2EX0A

Crystal structure of multifunctional sialyltransferase from pasteurella multocida
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
392
structure length
392
Chain Sequence
MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKQVKSKEDALNNPYVKVMRRLGIIDESQVIFWDSLKQLGGGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords a2,3-sialyltransferase, a2,6-sialyltransferase
publication title Cytidine 5'-Monophosphate (CMP)-Induced Structural Changes in a Multifunctional Sialyltransferase from Pasteurella multocida
pubmed doi rcsb
source organism Pasteurella multocida
molecule tags Transferase
total genus 136
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature ec 2.4.99.4: Beta-galactoside alpha-2,3-sialyltransferase.
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex0A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex0A01
2IHJA 2C84A 2IY8A 4V3BA 2EX1A 4V39A 4V2UA 2IY7A 2II6A 4R83A 2IIBA 2EX0A 4V38A 4R9VA 4R84A 2C83A 2IIQA 2ILVA 2IHZA 2ZWIA 4V3CA 3S44A 2IHKA 2Z4TA
chains in the Genus database with same CATH superfamily
2Q41A 4P7GA 1KR5A 3FWHA 3NUQA 3ZWOA 3EXIA 4Z54A 1OVMA 1Z08A 3UJAA 3AEKA 4LGYA 2ONYA 4BRWA 1IN7A 3VSBA 1T2UA 4MPPA 2PBRA 5FD8A 1N4AA 3HZHA 3NANA 5FA8A 2RHTA 2ZIAA 1M6WA 3D7RA 3SVTA 4I14A 3IE0A 1E7MA 5CNJA 2HSEA 4OI2A 1PJLA 2WLTA 4GX0A 4KU4A 4CV3A 2JGMA 3MTQA 4DLTA 1BDIA 4BJHB 4L50A 4EMTA 4MWBA 2EC5A 1QGED 2QZSA 1IZZA 4ITVA 5JCJD 3K7EA 1LH0A 1O6ZA 1PJCA 3OIFA 4K1LA 2E4AA 3PQEA 4TZKA 5ILOA 4S24A 4BFCA 2IC5A 3MB5A 2Q9CA 4KFCA 5KWEA 2P5TB 1K98A 1CYDA 1PR6A 4D2IA 2FWMX 1Q11A 1GZVA 3IE2A 5ES3A 4EUKA 1V6SA 5JROA 1WW2A 1UJ4A 3EASA 3LOPA 2AN1A 1X1SA 2FUG6 3ZU2A 1C7RA 5E6SB 1ZY2A 3FKSA 4UTZA 1OXBB 2RHJA 4PSVA 2AHOA 4UNRA 3O90A 3JVEA 1GTRA 4ZMBA 1V71A 1XELA 1I2AA 3KSUA 2FVXA 2ATCA 1TOAA 2QT0A 3WYDA 1R6AA 2GM9A 2DC1A 3IP1A 2GPTA 1DXHA 2JCSA 3NC4A 4ODIA 1J33A 3W79A 2I6FA 1BGWA 3K71B 3NONA 2PM8A 4GG1A 1YQ9A 4QXMA 4AZVA 1L6IA 3LUFA 1NC3A 2G82A 8AT1A 4YAEA 5FBHA 4MJLA 5BUSA 3DOFA 4WBNA 4FGUA 4OM7A 3O8QB 4QDXA 3B5IA 4MGEA 4O63O 3SKVA 2OD9A 4IUYA 5E4TA 4KLZA 3OJOA 1FVHA 1CUUA 2CV0A 4RM3A 1FVFA 1TTQB 4ITRC 1RD4A 3VU0A 4E88A 1LW6E 2IIBA 3N2GB 3IB3A 2D5BA 5JCXA 3GLIE 4EHDA 1NBHA 2C3MA 3IUEA 2XNKA 4MW2A 4A26A 2ABWA 1J0XO 4Q1AA 3VU9B 1AQLA 1P2DA 2OUKA 4EHBA 3A6JA 1H1TA 4F3NA 1CUFA 3AWIA 3VYVA 1F48A 3V5NA 2NVWA 1REQA 3PQCA 1T3GA 2ZQZA 3C4QA 1TLFA 4IRXA 1PTJA 4MIYA 4JI4B 1ZH4A 2XHZA 4BP1A 1ISJA 4HK4A 1Y1KE 3SXPA 3I1JA 2YJ3A 5DWQA 4YMLA 4KQEA 1U9YA 1OV4A 3SFVA 4WJZA 1UQRA 2NNWB 2C7QA 1PWXA 4DLYA 5EJ5A 1Z82A 4P34A 4LAFA 2NX2A 4BEBA 4L76A 4LXIA 5DYIA 3GXOA 1RRVA 5DCUA 2XRMA 5EKUA 3W3AD 5HA5A 5H9WA 1BROA 3MWGA 1OWMA 3UTDA 3WA7A 3WLQA 1A9ZA 1DKNA 1MAWA 1R0LA 1R8XA 2IU4A 2X0JA 1H0RA 4I81A 4UUOA 1NM5C 3UV6A 4M8IA 1CQXA 2B5VA 4MRAA 3LHSA 3WFJA 4BS9A 5JQWA 3C7AA 3QVWA 1QGDA 1K6MA 3AI3A 3FR7A 3P9NA 4QXQA 1GNRA 3KHSA 4AY5A 1LSJA 3JQQA 1CB0A 2VP9A 3REFA 4EYSA 1Y89A 4U2BA 1KTIA 4RTPA 2BSAA 1Y9EA 1UL1X 1CY8A 3D31A 2REQA 3I32A 2WE7A 2XNDD 4WY5A 5DGHA 4ZAYA 2FZVA 3H4TA 3N6RA 4FS8A 5CK5A 2B35A 5DDIP 5DW0A 5EFOA 3GLHA 3SICE 3TSOA 2JBHA 1W44A 1ZN2A 2OORC 2WT4A 3K09A 3S5JA 2CV1A 2O2JA 5DVZA 2PIDA 4HRYA 2UZ4A 5EFZA 4XB2A 1INLA 3IDSA 3RHFA 1RC8A 1QHFA 1U0LA 1P5RA 2R6FA 1UP7A 4HGPA 4OQFA 4B2IA 2VWHA 5KHAA 3P9XA 2VZLA 1YU9A 1MTOA 2ODTX 4YXWA 4IFEA 3RLIA 3K8YA 1Y1PA 2YFYA 3DFMA 3PUJA 3RS4A 5K7SA 4LY9A 3W8EA 2J41A 3ORRA 4FGKA 1B73A 2FZEA 2JATA 3PZBA 4KIFA 4OQ4A 5EHZA 5DE3A 2RD2A 2QTNA 4UXJA 4GOLD 1N8NA 1WAMA 2ZR9A 2BGMA 3BXEA 3H75A 5AVYA 4B3RB 4PLCA 1B00A 1UJNA 1XCMA 2LCIA 3RRFA 5ITVA 4DUGD 1E0SA 2EF0A 2ZR7A 3LM8A 3L7OA 5FWDA 4D3SA 3GFBA 3JTMA 3VOSA 2VDWA 2YDXA 3WKCA 4C0BA 5LL6P 2CUZA 4CM9A 2PKQO 1NLUA 2QQ5A 1V47A 5DULA 1MC5A 3U7JA 1W1UA 2V7QA 3UHFA 1F7UA 1FB5A 4NBUA 3VNVA 3FTQA 2V74B 3ZK9A 3AW8A 2RARA 5DTJA 1EUCB 2BC9A 3ANLA 1I3OA 1QFSA 3H6KA 3NKFA 4BN4A 2DBVO 4KNWA 4KVGA 2ECQA 3RWOA 1Q0TA 4QGSA 5B2EA 1IRXA 4Y8VA 1YXMA 4W9RA 3IQZA 2V58A 3MCAA 1OXXK 1CRQA 2EWWA 4UREA 3QI7A 3QZUA 1PJQA 2WM2A 4IUCS 4R3UC 3Q6NA 1CLEA 1V4BA 3WLPA 1VB3A 4TUYA 3DE7X 1TCVA 3NHJA 5K3BA 4S0ZA 4L4ZA 3GZNB 2CNKA 3X2FA 3DAOA 3AR6A 4OJKA 3OD5A 4RS4A 3FWNA 5CB6A 1ATIA 1RPAA 2AE1A 2BISA 1I7SB 1O3YA 2WINI 1AVTA 3U7QA 1JHRA 1G8PA 1ZI6A 4IIXA 1BSVA 3WK6A 4MYUA 3TRDA 5KNCA 2FLVA 3DF7A 1CEQA 3L82B 5EWLB 4OHCA 3L2OB 2PLWA 2V6JA 2AIRA 2V55B 2WF9A 1LGYA 4HO1X 3BWCA 1P3JA 2AH5A 4GKKB 1NUTA 3CN9A 2EXXA 1YA8A 1FJHA 5TC4A 4P4SB 4X62B 4BXOB 3T3DA 1KTVA 4E70A 3TUIC 2WNSA 3IA2A 3OO0A 5T6MA 4FLMA 3AY6A 3VVLA 3GDWA 1GU1A 1P0CA 1A27A 2WD7B 1LC3A 4LZLA 3LRXA 3DBLB 3UFXA 3V33A 5JU6A 4L3OA 1UODA 5CM9C 2IUFA 4URFA 2R44A 3K0AB 4QVIA 4DN6A 4CEIB 1QPBA 3LT0A 1GKYA 1NZDA 4UTXA 3LWDA 1NP7A 3GP3A 3Q5EA 1I9CA 1MVNA 5LLSA 3O1HB 2BSXA 3PLAE 3C45A 4PX3A 1O94D 3IQGX 1T6BY 1DAIA 1NXTA 4HYQA 3W2FA 3FN4A 1OQAA 3S99A 1L7BA 2LIPA 1E7WA 2PDAA 2PH1A 3ED1A 3NDIA 3MS2A 2QVLA 4XFDA 4NY1A 2QMHA 3DEAA 3VR4A 3KEOA 2QN2A 3EVNA 3O4HA 1X74A 4X5OA 1GITA 1H66A 2PMBA 5M5BA 1LX6A 5T4FA 1VG9B 4Q1CA 5BNTA 2MINB 4PZDA 2VPPA 2FSVC 4CMIA 3I9JA 1SFRA 2RCYA 2OCDA 