2EX0A

Crystal structure of multifunctional sialyltransferase from pasteurella multocida
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
392
structure length
392
Chain Sequence
MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKQVKSKEDALNNPYVKVMRRLGIIDESQVIFWDSLKQLGGGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cytidine 5'-Monophosphate (CMP)-Induced Structural Changes in a Multifunctional Sialyltransferase from Pasteurella multocida
pubmed doi rcsb
source organism Pasteurella multocida
molecule tags Transferase
molecule keywords a2,3-sialyltransferase, a2,6-sialyltransferase
total genus 136
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature ec 2.4.99.4: Beta-galactoside alpha-2,3-sialyltransferase.
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex0A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex0A01
2II6A 4V38A 4V39A 4V2UA 4V3CA 4R9VA 2IIBA 2IHZA 4R83A 2C84A 2IHJA 4R84A 2C83A 2EX1A 2IY7A 2EX0A 2IHKA 2IY8A 2IIQA 4V3BA 2ILVA 2Z4TA 2ZWIA 3S44A
chains in the Genus database with same CATH superfamily
1Y8QB 1CJKC 1NTRA 3E3MA 3SWWA 1R37A 5AH0A 3IAFA 4TTPA 3VSCA 4CQLA 3AUUA 3UQZA 2XEDA 4DQ0A 3IL2A 1DBSA 5CG2A 3IKLA 2FNAA 2O3RA 1CVRA 2ZJ1A 3IQIX 2C4TA 2WJPA 4JLAA 4FMCB 1NI5A 4DJEC 2RHRA 3VR5H 4OB7A 1CWUA 1YDGA 2IXDA 4BFLA 1Z74A 2HCJB 4PG7A 4AO6A 4C7MA 2QSZA 4RAOA 3DOJA 1L1QA 3HZHA 1XT6A 1DC7A 3L1KA 4C06A 4JBWA 4I1IA 5AW0A 4PSUA 1X1AA 3GEDA 2IT1A 1DV2A 5DTEA 4KR9A 5IAOA 1JR3E 1AQ6A 4BO3A 1E0JA 3VHRA 1QCYA 4F4UA 4AQDA 1PHRA 4AS3A 2Y1EA 5KPJA 3N5KA 2WAMA 5I7AA 5J5AA 2CEKA 1L4UA 1E2MA 3AIIA 4L0MA 4LRYA 4XDHA 3TTUA 3UB3A 1U99A 5A3SA 2FK8A 2I34A 4ZVUA 3T5CA 2I22A 4Y2GA 221PA 4YT2A 2JS7A 4NRDA 3ZE8A 2DY0A 5TGTA 3QVOA 4HAZA 1NRIA 1K7SN 1S3GA 1X8KA 3GFOA 3UMJA 2M1XA 3GRUA 4LAFA 4JJ7A 2H2DA 3R7FA 4LZWA 2F3UA 2P3QA 4MDEA 1A1VA 1ZP6A 4F04A 5FWAA 2VTKA 3C7TA 1DVRA 2IOQA 5ITWA 3WOVA 3GGGA 1QIMA 1UBCA 3GLQA 3PXDA 4JP8A 4KSYA 4OP3A 4XARA 3S44A 3T0IA 4U39A 4ENRA 3UV6A 2BH2A 1JXMA 5D8DA 2IW1A 2X76A 1CW2B 5DYYA 1OWLA 2QN9A 3G85A 3H83A 2JGRA 3M34A 1QTRA 4MIKA 4IX9A 3MJSA 1DWQA 4H7IA 3SJZA 1KFEB 3F4KA 1UINA 4ZO9A 2VT2A 1I6MA 4OAPA 3HB5X 1GCGA 4EUEA 2VLBA 4RTOA 3H97A 3VAZA 5FYDA 1P3DA 4D6YA 2AC4A 2L18A 2TSYB 1LSSA 2QRJA 2ZETA 3A26A 4M87A 1J2UA 4A0HA 3FKJA 2QRKA 4ZMBA 4RO0A 1Q84A 4EHJA 1L6RA 4GU5A 2FUEA 2W2QA 3ZCXA 5B7PA 5GV7A 1TTTA 4CLEA 5IDXA 1I4OA 4PQEA 3K1YA 3QKSB 1WHSA 4GMDA 2NP6A 3O0TA 4ZKEA 1B8PA 4OM7A 1S2NA 2P9EA 1M34E 5HK8A 3LPNA 4CCAA 5JWRA 3PRKE 4JYAB 2H0RA 4PLVA 2ZRJA 2J41A 5L3QB 3W5AA 1XPOA 1YCFA 2LCIA 2UVPB 5KHLB 1N6HA 2X9QA 3VHQA 2DMRA 4AWAA 1GQSA 2VDQB 4OIFA 3E48A 3KKZA 3F4BA 3EDMA 3SFVA 3PQDA 4NHOA 4BLSA 4L50A 4MUBA 2W22A 4BEBA 5JTTA 1SQ6A 4MTLA 5BXQC 4LNUA 3VJLA 3HUDA 3WBJA 5AKHA 3UXYA 2Y9MB 3AJEA 4NPHA 2Z3WA 4N65A 3EN0A 4XLLA 2ZYIA 3QBJA 2QJFA 2YV1A 4MW5A 1H2EA 1UJ5A 1WUIS 4DIFA 2IYUA 1ZEJA 2ZEJA 3HEBA 4ZI3A 4HB4A 4BO2A 3X1ZA 3GNTA 3FBWA 4QGBA 1GILA 3DMFA 1YF3A 1I13A 2RH4A 2W00A 3OEHD 3S6JA 4BVHA 3DH0A 1E2PA 4MV5A 5FPHA 3LQRA 1E69A 4XGQA 1YZ3A 5K4GA 5ELMA 1FFYA 4DZTA 3LZ6A 2IS6A 2BCJQ 2AXQA 3CW2A 4C89A 2JLRA 4GP7A 4R83A 2OGZA 2WJJA 5I5EA 1S7GA 5BWBA 5LYYA 4DQDA 1V1JA 3AIKA 3URMA 3JRXA 2VPQA 3ITDA 1QIEA 1XEXA 2KLBA 3RUEA 1U63A 5AW4A 3KJEA 1ZSNA 4XCQA 1W2HA 3AVQA 3EQ7A 1RXUA 2PQ2A 1TF5A 4GT1A 4X24A 4WVFA 3R7NA 2RDMA 1E5XA 4UAGA 3EPRA 3O84A 1C81A 4I99A 3BBLA 4R8SA 2HCBA 1OI2A 4J0GA 1P18A 1MH9A 1G20B 4PGFA 4C6TA 4GXRA 4WNIA 5AVQA 1T34A 1Y8CA 4ZOQI 1FBTA 3G9ZA 1W5TA 3PHIA 5E3JA 2SICE 1W4RA 2XNDD 3L49A 3QMWA 5FR2A 4AJEA 3PJRA 4TYNA 3AJ8A 3D5TA 1DIBA 1A1SA 1PT9A 3UT5B 1NDUA 2W6OA 1XVLA 2FPPA 3FGZA 3UG7A 4DB4A 3WZLA 5HJ2A 1DAMA 5JROA 1YO6A 3E82A 2R8RA 2D5IA 1Q0UA 1W59A 2WIJA 3EHEA 2QZSA 1G6OA 4B6JA 1QGOA 3NTQA 3OTQA 4ZOLB 3V7UA 1JJBA 3EVZA 3CJQA 4H59A 1UBJS 2Q5JA 2IHVA 4H4CA 1EQ2A 4F60A 5EXSA 3HS3A 1JA9A 4GX2A 4MP3A 1ODLA 4GQAA 2WIDA 4L76A 3ZI4A 1H3EA 9GPBA 1YZTA 1C8BA 2Q0XA 2YIDA 2EGHA 3QBVA 3ST7A 3U0BA 3U48A 4F6RA 5J4LA 4IZIA 2RHDA 2PUWA 2GFQA 4X00A 2PPVA 4MUNA 3UK7A 1HFKA 4RF2A 2BVNA 4WXRA 3IPRA 3QPUA 3LVQE 2GO7A 1L8XA 1MQ9A 1NQOA 2RMKA 1B7GO 3M83A 2EOAA 4P3XA 1IHPA 1Y3DE 3LX5A 5KVCA 2FDXA 3TNYA 3P2IA 3SC6A 1XA0A 4RANA 4Q21A 4CT4B 4Q3DA 4KYIB 2HDHA 3J81k 1F8FA 3K0BA 4LRWA 4CT0A 2AI1A 5FOQA 2NMVA 3IGFA 3ORYA 4Z9FA 3ZE1B 4ZO7A 4ARZB 1ZCAA 1QV9A 3K9FC 3VR6D 3A4LA 1R0RE 4D92A 1U7WA 4IVRA 3CINA 3DULA 5DXAA 5EQTA 3FPJA 3PYLA 2C78A 4Q7QA 2VHXA 4KVAA 1TCUA 5AKIA 1RMQA 2A0YA 2I6XA 1AC5A 2WA2A 1Q1QA 1LDBA 2X1HA 3L1JA 3TAXA 2JD1A 1LPSA 3I4CA 4L08A 5EQDA 3GRZA 4YT5A 1G21A 4O1MA 1ZUNA 2QLTA 1PS8A 1XZPA 4K86A 1EWRA 2FB9A 3MVEA 2CSXA 2JAQA 4FZVA 1GZ5A 1G2PA 1YCHA 2X2EA 1OD6A 5AKGA 1V3VA 1XD2A 3RJMA 1HE4A 2PXCA 3QLUC 4I9GA 3ZGNA 4DS3A 4DV2B 1VLJA 1T3HA 3Q5EA 2JEYA 5CXXA 3U6KA 1BJTA 1BYUA 1Z3CA 4Y9SA 5CA0F 2IX3A 1B6SA 2XMDA 4IPTA 5IAAA 2OHIA 2ZJZA 3UNXA 2J08A 3O8BA 4X1OA 3VJRA 4RGBA 2YHSA 1GO2A 2WZDA 3UUGA 1JFVA 2DFTA 2PUHA 4ZU1X 2DBQA 2Z57A 4Q3KA 1JBEA 4KRYA 1BKDR 2FZEA 1B74A 1EB9A 1P2VA 1T2CA 1T4MA 4FYYA 5DNWA 4F3RA 2FRXA 1YRQA 1KEWA 1ZAKA 2CC2A 5CH3A 