4DAEA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 6-chloroguanosine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
232
structure length
232
Chain Sequence
b'MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase deoD-type
molecule tags Transferase
source organism Bacillus subtilis
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
total genus 80
structure length 232
sequence length 232
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4daeA00
4BMXA 4DA0A 3MMSA 2HWUA 1V48A 1Y6QA 4BMZA 1K9SA 2HRDA 1PR5A 4I2VA 1ODLA 3K8OE 1Z39A 3LA8A 4IP0A 1Z5NA 1B8OA 1B8NA 1LV8A 2OECA 1SQ6A 5DK6A 4M3NA 1Z33A 1YQQA 5EPUA 3DP9A 4JOSA 1T8WA 3EEIA 2AI3A 2HSWA 2OC4A 4L6IA 1Z36A 4RJ2A 4NSNA 1RCTE 4TYMA 4K6OA 4D8XA 3DPSA 1OV6A 2QSUA 4WKBA 1A9PA 1TGVA 4U2KA 4BN0A 1PR1A 1A69A 3BGSA 1SJ9A 5CXSA 1JE1A 5CCEA 1Y1TA 1TGYA 1TD1A 4NS1A 5F76A 1JP7A 4DA7A 1TCVA 3OF3A 1YBFA 1V2HE 4F2WA 4R31A 4QATA 1JYSA 3ONVA 2PGAA 1U1DA 1SD2A 3INYA 2A8YA 4H1TA 5F77A 1G2OA 4GMHA 3SCZA 5ETJA 4TXNA 3FB1A 1ZL2A 4M7WA 1A9RA 1LX7A 4L5YA 5F7XA 3BJEA 1PK7A 1Z37A 1U1GA 3UAXA 4P54A 2QPLA 1VHWA 3NM5A 4X24A 4GLJA 2GUWA 1OTYA 4LNHA 4R2WA 1PBNA 1U1CA 1V41E 4OGLA 3UAVA 1ULAA 4TTJA 1YRYE 3F8WA 4JP5A 4DARA 1N3IA 3NM6B 3OZCA 4UC0A 1ODIA 1RXCA 4DANA 1NW4A 1PW7A 4M1EA 1PR0A 1V3QE 3IOMA 3ENZA 3IEXA 2BSXA 3P0FA 4G41A 4KN5A 5F7JA 5F73A 1PK9A 4D8VA 5CYGA 1Z35A 2RJ3A 1PR2A 3BL6A 4EB8A 4OEHA 5EFOA 1TCUA 3OOHA 1RXSA 3E9RA 5F78A 4QEZA 4OGKA 3D1VA 3UAZA 2A0XA 1I80A 1CG6A 4PNPA 5IFKA 1T8SA 1Y1SA 4L0MA 1JDSA 4OY3A 4ECEA 4DA8A 5IU6A 5CYFA 2ON6A 2I8AA 3K8QA 2OC9A 1JDVA 4G89A 4FFSA 4MARA 4R2XA 5C80A 3KHSA 4TXLA 3OPVA 3KVVA 4NY1A 4WKOA 3NBQA 1OUMA 3PNSA 4YNBA 4QARA 5B7QA 4PR3A 4G8JA 5JPCA 1LVUA 1RXUA 4MCHA 1K3FA 3KVRA 2IQ5A 3KVYA 5CXQA 1RYZA 2P4SA 3C74A 2QTGA 4YJKA 4LKRA 3FNQA 1JDUA 1A9TA 1YQUA 3O4VA 4WKNA 4LZWA 1QE5A 2HN9A 4DA6A 1RFGE 1RXYA 2A0WA 4WKPA 4QAQA 1V4NA 4TTIA 4E1VA 4TXJA 4L5AA 4F3CA 2AI1A 1Z38A 4TS9A 1PKEA 3EUFA 4TXHA 1Z5PA 1ULBA 1Y6RA 1A9SA 1CB0A 2QDKA 1PR4A 3EMVA 4QFBA 3FUCA 3PHBE 5KB3A 4D8YA 2XRFA 1ODKA 3GGSA 3T94A 4F3KA 3FAZA 4DAEA 1K27A 3TL6A 4L5CA 3EUEA 2Q7OE 3E9ZA 3DJFA 1T8RA 5F7ZA 3UAWA 1WTAA 5F7OA 4TTAA 2ISCA 2AC7A 1XE3A 4F1WA 5FAKA 1JPVA 5I3CA 3FOWA 1RSZA 1U1FA 3OZEA 3ODGA 1U1EA 4WKCA 1PR6A 3LBAA 4GLFA 1JE0A 4D9HA 3P0EA 3DF9A 5CCDA 1OVGA 1NC1A 3FWPA 3KUKA 4JWTA 3OZDA 4YMLA 1JDZA 3OCCA 4LNAA 3GB9A 2B94A 4DABA 2QTTA 5K1ZA 1T0UA 2A0YA 3DDOA 1ECPA 1NC3A 1ODJA 3O6VA 1RT9A 4DAOA 1Y1RA 1OTXA 1M73E 3PNPA 3UAYA 1Z5OA 1VHJA 4OF4A 1FXUA 1Z34A 1A9QA 1PF7E 1ZOSA 4YO8A 3UT6A 4OJTA 3E0QA 4EARA 1JDTA 1A9OA 5B7PA 4GKAA 1OU4A 3QPBA 1VMKA 3PHCA 5B7GA 3BSFA 4F2PA 1SD1A 4TS3A 1C3XA 4LDNA 2OXFA 3U40A 5EUBA 2H8GA 2AI2A 1YR3A 3OOEA 4D98A 5B7NA 3MB8A 1RR6A 3NM4A 4BMYA 1V45E 3OZBA 1Y1QA 1T8YA 4MCIA 3LGSA 4QASA 1PWYE 2I4TA 3KU4A 1Q1GA 1VFNA 4TXMA
chains in the Genus database with same CATH superfamily
1RYNA 4RE5A 2VBCA 2Z3WA 1IJFA 1LDBA 3HCRA 4QTUB 4JI3B 1N5JA 2JIOA 4BX0A 4JIGA 5AH0A 2CL0X 5IPFA 3PICA 2JJ8A 4N5MA 3L7NA 3KOOA 3FPBA 1T2VA 1YBHA 2C3OA 1GNVA 2X8BA 3OEEA 2W6JD 4I1VA 3L04A 2G5CA 4Q1FA 4MP6A 1E2UA 3E9DA 3HO6A 3V6LA 4ANFA 4Z4HA 2XA2A 1CF2O 2J6CA 3SBDA 3HLTA 2V7EA 421PA 3QY9A 5GPBA 3WYBA 4UAGA 2A92A 2RGEA 4B1FA 3N58A 2P79A 4RK6A 3TNYA 3AF3A 4G26A 4MINA 4QDTA 5C37A 2H1IA 4BE9A 4KE8A 2YBEA 3S5JA 1U2DA 1VE9A 3LC0A 5E0KB 3Q98A 5NULA 1HQDA 1YI1A 4MQFB 2DXIA 4INZA 3GO4A 1SVKA 1VSUA 2AYYA 1MRNA 1IBCA 3Q2KA 3BZUA 3R7WB 3ORSA 1YS6A 2AK2A 3TOVA 1RI2A 1M6YA 3HBFA 2Q29A 1BKDR 1O08A 1G6OA 2Q6LA 3DP9A 3E53A 1T8WA 2DU8A 5A0FA 3WP0A 3TLYA 1G21E 3TINA 3HR4A 1YDFA 1I3OA 3I8SA 1IHUA 2O3SA 4HUJA 4IRXA 4R2IA 5EN4A 2XMBA 2AI3A 1W25A 1T8UA 1W88A 2Z6QA 1PHPA 4YEDA 4AYTA 1YMUA 4ZOEA 3CPSA 3L5OA 2FPLA 5J1TB 4NE9A 3ZIUA 5IRCD 4I3HA 1E0DA 5ECYA 5K0SA 2IH4A 3TZ6A 3D81A 4RDXA 4RZHA 1QRRA 3EVDA 3FFWA 4C6SA 2WWYA 3VGPA 4JR2A 4GZ6A 5AOCA 4JBWA 4ESVA 3C1UA 3K30A 2XUHA 4R84A 2WF5A 4EQZA 4PICA 3WGKA 4Q0MA 3WAJA 4QOIA 3NKVA 3CZ4A 1D5CA 3ONEA 5ERGB 2ZIXB 3HB4X 1SBNE 5AUNB 4Z4GA 2O8BA 3E7WA 1JXQA 1UXIA 5JASA 3AF2A 5SY4A 3OLQA 1KRWA 3LX8A 1BZYA 1ZESA 4PFQA 3UV6A 2P3SA 1OKKD 3CRZA 4BO1A 5IXSA 1M1YB 2ETVA 2NACA 1E1DA 2ZXUA 4EHDA 1ACJA 4LV5B 1CF9A 2ORED 4GWKA 4R31A 2H0AA 5G4LA 4JBLA 1R64A 1PQUA 3EY9A 5LXTF 1YIDA 2OZPA 4M0DA 3CLRD 3VR5D 2A57A 2DLNA 2M1ZA 3E4CA 4RV4A 4W6QA 2PGAA 5J63A 2QX8A 4AZVA 5DNAA 5AW0A 2RGUA 3OQPA 5B4UA 2UYOA 4K5QA 3OZIA 4OFZA 1PFGA 4V2IA 2PBLA 2BBSA 5BSVA 1XRNA 2VDWB 5CLJA 2VJMA 2GVDC 3QVLA 3SCZA 2OAP1 4DLXA 1L7NA 1SIOA 3GLGB 1PD1A 1R3DA 2YYYA 3BXHA 4BXOA 4QL3A 3BIOA 3E9QA 3SR4A 2ZI6A 3PUHA 1LX7A 4V0LA 4EKDA 1Q1QA 2QVYX 5FBQB 3BJEA 3T61A 4MH0R 1SQSA 5FFFA 3NQ41 5F2NA 4P54A 3WK9A 2VXBA 3KAJA 4I6EA 5FUWA 1L3IA 3TOCA 3OKCA 4GYKA 5FV4A 4AY6A 5E7JA 2NU9A 4FJ2A 3I9V1 5DISB 5AHOA 4D7AA 3AVYA 4X24A 4A6DA 5KVSA 4J16A 3RCBA 4ENUA 3OM1A 4RTOA 3ZDDA 2R6AA 4LF7B 1TFUA 1DPGA 2DTDA 4LNHA 1W1UA 3R6GA 4RTSA 4KJXA 1ADJA 1MMFB 1TIPA 3KKLA 1I4WA 2DZDA 2PZMA 2E37A 1JYFA 2P3QA 2VNSA 4PF1A 1GGEA 1TYDE 4JI2B 2Q3BA 1ISMA 1S3SA 