4MQMA 3UN1A 2EQAA 4EVSA 5IDQA 1JHUA 1T9KA 1I0IA 2ECOA 4GBED 3P4YA 2ACWA 4ZHQF 2BDEA 1L5LA 5A9SA 2CB9A 1VKZA 1YC2A 4D8WA 1B3RA 4B2YA 2IIVA 5KQPA 5FFFA 5BWMA 5BNFA 4CLRA 2PUGA 3W3AH 2B6NA 1F6WA 3D6UA 4OK5A 2JB9A 2I3DA 2IPLA 5JSUA 1P39A 4DRXB 1GD1O 4CVNA 4YCNA 3ILHA 2VP2A 4J1QA 4WXMA 1UIRA 3KQSA 4CODB 1IVNA 1R74A 3CV3A 4L4XA 1P44A 3WJ7A 3DSRA 2YHBA 3G0BA 5C8YB 3NHWA 2F48A 2X2EA 3DKKA 2CNDA 3U9SA 2P2NA 2CL6X 3IXLA 2XOKA 1EFDN 4Q16A 5IDXA 3JR7A 4NZOA 3JQGB 4DM4A 1HORA 5H4GA 4MARA 3PG5A 3TR0A 4GL2A 1AKNA 1VPEA 2J5BA 4IHJF 2PKYX 3A3YA 3ILSA 4HFNA 4N5DA 4B6QA 4BQRA 3LY8A 4WHMA 5IAAA 1JHQA 2FPWA 3GYGA 1TF5A 3P0RA 4DQKA 1E3MA 3GLIA 5DWVA 4D74A 1J8MF 3PJDA 1LLDA 3AEZA 4TT3A 3BMNB 4KXWA 5AT1A 3UJPA 2XNHA 2PVCA 3OCWA 4QA9A 5A4AA 1WHSA 1ODKA 2Z9DA 3G89A 1CF2O 3BRWA 3WKAA 3CPSA 2GMWA 4IH4A 3RRMA 3JQFA 4WADA 2OAGA 1QP4A 4KLRA 2CDRA 3U4QB 3KT0A 3PNBA 3OLYA 3QUTA 4WNAB 3I9NA 2NU9A 2I4NA 2BBWA 5J43A 1L8XA 1MCZA 2YYAA 3U7RA 4CIBA 2W4QA 3LC7O 4ZANA 3B3QA 1P74A 4JL8A 1R4MA 2ASVA 2NG1A 3CLHA 4BO9A 2XBMA 5E6UB 3DE3X 4Q4JB 3WK7A 3V7WA 1YTLA 1U5AA 3HDQA 4RW0A 2QORA 5HIAA 1OGIA 4YJHA 1K7SN 4W1RA 3VYWA 1HQDA 1WXEA 3TJRA 3ZEIA 1AQUA 1E79A 1Q1GA 2XWPA 1SG6A 3GHYA 1XGKA 2WF6A 4DLLA 2Y1FA 5DP2A 3B3JA 2I7CA 3STTA 4V1CI 3WLLA 1L1QA 4U2DA 4MUXA 3R09A 3TB6A 1CJBA 1PGJA 1WMEA 2AXPA 2JFZA 3P19A 4WQMA 2E4XA 2IUUA 1PCXA 1C9DB 4NV1A 4ZC8A 2H18A 1FEZA 1DL5A 3D5QA 1OKKA 5A1TA 4URWR 5EXDA 4M1WA 3Q0IA 2G28A 1TMOA 3BJIC 2PMEA 3O3CA 5IU6A 2HHJA 1JF8A 1KH2A 4I55B 1DIGA 3UAWA 5CHYA 2ATEA 5T5QA 3QLTA 5CAEA 4P38A 4JBLA 3UOAB 1E5XA 3U4HA 1CDZA 2Z83A 5EUMA 2NU6B 5KYXA 4S04A 5JXIA 1YL5A 2G09A 2X9VA 3JQBC 4DLAA 2PWYA 1O4VA 4ADSG 2H5LA 1OHHA 3G49A 2N1BA 1RS0A 1VPVA 3NHKA 3NWPA 3CRW1 1PL7A 4RHCA 3P2IA 2WF7A 3IC5A 5FEMA 3RQSA 3DKVA 4QQKA 1KGDA 4WEOA 4RDIA 5FYDA 1RAEA 2CVZA 3ULKA 1Q0LA 2D2VA 3NAQA 5DGCA 3TLCA 1OXUA 3A4LA 4OU4A 5FOTA 3SKYA 1YZTA 4IHKA 3T6KA 2GAOA 3ME5A 1QRSA 2OFOA 1FQOA 4AJNA 3EGWA 3VUFA 1OUMA 2JGKA 1KRXA 3KTAA 1QZUA 3OIUA 3R7FA 1Z7EA 3RIHA 5HZGA 1T2NA 2G7ZA 1AKVA 3EGIA 5TDHA 5B1YA 3Q11A 6NULA 1DIHA 3T3PB 1P33A 4EHFA 5D3MB 3IBCA 3P5BA 2X5NA 3GLRA 3P0HA 5KYUA 1GL9B 2WR8A 3NYRA 3NHMA 5EG5A 1YVPA 3JY6A 1TO1E 1YS4A 4AJ4A 4US0R 1AN9A 4FE3A 1Y0BA 1TIPA 2HHAA 2RIRA 4JP5A 1YVDA 1MEEA 3TQIA 1V48A 3A1DA 1G2IA 3PDIB 4ZAFA 3KJXA 3TIFA 3WBBA 4B3FX 4N5MA 2WPDA 2XT0A 3CJQA 3G59A 3RVDA 1Z06A 1BN6A 1NQOA 2P6PA 2YJTD 1D2AA 2ZDHA 3HRIA 3HWX1 4P7FA 2DU8A 2FSHA 5I4IA 1K8QA 3MBIA 1R4NA 2W6CX 1UM8A 2FJ0A 1CUDA 2V5AA 1E77A 6AT1A 1DG1G 1AKMA 2HPZA 2IE8A 5G3YA 5AOVA 1H94A 2BIFA 5IXYA 1ZP6A 1Z8HA 3DAHA 4OSEA 4PVCA 3SJBA 2IYQA 2AUTA 1KH3A 3OCVA 4R3WA 4ZPJA 1Z17A 4HDCA 5KYWA 2J5KA 3LH5A 4UHKA 3SSMA 4M6WB 3L6EA 1E89A 2BW0A 1PG5A 421PA 1DLJA 4A0QA 5BP7A 4A15A 1W581 2QNBA 3A32A 3K16A 3O8QA 1WDLA 3L06A 1AE1A 3F8TA 2XUQA 5JYEA 1P4RA 2JFWA 2FPGA 2Y71A 3T06B 3GCXA 2DF8A 2XI4A 3HN7A 1U8UA 3RFFA 2K7FA 1EZ4A 2I1VB 2N47A 3LC0A 1Y3FE 1SOVA 3QBTA 4N9QA 4QSMA 1KDZA 5HPYB 1XZGA 2PKEA 4INJA 5FQOA 5CLGA 3ZBTA 3ENZA 2ZYGA 1L5OA 2R62A 2XQVA 2ZVPX 2NLOA 3HP7A 3DV2A 1DTEA 4KI0A 4PAMA 3WLJA 1F2TB 1O9BA 2O8BA 2ZI6A 3DG9A 3RVSA 4HNTA 5FIUA 4PM4A 3UJ6A 4ZO6A 3GVPA 4XEUA 4IOMA 1I80A 2HA5A 3D3WA 5FBRB 2EBHX 3IUBA 3V55A 3CRRA 5C32A 4JLNA 5CP8A 5EPOA 4ZU1X 3DYVA 3CVOA 4KAXA 2WWYA 1VL2A 1U9ZA 2GFIA 1ZJ6A 1XKLA 1PNVA 1YFKA 1U7XA 2P7IA 3GB9A 4XEHA 4LDAA 3R7LA 2Q99A 1J2EA 1NPYA 4AJEA 4QEDA 1TM3E 1E9SA 3MWDB 2ZRGA 1Y1SA 2PSHA 4S1NA 4UUNA 4L51A 1NUUA 3RHSA 5LZ8A 1TF7A 1U8TA 1WF6A 4QT0A 2R4QA 3RTAA 3Q0EA 2ZI3A 3LF2A 4RIEA 3R0VA 4XGQA 4ZJPA 1PZHA 1Q3TA 2DPLA 4FMCF 5LXTF 2UXCB 3OQIA 4AMGA 4NJMA 5JMWA 1E0KA 3G02A 4Y6RA 4BUJA 1E7RA 4NQZA 2UZ3A 4RHTA 2X9NA 5EYPB 1WF3A 4FOTA 4MQBA 4YONB 5HF6A 5I5GA 4DNFA 1KI6B 4AROA 4A8PA 1URPA 2QTCA 1BFKA 3WTBA 2V3WA 5AIAA 1W4BA 2A33A 4OMDA 2CHUA 3RVNA 2NSLA 2EHDA 4XYBA 1V3TA 2ODPA 3NKLA 1DQRA 3SAJA 5K8IA 4B6JA 4EJ0A 2IHVA 4I5FA 1KJQA 4DB2A 3DZ8A 1SUDA 1WG8A 1X8LA 1JAYA 4J3JA 1QKIA 1UWCA 1AQJA 2J3DA 1PR1A 1U0BB 2FLWA 3PC6A 4XUDA 3QLUC 5JZBA 1JEQB 1N5DA 2DT5A 2I66A 1WMDA 3H9JA 4K05A 4MLZA 4BMNA 4KR3A 5AXAA 2ZJYA 2P6RA 3S2YA 1RIIA 1NW7A 3TL2A 2W43A 3G0IA 3R3VA 3HXOA 5M2QA 3AF2A 4HNRA 4U7JA 2XW6A 1P0MA 4KLNA 1YFLA 3IESA 4KFTA 5ELXA 4LYGA 1KMHB 4UDNA 3A9SA 2AWNA 4C7JA 4RJJA 4WN3A 5IXJA 4MVJP 1ORIA 3JWJA 1OLSA 5DTQA 3QVXA 1E6MA 1V1RB 1YR6A 2VTKA 5ALIA 2XUPA 4QBKA 5IM4F 1MA3A 3C8DA 3CGGA 3MCUA 3PD0A 4PYIA 5CG2A 1GZ5A 1CX9B 1YRYE 1CJVC 1Y6QA 821PA 3E3AA 3DTVA 3PJRA 3FOBA 1GUFA 5FLKA 5I9IA 1KWGA 1ZMBA 2XTAA 3RAPR 2D59A 2HREA 1GEEA 2ZZKA 4HWTA 4BE7B 2OC9A 4JX9A 2Q6OA 2ECPA 2ZIGA 3CLUD 4PSDA 4G1UC 4XH9B 2WTUA 2NPIA 1PVOA 4RAQA 5INTA 1HSZA 3IBTA 4W1PA 3VTAA 4H0NA 4M88A 1NQ5A 2C83A 4F60A 5BQ3A 4RK1A 4NZMA 4JB3A 1LWOA 1O5TA 2X9GA 1BE6A 4RXTA 2QX9A 1T3ZA 3O4JA 3SXUB 4JUFA 4A2CA 1BWSA 1KHTA 2J5XA 1EE2A 3E9QA 4QEKA 1NVFA 2H31A 2V97A 4YQFA 4C7XA 1B6SA 1EK2A 2FK8A 3N74A 4DANA 4Y2VA 4EQZA 4C7KA 2C03A 2VDJA 1N0IA 2EP7A 1UPCA 2VDKB 3EG5A 3GZNA 4ARCA 1KYXA 3SF0A 2VXCA 2B8NA 2GM4A 3IYLW 3P45A 2WM8A 5DN6A 3U0VA 3CB2A 5ARBA 2CXRA 2JLZA 1J09A 5CVCA 4IDFA 4ZTUB 1VHLA 