4DAEA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 6-chloroguanosine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
232
structure length
232
Chain Sequence
MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase deoD-type
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 80
structure length 232
sequence length 232
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4daeA00
1A9PA 4IP0A 4M3NA 4PR3A 1Z5PA 1Y1RA 4MCHA 2OECA 3BL6A 5DK6A 1PKEA 3F8WA 1RFGE 5I3CA 1C3XA 3O6VA 3OPVA 1Q1GA 4L5YA 1ODJA 1PR5A 3KU4A 4DA6A 5B7GA 1OTXA 1V4NA 4LKRA 1Z39A 1SD2A 2HN9A 4BMZA 1JE1A 4F2PA 1N3IA 2I4TA 2QTTA 1Y6RA 5FAKA 1CG6A 5F7OA 1JE0A 1V2HE 3NM6B 1RXSA 1CB0A 4R2XA 4WKPA 3OZBA 3IEXA 1U1EA 3C74A 4D9HA 1PF7E 3UT6A 1A69A 1K27A 4GMHA 2BSXA 4MCIA 3INYA 3OOHA 3E0QA 1RXYA 1U1DA 2A0XA 1PK7A 1T0UA 4TS3A 3KHSA 5EUBA 4TXJA 4DA7A 2P4SA 3GB9A 4RJ2A 3QPBA 3FAZA 4I2VA 3PNSA 4U2KA 1A9TA 2OC4A 1Z5OA 2IQ5A 2A0YA 3ONVA 2AI3A 3KVRA 3FOWA 4DA0A 4TTIA 1YR3A 1V45E 1PBNA 3BSFA 4X24A 1LVUA 4QEZA 3KUKA 4OGKA 1YBFA 1OVGA 1T8SA 2AI2A 4TYMA 5CYFA 3IOMA 3LA8A 5IU6A 3ENZA 1TCUA 4D8YA 3FUCA 3EUFA 1VMKA 3GGSA 3NM5A 1V3QE 4QASA 2RJ3A 1RXUA 1B8OA 1Z35A 3EMVA 4M7WA 3T94A 4F3CA 1Z37A 5B7PA 4D98A 3DP9A 5JPCA 1RT9A 1RCTE 1SD1A 4DAEA 3DJFA 2OXFA 1V41E 5EPUA 1ZOSA 1JDZA 3K8QA 3K8OE 4BN0A 2A8YA 2PGAA 4D8XA 4GLFA 3D1VA 4NS1A 1T8RA 5CCEA 4OEHA 3MB8A 1A9OA 4YMLA 2XRFA 1TGYA 1JDVA 1ODKA 1JDTA 2QSUA 2OC9A 4E1VA 3E9RA 4F1WA 1K3FA 2HWUA 1JYSA 1M73E 3FNQA 3BJEA 3OZDA 4TXLA 4KN5A 3UAZA 1RXCA 3KVVA 4LZWA 1T8YA 1YQUA 4L5CA 1RR6A 1ULBA 3P0EA 4LNHA 3UAVA 1U1CA 4TTAA 4MARA 4BMXA 1ECPA 3PNPA 5CCDA 2GUWA 1JPVA 4TTJA 1PK9A 3LBAA 5C80A 3SCZA 1PR1A 5KB3A 1Y1QA 2I8AA 3UAYA 4NSNA 5B7QA 4K6OA 1Z36A 3OZCA 1I80A 5B7NA 1VHWA 4GKAA 4P54A 3PHBE 1NW4A 5ETJA 3ODGA 5F78A 1A9RA 4G8JA 1Y6QA 2QDKA 1OTYA 4OJTA 1OV6A 1FXUA 4ECEA 1PR6A 4TXMA 4DABA 1ODLA 4EARA 1YQQA 4OY3A 4FFSA 3OZEA 1LV8A 2ISCA 4LNAA 3OF3A 5EFOA 4QATA 1B8NA 2A0WA 5F7XA 3OOEA 1RSZA 2H8GA 1WTAA 4DAOA 3UAXA 5K1ZA 1JDUA 5CYGA 1PWYE 4JOSA 3FB1A 3EUEA 4TXNA 5CXSA 2AC7A 3P0FA 4JWTA 4GLJA 1RYZA 4TXHA 3U40A 5F76A 3DF9A 1TGVA 3NBQA 3E9ZA 1Y1TA 3EEIA 4H1TA 4G89A 4WKCA 2HRDA 2QPLA 4NY1A 1PW7A 2Q7OE 4OGLA 1JP7A 1TD1A 4EB8A 3KVYA 4YJKA 1QE5A 4WKNA 1T8WA 1VFNA 1PR0A 3DDOA 4JP5A 4G41A 1PR4A 2ON6A 4LDNA 2AI1A 5CXQA 1NC3A 1PR2A 3DPSA 3BGSA 1A9QA 3O4VA 3OCCA 4QFBA 4UC0A 1LX7A 5F73A 4OF4A 1OUMA 1SJ9A 4WKBA 1Z38A 1Y1SA 1Z5NA 1TCVA 1XE3A 4F3KA 1ULAA 1V48A 3TL6A 4YNBA 1VHJA 4R2WA 4BMYA 4R31A 5F77A 2QTGA 1A9SA 1K9SA 3LGSA 3NM4A 3PHCA 4DA8A 4DARA 3MMSA 5IFKA 5F7ZA 4L5AA 4DANA 1U1FA 3FWPA 1Z33A 1NC1A 2B94A 1YRYE 4TS9A 4D8VA 1G2OA 4QAQA 4M1EA 1OU4A 1ODIA 3UAWA 2HSWA 1ZL2A 5F7JA 4QARA 4WKOA 1SQ6A 4PNPA 1U1GA 1JDSA 1Z34A 4YO8A 4F2WA 4L0MA 4L6IA
chains in the Genus database with same CATH superfamily
1IEXA 1TUEA 1UXJA 4JSTA 3LHSA 4ZDWA 3KXIA 3MVEA 2QUZA 1NBME 1X74A 1U31A 2Q6KA 2NGRA 2OZLA 4GWLA 3SE7A 5JUWA 2XYQA 1JBEA 2PCLA 2AVDA 4DCGA 1QO0D 5KAPA 2E7ZA 4N3AA 1UPAA 2QUBA 4YI3A 2AXPA 1KYVA 3ONEA 4JFRA 3TRFA 1QKKA 1AURA 1PZEA 4P6VF 4CMIB 5AW1A 5IXJA 1XNRB 3HCBA 2J0UA 1VJ0A 2XR1A 1B0AA 1WMBA 2YRFA 1OXBB 1YS1X 1HYHA 3AI1A 4MWGA 5SY6A 3VR5H 5CT5A 3WRXA 3ZE9A 2P9TA 3DVSX 2FWMX 1YZYA 2R66A 3Q3VA 3NTLA 3TAHA 3USCS 2FV8A 4FK8A 2DH6A 3DOOA 3EC7A 4C0AC 4Q1AA 4IIJF 3MUEA 3H7IA 1BWQA 2RAVA 1U8CB 4IJMA 4P4GA 4L50A 3EXFA 5AVKA 4ARIA 2EQ5A 4F3NA 1C41A 4Y0VA 4BDSA 2G28A 5M7EA 5JNRA 1C29B 4JB3A 2RBGA 3WOHA 3UHAA 1E89A 1O6CA 3ZWQA 3GFFA 4KR9A 1Q0ZA 1OBFO 4LYJA 3STTA 1B8PA 4TUYA 4LJKA 4Q4JA 1DJMA 1H3FA 4PLWA 4Z4HA 2H06A 1PHPA 2Z04A 3ROFA 2ZSDA 4YYEA 3H2GA 1QOZA 3R7DA 1C4WA 5EWLA 2WW8A 5BV8A 4H35A 4ZJZA 1NW9B 3VA7A 3B3QA 1U1EA 1AZLA 2CMKA 1ZH4A 4E5PA 5B5SA 4PBSA 2VQDA 2AW5A 4X3OA 4D56A 1XG5A 3A1EA 4LHXA 5CG1A 2AZXA 5FBKA 4KXFB 4EENA 4B76A 3C48A 2HA2A 4ML3A 4GMKA 1JNYA 1DO2A 1PL7A 1LU9A 1HGXA 3LLMA 3O94A 1EXMA 2NIPA 5H3LA 4HXYA 1D2NA 1SUCA 3DB2A 1Y8RB 1W0CA 2LCIA 4IHJF 2R2GA 5HKOA 2AD5A 3FDXA 4F6LA 1KS9A 1USKA 5FI0B 2R2AA 1VIMA 4PYMA 4TKZA 4D26A 3EPPA 1CDEA 4MEBA 1BXRB 3JZFA 3BIFA 4ARSA 4S24A 5HDQA 1PFKA 2JVJA 1PRYA 1R64A 2D59A 3RS9A 2WUDA 1QLWA 1XEWY 3RHZA 3QPBA 2NPIA 1E3EA 1WQ3A 4IDEA 4EW3A 4G5FA 3N6XA 3FZYA 1Z82A 2A3RA 3GJTA 1VCOA 4IXDA 2AMFA 1Z4IA 2NU8B 4E11A 3B36A 3A36A 3D6MA 4ZT4A 4O3MA 4BMOB 5C2JB 4QNNA 4YCLA 1T1RA 4GLLA 5DX0A 1PNVA 4J49A 1SCUA 4JGBA 4XD7D 2GZ1A 5HQ3A 3L02A 1KJZA 2BTQB 5FD8A 3ZC3A 1S9HA 2J45A 1RBZA 3PF8A 1LBSA 4G65A 4TMXA 4UDXX 4CFSA 1G8MA 3O4RA 2AI3A 4AKIA 1T3TA 5A3VA 2MYNA 1N7HA 3I9FA 3KZ1E 5K99A 4F8JA 4U6QA 1PBNA 1PZGA 3BT7A 4DY6A 2YY6A 1UKCA 2ADMA 3WRVA 1G5IA 1EAMA 1XMVA 4BX8A 4RTSA 3LM8A 1NMYA 5ICFA 4E2YA 1HR0B 1J0EA 2EG9A 4M1OA 1BJKA 3VJLA 5KVVA 3AWIA 4M0UA 1AHNA 4ZCMA 1D4OA 1SRRA 3LLCA 5AW2A 3IP5A 1IN8A 1WXGA 4TYMA 5KVAA 1Q0UA 3PGJA 3KR0A 1KYYA 1P1JA 4XWOA 1GQ2A 2WV9A 2A9RA 4KQEA 1ENOA 5IKMA 1E2QA 3PTLA 1Q19A 1E3MA 4Y9DA 1JFVA 1GARA 1I3MA 3LXMA 3OLXA 2PUCA 1G20B 1TIBA 4HO1X 3T7JA 2O2CA 1YUBA 3L6CA 4R1NA 5D1HA 5B6JA 3AP3A 2CXNA 1XK6A 4XR9A 