2XRMA 3E6AA 5EWMB 3GFRA 3DG9A 2C61A 3RUIA 5HUHA 5D87A 5JAUA 1B8PA 3PX3A 1G291 3SDSA 1NY5A 5CUQA 4O0MA 1N5RA 1L4MA 1V9SA 1DPFA 4BQNA 2Q4EA 4OSPA 3G2KA 4XCVA 1YTUA 3A6PC 3IUEA 2VF7A 2DFNA 4HXGA 5JI2E 1ZVQA 3GA7A 2ISQA 1YIAA 3A6DA 1RJ9A 4R7ZA 1I30A 3DUFB 1H0RA 1ZBDA 4KQCA 4AICA 1TQ2A 4ZK6A 4AD8A 2DUJA 1JTFA 3SSOA 1EX6A 4YALA 1DIRA 3EFOA 1VG8A 3VBEA 4AP6A 3C5VA 4ZALA 4F1KA 4BV3A 2ODEA 3E22A 3EVCA 3KTAB 5FCDA 2ANCA 5FPKA 5K5EA 2OV2A 1I24A 1U7HA 3PXCX 4FWTA 1SWWA 3R9WA 2B9VA 4EHJA 2GRJA 3QLJA 1G5IA 3NP7A 3NORA 2E87A 1A9YA 1R0SA 5B3JA 1VSQA 2Z2XA 4F84A 1QWSA 2PX0A 4OOEA 3LCCA 4XLTA 4C2UA 3JY6A 2GYYA 2DUUA 4Q3OA 2BUCA 3AI2A 2QM7A 3LUCA 5H83A 3HR7A 2Z08A 4BFCA 2PMKA 4ZTZB 5EC8A 4Q9IA 4Z4EA 3E70C 2PRSA 4HD8A 1EFLA 2RH9B 2IX9A 2XKJE 2OBLA 3VYUB 1W36C 1JJAA 3G82C 2PUCA 1W34A 3WC4A 2OCAA 1EFCA 2YNMA 2BTEA 4B6QA 2I2FA 1B2LA 1YAHA 2J5BA 2JHCA 2LUOA 2CMGA 3B48A 4PZUA 5CURA 1P9WA 3GUUA 1Z12A 2BMJA 1V35A 1BA3A 1I80A 4JYCA 2CJPA 1KAQA 2RI6A 3BPSA 1TT5A 1Z18A 2CMHA 1C7FA 2GBLA 5EHQA 1PDWA 1CE8A 1GO2A 3Q8WA 2PEYA 4JQZA 4P33A 2FSFA 4MKFA 1JEEA 3EC2A 1M8FA 1QBGA 3WYFA 4CCSA 4HAUA 2QD3A 3K6SB 2XOXA 5CYFA 1WIWA 1WY7A 4Y9UA 1OXUA 5FNVF 1JI3A 3SQNA 1E59A 2AN5A 2ON6A 2IP2A 2D5CA 2QRVA 4JN6B 2FGJA 2QTWB 3G02A 3LIPA 3K5HA 4MARA 2PIDA 4FKZA 1HYEA 4MRVA 1NM5A 4RO0A 5KCZA 2IH5A 4F3TA 3BWVA 1OIWA 3PQ2A 1Z73A 2REXB 1EZ1A 2WI8A 2YWBA 1VA4A 2G80A 2QN2A 3AEYA 3KVVA 3QLUC 1XZKA 1E6UA 5DLEA 3SEFA 3NH9A 5L4NA 1TTTA 2QSJA 4IIGA 3WXMA 4LE0A 3MIZA 1PWXA 1NQAO 4R71A 2X13A 3EZXA 3GFOA 2W8BA 2DTEA 2GILA 3MXTA 3WB9A 3SIPA 3BJIC 3R2JA 2F90A 3WQRA 1FMLA 2AH5A 1XZMA 3EGEA 3EFOB 3LOUA 1XHEA 1QV7A 2J4FA 2ZRCA 3D3JA 4YWHA 1T5SA 2NYVA 4E32A 1OE0A 2WLSA 2QD5A 2VP5A 2VQFB 1KK1A 1N36B 1NJ6A 2E5FA 1NNUA 2ALJA 2HRRA 4IOJA 1ZHHA 3A4VA 1JPUA 1DOHA 4IXWA 4EITA 1U7UA 1P0FA 3L06A 5KOHB 2UYHA 1CB7A 1HDCA 4U02A 4CTNA 4PRLA 1OLSB 2JFXA 2QAGB 4X84A 3MWEB 4V3BA 1B3BA 4U7TB 1QH8B 2YWRA 1AXRA 3VV3A 4J75A 2BAGA 1VCIA 2YCLA 3BE4A 1E2IA 4RY9A 1T5LA 2A0FA 1TM2A 2DUNA 2EFGA 2CUKA 3BCSA 3M1IA 4JQOA 4TQUS 3NV9A 2GTPA 2BLNA 2JFQA 2F9MA 3A1VA 2K7ZA 3BF7A 2H1WA 2ICAA 5AI0A 1XGKA 2IJGX 4HH1A 3N7TA 4L1KA 1PTJA 2FZLA 1EDEA 3G68A 1YVRA 3F96A 1C9MA 4JC5A 1QGDA 5I7HA 3KZNA 5JJBA 3AJAA 2JI4A 2JLCA 2AR9A 2QX7A 3L6OO 4E1VA 2Q6KA 3EG5A 3V1MA 1EK1A 3CINA 2P4HX 2O05A 1WTCA 2R6HA 4FNAA 4TVKA 1BXRA 3P0JA 4NESA 1CW2B 1T3LA 4GPAA 3VHXA 1EAYA 2OK8A 3FYUC 3TI9A 4F3CA 3E9CA 3ZTTA 4MR7B 4AN0A 2C7GA 4DCPA 3V4SA 2Z9CA 5CFPA 3D6FA 4UD2A 2F00A 1VZ3A 2CFSA 2EW1A 1WE2A 3G5TA 4I3FA 2Q3LA 1JHYA 5T6BA 2IPLA 4H17A 1K5GA 1N5MA 3SIRA 1KC1A 4CG1A 4WCFA 1E6MA 1JG2A 1ZUD1 5GM2A 4B45A 5A4MS 4LWPA 4MI1A 2PLWA 4PC7A 3SN6A 4KOEC 2PRYA 3O95A 5CTAA 1W5EA 3AUSA 3FGOA 4UDNA 2OG2A 1UPCA 2JS7A 2OSBA 4HDRA 4O4LF 3HZRA 5EE3A 3VISA 3PWKA 4AL4A 4B81A 3LUHA 5I8WA 3CWQA 3B9QA 1SC3A 2O2ZA 2EJWA 4DMLA 4E4RA 3ZGLA 4RV9A 1ODCA 5DIZA 2X0EA 2R8EA 3MFQA 3QNUA 1M1YA 1RP1A 2BBOA 2BI7A 2WAOA 3AY7A 4QVGA 1T3ZA 1L6RA 4B6OA 5ILOA 3SJCA 3V4FA 4RLSA 4R1TA 4L5CA 4ER0A 3KQHA 4D9FA 4HH0A 5JVDF 1YZHA 1E6LA 4FHEA 4YACA 1JEJA 4HDKA 3OZSA 1YU6A 1P7VA 1ZSVA 2OXCA 2Y0DA 3BCHA 3LCVB 4F6RA 4OP1A 3LCUA 1GAJA 4UTPA 1W0KD 3EGXA 4RJJA 3OM0A 2Q4OA 3RU2A 4OHXA 4TV9B 1PFYA 5KJCA 4LC9A 1KF0A 2HRCA 3D0RA 1OD6A 4GFDA 1NMZA 4RTMA 3I83A 1LDMA 3MJEA 2AUTA 1SOWA 3ZG6A 3PWSA 2FMTA 4DT1A 2OLJA 3RLFA 1VXRA 3FCSB 1WUYA 1D9ZA 4KO3S 1XVUA 2D8AA 3HY3A 5GY7A 1ESNA 3FOWA 3RYFA 2VPZA 1ZNQO 1QPBA 1U1EA 2FKNA 2C3PA 4L95C 1CIPA 3M81A 2PLFA 5FUBA 1ZNZA 2CNNA 4CKBA 2XD9A 3SSMA 2CNWA 1JQKA 3LUAA 4MS3B 4TTRA 4A4DA 2WZBA 2D3TA 1WF3A 4BDSA 1JE0A 4YR9A 2IKSA 4DRYA 4EJ6A 4F04A 1X3LA 1SCUA 4BNWA 1CR4A 1OI4A 4CKWB 2CMFA 1FQKA 1WG8A 4P84A 4CETA 3A3NA 3KT3A 1E4OA 1W581 3PD0A 1PJ4A 1DAEA 4WNCA 2PT5A 4Y3UA 5K3DA 3PQ3A 2JFZA 1JQLB 1Z75A 3EZGA 2JAWA 4ND2A 1EHYA 3ZCXA 3PIIA 4LRQA 1QO9A 1E6KA 2R00C 3G2IA 4PG5A 5EP4A 1RI1A 2NPIA 1TZ2A 1L7MA 3FPGA 5G40A 3RIYA 5CFRA 4YHHB 2PUFA 2XMDA 1AGPA 2EEPA 1M8KA 3K6KA 3OLCX 5JARA 1LQTA 1R8XA 4BVJA 1VKNA 3RWOA 4AZ3B 1AS0A 1CUJA 3DQZA 4WEQA 1DGQA 1WCYA 3U1VA 3W05A 1TU3A 1GR0A 3C0KA 4MMZB 1CDZA 1NP7A 2ZP1A 2EKLA 4LOJA 1B93A 1Z29A 3CS3A 3E3LA 3GRCA 1OKKA 4KWHA 4NMMA 3IBTA 2EJTA 4O4HA 5EJMA 4IKPA 3I01M 1GWNA 1VLZA 3PNPA 2FJ0A 4E22A 4CM4A 4HV4A 2O8EA 4PRYA 5KTYA 1E3IA 3HO8A 2QUJA 3ONWA 1W6UA 1M1NB 2TMGA 3DH0A 1HUQA 4KR0A 3ZQ6A 3RKSA 2X0JA 1OX4B 1I5RA 1CKEA 1V1RA 2Q45A 3I0ZA 1VBKA 3L1KA 4GXTA 3U7IA 1Q12A 4CDRA 1BCSB 3SQMA 4NZNA 1RXVA 1VYHA 3J81A 2HXGA 1TI7A 3IQXA 1ZAYA 1HEYA 3DMYA 1JG6A 3GJSA 1A71A 5B7PA 5HZGA 3K96A 3L41A 5JAIA 5LOVA 1ST3A 2ZI9A 2WQZA 3PC8C 4HFMA 1VYUA 3DBOB 1I4OA 1U2EA 2F43B 5KNCA 1RPZA 3PT5A 2FPRA 4ZVPA 5H0IA 4LVCA 2QJWA 5BMVF 1H5QA 2RMKA 3QU9A 2J9RA 1P0IA 1W1IA 3EZ7A 1M2JA 1RI3A 1DWOA 5I9SA 1C8LA 1NPTO 1XXHA 3HXPA 1SD1A 1KZ1A 1O57A 1EWRA 4KNVA 4ME6A 1BGXT 5HMLA 2G7MC 3O9ZA 1HYGA 2LVBA 1UMCB 2BOVA 4X7RA 1KMQA 4H7PA 4B2LA 3E81A 1PGPA 3ENWA 3IAEA 2QBYA 1MO2A 1Q7GA 2C29D 4F5ZA 5B7NA 4YAKA 3W77A 5JZMA 1ISPA 2YWCA 4MA5A 3DEYX 1A5TA 3QENA 2QE7A 4YCDA 4EGQA 3AUJB 5HGJA 3UB3A 