2QIPA 1T1JA 4CF4A 1X86B 1W0JD 2IW1A 2P9QA 4I4TF 4MKZA 3JYNA 4NPAA 2X7HA 3ZQ4A 1AURA 2Q2QA 3NEYA 1UBRS 4MCJA 4R05A 5FWYB 4DDHA 5DASA 5TR9A 2HMUA 3V8QA 3WGQA 4TRMA 1KJ9A 3LPNA 3OZEA 2NU7B 4QATA 1DQNA 4D9KA 1CE8B 1G8SA 2O3QA 2VPXA 5CBPB 1UDXA 1BYUA 1PR4A 2W6JA 2BP7A 2P9CA 5FA5A 5AVQA 4GPZA 1MJHA 3BIFA 3C3AA 3KC2A 3R5SA 3AUSA 4FT2A 3TTWA 4YGXB 3DTYA 5CCXA 1W5EA 4GYWA 2HSZA 4AMUA 1GTG1 4K1XA 3CLSD 2ON6A 1Y63A 1OR8A 5C46F 4JXKA 2V7WA 5IKEA 1P1JA 3K8OE 4BO4A 5JE8A 1V25A 2ORYA 4AMBA 1D9XA 4PBRA 4D02A 2DWPA 4V0SA 5DT2A 5LBUA 3ESQA 2V98A 3PNOA 2ALJA 2D06A 3NBYC 2QTTA 2I1QA 5GIOE 1IXSB 4QICA 3JYQA 3GT3A 4D42A 4ZOAA 4YASA 3RBVA 4DCOA 5L4NA 4PLZA 1USUA 3RSSA 5GVSA 4RESA 3HVUA 1T0JB 5LP1A 4M7RA 1Z2AA 2GCNA 1T10A 1M76A 4X64B 1Q0SA 3SHWA 1ZIYA 3ORSA 3WJAA 5KC9A 3ZI4A 2JNWA 1W0KD 1G0OA 1NBIA 3WOVA 2EARA 4ZP1A 5BWOA 3L8DA 2V9CA 4MV7A 1W73A 4ZJYA 1F0YA 3L5KA 2ZXUA 4FKBA 3GNQA 4P4NA 4AC9A 3TKAA 3WBKA 5A6SA 1NSFA 3GVIA 1X92A 4HLUA 1GTL1 1FY2A 4G07A 4JP2A 5AOBA 2C82A 5G4LA 5LMNB 1OMOA 3V1MA 2IXDA 2Q0SA 1KI1A 3RJZA 2EU8A 2NTYC 2Q3HA 2AC2A 5ER6A 1YQEA 2IP4A 3LT4A 3ZCUA 5HOQA 1KFBB 1Z6GA 3UWDA 4EUFA 3CUYA 4Q1EA 4PX2A 3WR5A 1RQLA 4GS5A 4KWHA 4BVAA 2GCOA 3UUFA 5MN4A 5J1TB 5DHPA 4OP3A 1CQWA 4HEJA 4ZARA 3KCNA 1QIKA 4MDYA 1RI2A 2JLYA 3OTHA 4CLOA 3KOYA 1GCGA 3O73A 1WZIA 2UUAB 2ENUA 2FWAA 4Q4HA 4ZOEA 5K3DA 1N5OX 1TKBA 3B1VA 4R68A 1HNWB 1G66A 3PNPA 4LYYA 5ER9A 1VHQA 4MX8A 1R1DA 4XJTA 1T6ZA 2PMWB 4ETNA 1Z5UA 1EBFA 3LCRA 3EIEA 2AN9A 3IEKA 2V7VA 5G3ZA 2Y99A 3BMNA 1FE8A 2DH5A 2NW6A 4IILA 1DDGA 4MGZR 1QYXA 3AHEA 4P82A 1K2VN 5FKJA 3SF8B 5ITZB 4QHSA 1F7VA 3DT9A 4LJKA 5KDDA 1SB9A 4K2HA 3KOUA 2QG9A 3KLMX 2DKOA 3EN0A 3TDKA 1E8DA 3OY2A 5SYMA 5JAIA 1KIAA 4RJKA 3QX9A 2JEYA 3T7AA 4NNPA 5G0WA 4KXLA 3OO1A 1QLWA 3ANMA 4DY4A 4CFSA 1CUAA 3SQWA 3PYLA 2PY6A 3AEQA 3PCXA 1E60A 3VTKA 4IDEA 4F7DA 3PI6A 1O95D 3MIIA 4I1VA 1TA4A 3BAFA 4YJGB 3ZHQA 5MDHA 2JS7A 5DX8A 2PU7A 3I2JA 1IIRA 1ZEJA 2C3UA 2I2WA 2ADOA 4Q4JA 5NULA 3RG8A 3D0OA 3S8YA 5DRYA 1V3VA 3HFGA 1V8FA 4B32A 5LB4A 3R5XA 1SBHA 4X61A 3QUAA 3L1HA 4KV9A 4HNUA 2IZ6A 5JBIA 4GECA 2MHCA 3T15A 5ALEA 1RKVA 1D2HA 4TYQA 4GM0A 1TYZA 4MR8B 2OFFA 3BPSA 4URYR 4LMAA 3FHJA 3X1ZA 4TYPA 2XUGA 4LF7B 4D0NA 2A0YA 3RO7A 1S4QA 4CL8A 2WU3A 3N05A 1SCNE 2IH5A 3E70C 3AEUB 4U63A 4E6PA 2F1RA 1FJGB 1ZGGA 1CZNA 3CSSA 3G7UA 3V2GA 3LWZA 3ZTYA 1Q7GA 4MEBA 2BKAA 3B89A 1ZCJA 4GT1A 4QWMA 2PPLA 2DWQA 3V2IA 3W8RA 5TIIA 3HB1A 2MCFA 4PNPA 2AFVA 1GRNA 2Z3VA 3GYBA 4X20A 4RK5A 2IH2A 1RC0A 2TMYA 3N87A 2FX2A 4RGBA 1J90A 4WXEA 3D81A 4D56A 3CLKA 1TUGA 4ZVRA 1V96A 4HJXA 2I4IA 2GPBA 3ICQB 5JJ5A 4KN6A 4R0VA 3ZWAA 5DYTA 4C03A 1ZOSA 1BCRB 2P6UA 2QRVB 3QEJA 5AVUA 1IUNA 3OC0A 3ZDYB 4EA9A 5AICA 5HYVA 1IBLB 4AY2A 1QG6A 1PJ3A 5AKKA 2H16A 1ZMRA 3ZWMA 1UBFA 2ZSBA 2B94A 3RI3A 1M7GA 4MWEA 1LNSA 2YS6A 3B51X 2XKAA 3NBZC 1PRYA 3B8HA 4YACA 3ROQA 1BFDA 4P2GA 4EGCB 4U3JA 5JSHA 2C7OA 4CCSA 2Q4OA 3FMIA 3OUZA 5D3MA 1SY7A 3NS7A 3RFVA 5K0GA 3QBDA 1VE6A 4P33A 5F77A 1M5UA 1XTJA 1YJCA 2QTHA 1XD8A 3H9GA 2YR0A 4YR9A 4GPAA 1IBRA 2A14A 1XE3A 1YK1A 2OM2A 3Q8WA 5KKNB 3QUBA 2WSYB 5EPEA 1RWNA 1L3IA 1A8QA 1GPH1 1DFGA 3RVLA 4J1TA 3DDSA 4WCFC 3TZ6A 3FUXA 4CDRA 3HYLA 1CCWA 3IIEA 1ZVVA 2YH2A 1GPAA 1WEKA 2PQ2A 4ALJA 3QUQA 2C57A 3ZXYA 5IT4A 1I7QB 5HVNA 1RKQA 2EF1A 3DWIA 3THYB 4YGYA 5EE1A 2GXUA 3NT4A 4P0TA 4DV4B 3GOQA 4QUGA 2D0DA 4CTKA 3UK7A 1A2QA 4UVDA 3E0QA 4JVLA 3SIRA 4KX3A 1WUIS 2GBGA 1F6BA 3I1YA 4M6WA 5DM0A 4G26A 3CF6R 3MUFA 1KY5A 3OPYA 4O4LF 3WHIA 1QGUB 5EJ9A 5EWMA 2G4VA 4Y2TA 4KQJA 1C3OB 1Q12A 1U9IC 2GLXA 3E5HA 3LOQA 4HDRB 1K7XB 1XC7A 5AJUA 1KZ6A 3LVRE 4KHZA 1TI7A 1K7CA 1N25A 2CXQA 2VQ3A 2C8KA 2FSPA 4LISA 4EFKA 3HHEA 4JZYA 3BDAA 1N2IA 4UAJA 3VZDA 2V7GA 4HNVA 4D3DA 1SXJE 4ZJUA 2PFKA 2P4HX 2V6MA 4EX6A 1Z35A 5LZ7A 4MLDA 1TUIA 3FJ1A 3OEHD 5EEHA 3ITKA 1VIVA 1RHRA 4LA4A 5LVAA 2VHCA 3QVSA 4E15A 5EIXA 2QP9X 2XVXA 3RSHA 5KTRA 3HJBA 4NATA 4BV2A 5JRJA 1E1CB 1Q7BA 2D8AA 1NI5A 2C77A 2WICA 3MLAA 3NH6A 3VPFA 2BZ0A 1IQ0A 3R7BA 3G82C 2YHUA 2OCIA 3VPDA 4DWJA 3EEBA 4JUDX 4POOA 3RAFC 4JI8B 3ICEA 1LBIA 4HS9A 2GF9A 4G8JA 3HP1A 1JH9A 1JSCA 1EWKA 4PC7A 3MUNA 4Z8YA 2BEKA 1SBNE 4KODA 1NUSA 4HI0E 4FR5A 2ZI7A 5IF3A 2HJWA 1KSHA 1WMBA 2VJAA 2XMRA 2HWUA 3MJFA 4IUDS 2X0DA 3C85A 1DV1A 2I4RA 4OD0A 4N0QA 4U6QA 1GZ7A 5H80A 5BSGA 3NBFA 1RLTA 4F2PA 3OLCX 2QP3A 4C7VA 4FQ7A 5REQB 4JLMA 5EYPA 2R1UA 3I9LA 1H9BA 2QHXA 3HKEB 3IP5A 3SDSA 3W5CA 3OT1A 5I01A 2D62A 1JTEA 2FPIA 3N6VA 5A06A 2DPYA 3N7AA 5EJ2A 1NKSA 2R8PA 8MHTA 1EVLA 3EZ2A 1SHZA 4TLMB 1F4PA 3FAKA 5ENDA 4P92A 2V7XA 5FA6A 2FP3A 4LIPD 4RD4A 4BNKA 5A3JA 5C9ZA 2OZLA 1E99A 1JL3A 4JQOA 2YYSA 1JMYA 2C7VA 1PKXA 4FN5A 5CH3A 2QPLA 3FFAA 1STOA 1ZVKA 4B3HA 1Z83A 2EFJA 4D26A 4WUVA 2OPHA 4ER6A 3VPSA 4RTJA 2JAOA 3QJGA 1E1RA 4B34A 1UZLA 1TVKA 2OHGA 2ZK7A 3I72A 2Y0DA 3BDIA 2JIZD 2AOUB 3LGSA 4JC5A 1DE0A 3L8CA 4IIUA 4X7BA 1NR5A 3RRJA 1EFLA 4P5EA 2LW7A 2BTQA 1QBGA 5IYZF 3KIPA 1WMSA 2RB5A 4YREA 1C9EA 3VO9A 2PFSA 1M1YB 3DCJA 2GHTA 3NEPX 1L3BA 3BAZA 1YACA 3BILA 3OFKA 4FEAA 4FHFA 4IV5A 5EUBA 3VTZA 3AVPA 5BSFA 3CLRC 2D2FA 4G56A 3U6KA 1T6XA 2IXBA 3UWKA 1TYDE 3M82A 