EQBA 3THYA 3DEZA 1K8XB 1H65A 1B43A 5I7SA 1BMTA 4G97A 1L6RA 2BLNA 2P4HX 3QYFA 2JAXA 4JA0A 1X9HA 3NBQA 1NUAA 3FJ1A 5AKEA 1Y3BE 5K2OA 5KCMA 2EIHA 1EWYA 2PHZA 2DFNA 1T2CA 1KZ6A 2ZSKA 1P7PA 2VDKB 3H7IA 4I50A 1N6NA 2EKBA 4V0RA 1YZQA 2YZ2A 2Q6VA 3VBCA 3OTGA 3H97A 5C8YB 2XD4A 4IX9A 3PDUA 1I5OA 2NU9A 4MS4A 1Y34E 4ZQGA 2Y99A 4PG6A 4N5DA 5KAMA 1BMFD 3TNDA 3BREA 4BYGA 4GRIA 3WG9A 1XZJA 3TBKA 1DUSA 4DCOA 4EB3A 1ZJ6A 3M9WA 5DNYB 5BWMA 1WZIA 1M6YA 2HJVA 3IGFA 5A4KA 5IN4A 2ZJ4A 3AY6A 1BEEA 3U13A 2QGFA 4AZWA 4DFDA 2ODTX 3OZAA 3DR3A 3O84A 3MCUA 4WN9B 3CRVA 1WVGA 1EFDN 2XUAA 4A5SA 3S4YA 3F7NA 3KD3A 5JCXA 2Z6UA 4JKYA 3D6HA 1MKYA 1NATA 3PNLA 1U7DA 2BFFA 4FYPA 2HWUA 4IO1A 4U0JA 3BB4A 3H87A 2ZIXA 5KDDA 3HYNA 1ZI8A 3IQDB 1XTRA 5JJCA 2VWHA 2ZTMA 3G1TA 4LZZA 5EC8A 4E2YA 4MUJA 1ZK0A 5IAOA 4TUYB 1SKBA 4J0EA 3VVMA 4E1AA 5DGTA 3N0RA 1SRRA 2P2DA 1HE1C 3HV2A 1AKMA 1CNFA 1MB4A 1WY5A 1M6HA 2VP0A 2YWRA 1AKQA 1X0XA 2F2TA 3E6AA 4OXQA 4YK7A 2G63A 4YYEA 4DIFA 3DC2A 3NHMA 3QUAA 4MEJA 4OYYA 2ZCUA 1JALA 4LGYA 5A04A 3R0QA 1Q1BA 2HSJA 4P4NA 3ZQKA 2GPWA 2G4CA 1FRFS 4JJZA 1SUFA 5AVVA 3WGMA 4IR7A 5CD9A 5EESA 1Z2OX 1SKYE 3JRXA 5BN5B 1IG3A 1LI4A 1UFRA 3RGGA 521PA 5EWMB 2BW0A 1GHTA 1D8TA 2UYYA 4EKIA 1W4ZA 4Y2HA 3OQOA 3QHAA 3QE4A 2JH8A 3LXRA 3BILA 4FHFA 1GTSA 1ZIDA 4BN0A 1LJ8A 2K7FA 1E1RA 2RFLA 1INLA 2VN8A 4I4TF 4LJ8A 1JZSA 1WDTA 2JH9A 5DB4A 4OX9B 3GJYA 2G72A 1Z2NX 2ZRDA 3AIIA 2QJWA 4E2XA 3QE0A 4D92A 5IWCA 3U26A 1YQGA 3PT9A 4CU2A 3NWOA 3RYHA 2DCUA 1PNQA 1W8IA 4BRSA 4LMRA 4P5DA 4DJJA 4HBGA 5D8DA 1J0EA 5J2UB 2F43B 3KZVA 4HEQA 5CYPA 2C4HA 2OUKA 2QN8A 4HHEA 2BZSA 3ERCA 1QUFA 4XB1A 2ZTHA 5I4IA 1NOKA 4D42A 2CCKA 1BOOA 1SCUA 3GCZA 3LUAA 2NQTA 4CMEA 3KSBC 3ZLUA 5KINB 4JL8A 3IUNA 1HFEL 3KR9A 1AE1A 4CG2A 2PKRA 2CFRA 2O05A 2CDBA 1UOQA 2ZRKA 4TQGA 3DFMA 4YAEA 1SXIA 3OA2A 1P2GA 3MXOA 5JZBA 5K6AA 2R7NA 1S2OA 1O6BA 2WVAA 3H5OA 3C74A 4E22A 4OQPA 3U17A 3U7JA 3FTDA 1E8NA 3RF6A 5JALA 4S05A 1WZCA 2JHCA 1LPMA 1P3DA 5I4BA 3Q7EA 1A8QA 1PDWA 2IC5A 4IWYA 1A5TA 3T12A 2ORVA 4RHEA 1GG5A 4YFYA 5DCYA 2KQUA 1DKPA 3EZNA 3LK6A 2JJ1A 4XGRA 3I01M 3X1WA 1BMDA 2VYFA 5TQ2A 1T3LA 4CEIB 4EJSC 1KZGB 1NVMB 3HU1A 2MSKA 1RM5A 1AQLA 5DF1A 1LZLA 3C3BA 3TSWA 2AEFA 5A4IS 1OKKA 4JC0A 5EWLA 2SCUB 3SX4A 1PI3A 2C99A 2ZI7A 1UMCA 2L18A 4ENTA 3UN1A 5B30A 2XUOA 3KTFA 1M67A 1DXYA 1N0UA 1UDAA 4X3PA 3NVAA 4BBPA 4DMHA 1XD9A 4N12A 3RH0A 4BKQA 2HU7A 4DV3B 4TLAA 5D87A 4D43A 2BDTA 4MUXA 1JEYB 4DC9A 2XUZA 2IPMA 1T6ZA 1SVUA 2H07A 3MRXA 3AW9A 1UUFA 2FQ1A 4B81A 3PQ7A 4PEVA 2JVIA 4QL3A 3TL6A 4KE8A 3WLTA 4I36A 3B6IA 4NESA 3LRTA 3JXEA 3DZIA 4NFYA 2QY6A 1OKKD 1O94A 1UANA 1RW4A 1W30A 2WT9A 4HTFB 2HMTA 4EEZA 5GWXA 2GHIA 3UJDA 3KQUA 2RAVA 1Z34A 1K75A 3I9MA 4NY1A 2Q5JA 1MAUA 2CW5A 1OZHA 4YT4A 1NFQA 1H42A 2FPGB 4YCDA 4A8JC 3GLHA 5C35A 3QKSB 1P7WA 3PQ4A 5JQWA 5D6OA 4KFSA 2B3DA 4R9NA 4B47A 3NIFB 