2EX0A

Crystal structure of multifunctional sialyltransferase from pasteurella multocida
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
392
structure length
392
Chain Sequence
MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKQVKSKEDALNNPYVKVMRRLGIIDESQVIFWDSLKQLGGGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords a2,3-sialyltransferase, a2,6-sialyltransferase
publication title Cytidine 5'-Monophosphate (CMP)-Induced Structural Changes in a Multifunctional Sialyltransferase from Pasteurella multocida
pubmed doi rcsb
source organism Pasteurella multocida
total genus 136
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature ec 2.4.99.4: Beta-galactoside alpha-2,3-sialyltransferase.
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex0A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex0A01
2C84A 2C83A 2IHKA 4V39A 2IY8A 4V2UA 2IIBA 2II6A 4V38A 4R84A 2EX1A 4V3BA 4R9VA 2EX0A 2ILVA 2IY7A 2IHZA 2Z4TA 2IIQA 4V3CA 3S44A 2IHJA 4R83A 2ZWIA
chains in the Genus database with same CATH superfamily
2C94A 2J8ZA 4UD6A 4PNZA 1HBJA 2XAAA 1E2GA 1FS4A 1L8XA 1NUHA 2EZ4A 1FFYA 2UUCB 3KR1A 1HT2E 1RQLA 5G1OA 4IZHA 4B83A 3HYNA 3Q1KA 2QL9A 3QUAA 3D4OA 1DV2A 4GT1A 4NU5A 4PC6A 3IT3A 1Z74A 3WVNA 2Z09A 4NAHA 1QANA 4G0YA 4GQBA 1GGKA 5AW9A 3GLVA 3SVZA 4QXRA 4DQVA 4FBLA 1FMFA 1P60A 3A9CA 2PMKA 2A35A 4EF6A 4FN5A 4HAIA 5JNRA 2YICA 1RXSA 2Y92A 3IP3A 4QWWA 5ALQA 5K8UA 4IIJA 1PR0A 4OGWA 4U00A 5I7RA 1G8HA 2LCIA 2B34A 3H5IA 3PNQA 1UM8A 2IHNA 1SIOA 4Q47A 3OKCA 2CNOA 4EO7A 4QODA 4A0HA 2ZJ8A 1JEDA 5AVKA 4CKYA 2PSHA 2KJQA 1H2HA 3I73A 5B64A 4H35A 2FG7C 2COUA 2QX8A 4AQDA 1ESZA 1UQTA 2CXNA 3LUDA 1Y8QB 2ZAMA 1JIVA 4F2GA 4RTNA 2QU7A 4RDXA 1CUSA 4AXBA 5ALRA 1TJNA 4O2BF 5DISB 1MQSA 3DG9A 5DM0A 3DR5A 2FR8A 1EVKA 3HB0A 5AK3A 4LQ4A 1OGJA 4A6XA 5EMJA 1R88A 2IS2A 3KZVA 4G25A 2G25A 1RACA 5BNFA 2BLLA 2BKVA 3LRTA 3OZIA 2GPJA 1TA4A 3F6EX 3QV2A 2FW1A 2BOVA 5IZCA 4YI3A 2GJ9A 1MHPA 4YI5A 4ZHQF 3TW8A 5JS8A 3I6YA 1MRZA 3B8HA 4EQ6B 5KYXB 4NECA 2PZFA 3LQ1A 2QAGB 1CY6A 2XUPA 3G8DA 1Z4IA 2O1EA 3ZHRA 3FDZA 3WL7A 1A4RA 1NQXA 1TKRA 3OZCA 4N8DA 5IM5A 3SSAA 4WACA 1Y3IA 1RW4A 1SZCA 2QMOA 2FW6A 1GD1O 4TMTA 4CR8A 5SZIA 3FWHA 3DDUA 4OSPA 5KOYA 1K6XA 4L5BA 2UVPB 4GZMA 2BGGA 3DEZA 3QKIA 1AH2A 3L6RA 3G5AA 4MJLA 1ZDMA 4AKIA 1S4MA 3E4CA 3TRFA 4D8XA 3K0BA 5IT4A 1V4VA 2GHRA 2IYXA 4ZCQA 4OHVA 1BXKA 5JUWA 2EGHA 3JQDA 3DFKA 2W00A 2B94A 1DEXA 5CTJA 4GYJA 4HUQB 4LVCA 1E4VA 3CVWA 4DWOA 4CL3A 3STWA 4XGNA 1YB6A 3ML1A 3H5AA 3MS2A 4JJEA 3L5KA 3BTVA 3EIXA 5F7JA 3HDQA 3HJCA 3IKJA 3USCS 2WIDA 4EFMA 3P9PA 4OXXA 4YV0A 3WA6A 2NO7A 1T3HA 3AFIA 3L07A 3SKVA 4KX3A 1M74A 4KACA 4BV2A 4EB8A 4B8WA 1UIRA 4CRWB 3CNBA 1UZUA 1MH1A 4FILA 3QTBA 3V8BA 4M9RA 1XZDA 2QV0A 1FRQA 1Y8QA 1JQEA 1SQ0A 1W2GA 2M6LA 2GN1A 3RF6A 3TBHA 1HTWA 4LV6A 1EWQA 4R41A 4BMYA 2BFFB 4FOOA 1SVOA 4CMGA 3AF2A 2P0AA 1K92A 2B1RA 2BFBB 2BFCB 3QWHA 3DFZA 2N42A 4D8WA 2XB9A 5J3JA 2CMFA 1ONNA 4RQUA 5D6OA 2GPSA 1EFKA 3EIEA 2FB9A 2JD1A 2Q8NA 1RI3A 3QBEA 1W6UA 2YJ5A 4M9CA 1KVRA 3NHMA 1NWCA 3TLMA 5K6AC 4AJLA 3Q3HA 1N8KA 4IEIA 1WABA 4PC7A 3HCOA 4ZOCA 5DEOA 4QG7A 4PGAA 2ID4A 5HFJA 1YC5A 1FS6A 3NP9A 1X86B 3QU7A 3GLUA 4NFYA 4BFUA 4D3XA 4EQ6A 2QAGA 2C1ZA 2H0QA 4GKAA 1UZMA 3KR9A 4PAQA 4YQEA 1V48A 4P35A 3SJBA 4IIYA 2P3OA 1XMPA 4IMIB 3MLEA 1ESMA 3ZIDA 1B8UA 2YNMA 1ORVA 4JI3B 3RASA 1FRNA 3DEKA 4IUCS 1TA0A 3VJLA 2BJVA 3LBYA 5TF0A 2UVPA 1Q0PA 2ISQA 3A3PA 2NVOA 4GPEA 2ZXFA 1SRQA 3R8XA 1F2UB 4CV0A 1S9DA 4OHKA 1L7MA 3DXZA 4KDFA 3E5NA 4NBNA 3REFA 4Q16A 3QFSA 3T7AA 2P9JA 2XOEA 3AC0A 2IUUA 3ZD8A 1H2YA 3H6KA 1XZAA 4HUQA 4ROTA 5F77A 3CZRA 4AF6A 1RJDA 4YCNA 5EQJB 1DFHA 3H2BA 3HEAA 4DCUA 3EJ6A 5DW3A 1X1QA 1ODSA 3RR2A 1W5BA 3N28A 1C3EA 4EM6A 3SQMA 2EEZA 4QD3A 2RG1A 3WQBA 1DCTA 4TKMA 4WXEA 4CMJA 4TL6A 4HUJA 5JSZB 1QFSA 3HZZA 5C1PA 5CYFA 5DLPA 1MXFA 1PR1A 4YRJA 2AR7A 4Q7JB 4RZHA 2RKOA 4MGKR 1XU7A 1DSSG 3OOSA 5CT6A 4JL6A 3GCDA 5KC9A 4D26A 1DBPA 4ZAGA 2EATA 4MMXB 1W93A 2ZIFA 3KOOA 5JISA 3ER8A 1RM3A 4D41A 4XIYA 3EDOA 5JZOA 1CJUC 2FAXA 2PWYA 2QI9C 2CGEA 4RGQA 3T3IA 1N3IA 2BFCA 2R65A 3R24A 1B6TA 1AO0A 4YP5A 3FOZA 2J3HA 2VT6A 2D2EA 1G55A 1LH0A 2VXYA 3C3YA 3HUFA 3RH0A 4HJXA 3KLNA 4XYGA 1PTJC 4PX9A 4B34A 3VI3B 1MO4A 2QN1A 1I7NA 2RK3A 2VJAA 1TYZA 3KJXA 2A94A 5A4KA 1HPLA 1U04A 3LDHA 3ESBA 1IBMB 2GXSA 2HPHA 2PLAA 2B8WA 1G4UR 2FQYA 5T41A 2QLMA 1W4RA 4HN4B 1OWNA 4C4AA 4QEZA 5ALDA 4KWHA 3BG5A 1SWVA 4OMUA 3LX6A 4HX9A 4NLLA 1C0LA 2PWPA 3HLKA 3PGLA 4PAOA 5AJHA 5FPHA 1CUUA 4M6WB 3QMPA 3C7DB 4LNUB 3VH3A 1ZGGA 4DLSA 2RE8A 3S27A 2C0QA 2VWPA 3O0DA 3B1YA 3G7UA 2X2OA 4II3A 2FRDC 3FSEA 2A4KA 3OOWA 3PPYA 4RV9A 4L5JA 3V2HA 3ZUGA 4GECA 1NLFA 2CD7A 3VV2A 1I30A 3RBVA 1VP9A 2F67A 1IOZA 1F2UA 2AEMA 3D8HA 4J2HA 4QPNA 1FFHA 3U3ZA 3RSQA 3QEBZ 2F43B 2PSFA 3MPOA 4N49A 2H29A 1TCUA 3Q3VA 1ACJA 4ZRMA 3CT4A 4B3CA 5KQMA 3B3AA 2H1WA 1VLHA 2R2GA 3U7IA 2VF2A 2YYSA 2GFQA 3K0HA 4R81A 1LF5A 3UC5A 3IE1A 3WGLA 3BIJA 3JQ7B 4FYYA 4KBGA 1CEYA 2Y27A 1ZH0A 1YIOA 2JIOA 2WJHA 4H6VA 4I5DA 3GDOA 3K2IA 2CC2A 1JT2A 3NM4A 1M2KA 5FI3A 3SEAA 2MSNA 1NQWA 3A2NA 3S6JA 