1V3QE 2ZRGA 1EFPB 2RJ3A 2XB8A 5ITSA 4C4XA 2XUJA 2HV8A 3ZOZA 3MJVA 4H7EA 2X8JA 4LSMA 2OGWA 3LC2O 3OM0A 3M4XA 3CBQA 4TV8A 3RPEA 5EJ6A 5AJWA 4PIMA 2XWBF 3LS2A 3ADCA 4CTKA 1FDWA 3NDIA 2Y0PA 3BRWA 4ARUA 3T5PA 1LI4A 5JPCA 1Z4MA 5BMOA 1MORA 1RCTE 2Y76A 3EE6A 2A0KA 1SD1A 3EY9A 4OLBA 4Q4AA 2V7VA 3DJFA 1RQLA 2X14A 1NYLA 3ISJA 4MA4A 5EWMB 1H22A 1V41E 4Y2QA 5EPUA 3NT4A 5AHKA 1NW7A 3GEBA 4MRRA 1QGUA 1UOPA 4EBBA 4LYAA 5KOJA 4LGMA 5KNDA 3ZNOA 1GPYA 2BE7A 3S1AB 3ZWCA 2PANA 1ADJA 1THGA 3R9KA 1W52X 2GZRA 3SP1A 1BS1A 3DOHA 1JAIA 3H18A 2N42A 2BKXA 1M8FA 3HYSA 4OEHA 3PXBA 5IRCD 4EP1A 4FQ8A 3B1FA 3GY0A 4HMOA 4IHAA 2Q5FA 1E4VA 1SHZA 3QKWA 4A10A 4BU0A 5K7SA 2VRCD 2WVAA 4L0DA 4B4OA 4BFCA 1G17A 1Q0SA 1JDVA 4QBIA 1UJ5A 2H11A 2PUBA 3H5TA 4ROSA 4A7PA 1UT5A 5TARA 4C2TA 4R2IA 5AJXA 2O1XA 3NHMA 5EXPA 1U7DA 4DLYA 3FMVA 3W0LB 1H5UA 3ORYA 4YMSA 2YDYA 1TUGA 4LVNA 2JGNA 5INTA 3PEWA 3KC2A 4XAQA 2WJWA 1MVNA 1RPTA 2KSQA 4L07A 5IN4A 5JV5A 2LIPA 2EFYA 1WEKA 1KMQA 4NZ9A 2MSLA 5KINB 5IVHA 2F9LA 4QUAA 2OQ2A 1U7HA 4EELA 1GGKA 2BFWA 4NDNE 3T3EA 1BG6A 4BBZA 5FBZA 2ZWMA 4XIYA 3VXKA 5EHZA 1CNEA 5DNDA 4C5AA 1U2QA 1CY8A 1FPMA 4H0CA 3AUJB 1NZFA 4HH4A 4DV7B 4R7ZA 3M5DA 3BTOA 4NBKA 2C7BA 4S1WA 4AJ4A 1NP7A 4AROA 5FFNA 4GI2A 2ZTUA 3B9RA 1ICIA 5F4BA 3RVNA 4EPYA 5IULC 3PNMA 1DS6A 3TNLA 1BX0A 3LQ2A 1DBWA 5FL7D 5JSKA 3CF2A 2H2WA 3D0OA 4FJ0A 3SM3A 1IQ0A 1UXGA 4O0LA 1TVMA 1UKAA 1X80B 2LTAA 1IHPA 3IP8A 3N8GA 4G36A 4IG4A 2I6QA 5EYPA 5JANA 4NK4A 2Y0CA 3AY3A 3E8XA 3K0BA 1VGVA 2VXBA 2QU8A 3PT5A 1P2SA 3ICVA 3JQRA 4K6GA 1G4HA 4LF5B 3O8OA 2KJQA 4AZVA 2G7ZA 5IJZA 5FPSA 4FFRA 4U7PB 5FQOA 3W2GA 4CT5A 4KZPA 2J30A 3L4SO 3CH6A 4TTVA 2WJJA 3A6FA 3EC1A 3QELB 3O31A 4PZUA 2ODNA 4X90A 3WXBA 5JY6A 2OY0A 3GR6A 3IIEA 1FQWA 4V38A 5CIQA 4GVXA 1MT0A 3Q2IA 2QU7A 2XB9A 4TWJA 4UOZA 1DCKA 3V3KA 3LGAA 1NOKA 2IK8A 4XKJA 4P3YA 1FFGA 2JHGA 1R66A 1Y81A 1YJAA 2VJDA 2PMKA 3D64A 4MRMA 4TKVA 2XUZA 2GHTA 1K92A 4TZ0A 2YXBA 3K6KA 2UZIR 4E12A 4XJXA 5BORA 1VLQA 4G0OA 4LY0A 3RU7A 3UJ7A 4IKPA 3NALA 1DINA 4FYWA 1LLUA 4X9XA 3LH5A 5JALA 3KS9A 3NIDB 3BFVA 3CEPB 3DR5A 2Y9MB 4IIDA 3FKSD 1ADGA 4I1YA 3MJEA 3IOCA 4FIZA 5L3SB 3AK4A 1PS0A 3RARA 5JXWA 3CR7A 3UJ9A 1NI4A 1WNFA 1ZM7A 3NBYC 2FG5A 4JJ8A 4WDRA 3NVAA 3UB3A 3TD6A 5JWHA 4KQKA 4ZCPA 2CUNA 3T7EA 3E7XA 1RYYA 2X77A 3WAJA 3LKDA 4LV8B 5E2IA 2VBFA 3R7FA 3ZQKA 4ZJUA 1KFKB 2TECE 5D01A 2ENWA 1D2GA 3N7TA 1G3UA 1DC3A 2CF6A 2KPOA 1LV8A 3LWBA 3DMTC 1KU0A 4JEUA 2AQIA 5J2TF 3HKEA 4MUEA 5P8WA 4BWFB 5HS6A 3DONA 3SYMA 3D2BA 3D6AA 3F78A 5L9AA 1O1YA 1REQB 4PO3X 3KU1A 3NV9A 5E38A 5EFZA 2IX3A 3RF6A 4KLRA 3GVXA 4H4CA 3B53X 5HIIA 5LOVF 1GCAA 5ER9A 2X9VA 5H82A 5TF0A 4DR7B 4Z4EA 4H7KA 2A9KA 4U3JB 3WNVA 3DE5X 2CW5A 3PFKA 4XUDA 4YJFB 1Z74A 4R6WA 1YRLA 3REOA 4JHXA 3A6ZA 1NN0A 2NUAA 5DNEA 4Z86A 2Q2OA 3KLBA 1L1QA 3FYSA 2O57A 5C8XA 5AVWA 1ZCJA 3A0RB 4GF5A 4US2R 5KOHA 3OJ0A 4DTIA 2ZVJA 2UYYA 4DMFA 5SYMA 1SCAA 3NWOA 4K8RB 4EFNA 1EDDA 5BNZA 5H5JA 3GFPA 1PQPA 1BFDA 2HLPA 2VP6A 3JX9A 4RPJA 1XZ8A 5FYDA 1JPNA 2INGX 5DX8A 1Q1EA 1LC3A 2D8AA 4JOSA 1XPUA 4GPZA 1IXZA 1HEIA 4P7KA 4TXNA 2GM9A 2J6IA 4R1UA 4XWKA 4NE2A 3UJ8A 3AHJA 4MV3A 1PFYA 3VR1A 5K0CA 2CVFA 1EVJA 4I1VA 3B2EA 4Q3LA 3T95A 4CEHB 1JQAA 3PC8A 1X3LA 3ND7A 1MNAA 2DPGA 1N8SA 3M5PA 4UTXA 5AI0A 2DWQA 2HMUA 3W05A 3TW0A 4D4LA 4FDUA 4BBAA 1AM4D 1J0AA 3OIFA 4Q48A 3KQNA 4BCDA 1XK7A 4LDZA 3U3JA 1TZBA 3UB4A 4MLCA 5HE9A 1FQKA 5LKAA 3ZDBA 3ED1A 4PSDA 3NH9A 2UYCA 4DKJA 3BQNB 1BMTA 4ZREA 2ZTLA 1VOTA 5KYTA 1CUWA 2E6KA 5EVCA 3IVAA 3IUJA 2BKVA 4Q4LA 3RS2A 1ZP6A 3ERCA 1N0WA 1NMEA 1GYRA 2OCLA 3FRJA 3KR2A 3KV3O 4NAVA 1K2VN 1DPGA 1OXMA 2J46A 4PQGA 2VDPB 3W9YA 4ED9A 5AVZA 3SC2A 2QW0X 4XRGA 1MZPA 4FGWA 1DTSA 1Y3DE 4GAEA 5EP3A 4ER5A 4Y30A 3QKSB 4LZPA 1TTQB 1JEYA 1CJMA 4BQOA 2GMWA 1NU6A 1DFIA 4BGIA 1E7SA 1RHRA 4N4AA 3VHXA 3LPLA 1OAKA 1LF0A 1KVTA 7ABPA 5E2AA 4DG8A 1UXHA 3EG9A 3W5BA 4M6WA 1R0XA 3PNQA 4KDFA 4YJ2F 4Z6KA 3VNAA 2CYBA 4EI9A 5IYZA 1ORRA 5AUOB 5K05A 2E48A 1DBSA 2K87A 2P9ZA 2AR7A 1I3CA 3Q8WA 4KNWA 1Q14A 3G2IA 1RZUA 4FHFA 2DZDA 1TAQA 2WWXA 5CU7A 4MRAA 3O8QA 3NTVA 5FNVB 2UZ1B 1GXSA 221PA 3MAAC 1XQ9A 1A98A 2C4MA 3P9XA 4HWTA 4XWAA 2YWXA 3L1IA 1JHDA 2PSJA 1ZVJA 2JNWA 1J42A 2QG9A 5IAKA 1W49A 3BWXA 4A0HA 1N0UA 1YASA 1ZK3A 3JV7A 3FAKA 3RRFA 3IAS6 5KWEA 1LBEA 4WLNA 1SQGA 3KB6A 2BGLA 1BDIA 1ZSYA 1YK0A 4Z0HO 5KNBD 1H2EA 2QP3A 2J9FA 2WSBA 3RU3A 2F7SA 2QRQA 4J2TA 3TF5A 4ES6A 4QVGA 1Q2XA 5KAMA 5BN3B 2GETA 1F12A 5JW6A 1SVOA 2P7HA 3OCVA 4K2HA 3VX3A 2L19A 4CUJA 4BLRA 2ZIAA 5KYXB 3IIIA 5L3VA 3AY7A 3FPHA 4DJ5X 1N5OX 1CF2O 4V1CI 4YEDA 4BBPA 3DZCA 3SYKA 3JAMA 1TB4A 2VK8A 2WINI 4TVOA 5CW1A 3AUFA 1NBHA 4FHGA 4Y2TA 1XZJA 5CA0A 3AZQA 3JAWA 4BRSA 3WKDA 4MVJP 3ACCA 4MA0A 2WPDD 1DEHA 2R1VA 1X1QA 4N7RA 5ELMA 1NVFA 3U3XA 3VC7A 2WU3A 1MXFA 2Z6QA 4CEJA 2EP5A 2J0UB 3CNBA 4LOHA 1BKDR 4L5AA 4O2BA 4XSVA 1HEUA 2IS6A 1U1FA 3B6KA 4DLZA 5JNSA 3F8SA 2WSSD 2PSEA 3ETNA 3IXQA 4OP1A 1CD5A 1KI9A 2Y92A 1D2HA 3I0ZA 3VBEA 5CH5A 3WHPA 3FSRA 2HJSA 3DOIA 3DNMA 3WDMA 4LC1A 1KEUA 1UQUA 1IVYA 3LMKA 1H93A 3D7KA 2QD3A 3LY9A 4Q3BA 