5DHPA 2IU4A 4JBGA 4LKOA 3SS8A 5I7HA 3HA7A 2ZT5A 1Q1BA 1FLNA 1NV8A 1V11A 1CJBA 1VIMA 4LZPA 3PGA1 3RE1A 3V4PB 1OE0A 4OG2A 5T4EA 2IP4A 4GPIB 3OOYA 4LI0A 3W0LB 4N4AA 3GT4A 3CH7A 4I9HA 1L0BA 4O4IF 3FNFA 2B5OA 4JD5A 4OGGA 4OXNA 4W5QA 3B9BA 1OILA 2M1ZA 3GT0A 3HMQA 5K3CA 4YYEA 1FE8A 2VPIA 3HZRA 3OFNA 4IIJA 4OTZA 3UT6A 3GFVA 1QVZA 1NT4A 1I1OA 3LY9A 2J5KA 3LWZA 4C7BA 2J9GA 1I9GA 4QBFA 3AI2A 3IAS6 2FKAA 4JXZA 1KJ9A 2W0MA 3DR3A 2XODA 3TOCA 1CF4A 2I55A 4XUGB 1JG4A 2H4XA 3TNLA 1UF9A 3CGWA 4IUBS 1EXNA 2C2YA 1DXOA 3GBVA 3IJ5A 3FAZA 4N8EA 3LLCA 4PYIA 5EVCA 4ZQBA 4BWYA 1YC5A 1KPGA 3G68A 1P45A 3HXPA 4D9JA 3H42B 1KVRA 4A6PA 3GLHE 3AERA 4ZPXA 2COEA 1KK3A 2GF9A 1IB6A 1SOMA 2PD4A 1UMKA 2PH5A 1JBQA 1E5TA 3KD2A 3P2KA 3T3IA 3PD7A 4BTLA 4HFJA 2G5CA 1TJNA 1M6EX 1LX6A 4RV4A 1FQWA 4EW1A 2D2FA 2BFNA 2E89A 4X85A 1UK7A 2G1KA 3MC1A 4G8DA 4GYKA 1R16A 5IM4F 1TYDE 2G07A 2PWBA 4RBNA 3PC8C 2ONCA 3OE1A 3Q9NA 3H2BA 1PJRA 1X1DA 4MQ5A 4PZLA 3L92A 1YCGA 5A71A 1COWA 3OJ0A 4P7BA 1WQ3A 4P58A 1CIJA 2F64A 1JI3A 4ER3A 1MHPA 3M5DA 4R2KA 2YUIA 3DKVA 4MUXA 1GPH1 2YJNA 3EWNA 2WUWE 4FDUA 4R1PA 3UFXB 3WK9A 4ABYA 3IAS1 4IMIB 5BYAA 4LF6B 5KNCH 1ZRHA 4KFCA 2J6HA 1LGYA 1L5VA 2ZYVX 1FSGA 1S2IA 3O8LA 3V1MA 4YJ3F 4UFOA 3RUDA 4L6IA 4GOLD 2E5FA 3G9QA 1N2IA 1E3LA 1PNTA 3BREA 4L5YA 4XI9A 3D4BA 4Q1BA 4F46A 3OQVA 3L93A 5AQ1A 2OBBA 3R7SA 4CV2A 4RPIA 2ZJYA 3R7AA 4ZWNA 5SY6A 3OLWA 1NFFA 2G8LA 3NIFB 2ZXFA 4PBRA 1T4CB 2CXUA 3E2PA 2G1PA 5CIYA 1Z3IX 3PDJA 5IG2A 2F8TA 2HRBA 1RIFA 4PC6A 2GBGA 1Z4IA 4N49A 4DCPA 1GNTA 3AKEA 4PFSA 3W1WA 1P1HA 3ZV6A 4G1MB 4F3TA 1D1QA 4LZNA 3PUZA 1ADCA 2GETA 4UUBA 4GDFA 4CIXA 3N0VA 4L5CA 4F93B 3KZKA 3ROTA 3CR7A 1MGPA 3ICWA 5LKAA 3DO6A 1TK3A 1C3VA 2VN8A 5CA1F 2ZJ7A 2KJQA 2ZIGA 4EYGA 4UEOA 4EPYA 4BB9A 3SQXA 3ZBTA 3LT0A 4GYWA 1UDRA 3MXOA 4JR2A 4MUFA 1HDYA 1T2EA 2FZ4A 3OC6A 4NAVA 3ZCSA 2NTEA 2F67A 3MD9A 4HLDA 5J2TA 5CVTA 5D00A 2GCOB 3DZHA 3AM1A 4NYMR 4R1TA 3DAGA 2X2FA 5MN4A 1JJIA 2QMOA 3CE6A 2I7CA 5EIWA 4AZ3B 1R8SA 4J1SA 4ZVLA 5M7EA 1TPZA 4AJNA 2IXFA 1QB8A 3ITNA 2R7MA 3OBBA 3FLAA 1SD5A 2PO7A 5KREA 1WV0A 3FMFA 4QWMA 3AOGA 4YJ3B 3C8DA 5FWYA 5CLJA 3N87A 3PHJA 5KYUA 2VYNA 3H5VA 4RNDB 1XMOB 4XVQA 2ODWA 3GDGA 4C76A 1GR0A 4IVPA 1JQKA 1FA9A 3ILHA 4CEJA 2H85A 2PAFA 3DF7A 1W6RA 2X1LA 1PG0A 1Z08A 2LBPA 4PGMA 1AZTA 1AQYA 1TU0A 3LUDA 4KRGA 1KJNA 2FMXA 3QUQA 5K9ZA 2OTCA 3HEAA 5A2GA 5BPHA 3EF1A 4PNZA 2FWNA 2PFSA 3FCYA 1UXKA 1UMCB 4UVGA 3HBFA 3K6SB 2EV9A 2YJZA 5J9FA 5IJZA 2P2GA 2Z6QA 3E5RA 4D74A 4RH1A 4A0FA 5JADA 2QL7A 1LA2A 4IDFA 4NBWA 3ELBA 5EYPA 4ZCMA 4N5MA 3ROMA 3NUQA 1LPAB 3CLHA 3WRVA 1A82A 1D7AA 1QIDA 2JLSA 5CEEA 1SBYA 2X19A 5CTAA 3V4VB 4W5HA 3SYLA 4C5CA 4NG4A 1E1DA 1N2XA 3K6JA 2VDKB 3LPLA 4JYMA 2DFLA 3MILA 3OZDA 2CLMB 3D8NA 4ZYYA 2WWXA 1WSAA 3I0NA 4GDMA 3U62A 5EMMA 3ZGYA 3W6ZA 1Y7HA 4ITVA 1GTMA 1J9EA 4HATA 4O4HF 5T67A 4C4PA 3M1LA 1ID8A 2NPIA 5AW2A 1L9XA 2F3TA 4JENA 2J4DA 2WTXA 1ISRA 2J4CA 1PJAA 4UPDA 3RFUA 1CR1A 4WA7A 1PGNA 4KYTA 2NXWA 4XCVA 3PKZA 2OD2A 2FXIA 3B7WA 2GN9A 1WLYA 2AG0A 3HUEA 5HZHA 4A8JA 2O5RA 3BWXA 4MYTA 4KFUA 2G4VA 1TVMA 4F5DA 2VPPA 3G2HA 1MA3A 3MFYA 3VU9B 1MABB 5IVKA 4BNGA 2WTUA 3T4PA 2FP4A 4DLNA 3EOBI 4NVRA 2IUYA 2VYQA 1S1CA 2IEGA 5LQUA 5BSHA 3H2SA 2LXNA 3DD5A 2X8AA 3IR6A 1PZNA 3EA0A 1D07A 4JP1A 3SX2A 4JVSB 1RPJA 4X84A 4FHGA 3BHIA 1IOWA 4CCSA 2WUDA 2Z3VA 3AYXB 2ZIXA 3D81A 2BHNA 1Z6ZA 3NR2A 3W9BA 4QGSA 1OFHA 2CMDA 2OPBA 3BQMB 3KUUA 3KOWA 1XLWA 2VSOA 4JQOA 4O8ZA 3V1LA 4XPIA 2IOFA 5BORA 1NQ5A 3F97A 3BRCA 2HU5A 4B3DA 3R09A 3DFZA 3WRXC 1EQAA 1ZVQA 5T6BA 1U28C 3TUJC 4ZJZA 5LR6A 3PFNA 1IJKA 3KEMA 4B7CA 4YCCA 5JFOA 3PXGA 3CUUA 3EQ2A 4DJFC 1UAGA 1ONSA 1TMKA 1XZJA 2W2NA 3QJGA 4F96A 4AJ2A 1G66A 2HBQA 1NKVA 1TDJA 1XKQA 2E1RA 4U2KA 5EWLB 3FWNA 1XQWA 5LC1A 2W0SA 1AMNA 1K7XB 1CY0A 5FEMA 3KTDA 3RGGA 2ZRPA 5ALFA 1DELA 4AKHA 3TL2A 1X7DA 2HRCA 2WWIA 3D3EA 3OPNA 4WNAA 4HLUA 4TSKA 3DLAA 5A1TA 3E53A 1K08A 3BFVA 2K7ZA 3D2AA 3LCMA 2J7KA 4LTNA 4PNPA 1CUSA 3WRYA 2R65A 2C1XA 5KDOA 4BNUA 3GJ7A 1TRKA 4HDQB 3G2JA 5EKDA 5TMBA 5GTDA 3NNSA 1PTKA 3GJSA 4MW4A 2G8NA 1HA3A 2NAFA 1E99A 1GGJA 4JL5A 1VYTA 1OU0A 3H2GA 5CUQA 1UZLA 3FGOA 2VNHA 3T7TA 2QUKA 2AJLI 3MTIA 3CG0A 1K75A 2FKNA 5JD3A 2JVJA 2Q4OA 3FUCA 1NF9A 1XRMA 4HNHA 1DKPA 4RZQA 4EX7A 1UBNA 4C7VA 5F9MA 2ZBRA 2C8JA 1KEZA 4DBLC 2XGOA 4RTSA 4MQUA 3T4XA 3LU1A 4EF6A 2HA6A 4DG9A 3U26A 1JQ5A 2VNJA 2FQ1A 4FUQA 4GS5A 1HSOA 4KVZA 2D8MA 1TT5A 4O4JB 5AXDA 3VOTA 3WLKX 1U6JA 2ON6A 4CM4A 3UWOA 4B3MB 2NZWA 1W76A 2BGLA 2AA3A 2DECA 4FNMA 2O3QA 5EJ8A 2YZNA 4OA8A 1ZD4A 2PT6A 2RGBA 4EKNB 2EJVA 1D1SA 3U0VA 2KLHA 1EQUA 3JYOA 3OOSA 4B5LA 1VC2A 2OUIA 1C8LA 2EYUA 2KS6A 5EHXA 2DH5A 5ECYA 1V3TA 4GYJA 3PNSA 5ITZA 1CUWA 3OURA 1O97C 3AQIA 4EYQA 5HQ3A 1RYYA 5DHTA 4JSTA 2J33A 3U4HA 1CZOA 2OBMA 2EFCB 3D6VA 5JJLA 1NYTA 1U2ZA 2JI7A 1PNQA 4RA6A 1KEVA 1UC8A 3UB4A 3QU2A 4NDZA 2IGBA 1E9CA 3SOZA 3ER6A 2OCAA 1OFTA 1K06A 4FFRA 5ESXA 5F5NA 4Z1OA 3U80A 5C51B 5HHTA 2WQ7A 2JZOA 4KLNA 1ZGGA 3CT6A 4LHXA 5TNXA 3H9JA 9ATCA 3TOXA 2I29A 1XSEA 3RUFA 2BKAA 4XDYA 4RV9A 2Q2WA 3W5DA 1N6LA 1TYEB 2A9OA 3R3WA 2QXUA 1NHGA 2OG1A 4BFTA 2OV6A 4DLSA 3STYA 