1WB5A 4M38A 2HFKA 4TWZA 1J0XO 1QFSA 1VI2A 1VMAA 3IP3A 3B6JA 5CXXA 1V5FA 2B1GA 3QWAA 3RRNA 4EF5A 3Q7TA 4MP8A 3R7NA 3T4XA 5F2NA 3AFMA 3AW8A 1O94D 2I54A 3FRIA 2QTTA 4WMLA 2GM5A 2EJCA 2ZWOA 5FA8A 4JHXA 5KDOA 1E32A 1OMOA 3I3SR 3E3AA 3TQFA 3ZGYA 3L8MA 1TIKA 1KO8A 5AOVA 2VTVA 3J7TA 5CFOA 1P9WA 4KYVA 6REQB 2JBHA 1OT5A 3UT0A 4QUHA 3EOBI 4AWXA 2NMVA 1YRYE 4BVEA 3DLHA 3UM9A 4R5HA 3RK0A 1CETA 4BO4A 2H7YA 5DBFA 1PVVA 1CDDA 2IWHA 3GFOA 1M1NA 1AUOA 3T94A 1R0KA 4M0KA 1HYGA 4QRIA 1RTKA 4YMUA 3EY9A 4P33A 2CE2X 4PRYA 4RH3A 4KQIA 4FOOA 5BVGA 2PEZA 4EYEA 1MOQA 2B1JA 1Z6ZA 4JLNA 3KUCA 5IFLA 2VDRB 2Z5VA 4Y1GA 3ZXUB 2OVFA 1ZDMA 3HU2A 3OP1A 2CJPA 3N6VA 1K7YA 1J9ZA 5AHKA 4EPWA 4QNRA 3HTXA 3QVGB 2PRYA 2A7QA 1HPLA 3FPFA 5BUQA 2MR6A 1ZD8A 3CEPB 3T1YB 1XF9A 5DKFA 3OE7A 1RKUA 1Y4ZA 4OHWA 1ESDA 3RYCB 3ZWCA 2NWQA 4NBVA 3U49A 4FWIB 4IX1A 3UY4A 3W78A 4EL5A 2NTYC 1DBRA 4Q9HA 2VR1A 1ZJ5A 2OV3A 2QTVB 4JYMA 4BX8A 1HDOA 1W96A 3NEPX 3QBTA 3UVEA 5JT1A 4IH4A 3TH5A 2X6RA 4BKPA 4LQCA 5K0ZA 3IUQA 1J56A 4HQFA 3RWMB 3AL2A 4JSTA 1HDXA 1MIOA 1Z8DA 2WJWA 5JCOA 5C51B 1JG6A 3R3WA 2BEWA 1ODIA 2DBQA 4PCUA 4E46A 1PZHA 4MO2A 4MV3A 4PZZA 4KBFA 3QEJA 4MHTA 1OFIA 4P3OA 4HSGA 5DDIP 3JRWA 1RLOA 3OE7D 4HQ6A 1TAHA 4QE3A 1MXFA 4ZTBA 3BFXA 1R8JA 3MCWA 3DB1A 3GA7A 3KUDA 5E38A 3VH4A 4KQJA 3WHLA 4TMTA 3SGLA 3GJZA 4BTVA 1ZINA 3LPLA 3WGOA 1RYMA 3BWDD 1DAGA 5FAKA 3MLBA 1E9DA 1Y9JA 2RH8A 2DY0A 2EHDA 1SC9A 4YCLA 1AS3A 1DUVG 1FY2A 3MWGA 4OGWA 4BECA 5A5EA 2P2ZA 3QU4A 4TKUB 5A9TA 5EUBA 4US1R 2ZE7A 2QG4A 1TADA 4ASUA 1KI9A 2CHUA 5BVHB 3AF3A 5E9AA 2V3CC 3ZVLA 1S3GA 2XA2A 1YE5A 3NJ4A 3WXBA 1DSSG 4LYAA 3KSDO 4UBMA 1V2HE 2EBHX 3QTTA 4RPLA 2FE1A 4F5WA 3D3NA 1WZEA 4EDFA 5AI6A 1SFRA 3G8AA 4V02A 1IQRA 1Y5NA 3HCWA 4JNCA 3RFFA 3BTSA 2I71A 1HQCA 3C4VA 4C4TA 3I6ZA 4L8YA 5C8ZA 5LUAA 1FYXA 2HRQA 1BU5A 4KN8A 3BVPA 4ASUD 1YUNA 2B94A 3CLUC 3KJEA 4FX2A 1DQYA 2X5KO 1MO3A 1FDWA 2NXWA 3DM9B 4HV4A 4Z4CA 3AHIA 4ZIRB 3D7NA 5E7JA 3RAGA 1AURA 5J4VA 3S2SA 1F2TA 4K88A 2AUNA 4I50F 3EMVA 3CF4A 4DRXA 4AZSA 1W2WB 4Q6WA 3RVMA 4C0SA 3AB7A 4N48A 5K0FA 2EYUA 2OWEA 3AL0C 2JCXA 4BE4A 4HN2A 5GZ3A 2NW6A 2W11A 4HRAA 3Q3GE 5JPDA 3FWNA 1CEYA 3I39X 5IG2A 5ALQA 1VSBA 1NJ6A 1QH8A 3PUVA 4RY8A 3OIDA 1L5HA 4BX2A 1SUPA 2QTNA 2X15A 1E5VA 3GA5A 4EW1A 1ISPA 2H5EA 4FFMA 4B82A 2QOEA 1H0KA 4AJEA 1K1EA 4DQVA 4PC3A 5K2MA 1UC8A 4L9SA 4IS2A 5GGYA 1G64A 3KXPA 2AOXA 3MN1A 5JVDB 4M0UA 4DGQA 4JI0B 4KXNA 4TROA 1SVSA 2FPOA 1W6UA 2ZWVA 3L1HA 4RS4A 4N41A 3D31A 3AINA 3E5RA 1EGMB 2ZRBA 1RIFA 3D4LA 3FUWA 1H2XA 2C20A 3B5IA 3RUCA 4F93B 4RQAA 2P65A 4DM4A 3OJ0A 3N86A 4M8NE 4FP9A 4RVDA 5T6MA 1EIWA 3BL8A 4KO8A 1ZX1A 3HP4A 3VHRA 4XGNA 1XVLA 3WLLA 4RY2A 2H2WA 3CF6R 2CL0X 4JUCA 4NC9A 4TSKA 1Z06A 4I1SA 3CJRA 3RV4A 4B80A 5KNLA 2VP2A 4J1SA 4HUQA 2Q5IA 2ID7A 1KZHA 1VL0A 2OD7A 1T36A 3KQTA 1K86A 1VGRA 5KTOA 3W7BA 4DIKA 1KIMA 4XIGS 2ZSAA 