5IF3A 4IVQA 3VHQA 5CDSA 5JATA 4ZT3A 2EIHA 4Q4JB 1G6OA 2POQX 4BKPA 5KNDH 3VV3A 3VU8A 4WXEA 1JJFA 4BB6A 3IULA 1N1EA 3A2KA 3Q7QA 5H3HA 2HPVA 3M3DA 1GRQA 3LCUA 5EWLB 5IKEA 5EMNA 2W4QA 4K6MA 5MGNA 1E8NA 2YTZA 4YMWA 1M10A 3DMNA 4XX0A 4XIJA 3A28A 3DEHA 2YWGA 3EBPA 3IPCA 3WBBA 2OORC 3EHDA 5K0ZA 4LC0A 2Z1NA 1JG4A 2BFEA 2H0RA 4H18A 3N07A 4RF3A 4ASUD 4B9AA 4I1OA 1A27A 2E1RA 3AFMA 3WGTA 9ATCA 1TLFA 2PLFA 2YC2C 3G6KA 3QE3A 1I2BA 2VAPA 2WJZB 3O7MA 4GBJA 1DOAA 4V03A 4ZN6A 4NBRA 5CDFA 4MWDA 1J2YA 5K8JB 4C0QC 2AHOA 5FH9A 4TLMB 4GGMX 2C88A 4CM8A 2JFFA 4KV9A 5ISMA 2HCRA 4EIWA 2FFJA 3HNPA 1O95A 4JV5B 1XROA 3F8WA 3L6BA 1JKIA 5DNUA 3HU5A 3JVUA 5J63A 4XVCA 1EHIA 1NSFA 2HBZA 2Q3BA 2BSAA 3F74A 4MTCA 3B1KA 4F9GA 5I7RA 1OZ0A 2FLVA 1CRWG 4RJLA 2IYNA 2D2FA 2P3LA 3LK6A 3F3SA 4M9ZA 3PENA 3FFWA 3RASA 3FRIA 1TDJA 5I3ZA 3OQ6A 4L3OA 4G0YA 4DV1B 1QIJA 1J5XA 2GWRA 1RHKA 3WMGA 3AUUA 3ZE1B 1GTG1 3W5UA 5HJ5A 2A0FA 2HN9A 3HXPA 4WEQA 4ZVVA 1SCUB 5HQ3B 4R0MA 5ERYA 1VC2A 3R3XA 3BC1A 3PEFA 3ZGNA 1CUSA 2PQ6A 4OL0A 3PX2A 1UBEA 3HI4A 4NDZA 5FAKA 3C8MA 1L4LA 4JCOA 4B09A 2CUKA 5CX1A 4YRQA 3C45A 4EHBA 1XU7A 1UP4A 1NN3A 1RQRA 1MKYA 3SF8B 3MMNA 2VLIA 3CH7A 4H3KB 2BELA 3BMOA 3FI0A 4OHFA 4X6UA 4LTNA 3CBGA 4OQEA 3ADOA 4V0SA 4E88A 3KQLA 2RD2A 3FF4A 1CIPA 2IODA 3M4YA 3OLZA 4K40A 3LLVA 1DRUA 4K87A 4P3KA 4ZQBA 2XLBA 4BFZA 5KHOC 1J8FA 1VI5A 1B1CA 1HDEA 3WLNA 5THKA 2X41A 2ATCA 5E4JA 5A5EA 2BM0A 5K20A 1A04A 2FWIA 1VL2A 4IFIA 4UREA 1U9ZA 1HV8A 1U1DA 3KK0A 4X61A 3VOBA 2B34A 3WYAA 4Z4GA 1BKYA 3UGTA 4EG5A 1YJQA 4ITUA 1C50A 1DSSG 4J0FA 4Y6LA 1B43A 1VKZA 2X8JB 4TV8B 2QNRA 5JIBA 2NUBA 5FTMA 1ZN7A 4EGCB 2EERA 2G70A 2WHEA 5IM4A 2C84A 4NNJA 3X1MA 1L4HA 2R8BA 4YRDA 2A9OA 3GJ4A 1NXQA 1F6WA 3TMYA 1ZS9A 2OHVA 2QRPA 2FRDC 1P2DA 2C9DA 1A9TA 1BH2A 3AB3A 2W2TA 1J4AA 3V97A 3WGGA 5IZ4A 3AI3A 1N6LA 4Q4AB 5K3OA 4PNZA 1EUYA 2OZKA 1Z8HA 2QJFA 3B9PA 3NHUA 3PC4A 4MSUA 4QTZA 1DAPA 4O4HA 1RZRA 4PSVA 5K0BA 1KI2A 1Q1ZA 2ZU6A 4RJTA 1DQZA 4GPIB 4BY9E 4BL5A 4KAJA 5I4CA 3CE9A 4IIGA 4QL3A 1PJ3A 2YW2A 3FCAA 2EEPA 3NNSA 3BKXA 3M6IA 4BQQA 1DXQA 5THQA 5D6OA 3SEFA 3TLMA 1L5ZA 4M0KA 1ILEA 2Y77A 3EZYA 1QHFA 1XRNA 3J80A 2PMFA 4XQ0A 2GF0A 3K9QO 3KUKA 4BJ3A 3KJIA 4OA8A 4I3GA 2JGFA 2ZR9A 3QI7A 4P4NA 1YBFA 2XUOA 1E3QA 3LFTA 4DVGA 2X0FA 5F1PA 2EKPA 5AIAA 1L5HA 1HZZA 2DFLA 4IBOA 2PO5A 3SSAA 2VO1A 3A9VA 4M1WA 3K6SA 3IDFA 3LOUA 1COWA 1JZSA 2ORYA 4WXMA 2KMLA 4NZNA 4OAOA 1Y3CE 2WABA 1DC5A 3USES 4AMGA 3P1JA 1KVSA 1CSEE 4F2HA 5CFNA 5HE8A 3CX8A 3WC4A 5IZCA 3OCZA 1OA0A 3E8MA 1KSFX 2J9GA 4OXIA 2EWVA 5I7VA 2BF4A 3SKXA 1VG9B 2GPNA 2BGRA 1ZQ1A 4LECA 2JHPA 4HADA 1ML3A 2NU6A 2YH2A 1PP4A 4LMPA 4BO6A 2LR0A 4R8SA 4ZXPA 2XITA 2YJNA 1CFJA 2V0CA 3C8ZA 1A5ZA 2I71A 1SOVA 3JZMA 4IGEA 4OKSA 4R84A 4ZVKA 3RJTA 5H68A 1KOGA 3CRRA 1KJYA 1ZA2A 5CB0A 3T5DA 5I7EA 4QXQA 3LTEA 2C2HA 1XJQA 3SBOA 4B7UA 3IEMA 1V39A 2IZ6A 1M8PA 3ZWAA 4LV5B 3IXLA 4MPJA 2QN9A 4WDQA 5A71A 5EXDA 1JAZA 3PHHA 4YONB 1JG1A 2OAEA 3OMLA 4PZZA 3T1OA 2JJ2D 3OTHA 5FUVA 5EYPB 4DADA 3WAGA 2Q41A 3FFXA 4H31A 1DKOA 2VF5X 2XF8A 2XMCA 2HJWA 3QTTA 1VGRA 1HT2E 1PS9A 3KOOA 1SPBS 2FF7A 1N5KA 4MKXA 1TZKA 3CR8A 3RADC 2RAFA 1P74A 1V8BA 2QVBA 3ANXA 3H75A 3MMZA 3LQRA 4PPQA 3U44A 1CUDA 1XTBA 1UBMS 1ODKA 1DL5A 4L16A 5ALYA 5K0EA 1OH7A 4MYHA 3FW1A 2BZSA 3P9KA 4YK7A 4HTAA 4ATNA 2PUDA 4AF6A 1XIVA 4KQHA 3BWBA 1MH1A 5CJPA 4KK4A 2X9QA 2GBFA 1O6FA 4MIOA 1G7CA 4MRMB 4TKVB 5SZIA 4JUDX 4KZKA 3VKUA 4IIEA 4NCBA 1XCBA 1QX4A 4PQYA 5EJAA 1V43A 2NZVG 5JXIA 1D4AA 1NQUA 2WIBA 3EGDA 4GI3A 1T8YA 3ZDCA 1YQUA 4LFAB 2ZI9A 3W4JA 2P3OA 2CZQA 1I3OA 4JEMA 4IOMA 3T5BA 5CDUA 1CY6A 3WY9A 3P0EA 5LZ8A 5KU1A 1RMTA 1NI4B 5I6DA 1JQLB 4IRUB 1ZX1A 2QY6A 4DNFA 1BTOA 3DLAA 3HMKA 4UNQA 1RI5A 5IBRA 4J75A 2GUWA 2II6A 1KNXA 3IP9A 1QH9A 4WNCA 4D6YA 3RS4A 1Y5LA 1JQDA 2RGAA 3IAEA 4PLHA 1SBZA 1KRXA 4GE0A 4BFVA 2C31A 4M0CA 5ALXA 4F3TA 2JHCA 3UPUA 3VSDA 3HKEB 1MB0A 1FU7A 3W2IA 1QH1A 1S6YA 2WA1A 3H11A 3E5RA 3GNTA 1YJBA 4RD6A 2HXYA 5TF4A 3RIHA 2QLLA 4EQ6A 4IH4A 3K4QA 3LUCA 3MJDA 4CIAA 2NSDA 1GGVA 1MQ8B 1JJVA 2Z6VA 3OO1A 1T2FA 1QTRA 5LBTA 1J0BA 1P17A 4NOJA 2Q5IA 2ZUUA 5EC8A 4J6EA 4NCXA 3OZCA 2ZUVA 3PC3A 4MQMA 3BXPA 4H16A 2C83A 3ED5A 2NUAB 3A4VA 4CI9A 4H59A 5BV7A 3BXZA 1A4RA 1HDCA 1WPQA 1X39A 5B1IA 3RUEA 2Y8EA 1XKTA 3Q15C 2NTNA 4POAA 3B8HA 4P54A 3I9V1 4F72A 5I9BA 4ZZIA 3VRHA 5AVYA 5LU9A 2X1MA 3T1VA 2G5PA 2QW8A 2J3EA 5ETJA 4GP7A 4O1MA 2TS1A 1M6EX 2HLDD 2I6TA 1GU1A 2IZ7A 3CX3A 4UHHA 2YFHA 5B37A 5TSDA 2WTBA 4B1FA 3FCSB 4ZI7A 3MMXA 1XPRA 4FB4A 1OF1A 2P4HX 3LTNC 3EDRA 2C2XA 1D4ZA 1DLJA 4BJ1A 1W5EA 4DV6B 5DXFA 4F4HA 2DUMA 2VG8A 2NAFA 4OJTA 1XJ0A 2HLNA 2DM6A 4HGQA 1U0RA 5TMEA 4F3RA 3J81k 3UBTA 2OGUA 4LY9A 4RV9A 3ZU6A 3O73A 4TXMA 4EY4A 5HOQA 3NBKA 4YHHB 1EA7A 5KVSA 2ZSHA 2P2GA 4C3OB 2IIVA 1GQQA 3N5CA 4NJMA 3H5IA 2QNBA 2O2DA 2ZS8A 4C1NA 3AVPA 3PD0A 4LCEA 2IBSA 1M1ZA 3TIFA 1ETHA 3AKZA 3V4FA 4HGYA 1AQYA 3IAHA 4ZCSA 3ZU4A 1R12A 2IEBA 4JA0A 5A5FA 4S04A 3A05A 3OA0A 3SC2B 2RKWA 4FB5A 4BU1A 1GUFA 2X2PA 3HB7A 4E1BA 3W2HA 1WCV1 3SOZA 4LMBA 3T15A 1LKZA 2IIPA 3IAFA 1UZMA 4RHTA 