4DC9A 5JSZA 2CXUA 1TCCA 1DAGA 4F1JA 1FX0B 4YCCA 1I10A 1JPNA 5A4AA 4CDGA 1YL6A 3E35A 4RSMA 3LKDA 2CNBA 1HLDA 2ZVPX 1RMYA 1Q7EA 2OFWA 3MNFA 3Q9SA 2DPYA 3RUIA 3WWCA 4EB3A 2AYZA 3WB0A 3ET4A 1EUYA 1G17A 1KY5A 4WGFA 2WWRA 3HDVA 1MFPA 1C9KA 3BQNB 1JMVA 1D0SA 4X84A 5LQSA 4XD7A 3VNRA 2I8CA 4MR8B 4TSKA 5ELMA 1UKBA 3ZU6A 4DA7A 4LRSB 3UXHA 4IG9A 5JJLA 4YMWA 5GM1A 4PSCA 4QIHA 3PSHA 4QYTA 5B7NA 3GFSA 3QX3A 1H93A 2AMJA 1ZONA 1FP7A 2ZR9A 5CDSA 2C4UA 1GPBA 4B81A 1IHOA 2CFTA 3TMYA 3O8LA 1WSDA 3CVYA 5LFAA 1OX5A 5AW2A 1NASA 2JIZA 1EFUA 1ECBA 1SBQA 3MCUA 4QDUA 3AG5A 1LFAA 1OU0A 3WAKA 1B0AA 5EEGA 3FMIA 2EIXA 4M6WA 1U7HA 1G8GA 2GK7A 1NUTA 5KMGB 4LNUA 3PA8A 1YWGO 4O59O 1HE8B 3AJAA 2XTNA 3OAAD 2ZRBA 4KI7A 3HCEA 4TVKA 5F7OA 3I1IA 2FQ1A 1SOWA 3U7EB 3KTFA 16PKA 1PU2A 1TYEB 3E5HA 1FLVA 1IDN1 2VRCD 1SIBE 1CP2A 1FCJA 4OLFA 3KL2A 2A5JA 2F43A 2I67A 1NF9A 1T3ZA 1RQ7A 2GJKA 4RW0A 4GPBA 4UHCA 2I6XA 3GEDA 5AI5A 1TIKA 3C6XA 2EZUA 3H5RA 4PG7A 3GN1A 4OLJA 3VZSA 5LXTB 5LU8A 4M21A 4DXDA 4M1YA 4MGZR 4RA6B 3JQ7A 1R0RE 3EA0A 4NNPA 2X19A 3S2IA 1PUJA 1Q7GA 1ZQ9A 2HGZA 3M6LA 4C7VA 2UDPA 2VP0A 1JW9B 2Y3IA 2V6MA 3KCNA 2I99A 3RRMA 4M1WA 1JGTA 4FSXA 3CG0A 3IOMA 4MUIA 1BTOA 2QZSA 2GF0A 4UMDA 1XTIA 1Q84A 2ZJ3A 1FX0A 2A5FA 4RVHA 4NOJA 2RBEA 2PYDA 3R5FA 4OPMA 3IQGX 5AJZA 4BLWA 2OZKA 3D4LA 3V2IA 3H18A 1ZD2P 4GLJA 1P1HA 2J33A 2NZ8A 3OA2A 4J0GA 4JB0A 4WXMA 3M33A 4WFIA 4U02A 5GJBA 1SUPA 5IABA 3N53A 4CV3A 4FN4A 3NPAA 1U9JA 2FA9A 2SKEA 1FFCA 3GWZA 4N39A 4NFSA 2GD1O 2OBFA 1A5SB 2RGXA 2X0JA 2BGIA 2VKTA 3AWDA 4MVJH 5F5NA 3VYSB 4MR8A 7MHTA 2W90A 1LDBA 2C03A 3ZS9A 1ESNA 5FUMA 2CLFB 3WK5A 2H2FA 1X13A 5AJUA 3IODA 1EXWA 4YRSA 2G1KA 2HFJA 4ILEA 1P77A 2DT5A 4B7XA 4WUVA 8OHMA 3VNQA 1SBIA 2XQIA 3ZQUA 4B7UA 4G1FA 4LRYA 3GC6A 1WWKA 3V48A 4H6XA 4B75A 1V26A 2R6HA 3KZCA 2XT9A 3TL6A 4RYLA 1AV6A 1QHXA 4TS4A 2K7FA 3DB2A 2P77A 3ACCA 2V4MA 1F4PA 3G2KA 4KMRA 4PHFA 4MUHA 5KMGA 3KELA 5H68A 3MAAC 3L92A 4WKPA 3O0TA 2R84A 3R0ZA 1BDBA 3BB4A 2WQ6A 1CUBA 2RK4A 2IDKA 4I1OA 2Q45A 4N5HX 5JQGF 2E37A 2AN1A 3AL0C 1A7AA 2Y4OA 1U7WA 4OO3A 5FFMA 3T12A 5JZSA 5FYQA 2PQ6A 5DK6A 3RHTA 2QR5A 4D92A 4Q4HB 2WF8A 4D0LB 1CEQA 1PS8A 1U5AA 3B1VA 4UULA 3RC9A 3V8PA 2X7XA 5B30A 1RPTA 4EGCB 2C7GA 3MQ4A 1OH6A 5LXTA 1ZIPA 3WK4A 1Q1ZA 4QXQA 2ZB7A 2OKCA 4M88A 3UT6A 4OX9B 4RA6A 3AY6A 1X7YB 4GX2A 4KKVA 4JY7A 2X22A 5LLSA 1JXOA 4JSRA 1OTYA 1YBFA 3JU3A 3EW9A 3ZJ4A 1RADA 1IM2A 4G5RA 2NO5A 4HVAA 3IT2A 3GRYA 2UYGA 3HRHA 1Q20A 1E7WA 1GQSA 3B48A 3MCVA 3SJCA 2M6KA 3BPSA 4L8VA 4PGMA 4MICA 5CVTA 2CEAA 1Z88A 5EHNA 2H1FA 1ZI6A 4RF2A 1OV4A 3OUTA 3DBIA 5KSYA 1EQ2A 5E9JA 4BU0A 5I6DA 4W6ZA 4GL4A 1BJRE 4PYOA 3AVUA 3KZOA 5DRYA 5ALMA 2YJNA 4YCBA 2A0FA 3A36A 1IAVA 1X19A 5A05A 3NAQA 1P29A 1H1LB 5B7QA 3EZYA 3QF7A 4PSKA 4E7OA 3PCXA 4DTIA 1WG8A 2A5DA 2IYFA 4JIGA 4FFNA 2GFIA 3BMCB 1J2RA 2JGLA 3NYWA 2IZ1A 4HNRA 4MUMA 3WK7A 1ETHA 3U3DA 1Q5PA 3IYLW 1Y3FE 4BPRA 4Z5XA 4NDAA 1K7EB 4UBLA 3SG0A 4B9EA 2XUIA 3T61A 2AT1A 2Q50A 3OQ1A 4DQLA 5AHKA 2BSQA 3HDGA 1KJZA 3GNTA 4J91A 4ZEXA 1WP4A 1Q16A 2E4VA 4IMRA 2HHAA 3VKVA 2SCUA 2VDPB 5F51A 3B60A 3ZJ5A 1KFCB 1GA4A 1L5YA 2ID7A 4JWTA 3CLRC 4HO1X 1LVGA 4KNWA 2R8RA 2YMMA 2FDXA 1GCOA 3OKFA 1XMIA 4DA6A 3UENA 3DMRA 1O9BA 3K32A 4TX1A 4I4NA 5FJIA 3ZNNA 1SXHA 2FEAA 4BEVA 3SXUA 1X77A 1T8WA 2OZPA 5J2TB 2WHQA 2H59A 4U0KA 2Q4EA 3SHOA 2KPOA 3VHXB 4EGFA 4EZEA 1WXQA 1YHZA 4Q4HA 2GF2A 1SVWA 2GN2A 1IRXA 5AXDA 5DNDA 1E62A 1REQB 3TSZA 1GT6A 1VQ1A 5KSPA 5DTIA 1GY8A 5CFOA 1XNJA 1K08A 4P4LA 2ECFA 3D3QA 1VMDA 3ZDDA 1GGHA 1NG1A 4BVHA 1O2DA 1W46A 1X7YA 2YHAA 3TB4A 2VJNA 1WCWA 1NAHA 1NXQA 3D7KA 4XIFA 4I9UA 4CT4B 1Z25A 1X2BA 5CLGA 4LC0A 4ZJPA 1IY9A 1KK0A 5JU6A 2HDWA 3CTMA 3I83A 2RHCA 1WP9A 3OFNA 5EHXA 2JD0A 1NVDA 1A7UA 4EWLA 4I5FA 5I48A 3LQ4A 5A5GA 4OL9A 4YJFB 5D5PA 1Z0JA 2RMKA 3F3SA 4R1MA 2IYWA 3WA7A 4Q05A 4DY4A 1SXJC 2O05A 4M7OA 1Z4NA 5KIAA 3VJRA 4C4YA 4RMNA 3EVBA 5F78A 4MNTA 5LQMA 1QV7A 3IMCA 1H1LA 1YGPA 4BNVA 1WPRA 2GVDC 4NZMA 4E13A 3R7SA 4G1VA 2H9IA 1K7YA 2DGDA 4F97A 1PD1A 4L4XA 2XNJA 5GONB 4F3TA 2JFBA 1C4OA 4E21A 1I4EB 3K7EA 1DBQA 4BNXA 1BKYA 2EFCB 1LGYA 1YQEA 4O8CA 3VPSA 2D59A 3GJQA 4EGSA 3GZJA 3IUBA 1SKQA 3O03A 3H9JA 5AESA 2XYRA 4E6EA 4AKGA 2I2XB 2Q3BA 2ZR7A 5CCEA 5C0OE 1ZVVA 4O1IA 1GT91 3B2EA 4L9AA 3AVXA 3GEHA 2JZOA 4C2UA 2OQRA 1KP3A 1RWNA 1TB4A 1MMFB 1U31A 4MVJE 4TXLA 4TPKA 2PMWB 3G23A 1T24A 3IOYA 4BU1A 1T5DX 1J90A 3ELBA 3IX7A 2R68A 4NZPA 1KIAA 3FBGA 3WIDA 1JLHA 5EE0A 3DHWC 2VRWA 4J1TA 3RHFA 3UB3A 1JIJA 4NBUA 5EYPB 5C4MA 3RU2A 2QQGA 3OHMA 3RUCA 5J2TA 1YRWA 2H57A 5HZKA 4JLJA 1Y80A 2MSDB 5K0NA 3A6ZA 1PZFA 3ZIAA 1RLIA 3F49S 4IV5A 4PX2A 5FOSA 1GA1A 1WZEA 3EMDA 1REQA 3I0NA 2V6JA 1T0JB 2YVLA 4MV9A 3U49A 3M4NA 1GUFA 3DYVA 4BV8A 1NVUQ 1CETA 2QD3A 3LPNA 2VT2A 5DRTA 3ZZMA 5HM6A 3HK2A 3P2IA 3HPQA 1UMDB 4OYYA 1ZXLA 2Z8YA 1LLDA 2AUNA 4NAUA 3SR3A 1OBFO 2YWRA 4BB0A 3ETDA 4F5EA 1EJ2A 2PGNA 3WL4A 3FROA 2FUKA 1ZL0A 2W6ZA 4Y7CA 4B2LA 4I55F 4IOMA 2PUBA 4AN0A 1C5KA 1F12A 2QR2A 3F6PA 5CT5A 3OU6A 4F5ZA 3RPEA 1G64A 3C8UA 4UVIA 1ISSA 1N34B 3BXOA 1YO6A 1WLYA 4KODA 1L5WA 3WMFA 4QUGA 3MAJA 3UJBA 1IK4A 1ABFA 2GPBA 4C29A 