1B8OA 1I32A 3FUXA 4ID3A 4AJ4A 1R0YA 2JIMA 4ZO8A 5JNLA 2MOKA 3QX9A 4OM7A 1ICEA 1PR3A 5C4MA 1TX4B 1IZYA 5KU1A 2NP7A 4RGBA 2C3UA 1DMRA 1GT6A 2AOTB 3DZHA 3BOSA 1GGFA 4NBNA 5IKMA 3P9CA 1M73E 3F3YA 4KYUA 1NFFA 1GRVA 2GR9A 1Z7WA 3EEFA 4MS1A 3TIIA 3KAPA 1Q91A 1JHZA 1FPMA 1JLLB 3RSLA 1OLSB 1HI9A 2A5DA 3PXEA 1DTEA 3PUYA 5KAPA 5LKAA 2ZM6B 3PJEA 1QTIA 4F1KA 3CQ9A 1SZPA 3FG9A 1ZQ1A 1WLSA 3H4MA 1LNZA 3S0JA 1TJPB 2FP3A 2IOFA 4U9HS 1ZIPA 5EZQA 5EJ7A 3TRDA 1AKVA 1E1LA 4RMGA 1M8GA 5CT5A 4YCJA 1ZD3A 2ZR7A 2GVNA 2C9ZA 1XB2A 4XFDA 4ITVA 2WWHA 2M1ZA 3L46A 4KO2S 5JAPA 5LLDA 2D54A 3IQZA 1E2JA 4ME6A 1XYGA 2B82A 2YZNA 1DAHA 5GJCA 5DXFA 1GZUA 3AEUA 3U60B 3VR4A 2P2NA 2HUNA 3MOGA 3CLSC 3LU1A 4ODIA 3IR6A 3AHFA 3INNA 4M0EA 4ZVNA 1U0LA 5ICFA 1LEHA 3KKNA 2VWGA 2ZGVA 1U2ZA 5DYWA 2PNJA 3SC4A 5IHPA 4HDQB 2E4UA 4CWAA 4YGXB 4KIWA 2EZ9A 3DVQX 1MDBA 5CFMA 2A9OA 3TCNA 3RS0A 2AKYA 1Y7TA 1AKRA 4V2IA 5FRDA 4HWRA 1E3EA 5HDQA 1HC7A 3ZHYA 3PVSA 5LB4A 4LHVA 4Z51A 2NTNA 2JRCA 4CG0A 4EUHA 4M8IA 3V55A 2O2YA 1Y3AA 4B8WA 2B92A 2O8NA 4QXAA 4G3XA 3T5TA 5BRAA 5E6SA 1RJWA 3DDWA 3JQ8A 4XOIA 1Z4IA 1L7PA 4ZJPA 4LCEA 2DR0A 2G80A 4DEXA 5IS2A 2X7HA 3HY4A 1Y3FE 3GFQA 3HVUA 4WD3A 1H4SA 2H9YA 2QG6A 4JUIA 4W7HA 3GHHA 5CPFA 3AESB 4BKMA 4LDJA 3DOIA 1N3IA 1XDGA 1MPTA 1O5IA 4MQMA 4NFHA 1NW9B 2WTNA 1ZGZA 4I4IA 3VU9A 1G3MA 1CV2A 5K8LA 1ZK4A 2DYKA 2CWDA 5DNVA 1AG9A 4W8GA 5HQTA 1QF7A 2QUHA 3PFKA 1OWOA 2HSZA 5G02A 2BRUA 2XNHA 1EGHA 1JLSA 1O89A 3EARA 5J4LA 2NSYA 3MJCA 3QOFA 1ZQ9A 3RUDA 5KQMA 1YMQA 2RH9B 4X8LA 5TJHA 3R7AA 4O2LA 3GBPA 1L8LA 4HPXB 2HLPA 4M1YA 4EFKA 4G5FA 3KFVA 3PHHA 2JIDA 4V0NA 5GJWC 3WAKA 2P3SA 5B5SA 5D01A 5IABA 1X7GA 3EDYA 1SUEA 4R8RA 2YKGA 3AKEA 3GJ3A 3JVIA 3PD7A 2IY9A 2OSBA 4L57A 2AEJA 5KX5A 3ZZ1A 3DDHA 1NULA 3HFSA 3ODPA 3NYWA 4C2AA 4P32A 4G8BA 3L0PA 1JIUA 1MG0A 1KNQA 1QONA 1U65A 1VI5A 1XZBA 3U3XA 1SWVA 1ULBA 2WWIA 3ZS8A 1VL2A 2ZB3A 5JZOA 3C5WP 3PKZA 2XGJA 1ARZA 1GG2A 5AWFC 4D74A 1Q3KA 4GL2A 5JDCC 1VCOA 3H9GA 3GZNA 4RJJA 2EWWA 2YXLA 3CR8A 4ZANA 3W8FA 4E5KA 1IK6A 4BO8A 4OMUA 5B1YA 1D2GA 1UKEA 3TFOA 4Q12A 5IYZB 2AJCA 4C3VA 4ND5A 1EFTA 1M66A 1QANA 5CLIA 1U7ZA 3E23A 3FPHA 5T57A 1KSGA 1S8NA 4LZJA 3VSEA 3EXFB 3QIAA 2OLKA 3H6GA 3RLIA 2XXAA 3OF2A 2XT9A 5LIRA 3ZHCA 3CTPA 4E14A 1JT9A 4H3HB 4EUEA 2RHWA 3P52A 1YTLA 3FJYA 1HT3A 3HC7A 3S1AA 3T9AA 3GVCA 4F7WA 2P6RA 1DPFA 1P1FA 2VP9A 1MAVA 3FJOA 4CTJA 2O2IA 3A6ZA 4OP1A 3IEXA 3QMPA 3H3JA 4RLSA 2XHEA 5J2UA 2F3TA 1QFZA 1WABA 2LKCA 3OCUA 1RAFA 3COZA 1IL0A 5ALXA 1NV8A 2A1IA 2VSFA 1DJQA 1Z22A 2WAOA 1M0TA 2IXAA 3W4IA 3E03A 3JAWB 5CDTA 4IIVA 1OWLA 1PAUA 3PJDA 1FS6A 1QS0B 3Q15C 4M49A 2GZRA 2ZUSA 3P2MA 3A1EA 1PJTA 2GHTA 1SKQA 5A71A 1Q6ZA 4CXMA 1KMHA 4NAHA 1JMYA 1FLDA 2BMDA 3DEAA 3HP1A 3NAGA 2OT3B 4ZCTA 3QKWA 1YA8A 5A06A 2W37A 4YI5A 1IMOA 5FO1A 1Y1KE 2AFIB 2ATEA 1JHXA 1I1QB 3P4YA 1DIAA 1H69A 1B3RA 3QBJA 