2QLMA 2QPOA 5FULA 3AHEA 4L3WA 3PD7A 2D7JA 4B85A 2Q1SA 1IYZA 4R1PA 5EI5A 1G7TA 4PPQA 3DOOA 2F59A 4UU1A 5H82A 2L0XA 3IODA 4IOMA 4A0GA 4AZ3A 4YY3B 3HY4A 3PUVA 5EGNA 4MEJA 2WEKA 1N6RA 2PD4A 3QEOA 5HCNA 1QQBA 1H2EA 4MVJP 2P8JA 4JQCA 1QCDA 3AEKA 4IRMA 1U7ZA 4P7GA 1ZN8A 1FVFA 2PH5A 2WFLA 4W1PA 5L3SB 3Q40A 4BLUA 2EQBA 4CM4B 4F06A 1X80A 2VRCD 4M86A 1DJQA 5A5FA 4G1MB 4Y7DA 3TBKA 4B75A 5BVGA 1F60A 3QYAA 2QJRA 2QZSA 2CL7X 4MR8B 4TSKA 1MOPA 3OFNA 4WY5A 3ZE6A 4AULA 4DA0A 4D5EA 4R16A 2IUFA 3ROTA 1RE1A 3ACCA 3BERA 1DLIA 4A8HA 4ETWA 4EG8A 1VGRA 1H3FA 3P9SA 4FR2A 3EIXA 4QXAA 4YHBA 5EMMA 3SXUB 1NVAA 3IMFA 1Y37A 3R5JA 2O7VA 4PONA 4EB0A 5F9FA 2IIVA 3B36A 4M9UA 1EX7A 1I6MA 1K0UA 3K8OE 2GZDA 4QLAA 5C8DA 2ZJ6A 4DXDA 2D7DA 5E0OA 4DT1B 4ZEXA 3K9WA 5FL7A 1RBMA 1YOBA 4IHKA 1EVLA 2IEDA 3A58B 3GVIA 3NDPA 2PQ2A 1K8ZB 1JRLA 3VH2A 4B6EA 5A05A 1QIKA 2FPGA 4MYCA 4DMGA 3A6HA 1SKUA 2Q6IA 2W8BB 4QDOA 3C1AA 4IFBA 3AFIA 3Q9NA 4WVLA 2KE5A 4C05A 4CLXA 3QUQA 2WJGA 4HDAA 3HU2A 4D56A 4Q4AA 2P2DA 2FRVA 4JFRA 3N87A 3DDSA 1ATZA 2C2OA 4Q1BA 2ZT6A 1E6WA 5ALWA 2X76A 4GMDA 5BYBA 3ZZUA 3EAQA 3FOZA 1FQOA 4JI4B 3THYA 3OJLA 1RCTE 5FTKA 4HFJA 4TYMA 3KFLA 1D7AA 3CR3C 3UZUA 3Q72A 1U0EA 3DJYA 1U3TA 2I9PA 5BQFA 3Q6MA 2DHQA 2AZMA 1YKFA 1SKMA 1KAOA 1OV6A 3CNNA 2FZWA 4YRIA 2FJPA 2Z6AA 1U2GC 2EOAA 3CTPA 2TMYA 5EHIA 1U98A 3PFBA 5B57C 3TG2A 1VHTA 1ZMOA 3DMHA 4NDZA 4ZAVA 1ND6A 3DZGA 2PJZA 3W7BA 2XBLA 1A4XA 4WASA 1JHXA 4DV0B 1CRPA 2ASEA 1NVWQ 1Y8RA 4NULA 5CB4A 3GNLA 1KZGB 4NU8X 2HCJB 2FPIB 2QENA 3DV0A 1XWIA 2YJTD 1AZWA 3GDWA 1NYQA 4B4UA 3TPZA 3KO8A 1DRJA 1HG0A 4KBFA 3FYTA 4LRYA 4D92A 1MOZA 4KFUA 1E62A 3UTDA 3FFTA 3LQ4A 1X8XA 3VPBA 3W1EA 1ZSNA 3RIGA 3TOZA 2O5CA 4GSLA 1T36B 3I09A 2HI0A 2IGTA 3QLTA 4YCAA 3WWDA 5ALNA 2VQEB 2V4MA 3PUXA 3UOGA 1U1DA 4QJBA 1VJRA 3ZX4A 2XWSA 4MKXA 5HWSA 2HLNA 1W4ZA 2Q8PA 4OM7A 3FKSA 3E1KA 3HUDA 3O4JA 3HJCA 4JYMA 4CG3A 3SJAA 4R1NA 2FWJA 3VQTA 1AN9A 1T4DA 3PRJA 4J07A 1TDJA 4FZJA 4S1NA 2C2BA 4UCXA 1F4VA 4GMHA 1JJIA 2XD4A 3P9ZA 5FL3A 1ECBA 5AUPB 1G5RA 3HUFA 3NXKA 4TXNA 1XAHA 3IHLA 2OZKA 2Q5EA 2O2IA 4H35A 4GM1A 2IBTA 1NMQA 4BGDA 4F21A 1KXJA 2QN7A 5CCBA 5HCIA 3WGUA 4Q9NA 1KVSA 1Z37A 1U1GA 2HB6A 2WVGA 1FP2A 2AJTA 2QE7D 3OEED 2Q50A 4YRGA 5IAKA 4UHKA 3AH8A 4HAOA 3UUFA 2I1QA 2SKDA 4X92A 5IKPA 1KOFA 4NK5A 2E55A 1VBNA 1CIJA 1F8YA 1W29A 2PUTA 3JALA 2ZT7A 1THZA 2FW0A 4DTCA 3GOHA 4MRMA 4P6VF 4BWYA 3THRA 4XIFA 4KXYA 1GQ2A 4HZIA 1P1CA 2GS9A 5TEVA 3B82A 3S2GA 1T10A 1C8BA 2W2KA 5EQJB 4L76A 4G5FA 3S40A 2ZTVA 2XZPA 1KI8A 2QRNA 2KI5A 2XGSA 3H9QA 4QYSA 1ZI6A 3DVSX 3W3AD 3EPJA 4KRGA 1OIVA 2CJYA 2B99A 3CVYA 2DH6A 1N2CA 5DZSA 1XNQB 4QUKA 1EWTA 4NZ9A 1MOSA 1E89A 3ZW9A 5IBRA 3GHYA 3K0CC 5TQVA 4E14A 5H9WA 5I9IA 3NM6B 1Q17A 4A8JC 2FN3A 2WHEA 2D4AA 5KZMB 1Q0QA 3PZBA 4R9NA 3R8FA 2DBRA 1FP4B 1VMAA 3U3XA 2PL3A 4R2KA 3WAGA 2H4JA 2R48A 3P2KA 5T67A 1CU1A 3GQBA 3HK2A 1TUGA 1WQ4A 2O8CB 4H60A 4I8IA 1IQUA 2PMCA 4KYVA 1QPGA 2GM3A 2VAPA 3PD1A 2D3WA 2R84A 3PDCA 1U2SA 3SP1A 1D1QA 1B76A 1IEWA 1VCMA 1KVUA 1MA0A 2FPXA 1E0SA 1U9YA 3P27A 4GVLA 2IA5A 3SBEA 3VNUA 2X19A 1B8UA 1USIA 5LBUA 4AWAA 1NQXA 1GKYA 3PJDA 1Y9EA 1OZGA 4FGJA 3W2HA 2ZUUA 4NBNA 4UHEA 2ZE5A 4DLSA 5CT6A 1T3TA 4B0OA 4ZOLA 3Q85A 4L6AA 1PL0A 5BNIA 4HCJA 4ICIA 2JLSA 2GCEA 2ES4A 2VHWA 1RPAA 1V3UA 1Y48E 3HL4A 2LCQA 4GL4A 4ZA2A 2BFFB 1KZHA 4C6RA 4MVJE 3UAZA 3EIWA 3BWBA 3GBSA 2X3FA 4MA4A 3VX3A 1HDXA 3RUAA 1I7QB 2DR2A 1NR1A 4M0KA 1QQ5A 4Y2JA 4UTRA 1P2GA 3KETA 5A3VA 3TSAA 4ETMA 3H16A 3PA8A 4DBLE 3REOA 2R4QA 3EIUA 1NATA 3ON5A 5A4IS 4PY2A 3JCZA 1G55A 1CUBA 1JLLB 1MVNA 2OE2A 5G0WA 3TQRA 2HPAA 1JHAA 3K0EA 3NVAA 3THWA 3II6X 1YS2X 5EJFA 4RY8A 2HX1A 1PVDA 2B20A 3RYFB 4B3FX 1U8YA 2OC9A 1DBIA 4G89A 5CNJA 3I2YX 5F35A 3F4KA 3TLCA 2O5EA 3QY0A 5ADUS 2POQX 2D4HA 1S01A 2WJ3A 3CNHA 5HTKA 3JQCA 3CLSC 3DWIA 4HNVA 4GE3A 2C00A 3NBQA 4PWZA 4LWQA 1N2SA 2H1SA 2DQ4A 3CISA 2VVTA 2FFAA 4P82A 5T8KA 3U1TA 3T3NA 5LD2C 4MWZA 5TGZA 4QHSA 5KWVA 4QXQA 4YV0A 2ATEA 3I23A 3H19A 1IM5A 5AK5A 3DSRA 1LVUA 1RXUA 2PUWA 4B6RA 2C3YA 1K3FA 1X1CA 2O2XA 3GUZA 3V48A 3ZTWA 2E82A 3QVMA 3R7DA 2E6KA 4B33A 1TT5B 4OU4A 1EFRA 4ARUA 4EYEA 4L2IA 3FKSD 1C41A 3AJDA 1M2NA 1P18A 4K28A 1U0TA 1Z22A 4BCCA 2DBQA 4NK4A 4X1OA 1YFLA 3V6MA 4CMEA 5JYBA 4UTZA 3RS7A 3ZLBA 1KBZA 2ERXA 2FEOA 2FSVA 3O4VA 4L9SA 2GQ0A 1KIMA 2Y1OA 2ZRGA 4MRSA 1P2DA 1JJFA 1HV8A 1PP4A 1RFGE 1YRLA 3CYFA 4LHWA 5ALZA 5TT0A 1GEEA 5DEIA 4WPGA 1FSPA 1GPDG 4U4AA 3PUJA 3RBZA 1EVQA 4Y2HA 1G8JA 1JAHA 2A7XA 2G6BA 3AVOA 2BD0A 4IHQA 4REQB 1Z26A 3PDIB 3EG9A 1NSTA 2KYRA 4LHEA 1VRVA 2B35A 3IGFA 2BJHA 2TMDA 4TRNA 4R01A 1N75A 4YRBA 2WAAA 3FCUB 3LJKA 4JUAA 3WO0A 5KWEA 4AUEA 4C0LA 1DKQA 2AGVA 4KMRA 5F2KA 4AJIA 4N7JA 4A23A 3NG1A 4CKBB 3VTFA 3PNOA 2DERA 3MLEA 3M1AA 3KLPX 2EERA 1Y81A 3KOYA 1V3TA 4FFVA 4QBHA 3K9GA 4YDSA 3MSXA 1N5KA 5BNTA 1TYCA 1N77A 4NE2A 4XPIA 5AESA 3PG5A 3RSZA 3UG7A 3OWOA 2OEPA 3ILHA 3QEMB 2MR6A 3L0YA 1GQQA 4C5BA 2FMFA 2CE7A 3UHPA 1W85A 3TBHA 1UOQA 4BNXA 4DB2A 3WGHA 3BMCA 3RHTA 1B6SA 1I6KA 3NU1A 4TWBA 4Y1RB 4ZVSA 2I2BA 1R74A 3OM8A 3Q6IA 4RGYA 1ZDMA 2XDYA 3K8ZA 