3IBGA 1JH8A 5H9VA 3O6VA 1KKUA 1NC3A 2H1VA 4Y9TA 8ADHA 2PX5A 3U9LA 1FUUA 2SKCA 3IQXA 3I01M 3NEAA 2QRMA 3N59A 4DMCA 1U7DA 4J9UE 1ZJWA 3E3OA 4PPYA 5AK6A 4P84A 4KXVA 3A58B 1JECA 5GONA 2H3HA 3ZLJA 1NR5A 1T25A 1BQ4A 1Z7BA 1FX1A 3BIXA 1L7BA 4QTZA 4DRZA 3G8BA 2PVSA 1A8PA 2YYAA 1GEEA 1IK6A 3CLUD 3E53A 3F4LA 3JQBC 4REMA 1ISJA 1MAWA 1O5IA 3HP1A 1J09A 2VS1A 3A0RB 1EUDB 1DWOA 3LUAA 1JHOA 4IUYA 1EUQA 5JVDA 3B7WA 3N58A 1N6IA 5C1DA 4HLUC 3ZE8A 2LW7A 4EF4A 4UJ3A 5ADWA 3OPNA 4ENUA 2AF4C 3PGMA 4PTZA 2VYND 1MB3A 4HDCA 3JXEA 3U26A 4Q0MA 1M1UA 4KGDA 1GU7A 3CIFA 3BS4A 1TJ5A 1Z83A 1DEHA 2IOHA 3AYZB 2C3MA 3C6ZA 3QLEA 4HYQA 4LHYA 3K2QA 3LUJA 4I1SA 4WZBB 3B78A 3JAKB 4QYIB 4O2LA 5DLDA 1V5IA 1CJCA 3ROGA 3W9YA 3IQIX 2H08A 2VNHA 3KBOA 3ELYA 3FKSA 3TO5A 1H4VB 2XLCA 2I78A 3PUVA 4J94A 1OWOA 1Z3IX 2JCGA 4LBVA 3SICE 4N41A 3IIJA 3ORRA 1V11B 4OH7A 4P53A 4WKNA 1G5RA 1JZSA 1LB1B 2C59A 5IBCA 2B25A 1STOA 1VECA 5EWLB 5J4YA 4LZLA 4TWZA 5C46F 1ZOPA 1UMDA 4RJIA 2VJLA 1H3NA 3VR5H 4ER6A 3IHTA 3DOHA 3VPHA 3C3XA 1DKRA 1T8PA 2VYCA 1K8ZB 1NQUA 3NHUA 3OFND 3EWSA 1NIPA 4FFWA 3R7BA 3L79A 4M0CA 5HWSA 1HL7A 1U7ZA 4F9FA 4P33A 4QJ5A 1LLFA 5D00A 2QM8A 5LM3A 2HB6A 4XXHA 3RRYA 4D43A 2Z8ZA 2WYIA 4JC8A 4NBVA 4DLNA 2KHZA 1VGQA 2HBQA 4FTWA 3LHKA 5LB4A 3FNFA 4V02A 2I8AA 3DT9A 3I5YA 2C97A 1H1TA 3NWPA 4M60A 4R3NA 3T34A 4CFSA 4CG2A 5A0TA 2I4LA 5AICA 3OZUA 2CLEB 1K8YB 2QPOA 3ESCA 1NXVA 3TSCA 4CETA 1GSOA 4QNRA 3JVDA 4Y6QA 3LTEA 3UM9A 4MH0R 1H9AA 2XBUA 1L4KA 3BM5A 1W96A 2Q99A 2I4IA 3EEFA 3NNDA 5GZ6A 4YONB 1Y8AA 5J5CA 2PU5A 3UQYS 1TLLA 2IX3A 4QVKA 1FFEA 3SMVA 5LBTA 3THWB 1ISIA 1VSUA 4INJA 2HT6A 2V58A 3GUCA 5K8JB 5LPNA 2GARA 3DT8A 3PHHA 1OH7A 3EXAA 4J90A 4G5SA 4BVEA 3M6XA 3LV8A 4QA9A 4DSUA 1KEPA 4DJAA 5CM2Z 1EUDA 3AR8A 2XE4A 1I7DA 1GLVA 3JD2A 1QDEA 3E9EA 3FUUA 4DV4B 4ZAYA 1WETA 2O52A 2XGMA 2GILA 3W3AH 2V7EA 2OD2A 1DVRA 1G38A 4M38A 1EB9A 4L95C 3QE9Y 3W5AA 4FX2A 4E5KA 7ABPA 1RXWA 3V2GA 3DBRB 4CMIB 3LBIA 2K2QB 2OBNA 3HCAA 3P1JA 3OCZA 3RTEA 1WUYA 1VZ2A 5KNCH 1G4AE 4M99A 3FSJX 4M83A 4WZBA 3EASA 3JAKA 4QYIA 4GF5A 4XQGA 1Y1SA 1X0VA 2OR3A 2ZQ5A 3T5DA 5EIHA 4MB0A 3BBPA 3RVRA 2XDQB 1I6MA 3EIQA 2W9XA 3JW8A 2VJBA 3N9IA 1Z35A 1FDUA 1V11A 1ZM4A 1EX9A 3A9VA 3DW1X 1S02A 3HUEA 1ZK3A 3S2ZA 2V5VA 1D2AA 1QFXA 1HE4A 1Y4AE 5EWLA 1DIBA 5LZ5A 3WFZA 1JIIA 1QCDA 1UJMA 5C8YF 2B0JA 3SWWA 1XPJA 4WCFC 5JHGB 2G8NA 2JLQA 4FC7A 4P1ZA 1DMRA 5FOTA 2VF7A 1PZXA 4MQ6A 3VR6A 4MMYB 4MINA 4Q4AB 2HJRA 2W6CX 1Z0IA 2ZRNA 3KTAA 4FYIA 5HKAA 3T1YB 1RMQA 1XQ9A 4FK8A 4D8UA 1N36B 1KZ9A 3DTVD 3KJFA 2C7OA 2VDLB 1EX1A 4DIDA 3DYIA 1GFSA 1J0DA 1KTVA 1N9GB 2FEOA 3V7NA 1M8GA 2JZCA 3DFIA 2DUWA 3DD1A 3GLHE 3M9WA 3PC4A 1E9CA 3Q4GA 3H0CA 1WXXA 1DZ3A 4DIMA 1M0EA 1CG6A 3GLGE 1XZFA 2PXCA 4RENA 2ZXEA 3I9MA 5ADHA 3F0TA 3A10A 2Z1NA 2PMEA 1F9AA 1MAAA 2WOJA 1NVGA 3C8MA 4MJ7A 5SY4A 5BY2A 3AB7A 4ITVA 1E0AA 4OATA 5CM8B 2ZCVA 2HJGA 4EUHA 1JDZA 1FTSA 1G20B 5EKSA 3LI2A 1P2UA 2FH5B 3AR4A 1GL7A 2O3JA 3ADPA 4Q7LA 5ECGC 1U1IA 2RHDA 2PGXA 3NETA 4H1HA 4DG8A 4Z7OB 3ETGA 4KBFA 5CBKA 4NZYA 2B1GA 4OJMX 4ILKA 1W30A 3D6JA 4Q3AA 4OI1A 3THWA 5DV9A 2Z6UA 4ZT3A 2ESRA 4RJKA 1XNHA 3K73O 2LDBA 3SOZA 3BK1A 4ZJUA 3AP2A 5H70A 3WQRA 2BMAA 1WVIA 1V7QA 1ZHHA 2YY5A 2ZTVA 3DMGA 3THRA 1F60A 2PKQO 5EIEA 4GKJB 4JUCA 3TKLA 4BKPA 5DH9A 1CULC 1IXRC 1KAMA 4CU2A 3PDHA 3U4GA 1U6JA 1UC8A 1QH9A 1GCGA 2WWXA 3KEOA 1PTKA 3WGGA 1JR3A 2WABA 1DRJA 5I9MA 1NVXQ 2ST1A 2O6LA 5DSXA 3A11A 4BUZA 4PN7A 2ZYWX 1ITZA 1K4YA 4GC9A 4YFYA 3UYLA 1OGIA 2OAEA 3NBMA 4YT4A 3HG7A 3U56A 4UUBA 2C61A 3LUCA 5KSOA 3B6IA 5KTTA 3H99A 2XDQA 1JLLB 1WSWA 2BGUA 1VIYA 3DXXA 1PJ3A 2HK8A 2BGTA 3HU5A 1M2VB 1KYVA 3X1XA 3D02A 2WIKA 4RBNA 2Y76A 4CF3A 4YCAA 1A9XA 1OXVA 3W78A 3J7AC 3D8TA 4AJ2A 2VATA 1CEEA 4KYTA 5AK5A 4E5MA 2ZTMA 1BHO1 3NHRA 4FOSA 5KO2A 3QPUA 1SJ9A 4PHGA 10MHA 2ZJOA 4DMMA 4S1WA 3RIEA 5CGQB 1P5RA 2XWQA 1JDNA 1QO7A 1ZOSA 3UAYA 2C1EA 4BJHB 1TZJA 2Q3FA 2XVZA 4K6KA 1EPUA 3JV7A 4MKXA 5DM4A 5EPEA 2AA3A 3K0CA 2B0CA 4AWXA 4F3YA 3K5PA 4R4JA 3RT1A 1N9GA 5DTMA 1RRPA 1UM9B 2Z3ZA 3DM5A 3EXEA 1VG8A 3HU2A 2OBBA 3HB5X 3M4JA 3E7DA 3NNNA 2Y2UA 2CLDX 1JHVA 2YZKA 3I9NA 3K8QA 4KR7A 2DH5A 3O8BA 3R0XA 1XRLA 2WAOA 2IEYA 4DM3A 4MW0A 1P1CA 1JIKA 1RYMA 2B1JA 4NG5A 4DN6A 4QKQA 4TYYA 4BFWA 1G7SA 5JE8A 4IYJA 3UKDA 1CX9B 1AQYA 1PK8A 2I3ZA 3VC3A 1G20A 1OA1A 4ME6A 3NH9A 1HDXA 4DZZA 4ERXA 5EE3A 1IL0A 1K2WA 1L7VC 1RCFA 1P2FA 3INNA 3CF4G 1M83A 2QSYA 5ES3A 2CCGA 1SH7A 2VC2B 1SQGA 3DLBA 1SZPA 5E7QA 2OG2A 4X93A 1DKQA 4HB4A 4ZCLA 4RC9A 5G4KB 4DSAA 2Z6QA 1EE9A 3GJZA 1BKDR 4EI9A 4ALKA 2AJCA 2QE7A 1UXGA 3M7IA 3STHA 3IMEA 3OTQA 1NN5A 2O06A 4NBSA 4Q15A 5AM5A 5HF9A 2RKBA 4HDNA 4OREX 4YV2A 2FK8A 3Q8MA 1AN9A 3B52X 4UD2A 3CINA 4YC7A 1L9XA 1M6VA 1QK4A 4FDLA 4V0SA 4EA6A 3UWKA 2QTWB 1PQWA 2EERA 1P72A 3UPTA 3DMTC 3VAYA 1K06A 4WXHA 4GBGA 3SP1A 4UUPA 3KSBC 4P31A 2Z08A 1RI5A 4ZVPA 2C29D 2WEKA 2HYIC 3N8HA 2XPCA 3VTFA 5B57C 2J6IA 5B58T 2GR9A 2C9ZA 3GQVA 1GPMA 3MCWA 5JEEA 1JLLA 5G0VA 4Z3DA 3TIXB 2D1RA 4PR3A 1VHQA 1M2VA 3QXGA 3H0EA 3PWKA 3A1FA 4H17A 2OSBA 4Q3EA 4OQEA 3BE4A 5FO1A 1CUIA 5HCUA 3RU3A 4OVKA 2Z5VA 5IBRA 4UBNA 1S96A 3W4IA 