2Q6TA 2IITA 1JEJA 4Q3EA 4YCSA 3V4RA 1KYYA 4REMA 2BL4A 4PWYA 4AG3A 5F9MA 1O08A 4BJ3A 2NTEA 3N0VA 2BFMA 2I76A 3ZWWA 2IEIA 1HRDA 4KPUA 2XE8A 1Y8AA 3B3JA 2P11A 3OX2A 2CHVA 3L1IA 3JD1A 4OXXA 4PRLA 4BPRA 2P5UA 3B2EA 1IVNA 1PL0A 3FVVA 2HBYA 3WL6A 2IGBA 2KSQA 5IH7A 2R47A 3T7KA 1CJCA 3UK6A 4GSLA 2GVZC 1O6FA 2OBFA 3M8KA 2PKQO 4Q3BA 1YFLA 3GJ0A 2H7CA 3WLJA 5KNCA 1GNLA 1WF6A 3FCEA 1CZLA 3IRVA 5G0UA 1OFUA 5BMOA 3CF0A 2VEOA 3OCXA 4Z4QA 4D25A 3NJRA 1O54A 3HB1A 4M7OA 1XMIA 3WK6A 3E7PA 3N2KB 3IQGX 2D0IA 2FJPA 1DBPA 2IDMA 1IC6A 4WKGA 2PCJA 3H86A 1A7JA 2XUIA 4K8OA 2Z8YA 1K8RA 5LU9A 4J9UE 4PVCA 1FMCA 1EJ2A 1NW7A 5EZYB 2YS6A 4RMIA 5ERGB 4E07A 1QTNA 3PQCA 3VYVA 3EGEA 4A10A 1YZHA 1Q7TA 3OI7A 4RK0A 2FB9A 3NCTA 1EGVB 4H35A 4EEXA 3CUKA 1U0EA 2IHZA 2ONCA 4CKEA 4B8ZA 4EG5A 4X93A 5EY5B 4O2BB 4YXWA 3WBKA 2W2OA 1Q1GA 3UJ6A 2II6A 3L5KA 5DWVA 4FM9A 2HU5A 1IHDA 1UJ6A 3EAFA 3C6BA 4MWZA 3I61A 2CK3A 4RDHA 4GOXA 3C8MA 5BQ5A 4EHHA 4XFJA 3R3UA 5CFLA 1I6KA 2WYUA 3PIIA 4RKFA 3F6PA 3GIWA 2EGGA 5I9NA 2ZAGA 3VR4H 1P1KA 3WRYA 1H1LA 5HRCA 3OTHA 4R83A 2VHUA 5K3FA 4K0KB 1GDHA 4NCBA 2IHVA 5T3YA 1LLUA 1SOAA 1GCIA 4YXWD 1ZJYA 2GF9A 2YV5A 2J33A 1JDUA 2XYHA 1I36A 2H2FA 4RHYA 5ICCA 3VU8A 4UVHA 1ZVMA 2QQ0A 4L4SA 1IY9A 3RRMA 4CE6A 1BU8A 1L8QA 2B4YA 2A0WA 3X43A 1W88A 1DBWA 3PUKA 2DQSA 3RSGA 5BT8A 3QW4B 2YVLA 5LM3A 3PEEA 1R12A 1HLFA 4D41A 3FMOB 4YP7A 2G8LA 4I5IA 1R74A 2Y0PA 1AV7A 3F5SA 3I9KA 2VSQA 3K72B 2PK3A 4FNGA 1W36C 5A6VA 2ZG6A 3KKPA 4Q16A 1KFKB 5FADA 4PNPA 2AIRA 2G7MC 4WFJA 2UYOA 3GN2A 1O4WA 1QR6A 1XA4A 2O07A 4ARBA 4F11A 2GH1A 4GOLD 3MD9A 3REQA 2WMDA 5BSVA 3K6SA 4RTMA 4DJFC 3CLRD 4JCCA 1MP0A 1X1RA 1VL5A 3HKDA 2E4ZA 4G0NA 4B1FA 1QIDA 5IEBA 4EPTA 2J9GA 4PZEA 4C0XA 3UATA 1WO8A 2BDUA 3C85A 3NPAA 1YZUA 2ZPAA 3KSUA 2KLHA 4P5EA 4Z9FA 5LMUB 3JQ7B 1UOPA 3N76A 3IIEA 2QBYA 1GGKA 3Q9SA 3G02A 2IUFA 1PRYA 2G07A 4IRUB 1WMAA 2OENG 4TKVA 4XX0B 1UOOA 1HKUA 1B41A 5IM5A 1OLUA 1KOGA 4O4IA 3RU7A 1MQAA 2F3PA 1Y5MA 3GZJA 5HTKA 1MBZA 5AQ1A 1ORTA 2VHYA 5NULA 1FNBA 3RRJA 3CLHA 3FGZA 4YRAA 1KS9A 4K46A 4HMQA 5BWOA 2I2WA 2ZIEA 1UINA 2C95A 3RWBA 3I62A 2ODNA 2XDYA 4J1QA 5TPZA 1L4EA 3K5WA 1GPMA 3STXA 1C0KA 1SQGA 1YR3A 2WE7A 3NHWA 4IEFB 4F9FA 5CVUA 4TV8B 1H5NA 4J29A 2OXRA 2BMJA 5HDBB 4OJYA 3QVUA 1KC3A 4BWVA 1X1DA 4YRFA 1WU8A 2LVBA 1C9DB 4LBYA 4ND6A 2J7KA 4Q5IA 2UYCA 2JGRA 3KQLA 1L5LA 4C4OA 1TIPA 2VYVA 1ZN7A 3U19A 1CQWA 3LJKA 1R0LA 1XJWA 5G4LA 1GILA 3TL2A 1M8JA 2QSJA 3QUBA 1XAJA 3OQPA 2QD4A 2JIQA 4G8DA 2J5KA 1KI8A 5DHFA 4C0AC 2BKEA 4BLVA 4D79A 4Z4FA 2BFNA 1NXQA 2QL9A 2JHAA 2FP4B 1GFZA 4BC0A 2DH5A 4P5PA 1JFVA 2ZJ2A 4M88A 1NSTA 5DNUA 4V03A 5CH8A 5ERYA 3VKHA 5HIAA 1Y8CA 1B42A 1N2JA 1Q14A 1X9IA 2FN4A 2QRKA 3BJMA 3S2GA 4Q9LA 5ALSA 1L4GA 2VYVD 3ULKA 3ZLTA 3AUAA 1UP4A 3A1TA 2UZ1A 4P3XA 1JA9A 1WDKA 1KJIA 4QODA 4TXHA 1MZVA 3AXTA 5EXXA 1Z0IA 3O8QB 4AP9A 2WUGA 1AA6A 