3V1LA 5LIRA 3T5AA 1GG5A 4W9NA 2QR2A 1VI5A 4LHSA 1TVCA 1E1CA 4MLCA 2IXBA 4HDCA 2FW9A 2WMNB 4H1UA 1EG2A 1TX4B 1XQ9A 4LC1A 3GXOA 4QOEA 4COKA 4D3SA 5MFPA 3HCFA 3NBUA 1MJNA 1GAEO 2B7BA 1SUBA 2X0IA 2YW9A 5ALXA 5F64A 1EFDN 3O1HB 2P68A 1SHKA 3R44A 3WWZA 3ELBA 3C7AA 4AG3A 5L4SA 3IOEA 1QQAA 1NP6A 1YMVA 1MAVA 5F7ZA 3MOSA 4M0FA 1D2EA 2GEKA 5IM5A 5KYUA 1R2QA 4K40A 1HKUA 4G86A 4MQBA 3IHKA 3ITEA 3IP7A 3KB2A 2GD6A 3MS7A 4EB6A 3KQWA 4CFSA 1D0VA 3HFRA 3PGMA 2YVAA 2LRHA 2ONYA 1Z2EA 4CHGA 2KWIA 3ZZMA 5GIOE 4TT3A 4ZCPA 2AFHE 3KDPA 4QLOA 1QK3A 3FNBA 2PZBA 2CHUA 3PFIA 4REQA 4DWWA 3JQEA 1POWA 1RKUA 2AG1A 4CLRA 3KQQA 2XQFA 4G5YA 2CJWB 5FD8A 4EM6A 5LVAA 1XVTA 3EVAA 5JROA 3OZEA 3QBDA 3WHLA 3QVGB 3ODGA 1ONBA 3F78A 2Q9BA 2RG7A 3GDHA 3IUJA 4FWIB 3V8MA 3ZKWA 4D80A 5B36A 2JI8A 4DCJA 5B1EA 2OGUA 3FAKA 3G2NA 2YXDA 3G0CA 1MA3A 1A7JA 1BMFD 1KAHA 1T0PA 1XRLA 1C9KA 3HDQA 1XZJA 5FTLA 3DFIA 5IANA 2AXEA 2NUTA 4BE4A 2PUEA 1OBVA 1WCV1 2ZI5A 2WA2A 2QRJA 3PNMA 3RHSA 1ZRMA 4YIHA 1ZJJA 2P0YA 4HWTA 1U8EA 3EVGA 3VZRA 4DDUA 3UA4A 3A25A 4Y2XA 1KO7A 4ZJYA 1P1KA 4BGIA 4RPGA 2JC3A 3ZQUA 3PFKA 3K70D 4P0PB 3GMSA 2ZGVA 3WIBA 3LK7A 1MEJA 4KO8A 3KUDA 2NXEA 2YOGA 4ODIA 2P9CA 2VC2B 1EGHA 1UBCA 2EYUA 2B30A 1SD5A 2HU7A 1O4VA 2WDPA 1DC4A 3FNHA 4NU6A 2YHAA 3VNAA 4AO7A 4E4YA 1SCKA 4YMLA 1LXCA 3KNZA 3BK7A 2ZFUA 1LPAB 3ABSB 4G0XA 2Z98A 4WN3A 1DC8A 3DMFA 4M0LA 1QIMA 1GIAA 4PPFA 3H8JA 3TE6A 1XEAA 2IEAA 3KV3O 3CB4A 1TYZA 3FD8A 1NLZA 1OHHA 4S1TA 3RARA 1QVZA 2WJIA 1R6DA 3MJDA 1LLFA 3ZCQA 3AVWA 2FQQA 3FSJX 2WPDA 1FZTA 4O2AA 2ZTUA 5LZ8A 3TVYA 4PN3A 2BL4A 3JWIA 2GN4A 4W9RA 5E9JA 2YY5A 1Y89A 2I6SA 1WRBA 1LFDB 1GSAA 5C34B 4COOA 4CTMA 3GH3A 3O92A 1OGYA 1WHSA 4EAAA 1KEWA 2BC9A 3LBFA 4KL8S 2YXPX 4HBGA 2SKEA 1ZNXA 4M99A 1NHWA 3R09A 2ZTMA 5M7EA 3N8KA 1GZUA 1C30A 3L6RA 4PZ0A 2IPNA 1O5OA 3KFVA 3ZZ0A 2ZTSA 5PGMA 4BLOA 1BWPA 4E5KA 1BEUB 5T4HA 4HYYA 4OI1A 1JU9A 2EJVA 2JAHA 1VE5A 3R3YA 2QVGA 1VE1A 3WSWA 4ZHSA 2EX1A 1BQ4A 3LUGA 4WKCA 1QIHA 1XVIA 3PHCA 3TX2A 2I8LA 2NO0A 3RS8A 1KZYC 2QI9C 1WWKA 4FNGA 2Q8QA 4MS1B 3ZHZA 3ORFA 2CF6A 3VSEA 3CVVA 3OU7A 2QM3A 1S2GA 2IDKA 1KY2A 1FB5A 3C5EA 1NW8A 4ZIRB 2WMDA 3N86A 1U04A 1GN8A 1U4NA 4DGSA 3LQRA 2CXRA 1RVDA 4NBRA 1TD9A 4FEEA 5FNVA 1CDOA 4QOFA 1Y1PA 3SPXA 4CL0A 4ZEWA 4FFBA 5CDSA 2B8WA 4XASA 3RVKA 2BEUB 1LF0A 4GR9A 2PUJA 1UKBA 2BM8A 3L43A 5I9TA 3QITA 2R47A 5TMDA 4QULA 2Y71A 2JGFA 2QX6A 1SG9A 2GN9A 1P8AA 2HDNB 2BZSA 2C2YA 2JHAA 2R6DA 1AU9A 4AWXA 2ZJ7A 5I7AA 4NLLA 4L85A 1O94C 2NXJA 3CKYA 4KQ1A 4M0MA 3TSOA 1F8XA 3GI1A 1B1CA 2P9FA 1JDBB 4LJ7A 4CMCA 1W75A 2OLKA 2PAAA 3KKOA 4MV4A 3RREA 3RVQA 2DHRA 4TZ0A 2JH3A 4RUKA 4ARBA 5KAPA 1GG9A 4BNTA 5H8WA 3AKEA 1RXIA 5L7TA 3RTAA 1E3LA 1ONOA 1GGMA 3HEMA 2X86A 5F4ZA 3PENA 3HG7A 1R8SA 2PRZA 1XJ0A 1IRIA 2ZI3A 2H18A 3RSGA 2V8OA 2BR4A 1GRCA 1IRXA 3E23A 3FR8A 3X1KA 1RWOA 3T3GA 2QJTA 3GG2A 1FU8A 3OAAD 1SPXA 1L8XA 4YCBA 4F85A 4OI2A 5HF8A 1UDCA 2V74B 3AEUB 1NPYA 1QGZA 2XF8A 4RZ2A 3WLSA 5KNDA 3T1YB 1ISJA 4DY4A 3OQHA 1JECA 3JQFA 3KQYA 2HRDA 3AR3A 4BVLA 2PD6A 4R0MA 1TJ5A 2G06A 2A1TR 1Z5UA 4ZQBA 3VR1A 1BVHA 2J7PA 3RC9A 4L08A 2GJ9A 4LXXA 1DS6A 3O93A 2XEDA 3DV2A 2GXQA 1ISIA 4EVIA 1GA1A 4UE2A 4LZJA 3NYRA 1MX9A 3F74A 4H7DA 2X4GA 1CJBA 2HF2A 2NVUA 4UEWA 3COSA 3CXUA 1MXFA 2H8KA 1H4TA 2EFDB 3NC4A 5IBCA 1HE8B 2WT8A 3MYYA 5A7HA 3H2GA 3LY9A 3EZ2A 3AUYA 2QDXA 16PKA 1U0GA 1VDMA 3H8SA 4GYJA 2PVSA 1UBMS 2P62A 1H2AS 1RDFA 1H2FA 2UV8A 3MBIA 4KI7A 4JHLA 1TZBA 3HNRA 2OP1A 3KAKA 4S1WA 5F98A 3V46A 2WIJA 1FJGB 3C8HA 4ZDIA 1SR8A 4LE2A 4MWGA 1R6TA 2ZRJA 2YJ3A 5D8DA 1X0XA 5DGDA 3ZC3A 1E8NA 5HP4A 1KR5A 4FHDA 4ND6A 1BHO1 3FWKA 3QA9A 3MBOA 1N92A 1K98A 4O59O 4UAUA 2OORC 2P11A 3ZXYA 3NOVA 1DWPA 1UBNA 4S04A 4FFDA 4MPTA 1DX4A 3BXPA 2JCBA 1OSNA 5F1PA 2OO3A 2ZIXA 3IJ5A 4JJFA 4IIFA 5TT1A 4BBJA 2ACKA 5KQRA 4QTTB 1U02A 5D1HA 5EVCA 2ZVDA 2BHSA 4MIOA 1E9BA 1NBEA 3YASA 5F3WB 1YBVA 3LNTA 3CZ5A 1Z6TA 1GTRA 3OT5A 5DK4A 3LHFA 2XR1A 1BW9A 1P7YA 3UJHA 1GCIA 2E3JA 1NVXQ 2VJBA 4IO0A 5DI3A 3A04A 3ND6A 4V0MA 4PX2A 4UHJA 2BI4A 4DMMA 1ZK0A 3JVDA 4ASUD 2H00A 5GJCA 1Y1TA 2I66A 2R1TB 1JJVA 3TD2A 5CCEA 5JLJA 3GOQA 1UWKA 3I2IA 4NYIQ 4X95A 2XVZA 5CA0B 5K3EA 1F8FA 2YJ4A 1UBRS 1XRQA 4EI7A 1UBJS 2J41A 2NZYA 2HWWA 2WZQA 3EIFA 5IDXA 5LOVF 4YQYA 3PL5A 4B7ZA 3GRUA 5IT5A 4AS3A 5LXTB 1I5OA 3LDAA 2WJ4A 4IKOA 3VC7A 1GPAA 4L6CA 4X3PA 1WW2A 5JY6A 2FRDC 3SE7A 4Z7NB 3QXXA 2OLEA 2Z30A 3Q6NA 5JSKA 4UAVA 4UARA 4DR6B 3CEHA 3JZMA 1GVHA 4IDPA 1T8TA 4EBBA 1APBA 5D5HA 3UV3A 2D2VA 5HKBA 2H7XA 2I4IA 2V0CA 1WSAA 2YJ6A 3LW7A 2JFVA 2OGSA 3OQBA 4PLVA 4PYOA 4Q6BA 4R0NA 5E7IA 3UCXA 4FVTA 1UPUA 3B53X 3D8RA 5F77A 3IXQA 3UUGA 2ZXEA 3BGVA 3JQPA 2YCBA 2WJVA 5K0EA 3EPKA 1DBVO 4PYJA 1MABB 2QOEA 4A82A 1VPVA 3UFXB 3A4IA 1Z6YA 1ZL2A 3HXMA 3OQVA 2DM6A 3DBLA 4HH4A 4D8TA 5F33A 4ND8B 4KPEC 2ZUDA 2J45A 3FG9A 2G63A 2BR3A 2E9SA 4J3NA 2FN8A 4GGPA 1ZSYA 4INOA 4TLDA 3ABIA 1N6OA 3WGQA 5IN5A 2PT7A 1U9ZA 1VL6A 1JU3A 2TSYB 1PI3A 1W5FA 3FZYA 1M8JA 4KYUA 3RBXA 2Z2ZA 1HFKA 1VOTA 3INTA 4RVSA 1S4MA 1IM2A 4LISA 1TE2A 1S89A 1VLMA 2DHCA 1L1FA 3FHOA 4OQYA 4EF6A 2B7CA 