4HLDA 4TV9B 4GI7A 2QSJA 4BLRA 2CJWA 2V1XA 2JIDA 1V1RA 4RD6A 1U2TA 2ZBFA 3IVCA 3M8KA 1TKCA 2VDRB 3GEEA 5HGXA 3S8EA 4YAKA 4DJAA 1X1DA 1OB2A 3DHNA 3M6XA 2GPJA 2NZUG 4UEOA 2OYCA 3IP9A 1SZPA 4B44A 1U94A 3DLTA 1ACLA 1M73E 4NYIQ 1RYYA 3BA1A 4ND3A 4KR7A 3S6JA 1I7NA 1QF6A 3WLMA 3PE6A 4LWZA 4U7GA 1EZZA 1L7PA 2JDIA 3KE9A 4BAZA 5A7FA 3VA7A 2O8DB 1J1IA 4OLJA 2QUKA 2IQ5A 4B5KA 3H42B 2V4ZA 3PYMA 3HZZA 1JHPA 1XYVA 3STVA 3PD1A 1GCAA 2AG8A 3KVOA 3UJCA 1W1WA 3NWBA 3HYRA 1Z4JA 2M6RA 4MAMA 2GBLC 1YHYA 5FTNA 1QUFA 3JATA 4NU8X 3GI1A 2GF2A 4XPIB 4AO8A 4Y2UA 5AUOB 1WDTA 4QU9A 1XMSA 1KZYC 1M2GA 2L42A 4EG5A 3RUIA 1DGQA 1SOAA 1UKYA 4Y9DA 3RC9A 1L7XA 1G42A 1PQYA 2NVOA 1LI7A 3RVRA 3WIOA 4BBZA 4F8YA 2PKXA 5J4VA 1FF9A 2PRKA 1T34A 1FFDA 1ZUWA 2A9OA 1OXSC 2QQGA 2HOQA 3Q5DA 1R5JA 4BCBA 1CG6A 4YAUA 2HMTA 1MDBA 4XIFA 4ZCQA 3MMZA 1QIEA 4EPWA 3PLRA 3E18A 1U3GA 3N9IA 1T8RA 4R1PA 3QU7A 4UOQA 4WASA 2O2CA 4N76A 2F1IA 1P6UA 3LUHA 1K68A 2C2WA 1M83A 1WV0A 4DBLE 1RNLA 5E9JA 2R11A 1ZNZA 5FWYA 1FFBA 3KALA 3R6GA 5DLYA 5ERYA 5EIBC 2WIFA 3AJRA 5HKKD 1J49A 2PUTA 1IUKA 4RK7A 1GA4A 3A1NA 4YT4A 3Q1KA 2OORA 2WT9A 2IYVA 2C95A 1I6KA 1LB1B 3I9MA 3BE6A 4OL9A 1ZM9A 1OAOC 3GR6A 1WEHA 2J1LA 3IXQA 1P8AA 2Q4RA 4EBFA 3H5NA 4YRDA 4LOIA 1UT5A 1NE2A 3N7TA 3TPCA 2ETVA 5D3KA 2GKOA 4IW3B 4BAUA 3GJZA 4KYTA 4LFBB 4AQ7A 3D8RA 4WWHA 3FCCA 4JXXA 4HGZA 5C1DA 1P9OA 1K0FA 1MA0A 3F74A 3FHLA 4MGKR 5CGQB 3SHTA 5DB4A 1M6HA 5CB4F 4IEFB 5CT8A 5E6RB 3MWEB 3Q88A 3TLXA 4EEKA 1CP2A 1RXIA 2QX4A 3CH7A 5FPYA 4A1FA 5HTOA 4JEMA 3Q5GA 4M89A 3INGA 5I7VA 2ZU6A 4GKVA 4EFNA 2WWVD 3GPLA 2OYSA 1C5KA 2OXTA 2GZSA 3DH0A 4RYLA 5A5FA 3E9NA 4XE5A 1K8RA 1N78A 1V8OA 4E3WA 2J9YB 1XEXB 1XPOA 3USES 3M89A 1B6TA 4HAXA 1J2TA 2CNOA 3CMMA 4HYTA 3VSAA 4DBZA 5G2OA 4KUHA 3WGNA 1UZUA 4KJZA 1XNRB 2PAFA 2E4YA 5KZMB 4IX1A 4J94A 1W9HA 1N1DA 3C41J 3MWKA 3NHPA 4YMSA 4F1WA 4MPJA 2QJWA 5MHTA 1GGEA 1U81A 3GJXC 4NBRA 1SUPA 3KT8A 1ZD8A 4EG7A 3BG5A 4E1VA 2R7AA 2CBGA 1WSAA 3H1TA 1CDEA 4ZA2A 4R9UC 4HEA1 5KVVA 3NTUA 2HLDA 2FGKA 4HDAA 1F06A 5BSMA 3K1TA 4KO2S 1QF9A 1JVSA 1Z45A 4QYMA 2C2XA 3A14A 4M0DA 2AOTB 3CX6A 3P2JA 3ROKA 5FO1A 3OTIA 2CLLB 5ECDA 4ZCPA 4Y6GB 3V9PA 3UWMA 5EMNA 5KI6A 3OZUA 3FPFA 3PGLA 1SRRA 3G6KA 4J43A 3RSQA 2DMRA 2W9XA 2FPXA 3L0YA 2VQ6A 3NWOA 4OX9Y 5JC1A 3PNQA 5EJAA 1DPFA 4RQBA 4LTDA 1GGHA 3WGTA 2O0MA 3EFBA 1JI3A 1JG1A 5EZQA 1II0A 3KT6A 1NNSA 2P62A 1N6RA 3DNPA 4EHKA 1LPSA 1IHYA 4FR0A 4E5VA 1WKBA 2FG7C 4Q3EA 2WJPA 4LI3X 4KITB 2YRFA 1O9HA 1U8ZA 2HNBA 2D7CA 3CLTC 3QI2A 4XDGA 4AZ3B 2EWMA 1GPKA 2PUWA 5KQSA 4EEZA 1KPGA 1M10A 2P3QA 3ZGVA 2KM1A 2DFPA 3ON5A 4TVBA 4CMGA 2ATIA 1UMDB 2D2XA 1TKAA 3O26A 2WTEA 3A58B 5JPDA 3N2YA 1A9TA 3N58A 4EAQA 3V3KA 4D0LB 5JDIC 4NCXA 2CL7X 4IBOA 3RVMA 3MF4A 4YV1A 3FZYA 1E5VA 1MH9A 2W6IA 3D3QA 4F45A 2BEWB 4TSKA 2BE9A 5E2IA 3D1LA 4N3NA 4OJTA 4W7IA 5P21A 4RLQA 1XFDA 3V34A 2X3FA 4E14A 5AVXA 1Y6GA 3E5MA 3PXAA 4Q3OA 2UVDA 4W4TA 3E23A 4FGSA 3AHGA 5K0FA 1Q6ZA 4L4RA 4B6PA 1EXWA 2X9QA 3OZRA 5C7IO 1QPZA 1PI3A 5DBGA 4G3XA 2YHAA 5HE8A 1NVKA 1UH5A 3AFIA 3G9XA 4WLOA 5CXXA 4EITA 2J9GA 3S5UA 4F3KA 3MQ4A 3OHPA 1F8UA 1P3Y1 4TTQA 3D7SA 1Z33A 1KY4A 1THGA 2H1WA 2YJ6A 4CMKA 1W5AA 1ZONA 1KP3A 2QW8A 3B7GA 3KS9A 3OJLA 1VGQA 1Z6XA 1K9SA 1BG6A 1VCIA 4LBVA 1L6RA 1RZUA 2VP4A 2WUGA 5F2KA 1BFUA 4NU0A 5T64A 4KOEC 1Z6YA 3MJTA 2P9EA 2A7QA 1OBVA 4J9UE 1Y4AE 2H5JA 2QRQA 4KQKA 1W94A 4DR5B 3IILA 3HQ4O 1ZW6A 5CBKA 1LNZA 4UASA 4CEHB 1BA2A 2XXAB 2JFGA 1C3VA 1RDFA 5AI5A 2B4QA 4CFYA 4TKUB 2QM0A 3QYAA 2ZAGA 4G65A 1IAVA 2RBKA 4DAOA 3KB2A 1T8SA 2UVPB 2F4NA 3F6RA 5U1PA 1EVKA 1QR6A 4K9DA 5FI5A 4BFXA 2PSSA 3S1LA 1ZPDA 3OQMA 4UCWA 5T67A 5DOVA 4F4DA 2ZCVA 2J9ZB 1M2OA 2FN9A 1WQ3A 1BRTA 4NDZA 2PUVA 1ENYA 3C3CA 2H4ZA 1Z68A 3AKYA 4C4OA 1P80A 2GOYA 1CUZA 1TGVA 1X7DA 4WN9B 1Q84A 3H5VA 5BOSA 3FW1A 4IXNA 4C0WA 1T1RA 4FCTA 3M5PA 4C3VA 1UKCA 4IQ4A 1BGVA 1K3UB 4LHXA 4CM7A 1P6QA 4V1CA 5AWFC 5BNWA 3AUYA 1P5ZB 4AL4A 1Z5VA 3MT8A 1CR6A 2YRWA 1NF8A 3P5SA 3X3HA 4HRAA 4DCUA 2XB9A 3RREA 2QL9A 3O4FA 4OJYA 1ZUNA 1OIWA 5EAIA 5AVJA 3SBDA 1PJRA 1UBEA 2C88A 5IT0A 1V8BA 4UEQA 3IODA 2P5SA 2XRZA 4A2PA 5JMOA 1PT9A 1RQ7A 4ARIA 1TO2E 2Q9AA 3B6IA 4I66A 1V9CA 4EF5A 2ZE5A 3DXZA 3OZGA 4WLEA 4J4BA 4N7MA 4WBXC 1E62A 1C3OA 3CFYA 4HDRA 3SNHA 1H5NA 1JXOA 4O4IF 4FHGA 4S0XA 1G17A 3F49S 4UQPA 1W75A 2IZ5A 2Y1GA 3EIUA 4BN0A 4JX8A 5I47A 3KR1A 3FG9A 3E1KA 4BO0A 4ZAXA 1D6SA 1SO8A 2OWEA 1IB6A 1L5WA 1CF9A 2PPVA 3SSAA 5JWOA 3B13B 4KBFA 4GSYA 3KR0A 3RC3A 3TQTA 2VNKA 3KWJA 4FQ5A 4R0MA 5T7BA 5FI3A 1JI0A 4GXQA 3ECSA 3S1AB 3LFHA 1G41A 4QD3A 3TQFA 2W2VA 3LHIA 4QOFA 1DMSA 5E7QA 3V8PA 1WPRA 4QKQA 1I3CA 1WHTB 2M9MA 5GJVC 2GAAA 4BVHA 1JPVA 3EY4A 1GR1A 1U3FA 3SY8A 2ZSKA 3FDJA 1E1CA 3JQBA 2HZ7A 3A3NA 4F96A 1DAKA 2P3OA 1GDDA 1T2AA 2VP3A 4LRWA 1YBAA 3GHHA 1IMJA 3QEMB 5FOUA 1ENZA 1X70A 2W0MA 1P0PA 1N36B 1Q0UA 1NHGA 3QJYA 3L8GA 3GY0A 1E1YA 3KVYA 5GV8A 5E8JA 2B4AA 1DTWB 3CIOA 5EE3A 3TIGA 1KDTA 3K0HA 3WP1B 1NBMD 1UMCA 3LCMA 2HEIA 3D3EA 3RYIB 3UMFA 3FBWA 3NWJA 4QU8A 2B8EA 3ZS9A 4WL0A 1DQZA 2ZJ3A 3F90A 4QRIA 5EIFA 5TT0A 1KR2A 4WFQA 2Q8QA 3LXUX 4NOKA 1KEKA 3VU8A 2J6HA 2JI6A 3UJ8A 