3D8NA 3BH7A 3OHPA 3OOEA 3VOAA 1T13A 2C98A 2PGNA 1Y1LA 4PZ0A 3VHXB 5KSWB 5DNCA 1XFAA 2YWBA 2PMEA 2D0DA 4C7JA 3EG9B 3LQFA 1OHHA 1V25A 1E9SA 3KUDA 1T2CA 3QK7A 4BLQA 1TEVA 2QRGA 4K9KA 2HY7A 1QGZA 2M1ZA 2PA0A 1DWOA 3H9JA 3TRDA 5IYZB 4CJXA 3K9NA 2AXNA 2JEOA 3F96A 4E08A 1IWBB 2VCYA 2ZTSA 1S2MA 3KE9A 4FLFA 3VV2A 1HYQA 2GLUA 3O8QB 1GXSB 5CLFA 5FLEX 1GFIA 3D3JA 3M83A 2XWPA 1V71A 1THMA 3HVUA 3OIDA 5DGIA 3ZV4A 4RTMA 3V7YA 2VDWA 1T9AA 1W7AA 4K88A 1Y98A 1ZESA 3Q7RA 4QREA 1UAAA 4N3GA 4JOCA 4C0HA 4H77A 3TAUA 4EPRA 1CVIA 3B1WA 4MIKA 4Q7EA 1JDPA 1YCHA 1DELA 2BIFA 1H23A 2J85A 4JJKA 3L41A 2VDQB 4YX9A 5LQDA 1IOLA 2FJ0A 1ZVKA 3IAS1 1P72A 1KF0A 3A9SA 4REQA 3RIEA 1WG8A 3WGQA 2B8JA 4NATA 2WPNA 3NU1A 3DQZA 5EJMA 2C04A 2D1QA 3I1YA 3KAKA 4IJQA 3OU7A 4WE3A 3QNMA 2QYOA 2GK6A 4IO1A 5DXJA 5LP6C 3A6EA 1VLZA 2BEVA 3LPAA 4ND7A 4YPFA 1U3FA 2AN9A 3GZ4A 1WSBA 4FW9A 5B4VA 3IBSA 1CR6A 2OHFA 5EJ2A 3FPCA 4NY1A 1RD4A 5KCMA 5KTSA 4IGFA 3VZRA 1R1DA 3JAWB 1IQRA 4V0QA 4HP8A 3IDQA 2FZKA 3IA2A 2BVNA 2R1VB 4I5EA 1U9IC 1YJ5A 4QNRA 2QSZA 5EESA 5HR5A 3FMPB 3DLCA 3H4TA 3JASA 3VR3D 1BX1A 1DBVO 3N6RA 4CEJB 1ODFA 3A31A 3EN0A 5FWNA 2OCAA 2XY4A 5U4XA 1MPXA 2I4MA 3CLTD 3N8IA 1Y3BE 3O82A 3EXEA 2V3VA 4O2BB 1V8FA 1XZNA 2V6GA 1UL1X 1Y63A 3M1LA 3EAGA 3QUQA 2JIQA 4QG7A 3WS7A 1NR7A 3WGHA 1M5RA 3A9UA 2J67A 1IN5A 2VNKA 1QZ3A 2WF7A 2Y66A 4FQ5A 4D25A 1G20E 3WZMA 1OWNA 3S7ZA 5C1DA 4YECA 3ASUA 1AMOA 3HVKA 5HJ7A 2ZI4A 3WNQA 4RTPA 1PR2A 3LSYA 2O8CB 3SQXA 3PS9A 4KTTE 3V42A 1RVV1 4ZYXA 1C2TA 2C3MA 1OXKB 2H2IA 1DRKA 4OJNA 4CKCB 3ZD7A 4CI0B 3EDOA 1ND5A 1UBUS 3OQMA 5BSEA 4Z54A 3G9UA 3ANNA 3TNJA 3X3HA 1EK2A 1GJRA 4K03A 3ZUGA 2DBQA 4EWLA 1Y1SA 3GDWA 2EF1A 4WXRA 1GDDA 3ESZA 3AJDA 4HBZA 3BCUA 3HXMA 4XX0B 4XWTA 2IEDA 2XNJA 1D9ZA 3CF0A 1V5GA 5BR8B 5FBWB 3V2HA 2QK4A 2BFEB 3IT1A 2BHLA 1DAIA 1BVUA 2BUCA 4P36A 2Q0XA 5FL3A 1EWYA 5C1IA 3RQSA 1P2UA 4IX9A 5AOAA 3ETHA 3UK6A 2CXUA 2WICA 4BJ6A 3M5CA 5AJVB 4EM6A 1S3IA 4JVMA 1LDBA 3KWMA 4I3FA 1I9CA 2P65A 4QWMA 5JTTA 1IULA 2HSZA 3FCYA 1IQUA 1Z2AA 5CEEA 5A6VA 4CM8B 1GDHA 1VRCA 3WL6A 3FPJA 1BAPA 4AWBA 1L4MA 2CCGA 1U2EA 4AVYA 5HKKA 5ICSA 1Q1BA 2WQZA 4WOPA 1DKNA 1MEJA 3GT4A 4XASA 1UOEA 3AR6A 4PFQA 1J2EA 3IV6A 3R7WA 3LKVA 4CNBA 3FTFA 4JJIA 5FKJA 3O9MA 4JBXA 4IDNA 2ZT8A 3PGKA 2B94A 1YRYE 2PUWA 1ZMTA 3S0JA 1A2KC 3G2LA 2F48A 3UK7A 1JNXX 2R8EA 4H7FA 4R68A 4D0SA 2Z98A 4FYYA 2IBTA 1FFDA 1V5IA 1AK9A 3PJEA 3Q9UA 4J0DA 3FWNA 4RW0A 4XDGA 3FKJA 4DPLA 1Z4QA 2Y05A 1L7AA 1Y5IA 3VOSA 1XHFA 3AIIA 5SY4A 2I99A 2IXEA 5J4LA 4YRNA 4NMHA 3O93A 4KQXA 5DI3A 5CRIA 2GXUA 1T4BA 2I1WA 3C39A 1AGYA 1D2MA 1JDSA 2JANA 3CXRA 4PPFA 5CX1B 4DNXA 4BYMA 1QO0A 1Q22A 1BO6A 2F00A 3TEJA 3ABZA 3FCOA 3FE2A 3NWEA 1RYEA 4KMRA 3PQ8A 4N65A 5AI8A 4MGIR 4WD3A 5IJAA 1NQVA 4QQFA 2OMEA 3I64A 3PQ4A 1TF5A 5FWAA 3QU9A 4L4XA 3NHBA 4HLDA 3IILA 3V48A 4W6QA 5ALMA 2QAJA 4CT4B 2VJMA 3L0IB 1ZDMA 4MQ6A 3FHLA 2CNKA 2OESA 5DPMA 3OEYA 5CCXA 4L8YA 3AJRA 1HFWA 1CJTC 2ZBEA 3HYCA 4MTLA 5DDIP 2O2YA 5FORA 3HBJA 3IQIX 2H5JA 3IO5A 2XE8A 2OAGA 3JVEA 4IIVA 4BKRA 2P9BA 3BCRA 4Y1GA 3I09A 3FG9A 5JDCC 2FZ4A 3TOXA 2B3TA 2EXXA 4OU4A 4UULA 5A9TA 4ECAA 4CETA 1OZGA 1CUYA 1DXYA 4L5YA 1MIHA 3Q1KA 1N1GA 1L7DA 1RE0A 5D5QA 5EQJB 2FCRA 3MXTA 3IXMA 4IYRA 5KKAA 4D9KA 5JQGA 1U3UA 3ANLA 1EBUA 1OAOC 2BGJA 2P2NA 3K5WA 4FSDA 4M7OA 5TMBA 3GP8A 3C43A 1OXSC 2JHAA 3N70A 4R5MA 1MVOA 1OKKD 4R8LA 1GY8A 5B7GA 4F5EA 1XWIA 5AKJA 1KQPA 2E55A 3EVBA 5BPFA 1OX5A 2ZW9A 3VNQA 3TXXA 2P6UA 2XAUA 4X41A 4QICA 3SBDA 2OGSA 3LHKA 3TXAA 3IR7A 1E94E 1JVSA 2J5QA 4YP1A 4L57A 3QWAA 3ND5A 1V37A 4HNSA 4NP6A 1WO8A 2RGXA 4V2UA 2V6IA 3BGIA 1OFTA 3ZHZA 2XV1A 5B3JA 4BTLA 3DC7A 4CMGA 5KIAA 4KWHA 4RABA 3PFNA 3C74A 4QLAA 3UK1A 2CEAA 2GFHA 4HZGA 5KX5A 1MVLA 4IFEA 4LE1A 5AOBA 2CLDX 1PF7E 1JKXA 3O95A 3W8RA 1C9NA 2Y1KA 2YVQA 3G0DA 1L5HB 4MA5A 2GN2A 3ANMA 3B12A 5K4HA 1GPNA 3JYPA 4CM9A 4OI4A 3K6SB 1U81A 2N3ZA 2HNBA 2JCVA 3KT0A 2Q9AA 2I2BA 1TYAE 1XYVA 1Y7TA 4RWEA 4MI9A 5C8YA 4YAKA 4ILKA 3RG8A 4NK5A 4JBWA 2OWEA 4HNHA 2YVLA 1AQJA 5ARCA 1QRSA 4EAQA 3UHFA 4BKOA 5CIYA 1FQJA 4DDUA 3RAJA 2VBCA 1T3LA 4U0JA 1T34A 1RJ9A 3OZUA 4FLEA 1ZEJA 4XD7A 4QPZA 3F0TA 1AOXA 1XZIA 3II6X 4RZ2A 5EUBA 1TM7E 1YT5A 4Z7OB 5JXHA 1KSJA 2NU6B 3HHPA 3HO8A 4ZOBA 1EKXA 3VZPA 2QRVA 4WOKA 5DEIA 4ZYUA 1U2PA 4I2VA 1NBWB 3T5TA 4YRFA 5EXSA 3SIXA 1QIIA 4RKQA 1T2DA 1Z6TA 1TQ2A 3MCWA 3CKYA 3KUCA 2G3YA 2O3TA 1T91A 2YZ7A 3IQEA 4RHFA 3UHPA 4LA4A 1ST3A 3I28A 4XUCA 1D7AA 4J07A 5BSUA 1QYIA 1Y3IA 2ZXUA 3RK1A 1YOBA 4L02A 1ABBA 1FNSA 5A4FS 3UK0A 3ONVA 1FTWA 5JYDA 5COQA 1T2VA 3VR0A 4PN7A 3ECCA 5DT9A 1ZKMA 2ZI6A 3C7KA 4ND5A 4AJOA 4D0GA 4XYMA 4B3JA 4NV0A 4RJKA 1FFYA 4YJ3A 3QVGA 3WLRA 1IBKB 1JF8A 2ZRHA 1KAGA 1Z4NA 3D0KA 2P6PA 3PA8A 4B7CA 3AGQA 4NCAA 3AG5A 2QL7A 3R75A 4PIPA 1Q15A 4CZ2A 1H9CA 3VYSB 1T8SA 3NYIA 5F64A 2NO6A 1UWVA 2VHVA 4TZKA 1JXAA 1DFHA 3OZSA 1BROA 1T2NA 3V2IA 2A9JA 4D8YA 3FUCA 2HJVA 3L7JA 1VSBA 3DT6A 4UATA 3SU8A 3MMPA 1DEAA 2EHJA 3R5FA 3N5KA 3ZZMA 3MT9A 4P5DA 4LFCB 2LV8A 4LWQA 4PSAA 1P91A 3SHFA 1M5UA 1ARZA 4CG1A 1MV5A 3I5AA 5AR1A 4BFYA 1B8VA 1C0IA 