5MN5A 4MUHA 2WM2A 4YRDA 2G36A 4FYIA 4PYLA 3IPAA 4OVKA 3IR7A 4J3JA 4HG2A 1R4AA 4LOAA 4C87A 4FD2A 3G2MA 1V41E 4DLRA 1YVPA 1C7IA 3H11A 2D1RA 2ETXA 1NBMA 1NXQA 3H2SA 1V1MA 3BMOA 3PNKA 4PQYA 3U49A 3QWFA 3LUBA 1HEIA 1SUIA 5EXTA 4LXHA 2E4VA 5C8VA 5DYTA 2AUNA 2P4EA 4JP5A 4DARA 2YJGA 3GPLA 4E88A 1C3JA 1NVVQ 1DMRA 4BBZA 3E58A 2HSGA 4CI0B 1P3DA 3KQNA 1BDJA 3ZD8A 2CVHA 4IIVA 4K1LA 4EKIA 3GJZA 2LIVA 1ODIA 1PL8A 2ATIA 1POXA 1W2WB 5IW8A 1MBZA 1RXCA 1XTJA 3AEXA 3DD5A 4FYPA 2MU1A 4X60A 3TI7A 4QPPA 4G56A 4E70A 4WK0B 2C92A 3DWEX 4L07A 4X94A 1QIFA 1YONA 5K8LA 3BRWD 1RCFA 3L4BC 1EXWA 3OF2A 4H08A 4XVUA 1EXMA 1RCUA 3HRIA 3KZKA 1XD9A 4IINA 4Z51A 4N48A 2IYXA 3SF0A 2PK3A 3TQOA 2WSIA 2B0CA 1IFXA 2WT4A 1MU0A 4HYQA 1Y8CA 1CQJA 3H18A 1LLCA 1ZX1A 4IDGA 3FNEA 1E4VA 1K8QA 2DWCA 4BFYA 5EJ5A 4EUKA 2I2AA 3FZEA 1HRDA 3RJZA 7REQA 5ULLA 1SUWA 3WKEA 1RRMA 4L02A 1I94B 3OCZA 2I7VA 3IVRA 1XSEA 5AVKA 1WP4A 2QRGA 3G23A 4H3HB 1KORA 1M5RA 4NCKA 4C03A 3KD2A 1N0VC 1GFIA 4FDMA 1CG6A 1E0JA 1L5FA 3MAAC 1CXZA 4NCNA 4NENB 5F2EA 5L9AA 1B23P 4AO8A 1GZHB 3HCDA 1OAAA 2GKOA 1M7GA 4L0MA 1FSSA 4YUYA 1NBWB 3E3OA 3TQCA 3KEMA 4DSAA 5AVUA 4NAUA 3N2KB 2C5FA 2WYOA 4CRWB 4PV7A 5IN4A 3GRFA 1UJBA 2V6JA 1U3WA 3C6KA 3GEMA 2P6OA 4L8LA 2FZGA 1THGA 4G5HA 4Q9LA 4LVOA 5FAXA 2XCQA 2YINC 2I8AA 4RJKA 1L1QA 4FYJA 4BV2A 1DAMA 4ISCA 5DTMA 4UHCA 1NTRA 4OQDA 5LA6B 1KQGA 2FDCA 4ASUA 2OCXA 3C3WA 5EWJA 1Y6ZA 4H7EA 4Z2AA 3TZBA 3FOBA 1YUBA 4K9SA 2B3DA 2IPAB 4ZXPA 3CPHA 2EEZA 1XZBA 3TLBA 4X7MA 2GN2A 2RGAA 1JEQB 2FSHA 4OYLA 1LX6A 1ZK3A 3SG0A 3SE0A 4Q7QA 1AMOA 4JP1A 1EP9A 2IPXA 4KV7A 1JAZA 1V47A 1A5BB 4AMGA 1UANA 4I9UA 2CFOA 4MQ5A 4ES6A 3DHYA 6GPBA 1N6LA 1MJGA 3M9LA 3ROXA 4DRZA 1JSLA 4ZIRA 1WXHA 1E94E 2GBPA 4OLJA 1KZ4A 3UHOA 4IV0A 1BTOA 2I34A 1U5AA 1UINA 2VHCA 4UTXA 5C3UA 5GJBA 3K0BA 1YZTA 3PPXA 4O0LA 4H6WA 2OENG 4JUFA 2JLBA 4XAQA 5GGYA 1LRKA 4BP8A 4L72A 2QL9A 3H4VA 1KEPA 1AD2A 1YDMA 2C5SA 3EDCA 4NZOA 5ARBA 3AM5A 1W96A 2QSYA 5LOVB 3EC7A 2FDXA 1G8KA 1YWGO 2HBYA 3SOPA 2H08A 5H70A 3VH1A 1VKZA 3CCBA 1C1DB 3VPHA 2C9BA 4C07A 2DCUA 2QV0A 1V8BA 1XCLA 4HB0A 3MWJA 3NMUF 4G6ZA 1DFGA 2BR5A 4WVFA 1QX4A 1AUVA 4Q4AB 1JIQA 3EZLA 3GLHE 3CY6A 1ATIA 1CUEA 1ZH6A 3L0OA 2ONJA 3AR9A 3ZXUB 4CIYA 1X2BA 3CNBA 4K9RA 2BEJA 2UYYA 4L5AA 3WHKA 3FVRA 2VJLA 2L19A 2V1XA 2C78A 4PFJA 4HRVA 2X77A 4US1R 1G7RA 3KZXA 3UJAA 1SNYA 3PKZA 3VZPA 3ZOZA 1A5ZA 1IB6A 1RM0A 3PXAA 3L8MA 4NYMR 4TMTA 4XOUA 4W63A 2B7LA 4YUVA 5CVVA 3BWCA 5GJWC 4DM3A 3OP1A 3RGGA 2GASA 1FFEA 4R05A 2TRSB 4ARZB 3ID6C 4C3UA 3M8KA 4P3PA 1IOLA 1FY2A 3MOGA 2F3RA 4AVYA 2B78A 2WKWA 3WRYA 1W0KA 3KS9A 5BWLA 1CC1S 4RE6A 1A9SA 1H8EA 1OH8A 3I73A 5I51A 3ABQB 4UHFA 5GZ6A 1CHDA 5F2OA 4TZKA 2SNIE 2Q8NA 3PC4A 4IDNA 1ZD3A 4FD3A 1KEUA 3RVPA 1QLWA 2Q4RA 4MGIR 2GLXA 1UEIA 4NCJA 4RFLA 2IXDA 3A4NA 4Y9DA 4KIUA 2JEOA 3F1LA 4ZRDA 3B1WA 8ABPA 1U0SY 2ZK7A 1Y1KE 1X7ZB 4H6XA 1P6UA 4B4WA 4LJRA 1NWHA 1KI9A 3WMGA 2Y9MB 5AT1A 2GYWA 3H4TA 1CLEA 3HU1A 1PYDA 1A8UA 4N3AA 2OILA 4I36A 3EUEA 5ALTA 3DZIA 1NJ2A 2CNKA 3IV7A 2ZI4A 3VR6D 4TPKA 2UZ1A 1B00A 5K99A 3AM3A 3JAWB 2VJYA 3KSDO 3QKRA 2G1UA 2FMIA 4FW8A 4I50F 4X00A 3RQSA 4D9GA 1OREA 2AA3A 1DEKA 5BW6B 2B1QA 4C4XA 3OO1A 2AOUA 5DM70 5JFGA 2O19A 5AXDA 1GDDA 3QPCA 4FWBA 1TPZA 3C5CA 2AN3A 1F0NA 3MA0A 4O02B 1BVUA 4EO9A 5KNCD 3ED1A 2A9FA 2Y4OA 4O1HA 4GDFA 1G9XA 3HV0A 3R3JA 4WWHA 3BRSA 4FILA 3V4ZA 5A9SA 5KTMA 4BAZA 1E2EA 4D9EA 1FFXA 1QAMA 2HSEA 3HFGA 1E9VA 3IQIX 3D31A 4IXTA 4Y67A 3E15A 3T9DA 2BHTA 4H9GA 2UUAB 4QXPA 1FNDA 1G18A 3RFCA 4E33A 4EY5A 4B84A 3LTEA 2H1LA 4N3GA 4MV8A 3I37X 3I0MA 1TFRA 1F2VA 4O5AA 3F98A 3O26A 5J5CA 3S2ZA 3X2FA 1ZIPA 4OL0A 1E63A 1XRMA 3A1UA 3BZWA 3DC7A 5JNSA 2Y1KA 3C8UA 2R11A 2Z8ZA 2NW6A 3WLLA 1TLLA 1DRKA 5EZSA 5AK0A 4OIFA 2BGTA 4R4JA 3RSSA 4RPHA 1DCFA 1ZD4A 4C30A 1M1UA 1KAGA 1X1QA 1ZO8A 3BK2A 4BLRA 5J2TA 4F86A 1EESA 5JLAA 1HL3A 1YJBA 4HPXB 3W1VA 4LYDA 1JXOA 2UUPA 3E1GA 4CJXA 1Q84A 3PE4A 4RENA 3VPCA 1ADYA 4R1UA 3UJ3X 1EM8B 1Q0HA 1KAMA 5LMNB 1JH8A 3FKQA 2YV1A 4QIHA 1F20A 2ZIVB 3DVAB 4C4PA 4F97A 1UBKS 1HO3A 1QSGA 2PE5A 4OG2A 3RGWS 4NJMB 3UMMA 2P0AA 4LW8A 3RS0A 2AJCA 4G65A 2IVFA 1SU6A 4WNAA 4ZYTA 3AV3A 1ECPA 1M6NA 1NRIA 3LSTA 2Z43A 2VYND 3HBAA 4P38A 5HVNA 3RRNA 4K9LA 1XCMA 3COPA 2ZSKA 1LD3A 1HE4A 5LSAA 4ZK2A 4Q21A 2NADA 3CJQA 2Y6VA 3G1TA 3I1IA 4KQ9A 1YGYA 1HLFA 1ZN2A 4IX1A 1UMDB 3GN2A 3I3OA 4JEIA 4YCLA 4Q02A 4XGIA 5HUJA 4LXTA 2I8CA 3SIXA 1QVVA 3DOEA 1PSDA 2VRNA 2PNJA 3IS3A 4EGAA 2AKEA 4B3MB 1GZDA 1JEAA 4DWOA 3C6MA 5CYOA 6AT1A 3AF5A 3L0PA 4KXVA 1TO1E 1XWFA 4OJTA 1WCWA 1ZVJA 1KJNA 2J8ZA 2OGWA 3ITKA 1LI4A 1R5OA 1VE6A 2HM7A 2XI4A 4FCCA 4O08A 4EARA 5C51B 3UK6A 2P2GA 4OI4A 1RM3A 2BZGA 4Q1VA 2QIPA 4UPVA 4YP1A 5ALKA 1NKTA 3H11B 1JVBA 2PWBA 2GETA 4WXMA 2FCAA 1J33A 3I01A 1UPAA 4IEIA 1QK4A 5AO9A 4ER7A 3QFSA 4D8UA 3C8ZA 4E94A 1D4AA 3X44A 4DUPA 2Q1WA 2COEA 4OYHA 5BPHA 1ZONA 4ITVA 4YN3A 5BSWA 4CVNA 3R3ZA 4POOA 1IXRC 4BJ5A 3AETB 2IY7A 1VCNA 5JCPA 3MK31 5JRDS 4X6YA 5C8YB 4AKGA 2WSLA 5DMXA 4QLBA 3PEVA 1FYVA 1OFUX 3BXZA 2NV6A 4YQFA 2WU4A 1VHQA 3SFTA 1JQAA 1CZUA 1P8JA 4A6EA 1M0EA 