2D8MA 4Z53A 3VBCA 5IXSA 2ATCA 4NV0A 3VR6D 3TBKA 2GCNA 1OIXA 2IYQA 4L8LA 3EHEA 4PZ9A 4IO0A 1UFRA 2Q2OA 2VDJA 5TMBA 1D4AA 4EHNA 5KNDA 2QTTA 2OYCA 4MV5A 3N2GB 3R5XA 4RO0A 1VKRA 5T4HA 1LY1A 1ZH8A 4M0UA 2C8VA 3KZXA 3OPQA 1AUOA 2HK7A 1L7OA 3RWMB 3HXLA 1EK1A 2BEVB 2CEKA 3T3GA 1FP4A 5C7LO 4ZGBA 3ZD7A 4MULA 1BHQ1 1JNXX 3PQ8A 4NYMR 4I50F 4TL7A 3WWPA 2QL5A 1Q74A 4TZTA 1G9SA 2ZJ1A 5EQDA 5BT9A 1ZA2A 2HXYA 2Z9CA 3CF0A 2AC2A 1V1MB 2HQ1A 2ZPTX 4IFIA 2WWIA 3W5IA 2HV8A 3O75A 2C3YA 3EXG1 3F7TA 4MKIA 3EPRA 2Z2YA 1JHYA 1ISRA 2NTYC 4MIKA 4JFRA 4OKNA 1YZFA 2DT8A 2YHUA 5IYZB 5G4KA 3UJPA 4MWTA 2R85A 1RWXA 1HLFA 1HT3A 1VG9B 2FRVA 1ZC3A 2W6NA 4NC9A 3EW7A 4W8OA 2I7CA 2IU3A 4FXPA 4C3ZA 3HU3A 3QOYA 2JFWA 4Q1AA 5JEDA 2XGOA 3IA7A 3OM0A 4RZSA 4DIOA 2O8CB 4AJKA 3L1JA 3I6BA 3IR6A 3PV0A 5AWFC 3O92A 3CRZA 2H4FA 3WSTA 4DR5B 1BXRB 1BEZA 1ZVMA 3A32A 2VOJA 4FHEA 1BQ3A 2BV3A 4WADA 5HJ2A 3RCBA 4FT2A 1NOIA 3H5NA 2DE0X 1N6NA 3Q88A 4BBZA 4EHKA 4EYQA 4YPOA 4H3VA 1PQYA 4HWSA 2P2YA 1G6HA 1Q95A 1JTEA 1QYVA 5EVJA 1UBEA 1EHYA 1NUAA 1NW6A 2IZ7A 1LCIA 4HRYA 2XQGA 1O6FA 1SKAA 3WB9A 4ASUA 1GP2A 1H4TA 4AG6A 1JH9A 4ND7A 1G21B 2RONA 1Z5OA 3WIBA 2JBAB 3QSGA 4MPDA 4BNTA 3SHVA 2BZ1A 3LW7A 1DJQA 1T3SA 1VLMA 5ALOA 3NW9A 3I2YX 3QTLA 4PQFA 3TSWA 4BQRA 1MW8X 2XUFA 4F4IA 4CIYA 1X1SA 4Q3OA 4RA9B 4W1SA 5F1YA 5JFTA 1P39A 4QM6A 4LI3X 3CW2A 1UBGA 4TTQA 4WKBA 1N2OA 4F9EA 5IJZA 4KWCA 2B4QA 3N2GA 5CW2A 3GVHA 4Q9HA 1IBLB 3E7WA 1EDZA 2CXSA 3BQ9A 1YT5A 3WGQA 1QG4A 2EW2A 3H5WA 3RKUA 3WHPA 1K7SN 4EO4A 2UZ3A 1OASA 2G9ZA 2BEVA 2QTNA 1CUCA 3M6IA 4P82A 4QDKA 1B8PA 1MAVA 2FWJA 2H2HA 2UZ4A 1MVLA 2JPDA 4JB3A 2NPFA 1JJAA 2AG5A 3BD7A 1Q92A 1V43A 2OCYC 3C8ZA 4PWYA 4IDAA 3VR1A 5KTRA 5LP1A 3ZXXA 2XSZA 1V1MA 1RS0A 2W2TA 2Y1GA 3GA7A 4EX6A 2P5SA 2B8NA 5D6NA 1MP0A 5CLLA 5LJIA 3CVJA 3JQ8B 4COKA 4JR0A 1FNMA 5IYZA 1VBNA 5AKHA 2W83A 3TVTA 3KAJA 3CV3A 1EIZA 4HYEA 3T1VA 2QE7D 1PSZA 3PFKA 4A5SA 2I2CA 4BGVA 3DLAA 1Q1QA 1BW9A 4NIMA 1QK5A 1B6RA 1TYCA 2V7QA 2AF3C 3RNOA 4O08A 1U8FO 2BEKA 1ORHA 3E9NA 2O8CA 2ZRMA 2XNHA 3KV1A 3I2HA 2NU7A 1ZIDA 1DKNA 1BXRA 1AX9A 2R7AA 1NJ5A 3S2EA 3TOZA 4J7CA 3RIGA 1QPGA 4CHTA 2ZYAA 3FCEA 5L53A 1TEXA 3HBMA 1AMUA 1ECPA 4ZD6A 1YE8A 2IP4A 1TKBA 1CUHA 3F1KA 4F0JA 4X6LA 2EWMA 4HXEB 3DYBA 1YTUA 1AD2A 3K8ZA 1DPGA 1N6LA 1V9LA 2BUCA 3KSUA 5K51A 1HM5A 1PFVA 1RWVA 2C00A 2PTHA 2FPMA 4R1SA 3LX8A 1G21A 1Z73A 4ZQFA 1UPUA 1FTQA 2P9YA 2PFSA 3K0KA 4A4DA 2BHTA 2G9NA 2JBAA 3IURA 1CR2A 4FCCA 1ZSYA 3SOPA 1VE9A 1ZZGA 4QLAA 5KI6A 1I32A 2AG8A 4JN6B 3E9QA 3UC9A 5AM1A 3JD3A 5B36A 3MWEB 3P0RA 1Q0LA 2E85A 3E4DA 4DHWA 1QVVA 4HGQA 2O0MA 2GZSA 4FVTA 4C0SA 1DCFA 2QRHA 1SVKA 3GP5A 4RU1A 1P2SA 3B9PA 4X71A 3Q8KA 1KO7A 1RP1A 1CHNA 1Z2CA 2H9YA 2I3GA 2DPHA 1QXSA 5I9NA 2Q7DA 3WGTA 4DMRA 2DQSA 2RH9B 5DP2A 3FVVA 2QZJA 3RUEA 3ROQA 5BR1A 1J2TA 1PG2A 2AFHB 2ID8A 3NTQA 3Q2IA 4IL5A 4BO4A 3NYRA 1T3LA 1W5AA 2QM7A 5T3YA 4L73A 5A4IS 4IDGA 1E1QD 2RGNC 3CUKA 5DXAA 4PW0A 2UUOA 5ABPA 1O95C 5IDYA 1Z8HA 1HNXB 1HLGA 2DFVA 4PBTA 2J3EA 5IKEA 1Q6ZA 4LYYA 5M3BA 2AFIE 3SZLA 4D0NA 3V00A 1N33B 4J3NA 2ZIXB 3JQ8A 2OK8A 3K0EA 4G1UC 1XLTA 3I05A 2ZRHA 5CW1A 4TMZA 1NYRA 4CTJA 2JFUA 4I1UA 2HLDA 5CDTA 2CNDA 2PY6A 3HVHA 3Q85A 1NXSA 2A0YA 3KL4A 4AQ7A 2EV9A 2A2ZA 3NOQA 2I3DA 3CFYA 3S99A 4B6JA 3KQUA 1KDYA 5BQ5A 3BAFA 2WIAA 1KJWA 4EJ0A 1H65A 3ENWA 4DVJA 3ILVA 3JARB 3JQCA 3LGXA 5COQA 3TF5A 3FZNA 4YDRA 4LDPA 1N1MA 5C7OO 5AXBA 5DULA 1PYGA 3P9CA 3FVQA 3L7JA 3E5MA 3Q6MA 4DS3A 1FNSA 1G2IA 2J7PD 4XQCA 5THKA 2GOYA 3KV3O 4IYRA 2REOA 1QOPB 1EXVA 4CR7A 1TQ8A 2GASA 1YUNA 2PH7A 3N07A 1D1TA 1U8ZA 4IFEA 3U0BA 3RC7A 3BN3A 4F92B 2WT4A 1GAXA 1IUKA 4MW4A 4I1YA 1OYVA 3Q87B 4BLVA 4YX9A 2FPSA 1ZZEA 2AH5A 2IW3A 3IAHA 3ROFA 3V1TC 1BWPA 5I3CA 2JI9A 4XA8A 4KSCA 5DYIA 1RMTA 3GIDA 4L76A 4ZC1A 5FLXA 1PR4A 1N2GA 3ABIA 2VHZA 2A9FA 4MQ4A 1Z4OA 2VHWA 2WSMA 3MWEA 2WJYA 2PUTA 1WBJB 5DT2A 1SQ6A 2X4GA 3HE3A 5EJFA 1VI2A 3E6AA 3ITNA 4FW9A 2D06A 1VE6A 1JWAB 4KQWA 3U0VA 2XGGA 1DOZA 4DSZA 1C3VA 3ZBTA 3V1NA 4S05A 1I13A 1M2GA 1YI8A 1Z0KA 3FPKA 3HCWA 3K6RA 4NABA 1W6RA 4MSUA 5E3IA 2AFHA 2GZ3A 2YQ4A 4ZQBA 2MYUA 4JA0A 2FKAA 2B7LA 4NYJQ 5H4HA 1CJKC 4JQOA 3URMA 2XSZD 4BOYA 1EB8A 4V0OA 2ZIVB 3OOYA 1I7PA 1ZJJA 4C0LA 1ZN8A 4YMUA 2QMQA 1XTPA 1YMUA 3AOEC 4FOLA 4HWPA 5FF9A 4AU1A 3MMXA 4TZ0A 1WUKS 2DSNA 2X4LA 1YFKA 1FDIA 1RJEA 1KAGA 3FYUA 1I4OA 4EMUA 4AURA 3C3AA 3FF1A 4GI5A 1EFRD 1TC1A 2C82A 3ELDA 1CPYA 4IS3A 1NN1A 3TWOA 4F6CA 1QU2A 4IH4A 4UDYX 3W1VA 5DCYA 4LXQA 4YAKA 1TKCA 3I32A 1FK8A 4XSHA 3ZJVA 1S3FA 3QMMA 4O2BB 4B3GA 2GEVA 2OPHA 4GLFA 3RUPA 4RKEA 1UODA 2FW0A 2JKVA 4NBLA 4WRRA 4LJKA 5TEVA 2A3RA 2G8LA 3NO4A 4F4UA 5FR1A 3U3XA 1CUZA 1QYRA 3JQ9C 1BMFA 4H7HA 3PEWA 1UBUS 1VIDA 1KK1A 4XLTA 3RSZA 3R75A 2CXOA 3X1WA 1WZIA 1U1FA 2YL2A 4C6HA 1CNMA 2AD1A 5KTYA 3QUQA 5EJEA 3RAFC 4ND8B 3A1VA 1MC1A 4MA4A 3MSXA 4H59A 3MF4A 2O8VA 3FCYA 2F9FA 2VBFA 4Z4IA 5EIWA 3CT6A 3Q5GA 1CQIB 1I4LD 1IXZA 2QZPA 2QDKA 2WVHA 4KN9S 1EJ0A 4M49A 2Q0XA 4C6TB 4E5NA 1VJCA 1KBQA 3Q2OA 4WK6A 3UUGA 1H4SA 3ZDAA 1R0KA 4DSTA 4A1FA 2NYUA 2PLFA 1J0CA 1GQRA 4IH9A 4IX9A 5A4FS 1NV8A 5K8TA 1TFUA 1IVYA 5BYJA 2BCJQ 5IWAB 