3HB9A 4ZQEA 4X71A 4ZOLA 3R44A 3L6UA 3EGDB 5K8VA 1D6NA 3FHTA 1KMIY 2QTFA 4N9QA 1E77A 1R9MA 2PFGA 2VT6A 2CL0X 2WG2A 1EGAA 4MVJE 1GPLA 4PONA 4S35A 3SLRA 3HSSA 4EMUA 1W9HA 4RGQA 4TYNA 1KVRA 2AFVA 2VDUE 1XLUA 3VVLA 1D3AA 4PSCA 3ICEA 1M3SA 2IXGA 1SVWA 1I4EB 1VSVA 2WKWA 4FFMA 1F7VA 4DN6A 4W5RA 2BFDA 1QR6A 3QF7A 4UXIA 1XCLA 2VRCA 4TT3D 5CT8A 2ZSFA 2WP0A 4MO2A 2Q3JA 4D8XA 2CK3D 3S8YA 1L5WA 2TRSB 1KEWA 1X9IA 2GLXA 4LGCA 1UM9B 4Q21A 1DKRA 1W0KD 1M2VA 1PBTA 1Q3HA 4MUGA 7ADHA 2Q46A 3SZMA 3ZCXA 3GV0A 1PJQA 1KBQA 3BIWA 3NASA 4CQMA 2NMVA 1M67A 2ZSKA 3ONNA 2UZAA 3H11B 4DUPA 3E9MA 4EQ6B 5A0VA 1U3GA 1R6AA 4MP8A 5IDXA 5BSMA 4RX1A 1LK5A 3CF6R 3O8LA 4LJLA 3AKDA 3UGQA 2ECKA 2OMKA 2VXCA 3IMGA 3EEQA 3U09A 2R47A 4L76A 3CR3C 4EGFA 1SEVA 1EVIA 4DJFC 1QB8A 4RKWA 2V55B 2W6JD 4HYEA 3K72B 1QG6A 2NQ2C 5AHOA 1ZK2A 2AXEA 2ZXFA 4L4ZA 4BVJA 4AB1A 3IODA 3CG4A 2VPQA 4QXPA 3C6XA 4Z2YA 4U4AA 4CV0A 3FB4A 4L4YA 1Z06A 3FNQA 2W2NA 1YZFA 3QM1A 4S3MA 1TJYA 3R6WA 2K6GA 1CEYA 5CDGA 2I1QA 3RK0A 4HXFB 1PJAA 1F1BA 3UAZA 4DRXA 3WIEA 5SYAA 1OGYA 3AG6A 4BLUA 3G5TA 4W9MC 2LVBA 1SULA 4DGQA 4ZI7B 5IG2A 2QVYX 3Q2OA 2YN2A 4Q01A 4B71A 3GT7A 3HDVA 4FINA 1THTA 1O5TA 3KOZA 4L5CA 4LX8A 4PYLA 2G83A 4ROTA 621PA 2DLDA 3GLFA 3P9SA 4YRRA 3ORFA 5BWCA 2QTLA 2ARKA 2CSXA 1XQ6A 3MTEA 4BMXA 1AUQA 1PE0A 2YJ4A 4DF3A 5K4GA 3ZYZA 4DDKA 4EGQA 4PW0A 2H9AA 2PA3A 3TVYA 2C7OA 3JR7A 4OTZA 1T10A 4LDQA 4NJMB 3AEXA 1TT5A 3WJ1A 1ZJ6A 3I6IA 3M8KA 3GCGA 3Q3GE 3PPYA 1OMOA 4BEBA 5C80A 1KO4A 1HLGA 3AI2A 2PRZA 4QRDA 5C7LO 5JZ9A 2C77A 3HCEA 3KL4A 2YJ5A 2R8YA 4RBNA 4TV9F 5DW3A 4AG3A 4NPHA 4C0LA 4QPPA 5BQOA 5JVDF 3UAYA 4ENUA 5LDGA 3KOXA 3DCJA 1BOOA 3K6RA 4AN0A 2W48A 1SNYA 1YRQA 2JAOA 3A4IA 2HYDA 1G8HA 3A26A 1PCXA 3V80A 4ZI2A 3EGVA 1P7VA 2QZSA 4M86A 2F6RA 3LQ1A 1I2ZA 3GMTA 1F8GA 1JKJA 4RTLA 4AURA 3FKSA 2MCFA 2V5UA 3CLHA 5HYVA 3ND8A 1GTJ1 4RF2A 4IFBA 2ZDHA 2Q5EA 3GDGA 5ECDA 1CEEA 5B6IA 4LWZA 4JY7A 4J4HA 3C16C 4JLSA 3M6UA 1EWVA 2BV3A 4H7PA 3IELA 1BA3A 2Q6IA 2G7MC 3L1KA 2YWEA 4ZC8A 2G9ZA 2VDWB 1T9CA 4QU8A 3U60B 2JFVA 4AZ3A 5J5CA 2CE7A 4IL5A 5D5HA 1FS5A 4QHYA 1NJ6A 2H5IA 1GRRA 2DHEA 4DGSA 4U5QA 2DG2A 3ZX4A 3GELA 1H2YA 3AV3A 4W6ZA 5EWJA 2ABWA 4RQUA 2C20A 3N28A 1RKXA 1EMDA 4REQB 3ZWOA 2FLKA 5FTJA 3C98A 1K06A 2GESA 2D0PB 1R6TA 3D7RA 3OZEA 5TPZA 3V6MA 3G7SA 1XZCA 4QGBA 2DFDA 4FMCB 4G2NA 3IBTA 3Q0EA 3G1TA 3S8EA 5MHTA 2G0AA 1U9CA 2BEVB 4LXTA 4QDZA 2OB1A 5DNAA 1UT6A 3SC3A 2IKQA 2FRVA 2HYIC 2JLVA 1YRBA 4QPDA 3DO8A 4IX1A 4WASA 1G21A 3ASZA 1XGKA 4D6XA 4KH1A 5ECYA 2XCOA 4LZAA 5JSYA 5IVIA 1XI2A 3EULA 4A0GA 1MRSA 3F6CA 1KYXA 3DAGA 3JASB 4YI5A 1AH2A 3C1UA 2V3CC 5G4KA 2DERA 1VRWA 5EI5A 2H7VA 3DWFA 4DUYB 3N0WA 3EXEB 5BVGB 4F9FA 4PYIA 4IFTA 2IGBA 3DD1A 3JQFA 1N8NA 2WUFA 1ZD8A 1OLOA 1QP8A 1AGNA 3O8DA 3BBLA 3H2BA 3NEJA 4EY7A 4YFYA 5LQJA 2BI4A 2H1HA 2ZULA 4FN5A 3OE7A 4RY8A 3P32A 4RA9B 5EL0A 4ZEOA 4C0WA 3SVTA 3B70A 3UMCA 2NU9B 3LRXA 1GPJA 4EITA 1T35A 5DISB 4RLQA 2J3MA 1U0SY 4JLKA 5LIRA 3IL2A 1YRWA 1EXNA 2PSFA 2XRYA 3O2NA 2KYRA 3OPMA 4JDUA 4K26A 2QYSA 4PNHA 1QCCA 2WWGA 1UK9A 2I67A 2WZCA 3R0XA 1AMUA 3N7UA 3IFSA 5GOTA 4HWPA 4UE2A 4MV5A 4GSLA 5GM1A 4WCVA 4JVOA 1FVFA 3CCFA 4TN5A 1QNLA 3PEYA 5I4IA 1SKBA 3GVHA 3MC1A 4GZLA 3CW2A 2LRHA 4OSPA 1SK8A 4YRCA 3E9ZA 5SZHB 4EB3A 1DPFA 1TEHA 2PL1A 2EAUA 3WBJA 5BRAA 4UOEA 3GFBA 3ACBA 2ATEA 2PS1A 2YJ6A 1PG0A 4ND1A 4WNYA 1IZZA 2CC2A 2V58A 2W0SA 3IBCA 3MGGA 5EJIA 2OO5C 3TI7A 4X44A 4DEVA 2VSXA 1S2OA 4B6GA 5TGZA 4JBIA 3FDJA 1FW8A 1JSZA 2AQ8A 1Z6PA 3PIIA 1WDKA 2YJ3A 3LD9A 4D2IA 1XCOA 4LVUA 1BNCA 4HAXA 1QE5A 1I5OA 1AV7A 2C9OA 1M1UA 4FYHA 2BBOA 4G5XA 3R7WB 1SHTX 4XQEA 4OQYA 2B4RO 4CKXA 1LSOA 3OETA 2JJ1A 4PX3A 2PRJA 4P86A 2E5LB 3O8NA 2W8ZA 5KNBA 2VJPA 4UTPA 1W85A 4XYBA 5BP7A 2TYSB 1W76A 2FFHA 4G3XA 4AMVA 2WTUA 4JBLA 3HKDB 4RZIA 2HEGA 4RENA 3RROA 2QTHA 4S12A 5B2ZA 3DPSA 4DLPA 5A1TA 2FFQA 3ST7A 1OW3B 3HFSA 4KK3A 4R2JA 1QE3A 3JQCA 4UEQA 4J4TA 3UJBA 2G1AA 1WB9A 1P1RA 2B4AA 2VDOB 1Z28A 1TM1E 1SZPA 4HK4A 2XUFA 5DYIA 1I01A 1PGNA 3JARB 2PTHA 3IQWA 1S3GA 2WTNA 3COPA 5DI3B 3WNCA 4YCCA 1I7QB 1WBBA 1PGQA 1X15A 2XDYA 1N2ZA 2A1TS 2WMDA 3RJ9A 1P5ZB 4EHHA 3OG9A 3U16A 3E3OA 2X2OA 3LL4A 3V8QA 1CUXA 2CFTA 3DOCA 2WPDA 1E66A 3H4VA 3HO6A 3LVRE 4NYIQ 1Q0HA 3L8GA 4UZFA 4YQYA 2FVYA 1XTKA 2EBHX 4WOJA 4DIKA 1JN0A 1GKUB 4B48A 4H7DA 3AGPA 3D1LA 1HTWA 2ZITA 5CLHA 2VJMB 3Q0IA 4E5KA 2CJWA 2QOEA 1NVEA 1YCDA 3TBHA 4IXWA 1VP9A 3RFFA 1T4CA 2VHWA 4G5OA 5BYAA 5LZ9A 3PHCA 4TL9A 3GBPA 5E9JA 5G40A 3U2QA 1V35A 3DZGA 4OLHA 2ZJZA 2WD7A 4O2AA 2FZCA 2VYVD 2ZYUX 1JJIA 3IUQA 3OM1A 2QORA 3ZS9A 4D02A 5F52A 4EF6A 3ADDA 1MAAA 2GA9A 3WBFA 5KQSA 4EPVA 2WKPA 1VJDA 2P9CA 5JQGB 2XOKD 4QA9A 1PEKE 3V8BA 2O7NA 3F4BA 1XUOA 2ACEA 2AN1A 3WK4A 4DA4A 2JAXA 2G9VA 3A37A 2ODBA 4KX5A 4TYPA 3REFA 1LPPA 1WDLA 2CLIB 4D8VA 3X1DA 3NYWA 2V65A 3CZRA 4JODA 1ZC4A 5TB5A 1GTSA 2FHPA 3DBIA 1YRHA 3QTLA 4M1EA 2QQGA 1DC8A 2JAHA 3ZGOA 1FY2A 2OBFA 2X19A 2AG8A 1U0TA 3BK2A 1O89A 3DL4A 3OUZA 3K0HA 3OAAD 4G1EB 4PG6A 3NPMA 2BRUC 4HATA 4XIIA 5AI9A 1S4QA 5DLQC 3N0VA 5EE5B 5A7GA 3L8HA 3AR3A 4DLRA 1WXDA 