4DAEA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 6-chloroguanosine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
232
structure length
232
Chain Sequence
MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase deoD-type
total genus 80
structure length 232
sequence length 232
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4daeA00
4BMXA 4R31A 4DABA 1Z37A 4M7WA 3TL6A 4MARA 3C74A 1PF7E 2A0WA 4D98A 4YMLA 1PK9A 3KHSA 4M3NA 5JPCA 3BSFA 3LA8A 1A9SA 4NY1A 3O6VA 4DANA 4GKAA 5B7QA 2PGAA 1NC3A 3ODGA 4WKBA 4TS9A 1VHJA 4JOSA 4MCIA 1JE1A 1Y1QA 4L5YA 1NC1A 1C3XA 1Z38A 2OECA 1T0UA 4UC0A 1RYZA 3FB1A 4GMHA 4TXJA 1ECPA 4KN5A 2I4TA 2OC9A 1K3FA 5B7GA 1A9RA 1SJ9A 3F8WA 4OGKA 1JPVA 1YQQA 4PR3A 4ECEA 3T94A 1JYSA 1LVUA 1JE0A 3FAZA 1VHWA 2QSUA 2XRFA 1Z39A 5F73A 1RT9A 2P4SA 4F3CA 3MB8A 3K8OE 3INYA 1ODLA 1RFGE 5IU6A 2A0XA 1QE5A 2HN9A 2BSXA 3LBAA 4WKCA 1Z5NA 5CXSA 1U1GA 4MCHA 3IOMA 5F78A 4OF4A 4FFSA 2ON6A 4YJKA 3UAZA 1PK7A 3GGSA 4M1EA 5CCDA 3D1VA 1PW7A 5F7XA 4LNAA 4QATA 1PR0A 1Z34A 1PR5A 2AI3A 2B94A 2A8YA 2QTGA 2A0YA 2RJ3A 3P0FA 5IFKA 4DA6A 3E9ZA 2QDKA 4OJTA 1Z35A 4TTIA 5KB3A 2Q7OE 1ULAA 1B8NA 5K1ZA 4D8VA 1JDSA 1RCTE 4TS3A 5EPUA 3OOHA 3P0EA 4OY3A 3IEXA 1YR3A 3O4VA 1ODJA 3KUKA 4WKPA 1TGYA 3EMVA 2QPLA 1TD1A 1SD1A 3OZEA 4TXHA 4BN0A 1M73E 3FUCA 1WTAA 4P54A 5EUBA 1RXUA 1Y6RA 4QFBA 4R2WA 3KVYA 1U1FA 1VMKA 3OF3A 4TTJA 1U1DA 1V4NA 5EFOA 3GB9A 3PHCA 4I2VA 3SCZA 4DA7A 5CYGA 1V41E 3EUEA 1TCVA 1JDTA 4GLFA 3OZBA 1LX7A 4WKNA 1T8RA 5CCEA 3EEIA 1N3IA 3PNPA 1OU4A 1V45E 1JDZA 4LKRA 5F7ZA 1RXSA 4GLJA 1ZOSA 1A9OA 1VFNA 2ISCA 1OTXA 4DA8A 4JP5A 4BMZA 3NM4A 2I8AA 4F3KA 1PR2A 3PHBE 1PR4A 2IQ5A 3DJFA 4L0MA 1PBNA 3FOWA 4JWTA 1Y1RA 5DK6A 1TCUA 4E1VA 4L6IA 3OCCA 4TXLA 1PR6A 4H1TA 1OVGA 1JP7A 1OUMA 1B8OA 4TYMA 1V48A 4EB8A 1ZL2A 4G89A 2GUWA 4QAQA 4G8JA 5B7NA 1Y1TA 4DAOA 1PKEA 4G41A 4WKOA 3BJEA 4K6OA 3DP9A 2HRDA 4LDNA 4TTAA 4EARA 2AC7A 1A9TA 1CG6A 3U40A 1I80A 1JDVA 3FNQA 4TXNA 4OGLA 4F2PA 1U1EA 1OTYA 2OC4A 1K27A 3UAYA 1CB0A 1LV8A 5C80A 3PNSA 4DA0A 5F77A 4OEHA 4R2XA 1NW4A 5ETJA 1ODIA 1V2HE 1Y1SA 1ULBA 1ODKA 2H8GA 3OOEA 3LGSA 4F1WA 1YRYE 3DDOA 1RR6A 3EUFA 4NS1A 5CYFA 4RJ2A 3FWPA 3DPSA 4QARA 1PR1A 1XE3A 1Z5PA 4DAEA 3K8QA 3KU4A 1A9QA 5F7JA 4D9HA 1A9PA 4F2WA 3UAVA 1RXCA 1U1CA 1Z36A 2OXFA 3OZDA 1SQ6A 1Z5OA 4QEZA 1YQUA 4U2KA 5F76A 1OV6A 3ENZA 3MMSA 3NBQA 1T8WA 4TXMA 4PNPA 4D8XA 1K9SA 3NM5A 4LNHA 3BL6A 3E0QA 3OPVA 1Q1GA 4YNBA 4YO8A 1RSZA 3DF9A 1FXUA 3OZCA 4NSNA 1SD2A 3UT6A 2HSWA 3UAWA 5FAKA 2AI1A 4L5CA 1YBFA 4X24A 4IP0A 4QASA 1Y6QA 4D8YA 3KVVA 1V3QE 5F7OA 3KVRA 1JDUA 2AI2A 3ONVA 4L5AA 3BGSA 3E9RA 1T8YA 5CXQA 1A69A 1TGVA 3NM6B 3UAXA 2QTTA 5I3CA 1PWYE 1T8SA 1Z33A 3QPBA 5B7PA 1RXYA 4LZWA 4BMYA 4DARA 1G2OA 2HWUA
chains in the Genus database with same CATH superfamily
1ISGA 4C2UA 3BN3A 1P72A 1I0ZA 3D0OA 4V1CB 2OGSA 3UT5B 5AKIA 4CEHA 1VKJA 3U7FB 3LUBA 3JRNA 3R9XB 3W5DA 3VR5A 4MW2A 2ZOSA 4MK4A 1Q7BA 3R7FA 3FSRA 1YC5A 4OATA 1HV8A 4WY8A 4RWEA 4DIEA 3H1GA 1E3JA 4DA9A 2WIFA 3ZS8A 4EB0A 1UR5A 1GG9A 1RLTA 4KITB 3R7NA 2VHQA 4AJJA 1IZZA 3ZQJA 1R8YA 2OSVA 3C41J 5I5EA 3FPKA 1SKMA 2OCBA 3HDYA 3L6DA 1WE2A 1S4MA 3KWMA 1O95A 2RGWA 4D26A 1MRZA 4RVHA 3LA8A 1KDZA 3AJRA 4NC9A 4G0NA 2OYRA 5JEEA 4MS3A 1JHOA 4V0QA 2VRNA 3EXFA 4QRIA 4MUKA 2IODA 4DJEC 5AVUA 3D6TB 3CLVA 1ZD9A 2WOOA 