2HK7A 2ZR0A 3HG7A 4X90A 5D5HA 1MZPA 4KLZA 2AJ8A 3H1FA 3R23A 4HD8A 3DBLB 5HK9A 5JROA 3PE3A 1X7XB 3C7CB 1I2MA 2P8SA 3EDRA 1MJ5A 1D2EA 3B48A 3BIJA 4KQMA 4ZEVA 1XWIA 3NMUF 4Q9AA 2UYQA 3RUAA 2YV3A 1T34A 1E2GA 3L7KA 4UZFA 3EUEA 1NL3A 2Q0QA 3AQ4A 3QPCA 2BFCA 2FDXA 3KHTA 1G42A 1MJHA 4KYIB 3T9CA 2REBA 4HFRA 5IULC 1BXGA 9ATCA 1N9GB 5FWNA 1Y3IA 5AKHA 1I0IA 3AETA 3G5MA 3EGDB 4YAKA 3LOQA 2MYPA 2W7TA 4G41A 4XUGB 4BE7B 1AF4A 4KGVA 2Q9CA 1EWKA 3G7UA 4DDMA 3SKXA 1CS4C 1JXAA 1TF5A 1X6VA 2Z1MA 3RTEA 4EEKA 1J2EA 3E8SA 4YRNA 5L9AA 5FYQA 1KZYC 5E2IA 5TQVA 1CD5A 4H0CA 5EMMA 5AO9A 3DDUA 2AG8A 3QVMA 3RS2A 1G4UR 2A9RA 5L3VA 1D2MA 3KKMA 1B2LA 5KX5F 1D9XA 3IKVA 5JXIA 1PD0A 1VE1A 2H31A 2WNSA 4WK0B 1AHIA 5E4YA 1ZKDA 2WIFA 2IUYA 3KZNA 3W04A 3PFNA 4BV2A 4DV1B 1OTYA 4Q34A 1I4OA 2YJZA 2Z3ZA 1RHJA 4DANA 1X80B 1O0BA 1P4SA 2A67A 4FEEA 3BA6A 1JU4A 4HX5A 3L8YA 4EG6A 4OQ4A 3LF1A 7REQA 1I7SB 4OMCA 1PK8A 2ZATA 2ZWIA 1RS0A 3KWFA 5B53A 2OFFA 4N01A 3SEQA 3FBTA 3ZCUA 3JAMA 4GF5A 2B9VA 4BC1A 1WCV1 3U7QA 4JV5B 1RHQA 4V38A 2W2LA 5C5DA 1CR1A 4UDYX 3LSYA 1D2AA 1V9LA 1W29A 1GNQA 1EJ6A 1MHTA 1UXGA 4FYKA 1B8VA 5EQTA 4CCAA 2E55A 3SQXA 3HBJA 1LSOA 4CL0A 1E1NA 1H8HD 1IU9A 1KYTA 4UC0A 5IT0A 1EUDB 1QHYA 1HT0A 2OZPA 3EX7C 1GV0A 2IBMA 4G5XA 1R0SA 4H6WA 2QORA 2Q3JA 3PA8A 1X7YA 4NI5A 2XB2A 3H3XA 1NNLA 3KCQA 4K81B 4QDKA 4ZT4A 4TS3A 4QQKA 2H8GA 1N5RA 2XDAA 3HXPA 5DWDA 2V0GA 1U3CA 3L41A 1QKKA 4RXMA 5IDWA 2W2LD 2GEUA 3ZOKA 2HF7A 1Q20A 3JVVA 4YJFA 1Q11A 3HMKA 5FNVA 4UOQA 4BV3A 1Q0PA 2HA5A 1E3DA 2FPXA 3SPXA 4BEBA 2W6OA 4ZCMA 1G60A 2RBKA 4F5YA 3SIRA 5IKEA 3B8HA 1KGSA 3AYZB 3C15C 1YCGA 5E4FA 2H2HA 4URWR 3DGEC 5AW1A 1K4MA 4OJMX 1ULTA 2RGUA 4MI3A 4PO1A 4BNLA 1XXHB 4AJHA 3HHPA 4CKYA 4RTQA 4GBMA 1N7GA 1U28C 3V2IA 1PEAA 3ET4A 2CLDX 1E1CB 1DKUA 3KPVA 1SHUX 5LJLA 2EFDB 1NJ5A 3BCRA 3B82A 4GVLA 4J43A 1U94A 3MINA 5EQJB 4MWEA 1UODA 2EW8A 2XLCA 3VC3A 3CU5A 2CCJA 4B73A 1SUSA 1K4KA 1ZGCA 1NI4B 4HDSB 1NM5A 4HRXA 5FBRB 4DRZA 1MA3A 4JI1B 2A6PA 2P9GA 1G3IA 3AEXA 1TVCA 2GK7A 2H2DA 2QZPA 3TR5A 2BM9A 1E66A 3DSRA 4TLMB 4AFNA 2D3WA 1JIKA 4C20A 3AF6A 1ZMBA 2Q9AA 1A50B 1ACJA 2O2EA 1GRRA 4AMZA 3ND5A 3KELA 4I3FA 1RI4A 1TYCA 4PYRA 1AH2A 1ZKMA 3IEKA 2C0PA 5FPSA 5TMPA 2ZB2A 1O8BA 5FOSA 4Y1EA 5FF9A 3FM9A 3FDZA 2OFXA 2BBSA 2GAIA 3DJYA 2I1QA 4E15A 2IW3A 3C3DA 5C5EA 3VI3B 5ALHA 3GT3A 3CV3A 3WDKA 3PXBA 1L4HA 4UATA 5TIIA 3IBFA 3QU9A 3RODA 5CG2A 2H1OA 1PWZA 4KNVA 3OE4A 4N0DA 3CGGA 4ZI2A 4URYR 3D4NA 3A1CA 3MZ0A 5AI4A 5HZHA 3R3HA 4OP2A 3SS7X 1NMQA 3VVCA 3GUUA 4KW7A 2FVYA 3L07A 5A0FA 3RIEA 1NBEA 5JRJA 4G26A 5L7TA 4EA8A 4MA0A 2PGJA 1HDYA 2JKVA 2GEVA 2X4GA 1IXSB 3HJRA 3R5HA 3EDQA 3PCRB 1WU7A 4OMFG 4YWJA 2FPPB 3AERB 3R76A 2VUHB 1HBJA 3IHWA 1ZU5A 4YRLA 2Q1UA 3ZXIA 1N6IA 1JNYA 3PD1A 3GRUA 4L5CA 3VOTA 1D6SA 1KK3A 4JJ8A 1UT5A 5D51S 1E2UA 4UBKA 3TLKA 1OVMA 1Q1AA 2PX5A 4GICA 5JBQA 1ZWLA 