3ZOKA 3ZCSA 1WZIA 1Z08A 2R8ZA 3EZGA 3U1BA 2IP1A 2AUMA 3EXHC 3KKEA 1O95C 4LUCA 3NHLA 4MYDA 4OJKA 2NT4A 2YIJA 4UNNA 1H0SA 1YS2X 4FCCA 2O19A 3HACA 4UCQA 2FN9A 1NVTA 2GN4A 2H7CA 1ZD9A 4L74A 5DYYA 5KX5B 3RUDA 4E2XA 1ZM3A 3SEZA 3WLAA 2AJTA 2OHGA 3A4MA 5IUJC 4DMHA 2XT6A 4ZYYA 2JJYA 5IJWA 1PJLA 1V3VA 4K9DA 3QMMA 1Z45A 1DCFA 1FFSA 1A97A 1DBIA 1MGPA 3ILXA 3E48A 4ZFNA 1XLVA 3IMKA 5KREA 1DAKA 5C8YB 2AOUA 4FHCA 3CISA 4XARA 5A6SA 4LF4B 4X84A 4GOKA 3JQ6A 4M88A 3G0OA 1R8XA 2IPMA 4JLWA 2FW9A 4J16A 2G8LA 4H15A 3EPHA 2O3QA 1FU8A 1HLPA 4RK6A 1OLXA 5SZKB 2G9QA 1DIGA 1Z0IA 1MAUA 4X95A 5LBUA 1P1HA 4IXNA 3QVUA 2RIPA 1ZVQA 2BWJA 3KKKA 5HA5A 2WYWA 4V0LA 5LA6A 1T1EA 3PUIA 2ZIXA 3AVOA 1H8ED 2XYVA 5JAPA 1V4NA 2NO5A 2H5EA 1XYGA 3K9BA 2QMZA 1MD9A 1SD2A 1TOAA 1T36A 1SXHA 2VDMB 3VO9A 3NRJA 2X5JO 3F67A 4Y1FA 3HBNA 2F2TA 1Q50A 5EEGA 4CE6A 1JE0A 1GUAA 3GU3A 3OCWA 2ZJ0A 3F3YA 5L7YA 3RRMA 3B1XA 4BNWA 3NZEA 3CNNA 1ID8A 1KQNA 4P0QB 2V1XA 3ZJ4A 4LQ4A 4O63O 4WKPA 4N48A 4YJ3B 4CMKA 3QVGB 3HKBB 1VE1A 2YIVX 4LY6A 1UPTA 1JA1A 2HZ7A 2ZQYA 3L6EA 3Q5DA 1FFBA 4GGPA 4IW3B 4Q3NA 2FZEA 4D4GA 1YL5A 3C5CA 4RZXA 1AGRA 4I99A 5LP6F 1T5HX 3ZH2A 4BB0A 1W88A 2SHKA 1K7EB 1L7VC 3K3PA 3H0EA 4JVNA 2EIXA 4XIGS 1N6OA 1U4SA 3MCTA 1I3NA 3O3CA 2RHRA 2ZUBA 2X22A 3VJRA 4ZK6A 3A27A 4N7MA 1ZOPA 2N75A 5CPFA 1L5MA 3HPRA 3QVXA 2QMYA 3E58A 2PK3A 4P7BA 3ZNPA 1FXWF 4TXJA 3PKIA 4ZOLB 1DXHA 2CLEB 1IJKA 2QXTA 2ZIEA 5L3RA 3VMFA 3PNSA 2PXAA 4IJ5A 2HX1A 1K8QA 1HZZC 3H4IA 1A8SA 4MUMA 2Y1OA 4MR9A 1KDTA 1GIAA 1K7FB 2H16A 2BFDB 1I2CA 2G76A 4JLUA 2GBGA 3DEFA 1E9BA 2BL4A 3AEKA 2PKRA 3HQ4O 3RD5A 2QN8A 4BNDA 5J4VA 4L7VA 2Z9CA 5IZCC 2Q1XA 3EASA 4BE4A 1M2VB 3N2LA 2AUTA 4I6EA 4A82A 2REQB 4CQMB 3F2IA 1N9GA 4K7JA 5BMVF 4C7OA 3I5UA 3H9EO 3QLTA 3SLGA 4Q1VA 2NYVA 4D96A 4OMFG 3TD2A 3CVXA 4KXWA 4MQUA 4E5DA 1XNHA 3NCTA 2C3OA 5J4YA 3HR8A 1QZXA 3RIYA 2C8JA 3HDQA 3PSHA 4KVGA 5EJ7A 1OVGA 3NT5A 4K5QA 3G79A 5CYFA 4F96A 5JT1A 5JFOA 1W0JD 4M8IA 3PWKA 2JKVA 1NF9A 1L3IA 3MIIA 4OKNA 4MMYB 4HPWA 4PLYA 1SBNE 1ZZGA 3K96A 2WLTA 3A4TA 3NYRA 2F8TA 2Q49A 1J0CA 2XZTA 4M0DA 5D84A 4KQ1A 4LKOA 3AZOA 1AU9A 2XWQA 3L3BA 3IYLW 1G38A 2VC2B 1T9DA 1SO8A 1Z7BA 2PGLA 3CNEA 5HMMA 4D4JA 2JLYA 2H9YA 1G64A 1ISGA 3ABIA 2GOYA 3FJ1A 3QYAA 4U7JA 4DRXB 4AI6A 3MWEA 1T4GA 4FXPA 4F46A 1Y80A 5JAUA 2O59A 5C1OA 2FMHA 4I4NA 1ZL0A 3O3NB 1SXJB 4YYZA 4TYYA 1WY7A 1P60A 3MF4A 3RKSA 3GLFB 4C3UA 2OZPA 3O1HB 1XO1A 8ABPA 4FTWA 4LRYA 3L4EA 1NI5A 3G8CA 4EMTA 2PX8A 5MFPA 3R77A 4DAEA 4DJDC 2WAYA 4UM8B 4F5DA 3TTUA 1A88A 1WVMA 2FEOA 3NAMA 3BZBA 2BCGY 4LPSA 4LJ9A 3DAFA 5FPYA 1TT5B 1MFZA 1JR4A 2DSTA 3D1VA 5T8KA 2JHFA 4IQGA 5H1YA 5JCPA 2CHEA 2GZMA 1T8RA 1E92A 2VAXA 2PT5A 2H2DA 3CMCO 3KTOA 4N3NA 4ND3A 4ZRNA 4CXMA 1QO7A 2EKLA 1NJ1A 4KFUA 4BJHB 5DMHA 3ZVLA 2BEUA 5HRCA 4NMWA 2W42A 1G7RA 3NVKI 4OHVA 2CLFB 2IH2A 2NTVA 4CU5A 3EAQA 2IXBA 5DIFA 1O6BA 1MX3A 1GILA 4ESOA 3N53A 4LYYA 2VT3A 3BQ9A 2CVZA 3AFGA 1JLLA 3C70A 1JKJB 1DC7A 2VUHB 3U26A 4BO3A 3AKYA 3AL2A 3D2CA 1Y33E 2V9PA 1FDSA 1A7AA 1TO2E 4RM2A 5CNKA 5BUZA 1XHEA 2VCEA 4IIJA 4BO8A 5CDFE 1A4XA 1O3YA 3R6TA 4Q9IA 2KI5A 2W6MA 5KNBH 1CY2A 3L9XA 5SV2A 8ADHA 4DRYA 4NX2A 1M2OA 4PBRA 2QRHA 2D1RA 4M8SA 1SKMA 4I55F 3L92A 4P98A 2JFXA 1PU2A 1RDFA 3BUSA 3RFCA 4E13A 3AILA 2JFHA 1BGXT 3H1GA 2HK8A 4AZ3B 3TZBA 2OHJA 1LTHR 3ENVA 1M2KA 3R74A 2AN3A 3QH4A 4BASA 2Q6TA 4BX0A 4MARA 1I0IA 5DNWA 3EY4A 4RK7A 2RI1A 2JLUA 3W06A 2Q62A 4TTJA 1X8KA 5A3RA 1N6KA 5E2BA 4FDMA 4RGVA 3HM9A 4ZT5A 2F8SA 1L3BA 1GAQA 3R5HA 4CR6A 5JASA 3I4FA 1IBRA 3MZ0A 3SS7X 3QBVA 4GBED 5F5NA 3OOWA 4BUCA 3DE4X 5A3QA 3H97A 4UTZA 2X9GA 3KQUA 2DUUA 4XE5A 5EMKA 4YMVA 1ZLYA 2QRZA 4OLJA 1EJ6A 1VMAA 2JGLA 3GJZA 4IHJA 5KHLB 2JW5A 5ERGB 3T5AA 4NZPA 4B3MB 4BN4A 1PW5A 2DT8A 4CKBB 2OXEA 4V3BA 3THXB 1NX9A 2HLDA 2YBDA 2IP4A 4R8MA 2HJGA 4QECA 1G7TA 3JWEA 5LQCA 5LUAA 5G4KB 4Y2UA 3OJXA 2YR0A 3PXXA 4OXQA 2ZTVA 4E15A 2XCTB 5PNTA 5TRTA 1LS6A 2E6UX 5C4GB 1E2KA 3FHJA 3L0OA 4JYZA 5DWVA 3HA2A 3BGWA 1FBTA 1JAHA 2RMKA 3AUAA 4EABA 4I8DA 1XFDA 2IA5A 1UFKA 4HOYA 4W8OA 2CLHB 1XTVA 3P9QA 3RREA 3VAAA 4YP9A 2PHZA 4F7WA 3FRHA 4DZTA 2Q50A 4GHWA 3WSWA 3DYBA 4JYBA 4KXUA 5CB8A 3CEJA 3K5PA 2P27A 1P7PA 1IB0A 4HAUA 2WSYB 2AB0A 4QNMA 2B21A 3H6KA 1TUIA 1W36C 3FIJA 4K9RA 1C4XA 3KJEA 2EC5A 4RY9A 5LBIA 3Q7EA 4DCPA 1Z7GA 4FYJA 4OY3A 5C37A 2BH2A 1KIFA 3IP1A 4WLEA 4G5RA 3UXHA 1KAOA 3H1TA 1DO8A 4LISA 4WH0A 3U7HB 1V6AA 1XEXB 1YMUA 5LQKA 3QEAZ 4XVQA 4N03A 3U7RA 3Q10A 2QM3A 4CMEC 3L7IA 3KZOA 1L7EA 3BFKA 4DTCA 2VTVA 3I8OA 2I7VA 2AFHA 2C07A 1G6Q1 4X64B 4J0CA 2DU8A 3TQSA 1U3CA 3IQFA 4FC6A 2L82A 2IIQA 2RHJA 5AJYA 3C3DA 4BMNA 3KZCA 1WF6A 4UAGA 1IDOA 1IXYA 5F1KA 5ITVA 1V0JA 3ZIAD 2J0QA 1AS2A 5AVOA 2HU8A 4BVLA 2YCLA 4JR1A 5K3CA 3KYJB 1X8JA 2YASA 2YYAA 3TQRA 3B7GA 3HRKA 4N5HX 5ENZA 3Q9NA 3LUHA 3E9CA 1Y4UA 1ZYUA 1JAXA 1GRVA 3NR2A 1T9GS 3AEYA 3BMQA 1GKIA 1HY3A 5FFFA 4ZZ2A 4DLXA 1HE5A 1JDUA 1W85B 4AF7A 4NFLA 4IIHA 3TBKA 3VDQA 3Q12A 3O8BA 4YPVA 1WP9A 3TLJA 1Z3IX 2C2GA 2H92A 1P1KA 3I58A 2Q7XA 2ECPA 4LXHA 4MKRA 4TMWA 4W99A 5IBPA 4CQJA 3LZDA 4Q34A 2OHHA 1AQUA 