3GFTA 4NFYA 4NVRA 5P8WA 2Y77A 4PG6A 3SK0A 4CQMA 1YL7A 3C97A 5BWMA 2F6RA 2PUAA 2RDMA 1S1CA 1QB7A 2CXNA 3FROA 3S55A 4DLBA 1D8TA 3D6NB 3T3MB 3DPUA 3PDHA 3LYUA 2PGIA 2FSIA 1Q1EA 1XYGA 3I9V6 4GR4A 4I50A 4DCVA 1SIBE 2X6QA 3VR2D 1JG4A 4JD5A 2QTRA 4WY8A 4F3YA 3VR6A 4WFIA 3RAFC 1FDSA 1P7CA 2WHYA 3GFGA 2XH8A 1OPRA 1IU9A 1QG2A 1UDBA 5IF9A 1OB2A 2VH5R 4I81A 2O8EB 2QG4A 3E5RA 1J8VA 1I10A 1Q1GA 4K87A 4KUGA 2XUOA 1T3GA 4QUJA 1G20B 1OROA 2IY8A 3AGPA 3AF6A 3AJ9A 1RQXA 1XLTA 2J9XB 3N07A 3K0AA 3TRJA 3O75A 1YCDA 1OMOA 4KO1S 4PC6A 2NX2A 4G97A 4BQFA 2POCA 4DR1B 1GOTA 1H6AA 1EFPA 4BFLA 2VT2A 2EBUA 3PNLA 3U7QA 8ADHA 4OI0A 1MH9A 1Y6QA 2XE6A 3FYUA 4TV9F 3ZDZB 1K9SA 5B6IA 2DR3A 2WUDA 1WNTA 4PGMA 5KBYA 1HE3A 4Z54A 2EFYA 3HE3A 5BSRA 4M9RA 1NG1A 1F3LA 1PJRA 3WIOA 1GL3A 1XF1A 2YFHA 3HWSA 3CSSA 3NGXA 3QBVA 3QXJA 1GPBA 2PWYA 3PQ4A 1J0AA 1BOOA 1EA7A 3BHIA 3QUBA 4OAOA 1CFZA 4YP6A 4M7PA 2WUWE 1Z63A 3GT7A 1IN7A 3OMLA 1D6NA 2X14A 4G0UA 4KSBA 1GKIA 3W8FA 2QF7A 2QUZA 4PPNA 2XNCA 1KE1A 1XQYA 1DX6A 1O4WA 1GV1A 2MSKA 2O4UX 2WDZA 4BUJA 2JIPA 1QNFA 5JFTA 3IPLA 2XKBA 2B4RO 2WJAA 2WVJA 2ZIEA 5JZ9A 3JTEA 3O2QB 2HQBA 3JQAB 1W9HA 3KZ1E 5JQGB 1ISFA 4XLZA 3PPVA 3E5NA 2W6JA 4IDDA 1RVV1 1C1XB 1NKVA 4Q12A 3R3SA 4V0RA 4XE5A 4B83A 4BKQA 1XU4A 1UIMA 2IU3A 1MC1A 3N0WA 4ZOLF 4AF6A 5LD2B 1QQTA 1KO8A 2PYDA 5B1SA 1N3YA 4OX9Y 1H85A 2O2CA 2ZU6A 3C85A 4OP2A 3QBTA 2VP6A 3RQIA 1QGAA 5C0OE 2XMGA 1QV6A 2R6R1 2REQA 4OQMA 4EDHA 2Q9CA 2ASVA 1W0JD 1T4BA 3OJXA 1PKXA 1GPWB 3W79A 2Z0MA 1BXGA 1IEVA 1NY6A 4XWYA 4B7CA 1WSBA 3WTCA 4OA8A 3HY6A 5T5QA 4RL6A 5ALQA 5DGIA 3RYIA 3LBYA 5EQTA 4DG9A 3FVTA 1G20A 2OHHA 3HEBA 3T5PA 4UM7A 5LXTA 2OZLA 3KB1A 4YRCA 4XYBA 2PLNA 4M88A 1MVLA 2PXCA 3WGTA 4D3DA 3PLAE 3FTPA 1JKXA 3D2CA 3LHSA 5KTOA 2NNLD 2CKDA 1E79A 3B1VA 1D07A 2OFOA 1E6CA 3NDJA 5HXAA 3ZU4A 4MS4A 3EFBA 1U3GA 4LHZA 1XIVA 3K09C 4KAFA 3JR3A 1D4ZA 1XDSA 2XOEA 3QUCA 4D82A 1U7OA 2B2XA 4L4SA 3KJEA 5BYJA 4DR3B 1A8HA 1FC0A 4M38A 1NUUA 5HZHA 3IBSA 1BGWA 4HX9A 4PE5B 5JEDA 3ICOA 2J5XA 1KO4A 3DKIA 4IUDS 5HQTA 1UP4A 3V32A 4HDNA 4TMXA 1NBHA 1TJ4A 1L7XA 5B37A 1EP3B 1U31A 2VT7A 5E6UB 5K01A 4MVWA 3I52A 4YP7A 1D1SA 2G83A 4FXPA 2C5AA 4L5YA 1FU4A 1GJRA 4PYRA 5A6SB 3SHVA 5F7XA 4TN5A 4I4LA 3UCEA 4KRYA 3M6XA 3TZHA 3FY4A 2FPWA 4MV0A 2H59A 4ID3A 3SZ3A 4CKXA 3H0EA 3N2ZB 4QU5A 3TZEA 3SVZA 5AVYA 1NU8A 2FG7C 1GQSA 3GLSA 5HPYB 4P31A 2ZYIA 1J2TA 1R15A 1HH4A 3G2LA 2CXOA 2WIDA 5DB4A 4ED9A 2G4VA 1T9HA 4LJ8A 2A3RA 2V45A 2VNKA 3OF5A 1NN1A 4LJYA 3NS7A 4MJXA 2O7QA 4OMFG 5AM1A 2V7WA 3TE7A 4N7MA 4A15A 1TC2A 4F56A 1YT5A 1V5FA 4G01B 1NUAA 1OXBB 3IDZA 4HGQA 4QNRA 4BZWA 1P1BA 4MHTA 2GB4A 4Z8XA 4FC7A 1YRYE 3LECA 5DSTA 2J9YB 5IC4A 3L05A 4M1QA 1WHSB 3DBRB 4B34A 5ITVA 2OFFA 2V4ZA 1XEXA 1NXPA 4MQMA 2OB2A 5BMOA 3DTVD 3UJPA 2PR2A 4K9OA 2NVBA 3QVSA 4GMFA 3T54A 4HAZA 2X22A 3V55A 1QCZA 1O3YA 2D1QA 2OMKA 2W5UA 3A6GA 3GA5A 5T57A 5IZCA 1KEEA 1D03A 4DR7B 1K75A 4MUXA 1G3UA 4KSCA 1ORRA 1CVRA 3DKVA 4HTFA 5CW2A 1SVOA 1NXOA 2XWJI 5EE1A 3MF4A 1J8QA 1C2YA 1Z25A 4JROA 4M1EA 4DRXA 4F0JA 3OE4A 4CL2A 1UK9A 1DJMA 3BORA 1G5FA 3CNOA 2IEZA 4P7FA 1DZ3A 4H4EA 2ODQA 3I61A 4WXYB 1P5HA 5DI3B 3OIUA 4UUBA 1PGQA 2VA9A 4XD2A 9ABPA 5AW1A 2HR1A 1T9DA 3IOMA 3M3HA 2W42A 2JHPA 4M36A 4HEA6 3KLNA 1MJFA 2QJFA 4O2BF 1MAUA 4Q24A 1BXKA 1XZIA 2V7PA 3A05A 5EJ7A 3UMFA 1CQPA 2B4YA 2ACWA 4JP2A 4B8ZA 3KWMA 1RADA 1W73A 4K9PA 5C52B 1EE1A 3DE7X 1YZLA 3TEFA 1F9AA 3WIDA 1GD1O 1ZMBA 1T2DA 1SQGA 2XZOA 1S2DA 2BGIA 4YXWA 3NTXA 3IJRA 1I2BA 2I91A 1UK8A 1CQXA 3U3KA 1D3AA 3O4FA 5ENZA 1BKSB 4FFPA 5BMVB 3D1VA 2WWFA 3AVQA 5IAGA 2HNAA 4M89A 4MO9A 3S68A 1P6QA 4NONA 4B8WA 1RRFA 1CYEA 3H2JA 4XYLA 3WA7A 4LF5B 1DKPA 2GESA 3RK4A 3MWGA 6ADHA 2IHVA 4DA8A 1EK6A 2BSAA 2UYQA 2AEEA 1P9LA 4I55F 1ECJA 1UPFA 3WG9A 4C2AA 4YCNA 1NW9B 2C9CA 1H2RS 2GD1O 2Q3MA 3W5DA 1FYDA 3EPPA 4MW4A 3BE8A 3JATB 5AVOA 3H42B 2TMKA 4N8EA 1Z6XA 4TMKA 1MORA 4GYWA 4GZ3A 3RNLA 3W5VA 3IR5A 1NJ1A 1A82A 2WTAA 1C7ZA 3HVKA 4Q3NA 1AZLA 4EFMA 3HBLA 1LWNA 4ZJUA 4GSYA 1Y5IA 3ZCTA 3HP7A 3ENNA 1JWLA 1BXRB 1P1HA 1CV2A 2C7BA 3T4XA 2EZUA 2O20A 3DZKA 3M1YA 2AOTB 2PYZA 3AEUA 1DRVA 3T5GA 4ND4A 4NZMA 3D6HA 2BUBA 2EHJA 4QQRA 2OZLB 3IVGA 1Y3DE 2NU6B 2CB9A 4EYGA 1ZGZA 3WGYA 4TYWA 5CJPA 3G5AA 4TUYA 4BNYA 1PWEA 2QQGA 2R7AA 2J6BA 1QAOA 2C0PA 1KYXA 1Y3BE 3M2TA 1LI5A 1YK1A 2PFKA 3BXFA 4JLBA 4ZCSA 2J59A 2B61A 3GJ4A 1ESEA 4PYKA 3T7KA 2H2AA 3OC6A 1IJBA 1M67A 3VOTA 3HUEA 5BWNA 1JVSA 3QNMA 4GXQA 1PYGA 1FX0B 3WGGA 1E20A 4F4HA 2Q5JA 4YLEA 4KDEA 3MPUA 1I6WA 3TWOA 5EJ8A 3LT2A 1JHUA 4MWBA 1R9NA 1UBGA 2ZQ5A 1EZZA 5HIAA 3GD5A 4UMDA 3NALA 4ZDWA 1ISHA 4HATA 4HNRA 4AT1A 5IXJA 1IDOA 3X1MA 1HNZB 3G9TA 4YVFA 2VYQA 1O8BA 5LUAA 3RVRA 1F9EA 1R5NA 3RSQA 1D2GA 5TPWB 4BCDA 3KJXA 4Z7OB 3NHYA 3NYIA 1WJGA 2R60A 1EE9A 5BUZA 3E27A 4A91A 3STUA 2ZIWB 3ACBA 2CXHA 4RS3A 5BSGA 4QGAA 2LGJA 5B5SA 1A2OA 1SBYA 2R97A 2P9BA 5D84A 4HAVA 3WL5A 1EIWA 3AFHA 5AK4A 4AUKA 3FPCA 3V7YA 3WMXA 3KJZA 3V2IA 1L5SA 1RWXA 1DCMA 1Y63A 3FCOA 1WZNA 2QN9A 1K63A 3FFXA 3MELA 4KE6A 3ZWBA 2QRQA 1UQUA 1F38A 1XXHE 2A5GA 3LLCA 5AJWA 3TNLA 3WY9A 3UGJA 1E92A 