2MYNA 3U7FB 3SCZA 1IWOA 2WF8A 1ZAKA 3K32A 2ETVA 3G1UA 4HNSA 2A84A 4N40A 4ZVOA 5B6JA 3PHGA 3CZCA 1PFKA 2R97A 1YL7A 3RUHA 3O2NA 4DUZB 1B15A 3MS7A 5IJ0A 2Q41A 2ZVDA 1B26A 5K0GA 3JWPA 4GIBA 5D00A 3UGTA 3WL5A 4S3MA 3WWOA 3E8XA 4FFLA 3LUPA 4MW9A 2AR7A 1R6DA 1TO6A 2W8ZA 4YUXA 1KK2A 1RYYA 3OJXA 4OBWA 3VPFA 1E79D 4CLOB 2OGSA 4ICIA 1OFGA 3DHWC 1G9TA 3GY0A 3IMFA 1KMNA 3O3MB 3O7WA 4IZOA 4LECA 2VHCA 5CDFA 2CYAA 3VSBA 4F2PA 1TMKA 3HADA 4I14A 3KUKA 4BAZA 1A0OA 5CG1A 1OGJA 3DEJA 5KOJA 1T6XA 1DRKA 1D0IA 4PR0A 5AOBA 3BMOB 3L7JA 1J20A 1U9JA 3ADPA 3E22A 4X97A 3TIGA 3K9QO 3VHXA 4CNBA 4MDFA 1V96A 4OHFA 3U9LA 2OORA 4DRYA 4JT8A 4MV9A 4E3WA 4PG8A 3ZGZA 3MQ2A 4LJAA 4LOKA 4A15A 3ZE1B 1UFKA 4KXXA 4IZ6A 5GVSA 3HJCA 5AJYA 1XFDA 2YXDA 1GY8A 1IN8A 2D7JA 4AY5A 1QOQB 4D9GA 5B3KA 4DYHA 2R8RA 1B0ZA 3U1VA 4BMXA 1D4OA 4A1OA 5C7OO 4R2HA 5COQA 5DV9A 5AVUA 4NE9A 4UUOA 1KKMA 1P7ZA 3IA2A 5IVIA 1YHNA 4YUAA 1MW8X 4O4IF 2O8EB 1U1EA 3HDGA 3UWSA 1QDEA 5KOHB 1I2AA 2WAAA 4MVCA 2IYEA 3PF8A 4IOLA 1QLJA 1LU9A 1XTKA 1CUVA 1FE8A 1Z4MA 2Z95A 4H1VA 2CXOA 4MKXA 3S29A 2ZIVB 3I92A 1VRWA 4YCAA 2UXCB 2Z5GA 2JRLA 3F4KA 2IUTA 2OCKA 1LK0A 3OG9A 1NVUQ 4KMOA 3V3KA 3HJFA 3D3JA 2LPMA 3IAS1 3W8EA 4Z2YA 3L1UA 3LQFA 3U7EB 3ECAA 4XGIA 3ZVNA 3MD0A 4DWJA 1GGMA 1AKWA 1Z0AA 2P9BA 3PLNA 5C80A 5CA1F 2IZ5A 3VC7A 1YKFA 1JU9A 3LXMA 1NNEA 2X1VA 4D80A 5KEIA 1D0VA 3GGSA 1CF4A 2A78A 2PUWA 3EISA 5DVZA 1ESNA 3T4EA 2WM8A 3TVDA 1YR2A 4OMDA 1ESCA 4NMMA 1NT2A 1IM8A 3BL5A 3LCCA 2O23A 4AS2A 2IU0A 3V1TC 3S8EA 4JXZA 1E6WA 1JHYA 3GMSA 1X42A 4G8CA 5IAGA 3GJ6A 3CPEA 4RKRA 1W49A 2K2WA 3A2MA 3GAZA 1S01A 2Y1DA 1HOXA 3JU3A 4MP3A 1XEAA 1J00A 1MV8A 2FMUA 3KALA 4BB0A 4JX8A 1HEYA 2FCRA 3V8VA 1V4VA 2BMFA 4D8TA 1HLGA 1QZZA 1T1IA 4B7UA 1JTVA 5K6RA 4D9EA 1ZNZA 4M9ZA 1L3CA 1CR4A 1AK9A 2B4AA 4NU6A 2OQRA 3PKIA 1CLUA 2AJBA 3EVFA 2W71A 1OYOA 4WINA 3KHSA 2FFRA 3DBVO 3JZAA 1G19A 4TWIA 5H4HA 4KE7A 5I7EA 1FLAA 3BH6A 1L7MA 5FTWA 2YMQA 3QOYA 1XZMA 4A8JA 2R79A 3SYRA 3A05A 5DHQA 3T3IA 4N8EA 1I24A 4OK3A 5TGDA 4IM7A 3HB9A 2TMDA 3TW8A 4BATA 1QAMA 4BZPA 2CLIB 2DX7A 1Y7PA 2GHRA 4HF7A 3P9PA 4IDCA 1KKUA 4RK4A 1EP2B 2G76A 4M3NA 4ZK2A 2MCFA 2CXQA 2JCVA 1V48A 1ONOA 3I01A 3VH2A 5LQSA 4M1QA 1JFLA 1WG8A 1ZK1A 4I81A 2P75A 4D3YA 4XVUA 3LC0A 2XTMA 4OEHA 3ELBA 1ANKA 1TYBE 2WIKA 4L8FA 1XU7A 3JALB 1A4UA 5CVEA 4QDZA 3ZDFA 2WMYA 1YC2A 3KXLA 2QVYX 2OCYC 3WA6A 5KYUA 5LUBA 3OD1A 4CTKA 2YYYA 4RFVA 3GRVA 1ZLYA 2YN2A 1N5JA 2LD4A 1ETUA 2O4CA 4FYMA 1WDLA 2YIJA 3RNOA 3LO8A 5IZCA 1G59A 3ZLVA 2VHQA 4JJIA 5HJ7A 2O48X 4MWSA 4RKEA 5BUZA 3QX3A 3BORA 2CMGA 3MWKA 1QVRA 3VPCA 2QD1A 2UUOA 4KN5A 3JAKB 4QM7A 1NSFA 1O96B 4YRIA 4FNAA 5CEEA 4AB1A 4P3NA 3HBMA 4IOKA 4ONEA 4LCJA 2YZKA 4X45A 2DPGA 3TLBA 1E0KA 2DBYA 2GZMA 3EAGA 3OZCA 3Q10A 1IFXA 3NHLA 4MPRA 4UE6A 4AZVA 4C1NA 6AT1A 3GLGE 3AFNA 5BOSA 4BNVA 5BQFA 3AEQA 1N36B 3KLBA 2HQBA 5ELLA 