3FR8A 3NORA 2SCUB 1VHJA 5TQ2B 1NATA 2WMOB 2VRWA 3VMFA 4EL0A 3GG2A 3PFFA 1JG7A 2NO5A 5AI8A 1TT7A 1M0EA 4AKGA 2QLLA 1ZMXA 2X4LA 1N0WA 4BNGA 1Z6AA 4ITUA 4XGRA 1X7GA 3ODPA 2BSQA 1QHHB 2SCUA 4D79A 1TKAA 3BGDA 5FTKA 2YIVX 3JZMA 3P9SA 5IKOA 3TQOA 4W5WA 5TMEA 4RSHA 4AKHA 3BQNB 3TVYA 3JARA 3UMJA 5BQ5A 4X65B 4OI4A 5JLJA 5JSZA 2C88A 2E48A 3IE2A 5K8JB 3NRJA 1KRHA 4F0JA 1U02A 1ULSA 1AQUA 1RYZA 1Y3DE 4G07A 4B3CA 3NTOA 3AR9A 1X3SA 4ND4A 1I9GA 2QLFA 5G0VA 3E9MA 3P52A 3TLBA 3M4YA 5CDTA 2GN1A 4ZV9A 1ZICA 1B0ZA 3DE5X 4GFDA 1L9KA 4OHOA 2B2XA 1FA9A 3RI3A 4BQEA 5C1IA 4EYQA 4BNWA 2HV9A 4HXGA 2K7ZA 2CNOA 1CUUA 2W11A 3Q8LA 5CA0A 1CR4A 2WKPA 1WCYA 3B8HA 4UOEA 4J1TC 3A6DA 2FWRA 3JQQA 1XMQB 1DCFA 3MIIA 3MTIA 2YMLA 1XZLA 3OJCA 3PXAA 1CFJA 4M9UA 4ZQBA 4OK3A 5GQSA 2EKDA 1NJFA 1SBQA 4Y9UA 4ISCA 3RODA 3SM3A 2C98A 4JHXA 3GH1A 4TT8A 4Q4AB 1E0DA 2J33A 5KOYA 5ALKA 1IQRA 1Z2NX 4WK0B 2IDZA 1YS2X 1GM5A 1W5BA 3CR7A 4R1LA 1N6HA 1IN7A 2P9BA 3MRXA 2PAFA 5IM4A 3PQFA 3HHPA 3M1IA 4OBXA 1ISPA 1VCOA 2PT5A 2ZFUA 1Y4DE 5CUQA 2H6EA 4UM5A 3RK0A 3RU3A 3WB9A 4H3VA 1IBMB 2G8LA 5J63A 2DH5A 5E6UB 1DQZA 4C29A 4FSHA 5E0KB 3M1AA 4YH1A 5L3ZA 3QLVC 1F12A 1DWQA 4C3UA 2D1FA 1Z4NA 2PTHA 1AO3A 2R7NA 3OA0A 4AJLA 1WBDA 2AKEA 1IZ8A 3OZAA 4Z5XA 3H5OA 5EPUA 1R4MB 1MOPA 4A8JB 1J25A 4US2R 3QJGA 1Y3CE 1CEXA 3ZWMA 2WF6A 3T61A 1JB9A 1KPHA 4YCSA 2AMFA 1G5RA 3E5NA 3GJZA 1KO4A 2ZRIA 3CW9A 1C7IA 2ZYAA 3PR1A 4KJZA 4OJNA 4P83A 2GQ0A 2G09A 2ZJ0A 3UXMA 3VR6A 5BN3B 5AVRA 1NAIA 1KU0A 4LI0A 1FTYA 1OLSA 3QF4B 3U3ZA 1ISSA 2L82A 1EP9A 5I7AA 1YCFA 5ER9A 3SSAA 1PL0A 1U5CA 1T4CB 1KI7A 2ZRJA 2W48A 3HU5A 1PU2A 1KQPA 1V0JA 2I78A 3EBOA 1LB1B 4RMHA 4RUKA 1C9DB 2EERA 2GYVA 1E2NA 3ECAA 4I1OA 4KXNA 1KQNA 3ROTA 4FCWA 5LP6B 1ZM3A 2Z58A 1XXHE 5ENDA 3PNLA 1IWBB 1U5BA 1WUHS 1FX1A 3GJ4A 5D1NA 3A0UA 1L7BA 4YS6A 1G9SA 4M38A 3OM0A 3H9EO 5CXXA 5TS3A 3TLYA 3SIXA 2VO1A 1E9BA 2GUGA 1EP1B 5FBQB 3TD2A 1ND5A 2DKFA 3AJDA 3CT6A 3WICA 4AJEA 2IE0A 1Z75A 4HNAA 4EW2A 5HTOA 5K2OA 3F5FA 1ULAA 3OKAA 2YJNA 1NU6A 3NT2A 4G4GA 4CUKA 1BMFD 4R3WA 5FOTA 4JQZA 4EFMA 5CA0F 2R6FA 1K66A 1MN6A 2J67A 4Y2TA 4TV8A 4XUDA 2ZJ4A 4A6EA 3U31A 5KYKA 2ZWIA 3AERB 2QPLA 3V33A 1Y6JA 2QYOA 1UMBB 2P5UA 2XMGA 3PYMA 1BC5A 1Q22A 3CMMA 3L8DA 4N5HX 2ZRFA 4DBLC 4EPTA 3D31A 3C1AA 3FRIA 4JOBA 5ALTA 1IHDA 1LV7A 4M9RA 4MKHA 4ZEWA 3O7MA 4J6EA 5J58A 1R6TA 2ZANA 1TRKA 4CM9A 4Y2PA 2EFGA 3P8ZA 5H83A 1CUEA 1R15A 3MSXA 1B8VA 3WQBA 1XYYA 1XZGA 3DOEA 2WIJA 3HVKA 1IBRA 6YASA 3OJEA 1EZZA 4NBNA 4YC7A 4EI8A 1CPYA 1XMOB 4MA4A 2ZR9A 5K5EA 1N75A 2PMFA 2RK3A 4O08A 5KYWA 1UPTA 1O6BA 1JA1A 1K63A 1RWQA 3FUTA 3W05A 4FB4A 4FTWA 1TB4A 4AJ4A 5K51A 1CULC 4BEJA 3F4KA 3OAAD 1YT5A 1H69A 3H1AA 3HM9A 2ZT8A 2R7KA 3BRWD 4WLFA 1XTBA 2F1IA 4C0BA 3OHPA 3CRVA 1Q15A 3B2NA 3F5SA 4CLHA 5TLSA 4KXWA 6ABPA 3PX7A 1RU3A 3MD0A 3PHLA 4FMCF 4KV9A 5HIMA 3R8CA 2WPDA 1KP2A 3X44A 4N6NA 2QM3A 1RZ3A 1CUYA 1N6RA 4KYUA 4U6NA 3T1QA 4D6YA 3LSYA 1U28C 5CCEA 3U0BA 4EPWA 1Z7GA 2IXAA 1P9OA 2GS9A 4KV7A 4MJ3A 1Q3KA 2ZB8A 2G1KA 3C6MA 1LDYA 4MTLA 3FOZA 1FW8A 2RKWA 4PC6A 3PEYA 3HYLA 2QJWA 2ZS7A 2ISCA 1Y0BA 3EGXB 1QCYA 5J1TB 3F7NA 1T5DX 2R2GA 2HQSA 5ES3A 1JLSA 3QBTA 3FKSA 1ZJ5A 3ZWCA 4RSMA 1AX9A 4H7KA 4YDRA 1XTIA 3Q8KA 1F17A 3HDGA 2WI8A 3O4IA 3OBIA 3AFMA 1YNOA 4GI1A 3ZCXA 1J8MF 4D4GA 2GTHA 2VDJA 5ADVA 5GP1A 1GVHA 4PYKA 2NUAB 1IUPA 