2WUDA 1GPBA 2B92A 2DX7A 1KMIY 5ABPA 1KOJA 4I9HA 4ILEA 3R3XA 4GNKA 4QJIA 1FIUA 4C7OB 1KJZA 2PX0A 2F17A 2R66A 1FUKA 1NI3A 5DGIA 2PS0A 3KB1A 3WVNA 1VCMA 2C9YA 1FTGA 4M87A 3C2QA 2VQSA 4WECA 4WCFB 4EIWA 2KS6A 2A4KA 4Y18A 2QENA 3PEFA 2J5QA 3STUA 3RE1A 3BL5A 4FB4A 2H1LA 1E9FA 1L9XA 3LA6A 4X8HA 3LUPA 3WLFA 4BFVA 2QN1A 1P81A 3O8RA 3K4HA 1BC5A 3DMNA 2VKQA 3PFWO 3PC4A 3KUDA 4PHTA 2MMCA 1UJBA 2XSZA 3KWLA 3N2EA 4EY4A 3OOJA 4JUAA 5KAPA 1UKEA 4C43A 2J67A 1P0FA 1VMIA 2V6GA 4H3HB 1TJ4A 1JT2A 1HR0B 2EFDB 2W0SA 3DE1X 4KSBA 4R2XA 1HNZB 2RKBA 3QVLA 4YJ3F 2R1TB 3B6KA 4M86A 4BE4A 1XTQA 3DOCA 2BGKA 2RGXA 2WOOA 1WA5A 3D8NA 3Q6IA 5L8VA 1C0LA 1IQRA 3DMRA 3B7PA 3LIPA 1MNAA 3W9UA 3U7FB 2H2FA 1OI3A 2NUTB 3RNOA 2HK6A 2GCGA 4PHHA 2RDMA 3M4XA 3ZGZA 4DE5A 1QV6A 3CUUA 5FV7A 1KDVA 3CEAA 4B7CA 4BNJA 3G68A 3SN6A 3UPDA 1CR4A 2ZEJA 4IP0A 4YP5A 1E6WA 1K3FA 4DMLA 2AN4A 4FNOA 1G16A 1ULZA 2QD1A 4PNHA 4ZPXA 4CQMA 1JIXA 5BT8A 1YS9A 2IT1A 1LQTA 4B4KA 1AJEA 2CJFA 4R4JA 3JRNA 2GH1A 2GBFA 2ORWA 4WEQA 3TSWA 3N0VA 1B8OA 4LXGA 1OE0A 3U09A 3NHZA 5BVGB 4KQFA 4M9SA 2Y77A 2FW0A 4ANFA 4H6WA 4M37A 5TGDA 1R4ZA 2IEZA 4NEGA 4G5SA 1JAHA 1R12A 5J40A 4EQ6B 2GTHA 2OXCA 2D2EA 2ZYVX 3BL6A 3EW9A 3OICA 4QTTB 4RVOA 3VNSA 4BC0A 4AKHA 4B83A 3OTQA 5EPUA 4DWVA 1H2EA 1RAHA 1N5LA 4BFUA 2VJMB 3WC4A 3L9XA 3SCZA 3KLBA 5J2UB 2WKQA 3FVWA 3HDJA 1RCTE 4BQQA 1E1LA 3F9IA 1Y34E 1VBKA 2YX1A 3OPMA 1EH5A 2VK4A 4JD5A 4PF1A 4MHTA 4S05A 1R16A 3FNHA 4UCQA 1FFSA 2F43A 3JWGA 4MCAA 2ZGVA 1KAGA 4H60A 3EXEB 1WQ1R 3AL0C 1L5FA 4I1OA 4PC1A 3DQZA 3FHCB 2XLBA 1DJNA 3HXTA 1DSSG 1UK8A 3HB5X 1E0DA 4G23A 1A9SA 1HYEA 4WLVA 3RWMB 2H3EA 3GAAA 3ZLBA 3ZR4B 1O6GA 5IC6A 1RRFA 2B99A 1GFSA 5FOQA 4HQLA 2OHHA 2QWXA 2OSBA 1QZXA 2DR2A 3LPCA 3WMFA 4MUHA 1U8FO 1XT6A 4OUDB 2G9NA 5JW6A 1SCAA 3KR2A 3UT6A 4N01A 1NKVA 3SZUA 3FDZA 3ORYA 3QLUA 2GYYA 5HIJA 4AJOA 2OEPA 1C7JA 4JKOA 5CLHA 4Q7QA 1RXVA 3A1WA 4EHNA 3I39X 5BN3B 4IJUA 4KO8A 1S2DA 2ROQA 2ZRQA 4HDMA 4B6FA 4KX5A 1SA0A 2E6UX 5K3OA 2A5DA 5AVOA 2ZM5A 3SWWA 2Q0HA 4P22A 3W05A 2EL9A 2PV0A 4N6GA 5IPFA 3IUQA 4BNLA 4QUDA 2QAJA 1N2SA 2EZ4A 2YCLA 4N7RA 2WIAA 5AJTA 1EDEA 5FFMA 1A2BA 5BYBA 1A50B 1N7HA 3TBFA 1ZO8A 4X1IA 5HSGA 4LJLA 4BMOB 1DT3A 2IUSA 3Q2KA 4EB8A 5FTLA 1XRJA 1WWKA 4E33A 4BO7A 2F59A 5LQJA 2O4CA 4B84A 1PZMA 4FE4A 2ZRKA 5GIPE 1YR9A 3LBIA 4H15A 1LBTA 4L8VA 2D74A 2V96A 1RTKA 4Y2XA 4CUKA 3DD5A 5JOQA 3JVIA 1AA9A 3Q7QA 2UYYA 1QJCA 1SGWA 5ALJA 3SE7A 1RHMA 3K9BA 3SJAA 2JAPA 5A4JA 3E22B 3H5RA 3OWHA 2SCUB 4KDCA 4HTFB 3DFKA 1DX9A 1RU3A 1T6YA 3R7DA 3GLTA 5HE9A 1YGPA 4YS6A 3SM9A 5JS1A 4YRSA 4AQYB 5IVDA 2BEUA 2Y0EA 2DEUA 4JVOA 1OIXA 1QYRA 3FH0A 2G70A 1JDZA 1IB0A 1N5JA 1PEYA 2PX5A 2X0EA 3ZHVA 3CE9A 4QJBA 1A04A 4CDMA 1F60A 5AW9A 3IOEA 4PZCA 5B58T 3S29A 5ITSA 3DDZX 2WJGA 4DXAA 5HKAA 2RGBA 3FCYA 1ZBDA 2VSYA 3O91A 4GMKA 2NUPB 3TLZA 1IPEA 1K6XA 3LSTA 4LF4B 5HM8A 1BKYA 3QYJA 5AW5A 4RFSA 2AQKA 3F5SA 4ZOLA 1XRSB 4R9NA 1NONA 1GPNA 5JBNA 4EJSC 5EE5B 4JEUA 4Y7DA 4BMPB 3TQCA 2N9UA 1RPTA 1Y98A 4BYMA 5K6TA 1LV7A 2LXNA 2JLCA 4U6NA 2UDPA 3DHVA 3M9LA 2JGJA 3CUSA 2NV0A 4LF5B 1O5OA 3WGZA 4AP9A 1Z25A 2J4DA 2OZEA 2A1IA 5AJVB 2Q2WA 5FPTA 4E07A 1LSOA 3D3KA 7REQA 1Q14A 3FSGA 1PLJA 1IY0A 3QE3A 4PAOA 3TLEA 1QIGA 4QDKA 3C8UA 3T4EA 4JLVA 1L7OA 1DKPA 1YJQA 1Z0ZA 4EO9A 3I34X 2FXIA 2I4TA 2HQRA 3DP9A 3JQ7B 3R5FA 4LJ5A 4P3NA 5DHAA 2CMDA 2PQ0A 2AJBA 2BHNA 2PFGA 3L49A 2XCIA 4LDZA 5IUKC 4K88A 1IXYA 4IIYA 1G291 3CUWA 3RAEC 2P78A 1YNSA 3G9UA 3OWXA 3KJFA 3PXEA 2G17A 1BS1A 5GPBA 2OQVA 5I4CA 1KAQA 3UK0A 1NIJA 3LY7A 3HNOA 4WDQA 4BWVA 4RKYA 4AAYA 1B41A 4LWPA 5BN4B 3OQPA 1QO7A 3ZLUA 1KMCA 3SC3A 3ITDA 3QX7A 3GA0A 3R3UA 5H59A 1W87A 2ZIXB 5A02A 3HB0A 1SC4A 5CDSA 2BEWA 5FJIA 2Y1CA 3P0JA 3R8CA 1TT7A 5JS7A 4MZXA 5JS2A 3L46A 5CA1B 1TUEA 2XUOA 5TB5A 1Z75A 1MU0A 4XIYA 4AF6A 2QX8A 1U7HA 3EFEA 4NBLA 1ZMTA 3B6EA 3GRCA 4PIMA 5J4KA 1EQUA 1QB7A 1YQWA 3FPBA 5M7EA 3QENA 5DRTA 3KHTA 1CQIB 1F14A 2W6ZA 1QVZA 3IP3A 4OYHA 3RR2A 1ZD5A 5DPMA 1NQXA 1FFCA 3IEUA 3AL3A 4C89A 4HN9A 3U3RA 4XA8A 3PA6A 5TARA 5WRFA 1FPQA 4UBIA 4ETWA 4FB5A 1R0KA 4BTLA 5K3EA 1CUIA 2OXIA 4IO0A 4HVTA 4BATA 2XVMA 1CEYA 1QQ7A 2QVYX 3KQOA 5CA0B 2YFKA 4BJ6A 3GPDG 4L1KA 1ZIXA 3OUUA 2QE7A 2B78A 5B3JC 3BF8A 3AV0B 3M34A 4BB0A 4FEYA 3RIXA 1C0EA 3DMTC 3M33A 3PPIA 4O4JB 4EG8A 2JIOA 1E6CA 1QPGA 3DLAA 3PDUA 3T9BA 3HVJA 2NXWA 2O8FA 3E9ZA 1OAKA 3D3JA 3H2SA 5KX5B 2BI4A 2MU1A 4C88A 1ISSA 1LQ2A 4WOKA 2ERXA 4DIFA 5JQGA 3V3TA 4XYGA 3ABRB 5FLYA 1KYQA 2UVPA 2ODNA 1CUYA 3PC8A 2PSFA 2Z4SA 2BMDA 3ER8A 2GRUA 1F9AA 4Z86A 3ZHBA 3WYEA 2F1KA 3MUEA 1OLXA 2H2HA 3NEJA 1N75A 2YW9A 2VJDA 1AGYA 2ID9A 2YN0A 2OMKA 4XSGA 2AYXA 5BMVB 1COWD 2X3YA 4ZDWA 3A2LA 4WN9A 1YC5A 4AKSA 4CW7A 2PUBA 3JAWB 2I3GA 3DZBA 1SVIA 4F86A 1P19A 1F5NA 5DLPA 1OFIA 3QLVA 4XSVA 1R0SA 2XUDA 2WJ4A 4PTZA 4ND2A 2I6XA 3B9BA 1E6UA 3IXMA 4WXYB 4C0XA 4YRAA 1ZWLA 1V3UA 2H48A 2Z2KA 3BOSA 2Y9MB 4YJ2B 3VC1A 2XV1A 1KEZA 4RZIA 1B1CA 4ENUA 1LTKA 2AJLI 2IHNA 5F7OA 2DKFA 2DUMA 1JHYA 2ZT6A 4JH0A 4RIFA 5BRNA 3K0SA 1J1ZA 4R69A 5CT9A 4GGMX 5FWXA 3LTNC 1E58A 1Q19A 1QH0A 3EARA 2I9PA 1JAIA 3OSUA 2P8JA 3VHRA 1R5NA 3TECE 5LPNA 1SKYE 4QIHA 