1P0FA 2JLVA 1G5PA 1G17A 1KDOA 2B5OA 1SEPA 4LHWA 4XPIB 3RT7A 3JQBC 4NCKA 3SZOA 3G9TA 5BWBA 3K30A 2YFQA 1RRVA 2J9FB 2PWAA 3RKUA 1USIA 2B35A 3SM3A 2EZTA 3PT5A 1DJOA 1W9HA 1JVBA 3RKSA 2ZDQA 3AEYA 3VTZA 2PZKA 3M3DA 1YHYA 4DM7A 4LOLA 1ZH0A 2QNBA 3DC7A 3OM9A 1BX3A 1U0GA 2QJFA 4QTYA 3H6HA 1P62B 4J7AA 4EH1A 2B78A 1NX9A 4CV1A 4DAEA 1UOEA 4LN1A 5IAKA 1NC3A 1DWOA 1NW8A 1J1UA 1LFDB 3PIRA 1R00A 2H4ZA 3NHAA 4ZAZA 1RHUA 5HS6A 2C92A 5THKA 1IY1A 3ZR4B 3J81k 4D8UA 1QP8A 4A6XA 1JMVA 4GT1A 2Z6QA 2QF7A 5FBZA 4X7RA 1PBTA 1RRPA 5FNVF 4EA9A 4ILKA 2BM1A 2C2MA 1SC6A 1NLUA 4QSMA 4TTVA 4XAQA 2I6SA 2PSFA 1P5HA 3U0VA 3PR3A 1Q0SA 3LBYA 1EK0A 4XYMA 5EJAA 4GSKA 5J5CA 3UJBA 3E9RA 3UK2A 3UK1A 1T9GS 4DA0A 5CXQA 1WW3A 1KI4A 1SIBE 2F8LA 2HHLA 1C0EA 1CE8B 2HDNB 2OHHA 3A1SA 3HR7A 3LYUA 4RUKA 3RJTA 3RSOA 3BE6A 2X5XA 1K3TA 3RC9A 2NZXA 2SBTA 5C32A 2GMWA 2JEYA 2QN2A 3EHEA 4C76A 4DT1B 3OEEA 5ALFA 2XIJA 3CM0A 1NMEA 3I9JA 3QOWA 4XGKA 4BX9A 3TLJA 3ICWA 2VPXA 2VK4A 2G17A 1THTA 4KQFA 3VO1A 1UXHA 4KGDA 3B3GA 4Y6SA 5ED0A 2YVQA 1CUGA 2AZTA 3HSKA 1KE1A 3LRPA 3BHJA 2OO5C 3RARA 4OSEA 3TQSA 4I1OA 4IXNA 1O9BA 3CKKA 3OFJA 4PGGA 3RUFA 3ELDA 2YHIB 2VH1A 1JR3E 3CLVA 4ER6A 3GRKA 3QV1A 4I4NA 2GBFA 3O93A 4D46A 4GYWA 5EA2A 2VNKA 2K5UA 3PFCA 5EFZA 2E18A 1JSZA 1ZZGA 2P9EA 4PZDA 4ZEXA 1V0JA 3THWB 3N0XA 3NVDA 3OU2A 2ROQA 2H7VA 2WYVA 4NAUA 3C1AA 5FPHA 1RAEA 3S5UA 4DY6A 2FEMA 1E3SA 3FNEA 4I66A 3EBLA 3OURA 2NQ2C 1CUDA 3ICCA 3JQAA 3L40A 2QMOA 4EKEA 3CLUD 1QQBA 2GF0A 3V7WA 2YMPA 4G1BA 5C2JB 2PJZA 4NYMQ 8LDHA 2GEDA 3HYRA 4R84A 3G0IA 3DVRX 3KBOA 2GNAA 4U0KA 2VDOB 1TPYA 4RLFA 3EVDA 1U8EA 4S2UA 4Y2PA 4KSYA 1GV1A 1E9VA 2JF0A 2GERA 3TTUA 1OSNA 2QRZA 1RU3A 1Z62A 4XJSA 1XTIA 3EH2A 3QXXA 1PGPA 4OQMA 2IPOA 5JEDA 1E3WB 2Q2QA 1LK7A 1FRZA 3B1FA 1G20B 3NAZA 5K1ZA 3NH6A 4YRQA 2R86A 5FLKA 3OKCA 4XM2A 3VBEA 4TYWA 3JQAD 3R6DA 3DEIA 1YOBA 4BO1A 4OQNA 4JEIA 2H00A 2G04A 4LEIA 4MVJA 4Q1AA 4D4GA 2BHNA 5AT1A 1FFCA 3D6TB 4BGIA 4BQIA 4CTOA 1VPVA 2E3JA 2UV8A 3G2QA 4MYCA 1JEDA 3DV2A 3UTDA 5A2QA 3JD4A 2G1KA 4ARZA 4GVXA 3LUDA 1GM5A 3EQ2A 3ONDA 2IUEA 3E05A 4WOCA 2EJUA 4ZAYA 3K92A 3C39A 2ATIA 4M83A 3THSA 3Q0TA 2R96A 4RANA 2O8DA 1DEOA 2MSCB 5CW1A 4AIIA 1PWYE 1FYEA 4Q3CA 3WE7A 1RHMA 4POOA 5B55A 2O8BA 1CB7A 3IVXA 4DIBA 5BSHA 3GG9A 3RS9A 5AW2A 3AB8A 4MVJD 4EAQA 1C9YA 1IBCA 4KMSA 4IF6A 1E77A 5H3CA 4ENSA 1EFVB 2OCPA 2OG1A 4WEQA 2ZJBA 4Z2AA 3MWYW 3D6VA 1DOHA 1I2CA 3R3VA 1DDIA 1R50A 1XO1A 4JT2A 4I5FA 4TXNA 4UNPA 5A3VA 2WQ6A 4PW0A 3VISA 4EO9A 1KJ9A 1UXKA 1VPDA 4J0GA 4IIJB 5EIBC 3G8BA 2Y6UA 5HRUA 1NAHA 1S0UA 3KFLA 5ESWA 5KPDA 1N9ZA 5E7QA 4GM1A 3C7DB 4YMWA 7GPBA 2Z0MA 3D6NB 1DIHA 6CHYA 4JYAB 2P79A 2V3WA 2A5JA 5ICSA 4QUGA 3V2GA 3W5CA 3H04A 4LYHA 1ESZA 4Z0TA 1L5NA 4M6WB 3KLMX 4L22A 1LXCA 1M76A 5C0OE 4YCCA 5CBPB 1DMSA 1F3OA 2XDWA 4C4AA 2PUBA 1JHMA 3KJGA 5FBKA 3HKBB 4IQ8A 1TA0A 3U1TA 3N2GA 4UDNA 