3O03A 2B99A 1HZZA 1A7JA 3DXFA 2W2VA 2Y1FA 1DTSA 1SU4A 5LDHA 2ZB7A 4DV7B 4LUCA 2FN4A 2NUTA 2Z83A 2BEKA 2E0IA 2L42A 1Y89A 3H4IA 4AURA 4I46A 1UBOS 3UWPA 4I3HA 4WGFA 4E94A 3IKJA 3TTSA 2OTCA 1OXSC 1XPJA 4G8BA 4MMYB 3SN6A 3EZLA 4B2YA 4OH7A 4GOOD 1U0OC 2HCBA 3IPXA 3MYRA 3V7FA 3HKBB 3ID6C 3O8DA 3WK6A 1SC6A 4MYRA 2YYYA 3HKCA 3CFYA 1LS6A 4XJTA 4C0WA 1XHLA 4E5MA 4BASA 4QDXA 4TYMA 3DG9A 1WB4A 3IQWA 3MCTA 2FRDC 3F73A 3JQGA 1XXHB 3JYLA 1KI1A 5FJIA 1GD1O 2O5RA 4DY6A 2J4DA 1GXSA 5HPYB 5JH7B 3EXIA 4LK2A 1CQIB 1G5TA 4NMXB 5B7NA 1O96A 1P1BA 2R6DA 2R85A 1UC5B 4L8YA 2FP3A 3EMBA 3VM6A 3VR2D 2ATIA 4G1EB 1XDGA 4QAJA 1GRNA 3A37A 2ZBGA 1AZWA 3LQFA 3T7DA 3EXG2 2J3QA 2ATXA 3K70D 1A71A 1SU6A 2PLAA 1RWMA 1H8ED 2WICA 2GZ3A 3PD1A 5IRCD 5CIQA 1PLKA 2WPDD 3LY8A 2CNLA 4CM3A 5BUZA 2I6FA 3DOJA 1CNEA 1HT2E 1MLDA 1YR8A 3HA5A 4RMNA 3VHXB 9MHTA 1J00A 4KE8A 4ZVMA 1YWGO 4XYMA 5BWOA 3DFFA 2QL9A 5IT9A 1KOGA 4R1MA 2I2BA 3AJAA 1IJEA 4EGCB 2YJZA 4IGAA 2WIKA 3SM9A 3MQ2A 4G2TA 1E3IA 4H0NA 3JQ7A 4AQYB 4UBOA 3SXUB 3O83A 3W3AA 2XYGA 1E1YA 4OIMA 1E2HA 5BOVA 3BFJA 1ADGA 3Q4GA 1KC3A 4Y2JA 5BSMA 3RRXA 4F2PA 5BNFA 2EHDA 1H8HD 1VPDA 4TWAA 1D6NA 3T15A 1QHSA 1SVUA 1JR3D 3HKEB 1H66A 1AD2A 2ZJYA 1Y3BE 2YJGA 1B3BA 3IAM1 3PPYA 4O4HA 4OBWA 5F2KA 5FPKA 3CJRA 1DJNA 1BXRA 2F1KA 5F77A 4YROA 4R81A 1O58A 3EG9B 4OI1A 1CF4A 2AW5A 4LDRA 3TR6A 3A4IA 1KOFA 3QJYA 4B6SA 3AUTA 4G37A 4I5EA 1AS3A 1T0JB 2A86A 3OCJA 2B36A 3ZCSA 4OV6B 2Z1DA 1ID1A 3U09A 5I45A 3P0JA 2ORVA 2AKAB 3CVJA 1L8QA 1R64A 1QWSA 1XA4A 3CUWA 4PU0A 4CKWA 2XRZA 3VYUB 1U7WA 3ESQA 1BYIA 1ODKA 4LJKA 5J23A 1PJQA 2YJ6A 4FFBA 3A10A 4ZZIA 2P2YA 1RZUA 1VIVA 4ZJPA 4IH4A 4IX9A 3RRYA 3T06B 3TI7A 1PR1A 1XD9A 2HO5A 3CE6A 3FYUC 3OU6A 2AG0A 4O2AF 4BNDB 2JAQA 2O06A 4TTTS 3N8IA 3REFA 1V1RB 2VHVA 1SVIA 3BD8A 3RO7A 3L4SO 4PSUA 4FMDF 4EOGA 5BXQC 1MO3A 2X9GA 3PRYA 4CKZA 3I42A 2XSZA 1C4OA 5HRUA 1YIDA 1EVKA 2OWEA 2ZVPX 3BK7A 3D3QA 4FILA 3GJRA 3BWVA 3Q3EA 3R3WA 3TLGA 1HFEL 1E4VA 3RANA 4F2WA 4B48A 3T3OA 3Q11A 4GGPA 4QYIB 4TSFD 1PRYA 1SZCA 4HAVA 4M88A 5E8JA 2CK3A 1NKTA 1RDFA 4HX5A 4IRUB 3ORHA 2IYTA 2OZLB 2XUPA 1BW9B 1T3LA 4FGUA 3QUTA 4LXIA 2NZUG 3QELA 1ORVA 4DHWA 2QXUA 3DTYA 1YCHA 2BFEB 2UU9B 2IP2A 3AF1A 3G0IA 3W7BA 2ZJ6A 3TMYA 1XZEA 1KS9A 5BSTA 3GMSA 4GG1A 3DMYA 1AGXA 5BNTA 2IC5A 1K92A 2ZXFA 1UZUA 4CV1A 1K2WA 1XQ6A 2NG1A 4UUOA 1KXZA 1VM6A 5AXAA 4AJ9A 4PGGA 5NLLA 2MYNA 4R16A 5B4UA 1AKMA 1O94A 1C29B 4AZ3A 1YAJA 3E5HA 1J0AA 4MV8A 1P17A 4ZAVA 3UH0A 2UUAB 2PWZA 3GARA 2OENG 1UOOA 4ZHSA 1RWVA 1V3UA 1NVBA 3DV2A 4KIJA 2NUPB 1XA0A 4DMUB 1KJYA 1FEZA 4EI7A 1UMCB 3BE8A 4X85A 4LYAA 4N1AA 4B35A 3ILHA 3A9UA 3S70A 2G28A 2ZBEA 4R01A 4DDKA 4C3OB 5KX5B 1QPZA 2RGUA 2OGTA 1P73A 1VYUA 5JSYA 3K31A 5K6AA 3BTUA 5HKOA 4OSEA 1V11B 4LJ5A 1BOOA 2GCPA 1KMHB 3F9RA 3GGDA 1H1DA 3I3OA 3JSAA 3LM8A 3SVZA 1RJWA 2CLOB 1XP8A 4JYZA 1RMTA 3B6KA 1NMZA 3LBHA 3WGHA 4EG6A 2LVBA 2WILA 1D04A 4MRAA 1GNTA 3GVPA 2ZTUA 3NHMA 1EE9A 2F1JA 2WFMA 3W77A 2NZJA 3CF4G 4OQ4A 3MXTA 2GZAA 2VP0A 1WXWA 3O8BA 4NZPA 4BNLA 4D4JA 1ZX1A 4MICA 4RMGA 4Q93A 1VL1A 1JH9A 5G41A 1CRWG 1Z68A 5EG5A 5C8YF 4AKEA 1HMPA 2WKSA 3CWQA 2H1SA 2OVBA 5LYJF 4JENA 2BI7A 4QT0A 4JVMA 1SQFA 1QFZA 3HFJA 5FR2A 2D7CA 1G21B 5CXUA 4IOJA 3TR0A 3KAPA 1YDEA 3ZVRA 3L04A 3I61A 1TYZA 3KWFA 3KVRA 4LXXA 5TY0A 3SK0A 1WZEA 4R54A 1FTNA 5IXJA 4BAUA 1ZNQO 