2DQYA 1W46A 2FMKA 2R7KA 2G7ZA 3CW9A 1OFUA 3GMTA 3VKWA 1F8UA 2COUA 3LKBA 1PJTA 5KNBH 4QFBA 1RWKA 1TQ6A 2LPMA 3O2JA 1MW8X 1H69A 1EDBA 5EY5B 1U0NA 1IONA 5CM8B 1THMA 3BXGA 1OLUB 1MH1A 2ERCA 2IWRA 4EA7A 3CRNA 5DHAA 1E66A 2HTFA 3F6RA 4MUEA 5AFSA 4KDCA 1RIFA 3CNLA 1FW8A 2VTVA 4I6JA 3GGSA 3F3YA 4X44A 4MW1A 4BZPA 5JXJA 2X15A 3LPNA 2AMLA 3FAZA 5CFNA 5KTNA 2JLXA 1ULUA 4DC9A 2YIVX 1IMOA 3PC6A 2R6GA 4ZTUB 2GBLC 4L2IB 3TTYA 5EE0A 2Z1NA 4UPDA 5I6DA 1RLOA 1VBMA 1KOJA 2ODTX 2PS0A 1YZNA 4CNBA 1S9HA 1H65A 3K9QO 2A6PA 4QDJA 1YCGA 1UFQA 1LRJA 3T9AA 5HYVA 3LL4A 3K70C 1PNRA 2GK6A 2BEVA 3N7UA 2II6A 4HAXA 5CW1A 1OWPA 3MCVA 4R2HA 2WUGA 2H4WA 2JFYA 3GVXA 4YK7A 4GZ5A 2GAAA 3LL7A 2AC7A 2HMWA 4MVJD 2ARKA 2YFKA 2D0DA 2JZCA 2ZSBA 3DTYA 4K6GA 3EQ9A 2PH1A 2WVAA 1QU2A 4URXR 1CJSA 4E46A 4CIWA 2HXYA 5LPNA 2GXSA 3SYLA 3NWPA 1V11B 5F1YA 4K05A 1TKBA 3BJMA 1DAKA 4GI2A 1BJTA 4P92A 4N3CA 2QUAA 3QWIA 4J3FA 4LDRA 5DTJA 1MQ8B 3COWA 1OXSC 3BH7A 5FR1A 5G53C 4J9VA 1JTEA 5EA2A 1L5NA 2J4CA 4B4DA 1EI9A 5FA8A 3CKKA 1VPTA 3H0CA 3LDGA 4HGRA 5B1IA 5T64A 4OHVA 1IVYA 3TLEA 4BNIA 4RTJA 4N7BA 3DMGA 3EQZA 1A4UA 3I8XA 3P0EA 4PQGA 3B1YA 5A02A 1YA8A 1SU4A 2G9RA 3BDVA 3QXGA 4CR8A 1RC0A 2MMGA 4D45A 2O2SA 1JAXA 1NJFA 3BHJA 1UR5A 4YJFB 3RU7A 4E5NA 2P2SA 2IYOA 3OKFA 2WINI 4O4JF 3UMSA 1GP2A 1E2HA 1I9GA 2XSZA 1K6XA 1R7RA 1ORWA 2A94A 1DJNA 5A3SA 4B40A 3ZN2A 1HDGO 1CRQA 1FFAA 3EFEA 4M60A 3UQYS 1S3GA 2XXAA 2LDXA 3OQNA 2H3EA 3ZWVA 3PZRA 4MYDA 5DNEA 3DDOA 1Z7YA 1VG9B 3C6BA 1NASA 3OAAA 3TZCA 1KDRA 3ETJA 2B4AA 3FTQA 4PLFA 3RRFA 1WZUA 4JZKA 3R9XB 3SF8B 3ZHYA 1UKAA 3N3BC 1RT9A 1MAWA 3PXBA 5SICE 1ODFA 4BNKA 3I58A 2CNWD 2YZMA 2J0VA 4DRXB 4NMWA 1P5JA 3LDFA 5EEHA 4ZREA 5FLEX 2YZNA 2NU7A 4HN2A 2JGKA 3KKQA 4TM8A 5K2MA 3RRMA 3MFYA 3Q7RA 1UXHA 4H27A 3BXOA 2REBA 2NZ2A 3H65A 4D25A 2PGDA 1FXUA 1KFEB 2H92A 2LKDA 2XNJA 1DB3A 1SC6A 1EJ2A 1T26A 2EDAA 2QRLA 4H59A 2EFCB 3QLEA 1NV8A 2JK1A 2OGTA 1EE2A 3DKKA 3D0KA 2DMRA 4WOBA 2OFPA 5ALEA 4W5QA 1CULC 4M46A 1MB3A 2YVQA 4LCJA 3IT1A 2H2DA 1SUDA 2PMFA 1S96A 3G8YA 3M5WA 5EKDA 1VCOA 4CEJA 1U2PA 3KQUA 1HL7A 2F8SA 4LX0A 3U7EB 4KR7A 3QFCA 2NO7A 4F4IA 1NDUA 2UZAA 4W99A 2JGMA 4W7SA 2I65A 1BHQ1 5ESDA 3V00A 2WAXA 1C3XA 2HMYB 1J5XA 2J3EA 2YYSA 1DFHA 3C6QA 1T43A 3ESXA 2VAVA 5AW3A 1YR2A 4QUEA 3HKEA 3BMXA 3DO5A 2BM9A 3SR0A 1X7WB 3BILA 3GLHA 5IWCA 3L9WA 3R7FA 3KEGA 2J07A 3AJRA 4OO3A 4D98A 2Q0XA 4C2BA 4D46A 1KYQA 1VCHA 1EM6A 3NNNA 4WBXC 4X6XA 1IPFA 4ZO4A 4D9JA 3KX2A 4V0KA 4E5DA 4O3MA 5IAOA 1KMNA 2R8OA 3PHLA 4D79A 3MTBA 2ZUWA 1E9AA 2H5JA 4YXFA 2I6TA 5CA1A 4KE7A 1FSFA 1G5PA 1KA9H 1KZ9A 4YRTA 3HVIA 2VXYA 1XP5A 3GWZA 1PT9A 3P5SA 1IY9A 2ZVQX 4NYJQ 4ETIA 4S1VA 2EBHX 2WTNA 4R8VA 3A28A 2PZGA 3LPLA 1YE8A 1SRRA 1Q6YA 4DBLC 1TA9A 2VJAA 2O8CA 1UH5A 4QZVA 1XVVA 3QKWA 1VGQA 4J7XA 3BQ9A 4MYUA 2FZ4A 5TQ0B 1XYYA 2QTAA 1GPNA 1OGIA 2N1BA 2EAUA 1JN0A 2UVPA 2XUZA 4BQPA 3KDAA 3IHWA 2QN6A 1E1YA 3ER8A 1OHHD 5CX1A 4W1SA 2EATA 4U2EA 4V1CA 3U3JA 1GQYA 3OCYA 4G63A 4J0CA 1A1VA 1TO2E 4Z6KA 5KYTA 3E2MA 1HDEA 5GVRA 4DLYA 1TTQB 2FWNA 4BASA 3NLLA 5C18A 1JBQA 5AM4A 1X1AA 1LJLA 4BKUA 4YRAA 1O0SA 3L0ZA 4QC2A 4FMDF 4CM6A 3AKCA 2EFHB 2FSGA 2VDKB 3NVKI 1P0MA 2GARA 3L7OA 5HX7A 3HR8A 3QMVA 4PNHA 3UAOA 1UIRA 4CG0A 1SXPA 2LXNA 3HTXA 3TSCA 1X7HA 4KAXA 1N33B 4JDPA 4JLAA 3IP8A 5KYNA 1E7SA 1I7LA 2X1VA 5FFMA 1EGMB 4R8RA 3T6KA 3WRVA 5KDLA 1Y7HA 1T4MA 4QJ3A 3ER6A 3ISVA 3NIFB 3PUKA 5LLTA 3DMNA 4OHOA 1DQSA 4WINA 5LP6B 4JVMA 3DZDA 1YQQA 5J47A 2OB1A 1ELOA 1L4LA 5C1OA 5DN6D 3TJRA 5CT9A 4L4YA 3QKUA 3BBLA 4M1OA 5KYYA 4FTWA 2WSBA 1HBJA 2UZ0A 2VO1A 3A0UA 2O6HA 4Y6GB 5EUCA 3QEAZ 2QGNA 2BKAA 3B8HA 5ENVA 4OM8A 4BQQA 3DO6A 2RGXA 2FUCA 3ROPA 2B98A 3I4CA 4IZOA 4KAAA 3VU1A 1YB4A 4EJ2A 3EUWA 4IGAA 4OJNA 1GSHA 3MC1A 2L69A 3JZIA 3KYDA 3P0HA 1UZMA 3CWZA 1I1QB 4AUMA 1NZFA 3CVXA 4CGZA 1RI4A 1AN0A 2X8AA 5EZYF 3L7IA 2CL6X 3MGBA 2TYSB 3OX2A 1YKGA 2IYPA 3F5QA 1P2SA 1SVWA 4XRRA 4ZI7B 4PSUA 1PR1A 1P1FA 2XAAA 3UC5A 4AJNA 3PRYA 1RAAA 2UZIR 3DOUA 1WX1A 1YGPA 2UVPB 5G0UA 2F67A 3A3KA 2BCEA 3NIGB 5CNMA 1XPRA 1FJXA 2OD7A 3OPXA 1B41A 3OKAA 1J1UA 1TVKB 1NXVA 2LWIA 3R41A 2D0OB 1BOFA 2NV0A 1RJGA 3SZRA 4EGFA 2BGLA 1FSZA 3M5PA 4I4NA 2GWHA 2BP7A 5T4FA 1KPIA 4RVFA 1BHJA 1DAIA 2VBIA 1JYSA 4J1QA 4OMDA 1OX6A 2D0IA 2FPMA 4QUHA 4S35A 3IB3A 5LL6P 1KSJA 4HY3A 1SFRA 3DB1A 4BP9A 4D4KA 3ESCA 4MW0A 1RBQA 1MVOA 4UMFA 2IHTA 5FDFA 4H1TA 4GW3A 1IQPA 5CBKA 4JITA 4V24A 2FEKA 2JAQA 3GDGA 3GRKA 4AYWA 5JMOA 2FLKA 3G89A 1PZEA 2ORVA 3QVTA 4TRJA 4H31A 2P2YA 4ITRC 2ZAOA 2XB8A 4GLLA 2A35A 2AVNA 5T4BA 2FLWA 4NC9A 1TU0A 2AS0A 4ZAXA 2Z95A 3EQ8A 4K8OA 4W9MC 1EQ2A 4KLZA 3MGGA 5A4KA 4A26A 5HE8A 3NBKA 3PXXA 3PR3A 2QUBA 2QNIA 1D9XA 3UMGA 1L7RA 3QHQA 1NLYA 3V3TA 3NHMA 3PHHA 1VHWA 4ZZIA 5AHRA 3CLUC 3WWPA 1KTIA 4D9KA 1D4OA 3LP5A 4EWLA 4Y9TA 4LF9B 1QONA 1Z0IA 5IVIA 1VL2A 4F3NA 1R8QA 1M2WA 2Q2NA 4R2WA 2IUYA 4BBPA 2B1IA 3AESA 4Q4JA 4ZO8A 1I7PA 1M75A 4R6WA 3K7EA 4RYLA 4FFMA 4J2HA 1NUQA 1XUOA 4ZOLB 4W8GA 4GSKA 1U5BA 1G0OA 1YL5A 2V6GA 1K5PA 1W5SA 3ZQ4A 1KC3A 4UFNA 1KIAA 4DCMA 4JJIA 1DCTA 1D7OA 3JQAA 1BH2A 3N8NA 4LTMA 