5KOIA 3CWQA 3PTZA 4QNMA 4FYJA 3BJRA 3EXG1 4IZHA 4OO3A 3P20A 1SKYB 1YRWA 4ZQIA 5G0VA 4JXKA 4F71A 3TDKA 3RT9A 1GGEA 3KLPX 3PQEA 4PZCA 3R3XA 5FV4A 2PPLA 4U4AA 3EFHA 4D96A 3LF2A 3NDIA 2J46A 1G8FA 1GXSA 3AM5A 3NBKA 4YHBA 3CLSD 2WV7A 3MVEA 3ZD7A 2FRDA 3OZUA 4J0FA 3BSYA 2WW8A 4X54A 4D4HA 3IAM6 4P58A 1G8SA 4O4LA 3B6EA 3E35A 4F2WA 3FUTA 5HQ3B 2QS9A 3RGWS 1S2NA 2GHQA 1RKXA 3GNQA 2GK3A 1TI7A 4DLUA 2GEFA 4NCIA 2FF7A 1E63A 1EI9A 5EXDA 1ZCZA 3IT1A 1WIWA 3N1UA 3QFCA 2H4HA 1LLFA 4K6OA 1NXWA 3UCFA 3ZBTA 4YAGA 5C1OA 4H16A 1XTJA 4RZXA 1N77A 3GFBA 3CVJA 1FUIA 2HSDA 4FR0A 3WFZA 5KC8A 4JP8A 5L3SA 2OK7A 1KFEB 3L04A 4GECA 1HF3A 1Z4KA 1A9TA 1CQJA 4JZKA 2YY6A 4FSHA 1G21B 1FVHA 4XR9A 4GS5A 2B2NA 1CUIA 2R8BA 3I28A 3LFHA 3K4HA 4JLMA 5AJZA 4L3VA 1TZBA 1SHTX 4A6DA 2WDZA 4REQB 2GAOA 4MINA 4GMKA 3OCWA 1G6OA 3QOXA 3KHUA 4KX3A 4UTXA 2JCBA 4EFLA 1DRUA 1GKUB 1L7XA 1N8NA 1NR5A 2IU4A 4PX3A 1SKAA 4RLHA 1MABA 4PXYA 5HIIA 3IAAA 1JFFA 1EDDA 1RWQA 1TECE 3D81A 1CG6A 3PPYA 4PZAA 2VDPB 2E6KA 1E9RA 2XITA 3Q6MA 1E99A 3MPUA 4WSOA 4MRMB 4PSUA 3GF4A 2QT9A 3P4XA 3RB8A 3QVSA 3R40A 1JJAA 1WUTA 3PX3A 4YH1A 4K1LA 4QBIA 1GQFA 1JWAB 1MD9A 1RJDA 4W8HA 4A16A 1M0WA 1DWUA 2R2AA 5ES3A 2ID8A 4G07A 1T0BA 3LH5A 9GPBA 4HNQA 1HZZC 3GUYA 3U4CA 1QO9A 3FDFA 2XMCA 3TOSA 4DR2B 3PP8A 5HFNA 4DHWA 1OA0A 1ECJA 1EWVA 2J4DA 1PZMA 5C8YA 3T7JA 1XEWX 1U7WA 1I0LA 1U9YA 2W0MA 2ZXFA 3GCDA 2YFYA 3DDZX 4JEHA 3SC2B 1VLZA 2HMSA 3KZKA 4HJRA 2FXVA 5KKCA 1J5EB 2BFEA 1W0JA 1PDVA 2FJ0A 3CX6A 3PHLA 4GP9A 2NZWA 3KOXA 4IJ6A 4S35A 4D6XA 4HGRA 1Z8NA 4F5ZA 1GKLA 4D02A 3MMPA 3I30X 1U04A 3ROPA 3ENKA 4YV2A 1W93A 4Z9BA 1C4WA 1F60A 5D1NA 3RC7A 3V8BA 2XUPA 1YDWA 4HB2A 4EBFA 4RTOA 3OCJA 4UVIA 2O8CB 4ZCQA 4P86A 2REQA 4DSZA 1SPBS 3NKFA 4MWCA 3CNNA 5J40A 1RHRA 1F6WA 4KV9A 4QATA 1C8KA 2QM0A 4D9BA 5BQPA 1WXGA 2PTHA 1H5UA 5LU8A 4UEQA 1LDGA 1I9CA 2ECFA 2Z9DA 3KQYA 4FE7A 4TUYA 1JBEA 4F4CA 3B9BA 4EW2A 3I2YX 3M1AA 3HWSA 1DBQA 3OX1A 1ZD2P 4LNHA 4RJLA 2I8LA 4IVPA 1L5ZA 1PD1A 2GAJA 2HNAA 3N05A 1FPQA 2VAVA 1V6CA 4FFRA 1CR2A 3AFOA 3COYA 3RYFB 3USCS 5CEFA 3OOWA 4G65A 3NFRA 4I5GA 4EG4A 1ZO8A 1U3DA 1H4QA 1LF5A 5DXJA 2DUUA 4B74A 1Y3CE 2HC9A 1E4VA 3DA8A 1I7PA 1E0DA 1OWMA 1UKBA 3ACCA 1JQEA 1E2QA 3PC8A 5EERA 5K20A 1BIFA 4TTIA 2J3JA 2V7UA 3BH0A 1HYBA 4PGHA 3WYCA 1MOPA 2YWHA 4KK4A 1OZ0A 2AK3A 2ONZA 4F3KA 4MRRA 3W77A 5C3MA 2I3BA 3O8OA 5JRDS 4QOFA 1UDCA 1CQIB 1HE4A 1VE6A 3WBFA 4GMFA 4ZO4A 3LA8A 3V48A 4ZOQI 2NTVA 2HK9A 2A4MA 1HMYA 2N1BA 1YULA 2RHDA 1A9XB 3BYZA 3P9XA 5EKUA 4CQLB 1ZHOA 2BH9A 3GNLA 1VLJA 3OZWA 4IIFA 1XMSA 2P6NA 2RBGA 3OICA 1RYEA 3KWLA 1OW3B 1GZHB 3U4AA 3M4XA 2ZAMA 4RD4A 3RS7A 3GLRA 4C4ZA 4WXYB 2F43A 1MJGM 3R20A 3RVRA 4MPJA 4KN6A 4BFLA 1YB2A 1PT7A 3PF9A 5DIFA 4EK9A 1W5BA 1Q0HA 4IFIA 5K3CA 1JR2A 2WJ6A 5EE5B 1GEGA 3A9WA 3OY7A 3T41A 2X6TA 1AHNA 3TRJA 1KFCB 3QKRB 3U44B 4DADA 2IE8A 3JW8A 3N0WA