2QJWA 5IKEA 1VB3A 3IAXA 5D5PA 3ZC3A 1VIVA 2IY7A 4XQEA 3A9TA 1A8SA 3IMEA 4H17A 3EUAA 5GV8A 5ULLA 3CZAA 2P2SA 2VH2A 4NC9A 1FU7A 1NMZA 2WV7A 5AW9A 5BWLA 2VSXA 2VTDA 3HP7A 4D8XA 1FRZA 3HV0A 3KJNA 4LUCA 3PQ7A 4J4HA 3OESA 2DG2A 1E0KA 3R0JA 2VOJA 1N25A 2Z4TA 4DMCA 2Y1GA 4CE6A 3DW1X 3ZYZA 4WUVA 3RVKA 5GZ1A 4Q9JA 4OHRA 3GZ4A 2B5VA 1UC9A 2CBGA 3AXTA 5DP1A 4KHPB 3UJ8A 3GJZA 4GR4A 4EZBA 1W75A 2QYHA 1ZMOA 3FCCA 1K8ZB 2X3YA 2YXBA 2GJ9A 3ZZNA 1N34B 3IJRA 4RA6B 2P5YA 3P32A 1Y3IA 3KHUA 1EUYA 2O2XA 10MHA 3D7RA 3L82B 4XE5A 3AESA 3R41A 4U2GA 3O9VA 1N5RA 1RJFA 3BB3A 2XF8A 1C9DB 3WNZA 3T95A 3MHTA 4BB0A 4GI3A 1SQSA 3AI7A 4LN1A 4GLBA 1UWCA 4MVJG 1KC3A 3BVPA 4HQOA 2H4YA 1XMXA 3QF4A 2JGKA 3DDOA 5M29A 2DP4E 2GBIA 2PKRA 1B4DA 1GNPA 1OIVA 1PFVA 4G2NA 4ZZ3A 4IFTA 1R7RA 4CMEC 2PR2A 1CG6A 1DLIA 2H7VA 1I2DA 4P4UA 2JASA 2PMKA 1GADO 1ULSA 2Q28A 2WKRA 2XMGA 4YCAA 2EL7A 5CM9C 4YALA 1RXYA 1UIRA 3ILVA 1GYRA 3UJAA 4EKYA 5C5DA 2IOHA 1R6UA 1W34A 2EX0A 5TMPA 4EPVA 3JQ7B 1BMQA 3DMTC 3EVAA 3P9CA 4EKGA 5AK0A 1Z6YA 1W19A 4JB3A 3W06A 2HUNA 3AK4A 3VBEA 3T7SA 2PU7A 3BULA 4BYGA 2FVYA 4YO7A 2HDNB 1AQLA 1LRLA 3QUBA 3C4JA 3SIXA 3MJVA 4WL0A 1J2RA 4LXYA 3DG9A 2YV2A 1I3KA 4O5OA 2BBOA 1NR7A 2XBLA 2XD9A 1YDHA 1Q3HA 2WFLA 4BKOA 3RAGA 2E5LB 3P45A 3L4BC 3KQQA 1R6VA 4IJVA 2XSZD 3FYSA 1ZJWA 4LQCA 4M6WB 2VLIA 2X6RA 2I65A 3J7AC 2FVXA 1N1EA 2OZVA 4GX1A 3DJFA 3NX4A 4WZAE 4CLRB 1RRMA 4D9IA 5HRCA 4ZO4A 2XTMA 1JWBB 4UNNA 5LXTB 5FAXA 1NQXA 1TQHA 5TMDA 1R0BA 2BZ0A 2QE7D 4PLWA 3IMGA 3QKIA 4TM8A 3NPMA 2NPFA 3AUAA 1VPVA 5B1YA 1A88A 3EG5A 1XRJA 3PDHA 2YFYA 1D2GA 3DE1X 2X8JB 2WQZA 4WK4B 5EUQB 2LPMA 2GEVA 2YZGA 1XJQA 2AR0A 4GG1A 4ND1A 3SJAA 4MVJA 1AGYA 2UZ3A 4XYGA 2Z4SA 2CFCA 4YP0A 2W6NA 2R86A 2A67A 3JASA 4NICA 5TF4A 4LRUA 4S12A 3QRWA 2X0RA 3EEIA 1PUJA 3RAFC 1AQIA 1QIIA 4B35A 2UZ4A 5HJ7A 5ARDA 3IQEA 1Q7EA 3M6AA 3HP4A 2BF7A 3WKBA 4JI7B 4KQ9A 1XHFA 2BY4A 1M67A 1UT8A 3MM4A 2RGYA 3PC4A 1XDSA 4FX5A 4K26A 2VDPB 5JRJA 5JAHA 2QG4A 1BC5A 4X6LA 3HRHA 3OCCA 4QECA 4M9QA 1E64A 1YS7A 4ER0A 3U6BA 2HNAA 1RACA 1DUVG 3D3NA 4ECEA 3OUZA 4ARIA 1OKKD 1KI6A 3EXG2 2GCEA 2DUNA 3HU3A 3LTEA 3R40A 3WNQA 4DRXA 4WCFA 4QT4A 4RPHA 4UBMA 1BRMA 1CQZA 4TMZA 5FD8A 3EVNA 4KPFC 4OYRA 3IO5A 1KH1A 3UJCA 1T2AA 1ZK3A 2PEZA 4EB6B 2OCKA 2FMIA 1XXHB 5CCXA 3THYB 4HK4A 2GHTA 1KJJA 1W85B 1X1TA 1H9AA 4WSOA 1WJGA 3KOZA 4KGXA 2M9MA 4O0MA 1Y6GA 3H1FA 3FWZA 4NK4A 1NL3A 2HHLA 4MJ7A 3ZV3A 2QRLA 4AS1A 1E4YA 4ETIA 2ACKA 3LBHA 4QXRA 1GSAA 1ZH2A 2GT1A 4BX8A 3HKDB 2Y1CA 2P8JA 3TGPA 2UYCA 1GY8A 2W11A 2YX1A 2I0FA 3DUWA 3FVWA 1NQAO 2YMMA 1HR0B 4FI3C 1CF9A 3L5KA 1FK8A 3M2PA 5ALSA 4DTIA 1YFLA 1Z2CA 3A4VA 1V16B 3ER8A 3F1LA 3R0XA 2H7XA 3DTVA 3I9LA 3P0RA 1JU3A 4GLOA 4GL4A 2IDMA 4V0KA 1ZSYA 2DR0A 3VSDA 1A95A 2GK4A 1I5EA 4MINA 3B6ZA 1F8UA 1G19A 1SKYB 1H66A 4G84A 2H00A 1HNNA 4OP1A 3RV3A 2DQ4A 2IDZA 1CYDA 1OZ0A 3FFAA 3ZV7A 1YRYE 4BFWA 3BDIA 2BRUA 4GX0A 1M2JA 4PONA 1CUHA 2DQZA 3Q1KA 4MJXA 3PG5A 3UAZA 1OGJA 5JS1A 5J4YA 2VHWA 3LIIA 2E55A 4MPDA 4P38A 1KH2A 3EZYA 1U5BB 2BFWA 3WL3A 3JTMA 3KDSE 2CHGA 3M4NA 4Q4AB 5LL6P 2PZGA 2VTVA 3QJYA 3U61B 1N77A 4KNVA 5B1HA 3WLFA 1A9ZA 2R5WA 2XB8A 3GX1A 3GGOA 4HXYA 4LZOA 2V55B 1YD7A 1KO4A 2R8ZA 1L5HA 1ULAA 4BLQA 5KYXB 4YRGA 3EFOB 2MT9A 1RZRA 1GUAA 2VP6A 3QKUA 5BN3A 2QX4A 4LZZA 3WHPA 4KFRA 3M6WA 3PTAA 3HRIA 2C1EA 5EYPB 2Y92A 4A27A 1G8FA 1M6NA 1QGZA 1AGRA 2FMHA 2Y71A 4MB0A 4NFSA 5FXMA 3RJZA 4FWBA 5HKAA 4FFWA 4R9VA 1WMAA 3TZCA 1W5FA 5TS2A 1QE0A 1RXCA 1SU4A 1Z5PA 4FHDA 4HYTA 2OYCA 5AFSA 3Q3GE 3GLIA 1HDXA 4MS3B 2WE8A 3O4RA 2CUNA 4TKZA 3JU3A 4EK9A 4I5DA 4L72A 5K99A 4KUHA 1XU7A 3QHPA 4RD3A 2HQ1A 1TL7C 2XAAA 4CG3A 2ZRNA 4TTIA 3WA6A 3G8AA 2Q5FA 2GWRA 3M3DA 3NATA 5CB6A 1BHSA 5JNSA 5IDVA 1DL5A 1U3TA 5L53A 3A6HA 2NG1A 2FE1A 2O48X 1GVHA 4W63A 2W58A 1KAMA 3E22A 3H4VA 2JHPA 3KDPA 3ZNPA 2EHDA 4NOJA 3UOAB 1E96A 1DKRA 2CFIA 2PRSA 3NKVA 4KXXA 4DCGA 1F60A 1P5ZB 2H1IA 1OXMA 3HU1A 1D5WA 4TWBA 2XUDA 3GOQA 3JQGB 1KVSA 2FPWA 3JQRA 3Q72A 4MRNA 3RRZA 1FZTA 2O14A 2OO5C 3AB3A 4RIFA 4ER6A 3LOPA 2VEOA 3ACBA 3T06B 5HCUA 1F2TB 4TT8A 4UBKA 2XXBA 3FPKA 1QG6A 1LPPA 3LXXA 5H02A 3HNRA 1PVDA 4BX0A 2UXCB 5F3DA 4JN6B 5EFOA 3FH0A 2PRKA 3PUJA 2G9UA 3FPHA 2C07A 2WNIA 5JPIA 4A6DA 1N2OA 4HDCA 4TVBA 2H5JA 3NTRA 1V4NA 5EWMA 5EKTA 2VJPA 4JR0A 1P5FA 4G81A 4MEJA 4TMVA 3TPZA 1RC1A 4XAQA 1FSSA 1LFAA 1QFZA 2ZR8A 4WKCA 3WGNA 1TB4A 2EBWA 3IQXA 3A1TA 4QOFA 1U5BA 3KT8A 1PWYE 5AOVA 4LBZA 1H5NA 3E22B 5IAGA 1XRQA 3DQQA 1IY1A 1GL6A 5CAEA 4DUPA 3LTNC 4NL4H 2PEYA 3WAGA 1FX1A 2Z6VA 3L2OB 4HWOA 3AYZB 3TIVA 4HX2A 4S05A 5D3MB 4NE2A 3RS4A 1E5QA 4J0FA 3NV9A 3T5PA 4PYJA 3KAKA 1G3UA 1FFCA 4KIGA 1DJQA 1XNGA 3TINA 3VYTB 3KOXA 1N4AA 4EHLA 1MG0A 3BF7A 5LBTA 1XZ8A 2RHMA 3FY4A 1D4ZA 4DC0A 2XE6A 3PXCX 4YP9A 1YQDA 5B7GA 2DUMA 3JYHA 4G07A 3EJ6A 4FNAA 4EB8A 1Q0RA 2QSYA 3MRXA 4H1VA 4HPWA 2J0UA 3A28A 5FPQA 4B76A 1QU2A 3E35A 1GKKA 1SB8A 1SMKA 2HHAA 3DHWC 1Y8RB 4K9OA 3M6LA 2RC6A 4XEHA 5IDYA 5ICSA 1EDDA 1RXVA 3BCUA 1Y82A 1XDZA 3WR5A 3VU1A 2WF5A 3DVQX 1M0EA 1M2KA 2J6BA 4FZJA 3CE9A 2AG5A 2XMBA 3BIXA 2GF2A 3INYA 5FPYA 1DEHA 2AQKA 2YOGA 3B51X 2HEIA 4LI3X 3JZMA 1QHIA 