4W5NA 5TT0A 2V98A 3LYHA 3H16A 4WA8A 4G65A 3RROA 4BFTA 4DZTA 1NUQA 3GJSA 1DQPA 3IKVA 3V3TA 2FPKA 4EBBA 2H5EA 4YO7A 1HYQA 2WMYA 1EGQA 3OZSA 4LXYA 2INGX 1E79A 3D7RA 1RWQA 5F9HA 4EBFA 4N3AA 1FZQA 4P2GA 4CG0A 4OGKA 4HNAA 4YRGA 2ZWPA 3IQHX 1JDPA 1O3YA 4YVFA 2O2DA 3SHFA 1KSHA 4D8VA 1M1YB 1PT6A 3PCRB 3WZLA 3TXYA 2JGAA 2XMZA 3WJ7A 3UH0A 3PLAE 3ZE0B 4IHJF 4CI9A 5K0GA 3DCIA 1O97D 3K1TA 4DLBA 8GPBA 2P2SA 2I8LA 3FLEA 5CXXA 2C96A 2F3SA 5EIBD 3WNBA 1QIGA 4OK3A 3LA8A 1X7XA 4BVJA 2HF9A 2HLDD 1F5SA 2PX6A 4KZPA 5CFZA 3LQRA 2ZUTA 3HABA 2NUPB 5JH7F 2Y1WA 1P19A 4E11A 4WZZA 1PT7A 2EHJA 2QA5A 3COWA 1RZVA 1ELOA 1WB5A 1VC2A 2XW6A 3AR7A 3FZGA 4HMPA 1AKUA 4Q9LA 3X2SA 1OSNA 1ID1A 2UVQA 3MVEA 2APJA 2W2NA 2WTAA 2PO5A 2OESA 3QJ5A 4KMOA 3T3HA 3GRAA 1US8A 4BE7B 2FMTA 2ORVA 2PSEA 3HFJA 5B6PA 4U7FA 4S12A 4BE9A 1P33A 1CERA 3DEJA 4DNPA 2GA9A 4PR0A 1XTJA 4KFTA 3F4BA 4ND8A 4OQXA 4DRXB 1O0BA 1GDDA 1WF3A 1H2BA 2F3TA 2FKNA 2FUCA 4K9SA 1TPZA 1UWCA 3VQTA 4PTLA 3UGJA 1CQIA 2RHLA 4LPSA 3WMEA 4DDUA 1LPBB 1QB7A 2EW1A 2RCYA 3BCRA 3CZ9A 3E9DA 4IEFB 4C6TA 4NK5A 1NRJB 3H65A 4DV3B 1BA2A 1O5TA 2Q2WA 5ESRA 5I7AA 1L5LA 3MT7A 4ASUD 2II6A 4ZYUA 2YWGA 1ZR2A 1VL5A 1ESEA 4K9QA 4MOWA 1NDUA 4BVFA 1X9IA 3W5DA 4MUKA 4B09A 2I4OA 5HF8A 1DC6A 4R05A 4FPXA 1M1NB 5G0WA 4KX5A 5J2UF 5LQUA 3ADDA 3WGHA 1TE2A 1BMQA 4UBOA 1XKTA 1T36B 5JFGA 1ZU5A 4CIWA 3PFFA 4V03A 4TM8A 4HEA1 3V4FA 5INTA 2XCIA 2VAMA 1I4DD 4JCOA 2GRAA 2W2KA 4F8EA 3AM4A 5EZ5A 5JCJD 1EVJA 2OVFA 3TINA 5KNCA 4I1PA 4ANFA 1C0KA 2IP2A 1CUVA 3LPDA 2NXEA 4X64B 1K5PA 3VR0A 1SHLA 5G0TA 2VJDA 2XCLA 2W2LA 2XMQA 1N2JA 4HDSB 4HNUA 1KFJB 1OAAA 3LPAA 2WF9A 3ZY3A 1SXQA 2VQFB 4LVNA 3H9BA 4P5PA 1R9JA 1UDWA 4FHDA 4HWKA 2AJ8A 2QQ0A 1E66A 1I5OA 2NUPA 3MUEA 4OQLA 2R6CA 4U0JA 3PICA 1M2OB 3OEED 4GPTA 4GQIA 4EHIA 1M67A 2JARA 1XDGA 4GFDA 5ICEA 4JGIA 4C0QC 4MUYA 2OT3B 3W8NA 3AVYA 4U9IS 1P8AA 2C54A 3WRWA 4LYHA 1U28C 2RB4A 1QE5A 1R6TA 2AXNA 2RGGA 2FEXA 3G89A 4LV5B 4I3FA 4F1KA 2X8JB 4TT3D 1XKLA 2HKIA 3SN6A 4CBVA 4YALA 2WJ3A 1XCJA 1EK6A 1H2RS 1KYWA 4DM4A 1LVUA 2BSAA 5CG2A 4J3JA 2IEGA 2GD6A 4PZYA 1KARA 3M0EA 1EKXA 2KE5A 3KT3A 5TVKA 3HB7A 4DRXA 2ZBFA 4COOA 3AZQA 1ADCA 2OD9A 4EF5A 3FRHA 1UXHA 2WYOA 4JT9A 5TSDA 2V7GA 2EKPA 4D4HA 2DY1A 9LDBA 3PQ6A 4Z3OA 4L22A 4OQFA 1MC5A 3SQOA 1MTZA 3DAGA 1NUUA 3WRXC 5LIPA 3GRCA 4G9GA 5PNTA 3VNAA 4H27A 2YDXA 4FFBB 4RVDA 3QX7A 4HVTA 3HYSA 1Z4PX 5J5AA 3RFTA 4J0DA 2QT9A 1VOTA 3SDBA 3S2GA 4ESEA 1M6HA 3P7MA 2ZT8A 5HFNA 3FSRA 2QTAA 4LY0A 1M1NA 2Q9AA 2WM8A 3G9QA 5COBA 5HM8A 4TTSA 4GPZA 3GHYA 2FR0A 1KYQA 1YVRA 4TZ6A 4ECEA 1T36A 4KUGA 3KXKA 4BQFA 2ERCA 1MDBA 1TK9A 3MPUA 4S1OA 1PGNA 4BNZA 5BSEA 4JC4A 5HF6A 5IS2A 4FD2A 4PBSA 2D7JA 3U81A 3EUWA 4EITA 5JROA 3V97A 4L02A 4RPLA 4ZXFA 5JCOC 2J9FB 2D5CA 3OKAA 2VCHA 1LPMA 2DECA 3FTEA 3VX4A 2V9CA 3D4BA 3ZGXA 1SUFA 3EPLA 4MHTA 2W37A 1EFLA 3LCJA 4M22A 5J58A 4RXTA 3GDHA 4J4HA 1JHQA 1QFJA 2OHHA 3HHEA 3FY4A 2LBPA 1O58A 3H05A 1PUIA 5JLJA 1BVHA 4B4VA 2CUNA 1YRBA 1MJFA 5B7GA 3RVSA 4FZ5A 2ZREA 5LIRA 1FJGB 3LBAA 4EOGA 4WZ6A 1JT9A 1PS9A 4FR2A 3ZZTA 4MUGA 4MS3A 4NZOA 1UWLA 1PSWA 3O3MB 5KKCA 3ZGZA 5FP0A 1RTKA 1JHXA 4ZYTA 4RTQA 2IY9A 2XD9A 1FNDA 1ZD9A 3FX2A 4EB6A 1LDGA 4F60A 5I47A 1HEYA 2X8JA 1PBTA 3H2HA 3DMYA 1N1EA 4H18A 5K0LA 3VDQA 4L3OA 3B3JA 4UOQA 4Q7QA 4K6MA 2VO1A 2PKRA 3ZNQA 5BSRA 4WESB 1I3NA 5CDUA 1THMA 2DFPA 3HLTA 1XDSA 1M1YE 5KOJB 1PGPA 2AI1A 5EJAA 2B21A 2AOVA 1V2GA 4EDFA 2ZPUA 3KZNA 1IEQA 4C4XA 1USKA 4OU4A 4B87A 4Q03A 4LRWA 1E69A 2HK6A 1WIWA 5DXJA 1L4HA 3VHRA 5F2OA 2FX3A 3EVGA 3H3JA 3OIUA 4BP9A 1F8YA 2JJ1A 3AP1A 3GW8A 1C1DB 3NOVA 5F9FA 5I9SA 2QSZA 1J0EA 3PI7A 2O8DB 4FFBA 5A06A 2IXGA 1OILA 4MYRA 5REQB 4Z6KA 3ZVNA 2XB8A 4KO8A 4MEAA 3WMWA 1OYYA 1RC8A 4FHZA 1ZGJA 3M70A 3OF5A 1FXUA 1PCXA 4FGZA 4O3MA 5K6AA 1DEAA 4GX0A 3HI4A 2KM1A 3WDSA 4TRJA 2F55A 3LL4A 4MYCA 4NE9A 2DWQA 3BJZA 4DA0A 1FNBA 3BIWA 2W6QA 1U80A 1ZVKA 4MO2A 1TU4A 3CJTA 4XZ3A 4Y1FA 4JS0A 3HY4A 3WGYA 4DSOA 1E3QA 3VNBA 1CXZA 3B1ZA 2YJTD 2ZRPA 5E2IA 4P3XA 3QTTA 1GTRA 5FDFA 1S8FA 2EOAA 3BE8A 1JDJA 4XWTA 1WAMA 1YB5A 1IXYA 2J9FA 2CZQA 5T4EA 5EXXA 3IQWA 5AI6A 4FS8A 2DJIA 4PG4A 3ZYCA 5FCDA 2EX1A 2J3KA 2W2LD 4MV7A 2WIBA 3H2KA 3BH7A 3MTIA 2E4AA 1CWUA 4JI0B 3WV4A 4UFPA 2ZEJA 3BIOA 3TCKA 1EFVB 1X8XA 2J46A 3DQZA 2YWHA 3QVKA 4R9NA 4K9RA 3AYXB 3TM4A 3LIPA 4W5QA 5TQJA 4ZTBA 1DQYA 1TW2A 2N75A 1HLPA 4GZ5A 1MABB 2XZPA 1FE8A 4WFKA 2A86A 3RM3A 5K2OA 2XWPA 3N75A 1B3BA 3I6ZA 2LUOA 3KPWA 4YRLA 3H87A 1RXVA 3NG1A 4YMLA 4YJKA 1L6IA 3INTA 4BMVA 3OECA 3HUDA 4HL6A 3AI7A 5CVCA 4R40A 5LA6B 2P41A 3UY4A 2V7XA 4GVLA 3ZHCA 4I7EA 4WESA 2AHRA 2QD1A 3S1LA 4CLEA 1YS7A 1XZBA 4J0KA 2Z9BA 4JLOA 4B6SA 2R1UA 1NMEA 2C4MA 3W90A 4Z8YA 3O1IC 4Y2QA 1IIBA 1LPNA 5EP2A 3F9RA 3KQNA 3K2EA 3N2YA 2OGUA 4HGYA 4ERNA 1VPEA 5JYEA 3IQFA 1T1EA 4W5WA 1DBVO 1HEUA 5JPDA 4IW3B 4KLNA 4AZTA 1B73A 3ZQ6A 1C1DA 5HRUA 3O82A 4MW6A 2WA1A 4XX1A 3WO0A 5A4JA 3OX1A 2O8DA 5REQA 4P8RA 2VHTA 1UPFA 3HCFA 4G1EB 4WN3A 1XTQA 5ECDA 3RNLA 4N8EA 4QGAA 3H1FA 5DX0A 1DXOA 4RVSA 4M86A 2GHQA 2QNBA 1YB2A 3MQ2A 3PIRA 3LZ6A 1PK9A 4KQJA 3P0FA 4LYAA 5BSFA 5HKBA 4LY6A 3K4HA 1SR8A 3QE2A 4ZYYA 1KBZA 