4EHLA 3A1EA 1QP0A 3K32A 1ZICA 2D1TA 1QAOA 4GWGA 4N0EA 4TWRA 4ZTZB 2ZI9A 1RMQA 2ZFUA 2RCNA 1NVDA 3OZWA 5CGZA 1XDBA 1SXIA 3FI0A 5DHUA 4MP8A 4HUJA 1CXZA 2R8RA 3UMVA 5DCWA 5KPDA 5LLDA 3L1UA 1J20A 1KY3A 4QGFA 4RTSA 2UXBB 1B8VA 1IY1A 4F1JA 4IICA 2CXTA 2FP4B 3PQ7A 4Q7MB 4P58A 3P0FA 3V97A 4FS3A 4RF5A 1OBFO 5IJ9B 2QVZX 4CCYB 5A4MS 3QA3E 2P9JA 3C87A 4ZU3A 3OFJA 3EJWA 4UM7A 5KINB 1WHTA 1NQVA 3HM9A 1E9BA 4DZTA 1OBHA 1OGJA 1SVKA 2PMCA 2CVOA 4TLCA 3IVGA 5DH9A 3I6YA 2I1WA 1K06A 1ESEA 2I3BA 3AHDA 3O38A 3QVMA 2BV3A 4D92A 1SUSA 1E9EA 3DCYA 3PPYA 1OXMA 3VX4A 3VVMA 3I92A 3TXXA 1PGQA 3K96A 1XZMA 1EFRD 2GRAA 4M1EA 3ZK7A 4R2LA 4V2UA 4NR0A 2XBLA 1YIOA 1O8CA 3VV3A 1P62B 1BHSA 4DIUA 4C6HA 2JCYA 4FFWA 3HMKA 4K03A 2HSDA 2ZRNA 3L1JA 4P2BA 4ZYWA 2BGWA 4C4AA 3N3AC 5C53B 4R51A 1IMOA 2AFIB 2QYOA 2QY9A 2VBCA 3DYIA 3DZCA 1QO0D 1BO6A 4GWKA 4RLFA 1W5TA 2OK8A 5LQKA 4BFYA 5L40A 4LYAA 5F1KA 2NPOA 4BGVA 3FPAA 1O94C 5JVDB 3CNNA 2I2BA 3F3MA 5JAUA 4B4DA 3BXGA 1CNFA 1I2ZA 3VH3A 4ALMA 1E66A 2G07A 3L6UA 1P2SA 4LSGA 4KHPB 1M1NB 2EJBA 3IMGA 3CHYA 2GJ4A 4WCFA 2ODAA 3RYHB 2HGSA 1QKJA 1ESMA 3L7KA 2QRJA 3AQIA 3ETNA 4BIMA 1IOVA 2GT1A 3GDHA 3M1LA 3L1VA 3Q2IA 3E7FA 3I8SA 2FFJA 1UM9A 4J0JA 4MW4A 2XR1A 1XB2A 3D2CA 2RHGB 4FQ8A 1M2FA 4TVSA 2JKVA 4HG2A 2CLDX 4X90A 5J2TF 2ET6A 2J07A 4B81A 2J3IA 1TAQA 3A9RA 1PS0A 5EIWA 5ENVA 10MHA 4BU1A 1ZLYA 4N8EA 4OXNA 3QE0A 5SYNA 1CIPA 1WZUA 3Q8LA 2F9MA 1M8JA 4MV1A 1JQBA 4OI4A 5F12A 1W0CA 2H5IA 2R1TA 3W5AA 3ZDRA 1QG4A 2OL4A 2CXOA 1RIFA 2V7EA 3CO5A 3ZXUB 3R76A 3TL3A 4DT1B 4I1PA 4Z9XA 2ZJBA 2ZDQA 3I1IA 3N8HA 2B98A 4GDMA 4LVNA 4ID3A 2D0IA 3A9VA 3HA7A 3V42A 4F2GA 3ED5A 5J5CA 2VAWA 4NG5A 3QQ5A 4AVYA 3WICA 1QHHA 3LVFO 4BO5A 2EFCB 4EG1A 4OI1A 5JRDS 3KZXA 2Z57A 3PDHA 4J0HA 4M0LA 1XMIA 4JEIA 4OHRA 3A2MA 4TXJA 3TFOA 1HC7A 3GLFE 1GAWA 3GG2A 4X1YA 4IF4A 3SS8A 2GN6A 3OAAD 4UZSA 4CIDA 4F4CA 5L53A 1RM0A 3SQXA 4OHVA 1PQPA 3G9ZA 2NVUB 3KX2A 3QYPA 2NXJA 1YJXA 2X77A 4BLWA 2VAVA 4UJ5A 3TD2A 3GAZA 2Q45A 4C3UA 4X97A 3JYHA 4FNAA 4ZREA 3BCHA 1R0WA 1Z5NA 3KWFA 1JZTA 4ZGBA 1R8YA 3BFXA 1W4ZA 3BQNB 2IHJA 3HRKA 3A6GA 3Q7IA 2DB3A 1DUIA 4X41A 2Q62A 1ZM4A 3A1TA 1NJ2A 2PRSA 4G41A 2O6LA 3A7EA 4MI9A 3TRHA 5KNBH 2ZQ5A 4ZO9A 1CUJA 2HADA 1YDGA 3A4NA 5J2UA 4GU5A 3HN2A 3Q12A 3V1TC 3G3EA 2BUBA 4MLPA 2J7PA 2ZRMA 3UMYA 2DBZA 2IYOA 2C9DA 3TOZA 1DV2A 1QK5A 2Y4NA 1CRZA 2G0NA 2Z3WA 4GDFA 3D59A 3T0IA 2IVZA 4ZT2A 5EJ8A 3LT1A 4F3TA 1Q91A 4RD3A 3VYSB 3W7BA 4ZYZA 3MSCA 1A8IA 3PQ4A 4DLPA 3AUXA 1H6CA 4PLTA 3IQDB 1OFTA 5U4XA 1QVWA 3CZQA 4JBNA 4YY3B 1LDYA 3IIJA 3IMKA 4MLCA 2FLKA 1NRWA 5EZ6B 3SJZA 5ALWA 2QLBA 5FTKA 1JNYA 4X44A 3T8YA 1IM8A 1X13A 4CM4B 4D4JA 3AP3A 2EJTA 2O7NA 2WPNA 4LQLA 1G8MA 3TZLA 4ZZIA 3TRKA 1PWZA 1JVNA 5C8ZA 4IJ5A 4PTLA 1C3JA 4EDHA 3ZE9A 1Z4NA 3EXAA 5C5DA 4CCWA 3G2HA 1WPQA 4PWYA 2FX3A 3CONA 5GADl 1HT2E 2CCKA 3IO5A 2OAQ1 4CMCA 2WWGA 3Q7PA 3CF2A 3LW8A 2IDKA 2YINC 2Q1TA 1SQGA 3NP7A 1SOUA 4PAGA 4Z0PA 3HWWA 2XUKA 4B3SB 2ILVA 1QUEA 5JCOA 1JV2B 1XP5A 4XQ9A 5B58C 2H51A 3QA9A 4R1TA 2HCRA 4TKLA 2FE4A 3K2IA 4TXMA 4CIAA 4KRFA 4EHHA 4G5GA 1J0AA 1X0VA 3GQVA 4PQGA 5BO5A 1WJGA 3H83A 4YB8A 2DETA 1F5SA 2P91A 1J0BA 3AHIA 4YDHB 6ABPA 1TFRA 3L8YA 3AP1A 2O57A 3CXUA 3D4BA 3I9V1 3OZ7A 4JCOA 5HKOA 1ZOOA 3LQFA 4JT4A 4PSKA 4WSOA 3W1VA 4C4TA 1UJ6A 2WY2D 1MB2A 1RAGA 1O4WA 1XJCA 4AT1A 4JY7A 1CYEA 1W5BA 1SUCA 5SY9A 2PD3A 3T9CA 4F6CA 4IY1A 3PPVA 4ZAVA 5BT9A 3F5DA 2AV6A 3H4MA 2H7VA 1X38A 4IDNA 3AB8A 2WKPA 1EK0A 3FRIA 4KIWA 4PRYA 1IK4A 4Y1FA 4J0KA 5DT9A 3OX2A 1E3WB 4HTFA 4I1YA 5CTAA 2GN9A 1VE3A 2NP6A 4JI0B 2OV4A 4ZDJA 4EI7A 1B6GA 3KAKA 3O2SB 3QFFA 2DHEA 3O3OB 4TRNA 5IK2A 2CNBA 1PIWA 5KYWB 3IMCA 2VRWA 3ABQB 1ZJZA 1DEKA 3ICVA 3U3OA 5H70A 3DW1X 3C6ZA 4JC0A 4CF7A 1BMFA 4RPGA 4IO1A 2R8XA 1TA9A 4TLEA 3E27A 4PNEA 1E3IA 4PZLA 1GZUA 1N9ZA 1UOOA 3KV3O 3P2KA 4TM7A 5E4JA 3M3DA 5L3SB 1NNEA 3KM0A 1E7QA 1ZITA 2ZRJA 4KBGA 5JASA 1JKIA 3DBRB 3C3KA 4O33A 4I55F 4E2YA 1CNEA 1K27A 4ZYXA 3KLNA 1G20B 2E82A 2QGFA 4P7KA 1THZA 4DRYA 3OKAA 1VDMA 4EGQA 3C7KA 1FP1D 1NW5A 3HSKA 3MPOA 4O5AA 1DKQA 5EERA 2QN6A 4UAGA 3F0TA 3HCDA 1J9GA 4AZ0A 3KTDA 5DLEA 3ZU3A 3P2OA 1HTBA 1UOPA 3USZA 3PK0A 3LXXA 4J0QA 4JOSA 2GLUA 1W4RA 2HXYA 3VOAA 2FOIA 2X8AA 1QAQA 1FRQA 2A3NA 2KE5A 1JFFA 3KXLA 5D3ZA 3TLBA 4TKZA 5CDHA 4S3MA 3FUCA 3T7IA 1G2PA 3U26A 3PR3A 4FLEA 2NUAA 3GT4A 2AVNA 1RLJA 3AUJB 3F46A 3A1CA 2W42A 2VQFB 4G1MB 4W9MC 3S27A 2C5GA 3ZIAD 1KGSA 1KOFA 1OAOA 4GUAA 2EFEB 3NMUF 4MA5A 3FYHA 1EX7A 1PZFA 4F8EA 3L4BC 4Z2AA 2A0FA 4FFLA 2ES4A 3KEMA 5KOYA 4IIJA 1G8JA 3KO8A 2GO7A 5A62A 4OQMA 1SD5A 2PL1A 3FWZA 3HPQA 3KKEA 4YWJA 3HYSA 4ZVVA 4GXRA 4Z5XA 3C3DA 5TMBA 3WGYA 2XNJA 1ESDA 1SXPA 2RHHA 2A1UB 3IP7A 1ZN8A 2O52A 5DSXA 5HF8A 2I5PO 4OY3A 4ZQCB 2VYVD 4Q7LA 3D0KA 2EX1A 3BWBA 1OWOA 4MVCA 4EW1A 4IXDA 2Z6VA 3QWHA 1MOPA 4IIVA 2CE7A 4RTQA 1Z7GA 2B8JA 3VZBA 4ROTA 4Y98A 2WSLA 2XRYA 5HS6A 1HOXA 2JAXA 3H5WA 3ELWA 4RH3A 1F3OA 4J7AA 3L6CA 4QREA 1H22A 4JYBA 1ZMOA 2LVBA 3DEHA 3EMBA 2J0UA 4GI2A 4FGLA 2CHQA 1MO2A 4YJDA 2CB0A 4Q4LA 3KZKA 5JNSA 3BK2A 4KPYA 5IM5A 4I9UA 2JAQA 1DLIA 2YQ5A 1AZLA 5ENZA 3R41A 1TK9A 2G6TA 3WWDA 4CIXA 4DSUA 1RHKA 