3L1HA 4U7HA 4ZODA 5I7OA 1AOXA 1RMTA 3I4LA 1KFJB 1C7IA 8MHTA 2R2AA 1K2VN 4JYBA 1SQ0A 4FS3A 1E1QD 3SIPA 1J90A 2YXLA 5BYJA 3DMHA 2CHEA 1XZKA 3M5PA 3C8UA 4OYYA 3ZQJA 1GNQA 4G41A 1A5ZA 3W6UA 2QU8A 3FNBA 3AU8A 4AJIA 4B81A 4U7PB 2VH1A 4U5QA 4JNCA 2PO5A 1NUQA 3N53A 1NRXA 2HGZA 5DISB 3TL6A 4EA6A 1OXBB 2ID8A 3CH4B 4Q15A 1TUGA 4GI7A 5IP5A 1UPTA 1GGVA 4DMRA 1JSZA 4F72A 4L2IA 3SXUA 3VU0A 5FTJA 4Y30A 3ADOA 4BUZA 4KR6A 1IQ0A 5IJXA 2Z1NA 4Q0MA 4EWLA 4UUOA 2OBXA 1JDUA 1KP3A 2G82A 3AHFA 4IDPA 1TO6A 4GXNA 2CL7X 4DLAA 3EGVA 3R6TA 4EI7A 4FMPA 2ZT8A 3UAYA 1H0SA 1SUPA 2WMNB 2WWGA 2XZDA 4MX8A 5C52B 1PJ8A 1WEHA 3V1YA 5CBPB 3VJKA 1AUPA 5ERYA 2BZSA 1Z34A 1YQEA 3DCJA 4NJOA 4OREX 1E1CA 4F56A 3PIIA 4OVKA 3MTQA 4YP6A 4UNQA 4HT3B 1AHPA 2B6HA 2GR9A 2I99A 1J5PA 4RHTA 2Y27A 3E0QA 2C84A 4UXIA 3KQUA 3GP3A 1WXDA 2G4LA 1Q14A 1O2DA 3FG9A 4CQLB 4BN4A 5LU8A 1X7ZB 2C29D 1UZUA 2IOYA 3N07A 4N0QA 3QTBA 4O2RA 5T4HA 3EIEA 3JSAA 4WCDA 2MINA 2RK6A 2FEAA 2XA2A 3BKXA 3I39X 3LQKA 1WG8A 1FPQA 3MHPA 2FDCA 1Q20A 1TEZA 4QUKA 4WK2B 1ZA1A 4Q3BA 5EUMA 1VFPA 2W93A 4A5SA 4AKSA 4AX8A 3TKAA 4UBLA 5HM8A 1W88B 3QVLA 4PNEA 3LHIA 1MGOA 1SXJC 3G79A 1BWPA 2WC1A 5FDFA 2O19A 4NXNB 2JFVA 4OPMA 3Q2KA 4D43A 2WJZB 4EHDA 5KWVA 1FJ2A 4B45A 2D0OB 4DBLE 1Q6ZA 3NWJA 2PWZA 2DSTA 1DCTA 4AP5A 3EPHA 3WDKA 2W6JD 1YQWA 3TPFA 3X2EA 4JL8A 2R6CA 3VGPA 4G1UC 2QL6A 3L8FA 3U3ZA 3COVA 3JWIA 2L2QA 4K6HA 3AF0A 3GVHA 2ONZA 5IFKA 4MQEB 2CCJA 2O7NA 4RGQA 4QC2A 4ZCIA 4QQKA 1O97D 1Q44A 3BZWA 3TB6A 4NOKA 3O8OA 1C3XA 1VG0B 4YMVA 2W2KA 5IRCD 2J67A 2MDTA 4JVMA 1FC0A 1GL7A 3IRUA 4F9EA 1VI2A 3O1LA 5FWDA 4FQ5A 4C88A 1S1MA 1DIRA 1SVWA 4YR9A 3M82A 4MI3A 1MB2A 3W2IA 2DKNA 4FDAA 1RYEA 2AMJA 4K03A 4EHAA 1F8XA 4UQOA 3NJRA 3T8YA 1ZITA 1SUFA 2IPAB 3CLSD 2B69A 2XT6A 3G2IA 2BLNA 2XCUA 3L43A 4EJ2A 4NPAA 3IT1A 1XE3A 2YNMA 3LUAA 4YJDA 5E2AA 3RQSA 1PQYA 4GKBA 1GTZA 1VHDA 4C2TA 3RNLA 4Z6KA 2F8SA 1FDSA 1W88A 1N2GA 1T1IA 4YACA 3MINB 3SXUB 4B8ZA 1E79A 4URFA 1AF7A 4PBSA 3WWZA 2F8LA 3HN2A 3B6JA 4OKIA 4HDMB 2FR8C 1MC1A 2ZCUA 1Q91A 4TKUA 4B4DA 1Q92A 4ETWA 1FW6A 1F3LA 4PX9A 4L4RA 3IO3A 3ZD8A 3Q1LA 5JC8A 3DMTA 3K1AB 3RFCA 4REOA 2O8EB 2OHFA 3GWGA 3P52A 5E6SB 3MTJA 3ZE6A 3Q88A 5F7XA 4M9SA 3QEMB 3I05A 1RWKA 1GFSA 4JWTA 3CKKA 4HDKB 2BMJA 1ZXXA 3NONA 3CN9A 3IP7A 4DW8A 3BBPA 1NW9B 4Y9RA 1M1YE 2FUKA 3KJFA 1E1RA 3NI2A 1T36B 3DD1A 3QGMA 5K7SA 2QXYA 3LAWA 2HA7A 1SZCA 2HLDD 1RKBA 1AK2A 1L4HA 1KGDA 3N0XA 4X95A 4A2QA 4RE5A 4BGIA 4BV2A 3ZD7A 1GKLA 4FXPA 2EKDA 4R9NA 2N75A 1VSUA 2ZTHA 5LQNA 4YX9A 4RZ2A 2HDWA 4GC9A 2BBTA 1N32B 4IDQA 4FYPA 1WQ1R 1ADBA 3EAGA 1FLVA 3RH0A 2Q3LA 1CD5A 3ZU6A 2VG8A 3TIXB 3QY0A 4B4WA 4RZ3A 2VBIA 1O77A 1XQVA 4G9EA 3CUWA 3EVDA 2JRLA 2OAEA 1YACA 1M8FA 2WD7B 3B5IA 3KCNA 1EZZA 3AR8A 5HUJA 5JECA 2HPZA 3DCNA 1V8BA 2X0IA 2WF6A 1JKMA 4JOBA 1N57A 4TMFA 4YJ2F 1V4VA 2NSYA 2QR5A 1RFGE 2E85A 4HB3A 2BP7B 2DQKA 4QVIA 1MX9A 1P61B 4HOYA 4YGYA 1IB0A 2DLNA 2VKQA 1L1RA 3HYTA 4YMSA 5JNUA 4PFQA 3QEJA 2UUPA 1AG9A 3FOBA 1G8KA 3H4TA 4PR0A 3JQBA 4M0EA 1JPNA 3ZBPA 1C1HA 3G9TA 1QAOA 2RHOA 4ACAA 4W7IA 4B7XA 4C7KA 1AN0A 2YV5A 2CXTA 3KNZA 2EKQA 4HEA6 3AF5A 1JDJA 5BW6B 1AQNA 2AC2A 1OT3A 3BZBA 3CN7A 5FO1A 4FKBA 4QJBA 5JQWA 3NDBB 2NT3A 5AKJA 2H29A 1IDN1 1NSFA 4DLRA 4E7PA 2VBFA 3D7SA 4FMBB 4LHVA 1XP5A 1B0UA 4M0MA 2QBYB 3GJQA 2QA5A 4M55A 4MGIR 2PKQP 4TMYA 4QG3A 1CZLA 1GT6A 1GZHB 1H8HA 5EJAA 1NW4A 3IV9A 3CX3A 2EDCA 1JKJB 1YDFA 3QSGA 2WU0A 1MOPA 1M1ZA 2CJYA 3HG7A 3UT5A 5DX1A 4NU6A 4MTCA 3VPBA 3BIWA 5I7EA 1WL8A 4ZPJA 4E13A 2JBWA 2P41A 4Q1DA 1J09A 1XQ9A 2WUVA 3KR1A 3QE4A 2OGTA 3AUJB 1I30A 1G5HA 2IYQA 2X9VA 2Z56A 3IJEB 4A10A 4S35A 4Q24A 3RDPA 4D79A 1VFNA 3ELYA 1Y7IA 2WKSA 3TZKA 4M8KA 1OXVA 2J9XB 3N8IA 2BP7A 2BE7A 3ZNNA 1UZNA 1ZNZA 4D8YA 4D99A 1Z7GA 1ZGBA 5BSVA 3NDPA 1JHZA 1XPUA 3G17A 2EWWA 3WK4A 1Y3BE 3UHPA 4HS4A 1Q0SA 4IX1A 1Q1EA 3M3PA 4P2GA 2X2PA 3VZSA 4YV0A 3CTMA 5ADVA 3UANA 4ER5A 1B23P 2PA0A 2ERXA 8GPBA 5ITZB 2VDWB 1HDEA 1UFKA 1EB8A 2BR5A 3HDTA 3K6KA 5FRDA 2JFXA 3WGOA 2LW7A 1L5RA 1CDZA 3ZIDA 2IV7A 1E60A 2QAIA 4KBGA 4LJ8A 4LOIA 5JMOA 4PE5B 5G0UA 4DABA 3GLGA 2FW6A 3TCXB 4YCSA 4DXHA 4UHJA 3B5EA 3PI7A 3WNVA 3DLHA 5E4FA 3A3OA 3K0CA 5C1BA 1JW9B 3VMMA 1P6UA 5AOBA 1E92A 2IX9A 2AIRA 2Y05A 2VDVE 3WK8A 2GZ1A 1JQAA 2FF5A 4IDHA 2Y6VA 4LY6A 3UPUA 4U5XA 1VGVA 2HR1A 1JGTA 3BSSA 4PYQA 2XNSA 3WMFA 5CW2A 4NIMA 1SWVA 3KQTA 5HCIA 2EATA 2PXAA 2IZ7A 2ZREA 3QXHA 1V26A 2FSVA 1NNLA 3CY6A 1N5IA 2XDAA 3IURA 4HCJA 3PFCA 3TLGA 3UA4A 4ERNA 1Z4PX 2YW2A 2PSDA 4ARAA 5BW8A 4QJIA 4M8IA 1C14A 4ZCSA 3WZMA 3QI7A 5LN1A 3FRIA 5THKA 3PR1A 3GJ5A 2W8ZA 1JEYB 4I6JA 2JJQA 4XGRA 3UT0A 2ZR9A 2B35A 4DQXA 2W98A 3TYXA 3IBYA 1Z75A 3NHYA 3QPDA 4LYGA 3PCRB 4ENPA 4UE2A 3ADDA 1F2UB 3LQ2A 3R2JA 2LRHA 2X4GA 1NONA 3SS7X 1T1EA 1TMGE 1NQTA 2VSNA 2WPNA 5KTTA 4O59O 1NZDA 4QXAA 1DC5A 2C54A 4WOCA 4XYLA 1JG3A 3DEZA 1P2SA 4QZVA 1KBZA 4TYMA 2A59A 3KYDB 1J8QA 4HP8A 2NVUB 3S1SA 1XLTC 4B4OA 2RB5A 2PVSA 4FI3F 3UJNA 4Z4EA 3NHRA 1J8MF 2HIMA 2FPIB 1NW7A 3P2JA 2V3WA 5GJBA 3D4OA 3ICEA 5FTNA 2EG9A 1CJSA 1RS0A 2GMWA 3MS2A 2PD3A 4N82A 3Q8MA 3OZ7A 3FSGA 5AKEA 4ZDIA 4Q9KA 2QTRA 4IGKA 2V9CA 4MV4A 3RREA 