4ES6A 1QF6A 4LISA 2B37A 3DBHA 1KFJB 3EZNA 3NHLA 2COUA 2Q3FA 3EEYA 1SC9A 4J1NA 1GT91 1N6PA 1IMJA 2EWMA 1P9LA 4O59O 4MV9A 3ZXXA 5KC9A 3U19A 4TKZA 2YC2C 4XFKA 3E9RA 2OB1A 4O33A 2DHDA 1XP5A 3G23A 3KYJB 4X1YA 2AN3A 1EFAA 1FDTA 5TDHA 3OY2A 1G0NA 2G88A 3ABQB 3AF3A 3C7KA 5CLIA 3UYLA 2H1OA 1X8XA 1T8SA 4CR6A 1Z83A 2HBZA 1PVVA 3QNMA 2I4NA 1N0VC 3SFZA 4IIBA 1L5YA 5HQ3A 2VL7A 4IQ4A 1SH7A 4MWBA 1JVBA 5EUMA 2ZYTX 4RIEA 5HRCA 5AT1A 3KSAC 1NXVA 3HU2A 4IDDA 2ODAA 2GX6A 3BFVA 1I2BA 3DEHA 4QOSA 2AC2A 3SLGA 1WMAA 4XD7D 3DMFA 2OHGA 3DZFA 2XYQA 1DRKA 4R31A 1DQRA 4J7AA 1A8HA 3B2EA 4M7WA 3T12A 4AJNA 3G8BA 4I66A 3DE7X 4BFZA 1L5SA 4RGVA 2A0WA 3N8DA 4KXQA 4MR9A 4ALJA 1PQ4A 2PXHA 4BO0A 5AQ1A 2CXQA 6PFKA 3T1YB 4M3NA 1TUBA 2X5XA 5H59A 1GNRA 4BOYA 3I64A 5TMPA 3PYXA 1VJGA 3NDIA 1LLUA 4IJQA 3ESZA 1QK5A 2GPSA 2WD7B 4BVJA 3NCHA 2Q1TA 4D9KA 2HDOA 1BG6A 3ZY4A 2VJNA 1KWKA 4AJPA 2EIXA 5FORA 4G63A 4D74A 1M1NA 4Q37A 4PAMA 2VUTA 4AS3A 1F51E 3MAGA 2P91A 2IEGA 2P9FA 3HVJA 1OFUA 3F47A 3MHPA 3M6LA 3PUWA 4TKMA 3RS5A 7REQA 3K9LA 2LUOA 4HAYA 4BVBA 4LWPA 4FFDA 4RPKA 5JD3A 4JI7B 4XI9A 2Q7XA 3DJYA 1MRNA 3HO6A 3QXGA 3RVSA 1G8JA 4QHYA 1L7RA 3IR7A 3V4VB 1RHRA 4XWGA 2ZJ2A 3TQQA 5E95A 2JGDA 1CRLA 1UH5A 3RT9A 1YQGA 2QUHA 2PLRA 1OA1A 4URFA 5ALLA 1ETHA 1C1YA 2A7QA 2QP3A 4MYTA 4B0PA 1FUUA 3R9WA 1KZ7B 4QGBA 1RBZA 1M33A 3JVEA 4PX5A 4JI1B 4JCOA 1KJ8A 4RPGA 1XU9A 5EWJB 1YJBA 1Z26A 2HGSA 5E8RA 1VKZA 3UB3A 1GGKA 3UCEA 3X1ZA 4ZGBA 4GU5A 3GRCA 4ZO4A 2FPXA 3JYHA 1C5KA 1E8NA 2CJFA 4MV6A 5LDGA 1N34B 2EGGA 3FTPA 4MVJH 3UK7A 1DUSA 1R3DA 1T2CA 1Y5IA 3UMGA 2GBLC 3A28A 3B6ZA 3E1GA 2BP7B 1Z74A 5AUPB 2X5JO 5LMNB 4C1NA 1Z73A 1EX7A 2ODQA 4LHXA 1WCIA 4NLLA 3OCVA 3AEYA 3ZLBA 5EERA 5B7GA 3KDPA 1A1VA 2HF8A 2ZBUA 1YDWA 1HMYA 3DXXA 4XJSA 3MMNA 2UKDA 3FBGA 3QTBA 3V4SA 3VZBA 5I4CA 3IXLA 4S35A 5CX1A 1OBOA 4XVHA 3GFRA 1EVLA 3VAAA 4MAFA 4ABYA 3P97A 2DUWA 3LZDA 3DQQA 2X19A 3Q6IA 4UPEA 3NVMB 5F5XA 2ZIUB 1G6OA 4LC9A 3UUGA 5IPFA 5LLSA 4TKUB 4BMSA 1J1IA 1B0UA 4MQ6A 4IDCA 2FUKA 1A4RA 1BMQA 1EFVA 2ZWMA 1U6JA 5G1PA 3YASA 4NYJQ 4YRDA 4BUCA 4YIHA 4FM9A 4W5QA 4IVPA 4ZOLB 4ZQFA 3MTAA 4GYWA 3VH1A 3K9FC 5FA6A 5TQVA 2ZRAA 1KI4A 4UHKA 3I76A 4COKA 5KVSA 1USGA 2I0FA 3LBAA 2ECPA 3PZBA 4IXTA 2HLDA 5LQKA 3K6SA 5HIIA 3QX9A 2UVPB 3S2GA 2ZR7A 3ZK7A 1M8JA 1LBSA 9LDBA 1SEVA 2B30A 1BKYA 4CW7A 2JK0A 4URYR 2YV2A 3UJDA 1MX5A 3ZJUA 1AMOA 1CDDA 3KEOA 4QHSA 3JQBA 3T3EA 2CVZA 4QD3A 8GPBA 2GM9A 2O8VA 2PMWB 4L8WB 3MINA 3KDSE 1JXOA 3TE6A 4B75A 5DNCA 5HIJA 2FCRA 1PCXA 2IY8A 4E2ZA 4NCHA 4ZTZB 3DGFC 4B9AA 3VSDA 2V45A 1HO3A 4EDFA 5TEVA 2P3QA 3RFCA 1JJIA 3RTGA 6CHYA 4ETIA 3TG2A 3EHDA 1RRMA 4IO1A 1Z0KA 1NLYA 2A3RA 2JGRA 4Z2YA 2C83A 5DTRA 4DLRA 4QQKA 4F2HA 5MHTA 3LYHA 3FNRA 1S6YA 4U4AA 4MPTA 5HF9A 4M8KA 1U0LA 2BMWA 3O2NA 3Q88A 1ZW1A 3RFTA 3QU5A 2ZQYA 3HCDA 1IDOA 2IH4A 3LBFA 5CDUA 2Q6KA 2MOKA 1DAFA 1AA9A 2WQZA 4ZI5A 4DR1B 2V6JA 1MBZA 2XMBA 2VPPA 3WGGA 3QV2A 4RULA 4EY3A 4K2AA 4AMYA 2BCEA 1WMEA 1EE1A 4MUIA 4DA6A 3E2IA 4TLCA 5IYZF 3RVPA 5CFZA 2AHOA 2J5RA 3TQHA 1QRUA 4URUR 2R751 3CF2A 5C9ZA 5M2QA 2AJDA 3SFTA 4UXHA 1SUDA 1UJCA 4HGYA 1LDMA 1NIJA 1Q11A 1RP1A 3IA2A 5D5PA 2I1QA 1T35A 1XKQA 1Y33E 4GMFA 4DIMA 4ZDJA 1AQ6A 5IJXA 4RTNA 2PRIA 5E4JA 3QPVA 1QOPB 2IYWA 3DDHA 2UUPA 4JR0A 1UT5A 1NHWA 1YMUA 2R1VA 4FI3C 3HJCA 3MWJA 2HSZA 2KMLA 4HPWA 3RBAA 2PZFA 