5CD1A 3JALB 3ZXSA 2IYEA 1E1CB 3RVDA 5M5BA 4JLSA 1RBZA 2WWGA 1SBCA 4HFJA 4ZO8A 5JALA 1P6XA 3HM9A 3IO5A 4CF7A 3ABQB 2J0EA 4B33A 1Z4KA 3UZUA 1EP2B 2QP3A 2HMVA 2O2YA 3LO5A 1FBNA 1K4MA 2GZMA 2JGIA 5SZHB 2JFOA 2NVUB 1NKTA 1JE1A 3KQTA 1EFVA 4UHHA 1EVIA 1KI4A 1F2TB 4BWYA 1NTRA 3EVCA 3RRJA 4CMHA 1OJ7A 3WMRA 4ZDWA 3C48A 3IALA 4ND1A 1MABA 2PS3A 5DM1A 4LUCA 1P18A 2VHUA 2EZ9A 5EN4A 1H2EA 3D8SA 2VEDA 4FFLA 3CO5A 3VKWA 2PL9A 4I14A 3RHZA 1WJGA 1NULA 5LA6A 1KI9A 4C3VA 5LDHA 5IT9A 3OPXA 4OHOA 4LJ8A 3FE2A 3NWOA 2QJOA 2ZTSA 3MUNA 4MV3A 3DNPA 4ZCRA 3ADBA 4BO8A 2W8ZA 4IZIA 2IX9A 4DA9A 1Q11A 4ZANA 5LYJF 2DR2A 1BVYF 3S1SA 3H42B 1BAPA 2H48A 1RYEA 3OCUA 4DLZA 2GMWA 3RIXA 1LFDB 2OCDA 2YOHA 3FHOA 1QONA 2C31A 5CJJA 4LGCA 5C5CA 2YR0A 3EGVA 3GUVA 4OP1A 2A8YA 3PT9A 4JOSA 4Z0PA 1UFOA 1CDDA 1K68A 4ITUA 4GGOA 4Q1CA 4S1TA 5FI1B 4C0KA 3STVA 4EA8A 3FRJA 1E2LA 5CXUA 3I62A 2OHIA 1W9HA 3F6YA 3GH1A 4ZOBA 3P4YA 4JLKA 3GPBA 1CQXA 3CS3A 1E64A 4BMDA 2FY8A 3EGCA 4JJZA 4RHYA 2XUHA 1Y7HA 3RWBA 4TYQA 5FRDA 2CJPA 1XE3A 2EX4A 4GOKA 2CNLA 1GUAA 2E4UA 5B37A 3O9VA 4HDKA 3OLXA 4ZYZA 5AVZA 1KGSA 1JAYA 1K3FA 1QCYA 3HYLA 3PB3A 4YAOA 1YFJA 3F5SA 3NUGA 3PFCA 4JXJA 2CT8A 3TW0A 3KG2A 4P5DA 1RLMA 5JV5A 4GVPA 1P7WA 2Y67A 2HLPA 5TX7A 1E58A 1YV9A 4QU8A 4K6FA 4TM7A 1J8YF 3JALA 1E1CA 4QAJA 4CLRA 1JQBA 4FDUA 4UU7A 3QMVA 4G09A 1VGRA 3KU4A 4MA0A 5HDBB 1T5SA 2JAXA 4EKDA 3U7FB 4UM7A 3K70B 3AERB 3PUWA 4MUJA 1MX5A 4NEGA 1FDVA 4R2WA 3ZGNA 4MCJA 4RGYA 1S7GA 2Y0BA 3COSA 4P83A 3AHCA 2XKAA 2NVUA 4N0MA 4L0QA 5FOVA 1AB6A 3U4CA 4DWJA 5F3WB 3ANXA 5LLDA 1F2TA 1YZYA 4URUR 3ZDYB 1IC6A 4FSDA 1PW7A 1VE1A 5JXJA 2EW8A 1R6XA 2QENA 3QIAA 5BN1A 4JZYA 2VAPA 2X0NA 3O2NA 3P19A 2H2GA 4FNOA 3VKGA 3I0ZA 1CUDA 3O4HA 4ESVA 1RYZA 4YHBA 3WO1A 4BBJA 1F6WA 1N2CB 1XCLA 1FU7A 4IGKA 4RJJA 1YJXA 2N9UA 2J6BA 2YC2C 4RF4A 2W0SA 1DE0A 1Y9EA 2AL7A 3K31A 2VNKA 3OZDA 3RC1A 1U0FA 3C87A 3TRIA 4ZIRB 6CHYA 5LWHA 4WDQA 4AD8A 1Z8FA 2DWPA 4FR0A 3T06B 221PA 1YBMA 2PUEA 1XCGB 2FTKE 3K96A 1KO8A 4GBJA 3Q8WA 1YKSA 1D2NA 2H5IA 2J4DA 1XVIA 5D85A 4X54A 2IXBA 1BCRB 3LLMA 3FCAA 3IUJA 2DFNA 2JVIA 3HO8A 4CG1A 3ZW8A 3SLKA 2P4SA 2C7PA 5H80A 2VLBA 5JAPA 3ZQKA 2WJWA 4MRRA 3IVCA 1Y0BA 4B6GA 4JP3A 1VA4A 1LLUA 2XYHA 3RVLA 3U3JA 2JCXA 3UMCA 2MSKA 4RE5A 4DDTA 4NTZA 5K8CA 1ARZA 1JIQA 3QH4A 3P0JA 1O9GA 4R2LA 4D46A 2WF5A 3TTVA 1OLXB 3DDNA 1AHHA 4BVBA 4Z49A 1HNZB 2EAUA 1RXUA 2JJ2D 2NZJA 4HFNA 3HHPA 4C6RA 3CHYA 3ZCXA 4XYLA 2DUMA 3GZTB 4FZRA 2IXDA 1KEVA 3ADKA 2HQSA 4C08A 1Q17A 3GAMA 3VVBA 2AR0A 3DE7X 3HFGA 5D1HA 1CE8B 4I55B 2YJ3A 1D2EA 4V0QA 4QBTA 2BYTA 3ILHA 3X1JA 3CR8A 1TLFA 1S9HA 2R6GA 1Z5VA 4UM9D 2P1DA 2Z04A 4V0MA 2MHCA 4CMIA 1A1SA 4E6PA 2B4RO 4HI0E 4TWBA 3L77A 1TVMA 4ZK2A 4YJ2F 3BXEA 1NA5A 3U13A 3ZC3A 4YMGA 4H0NA 4RQAA 3PWZA 3T7CA 3FUWA 1SU8A 2WSLA 2C9DA 3GOHA 3H97A 1N5KA 4EYSA 1OWLA 3IP5A 7YASA 1HY3A 3JZIA 3LQKA 4WKOA 4F11A 2QD5A 5LP6C 1DOAA 3DV9A 3PTAA 3U48A 4NEQA 4H3HB 1N2CA 3T5PA 4I1VA 5EMLA 5BWCA 1NZJA 2R5NA 3AI3A 2XUAA 3MN1A 4CGZA 1RDFA 5EUQB 1MJGM 1A96A 2DVMA 1AF4A 1G16A 4XDZA 4ZIRA 2XKBA 4OY3A 3T99A 621PA 1NU8A 4BMZA 4KOEC 2WSSA 3RUAA 2Q49A 3H9EO 2HX1A 2X42A 4MAFA 5DCUA 1NI5A 3R3ZA 3PUIA 1JLSA 3A2MA 1G9XA 3IXMA 4FEEA 3V46A 2AEJA 3EQ8A 4KWIA 2HPZA 3QELB 1IG3A 3ZS8A 1GNRA 1VZ3A 1Q0HA 1XQ6A 3E61A 2GAFA 4R16A 5FTKA 3A9RA 4W5OA 4LMAA 4B4KA 4DR6B 3B6KA 3CKLA 1TZKA 4ID3A 4R98A 1ZJ4A 3BXZA 1MVNA 1ZK2A 1N2XA 4HEJA 4EI7A 5HF5A 4KXWA 2PBZA 1OLXA 1FW6A 4EYGA 5IUJC 3FOEC 3CX3A 3LOQA 4PG8A 1HZJA 4XCXA 3RS5A 5JSQA 3GDFA 2I7DA 3HB1A 4BX9A 3TZLA 1DBWA 4FYMA 5H83A 3D6VA 4LGYA 3IPYA 4I55A 2A57A 5LMUB 3D6FA 2X0DA 1TMYA 4P7KA 4PYKA 4WLUA 1ZBDA 4YA6A 2CL7X 1KAEA 5HTOA 1IHPA 4DXHA 2IXAA 2VFAA 2I87A 3EYAA 5GOZA 5K3SA 3IFSA 3EUAA 4G63A 2Q2VA 2AOTB 1YZQA 3V8NA 3GJTA 1JZQA 3W2TA 5ALIA 2YXPX 2V5AA 1NT4A 1OAOA 2IEIA 2PK3A 4J29A 2XMBA 4INPA 2HJWA 4JLUA 1MR3F 3EGOA 4KHZA 3WKAA 2QROA 4PNEA 1HKUA 3I6MA 2JIBA 3TCXB 3ZHQA 2ON6A 3BMOA 1Y1LA 4NX2A 4W82A 2A3NA 3V9PA 4B6RA 3OWOA 1SVMA 1OXXK 3ICOA 3SC6A 2ATIA 2OZLB 4BX8A 2DTEA 3DKVA 1ODIA 4A2PA 3LK7A 1KSFX 1IN5A 3CX4A 4DMFA 3E81A 3A05A 1PSDA 2OBYA 5THXA 3WI7A 1QVRA 3O3OB 3OFKA 5DM60 1H5NA 1Z5GA 2JASA 3PD1A 1IJKA 1OTXA 3ROPA 4ZCPA 1IZ8A 4TXMA 5G02A 4WLNA 1JQ5A 1QGZA 3NDRA 4OGFA 5FAXA 4RIHA 2DP4E 2QDXA 2PM8A 2VWHA 3C6KA 4OB6A 1EWYA 1GZ6A 2WU0A 3E70C 3MRSA 3GJXC 1J22A 3NRJA 4IF6A 4IJMA 4DLAA 3ZJUA 3FTFA 4FLFA 1L5QA 1JQ3A 1HG1A 2XGJA 2QLTA 3KYCB 1IB6A 5EKUA 1GEGA 3TTXA 3AEUB 4ZI7F 5KTOA 1QMPA 2OHJA 3FHJA 3GMSA 2R48A 4JU8A 4TYNA 4LFAB 3NFYA 3QOXA 2O54A 3MBOA 1BS1A 2AOXA 1HNWB 4KHPB 1VL0A 2Z5LA 3FSGD 5H02A 1NRWA 5EKTA 2FR1A 4LEIA 2PN1A 4AUKA 3TRDA 2J3LA 4TVSA 3LBNA 5TB5A 1B0UA 2AJBA 5LL6P 4KQEA 2RFLA 2B92A 1THTA 4CE6A 1HL3A 1ISFA 3W8EA 2FPPB 2I71A 3IBYA 1W25A 2JGEA 4MTCA 3A28A 2YKGA 3B5EA 4FLEA 4LMRA 3KLMX 4PYNA 1JLMA 1XYVA 3BMNB 1OI7A 4X65B 3NHZA 4JU9A 2VHJA 2XE8A 4YY3B 4OG2A 3RAJA 1YB1A 2V8OA 3D8BA 5KTMA 1R6VA 1UBSB 4JSTA 3L46A 3GFRA 4XPIB 3LUHA 4KO2S 3T52A 4AJOA 1L4GA 3FPJA 4MI3A 5MFZA 2BTEA 4IMJB 4B82A 4OP3A 1F6DA 3NVDA 3HL0A 4RTPA 3TG2A 1SC6A 3FTPA 4Q39A 1CY4A 4KLZA 1D2RA 1WW3A 2Q4OA 