1KPGA 2PL9A 2YNMD 3KLPX 4WZBA 4BAUA 4FMDB 1LDYA 1RQGA 2C00A 3OA2A 5FB3A 3D7MA 1Y4ZA 5EXXA 4BYGA 2H4ZA 3RC9A 1C9DB 1NHWA 3DTVA 3SZRA 4NNOA 4XDHA 1F8YA 1EA5A 2DUNA 4DBLC 1ZM4A 4XWWA 3U56A 4TM8A 3U40A 1C7FA 5KYYA 1F7UA 4ARVA 5EP2A 3M9WA 2AG0A 3QXGA 4MW9A 2EBFX 3UEOA 1WCIB 1R7RA 2EARA 3I12A 4P80A 3TFOA 4JMLA 3UICA 3IR6A 2LW7A 1X19A 3EEIA 3F1LA 1QHGA 1R9NA 2QTZA 1PL6A 3E3MA 3JD0A 4U7FA 3ND6A 1UDAA 3CVOA 1BCSA 1U0FA 2DETA 1QHIA 3L6RA 2EZ4A 2CJWB 4KDRA 4QU0A 1PW7A 4ZTBA 1XAHA 4IMRA 4U9HS 3WLOA 3KB1A 5P21A 5EIEA 5LM3A 3N0RA 1UBSB 3CU5A 1GCUA 1A82A 4GI5A 4O2AB 4CIWA 1MJFA 4R69A 3TZCA 2FZWA 3FPGA 2RH8A 2GM5A 2YMLA 3R9XA 4XWYA 1Q1AA 2OGZA 2Q3FA 2BKAA 4HNQA 3EPKA 1XF1A 5MDHA 5BMVB 2HHLA 1PR4A 3HH8A 3CZQA 3D3NA 3MA0A 3QGMA 4M37A 4OXKA 1GUZA 3GXOA 3L6OO 3NIWA 4RJIA 4J6FA 4EG8A 1PDWA 4FWBA 5GGYA 3AOEC 5CVEA 1F2UA 1GG8A 3TR6A 2PIAA 2YFQA 5K5EA 1CZHA 4ND8A 5LMNB 8MHTA 4P92A 4PIVA 4BNNA 5DTMA 3CGGA 1YMVA 1F14A 1YI8A 2D1SA 2P3SA 3LL7A 1WSAA 2QUJA 5K9ZA 3WGYA 4BHTA 1XTRA 3MRTA 3NH6A 4ZO6A 5E4FA 4YRPA 3GLQA 2FAXA 2ZB7A 2LDBA 2G07A 2P0YA 2B1GA 2HBQA 4K8OA 1C1DB 4PO8A 4UHEA 1C9JA 1KSHA 1UJNA 1SA0A 3E1GA 3F9RA 2EGUA 2V7EA 3L5KA 1Z07A 1S2DA 2GN8A 3IV7A 1TCVA 3EDMA 4S1NA 4EKGA 3F6YA 3EB9A 5AKHA 2QJTA 1E59A 4GOJA 4C2BA 1O94D 5DASA 1L5RA 4GICA 5BRNA 3W3AD 1MH9A 3DBOB 2W2OA 3WJ2A 4BZWA 3KR9A 1UWCA 1VHJA 2CE2X 3BAZA 3D3KA 3NHZA 3RAEC 5F77A 3B7WA 1N3YA 4E3ZA 4K0KB 3DFZA 1JBQA 5I9LA 1JZTA 1DKLA 1MAWA 4RGYA 3HCOA 2IH5A 2VLBA 4BNFA 4MJ7A 3CSSA 3NM4A 3Q4GA 1H2ZA 4ZQIA 3WGOA 5E6SA 9ABPA 2AOUB 4AUMA 3STUA 2OCXA 3EH2A 3F6EX 2DJIA 2FOXA 1Q7EA 5A6SB 4EB6A 4F1JA 4DR4B 2FA9A 2HREA 3L82B 4LQCA 4AYWA 2EG5A 3PD7A 4LW8A 1SXGA 3VHLB 5IVPA 5LC1A 4B6OA 2ZCJA 3R7LA 3FLBA 3A2LA 3IKLA 3TPCA 3V2GA 3F1KA 3I1FA 3ESRA 1M0TA 3LXRA 1OLXB 5AI6A 2VBIA 2LXNA 1CVRA 2FQWA 4MJ3A 1JA9A 5HCNA 1RKQA 3TKLA 2N1MA 4C6TA 3EPJA 1JQBA 1E8MA 3PUVA 3ZHBA 2IY8A 4JX8A 3GO4A 2HRBA 2IWRA 3TINA 4OLFA 4EOGA 5FBVB 4N0EA 2IVZA 5LA6B 2IP2A 1G2OA 2V4UA 1RLMA 1HZJA 1AKRA 2OG1A 4FCWA 4M55A 2P68A 1ODIA 1A50B 2QVZX 3AF3A 3QF4A 1WPXA 1NF2A 4WLFA 2TSYB 3PHIA 5SY9A 1T36B 2FW1A 2A5LA 4ZWNA 2AMYA 2D00A 3E4DA 4YV0A 5J2TA 1P31A 2HJ9A 2JIPA 2PMBA 3W5JA 2OBYA 4HNAA 2G80A 3RUCA 2BGMA 4HXGA 2GYUA 2J6BA 4MEAA 3RHFA 2C61A 3BD8A 3E53A 3T9FA 1NI3A 2I22A 3TFQA 1ZY2A 5LOVA 3AUKA 2YWHA 1H9AA 1WMSA 3WLKX 1QIMA 1UKEA 2R7LA 3NBMA 4YDSA 5TQJA 4JU9A 4JBHA 3IEPA 2NTEA 2H31A 5FWDA 2FZLA 2R6AA 3O4FA 1GLGA 5KYVA 1U0JA 4IEEA 3TSAA 3U7IA 1IH8A 1UXKA 1WTCA 2R79A 1V11A 3M49A 3DQQA 2PU5A 3V55A 1W88B 3U7QA 4O25A 3D43A 3WGVA 4HEQA 4D4IA 4IDOA 3D4BA 3TRJA 2YVUA 1NMQA 4PRYA 4QUEA 3DV9A 1F9AA 3Q9SA 1NY6A 1OKKA 4P33A 2OFWA 1WXWA 4I36A 1YI0A 1QGAA 3DMHA 4XQ9A 1YHYA 2HMVA 5HKLA 2N46A 5FTLA 5I3CA 1C3XA 3O6VA 3CIOA 2EL7A 1PDOA 1SELA 4CIBA 2CLLB 4PCUA 5TT1A 1MHTA 4CR8A 3ILSA 3KKZA 5T67A 1KDPA 3S2ZA 4AJLA 5T7BA 2IZZA 2J3JA 2FOIA 3EBLA 2ILTA 2YZKA 1IN6A 4MCAA 2W4IA 3T9DA 4Z2AA 1F0YA 1VE6A 3PNVA 1U2SA 3C6ZA 2PWYA 4QDTA 5ARBA 3HL4A 3QUCA 1AB5A 5ABPA 3CWQA 4MR9B 4B73A 3K71B 4Q15A 2FI1A 4F2PA 3O21A 1XEWX 1DEOA 2I4TA 3DM5A 3QVMA 1DBQA 4H27A 1EP9A 2IZ1A 4Y67A 5AK5A 2TMYA 4PS0A 3SJAA 4UCWA 3ZI0A 4BNDB 1CG6A 3GCZA 4U8GA 2FLWA 3COWA 3EZ2A 1GYQA 4PTYA 1RXSA 4WBNF 1CB0A 1N9GB 4BNHA 4R2XA 3QPUA 4OK5A 521PA 2DFPA 4C7OB 1IHOA 2IZOA 2BFNA 3BN3A 5GOZA 2YOFA 3LT0A 2A6PA 4TKMA 4HLQB 5B1SA 4HEA1 2VPWA 5TEVA 3KQYA 1GA1A 4ZQFA 2YUIA 1A69A 2GKSA 2XIQA 3RYHB 4ZDIA 3AUTA 5MF6A 4YJ2A 4EYEA 4P32A 3T7TA 4NYIR 3Q40A 5KKNB 2ETXA 1GZVA 2ZB4A 1KOJA 1M8GA 1T9KA 2IHTA 2QMEA 5FOVA 1Y8ZA 2ZYIA 3P2OA 4PRLA 3NOVA 4C03A 1KIMA 5JYEA 3QVLA 1E20A 5LN1A 3ZPXA 2WE7A 3LG2A 3HS3A 3K1AA 3QU5A 4P3NA 3R7NA 1RAAA 4RNCA 3U4DA 4E7OA 1LRLA 5DM60 2JCBA 4BQRA 5JNTA 1DQNA 1XVVA 1TLLA 2ECQA 3E9YA 4CMAA 1J1UA 2OO7A 3HXTA 2VTBA 3AEQA 1BQ4A 1ICEA 4LBWA 2YY7A 4AULA 3ZGZA 4QJ3A 1OI7A 2DQKA 3E7FA 4IQ8A 3S99A 1BE0A 4L9AA 4EJFA 1MLDA 1Q0RA 3ROEA 5K0JA 4GVLA 1CLEA 3FAZA 2Q4DA 3ZHOA 1C8VB 4RELA 3CRZA 5DTRA 1GPAA 3LBFA 3UT5A 3TRKA 1Z22A 1DIRA 4GR5A 4JD5A 3AM1A 2ISQA 4A0QA 4XYEA 1AZWA 1GYPA 1FOEB 3ZHUA 5B53A 2MMGA 5KKCA 3MT0A 2BFFA 3D4LA 4OBXA 1QOQB 2RONA 3VX4A 1EDBA 2G6BA 1QHYA 3HDHA 3S27A 3I04A 2H6EA 3C7AA 4KXXA 5DYGA 3GLUA 5DBIA 1UMBA 1P19A 1TMGE 2GBIA 3A9TA 1GFZA 3KVRA 3PXAA 3IEIA 5B1HA 4DA0A 3PBKA 4RTOA 2CSUA 4V0NA 1Y82A 3KQPA 2VOEA 4OHPA 1IY0A 3NNNA 3MRXA 5TVGA 4LXYA 2QZZA 3GRYA 4FFVA 2OFFA 2O0MA 3T7SA 1OV4A 2BEUB 4EUNA 2BE9A 2QQ5A 3K0KA 3RQIA 2V6FA 3H84A 5CNMA 3VR2D 5AXBA 3UY4A 4CF3A 4D99A 3EARA 3GDHA 4FR5A 1V7PC 1LLDA 5DX1A 1BMDA 1F3LA 3F71A 1KZYC 1IOWA 3ESYA 2XB6A 3BF8A 2RGWA 3F6PA 3K0AB 3R3WA 1CE8A 2GVNA 4JP8A 4LCJA 3VH4A 3R0ZA 5JAOA 3ZD8A 2ZYSA 1JLLB 1QHSA 2GN1A 3NC4A 1F60A 2JCXA 2PZEA 2G9NA 3LP5A 2UXBB 2FK8A 3FJYA 4N0QA 1QV7A 2PEZA 5F9FA 4IIJB 2PLWA 1ZIXA 1E58A 1MXHA 2ACKA 3UAGA 4AKEA 5HW0A 2Q1TA 4UHDA 2WT4A 1QVZA 1MB3A 5LZ2A 3V46A 1XMXA 3L8MA 3CLUD 3QEBZ 1M2OB 1DU4A 4ENSA 1AHHA 3RTBA 4G1VA 2JKYA 5K3BA 4MDYA 3D59A 2JIMA 3U48A 4JI2B 3EH1A 1EFCA 2CK3A 3G6WA 3QQ5A 1PVVA 4Z51A 3LVBA 4A91A 2DUWA 1MO4A 