4YMGA 1TYCA 4YV1A 5F52A 2P7HA 1C81A 3W9BA 3DHVA 4BUZA 2DR3A 4A4DA 2MYUA 2DAPA 4UCXA 2BGIA 4BN0A 3IIKA 5AD1A 3EPHA 2FSFA 2EJBA 3SHQA 5DHUA 4EEKA 3LHIA 5ICMA 2VP3A 3JQ8B 4G4SP 2K7FA 3DZ8A 2Q27A 1CUGA 2D2VA 1U1FA 4NULA 2XKJE 3K94A 1ZRMA 4QDKA 5H0IA 3UW1A 4P3XA 3OX1A 3G2HA 1IJFA 3PVCA 2VJPA 4L27A 1HT1E 1I3CA 2V7BA 1DNPA 2WWHA 3EOAI 3VKWA 2FYTA 1W4LA 3ND5A 4V03A 5AUNB 3U56A 2D2XA 2GZDA 1LPMA 3OSUA 4L9SA 3WHIA 4BMPB 2I33A 4PRLA 3GA0A 5C8XA 3ZJYA 3CTMA 3O93A 3TXYA 3GZ4A 4Y2YA 1W85A 3PFCA 4M7PA 1V16A 4DJTA 3T5GA 4IKPA 4YAWA 2X14A 1E6UA 5JNSA 2A35A 1TEHA 5AM1A 4QM6A 3TOCA 2XTJA 1IIRA 5JXJA 3E7FA 3NEJA 1T9KA 3JYOA 1P8AA 2C61A 3BICA 4DB2A 3FKJA 3TZEA 5DMHA 1P2BA 3D0KA 4I4TF 5JZVA 1U65A 1IY0A 5C52B 5C8YA 3HV0A 4YJ3B 1EGMB 3DAHA 4NPAA 3T5PA 1A9OA 3UZUA 3VAYA 5DLPA 1MP0A 1B7GO 3DZIA 3PKZA 4UJ5A 2GEDA 2YWEA 1XRSB 4HNGA 2XHEA 5JO0A 2AOUB 2MR6A 5CCBA 1M8FA 2LNDA 4ZI7A 3HL0A 5BMOA 5JO9A 1BA2A 4ASUA 4DSOA 4IVQA 1HKHA 2CV1A 4DIOA 2C5EA 5JD4A 1J8QA 1RBQA 1WD5A 2IPXA 3L0DA 2LDBA 1GKYA 4QTXA 2VDVE 5CLQA 4E30A 1GDTA 4JFRA 3GFBA 4DR3B 1FOEB 3PDCA 1CFZA 2VATA 3CSSA 1C3JA 2TMDA 2J08A 1NF2A 3HBNA 1BVYF 2JI9A 4L0MA 5EE9A 5LA6F 5H1YA 1X7XB 4F60A 1WXXA 2HK6A 3UT5A 1QGUA 1UDAA 2WTXA 1N2IA 1E2QA 3OFNA 5T8KA 3VISA 5IBCA 5IWCA 3DO8A 1DJPA 3BK2A 4J0QA 2K6GA 2AJTA 2ZRPA 3VNAA 3UWDA 2H4HA 4FNAA 1E79D 4HDNA 3IQDB 5TJHA 3Q2IA 3EPPA 3P5BA 1DX9A 4JD5A 3WJ1A 5IT4A 5EEHA 2BMEA 1K7FB 3KSMA 1GUZA 1JBKA 1NONA 1T9GR 3UFXA 4D4IA 3F7TA 1OOEA 3UK0A 4EUKA 2UYOA 3M6AA 4HDNB 4LV6A 2D5LA 2IOFA 4PLCA 3QF7A 5IT0A 2WG2A 1V3VA 5KYVA 4DM3A 1QRSA 1Y7LA 1EGAA 1AHIA 1TM7E 3PRKE 4KOAA 2QTCA 4NCKA 1IN1A 2C2HA 2JASA 4HGZA 3DP9A 2PR7A 3EIXA 2QLJA 1U2QA 1PGJA 2QMHA 4KFRA 3VR4H 5T8KC 4R9UC 4PPNA 3MOGA 2C5FA 3A11A 1K7YA 3EFOA 3OM8A 3BF7A 3KQTA 3L7JA 1VMAA 3T0FA 4BDTA 3QKSB 1OXKB 4BNHA 1N9GB 1FP7A 5KU7A 3OJLA 1DV2A 2RCYA 5JSZB 2R87A 1HDOA 3CE9A 3EIEA 3IDAA 3FNQA 3NBZC 1ELOA 3IRVA 2PPVA 1HFKA 5HZMA 5F64A 4KPYA 1QYWA 2BKVA 3F49S 2BKLA 1JAIA 4RLHA 5IF9A 1TCAA 2QM8A 1H42A 1K27A 3UWOA 3OX4A 3K6JA 1S2OA 1I0LA 2F3TA 3HN2A 5EP2A 4JL8A 5D7NA 3GLGA 1TT5B 3DPUA 3L4EA 3SVTA 3R3VA 3OE4A 2BKAA 3IUBA 5G3ZA 5BWNA 5CEEA 3R9IA 2MSWA 4IDBA 4EMBA 4XARA 1IXZA 2PS1A 2CXXA 1DQNA 1NQOA 2V9PA 4K3UA 1P3DA 3C97A 3IEUA 5C8ZA 2CFIA 2AR9A 3IAM6 1GDHA 4B4UA 3PC4A 4ERXA 3GLGB 1ZAYA 2CDBA 1W88B 2PH1A 2VXYA 1EKXA 5ETJA 3GFVA 3Q7IA 4L74A 2ONKA 4FX2A 2Y27A 4CTJA 2IXBA 2VWGA 4Q4LA 2J5BA 3ESYA 3MTJA 3UJ3X 2HMTA 2P2DA 5TF0A 1J8FA 4F45A 2H4ZA 5ALSA 3UHPA 1NSFA 1RR6A 2HF2A 2JA1A 2OOSA 2Z56A 3JTEA 1LFAA 1IY1A 1XRLA 4NYJR 4AJ1A 5CA0B 2VK4A 1NLZA 2FPIA 4KMSA 4E5DA 2VQ6A 3NKVA 4DV2B 1AQIA 3IO5A 2IJGX 4TMXA 4DMKA 3EUWA 1N2XA 4OXRA 1RI3A 4FR5A 1TVMA 3VZRA 2JIZA 3GQVA 2QZ9A 4B47A 5CLFA 1N5JA 1GGHA 1GPDG 1M2GA 2B2CA 2IX9A 4ND8A 5JCJA 4BBZA 4DQLA 4J0KA 2QYSA 1U2RA 3K0FA 1KU6A 2WSLA 1CE8A 2EIHA 3IURA 4W5OA 2RGEA 5CLLA 3ANSA 3FUWA 3LXRA 4BVKA 1EVIA 4YJFA 5ECDA 2VP2A 4F1KA 5A05A 2ZJ7A 1E1KA 2HRCA 1G8FA 4US0R 3OLCX 1XLVA 3KAKA 2I03A 1U9ZA 2XBUA 3DE3X 3KSUA 2AK3A 2ZIVB 2GJKA 1KMHA 2O6HA 3STXA 4E07A 3IDFA 5DV9A 3NC4A 2WDPA 1AQNA 2V5UA 1N36B 3IX7A 1UT8A 3CINA 2WTAA 5KJFA 2DBRA 1WDKA 3K5IA 3VJLA 2V4UA 3LFTA 1BXZA 1E0AA 2NYRA 2QQEA 3ENZA 4P8RA 3HVHA 1ADYA 4TXMA 4QDUA 2F59A 1KO1A 2QSJA 1EP3B 1KJQA 1MJFA 2ZRMA 2RAFA 5ECYA 4RVDA 4EHJA 