1WBDA 3EQ8A 1IZ9A 3Q3CA 3V4RA 2AD5A 4JLWA 3KVRA 3LXUX 4RVHA 5TPWA 4CKWA 3KFXA 4XEUA 5EXEA 4DV1B 2H9AA 3BT7A 5ECWA 2OV8A 1EVKA 2FW9A 2XADA 1RYZA 4IAOA 4D9NA 4COOA 4CM7A 4D3SA 5I5GA 1NJSA 5I7VA 4QELA 3W78A 3L7LA 3WLEA 2V7BA 1XXLA 1ORHA 1YZYA 1S96A 2JGIA 4AZ0A 3UF0A 2GPTA 3ESAA 3B78A 2CMFA 4LEIA 1VG8A 1FYDA 4J9UE 4A0QA 4EB6A 4B3XA 1GEEA 2ZR0A 1ZLYA 1Z45A 3BWBA 4P7FA 4KNWA 1NMEA 5DTIA 5BUCA 3AKZA 2XYRA 1JAYA 1Q1ZA 2IYXA 1G8HA 2XCOA 4RD6A 4V2UA 1T8WA 3QUTA 3RSGA 3KQMA 1JDBC 3KJGA 2JGJA 3V3TA 4P98A 1JSXA 1XEAA 1Z2AA 4MMZB 1GAJA 4E1AA 3INRA 2ZBQA 5CEFA 2JLZA 2B4KA 2DPGA 3CHYA 4HLNA 5D5HA 4I2VA 3B3FA 4FDMA 4OHPA 4GBED 3EPPA 4LV6A 1KDOA 3L8CA 3T3GA 2HREA 4I9FA 2P3SA 1KDTA 3O26A 1DWPA 3ITEA 1U3FA 4Q7KA 2HF2A 2HN9A 3Q0IA 4Z5XA 1O94D 2KHZA 4OJQA 1PJSA 1CX9B 4P3PA 2E4XA 3ENWA 4ZRMA 2H1LA 4V1CI 1R6XA 2NNWB 5FHQA 3NEJA 3W5CA 1JEQA 2JFBA 1GZDA 1QP8A 4QQFA 4JI1B 3JASB 4Y1GA 4Y2RA 4OUDB 5DK4A 3QPWA 3W05A 5SYNA 2PGLA 3JQQA 5D86A 4Z9YA 1ZL2A 2C3MA 3IT2A 5KO2A 3K6RA 1U3DA 3MOSA 1Z36A 4R1NA 5EXPA 4BJ1A 7AT1A 1P7ZA 1BX3A 2QRVA 2A88A 3PX7A 3AV3A 2XRYA 5EIFA 1EYZA 2JGLA 2OOKA 3DNPA 1J0DA 3PE3A 4YR7A 4YP7A 4RNCA 2JBAA 4UNSA 2CB0A 1E3EA 1G6HA 2I3ZA 3ANXA 4OHVA 2OCXA 2Z2YA 2D7JA 2ZG6A 3MMPA 2HMUA 2R25B 4I19A 5DJ5A 4KQFA 5CFQA 4NBRA 5I8PA 1P74A 4ALKA 1XMQB 3RT9A 1L7VC 3DBIA 5FQOA 3VPHA 1RVDA 4JXXA 3D2LA 2XUKA 2B4AA 5CDFE 1URPA 2JJ1A 3HWRA 5L3ZA 3PGXA 4NE7A 3SZUA 2MHCA 1FVOA 3S4YA 5JO0A 3AFOA 1CJTC 2P2DA 1P5RA 1IHXA 5C1DA 5AIAA 4DA9A 1QK3A 2G1AA 2OV4A 4FYJA 4LGVA 3WS7A 1WTAA 1WCIA 3WVNA 2XUOA 4NX2A 4R40A 1BOOA 4B7ZA 5KEIA 1L4MA 2ZAGA 3TLKA 2AEJA 5LMUB 5GMOA 2ODQA 2DVMA 2DZDA 4L9SA 4LKRA 3OUUA 3OA0A 2MOKA 2O1WA 4ALMA 1WW2A 1E2EA 3VH2A 4BNLA 2P7IA 4NY1A 5BV8A 1V16A 2GHRA 3TXAA 3IAEA 4BX9A 1QX3A 2XMZA 5M34A 3AF6A 5LBIA 3GQVA 1P4JA 1QFJA 2FSPA 2QPLA 3Q41A 4HUQB 2MYPA 3CX7A 2YVKA 3KVOA 3DL4A 2QW8A 2GEKA 1WS6A 1VHQA 5JYEA 4S2EA 1ACJA 1GLGA 1ORRA 2B2CA 1L4KA 3HWWA 3S8YA 4Z3DA 1NG9A 1J2YA 1JEAA 1QG4A 3I2GA 5U4QA 4XUDA 3KSDO 1W46A 4CJXA 1RYFA 1QORA 1OXXK 2Q4BA 3EX7C 4K6FA 1H4VB 3DZGA 4HZIA 4D0LB 4AMBA 1QXSA 2PVCA 4EUNA 3BB1A 4GSKA 2NSJA 4AJHA 3UV7A 1PJZA 1QE5A 3LYAA 5BP7A 1GYPA 1QH8A 2LCQA 3C24A 4DVJA 3F47A 2YV3A 4ZKDA 3C6KA 1TXGA 5ETJA 1H8ED 3MD0A 2JFGA 2JAHA 3JAMA 5DTMA 4EYKA 4J9VA 3VR5A 4CDNA 5ALLA 3RRJA 2R79A 1NP3A 3HHEA 2OCYC 3K9WA 1QRUA 2YIVX 2VRBA 3TXXA 3SE0A 3KXIA 5FNVF 2B94A 5DM1A 3UHOA 4TL7A 2XDWA 3WWEA 1PYDA 1F8GA 1L4FA 4FGSA 2P67A 2X40A 3X43A 3Q0EA 4KREA 4C4XA 3ZIAD 4XWWA 4Y0AA 4GSLA 3ENZA 5JZ9A 3VOAA 5LMZA 3AM4A 3NTOA 3VPSA 1O54A 2XUHA 2WHPB 3MWJA 3WB1A 4Z3KA 1L2TA 2DT5A 3GFTA 4FFMA 2AOVA 1J33A 3LGSA 3SC3A 3GQBA 4DLZA 1FDWA 3EFHA 4LRQA 3WGLA 4EUFA 1YZFA 3BB4A 4JLNA 2W2PA 1GTVA 1FTYA 2V6FA 3NT4A 5DP2A 8OHMA 3WQHA 2GBLC 3N0RA 4TWAA 3TI7A 2W83A 2GK3A 5A9TA 5M3BA 4EY8A 1ZIPA 2HF8A 1A9SA 3CG4A 1E4OA 3HXLA 3PNBA 2JFPA 1G59A 2V5VA 1ZN2A 1UZMA 3C3CA 3MN1A 4WPGA 4HVCA 5FLEX 5AUNB 2ZUBA 2FPKA 4PC1A 5D6OA 4R6XA 3SSNA 2YY7A 3O94A 4B6GA 1D1PA 1F2TA 5CBPA 1I2ZA 2W43A 5LOVB 2AN5A 1YXMA 2O0KA 2ATXA 3EGDA 1YE3A 4ODIA 4A8JC 2NAPA 5A02A 2FG7C 2ZJ6A 5CFRA 2PX6A 5F7ZA 4CF5A 5KDDA 1BH6A 2OPHA 1ECGA 4B9EA 2VPWA 1C2YA 1HSZA 4LC0A 3S2IA 2REXB 3KQLA 2BSXA 1ZGCA 3D3KA 4PC2A 2I7VA 4I1RA 3TE6A 3PQ8A 4K9PA 4REMA 2F7SA 2QYTA 2BUAA 4V0MA 4DA7A 2J0VA 3WLJA 1Z5UA 3E61A 1S3SA 5JDCA 4DR7B 3TFWA 3LNCA 5DT2A 1IHDA 1N6OA 3GF4A 3MWYW 2B3DA 3LS2A 1J97A 4EB3A 6CHYA 1KEPA 4NYJR 1U8YA 3L18A 3QIVA 4MRRA 4P31A 4P7KA 4RY9A 4EHBA 1X1RA 4F97A 5JXGA 4HH1A 3FKSD 1A9RA 1B6GA 3AW9A 4G86A 3NXKA 4NU5A 2RGCA 4UJ3A 3EDRA 2AWNA 2C3YA 1D09A 3N2NA 3MIZA 3ZHZA 4ADSG 1KY2A 1IQRA 1IG0A 2FK7A 5A4DA 5CIWA 2WKWA 1N36B 4PPQA 2XMQA 1KZGB 1ZZGA 3QM1A 1Q6YA 4D4GA 2G09A 5A5DA 3T3NA 3EIOA 1KQ3A 3IVGA 4MVJI 3GAMA 4F9TA 1Y8RA 1C0LA 3TVYA 3WGTA 5IASA 1L5MA 2IIPA 3AV0B 3BS4A 1IY0A 4DJTA 5BQ5A 1MD9A 3GW8A 4FGZA 1BGXT 1GPNA 3EDOA 3SVLA 4IYJA 4JR1A 4WWHA 1I14A 2VRWA 3IQZA 1RR6A 4LGYA 3EW9A 4ITUA 4BVGA 1SK9A 3G0DA 1E7SA 3PK0A 1FFAA 2WAYA 2Y0EA 2EZ9A 1RRPA 1TLTA 2IS4A 4UHDA 4YRQA 1JEOA 3FRJA 2HNKA 1W48A 4Z8XA 1GFWA 1CHNA 1Y5IA 3V4OA 4TUYA 1THZA 4DVGA 4WZAB 5EI5A 3VH1A 1JP7A 4D3XA 3L6RA 3CZCA 1W0KA 3GEBA 3THXB 4DGQA 2XNKA 5JW6A 2IHNA 3FXAA 3CYFA 4Y9UA 4ZQEA 3EXHC 5AUOB 1PLJA 4OXYA 1UMBA 2DKFA 3JVVA 3O4FA 4KV9A 2QD5A 3OT5A 4KDEA 1W94A 1T5OA 3L0DA 1LPBB 1QH0A 1AHNA 4HGQA 4EFDA 4E5MA 1ZMXA 3SIRA 2JLWA 1PQ4A 5EJ6A 1E0SA 2W2KB 4EY4A 1YVUA 2BC9A 1YB6A 5C8YF 1Z5OA 1JE1A 1TRHA 1CJVC 3L6UA 4MNTA 4R1MA 5T41A 3TEFA 1NJ8A 5JXIA 4R51A 4MUJA 4A0SA 1F6WA 1I1QB 5EWJB 4GEGA 2V6GA 1FFXB 1Y5LA 2Z8YM 3BZUA 3IRVA 3LXRA 4K8RB 4B4VA 1NAHA 2GZ3A 4P36A 2JIPA 3NYQA 5DVZA 1KSHA 5BQFA 1MAHA 1MDFA 5LZ9A 2CNKA 1J00A 2HQOA 3DBHB 4ZA2A 3CWCA 1RHQA 4J43A 5B3AA 4CN9A 5E3IA 1YV9A 3W3ZB 3IBTA 4L7QA 5FBZA 4QUEA 1KJYA 4P6VF 4Y6LA 3MAGA 4KR0A 1CY7A 5FUWA 1E2FA 1FFEA 4U0JA 1C41A 1UBEA 2BEJA 2D5AA 2QMUA 1B3BA 4J2HA 2VZEA 3QEOA 3P94A 4M49A 2RGGA 1QV7A 3FNHA 2YYSA 1ACLA 1X1EA 2F6RA 3OCUA 3Q7IA 4FQ8A 4KG7A 1ZCBA 4U3JB 5JASA 1JHPA 1A69A 4P5EA 2E4YA 5JT1A 3ACDA 4X3CA 4OHYA 1T1SA 1G2QA 3JD2A 2OV3A 3AHDA 1AS3A 