4YJGA 4FSXA 5ADWA 4PC3A 3RIGA 4EKNB 2OBNA 2XTAA 4AKSA 4UM5A 1PZXA 5LCXA 1PUIA 3ZH9B 1UT8A 1IK4A 3R8FA 3GEMA 2FWAA 2V96A 2DSNA 3SNKA 1VLMA 1M6VA 2FJPA 2G82A 2GF9A 2P0EA 3GJXC 2A8YA 4KKVA 5EEHA 1L7RA 4GU5A 3WYGA 2YQZA 1P0PA 3SX2A 1TT7A 1EFVA 1YSCA 2W6JA 3EIUA 3FTPA 3UWDA 5DRTA 3HFRA 3AQ4A 1VA4A 1P2BA 3PFHA 5D7NA 2O0HA 5EUCA 1A9OA 4Q82A 1N75A 3QFSA 2XMGA 3AU8A 2BGNA 1ONOA 2YXDA 1TCCA 2D7JA 5BT9A 3V8PA 5JNWA 3SM9A 1UDCA 3F2VA 4IHJB 5FPHA 3W8FA 2AR0A 4DJTA 3B6IA 4DNOA 2DR0A 5DOVA 1SKQA 2O07A 5DYNA 1NOIA 4IJVA 3JYLA 4K1XA 1LJ8A 3GCWA 3LUAA 3TW4A 4EO4A 1QPZA 2OC9A 4MGZR 4E1VA 5A2QA 5LMZA 3N76A 4E07A 3HR7A 5BUQA 3UMRA 1EX7A 5ALTA 1JYSA 1K3TA 3QHPA 3FOCA 1YDWA 2VJNA 3BJEA 3QG1A 1UCFA 4TS4A 5AKYA 3U9SA 4TXLA 3R1IA 3LBHA 5K0LA 3ZV6A 2F8MA 2J3DA 5TV2A 2QTCA 2W9XA 1CDZA 2PR2A 3NXKA 4HJXA 4OKIA 3NPAA 1RXCA 4KWIA 2W5UA 5AHRA 2YV2A 3FBWA 1E2GA 3I05A 1CQJA 4N3CA 4H0FA 4EG4A 2DWOA 3OX3A 5IABA 1GT6A 3QBTA 4BCBA 2UYHA 1CR0A 4QIHA 1OD6A 3UYLA 5AVRA 1GPDG 1Q74A 2BDEA 3L0BA 3UAVA 4Y1RA 5GJVC 2YY5A 4X6LA 4X1IA 4MW0A 5F2OA 2IU6A 1S02A 3A10A 3PYXA 4ITRC 4L5IA 2C9YA 3KHKA 4MQ5A 5IKOA 1OFIA 2FPKA 3DULA 3LUFA 3MS4A 3PRYA 1TVCA 1ZOLA 4KOAA 3UAOA 1XALA 5EZSA 2CL6X 1M1YA 5EZQA 1JDBB 3PICA 4QO7A 3PDIA 1OJLA 1KI7A 1TJ5A 1WU7A 1OYYA 3FY4A 1OR8A 4MUKA 4CQLA 1RP7A 3H5LA 3U49A 3H0CA 5DN6D 1Q7TA 1ISFA 3SSMA 3MJCA 4D3FA 2AFHB 4TLDA 1FYFA 5A5VA 1GTL1 1SUWA 3H1AA 4A1FA 4JLJA 1Q17A 2EW8A 5U1PA 5B36A 2VHJA 3FSEA 3GJ0A 5D3QA 5AUQA 5HDBB 1KOFA 4FOTA 1CJUC 2JVIA 3P4UA 4LJYA 3FMGA 1D04A 3ZQ6A 2FR0A 5AESA 1K75A 4FMBB 1QCDA 4L9RA 1TQHA 4URYR 3PNKA 2WM2A 1SUAA 3GD5A 5BYKA 2HHAA 3QEJA 1PSWA 3DCYA 4JB2A 4W5HA 5IWAB 2P6RA 2GVZC 2WWWA 3I73A 3GQBA 4X85A 2ZIUB 4MPDA 5D7BA 2AC2A 5IEJA 1PQ4A 2AA3A 2PFKA 1LDGA 4NF2A 3BMQB 5JAIA 1OZHA 3G2HA 4FFWA 4V1CB 1DHRA 3ORHA 2VS1A 3J7TA 1X7XA 1Y3HA 1H69A 3ELBA 3V3TA 1IC6A 3NX4A 3GEIA 3UKDA 4PZCA 3KQVA 1I51A 2ZBUA 1K4MA 1PYOA 4J7XA 4YRLA 5AJHA 1X38A 5AVXA 2I3DA 5C8VA 2PDAA 4WZBB 3A3PA 3M6XA 4RK4A 4ENVA 3JS5A 2PH1A 2Q07A 1FXUA 3U4HA 3DTVB 2O14A 4HUQA 4IQ4A 4WFJA 3ECSA 2I4NA 4L15A 4X20A 3G17A 5BV2P 5KYYB 3QUBA 1MABA 2PZGA 3GFVA 1PGPA 3MOSA 4ITVA 1TCAA 1VZ3A 4ENPA 4ARZA 1PKXA 3D4IA 4LN1A 4DSAA 1DIOB 2HRQA 3JQFC 3GLIE 1RHMA 1RJWA 4KGZA 5DGTA 2Z3ZA 3FTQA 4YV2A 4AF8A 1EG2A 1WZEA 4QUGA 1BCSB 3QQPA 1C0LA 2I80A 1X1TA 3TG2A 2EJWA 3K9FC 5L6MB 2VN8A 1S8NA 3HPQA 4B85A 2OV1A 3QBEA 2SCUB 2XKAA 3LT4A 4UARA 5ILGA 3UJHA 1EG7A 3N59A 2CLOB 1UFOA 4F4UA 4KVAA 3VISA 1F5NA 1FLVA 1HI9A 3IHWA 4OOEA 4ACAA 5KTYA 4O5OA 2ZJ8A 6ADHA 3BMNA 2O0LA 2XE7A 3WA7A 4OQDA 4KSBA 1ZGZA 3PWTA 1T6ZA 2OXTA 3B89A 4YCMA 1JX6A 1G41A 1KP2A 3Q8XB 5IT0A 1QCZA 5K0SA 4YRJA 1E2FA 3G89A 1W2GA 4CLXA 5C5IA 3AVQA 1E69A 4WCFC 1HFJA 1C9KA 1EK1A 1E1KA 4G8DA 4L8WB 4BP9A 5LQMA 5IVKA 3IS3A 3OLVA 2X0KA 1H4VB 4DMGA 2H5LA 1O03A 4B46A 1C9YA 1R4NA 1YRAA 1SGWA 3HN2A 1STOA 4ND8B 3TCKA 2A59A 3BHIA 3S3TA 1F6DA 3JRNA 1NULA 1OWOA 4NZOA 2ZB2A 3E9NA 3Q9LA 3V4SA 4I6GA 4ZI5A 3ROQA 2H52A 2F55A 2X0IA 1NR5A 2A7XA 1EFHA 3AINA 4CIXA 4EBFA 3GUUA 1SOWA 2CUZA 1N2CE 1W48A 1QIDA 2SNIE 2WYUA 5A9SB 1APBA 3F8TA 3OJEA 3P94A 4L27A 2G40A 1QMGA 3QEMB 2PLNA 3UJ3X 3PV0A 2Z43A 3BK7A 4KYVA 4U00A 2PYDA 3I45A 4FFDA 4N5DA 3C3BA 4WLVA 3LX4A 5DFAA 2NUTA 5CFMA 4G9BA 2EJBA 2PLAA 2WKRA 3FNEA 1OXXK 2H4WA 2O3UA 2PUTA 1DC6A 5FCDA 3R4CA 4HFJA 4KWEA 3D31A 5AM5A 2RGNC 4MK4A 2XBLA 1NX6A 5JC8A 1YVEI 4F5ZA 3MIZA 3ZJ5A 4DQXA 4BATA 1H94A 1MO3A 1RLUA 1U5BA 4R1SA 4QDXA 4YAWA 1LNZA 2EU8A 3G2OA 3QE4A 3MEQA 4H08A 5E6SB 2I5PO 1VMDA 3BXXA 3NC1C 3WWCA 4BGVA 1VI2A 1NVGA 1SC4A 3P9YA 1JIKA 3DVQX 3GOQA 4H60A 1PEAA 4HNRA 4OUDA 4WKNA 3TPZA 3TDMA 1QE0A 4RXMA 3ZTYA 3DWIA 4F2DA 4C05A 4ZHSA 2NWQA 2WD8A 3NAQA 4CR7A 1AB6A 1NAHA 3KKPA 5IAEA 2JJMA 3RV4A 3DDOA 4BFTA 4DRZA 2QQ0A 3AESA 2GNOA 2ON6A 1K89A 2ZSEA 4ALNA 2ZP1A 4BV8A 2EFHB 2F3PA 1PJSA 2NUPA 2P91A 3OX2A 1QH8A 2I4LA 2QRKA 3HBFA 4MV9A 1AUXA 3IDAA 2HXGA 3WA6A 4KVFA 4ZQHA 2BBWA 2COKA 4OHZA 5A4KA 3NMUF 4OHYA 1V9CA 3IX7A 2JAUA 1JLHA 3CE6A 5DRYA 3QF4B 3INGA 4XM1A 1C3OB 1BRMA 2BMJA 4TRMA 3DXFA 1YZQA 2XOEA 2SKEA 4UD6A 2VPZA 4Y2PA 1FDVA 1R5BA 2GEFA 2DH5A 1ESNA 5J2TB 2GERA 3OCCA 1SXJE 2A3NA 3JSAA 4DQVA 3GLFE 3BKWA 4NWIA 3ANSA 3IBFA 4KI7A 4LJ5A 4Y6SA 5IBQA 1Z13A 1TQDA 4OHBA 4E5NA 2RCNA 5LOVB 5KPJA 5ECWA 1V9SA 1MN6A 4F6RA 2OXIA 1JALA 4U39A 1XD8A 3TN7A 5COAA 3TLEA 3THYA 1QANA 3VVBA 1RJDA 5CH3A 1CDOA 1NMZA 2VYVA 1GNRA 1JHRA 3L01A 1VHLA 2C7QA 4A8JC 3QEKA 4O29A 5E1BA 2AJBA 3TOCA 4OREX 3ZHVA 3BERA 2M9MA 4PPGA 1XKLA 5B2EA 5I4BA 3AF1A 1K9SA 4KX3A 4ETWA 2CDBA 1V11B 1ISSA 2XOKA 3U7QB 3OD1A 4QO8A 2I4IA 5E9AA 3AVTA 2WIKA 5EJFA 3VKHA 1MIOB 1GAWA 3CKLA 1Z4LA 3E23A 3EA4A 3K5HA 3DH0A 4YIKA 3ELYA 3Q11A 1SHLA 3K73O 1JPJA 1M8KA 3AF4A 4R8KA 1OBHA 1W4LA 3KKNA 3M3PA 1SVIA 4INPA 1NMSA 2HRZA 2ZUFA 3QUAA 5GZ1A 3OAAA 3TZLA 5KNCD 4RVUA 3F5FA 2BKUA 4JSRA 3ZGLA 3O47A 3FR7A 4OPMA 1IY2A 3FOBA 5C5DA 2PU7A 3PNLA 1D2RA 5D85A 2QM0A 5DBEX 4XDYA 1WX1A 4UUMA 5DWQA 3IBYA 5EGNA 1ORIA 2CJFA 1VJCA 2IH4A 3L1HA 3UAWA 1UBNA 1KRHA 2VK1A 3B9BA 1ONNA 2X9NA 2XODA 4HVTA 4JLAA