2BZSA 3AVXA 5IARA 4EB3A 2F6RA 3DL0A 1YZNA 3LQKA 2ZUCA 5CA0A 4KGZA 3G5AA 4PEVA 4Q1BA 5IP5A 3K5WA 2VQEB 1I2MA 2OKCA 2HIGA 1YZGA 4R6WA 3VZPA 4DL9A 5JECA 3IJ5A 4O4JA 3ZV3A 5DLQC 3CT4A 1V9LA 5JD6A 3H2KA 2AKYA 1PGPA 3AKZA 1F38A 2Y0BA 3DR3A 3ESZA 1GN9A 1KFCB 2ZRIA 4EJSB 1FYFA 2HMSA 3F6EX 4KE8A 4D9IA 3HBFA 3CNLA 4RABA 2H2WA 2H1OA 1M75A 4JITA 3UA4A 5BV7A 4URHA 1SKMA 3JWPA 3M6WA 3NC0C 2QJTA 2FW1A 3HYCA 3L84A 2KLHA 2XE8A 3AVTA 4KK4A 1YO6A 3F9RA 1KPHA 5LD2C 1RI4A 1Q6YA 3HN6A 1DRKA 3T4PA 3V2UA 4FNGA 4WD3A 4MYCA 3B78A 1VLZA 4AUEA 3GLFA 1U28C 3QY9A 3CM0A 3MT0A 4BLSA 3HVIA 3VTFA 3EWSA 4KDFA 4CKBB 1RYHA 3V2HA 5JCZA 4LY3A 4XCXA 1VPDA 1WKVA 3UNXA 3IE1A 4G4IA 3T5MA 5CEFA 3EF3A 1A4UA 3VV2A 3DO5A 2SKDA 3CF0A 1CW2B 1UINA 3TLKA 4D4HA 5C3UA 4BTVA 4LDJA 3MUOA 5JNRA 2V8BA 3PQ6A 3SBEA 3OLVA 4PGAA 3EYWA 3C6XA 2AFHE 2O06A 1V8ZA 3WGMA 3TUZC 5HMLA 1KI8A 1J8VA 5LBTA 4LVOA 3E5NA 1SBQA 5K0LA 4JBXA 3TJMA 5JY1A 4ZV4A 1VP9A 3AIOA 4UQOA 3QEAZ 1YDWA 1XK6A 2ST1A 2R5FA 2VDPB 2CF6A 3EGVA 3P8ZA 4WZAB 1SC3A 1C9YA 2R1VA 4XQCA 1T13A 1EVEA 1X9GA 3CH5A 1HNXB 1A9YA 3QJ5A 1QMPA 4RNCA 3QVVA 2B3TA 2FFBA 2WWFA 5CNMA 5CFLA 1JR6A 4KTTE 1N7GA 3UCFA 2LDBA 4BNUA 1XU4A 1P0QA 1SK9A 5I9SA 2B1QA 3AKEA 4WDRA 1ZUHA 4HT3B 3LKDA 1XLVA 2CY0A 4DCTA 4B6RA 1D0SA 1PBNA 3P9PA 3S28A 2R8EA 1OF1A 2GM5A 3FPJA 3WO0A 4HRXA 1ZGCA 3PGVA 4GX5A 3WL8A 3OCCA 4ALLA 2D1SA 4LJ4A 4RF4A 1UF9A 3P26A 2NZ8A 3NIFB 1SEVA 3MHTA 2MR5A 1II8A 1FVXA 1U0GA 3R5TA 1TQ6A 2ZWPA 2COKA 1XZNA 2P11A 4HDNB 1KYVA 2ZUFA 3AB7A 1QYDA 3IAEA 3R5JA 1KZ1A 3CT6A 3GWGA 1AKRA 3E53A 1P2GA 1JFLA 3C1OA 3DB1A 3ZWVA 4Z3DA 3TTUA 1EB9A 2IEYA 1V8DA 2UZAA 1A1SA 3O84A 3Q3JB 2IIQA 4EYQA 2GSWA 1TW2A 2BE7A 2K6GA 2WT8A 3VPAA 3MWLA 1FZTA 3WNDA 2ANCA 4J3NA 5JCPA 1QKKA 1K3TA 2JEZA 4X0EA 5DXJA 4Z9FA 5IS2A 2HBZA 3IRUA 4JASB 4ZK6A 2I7TA 1RQNA 2FZWA 1T2FA 2BD0A 2WNIA 3ZCQA 4BKQA 4BNGA 1AOXA 3KQWA 1HA3A 5T57A 2EFHB 3CLSC 4GD3Q 2C2GA 4QVGA 4ER7A 2XBUA 3LLCA 5FEUA 1XU7A 2PEYA 5FAXA 3STWA 2PA3A 1RWKA 2Q5EA 4MVJM 2PT9A 4OSPA 4HNAA 1R8QA 5IKOA 1QHYA 4F9TA 4J03A 4YCCA 1VPWA 3R75A 1WABA 2ESRA 4XM0A 5DFAA 3WADA 1KL7A 1PT8A 1E7SA 3ND5A 2XKBA 2B1RA 2P2DA 2ZT7A 4H1UA 4I5EA 4I4IA 4MGIR 3S2SA 1SXQA 3FLAA 3O83A 3T3GA 4CDGA 3GFOA 3FYCA 3MN1A 4DFDA 1UXIA 3TGWA 3IEPA 4ND8A 5CYFA 5AVKA 1LBEA 1R6TA 4R81A 4Z4CA 1SKQA 1W2HA 3IKJA 4R8RA 3MAJA 1GNLA 4MQ4A 1PL6A 4BMSA 2GLTA 3O7WA 1I3LA 4ONEA 3AF4A 3HKDB 1UXGA 4DMRA 2QMEA 3FYUC 3Q3EA 2BFAA 4HRVA 1HFWA 3SC6A 3GLKA 5JG7A 1Z39A 2BM9A 3D9QX 1IULA 3MAAC 1WP9A 1T36A 2QBYB 2GD2A 2Z1DA 1GTSA 1TJYA 3LUJA 1IN5A 2AMVA 3IR5A 3CMCO 4R1QA 2J3QA 1R3UA 4D8XA 2YMMA 4RMJA 5DOZA 2XD4A 5IDVA 5LA6B 1JJBA 1FP4A 5A7GA 1KJIA 1TM2A 4GVLA 1LF0A 4M1QA 1UBOS 2N1MA 5D85A 5F7JA 4CKEA 4QO7A 5G0UA 3BXXA 3OA0A 1PR0A 1NP3A 1XPRA 2KJQA 2OCXA 4FW9A 4BVJA 4Z51A 1NMZA 4P4LA 4PYRA 2PBFA 2QMQA 1GPYA 2J59A 3G0CA 2TMKA 1PFVA 3HV2A 4I5IA 4WKBA 4CL0A 1LPAB 3GEPA 5ALQA 1WPGA 1X94A 5AM3A 4KP7A 1ONOA 4YRCA 2DBRA 5DYWA 1DKLA 4N41A 4F46A 1IVYA 5E1OA 3VNRA 2GFQA 2ONJA 3O2JA 4M36A 1N77A 3BGIA 1JLLB 2QN3A 1JG3A 3S2FA 2XGJA 2D00A 4QPNA 5TE9A 2WDZA 2K4MA 2H00A 4RQUA 1GTZA 1LI5A 4V02A 3BE8A 4FXPA 4ESEA 1N6PA 2GEKA 3WMEA 1GZSA 4DV2B 3TF5A 4XLZA 1U6IA 1C4KA 1NPTO 2R00A 1LPOA 4NBKA 5DSZA 1K88A 2WWIA 4FVTA 4WJLA 1HE5A 3TWOA 3WAJA 5SYAA 3GLGB 1TZMA 2ZJ0A 2QL6A 1L4KA 3E2PA 3LMKA 2C99A 4CG2A 1XL1A 2W4IA 4ES6A 5ALLA 1AU9A 1KSJA 4ZKDA 5AVTA 3NTOA 3LQQA 1MQAA 4GICA 2CL0X 2A7XA 1O95C 3OHSX 3ADPA 1USIA 2W2QA 4LCJA 3ZS8A 4ZAWA 2PO5A 2VRCA 1P2BA 1ZEMA 1ZGZA 1T4BA 3MRXA 4NZPA 5A6VA 1YT5A 5EJEA 4KPFC 1SHTX 3GGCA 5CYOA 4CM4A 3GCDA 1VLJA 1XKTA 4BPRA 3FHTA 1AKTA 2O23A 1FNCA 3U3MA 4X8OA 3V7YA 4F11A 2BPOA 1E3EA 1NRJB 1GXSA 4IHJB 1MRZA 3HCFA 4WKNA 2ZRPA 4BB9A 1V4NA 4WFKA 2CYCA 4YBRA 3UGKA 5HK9A 3GEDA 1N1EA 3U7GA 1DC5A 1XKQA 4FHZA 3NHBA 2AK2A 1PE0A 3ETLA 4NU6A 2FRVA 5GOZA 2R96A 2GN2A 1MQ8B 2IYAA 4FHEA 4O2RA 5IBQA 1YSCA 4G24A 4EUHA 2PUAA 1C0PA 3T1OA 3UEOA 1RVDA 3JCZA 1M5TA 3GJ8A 1MG5A 4CR8A 4FGWA 1N0VC 3AP2A 3VNQA 2OHJA 5FBVB 2VO1A 2H11A 2P2CA 2R4TA 4XI9A 1JIIA 2YJZA 3V8NA 3GJ0A 1A7JA 4FGZA 4N5LA 4YEDA 4A6XA 4MROA 5HQ3A 2Q3EA 4YTEA 1A5BB 5DKFA 1RYBA 5H02A 3X1JA 2JFUA 1GRVA 1R37A 1WXIA 2ZB3A 3L5OA 2XX3A 5FAKA 4CL2A 4DUZB 8ADHA 4UE3S 2VPIA 2IHTA 3LO8A 3WB1A 1VIMA 3M6IA 4DSOA 3FUUA 1ID1A 2IVFA 1OLOA 1P9WA 2B7CA 2H1CA 2MDTA 3P9KA 4RGVA 4XXHA 4KAFA 1KORA 3KXKA 1VFPA 1SBZA 1XEWY 1Z4MA 4FYVA 1LWNA 4FYWA 4BVGA 5ISMA 4ZCTA 3GDFA 1GY8A 1WDKA 3OG9A 4JDPA 1Y4DE 2JJ1A 1XO1A 4U0KA 2DERA 4YNBA 1I5EA 5H82A 2FMXA 4FXOA 5ALZA 4O4HA 5C7LO 1S3GA 1KY2A 2POCA 4FYKA 2CW5A 2AFHA 2XTZA 4HKTA 4OHWA 3WZMA 1DHRA 1QS0A 1W59A 3JALA 3UWPA 4KMMA 1PEAA 1EFVB 5A71A 2KWIA 3IAAA 4FJ0A 4RY8A 2HU5A 3QV2A 4CLXA 2JIBA 1I4EB 3C48A 4EY8A 3IPCA 5FR2A 3S55A 5F4ZA 3QELA 1NN3A 5JXGA 4V3BA 5KOJB 1DC7A 4DXDA 1JQ5A 3FROA 5IRCD 5GJBA 2KQUA 3C97A 3IEMA 1YCHA 4FI3F 2XADA 4R2KA 1O0SA 2VF4X 4GZLA 1M7BA 1XCBA 2C61A 1EX1A 3RS8A 5JTUA 1LJ8A 1NFRA 1YS6A 1ECFA 4DIOA 2VHEA 3QSYA 3GLUA 2AT1A 4PVDA 3SYLA 3BJEA 4ENQA 1SQ0A 1BX1A 4U4AA 3MBOA 5LZ5A 1M34E 1C1HA 5LWHA 1JEOA 1R6VA 2VHQA 3OZDA 2B2CA 4GRIA 3HR7A 2QTWB 