1TC2A 4NNJA 3RYHA 1VBKA 1Y7TA 1YS2X 2KM1A 4LNAA 3TNJA 2MJLA 4DRYA 1JWAB 5LQMA 4AXXA 1MTZA 1FJHA 1P1JA 2ZITA 3U4QA 3P8ZA 2CMKA 1GSOA 1FDIA 1U80A 5B58T 2Q45A 1QWSA 3NTLA 2FFQA 2O3TA 3MERA 4I7EA 3DE2X 6REQA 3U9TA 2BT4A 3I4FA 4AUEA 1L3CA 1O4WA 5JBQA 1QGUA 3S99A 1ORDA 2JVIA 4YA6A 1DG1G 5HXAA 5CLQA 3VSBA 4KX3A 2A2ZA 2QM8A 3K2QA 2YV4A 3N59A 4ZVTA 3SY8A 2JEOA 3IPLA 3ODPA 4CF6A 3URKA 4QNMA 2C2ZA 2R66A 3MCTA 5FOXA 2PMEA 3ORRA 5CXSA 2ADFA 2GTIA 3SZ3A 3MGGA 2QLLA 2WK1A 1Z0IA 1DJNA 2QR2A 2GBLA 4XD7A 2C4WA 3IS3A 2I5PO 2JFHA 2FWMX 3R3ZA 4FMDB 2QPOA 5EZSA 1XJ5A 3RC1A 3OD5A 1KR2A 1SXPA 3GAFA 3V8PA 4DLBA 3A25A 3ZGLA 5HKBA 1E7RA 5ESRA 2NXNA 3B1WA 1KC1A 3EGOA 4OHCA 4OQZA 3VA7A 3PFIA 5JMTA 5AHRA 4Y2TA 5A6VA 2VJNA 4B7UA 1Z6AA 3T5MA 2BEKA 1QAMA 2V7QA 3C1TA 2JI4A 1ZK2A 4IDCA 4NCAA 3LT2A 1S5PA 2OE2A 1JQ3A 4I1OA 2PWAA 4JUFA 3SYMA 3UBMA 4JI2B 3II6X 5AOCA 3IA7A 5K3DA 3ZEIA 3R5KA 1IVNA 3W9SA 3CW9A 1DAOA 3KHKA 2C99A 1A04A 1QCDA 1ESZA 4XKJA 1S3FA 3FRHA 4RC9A 1Q15A 3G88A 3I5AA 4BNXA 3WWPA 4C87A 3S5UA 3SDBA 4Q4JB 3GDFA 4MQBA 1T0HB 2G40A 4OV6B 4KOAA 3PNLA 1IN7A 4O2AA 3MGKA 4XIYA 2NT4A 4UTXA 4XVHA 1N6PA 4K0KB 3ICPA 3ZWNA 3NANA 1HKHA 2HU8A 4TKMA 5KYWA 3T41A 2DHDA 2O57A 2HO5A 2VP9A 3SLRA 2N1MA 2R4UA 2AI3A 4HVTA 3B7GA 5TQ0A 3TR0A 2C00A 3L5OA 2A1TS 3QWIA 4PQFA 4D4LA 3WK6A 1X1BA 3N7TA 4HDMA 1L8LA 1QIFA 1YUNA 3HJFA 3B2NA 4KBYA 2X5XA 4GOXA 1L3IA 3ZDZB 5A3QA 1SURA 4C0QC 2I6FA 1RAHA 4ZV9A 3RYTC 1BEEA 3LOUA 2ZYRA 2CNNA 3CRVA 3SEZA 4L9RA 5DBGA 2G63A 1VI6A 2D1TA 2DY1A 3GGCA 3KV1A 2E4ZA 2I2WA 2ANCA 3PICA 5EY5B 5IC6A 5IZ4A 1EE2A 5KYTA 3W3AD 3G5AA 2GQ0A 3AEQB 3LGXA 3SDSA 4EL5A 1QGUB 3HNPA 3WDSA 4BYMA 3H2ZA 1O6ZA 3VOBA 4NCNA 1TGYA 2VHCA 5H9WA 3I5UA 3ND6A 1Q11A 3V1TC 4AMVA 5A5EA 2XD4A 3L1UA 3HJCA 1PJ4A 1U7PA 2ZJAA 3WB9A 4UOEA 2AD1A 3WHIA 2WLTA 1BKYA 4G5SA 2ZYHA 1Y6FA 1GPAA 4ZYTA 2JJYA 4AUKA 4GZ6A 2W2VA 4YDSA 4F2WA 3ESZA 3MIIA 4XIFA 1P4AA 3E05A 1SULA 1USVA 1I7LA 4WI1A 4Q47A 4C2AA 1VCIA 3P2MA 1RZ3A 2V74B 3PKJA 1KYIA 1BDBA 2EKLA 2QVZX 3Q5GA 1B42A 1XL1A 1YCDA 3HUFA 4BZQA 1FDVA 2B1RA 1YK0A 4B3IA 1TQ4A 1J06A 2ETXA 4NZZA 1ONPA 4BU0A 3ZVNA 1ZM9A 2NQTA 1U8CB 4YFYA 3V8EA 2UDPA 3KQYA 4KXFB 3ILSA 2YINC 4URWR 5TVKA 4NFLA 1JL3A 2P5SA 2FZCA 3R3XA 1JX6A 2V1UA 1E5LA 1O5IA 2AF4C 3G6KA 2CFRA 3I64A 2XGJA 1A9XB 3DOOA 1G0OA 3FNRA 4YMTA 1HDCA 4GKKB 1RE0A 4N5LA 5BUSA 3CEHA 1ZD9A 2VBCA 3UATA 4ZCTA 4M9ZA 1WR8A 4D81A 4KFSA 1HDRA 1IEXA 4O02B 3O03A 1IM8A 5HIAA 5JXWA 1BROA 2ZTUA 3KD3A 3E1SA 2W4MA 3FW1A 3NVMB 3ZUPA 3L84A 5JH7A 2OECA 2VP4A 3GHYA 1U31A 1SO8A 1R2QA 3QOYA 1SHLA 2WJHA 5ALNA 2AFHB 4C5BA 1C3LA 2IF2A 3IUBA 1D2CA 1T8TA 4BMXA 1QQBA 3B1KA 3RJ5A 1OHHD 3JARB 4BCCA 2JAOA 1WXIA 4I3HA 1C0EA 1IXSB 1FZQA 4YONB 1VSQA 5LB2A 2FSGA 2OG2A 1JDVA 1PZFA 3W4KA 1WXFA 2B3TA 3EE6A 1XUOA 1KVTA 2D5CA 1DHTA 5DGIA 3RYIB 4BFZA 3I83A 2FN7A 4XGIA 1SVIA 5DIFA 5KVAA 3TG2A 2B98A 2R5FA 1JJVA 5J4KA 3A37A 1EX9A 4XWYA 1QRAA 1YGYA 1R9NA 3PPYA 4XW2A 1BA3A 3S81A 2DB3A 1PWZA 1P39A 4Q7LA 1W47A 1RVV1 1OROA 4L73A 2CDBA 1F2UA 5TJ9A 3ZU5A 5BN1A 5BUQA 3WL6A 5HPYB 2RHBA 4OUKX 4QUIA 5GWXA 3ZWOA 4EKDA 4GKVA 4D8WA 4Q4CA 3IBCA 5DGHA 2XBMA 1Z2EA 2IW3A 1JHRA 4FZ3A 3LVRE 1Z17A 1EINA 2OP1A 2FI1A 2ZKIA 3PT5A 4G5FA 3FOWA 3ZWCA 3ZVKA 3N7AA 4HEA1 5FUXA 1Y48E 4ZEOA 3PC2A 4GPD1 4ZYXA 1BXGB 4EENA 3TZLA 4TTJA 5IUJC 3EIFA 5CDHA 5LLSA 1AKVA 1U8UA 4JQYA 3UOGA 4NENB 4FN5A 2GDZA 3E9CA 4KGDA 5EZYB 5FTMA 4BCBA 4RMNA 2EG5A 2CE7A 2GI4A 3BJRA 3LWBA 1R10A 2CUTA 2OKCA 3SCZA 3IQDB 1EX7A 6GPBA 3TDMA 8AT1A 1XZMA 3UKDA 3ZTTA 4JUBA 4UU8A 2ZAMA 2FMKA 3RYFA 3AC0A 4H1WA 2IHKA 3HBLA 1J24A 1KKMA 1U0TA 1X9IA 3AESB 2C20A 2D4HA 2QRPA 3PX3A 4P3NA 3WTBA 3WL7A 2JH8A 1WKBA 1IU9A 3YASA 4RSHA 3VNBA 2P0EA 2VF2A 4UM9D 1E3WA 1NLUA 4BX2A 4YAUA 3A6FA 1PCXA 3UXMA 1I51A 1WIWA 3WGMA 1KWKA 3KAQA 2C7BA 1F1BA 2G70A 3WQSB 4PYNA 5DHRA 5C8ZA 2PUJA 4P81A 5KQPA 2JIQA 4FEYA 2IYSA 2DPMA 3ZY2A 5LA6B 3ROXA 1Y37A 2CLIB 3H5LA 4E51A 2G77B 1AMUA 3E23A 3U3MA 3Q7PA 1HG0A 2B8TA 2XTAA 3JZDA 1T1GA 3OQ1A 4TWIA 4MRPA 4C0JA 2FX5A 1E3SA 3AVOA 3E7PA 3IP6A 3UUWA 4IGIA 4MI9A 1YRHA 4FKMA 3Q11A 2Y66A 3K09C 4JU8A 3KB1A 7REQB 4BQQA 2PGIA 3SQNA 4WESB 2XWSA 3F6BX 2JJMA 4RKRA 2DR2A 5DXFA 1EJBA 3KAPA 1HE3A 2NPOA 2O7QA 3TRHA 1EPUA 4YUXA 2BFDA 4ACBA 3EB9A 1KFBB 2HYDA 3N76A 4KO8A 4HJRA 3KVNA 4M7PA 3SU8A 5K0JA 4G8CA 4DZZA 2RHCA 4BXOA 1KRXA 1JA1A 3JQFC 3WL5A 1YMUA 3K4HA 3K9HA 4V0NA 2GUGA 4G09A 3I6ZA 2UYYA 3E7XA 1W93A 2P4UA 1GGKA 1HYQA 3ZWDA 1Y4UA 2YXDA 2PHZA 2DWOA 4G1EB 1JB1A 3W2HA 5E2BA 4EYSA 1V95A 4N7RA 4O25A 1USKA 1EHIA 1Z0FA 3FCAA 1KP9A 3FCSB 4MAAA 5AXAA 3VO2A 1J25A 1T5HX 1U7ZA 2JATA 2XLCA 3F2VA 3MWFA 2DE0X 1LU9A 2QMZA 3AR6A 4P4SB 4PTLA 1Y3AA 1ZJZA 4EQ6A 3V34A 1SB9A 4LBYA 4EZIA 1GUDA 3TBKA 5EZ5A 3WKAA 4DWJA 2F55A 1Z38A 1X92A 2QORA 3DOEA 4QAJA 1NVBA 4TUYB 2WSBA 3ZY6A 2XI4A 2DH6A 1BQ3A 5HE9A 3ZUGA 2BM1A 4WBNB 4JV5B 3TN7A 1D03A 2PKWA 2E37A 3SZGA 1YL7A 3H3FA 3HR4A 1KHTA 1GTRA 2YC2C 5JISA 4U2DA 4LOLA 4ND6A 3STHA 1QFYA 1KQOA 3DBLA 1LW6E 4XASA 4CTMA 4P22A 1FNNA 2C9OA 4WFQA 1YASA 2EIHA 3OOEA 2YWHA 3LV8A 3ULKA 1ZM2A 1ZK4A 2C2XA 3OIGA 4XYEA 1IXKA 5C34B 5CFNA 3KHTA 4R41A 3LKDA 4PG5A 