4LVCA 5IEJA 2OP0A 3H99A 3IOEA 1HRDA 1NIPA 5FWYB 5J47A 3ROKA 3OQIB 4QECA 4LF8B 1WLYA 4L95C 4I1VA 4XM1A 1H9AA 1W4ZA 3V48A 3FMGA 4C4OA 2JZCA 5KEIA 4B4WA 3LRXA 3W04A 4DR4B 4J1TA 1G8KA 4JLJA 3U26A 1E3TA 2HHHB 3II6X 5YASA 1IC6A 3WGYA 3IHTA 2RK6A 3UGKA 1A5TA 3N87A 3PEVA 3C8DA 3I37X 4HL6A 2FN7A 3K0CA 5K09A 2R3SA 5ERXA 1CWUA 4C7XA 5KDDA 3GJQA 4LXQA 3DDZX 4AS2A 3CKMA 1C0LA 1AXEA 5D2CA 3I52A 4TV8B 5KWIA 3DWIA 2H16A 3V1MA 2X4GA 4TKVA 3SHTA 2RGXA 1CXZA 1D2RA 2P6OA 4IP0A 1X1RA 1UFRA 1WAMA 2WW8A 4LDJA 1BRTA 5JJCA 3L8YA 1UBFA 6REQB 4ZC8A 3F9IA 4GAEA 1KHTA 4TKVB 1QVRA 3R4CA 2DE0X 4YJ3F 2B5VA 4X62B 1J56A 3T9AA 2DM6A 4MR7A 5KNLA 4YBRA 1JVSA 3GLRA 1SC1A 2P9CA 4XXHA 3RKUA 2KPOA 3IT0A 4UEWA 2QA5A 3RSZA 2DP4E 1YQDA 1B6GA 2ZS9A 3FFXA 3MJCA 3PU6A 4MCJA 2WF9A 3EVDA 3MWDA 4ZODA 3A9WA 2SKDA 4UHHA 2Y2VA 4Z7OB 2QLNA 4UMDA 4D02A 5JHGB 4Q19A 3NIDB 4N0MA 3GLFE 4OOEA 3FPBA 5G02A 1EGVB 3E81A 4HB2A 5U1PA 1KYQA 3RTBA 5AKHA 4FUQA 1QS0A 3IMFA 3UAXA 3Q41A 4RV9A 3DDNA 3G7UA 3KE9A 2Q5LA 3EC7A 2V7UA 3DCNA 1EU1A 1RRVA 1E9CA 1JDPA 4O4IB 1N5DA 1ESCA 3GQBB 3M81A 5B7PA 1U1IA 3QE4A 4GSYA 3G1WA 1ZIYA 1HUQA 2LE0A 1G17A 3N0WA 4W8HA 3UB2A 1ZKDA 3JZIA 4LZWA 4Q9DA 1JS1X 1AHNA 2G9UA 2BHTA 2ILTA 3WGVA 2O7VA 1QXSA 1XD2B 1XNGA 3AJ9A 3MK31 4KXYA 2BC9A 1HDEA 3TFWA 4B9EA 2MHCA 1CY7A 3GNSA 1AXRA 3HWX1 1UK7A 3OFND 1P2VA 4LOIA 4YRFA 4Y8VA 4ZVSA 5LA6A 5JEDA 4A15A 2IEBA 3QMVA 2ZSEA 5B53A 2GTIA 3C74A 3GCDA 5HUQA 2H2IA 2WG0A 4HATA 3TSYA 2IXDA 3WXMA 5J4KA 1BNCA 3AR3A 1IHUA 4BBAA 3KHSA 4FYWA 2E1RA 5IFLA 1JQKA 1P44A 4PZLA 3HP4A 5DM4A 1C41A 3RRZA 5H4GA 5JECA 5MGBA 5EWJA 3PDJA 3PC2A 4UVDA 3OZWA 3LHSA 3QFTA 2IW1A 1JKJB 3HJBA 2LXNA 4ZQHA 4CDNA 2C3UA 3E4CA 2AZDA 1L5HB 1M34B 1P2FA 3O6VA 4D9FA 5BP7A 2O50A 2ADFA 3MGGA 4OB6A 1Z3CA 1VL5A 2EV9A 1QLJA 4YQEA 1NJSA 1G7RA 2J7KA 1ZOLA 4GVXA 2A5JA 2Z3ZA 1U7OA 2I3GA 3K0EA 1IN6A 5DMXA 4YCMA 1DJMA 4EZIA 1IONA 2V6MA 1P6UA 5TNXA 1WL8A 2B0JA 3RHZA 2Y8EA 5GONF 4ENSA 1KE2A 2EW1A 2NUTB 2AN5A 4DMMA 3PIDA 3GA5A 2D4HA 4YGYA 1LFDB 1F6DA 3JV7A 4D0SA 3QOFA 2WUDA 4XCVA 2Y1GA 3ZWQA 4FEYA 1T0UA 3ZUGA 3VJRA 2G3YA 3L1KA 5IABA 4PYOA 5DCYA 3IKMB 1D9XA 3NUQA 1T1RA 3W9UA 1U2GC 2O2HA 1SVWA 2E1PA 2XNKA 3USES 4ENVA 1XPUA 3KLBA 5HVNA 2BF4A 3ESCA 3FTCA 3JRWA 4FN4A 1AMUA 3RYCA 1NW7A 1XEWX 4HN4B 4M55A 1EFVB 2ZYVX 1BJTA 4KXFB 4CKCB 2QHXA 5D87A 3MJSA 2A4KA 2F8SA 2ODEA 4Q9LA 1B15A 2IZ6A 3K4HA 3QVGA 4YPFA 5AKJA 4HZIA 1U7TA 1DIAA 4QOJA 3UMVA 4TMTA 4DJDC 3WGIA 4MW6A 3L5OA 1UWLA 2RHHA 3ICQB 1QCCA 4V2UA 1XZDA 5BWCA 2ZIWB 1TE2A 3LW7A 1YUBA 2HREA 2BLLA 3ENKA 3F8WA 5AIBA 4YRNA 2P6MA 5DB4A 4BV2A 4V0ME 3IAS6 5AOVA 5L8VA 2CSXA 2GBCA 4CZ2A 4RPJA 2GEVA 1N0UA 4OFZA 4LWZA 1RD4A 1S5PA 2DWUA 5AQEA 1QO0D 1ZJZA 3CLKA 3RROA 2OE2A 4HWRA 4ZAZA 4F3CA 3X0DA 5JVDF 3JQRA 4LOAA 4TVBA 3WK7A 1J09A 4JYCA 1XMVA 2FEKA 2ZPAA 4ZVVA 3EZFA 1LDBA 4S0XA 1LUAA 1QE5A 1MDFA 2XAUA 3DOIA 3P26A 4WESA 3C6QA 4OHFA 5BQFA 3RC7A 3WO1A 3ZY6A 1CZOA 2WNIA 5H4HA 5JR3A 2VWQA 3CG4A 4UD6A 1P91A 1GUAA 3MS2A 3DOOA 3IOMA 3UAGA 3D2LA 3WRWA 4HWTA 4BFXA 1HXHA 4JUIA 4OF4A 2GM5A 4RDHA 4UKDA 1CUJA 6AT1A 4JELA 4JMLA 1E7RA 2WHPA 3ZKAA 3EG9A 1WZCA 2CFOA 4FSDA 3CUTA 3EGWA 4N0DA 1XTSA 1PEYA 1CIJA 3SICE 3T0IA 1P0FA 1TYAE 3TVTA 4QQNA 4C2TA 2IUYA 5K3DA 1CKEA 3D1VA 1Z07A 1Z45A 3FOCA 4XLZA 1AY0A 2YYSA 4KN9S 4RKQA 1QP8A 2XGGA 4ENPA 4Z1MD 4KJXA 4RD3A 1RVV1 