2H7YA 1D8AA 1Z3CA 1EP2B 2QZPA 4KG7A 4P81A 2RGWA 3EW7A 1R64A 2X8BA 3L8MA 4RY2A 2ZBQA 4P7JA 2GBIA 5IULC 3D8BA 1PYOA 2FYTA 2O8VA 1GNVA 3PCTA 1R8SA 2HJVA 2GGSA 2V0CA 3EIHA 4QBTA 4ZVNA 4YWHA 3CZ5A 3SU8A 1NP6A 1ZG3A 2W48A 2Q8NA 3L7IA 5E0OA 2O3SA 1WULS 1ADJA 1C7EA 2A1UA 1Z7YA 2NU8B 3TXAA 4DYVA 4BJ5A 1CHNA 1CS0B 2FRDC 3WB0A 4EUNA 5DLDA 2BEJA 1QWOA 2HU8A 3R6TA 2Z1NA 2G1UA 4R84A 4MS4B 2Q2VA 3HJHA 3AW9A 2VAMA 3WK9A 1IOZA 1UC8A 3IV7A 3NUGA 6ADHA 1GCUA 3IUYA 4F6RA 1TMKA 3I6BA 2FVYA 1ULUA 2WZBA 1XTUA 1ICEA 3D8SA 2WVAA 3DBHB 4EG6A 3PVCA 3MJHA 4NG4A 1IJEA 4II3A 3LWBA 4Q5IA 2JZCA 3V4VB 4A16A 2HO5A 3B12A 4RJLA 1C1XA 3QG5A 3MINB 3N0XA 5A4DA 5B2FA 3WIVA 5HUHA 5G40A 5K01A 4HVLA 3P2EA 4BNIA 2WOJA 2VN8A 4OL0A 2EIXA 3KCQA 4OXRA 1S89A 1HPLA 4YAJA 4DRZA 3LU1A 4QTXA 2IS1A 3D7LA 1QRAA 2X5JO 2FF5A 2RGYA 3ZPXA 1DXQA 1RCUA 2EKDA 3AJ8A 3O8OA 3PPWA 4WVLA 2GDJA 1ELOA 3JXEA 1EJ6A 3D6TB 4R1OA 2DZDA 4ZCMA 2W2XA 4MIKA 5JBQA 3BIWA 3KD2A 1DHTA 3SEFA 4X94A 4ERXA 2ZPUA 1M6VB 3KKKA 1L8OA 1SU7A 4QULA 3WKBA 3INYA 4MMYB 4S35A 3Q3CA 4UULA 1V16B 5BUCA 4NESA 1KEEA 1HDGO 1JWBB 2JCBA 2XMBA 4JJGA 4Y1RB 2G6BA 2J08A 2R5WA 5DSTA 3FVQA 4FDAA 3TXYA 1FFAA 4NL4H 2N46A 3HJAA 1OLUB 4HXFB 4DSTA 3TNJA 4EFLA 2ODQA 3L6BA 3MJVA 1AZWA 2WFMA 5GAJA 1SURA 4CMBA 4FD2A 5BYKA 4DV1B 2O20A 3ABOB 3NNSA 1JMKC 2FHPA 3PHCA 3UV3A 5CITA 4K6OA 2FUCA 3DC2A 3OCUA 4RANA 1NJ1A 3RU2A 1F20A 4ENTA 5CVTA 4WKCA 1VBMA 3KTFA 3TPFA 1WY5A 1CUVA 3CZ9A 3DYBA 2QUHA 3LL7A 3OLQA 4DYHA 2CFOA 1L4FA 2QTGA 4MQEB 3BQ9A 3LC1O 1VG0B 1ABBA 1WUTA 3VNUA 1KBZA 2KX7A 2JFYA 1N2CE 4KIUA 5B6PA 2HB6A 4YMTA 4K3VA 3K53A 2PS9A 1RLMA 3V1NA 3G0HA 1E4EA 7MDHA 1OCEA 1M1XB 1YDHA 2PLFA 1U1CA 3BB4A 2A0XA 2CUKA 2PH3A 1BYIA 3AR3A 1D7AA 3SXJA 2CNWA 1VA4A 4XUEA 4TV8F 3V1KA 1HKHA 3CZMA 4H1VA 4L2IA 1MXFA 3QOXA 1J21A 4XAQA 2WU8A 4ZD6A 2FMIA 2Z8ZA 3H16A 3EJ6A 4G8DA 5AVSA 1OTYA 3M83A 1JHVA 3E5RA 4XD7D 4AWBA 1M9NA 3LPAA 4WZAA 1L4HA 1NBAA 1ZH0A 4BRSA 1BJKA 2BFEA 4QT4A 4C20A 1GYPA 5KQLA 1ZRMA 5L7YA 1XMJA 3CGWA 4C4YA 1EI9A 4JP8A 1AA6A 2ZPTX 4OQYA 3ZLVA 4GI3A 1G38A 1RM3A 1OB5A 3AI7A 4L0CA 3KSDO 2IPOA 1E1DA 5JJLA 3H0EA 2Q1SA 4K6HA 1GLGA 1PDOA 3ZHYA 2LZ0A 2V6BA 3L07A 4LG1A 5ESDA 4O25A 1JKMA 2HSGA 1SUWA 2VNSA 3F5QA 4NC9A 4O5OA 4TV9F 3ADOA 2TS1A 5F4BA 1CZLA 2P90A 4HUQB 1QU3A 4QBFA 1UMBA 3DEKA 2PKCA 1I94B 5A3RA 1NQTA 5COBA 4BP3A 2H85A 4RDXA 1Y3AA 2F1OA 1P1BA 3LX6A 2FCAA 4MNTA 2V54A 4BJ1A 1AGPA 4K0KB 3N2ZB 2VPYA 4UATA 3EEYA 4JYMA 3OCYA 4J2TA 2C54A 4K9LA 1MIOB 1KAOA 3QXGA 2F90A 1X1CA 2ZJFA 2B82A 3UM9A 3AHFA 1T0IA 3SYRA 2HF7A 2X0RA 4GC5A 4EO4A 2VTBA 3GFTA 3N76A 2XJ9A 5D7BA 4EK9A 2C3PA 2RKWA 4A8HA 4D3XA 1KAEA 5L95A 4E94A 1P4GA 2BFCA 2OB2A 2WIBA 3MSXA 4LZJA 3QEBZ 2CXXA 1C81A 1LW7A 1AMNA 2IDMA 3O1LA 5K8UA 3QF4B 3H9BA 4ECEA 5BV2P 2BKLA 2NZWA 1YE8A 1U4NA 1OTXA 1YZYA 3KV1A 4QBIA 5D6OA 5LD2B 4DNOA 4QHTA 1Q0RA 1Y81A 4HGOA 4ZOQI 5ADHA 1QFZA 4L6CA 4PLWA 5ICEA 4ZCLA 2AG6A 1UAYA 5TPWB 1XI2A 2ZIEA 1O57A 3ANSA 4LBWA 1JWAB 4WBNF 3ASZA 2JIPA 1E2QA 3LDAA 2DKNA 4YLYA 2VJOA 1JSRA 2UYHA 4AG5A 5EMLA 2JJMA 1PLKA 1K6IA 3KLPX 1C1DA 1N57A 3EZYA 3FAZA 3DM5A 2J9FB 3EFOB 3O94A 4KAJA 3TNFA 3OF5A 2GK7A 3TOVA 1JKJA 4PFSA 4GP9A 1KYTA 4DARA 3L8HA 1LZLA 3HKDA 2AN5A 1Y33E 3PJGA 3ZVNA 5BN5B 4UUAA 1SJ9A 3PC3A 3PGA1 5C5CA 2J6CA 1ZXBA 2FN3A 1PAUA 5KREA 2AHRA 3OP4A 4Q12A 2NAPA 1VKJA 4BVBA 4ENPA 5IBCA 3MMXA 5EJFA 3N53A 4H4CA 3FMOB 4MR7B 4D5EA 1C7IA 4NSNA 5FULA 4QAQA 1WQ4A 3WE7A 2NT3A 4KXVA 2CUNA 2NUBA 5HZHA 2BJWA 1EWVA 4E7PA 3BHJA 1GL3A 2DAPA 3AG5A 1BVUA 2D5LA 5I7UA 3VMMA 4EG0A 3OHMA 2X2PA 2BFNA 3NBQA 4ZALA 3A0RB 5EJGA 1M34A 1N3YA 2KBFA 3EQZA 1Q20A 3UUEA 5IKXA 4YXWD 1KK0A 5TX7A 3AESA 1ECJA 3M0EA 3SYMA 3H99A 3NM4A 1QCYA 4YP7A 3OKPA 5AIBA 1OVGA 3V8MA 4G36A 2PUJA 3W6PA 2KSQA 5JFGA 1EM8A 1JHZA 3EE6A 3DUFB 2DM6A 2LE0A 4QX6A 5PNTA 2G67A 4NENB 4UDYX 4G1BA 1V1JA 2AC7A 1KK3A 2V3VA 2IBSA 1IY9A 2HTEA 2OAEA 1EJBA 1X2BA 1XK7A 2GZ2A 3LTEA 4YAIA 5B7PA 2P9HA 3T52A 1XQVA 2J3EA 4V0NA 4EB6B 4CM9D 3SQNA 4ZHQA 4FW8A 1PG0A 4FWBA 4C22A 2DQZA 3QMPA 3LVQE 2EX0A 4ZAGA 2NYAA 2GCIA 1VMEA 3BFJA 3AR5A 1MOSA 4CKZA 3K9WA 4PCVA 2PWAA 3P27A 1R2QA 3I2GA 1YB2A 1O94A 4Q03A 4DHEA 1D03A 2OBLA 3ZI0A 2Y4OA 1MAAA 3GW8A 3ACBA 1X6VA 3NFRA 5IVPA 2QV0A 2QI9F 6REQB 5AVVA 5KYKA 2R87A 4KJXA 2ZYAA 4BO3A 5K0TA 3ADBA 2J32A 2E5WA 4E2ZA 1TL7C 4HWGA 5JDCA 2EGUA 2SECE 2VXYA 3Q0TA 4KQ9A 3A1VA 4L27A 4Q4AB 3EC2A 2K2QB 2V4MA 2AMFA 2PTGA 3DMGA 3V4LA 1CJMA 3CEPB 3CWQA 5L4SA 1W85B 1MQSA 2P2SA 4UDOA 4ASUD 4FM9A 3MOIA 2HWYA 4H7IA 2FPMA 1JR4A 4XOIA 1JT9A 1J39A 1AHPA 3WP0A 3D7MA 2PX6A 4U0JA 2F3UA 3NKVA 4A2WA 3ITEA 4JS0A 3UTCA 1XBTA 4JKIA 4IIEA 1QE5A 3WZ2A 3PB3A 2AEJA 3QKTA 4D9HA 2C5EA 3T1VA 2QX7A 2REBA 3WMRA 2XKJE 4JU9A 4TL6A 1OI7A 3NHLA 3NNNA 1PW7A 1SIWA 4M8SA 3MCVA 2IYTA 1LF5A 1XDZA 2WJ6A 3OIYA 1CY4A 4A8JB 4C6RA 3TDNA 3LXMA 3KBBA 4DCMA 4ZVOA 4BGIA 3D6MA 1US8B 3PSHA 4OG2A 5TS3A 1QGOA 3BA6A 4CNBA 1MVOA 2R0QC 3WGGA 3PGMA 4LHEA 1H4QA 1JJ7A 3UW3A 4EYGA 5I3CA 2DHCA 4NECA 3ZD8A 1SOWA 3BB3A 4TUYF 5LQUA 1OA0A 2A9KA 1E20A 2C7BA 3ZCTA 2GUGA 3HXMA 4EGFA 4RKRA 4J29A 1T9DA 1N2CA 1U3CA 2ZIZA 1ZA2A 1HZZC 2H4FA 5IMBA 4OQEA 4N3BA