4WKGA 5C7OO 4Q00A 4LCBA 5FIUA 2H08A 3I9KA 3KSUA 5DCWA 4MUIA 3QKRA 1TLFA 4UCXA 2MSLA 4F6RB 1ZXBA 5FAKA 4Z8YA 4XM0A 1AQJA 1ZWKA 2A1IA 4ZARA 5A4FS 3HKBB 2C9DA 2GSWA 4GUAA 1GDTA 2R1UA 1CJMA 3RVDA 1FFXA 4LF7B 4YGXB 1T0PA 1MEJA 4L27A 3LX6A 4ZQIA 5IDWA 4RELA 3N7UA 4M0KA 1W9MA 3U2QA 3VM6A 4ECAA 2IK8A 5C1IA 3KJQA 1G7CA 3AGQA 2I3AA 2DF8A 1DIOB 4GGOA 4GOOD 4LHZA 3T54A 3UMGA 3TG8A 4UKDA 1DC8A 2Y93A 3U4QB 4N5IX 4Y1RA 5CA0B 1EVJA 2Y77A 3VYVA 5BVHB 1QIHA 1QHYA 3C2QA 1W44A 3NDRA 3PLRA 1TQ2A 1NJ6A 3O3NB 2Y6UA 4UASA 4AKEA 4RJTA 1M2OA 4HDRB 4DARA 3A2MA 3F7NA 4EW6A 2XE8A 2ZJFA 3TE7A 1WHTA 2KX7A 5JNWA 3IVAA 4MR7A 5UKDA 1EFHA 3D2BA 3BIJA 2C5LA 4Z86A 3GO4A 3OIYA 1X77A 4QDZA 3VR4H 3ZHUA 1JLSA 4YMIA 1MCZA 2CXNA 1TEHA 3KFLA 3EK2A 2MYUA 3DV0A 3TQSA 3GJYA 3I3OA 1HETA 1MAAA 4LWZA 4HUJA 1FXWF 4Y2SA 2GKSA 1AKEA 4FBLA 4BO7A 4OFBA 5CH8A 1WHTB 3MJFA 3OFVA 3D3JA 1NZJA 1CEYA 2JHFA 3OVMA 4N3AA 3LLMA 5EE3A 4DC9A 1ZBQA 2CJFA 3I6IA 4I1YA 1NU8A 3DC7A 1CB0A 1KF0A 4L4ZA 3RVMA 4M9XA 1M10A 5D3KA 1FP2A 3AL0C 4G8JA 3K8ZA 4IJWA 2RGRA 5FUBA 3GJXC 2VF4X 1EVZA 2Y8EA 4XWAA 3SYRA 1K0FA 4ML3A 3TFOA 2QROA 4H3HB 3V1NA 3VRHA 4QA9A 4LXTA 1R15A 5AM4A 5IMSA 4LDRA 5ICGA 3Q8KA 1XEXB 1JSLA 4XDZA 3V6MA 2R0QC 1NUTA 2IU6A 5GVSA 2IEDA 3QITA 3B89A 4WASA 4ESOA 1I4TD 3LLSA 3OLVA 4AULA 3QEMA 5I4KA 3V97A 4GZLA 1K8YB 4EBBA 3LK6A 2QG9A 4Z2AA 2VDMB 5JS6A 3A2LA 5JCPA 1S6YA 3A9VA 4LMAA 2UAGA 2IH4A 1QRDA 1G3MA 3IDOA 1SXJD 4JT2A 3OE7D 5EJEA 3RM3A 4CBVA 3G49A 3KC2A 5DNDA 5KNLA 3DV0B 4OU5A 2QQEA 5EIAA 1AVTA 4CTOA 3SBDA 4DT1A 2ABWA 1L6IA 1LLQA 4I4TB 1EXMA 1DWUA 2CE2X 2P2YA 1TEVA 1GSIA 1RWBA 1M2HA 2QN6A 1W5AA 1U81A 4KV7A 5CFPA 3PRHA 3EODA 3BICA 2SCUB 2WIFA 3TSCA 4UBIA 1FSFA 1U1FA 5B58C 4BDTA 4CKXA 4PLFA 2Q5IA 5A4IS 1C7JA 1SR8A 3RFTA 1M34B 1QR2A 1R0ZA 2ZSAA 4P5DA 3QOWA 4I4CA 3RLFA 4DCTA 1M1NB 2XRFA 3QOFA 3A27A 2QDXA 3W5IA 3B13B 2XAUA 1FUKA 3KVVA 4YJKA 3OEED 3KUKA 2CEAA 2PG3A 1XYGA 2GAFA 4G0UA 4N3CA 2ZTSA 4YUWA 2IPLA 4ZYZA 3WISA 1KA9H 3TSAA 2X13A 3M1YA 3ZXXA 4K9RA 1BCRB 1U2GC 2J85A 2SBTA 3UJ7A 1IEVA 4URUR 2XTJA 3FFTA 1TMOA 3CLKA 4H9GA 2A1UB 4MIOA 1DX4A 2REBA 3WV4A 1WMBA 2C94A 3VHXA 3WSTA 2J9FB 4WBXC 2HXYA 1ISSA 1ABFA 1VJ1A 5D1HA 1L5GB 5BVGA 2QRZA 5CURA 3QZUA 4ZGGA 3D7NA 1KMCA 4F3KA 3HXQA 6ABPA 1ZBDA 3ONFA 1YS6A 1GA6A 4UCFA 1Z12A 1CJCA 3A14A 3ZJYA 3MJRA 2E6KA 2H3EA 4INOA 3ZK9A 1G9XA 3GLHB 4CN8A 5ABPA 1JALA 3DAHA 4Q7EA 5CT5A 1AU9A 4E11A 2BI4A 2XCIA 4MXDA 1XDWA 4LDZA 1F0NA 2LUOA 2QR3A 1XEWY 1XTQA 3F8SA 4YJGA 5FTKA 4GPZA 3DOIA 1IWOA 2W6IA 2OHHA 2ZRHA 3P5SA 4M7OA 4R8RA 2H2IA 1U2PA 1GQFA 4PRLA 4WERA 1BNCA 4FJ0A 3S29A 4FGLA 2B21A 3OZSA 2RONA 1XEFA 4Q4HB 4MUMA 1DTEA 3C6ZA 4YLEA 5JQGA 5KINB 4MH0R 1FMTA 5C81A 1KQFA 3SC2B 3I53A 5L4LA 1NYRA 2R85A 3KXDA 5CB4B 4IIVA 2B4RO 1SC6A 3B9PA 3VSEA 1LCIA 1K7FB 1MIHA 1UPCA 5ALDA 2ZJOA 3PZBA 4GMFA 2YFHA 4XFKA 5JSFA 4DV3B 4X7BA 3L0SA 3REQA 3EIQA 2ZYWX 1WB4A 1RLIA 2Q9UA 5DHUA 1BCSA 5L45A 1D9ZA 2XE4A 2MR6A 2AS0A 1ZU5A 2C0QA 2VNAA 2WF7A 3OZIA 4RSMA 2R6GA 3WADA 4DHWA 4ZGBA 3GUCA 1U3GA 1TEXA 3DWIA 1M8GA 4HWKA 1G291 5DSXA 1Y9JA 2AOUB 3WI7A 1EFRD 4Z7NB 4HXGA 5GY7A 3KDAA 4HDOB 2Q3FA 4FUTA 1JEDA 2P9BA 2GCNA 3T38A 2PS0A 1CRQA 4JEIA 1W5SA 2EF0A 2GPNA 4JQCA 3WLAA 2HJ9A 5REQB 1HK7A 1HL7A 1QFXA 2OCLA 5LA6F 3USES 4CNQA 1PQUA 2ZDQA 1GT91 1U5AA 1E18A 1PBNA 1FDOA 1UBKS 5C2JB 3UMBA 3ZBUA 2Q1UA 2IEIA 3D6TB 4J0CA 4RVDA 1YJAA 1H42A 5C7YA 4KB5A 2WUEA 2WTNA 4LDQA 4OMCA 2BM9A 4AY5A 4D3FA 3GMSA 5CVUA 5ITSA 2BF4A 3P9KA 2DBZA 2R6DA 2ZRLA 1J0EA 2VUSA 1IDOA 2HAEA 3BK2A 4OO3A 3S2FA 1JNYA 1OBCA 2AFIA 1CKEA 1U98A 1AURA 4CCYB 2M6RA 2O3JA 4J0DA 1PGOA 1VBNA 4FCWA 5DULA 3NCTA 4Z4IA 1NI4A 4QYIB 2YWFA 2RG1A 1GKYA 1Y6QA 2QLMA 4Q3NA 4EH1A 2PX4A 1Q7GA 2VRNA 3MT7A 3KYCB 1AKTA 3DZBA 3TSZA 4C0HA 7MDHA 1ZLXA 3VZQA 4HLQB 3VH4A 4KQ1A 2REQA 4RDHA 4RXMA 4DCMA 2XB9A 2NO7A 5TQ0B 3VSAA 3FUWA 4Y9TA 4AY4A 5D84A 3AEUA 4NLLA 1FNMA 4DPMA 3V9AA 2JIBA 1CULC 4DUZB 2XMSA 2XKAA 5ILOA 4NARA 4MV9A 3VC3A 2FW1A 4AG5A 4R2HA 5I9MA 1DB3A 2HMWA 3GB9A 1N1MA 3I6MA 4DDTA 1AB6A 1AD2A 2J30A 3Q3VA 2G71A 1U0GA 1JYFA 1SY7A 2IRWA 4JLPA 3WWCA 2B30A 4YUAA 5JY1A 1XMPA 2ZI4A 4GKJB 1QO0A 1V5EA 5EHZA 1FP6A 2A9QA 3UC9A 1NY5A 4HNUA 1DJLA 4NYJQ 2DC1A 1Z5ZA 2AKYA 5IW8A 2JLYA 3O91A 2XDYA 1WPRA 1PJCA 1EDOA 1V96A 2FZKA 3FNGA 2IXEA 2VZ9A 3P4YA 4ISBA 1XA3A 2EGUA 2PV7A 3L8HA 5JCXA 4KXNA 2JI8A 5LD2C 2R68A 2H48A 2UZ0A 4H4EA 4UD6A 4OU4A 2HMVA 3OQIA 1YDMA 1X7XB 4QUBA 5ENZA 5TGZA 4A6XA 4KXUA 5FL7D 2H5LA 2D2XA 4MRVA 4MQFA 2BZ1A 1LPNA 3B2EA 5ALHA 1N0WA 3F2IA 1P7PA 2BCGY 5FOWA 3GWZA 3WL4A 4IIUA 5AW3A 1KEEA 1KZ7B 3V42A 2IP1A 4DQVA 4RH3A 1YDEA 1YQXA 2FPXA 1P0CA 3ELDA 5KKCA 4IZHA 2GUWA 1H0RA 1PEAA 3UYKA 3SJ7A 5CNMA 3VR6H 5AW5A 3DZCA 3IQHX 2VEDA 3VFDA 1EA7A 1XJCA 4DV7B 3U7GA 1G8MA 4M1KA 4A3SA 1BXRB 4X7RA 3U49A 4QGFA 2EZ4A 3NB0A 2P6NA 5DGDA 4W9RA 5C53B 4QDXA 4X5OA 4RY0A 4RFVA 3JPYA 2BCEA 3QPVA 4BS9A 5EWLA 2VJBA 2VJAA 2PJDA 1ABEA 3QFFA 5ECDA 1S2OA 3GRAA 3WIBA 1XDUA 1E3QA 1LK5A 3MBKA 1P5JA 4GBMA 4JT4A 3H87A 3MPOA 2AVDA 1E1MA 1Q77A 2RARA 3AEZA 3B1VA 3SQDA 2QN2A 4INZA 2LKCA 4OMFG 1PFKA 1YR6A 3N39C 1KPHA 2JIDA 5KJFA 1GPJA 2FTKE 