2J87A 4N6OA 1GZSA 4F71A 4JC4A 2FA9A 4UHEA 5JNTA 4AWXA 3Q87B 2CE7A 1VECA 1P1IA 4ZMRA 1QGZA 3I5MA 3QFRA 2EKQA 5EP3A 4GXRA 5AW4A 2JD0A 3DWGA 3RVNA 2XBMA 2VQSA 2GB4A 1P0IA 2GVDC 2E82A 1YC2A 3ESAA 1UKEA 5EY5B 2NTJA 3RSFA 4CIAA 2NPFA 3AL0C 2W2KB 1XQVA 2YVAA 4M1KA 3O4GA 4PFQA 3F74A 2B4RO 2RHRA 4JBGA 4NZYA 5JVDA 7ADHA 3CXUA 3E9CA 3LKVA 4FMBB 2EGUA 4F5WA 2A0YA 2I9KA 2BMDA 2B83A 1TW3A 1XU4A 2C2YA 4IQFA 2ZBQA 4QL3A 5LM3A 1M0SA 2B0CA 1CSEE 1JA0A 2X2FA 4CL2A 5FWNA 1ORHA 4PQFA 2PKRA 4M86A 5IAOA 4A0SA 2M1XA 3STYA 1EK5A 3PEUA 2G5GX 2NO1A 1YJXA 3C5WP 4YXWA 4AWBA 4C4ZA 3GYBA 1AK2A 4LZLA 4Y2SA 3DZBA 4IXWA 4Z51A 3I6MA 1NGSA 2OR3A 3JPYA 2GRAA 1C3LA 3L18A 4INOA 2BFEA 3LV8A 3OOHA 2W8BA 1MRSA 2WUGA 3M83A 4M9ZA 4R8RA 4ENRA 4NF2A 4TZ0A 5IP5A 3IKTA 2D8AA 2W6ZA 5KX5A 1U2PA 3CKLA 4M1SA 4KI7A 3L4BA 3DE1X 3L3BA 4ZQEA 4L78A 3FWKA 4Y2HA 3UKDA 4MYHA 3R9KA 3PC8C 1BS9A 2AH5A 2HQOA 4KO2S 2PHZA 2P5SA 3NTQA 4FVTA 4ZEOA 4ZCRA 2D2IA 5AM2A 5B6PA 2EW2A 1PJCA 3W1WA 2DERA 4YAFA 1CERA 1KZ9A 1SKUA 1M2JA 3O0DA 3B1FA 4WOPA 1F1JA 1GCIA 3L7MA 5CDYA 4QFBA 4X84A 5KREA 3VPCA 5FBHA 1MIOA 2C8JA 3ETHA 4YJ3A 3KVYA 3ESDA 4MDFA 3COVA 2LCIA 4NBLA 1DUIA 2RGDA 4XE5A 1TK2A 4C21A 1P45A 1U3CA 1LI5A 3ENNA 3IKVA 5F21A 4UUQA 2LGJA 5EVJA 2PYZA 3X1JA 1A2KC 3ORFA 3RE1A 1RAEA 4B3FX 3EOZA 4GMGA 1X15A 3NTRA 2IH5A 4W5TA 4FZRA 5A1JA 2EG9A 1ECCA 1SHTX 3Q0IA 5CYGA 4QTUB 1LPSA 3MFQA 2O14A 4EB3A 1W46A 1YV9A 4YT8A 1DOAA 2FLVA 2RGAA 2VOJA 3D54D 3RJZA 1OH6A 4JLUA 5JC1A 1NVXQ 1OGJA 2A9RA 1DIOB 4OXNA 1CJCA 3QKUA 3SDZA 3VPDA 4Q4JA 2HL6A 5LUBA 2QGZA 3TQIA 1RTTA 1NN3A 4H7IA 3UK1A 3EEIA 4W5RA 1DAHA 1P9NA 2NO0A 4OG2A 3W2TA 1U9CA 3OI7A 5KYUB 2F4VB 2NW6A 4MNTA 3F8TA 2NU6B 4H6XA 5LZ5A 4CDMA 4X90A 1RPAA 4P22A 4Q4JB 2YNMC 2XE8A 1FYDA 1UBHS 3T95A 3VO8A 1OE0A 3B2QA 4JX8A 3ZX5A 4V1CA 4U7FA 4HB0A 2F8TA 4ND2A 3MBIA 3ELBA 3HA3A 1T3ZA 4NR0A 3U39A 3AZOA 4I19A 3I58A 3DVQX 1W0KA 1KYXA 4WLOA 4J0IA 5BRJA 4A27A 2XUFA 2FPMA 3D8HA 1EFUA 3NH9A 3FMIA 1JQ5A 2XYVA 4YTEA 2QY9A 2P4QA 1T91A 2I6GA 5J9FA 3RVOA 4KQ9A 3GMIA 3D1LA 4L85A 4N8EA 4P4TA 4QYMA 4ENWA 4R71A 3AZPA 1QPGA 4NK5A 2GPTA 2IIVA 1L8LA 1JSXA 1C0KA 1P6QA 1SKYE 3KWJA 3SYNA 4DLYA 3W4JA 3LLUA 1QVAA 1YOVA 4BUJA 3JARB 4K88A 3I83A 3SXPA 4CCYB 3FIJA 1EDOA 1M6VB 3RIMA 4E1VA 1Y3FE 1OY1A 2DHQA 4YJHB 1YNSA 1YVDA 3KQOA 3R7AA 5L7TA 2QENA 5H68A 3SD7A 4YN3A 3KEGA 2IGTA 3T3DA 5HQ3B 4MP3A 2RH8A 3WIBA 2R6ZA 2D2FA 5JWRA 1B8OA 2EFEB 3PC3A 4FW8A 4GZLA 1J06A 1NBHA 1TYBE 3ZUPA 1X70A 4V39A 2D2EA 4GUDA 1SXPA 2WJ4A 1P9WA 1VE1A 2HSJA 2N47A 3Q8XB 3S99A 4RZ3A 5JY1A 3IVGA 3ER9A 3A4MA 3MJRA 5DO9A 1JWLA 3AVWA 2PA3A 3ETJA 2POCA 3CLRD 5AIAA 4QPZA 4DA4A 1HTTA 4Z9FA 4JI6B 4DV5B 1QZUA 1Y7TA 2VYFA 2Z2JA 3GDHA 4F6RB 4XYLA 2H9YA 4G41A 2HAEA 5EP4A 3AOEC 2YWRA 1PFYA 3PE4A 1K3TA 2IF2A 1SNYA 3WKCA 4EPXA 1U3WA 2O48X 3L5KA 5JLAA 7MHTA 2KB0A 4G86A 5SZHB 1OU0A 5ES4B 3DW3X 4KXLA 4A3SA 1K5GA 5AVSA 1HLFA 3PX3A 4RADA 1OC4A 3GP8A 5BW8A 4DE5A 1U9JA 1SCUB 2YIJA 4Z3DA 5FUWA 2AC7A 2FMIA 4MDEA 3DEZA 1U0JA 3B9RA 1KWGA 3EXG1 1QO0A 1U11A 4BQNA 3D4PA 3CEHA 4MS1A 3T1HB 1APBA 1O6CA 1Q44A 3U81A 3K0HA 1QLWA 4N5MA 3UHFA 3UT0A 1OFHA 2HJRA 4U7JA 3RYFA 5JQGF 2PX8A 4CEJB 2QZZA 3TW4A 4JUAA 4DDHA 2WBLC 3IQXA 2IZ7A 1HT0A 4DA0A 1JG1A 2OO5A 1KK2A 4MXDA 4J0FA 1O1YA 5E3IA 3K8YA 1L5VA 1D6MA 3PXXA 4RYDA 1YQXA 5MN6A 2W22A 2AFIE 1O0CA 1I1NA 