4RH0A 1C7EA 4R9RA 2PGAA 4UUAA 1DAOA 1DS6A 2QMHA 2BM0A 2JBWA 3KK0A 2OV3A 4FOPA 2J0UA 3K1YA 2XODA 4UARA 1TK3A 2A9VA 1S01A 3M49A 4ZAZA 3UAXA 4KSBA 2IQIA 2NGRA 4F72A 1QG2A 4G36A 4ZEVA 1NBME 4QBHA 1P4SA 1HYHA 4MPTA 2A1UB 4RLQA 4J76A 4XWGA 4C30A 4YXFA 5I8WA 1WZ2A 3CSSA 2ZSBA 4PX3A 1ESDA 1L8OA 2WSSD 2XF2A 3WRYA 1TU0A 1RZ3A 1WS6A 2HJ9A 1GUZA 5IEBA 2E21A 3NBAA 1PN3A 1IXKA 1XDBA 2C8LA 3S8YA 4QPJC 4XSVA 1ZH4A 5LQKA 1R4NB 1I0IA 3VA7A 3Q15C 2Z1MA 3STTA 1QWOA 3CWQA 4Q1FA 1XTBA 2OXFA 1KP2A 3PGJA 3TRHA 4BNFA 3UPUA 2CLIB 2ILTA 1EK5A 1NPDA 1PR6A 2XEXA 4C0WA 2BR4A 1YZLA 1NBOA 3KYCA 2UZ1B 3DL2A 1QKJA 2WJJA 4PSAA 3AEUA 2X3YA 4YRZA 3KXPA 4KYVA 5TGTA 2UVDA 1T0UA 1P1FA 4IGEA 5K2MA 1QHSA 4LJ5A 1UQUA 5H3LA 3DJYA 4Y2SA 2HA4A 1W4ZA 1C9DB 4C9BA 3IPRA 1KO5A 1JYFA 1VB5A 2VEOA 3VH1A 3KQSA 3V4PB 1WB9A 4G0ZA 2BUAA 3KQMA 1Y34E 1QTQA 2BEWB 4EJ2A 1ODLA 2NZYA 4QL3A 1E94E 1N6HA 2IY7A 3RSSA 1ZIYA 5I9IA 3IMKA 1ECLA 1N3LA 2P3QA 2WMNB 2IP1A 3MRTA 3CLRD 3N7TA 5KOHB 1MXHA 1GSHA 2D2IA 3BMNA 1MG5A 1A71A 2HM7A 4HLUA 3D5QA 4KAFA 4NENB 5EJIA 4P4SB 4WVLA 4L4SA 3MMSA 4DT1B 3EXFB 2BDTA 4BHTA 5B7PA 1ZD4A 3HEBA 4KXLA 4XPIA 5F1KA 3DEAA 3EVNA 4FFPA 1IJBA 1OF1A 3HI6A 3JVVA 5U4QA 2A92A 3RTBA 1BD4A 1YS6A 5KNLA 1QRUA 3P2OA 1UMCB 1NYTA 1PG5A 2VUHB 3DVRX 1PE0A 4HEA6 4HLDA 3QUBA 4IVQA 4OMDA 4M9UA 1F0KA 4PFJA 4DCMA 2NU8A 1LDMA 4KPGA 4LRXA 4E2WA 3R6TA 4A1OA 4NEHB 5A0VA 3JYQA 4JASB 3IP8A 2WIJA 2ZCJA 1G8MA 4H7FA 3IOCA 4LWZA 4RMIA 5EZQA 1CRQA 3IAXA 4TV9F 1O6ZA 5EKDA 1RAAA 2J5KA 4OJQA 3EK2A 4YXWA 3AO0B 3DAOA 3H17A 4HAVA 5ALYA 4BNUA 5JC8A 2PL5A 4OHFA 4MPJA 2HNKA 4J0HA 1DEKA 1WSBA 4LRUA 4PONA 3TRJA 5H9WA 1EAMA 1N5DA 4HRVA 1G2OA 1Z6YA 2SHKA 2A1UA 1IY8A 1FYDA 1FJ2A 2R97A 2VK4A 1BMTA 3L7MA 2UYYA 3RC2A 1B8OA 1XZIA 2I55A 2VHQA 3VPBA 6REQB 4J16A 2I91A 1NKSA 3BE6A 4D44A 3AW8A 3FTDA 4XEHA 3ABSB 3FVRA 5IZCC 1ZPDA 1R4NA 2MR5A 1SXJD 5AW4A 3BMQB 1NHWA 1S2LA 1U3TA 5CFRA 4GZ6A 3RLIA 2WG1A 1JDBC 3LHIA 3P9NA 3PGXA 4DLUA 4CM8B 1AHNA 2CW5A 2SECE 2P3LA 2PKWA 4Q7KA 3T7KA 3FMPB 4HAOA 1Q0QA 2MWMA 4LE1A 4IHKA 2A7QA 3U40A 5F23A 4DV5B 1UAGA 1SQ5A 5LQJA 4I4LA 4GMXA 3TE7A 4PF1A 1CB7A 3AONB 3IEXA 1O96A 1MPXA 5FBKA 5DNCA 1AQ6A 2BELA 1ZCFA 1KO4A 3L40A 4GPIB 1S1CA 1XGKA 2FSPA 3GMTA 5E3HA 1GTVA 1HT0A 2DHDA 2I7XA 2UYOA 3OE5A 2PGOA 3N0WA 1MZVA 2JI8A 3NHBA 2BEWA 1Z16A 4QXMA 5E6UA 3KOWA 2JCBA 2V7PA 3NHKA 2FHSA 3FNGA 1I1QB 4UTXA 1SURA 2ZDHA 1RQPA 4MQ5A 3A9SA 1EFPB 3HKEB 4NQRA 4DJDC 1WE2A 4Q4CA 4BY9E 1QFYA 3KQQA 4OGGA 5KOHA 1FP6A 1N3YA 3VR4D 1P7CA 4NENA 1ATZA 1TZ2A 4DANA 3NTUA 1PQUA 4DT1A 3EXFA 1XQWA 2QRLA 2C4NA 1WEHA 5EQTA 1UBKS 1KZ6A 2OB1A 4EJSB 3ICPA 3Q3EA 4L7VA 1CR1A 1DUSA 1P5JA 3GEEA 1EP3B 2AXEA 9ABPA 1UMCA 2PT5A 3FNQA 2BW0A 4I50B 1JYSA 3KPUA 5SYAA 4FYHA 2BMDA 3VU0A 4TRMA 3T9EA 4H16A 5MDHA 3FWPA 3AUYA 2KBEA 5K0ZA 5B12A 4M36A 5CEFA 1XQVA 2WWTA 1PHPA 4TXHA 3KB8A 1RYDA 2I1LA 1Z18A 4PFSA 1CVIA 1GNLA 2GDZA 2P65A 4MP3A 4MQFA 5ICCA 4KQIA 4BNYA 1YK1A 5CGZA 2OM6A 1G59A 1R4AA 3UB2A 3VR3D 2X13A 1QYWA 2PV0A 3A3YA 3PVSA 2HCRA 4JP2A 3BGIA 4G3XA 5JZ9A 6REQA 4TTVA 2XHEA 4RLHA 1PP4A 3K6JA 3OU2A 1R0XA 4WBNA 3LXRA 1TVCA 3B2QA 3ISTA 2AUMA 2UXCB 3OZGA 4YJGB 3BMQA 3BAZA 4MV0A 2B36A 3DDHA 3ZDQA 3DFUA 4YRQA 4GI1A 4CM8A 1QIDA 2QAGC 3UH1A 5FWNA 1H05A 4UW9A 3SQXA 3SEZA 1T5HX 2OCBA 1A4UA 3ESAA 4BTLA 4ZGGA 5CFQA 2E1PA 1PNRA 4RANA 2YNMC 1F3LA 2JHCA 3DDSA 4Y9DA 5DBIA 3NIFB 3CNNA 1UOQA 3IUEA 4KVZA 4OIMA 4NXNB 1ZCAA 2D2XA 1E1RA 4I81A 2WF7A 4RFLA 4FFMA 2C77A 2W6JD 1T1SA 3LL7A 3GGDA 3GGCA 3TS1A 3DBOB 5FBQB 5F35A 1EDOA 1KOFA 1J1ZA 3CEPB 4NJOA 4YP1A 3CISA 2F8SA 3SYLA 1EQUA 1PGQA 4DR4B 2AG1A 4JJ4A 3ZWDA 5ICSA 4DXAA 1U8YA 4MWZA 5ECWA 5FLKA 2OP0A 1C29B 4JVMA 4BO6A 1BGXT 5LZ8A 4QU5A 3L01A 2FRXA 1NI3A 2OQIA 4GE0A 3G9UA 5JXWA 2JFZA 4EJSA 4ZT5A 2WPDA 1TM7E 2ZWAA 2ZK7A 4U63A 3GT7A 2YBDA 3F1LA 5JDCC 1WMBA 1SUSA 2VTBB 2AZMA 4R2HA 2GRUA 4FBGA 1L1EA 4KQXA 3VDRA 1PJ2A 4HQFA 4DC1A 4UPEA 3C45A 1VRVA 4XIIA 4RAOA 3NT2A 3WL5A 4CKBA 5ARCA 3HN7A 4E0BA 3NV7A 2H7VA 2YHBA 1SC9A 2QY9A 4EELA 3BJIC 2EIHA 1Y5NA 4LCJA 5ARBA 4E7PA 5I3ZA 1JHZA 3UA4A 4JI8B 1G6OA 2K6GA 2GEKA 1EVLA 1DQRA 3G82C 2XUOA 2ZU6A 4WJKB 1F51E 3ST7A 3MRXA 4EVSA 1BVUA 2KQUA 3GG9A 4P9NA 1GZ5A 2VL7A 2ZROA 4CKEB 3OIGA 4BNDB 2C4WA 4LE2A 2DX7A 3I0MA 1EBFA 2BONA 2GAIA 2PRJA 1XVTA 2H8GA 1E3IA 1Q1EA 1E9DA 2PCJA 2V65A 2W11A 4FMDF 1EYZA 1HMYA 2JLCA 2VH1A 4R9UC 3RKRA 2QUJA 4BNNA 1CJTC 4L8FA 2ILVA 3ODPA 2V9ZA 1AGXA 4X7RA 2WV9A 2Y9MB 5ICGA 1A7KA 1JQJC 3OZXA 5HR5A 1XI2A 4LYJA 1FXWA 3GRRA 2DMRA 9LDTA 3D6TB 2VPWA 1X94A 2W58A 4R1TA 3EDCA 4LW8A 4M0EA 1OBVA 4XW2A 2XRYA 3U6KA 3ANYB 3AW9A 5ICMA 4A2WA 1TT7A 3PFIA 3ZDBA 2Y1FA 1YKGA 5DYYA 4JIMA 3C6MA 4TMKA 1HQYE 3WNDA 2RK6A 3X1KA 3ZWAA 1Z37A 2YWJA 4DZRA 1KYIA 2HQBA 1FP1D 2DTXA 3HP7A 3KSMA 4ZKEA 1NMZA 2AQ8A 3DE5X 1IOWA 2NMVA 3GQBB 1P4GA 1JFLA 3AR6A 4RIEA 3TR5A 3E84A 2A30A 4O4IF 4XB2A 3E18A 3P9ZA 3AVQA 1E9AA 1PJRA 4EMSA 2UYHA 5JAOA 2CMGA 2AC7A 5AK0A 1ZN2A 4MGEA 2G72A 3ZI0A 2J45A 4LC9A 1JXMA 2QPTA 2CFCA 2AG0A 3OZTA 1ZFNA 3HFRA 2VTBA 5HBRA 3W2FA 4RZXA 3RBZA 1C3OB 3ZQ4A 1Z0FA 2H4WA 1MT0A 3CM0A 4ZXPA 1WQ1R 4EP1A 2FMHA 1DJOA 4LF8B 3OJFA 