4U2BA 4IH1A 1P7CA 2WIBA 3OO1A 4FD3A 1RQRA 1LSJA 2AEEA 1EGQA 1K8XB 3DGEC 3QV1A 4L51A 4MQFB 2DBVO 3N0WA 3UXHA 4AUMA 4ZICA 5JH7B 1NX6A 1L5LA 1M6YA 2I71A 4KI0A 5ELXA 5KAPA 3T9AA 4JT8A 4CQMD 3O3MB 1RHKA 1KI7A 2FHSA 1B00A 3TQQA 3T1TA 1ECBA 3G5TA 1GVNB 1PR3A 1PT5A 1RZVA 4IWXA 4LQLA 4E1BA 2EZTA 3B2QA 4NCBA 2VIIA 4B3RB 3JQGA 3OJOA 1L7DA 4IHQA 1Z5VA 4XVRA 4DR1B 3ZWWA 2WG0A 2R8EA 3A3NA 4BVLA 2ZWAA 4ALJA 2NXJA 1ZISA 5K0BA 5LOVF 4QTUB 5BMOA 3RIYA 3CNQS 2VHTA 4AJPA 2L17A 2O7VA 1I33A 1VHJA 3K9QO 3WDLA 3MWEA 4ZRDA 1Y1PA 3U7JA 1GIAA 3FLMA 1MJNA 3H2KA 2H9YA 3FFBA 3NDIA 4ZAZA 1P8JA 3ZDEA 3T9DA 4OQFA 1OVGA 1ZQ9A 3M2TA 4DKXA 3BK7A 3GCWA 2PT9A 4E33A 5LP6F 4LC1A 4MKIA 1UBSB 3AI3A 3PLAE 2WPDD 5CPBA 1H6DA 2H65A 4ZHSA 1LK0A 1BN7A 3S0JA 3CZPA 4II7A 4YK7A 3SD7A 1OXTA 4WXMA 5AK6A 1UAAA 1THMA 2A5DA 4KL8S 5JS7A 2BGGA 4UARA 5KQSA 5KNBA 2XH8A 2GPSA 2HSEA 2XUAA 3FWYA 5KSZA 1E6EA 3AOEA 1T2DA 2R00A 3D4LA 3GYGA 3NAGA 3P97A 1EE9A 1WWKA 4J4TA 3TW4A 1WUJS 4WLNA 1IONA 1HUQA 2ZRQA 2YRWA 3DEKA 3WYNA 1TYBE 5K4HA 2ASVA 2QQGA 4HXEB 4RA9A 2EWVA 1NSTA 2Q0SA 1TM3E 3IR7A 3U3RA 1J2EA 3E03A 1X80B 2Z9DA 1MC5A 3H13A 1O9GA 2C2OA 3L01A 4G0OA 3L4BA 3BWDD 4JCOA 3IPAA 2G17A 4CF4A 2RCNA 4C9BA 1YNOA 2O2YA 1ZUHA 4JUIA 1DAEA 3DYIA 4MP6A 3I6BA 1MENA 1UJBA 4RXTA 4N01A 2E4UA 4Y1RB 4KYVA 1ZPDA 1ICEA 4PGGA 4UE3S 1V48A 4JH0A 2BZGA 1HNZB 1X7YB 1TM1E 4DSOA 4DBZA 3CW8X 5I47A 2EQBA 4RTPA 5I4CA 2R3SA 2YZ7A 1QHHA 3CIFA 4C4OA 4AKTA 4NZOA 1JR3A 1UJ4A 1XZCA 1CQXA 3QLTA 2A4KA 1P2GA 4I0WB 5T64A 3H7IA 5AVWA 3HJBA 1MB3A 1NVUQ 5FUMA 1CQIB 4I1SA 4R8LA 2AI2A 2HV8A 5JS8A 1NKTA 4JODA 5B37A 3RFXA 1IQPA 3D8BA 3H04A 3PTZA 2P4HX 5B4VA 2Q2QA 1R8JA 1IMJA 1SC9A 3VO9A 4UDNA 3BMQB 1QGYA 4B2PA 2X5NA 1NY6A 3AF2A 3G02A 3O4HA 4GE0A 4ZJUA 2Q3CA 4MI6A 4RL4A 1XDBA 1YUMA 5D87A 1ETUA 3CEJA 2HXGA 2GX6A 5JEDA 1QF9A 2GJ4A 2RBKA 2O1XA 2PAAA 2BUCA 1JMYA 1ZIYA 3HGQA 4GM4A 4HC4A 2XF2A 3WGGA 2ZRKA 5B3JA 3TTYA 4AQYB 2OLJA 2ZW9A 5CVJA 3KWJA 2DKOA 4HJXA 1FNDA 5IHPA 2OXIA 1Y4ZA 1NIJA 2XIQA 2H1CA 4TRNA 1P9LA 1CK4A 5CNJA 1I0IA 2WYIA 3T0GA 3QP9A 2X0DA 3BEOA 1S01A 3F5FA 3MWGA 4CR7A 3U60B 1ZH8A 3EXAA 4QSHA 5BN4B 3WC4A 4PBTA 1LKZA 4JP2A 4P4SA 2I2CA 1TF7A 1F4VA 3BCHA 4HB2A 1ECCA 2QBYA 2NVOA 4NBLA 2VBGA 4XWOA 3SGLA 2IDKA 3FYTA 1Q0TA 1Z7BA 1GLVA 1VYHA 1EX1A 4DRZA 3ZEAA 2XHEA 1TA0A 2IBTA 2NSLA 3EZNA 2FSVC 1L8AA 3ICCA 1KJIA 3PQ4A 4KLZA 3D1LA 1SPXA 2WHEA 1F3OA 1DHRA 1J9GA 4OP2A 4X94A 1B8NA 3WGUA 1NDHA 2ZTVA 2Y76A 3CZ4A 1KAHA 2HWWA 5FWXB 5GVRA 3VAYA 5JJIA 2X7XA 1G5IA 4UZEA 2HCTA 3U7QB 3U9SA 3DYVA 3X1KA 1GU1A 1EFPB 2I4NA 2EP7A 2PL9A 2PQMA 4NECA 1ORVA 3AHEA 4ND4A 4P3KA 3M3HA 4ZU3A 5DMHA 4IHKA 1GNRA 3H8SA 1QOZA 3H9EO 4RHXA 2VA9A 4GRDA 3O8NA 3BRQA 4UUMA 1YQUA 1KTIA 1OFUX 2QAGB 4DV0B 3ASYA 4WIAA 3HRKA 1OSNA 2E82A 5JHHB 4Q1AA 2PIAA 5CA1B 3STWA 5GINE 3H4MA 4LF4B 4QEZA 2YASA 5KUTA 1WLSA 3ESQA 2VP3A 3EXFB 1QHHB 1MQ8B 1SHJA 4C4YA 4UM8B 1YJBA 4UXJA 4AWBA 1A9TA 1BXGA 3ADPA 4IINA 2ZS7A 4L15A 1S02A 4EY5A 2PUCA 3Q6MA 4XM1A 1C4XA 4BOYA 4MAFA 4PIPA 3T35A 4EO4A 3G5MA 2CHVA 4J49A 5AVXA 2ZU0C 2CJWB 3K92A 4EAAA 3RIEA 1P81A 1K5DA 1Y98A 4MO2A 5JSKA 3WXMA 3KOOA 4GMKA 5F78A 2Y1FA 1LV8A 3M9LA 4W5JA 2YWGA 1PK8A 3BRWA 3NWPA 4G6ZA 1GRVA 4DA0A 2CUKA 2P9ZA 2ZWIA 4HN9A 4RPKA 3RS9A 4DEVA 3I0ZA 2BDUA 1XALA 2VJDA 5DW0A 5KX5F 2VK2A 1ONNA 3ZTYA 1I7NA 3H9UA 2VYVD 4O8CA 3U19A 4KZKA 2P6MA 5A4KA 1VP9A 3KJIA 5EE9A 1C7QA 4TWRA 1WW3A 3SX0A 3UIEA 1GRNA 1R5JA 3K20A 5GZ6A 4CMCA 1QGED 5CM8B 1T9AA 5CH5A 1U0EA 3HDYA 1N7IA 4DLWA 3HUTA 1FFGA 4YS6A 4N5NA 3LRTA 1HNXB 2WNHA 1RKQA 3FD8A 1JE0A 3OPQA 2F9FA 4PZCA 3C5WP 3L0CA 5H3CA 3SQMA 1HTTA 3GZNB 1OBVA 1EXDA 3TTTA 1ZOSA 3KB2A 5JUWA 1M76A 4JKYA 2I78A 2E87A 4IG9A 2VT6A 3B12A 4QEKA 3RU3A 5L3SA 4MR9A 1P2DA 2HL6A 3MT8A 1P44A 4CM5A 5L51A 5F64A 1APBA 2FPGA 2WF8A 5E8RA 1Z29A 4RJIA 1VJGA 1M2VA 4IGEA 5ES3A 1WETA 2I9KA 1VLLA 1DWOA 5J43A 3O74A 1JIKA 3VNRA 4EQ6B 2ANBA 2WTMA 1VDZA 2W2LD 4AJKA 3JQ7A 4Z0HO 4GNRA 2VYFA 4BJ3A 1EKXA 3MG9A 3U7QA 1PN3A 2YICA 3G3EA 4FDLA 4MUYA 4OI2A 4YT8A 4RK6A 1WZUA 5BXYA 1EDZA 5BYKA 2QPAA 5LJLA 1L7EA 4Q39A 3FYUA 3IX7A 2OXTA 4Y6SA 4RD0A 1T5LA 1SQ5A 1UDWA 5TB5A 5HIKA 4P3OA 3TH5A 3LUFA 2IZZA 2Q6KA 2O2GA 2VRCD 3E9DA 1T2VA 1XZFA 4CUKA 2PUDA 4RMJA 3CUSA 3O8CA 4YT4A 3C70A 3NOXA 1V1MA 5HQ3B 4GLFA 1RBZA 1Z8FA 2PZLA 4LHEA 3QVGB 5SYAA 2QMHA 2VUUA 3GFRA 2QTWB 1D6SA 3HPQA 3OKFA 1NI3A 4KITB 3OM1A 1UDCA 2V8BA 5AOAA 5CDYA 4FFPA 3JQ8A 3AONB 4XR9A 1CUIA 3ABQB 4J0KA 1KDPA 3L8DA 4TQAA 4DV5B 5DTRA 1YFZA 5P21A 2OQVA 2C8VA 3BGIA 1NXVA 5AXCA 1HTWA 5CU7A 2AQ8A 5F2NA 1G0NA 5KSYA 3UAGA 5DDIP 3QVGA 2ZS9A 1PTJC 1WY7A 2BFFA 2ZPAA 2JGNA 4LQDA 3R8FA 4JI4B 1C50A 1PR9A 2DPYA 2NUPB 3ZW9A 2FPSA 3CUVA 5AHKA 2YYYA 4CMAA 3HQ4O 3RABA 3KAJA 3HCDA 4TTTS 2C04A 2EKPA 1XVIA 1YMVA 2BGJA 2CCGA 4FONA 2I3GA 2VDUE 3QG1A 2YL2A 4KQJA 2VA8A 3ETDA 1JVNA 4YCNA 3CR3C 4FNGA 1SUCA 2FWPA 3SF8A 3HBMA 1UK6A 1C0PA 1YNSA 2PJZA 2X7JA 3L4EA 5FBWB 2VXBA 4NMLA 4F3CA 4Q82A 3ZX5A 1ID1A 2BFBA 3H5AA 3VNSA 3OFJA 2UYQA 2FPMA 4EO7A 1C3OA 3R9XA 4RK0A 1NBMD 5H80A 2JFYA 4PHHA 5B1DA 3GLVA 4IQ8A 2VWGA 5DBEX 1OAOC 2VQSA 2R8OA 4XIIA 3E6AA 4C4ZA 2AG6A 4E94A 1XRPA