4MEAA 5JQGA 4TOIA 2ZR9A 2G08A 2ZSHA 2AZ4A 3A3OA 4PQEA 3LU1A 1SB9A 3HMKA 4MR9A 4YRFA 2JGDA 2OCGA 1GLVA 5G1PA 3JSAA 1WMSA 2BISA 4BIIA 4E09A 2VYVA 4I1UA 1BMDA 2GA8A 4MHOA 1HLGA 2F1JA 2Q07A 1E32A 3NW9A 4IIEA 1T6BY 2G5PA 1AHNA 1V8FA 2LIPA 3VZBA 1T2CA 2BJVA 2OBFA 2O1WA 5JANA 1FP1D 2NAFA 3WGIA 4FYHA 2C5HA 3IXLA 2BRUA 2CLMB 2I87A 1BDIA 1V3QE 1YULA 3UANA 1YF3A 2ZYVX 3LYAA 4YGYA 5CB4F 4Q9DA 4EUNA 4EHFA 2PO7A 2EZTA 3W5SA 3W9UA 3BJZA 1HKHA 2IYQA 5CEEA 3BL6A 1T34A 3G5UA 3O90A 4R69A 4U3JB 2OORA 1LPPA 3N8GA 2FWAA 4WFKA 5EJ9A 3R8XA 3B85A 1CRZA 3EH1A 1PJZA 2BHLA 1ZMXA 2G09A 1KMCA 3EF1A 3O03A 4UBJA 5HSGA 4NHEA 1F3OA 2XUGA 3N2KA 3PSAA 1FLAA 3P2YA 3RV4A 4OFXA 5IK2A 3PJEA 4QG3A 3DZ8A 1SCBA 3GWGA 2BH2A 4K9QA 1OZFA 4MI9A 3OT1A 3VSDA 2HA2A 5IFKA 4QVIA 3FIJA 3IL2A 1XROA 1I4EB 2GJAA 1J0XO 2XDQB 4D57A 1J8DA 3T15A 3TTXA 2XA1A 2EP5A 1V8DA 3AQ4A 1GTVA 4HDNB 4LK3A 1HDYA 5KVAA 4AZ0B 2QPTA 4LRUA 1GT91 4I46A 4M0UA 4DCNA 2CWDA 3PVSA 1JHZA 1N0HA 3MWKA 5J2UA 2WYHA 3U4GA 3VR5A 1Z4MA 1JIXA 3AUAA 3PCRB 4EHNA 1J6UA 5ADHA 2GOYA 4F4DA 1PWHA 1QHNA 1TC1A 1UC8A 1XEWX 2BI8A 1HFJA 1SVSA 2DY1A 5JO9A 3RFUA 4EJSA 4UFPA 1U8AA 3KSRA 4RKEA 3THXA 2HY7A 1R4MB 2QV7A 3IESA 3S5UA 5BYKA 3COJA 2E5LB 3AERB 4XKJA 2CY0A 4LGVA 1BKYA 2ZIZA 2PRJA 1CJTC 2YHIB 4CPDA 3FDZB 3M34A 1EXVA 2R5NA 4QARA 3OIVA 3E9MA 3ZIDA 4BRWA 3CLVA 1ULHA 3KKEA 4KPGA 3CT6A 2H1VA 2JJ1A 4NEHB 4PO8A 4BB9A 4N0DA 1FTGA 5JMPA 1M0SA 1XKLA 2ZAIA 3OOYA 3MAJA 3EULA 3PHIA 4D0SA 4K2HA 1CY7A 2FKAA 2GF2A 3TNDA 4KYTA 3E8SA 4LSWA 2VZEA 3GD7A 1XLUA 4E21A 2Q3CA 3SJ7A 4NJEA 2C2ZA 5DDIP 4LMPA 3IAM1 4XCXA 1QZXA 2D5IA 1BSVA 1BWRA 3BIXA 5A9RA 4JP3A 3P2OA 4QTZA 4U7GA 1I32A 4Q4DA 5FXMA 3F5SA 3I2FA 3FFAA 4NBKA 4LGYA 4QVKA 1T9GR 2F55A 4ZCRA 1H94A 3FN4A 5DSXA 1R6BX 2FX5A 5K0BA 3G5LA 2LE0A 1R10A 2G76A 5KUTA 3EWAA 1A77A 4OQ4A 4D3ZA 3TW8A 3WGVA 1I2CA 4MDYA 2XF2A 2PV7A 2J3MA 4YRZA 1H6CA 4OXRA 1FVXA 1IN4A 1T6ZA 3GT3A 3NPMA 1LSSA 3U3RA 2WD7A 4A27A 4ND5A 5ABPA 1O95C 1JEYB 5HKAA 1GITA 2C42A 2IYYA 1E9SA 3H7IA 1ACLA 4IF6A 4TZTA 5FP0A 2WOOA 5T3YA 3TIIA 2X4IA 5KYUB 3QVJA 5B2ZA 3BIWA 3EG9B 1XPOA 4H6PA 2B34A 2XUJA 5ANRB 1WEKA 3GAZA 4HI0E 3EZ9A 3M4ZA 3OKPA 3W6PA 1ONPA 1X9HA 2VKTA 2JVIA 3QE2A 2FH5B 3GXBA 4EUFA 3DCIA 3SLRA 2Q5QA 3DAGA 3RC7A 4ALLA 1T0BA 1FX0A 4E6PA 2C4UA 3AESB 3OJCA 5GTDA 4MWCA 1YHYA 3JD2A 2YY7A 3L7DA 2I71A 5KOHA 3B6KA 1HG1A 4G1FA 1FS5A 4LTDA 2XB6A 2BKXA 3HB5X 4OQEA 1V1JA 1IPHA 3L7CA 2XDWA 2HA7A 2AFHA 3TPCA 2Y0BA 5IEJA 5D7NA 1P7ZA 4GKKB 3BMCB 4DHWA 4J6EA 3LPMA 2HLDA 2IYAA 1V26A 1X87A 5E95A 4CLEA 4F3KA 2AOXA 4BTEA 1TM5E 4OKNA 1K27A 3TB6A 3TL6A 5IJ9A 4MV6A 5J2UF 2P6RA 3ET5A 3PPIA 5DN9A 3WYEA 4DF3A 5SZJA 3GFPA 1TEXA 3SC2B 2YBDA 1A9ZA 1KFBB 2HJVA 2MIIA 4TLLB 2ERYA 3UH0A 1HTBA 1GTG1 2GTIA 2Q6OA 2R5FA 3DJFA 3ROEA 1X14A 3MBKA 3HHPA 3IP5A 2D6FA 4DBZA 3WDLA 1BX1A 2FAXA 3IT2A 1UT6A 3G1UA 5FBRB 4JLVA 1B43A 1WTAA 3OICA 2PS3A 3L4EA 4R9VA 3BMOB 1COWD 1Q3HA 1XN1A 1NQOA 2R66A 3FSEA 4QUIA 4RKQA 3CJTA 1ECCA 2YZ2A 4UJ3A 3H5OA 3SD7A 2GFIA 3IB6A 2WBLC 4TL8A 3OX4A 4WIAA 3JSXA 3VOAA 3WHPA 1E3TA 3DC2A 4CHTA 4YRSA 5FYQA 4F45A 4KWCA 2RK6A 1G8PA 3K31A 3EN0A 1LWOA 4I4TB 3H9BA 4XWGA 5LR6A 3E7XA 2PNFA 3EW7A 5BN5B 1XQ6A 3K0CA 4OBWA 3HXTA 4UXJA 3VVMA 1VL5A 1CT9A 1J1IA 4UOQA 4RESA 1E5TA 4MA0A 5JPDA 3ZWNA 1JLRA 2P90A 4CBVA 2BELA 3I1FA 4OATA 3KZOA 4NOLA 5KDDA 4NNOA 3CGGA 4D0NA 1US8A 2FUG1 1JSXA 4WERA 4B3DA 2IHNA 3PEWA 4Y2PA 1LA2A 4BO7A 2XUQA 2J87A 3JQBA 4Z99A 2J0UA 5CCDA 2HEGA 2WU8A 1MFZA 3AC0A 4H6VA 4IDFA 4OYRA 4LV8B 5EE5B 2WYVA 3PLNA 2C3MA 4OOFA 5LYJA 4B32A 4CL3A 5A62A 2BWJA 3MMXA 1W19A 2QW8A 2BMVA 2XHZA 4KAJA 1R88A 3RSOA 5C3MA 4RJIA 1U9CA 1CS0A 4TV9A 1R4MA 1AOXA 5HS4A 4NP6A 1L5WA 1C7RA 3PL1A 4C14A 1T25A 1Z15A 3HI4A 1CQIA 2CFTA 1QG4A 5EESA 5A2GA 4J1TA 1LPBB 4G1EB 1GTZA 2ZRNA 4GM4A 4UXHA 4V0QA 5BV1A 5CBPB 1GG2A 2VUHB 4PPYA 1QMGA 3B3AA 1BS9A 3QF4A 2CSXA 1QYXA 1UXGA 2VRWA 3ZDEA 1J90A 1LPOA 1U8XX 5B2EA 2NSLA 2X58A 4R1SA 3N74A 3HCNA 3IQHX 2EARA 4KFRA 4JJ7A 5IMBA 1L2TA 1JG1A 4OF4A 3HFSA 3O73A 4O2AF 3VPFA 4BZQA 4DSUA 2GCGA 2OAGA 1OTHA 4JKOA 3CUWA 1E1NA 1JFFB 2HPVA 1NMXA 3V34A 1ABBA 4WK2B 4HAIA 3IE1A 2AE2A 1U1IA 5EJ4A 1P2UA 4CMGA 5A5VA 1GPMA 3Q2OA 5GINE 4JXXA 3L8YA 1CCWA 1R3UA 2WB2A 3H6GA 4A1FA 1RTTA 4JX8A 1I7DA 1Z0AA 2G0TA 2VHYA 1VMKA 1FU7A 1JHVA 2PKYX 5LQSA 4ZVUA 1E1MA 4KLAA 2NUTB 1JAIA 1QRSA 4XUEA 3K2BA 1ZGBA 3CRW1 2Q2WA 4HC4A 1OXTA 5F5NA 1F1JA 2X0RA 4DUGA 3EEYA 4B7AA 2Z56A 1DHTA 2IZ5A 2MYTA 4CIXA 4LJSA 4CGYA 4DM4A 4H7HA 1UMBA 5E6RA 1MFPA 4KREA 4DLPA 3EXHB 2GEJA 4A8JA 2IYRA 1V8ZA 2O1EA 4P34A 1AT1A 5JAPA 2HC9A 2VAMA 4PBTA 1MEOA 2RARA 1Z5ZA 3VZCA 1W0JA 1C80A 2O7NA 2WNSA 4FJ1A 4ZU1X 4EUSA 3OOEA 1B0AA 4IJ5A 2PKXA 3OEHA 1YR7A 4CV2A 3T0IA 4DM7A 3A4TA 1DIGA 3DMTA 4MVJA 4DUYB 3NM4A 1YHNA 3CF4G 3FCAA 5E9WA 3RI3A 4DQXA 3RYCB 3VU3A 2LDBA 1IWBB 1VJTA 1Q44A 2QZJA 4N7RA 2PTHA 4AJ4A 3ZQJA 2PQ0A 3ZNPA 4E2ZA 3DL7A 3STTA 4P83A 2XHEA 3N2NA 1NOJA 5AW5A 5KQGA 1PHRA 1TYAE 3UO8B 2XZLA 2R1VB 1E64A 2UZ1B 3H8VA 3KT8A 3LGSA 1DAOA 2WRZA 4EHHA 4US0R 1SKYB 1T6YA 2X5NA 3I9JA 2WMOB 5FO0A 1RYYA 2IRWA 5E38A 2ZIFA