5EVCA 3WGOA 2BBOA 4XM0A 4YRNA 3V7FA 1Z5UA 1B0ZA 2EJCA 2Y9PB 3BXHA 1I2DA 2FMIA 4H1WA 1SVSA 3ASVA 2IOYA 2EFJA 2AKEA 3IS3A 1E61A 2WU4A 5TDHA 1TEHA 3C70A 4BLPA 4HGRA 4QREA 3VR2A 4QPCA 4NYIQ 1GKIA 4B3RB 3KKPA 1WHTB 4X91A 1K7CA 5I45A 2J5XA 3LIIA 5EPOA 2XADA 4JEHA 4CKEA 5IG2A 2BH2A 4I4IA 4Y6GB 4BNDA 3V8RA 1WBBA 5JARA 3N8GA 1S2NA 2AMVA 2PV7A 5ITVA 2YFQA 3P45A 3R2JA 1U0OC 3GWGA 4W4TA 4RD2A 3TJMA 3UAWA 3PK0A 3D3KA 3TZQA 3STUA 2QXTA 5IF3A 3CPEA 3M83A 1R0YA 2PS0A 2V3VA 1RTTA 1WBDA 2ZSAA 4WZAB 4G8CA 4AX8A 3C4JA 3R3HA 3KFXA 4KV7A 4CNBA 5HZMA 5E6RB 5MN6A 3K1JA 1GYPA 2EX0A 2PZLA 2H1SA 3DOCA 1K7FB 5J2UB 3UHPA 2Z0MA 2BPOA 4ZOQI 4OSOA 1ZG3A 3CRVA 3H5LA 3UWOA 1E1RD 2JAPA 3DP7A 3E0QA 3O3CA 4FDAA 2J87A 3ZWCA 1KRWA 3S7ZA 4L78A 1E6LA 2D1QA 4DY6A 1TEVA 4A0RA 3GQBA 4A3SA 1OPRA 4I66A 4G23A 1VJTA 1YCFA 1YHNA 4P81A 2KSQA 2RGBA 3V80A 4DQUA 1R8JA 5CU7A 2HA6A 3KEFA 1OXTA 4HH1A 4JT8A 4AIIA 1E5TA 5I5EA 3FM9A 3D2BA 4UEWA 5IKXA 3AUSA 1C8LA 5TMPA 3Q8LA 2D6FA 4AJ9A 3GGOA 3BH0A 2OZEA 3O8RA 3E8SA 1T5BA 2G9QA 2RHRA 2QMZA 3AFHA 3I45A 2I2WA 1XEAA 3RTGA 3LC0A 2WV7A 5A4DA 4K9PA 2WU3A 3FAZA 4QZVA 3ILXA 1C3OA 1A50B 1LBTA 2IXEA 1H22A 3BSYA 3KT6A 1ORRA 5AHXA 1PNQA 3L1HA 4M1EA 4MWSA 3U2QA 2XHZA 3W9UA 1PYOA 3B1WA 2PTGA 3FMGA 3DHNA 2ERYA 1UDXA 2YWEA 3HL4A 4ZOEA 1RLOA 1AK2A 1QBKC 2VZ0A 1LDEA 1QH1B 2P75A 4RHCA 1GUBA 2CFIA 3JAMA 4Y6RA 4RS4A 1C0IA 1RRCA 5BRJA 3O7WA 4EVIA 1GPAA 3Q3GE 1K86A 4MI6A 2H4ZA 2RJ3A 2C4VA 4CIXA 5KNBD 1XG5A 2VHXA 3CURA 5BYKA 1Q44A 5ELXA 5TPZA 2ZJ4A 3O73A 3NHJA 2Z56A 4XUGB 3LOPA 2IK8A 1USIA 3QUSA 3MS4A 3FHCB 1K97A 1IPEA 3RT9A 3W7VA 5JANA 3EUEA 4M1ZA 3C4QA 5F2EA 1CDZA 1NY5A 2FV8A 2OHGA 1QO0D 2VZ9A 3PUJA 1G8SA 4U8HA 3CF6R 1T29A 2C2KA 5I01A 3R09A 1FRZA 3CLHA 1CF4A 2NSDA 2O07A 1LPSA 4RZQA 3P4UA 4LCEA 2BFEB 2EFYA 3SI7A 5AUQA 1Z7EA 3I39X 3MHPA 2JFVA 3T7JA 2WFAA 4FHFA 5ALGA 3EY4A 4R2JA 3WAGA 2RC6A 1SHUX 4N54A 1MTOA 4NU8X 1HXHA 3LS2A 4B3TB 1ID8A 1LJUA 2A0XA 3ME5A 1DARA 2Y71A 3GEBA 4JI5B 2G0NA 3A8TA 2HJHA 1FFDA 4FU0A 2D5AA 2C4HA 3UXMA 3OOJA 8ABPA 2WVAA 3GJ3A 3W2GA 1CUEA 1ENPA 2OGWA 3R5KA 5J23A 1J39A 3ZHTA 3ZDCA 3CH6A 4RKYA 3FCXA 2PUDA 3L4EA 1LS1A 4AECA 3Q0IA 1KFEB 1CR4A 5J47A 3ZCPA 4EECA 3OFJA 1NN3A 2FN8A 4H1TA 4ES6A 1LKZA 1T2AA 1XRMA 2GK3A 2HZ7A 2JLBA 3OJEA 2QJTA 2D1TA 2YYYA 1P62B 4YAJA 5HTKA 5JAQA 5BXQC 1X1CA 2J67A 5KVVA 2CE2X 3M8KA 2GX6A 4FB4A 3DOJA 5KYUB 2FLKA 3WYGA 3EZ2A 3G85A 5DHPA 1W88B 4ZWNA 1I36A 4OBWA 1RPNA 5CM9C 4R6WA 4KPEC 1OI2A 1Y3BE 1QH1A 1QHHB 2Q5QA 3P2EA 3PE3A 5AQEA 2WB4A 1EK0A 1P2DA 4Y1EA 3EBLA 1U2EA 4XJXA 3AHIA 3WMGA 1CZHA 2J32A 3TLBA 2UUBB 4QT0A 1I3OA 2CVOA 2IZOA 1RBMA 4QULA 4FFSA 1CUXA 2ZJBA 5FL7A 4G41A 2QYHA 4B3HA 1JPUA 1RRVA 4CTKA 3LP8A 4ZJZA 2CWWA 2YN4A 2ADOA 4TUYF 4ZV9A 1RVDA 4KDRA 4N9WA 4OYLA 4Y0VA 2IF0A 1HURA 4GLBA 3D3WB 3EGXB 4HGOA 4RL4A 1U2RA 5DX8A 4EG7A 3D1LA 5JXHA 3UAVA 4DR2B 4C4SA 4Y67A 4XOUA 3U16A 2XUQA 4JUBA 1WXWA 4L9RA 4ZZIA 2IGBA 3MWGA 5M2QA 3I3OA 1THZA 2ZTHA 4FCWA 4LJSA 2V7BA 2HA5A 4DNQA 3QQPA 4YUWA 5KVCA 1U11A 3G7NA 3HWX1 2IZZA 3ZIUA 5AM0A 1LBSA 4UTZA 1IBKB 1GDHA 2O20A 3BL8A 4AO8A 2BFEA 1XYGA 3ZWPA 4Q5IA 2AN5A 1O95A 5JAIA 3OSUA 3G2LA 1U1EA 3ZY5A 2ZAOA 1XZPA 1A76A 3CONA 4A8JB 5I4BA 5HIAA 4KQ1A 1CQJB 4CKWB 1JB9A 2Q5IA 3A1CA 3AFGA 3AKCA 1ZMOA 1FQKA 3R5JA 4OU5A 1MPTA 2PYIA 3HRKA 4URFA 4BLUA 3RU9A 2EZ8A 1KZHA 2A5GA 4TLDA 4A10A 1YE3A 3H4MA 3L7BA 1N78A 4J03A 4NJMB 4CIAA 3PR3A 2DXIA 1L7PA 3OPMA 2JL1A 4W1PA 6Q21A 1Q7CA 2E4WA 3QOWA 2PZGA 4KFSA 4NHEA 2JDIA 1Z6AA 3UOGA 5IMSA 1D6SA 2PSSA 3U4MA 5P21A 3MWYW 5B1IA 1KYTA 3D7SA 3BX1A 3JYOA 4B3IA 1UBFA 2GYYA 1A9YA 2O7RA 1CB0A 1Q15A 2M1XA 3Q3CA 2RGEA 4B4OA 2IS1A 1POXA 2OCPA 3FUCA 2IA5A 1G5PA 4MJ3A 1T9AA 1HZZC 2HIHA 3PVCA 4RVUA 3VDXA 4MPPA 2AW3A 4BZZA 4WZAE 5NULA 2DPGA 5KVAA 5KYUA 1YCDA 4RSHA 4TQ9A 2LR0A 4AW9A 1TECE 1AUQA 1W88A 1NOJA 3JWJA 1TCVA 2V6BA 1GTG1 1BD3A 1QHHA 1KXJA 2ZANA 3I5UA 3I30X 3UNXA 4MWGA 4M8IA 2IGTA 1O8CA 3HB4X 4ARAA 2IW1A 3LKBA 1JS1X 3Q7SA 1CY7A 1NVTA 4AVYA 4ESHA 5JTUA 3B5IA 2UYQA 3BSSA 3NT5A 4AS3A 3F73A 1Y9AA 3TQRA 4ETNA 1PLJA 3DCYA 5A9SB 1UOEA 2ZYSA 5KHAA 1VMEA 3TPCA 4BNGA 1J23A 4I5EA 4N9QA 4H77A 2FF7A 3D3WA 3EGXA 3L8FA 1HFEL 3ZXUB 1U8CB 1UK6A 2O9JA 4RVGA 2HOQA 4C04A 3HM2A 4Q4DA 1CVRA 2O5CA 1J1UA 3R7FA 1R12A 4IIDA 3DE3X 2C2HA 3FI9A 3C43A 2PX8A 5JJBA 3F5FA 3N2IA 3EOBI 1KHHA 2L42A 4Q6BA 4U9HS 3UHFA 3F5QA 3NORA 3V8VA 1M5RA 3JSXA 4OQQA 3DDOA 2IPNA 1MQ9A 2PXHA 4J1TC 4K2AA 4M46A 3ZCTA 3AOEA 1YVEI 4XFKA 5C35A 2JLUA 2R0QC 4A8JA 4AY2A 1ZI8A 5ALEA 4DEYA 1KJQA 2ISCA 1CQJA 5D8DA 4CKWA 4MWOA 1ZU4A 4IIXA 1NNI1 4YN3A 1WTCA 3V1LA 3TZEA 3GUYA 4NP6A 3UWPA 4KQCA 2OK7A 1U5BA 1T2VA 4NJMA 5T64A 5AOVA 4RNDB 4A9AA 4LQLA 1FNCA 3UWSA 1J70A 2Q5EA 3MOIA 4LJAA 4PLZA 4MA5A 1RHUA 4M7WA 4E03A 3P5SA 2VNJA 1Y6JA 2QW0X 1T0BA 1MC4A 4I2NA 2ZB8A 4K86A 4QLOA 4LY9A 3WLIA 5JS2A 3JQ9A 4MR9B 1XDWA 5J2UA 1JBQA 4RY8A 3USZA 1MB9A 1ZUHA 3EDRA 3H6GA 4QXAA 4CM1A 5LLTA 3AM1A 4J9VA 5L4NA 3KZMA 4JHLA 2WTBA 1S3GA 2D0IA 4FYKA 1LC3A 3KQPA 5C32A 5B1SA 3JX9A 2W43A 4EGAA 3BJRA 4KQHA 4CIBA 2WYUA 1WV1A 5DVZA 5IT0A 3D3EA 3RSGA 4ITRC 3DE1X 3QI2A 4Q3BA 2FVXA 5K0BA 3SF8B 4ROSA