5B12A 3V1KA 4RIHA 3H1FA 4TMWA 4C7VA 5CW2A 4EECA 4WGGA 3LE8A 3TZLA 1EVJA 1EUDB 3PHHA 1EVZA 3QOYA 3SZ3A 1G8AA 5JW6A 2Y4OA 4LNUB 1Y1SA 1ULBA 3JD4A 3PGA1 1QGYA 1O94D 2FW6A 3QEMB 1FSFA 4HDQB 2RHOA 4IF6A 1B43A 1P0CA 1LDGA 1R0SA 4MV7A 3QRWA 3UCFA 3BSWA 4E5VA 5CH3A 1E5TA 1N25A 5CB4A 5ICSA 4JR1A 1Q0ZA 2P9ZA 2YUTA 5CYFA 2XQVA 2ZJ3A 3FPHA 5D86A 4OYYA 1YI1A 2GASA 1DBRA 3RS0A 3DFIA 4FGKA 2ID8A 1DKOA 1Q5PA 2FKNA 2PSEA 2VHCA 4LQ4A 5LOVB 1AMNA 3T9EA 2ZSFA 1FQOA 1Q12A 1IH8A 2ZJ8A 4FBGA 1JTEA 4JUDX 1W4RA 1XRPA 4IEIA 1KI8A 2ZYRA 3KPVA 2P67A 3FVTA 1BH2A 2IOFK 3WTCA 4OHXA 3NZEA 1ORRA 5LOVA 4LIPD 4JSTA 3CBGA 3T38A 1U1CA 1PS9A 4CF7A 3AY3A 4ZCIA 2IXEA 4YK7A 5DLYA 3BPSA 3RB8A 3VRHA 1V4VA 2HW8A 1RAHA 1F14A 2OZKA 3DULA 1NE7A 4PO9A 5JAQA 3ES9A 1S01A 3FOAA 1YBMA 3MQFA 1N3BA 1NXWA 3SOZA 4W9NA 2HDWA 1UMDB 2C0CA 4GW3A 1ZLXA 3Q7TA 4MPDA 4YFVA 3SBEA 3RWOA 4BEBA 2RB4A 3C1UA 5ALFA 1XTRA 5EKUA 2RC6A 4M0FA 3FM9A 4J0HA 1KEEA 5D5HA 3U62A 2OCDA 3CZPA 4D2IA 2DULA 3QWIA 4EB6B 2MINA 4AC9A 4QT4A 4H08A 4OUDB 4QGFA 5CPBA 2JFHA 4WDQA 1D07A 2X23A 4ZXPA 1ZVMA 1D8AA 1EFPB 1Z25A 5CTAA 3V2GA 3EGDB 3BWBA 4M0DA 2ZSDA 3V8PA 2H85A 3WGOA 1VGRA 5AXBA 1N1EA 4AVYA 3QNWA 1N92A 4IH9A 1NBMD 3LC1O 1W36D 3UV7A 1NW8A 2UVQA 3P2OA 5CVEA 2O4UX 2BBWA 4OQNA 4W1QA 4ZPJA 2AE2A 3HBAA 4EABA 3UJNA 2O05A 5BRNA 4AY3A 4NATA 4ASUD 3IJ5A 1Z6QA 2XZDA 4MVJM 1HT3A 2HSWA 3DTNA 2P30A 3PSHA 4YJGB 2IU4A 2M32A 3H2KA 5K7SA 2ZI9A 4TUYF 1R0ZA 5DHFA 4MGKR 1QONA 3T3MB 3IPAA 3E7WA 4XH9B 4FZ3A 5G53C 3PL5A 2IYAA 3KEFA 3M5CA 4EHNA 4YCCA 3BA1A 1NDUA 2V7XA 2Y9PB 4P0PB 5JTTA 3HSYA 3O3CA 4S05A 1W96A 2P11A 2QQ5A 3LUKA 4TZTA 3UJ6A 4DYHA 1DO8A 2NNWB 3KSZO 5FBLB 1UWCA 1KI6A 4RHXA 1G7CA 3ABZA 2A0UA 2CLKB 2P7IA 4YV0A 3PWZA 1AKQA 4CLOB 2FV8A 2HMWA 2YY5A 1CY1A 3FTQA 4DMRA 4Q1BA 3HI4A 1AKYA 3HPQA 3AEUB 4O4JF 4RJIA 4WBSA 5HCNA 4GOJA 3V3TA 2ZUFA 4E7OA 1O4VA 1GL3A 4XWAA 5F3RA 1FE8A 5EKDA 3RV3A 4CMEA 3PWKA 5K9ZA 4C06A 1C7ZA 2LIVA 5KPJA 2AK2A 1NMXA 2J6BA 5TXGA 2HLNA 2ZIGA 2AEFA 1E6KA 2BEJA 3VR5H 1RJEA 2Q0HA 4WZZA 3A04A 2RHGB 1WSDA 1FYXA 1JTVA 2GKSA 5K2MA 1ZGGA 2NVOA 4G0ZA 3HQ4O 4QDOA 3EZ7A 2O3TA 5IVKA 4WFIA 3EE6A 1BE8A 2RH9B 4KFUA 3JQ8A 1Y63A 3IVCA 4JLVA 4ODIA 4DV4B 2D1YA 3SE0A 4A03A 2RIPA 3UYKA 2HNKA 1NYRA 1O9BA 3O94A 4MRSA 1QRDA 1YUNA 2R1UA 2IU0A 3SYLA 1EPUA 3FB4A 2AFVA 2H52A 2I29A 2OLEA 4FXPA 2O8CA 3EW9A 2VF4X 3S8YA 2Z57A 4PHHA 1RPZA 4LS3A 1G6Q1 2HWUA 1ZO8A 4OYHA 5IBQA 1XWFA 3LOQA 1EFRA 3R23A 4BWVA 5B3JA 3ADDA 4IHKA 1GNPA 4KQEA 5BUCA 1M10A 4YEDA 5JZBA 1KFBB 1FXWF 2X8BA 3BMQA 3QEOA 4DPMA 1KQFA 4G5HA 2JIQA 3D6HA 1SOUA 4YRPA 1FYWA 1KZHA 3QJ5A 3VPXA 6GPBA 1GYQA 1XZHA 1L1QA 4N9QA 4BU1A 4F11A 2H1FA 4DUZB 3VU9B 4YPVA 1Q7GA 3TW6A 3PLRA 2Z95A 2JI6A 3VR4A 1CT9A 1Y3AA 3SC6A 4MO9A 2BZGA 5CH8A 3K09A 4EKNB 1K5HA 2C4UA 4QGAA 4RZXA 4BJ6A 3Q10A 4DANA 1P1FA 2QNRA 3CRQA 4BMCA 4QEDA 4UD2A 1F6BA 4Y98A 4WKBA 1ENZA 4AJIA 4C6SA 1GDDA 2C54A 3NEPX 3L0SA 2KBEA 4MCIA 4OMUA 5EJ8A 4WACA 1ZD2P 3W5JA 2XQJA 4LX0A 2JCVA 1ZWKA 4GVLA 3UJ8A 2XI4A 5ALPA 5DHAA 2HADA 4ZOBA 4CIYA 5JYBA 4LF9B 3GRVA 3MCAA 5FB3A 4R3UC 1YIAA 2KWIA 4U63A 3CC8A 3DW1X 5DLDA 4KLAA 4WD3A 5AWFC 5A5DA 3AM4A 2CE2X 3B53X 2RAPA 4X5OA 3STVA 3LPCA 4PAWA 1V6CA 4MDHA 3LQKA 5DT9A 1QVWA 2QOEA 5JARA 1ZK0A 1TXGA 2Z6VA 5EQJB 4BL5A 4UNRA 2NACA 4PLTA 3PFGA 4IX1A 4R9VA 5AM5A 3K9GA 4GOND 4WXPA 3IIMA 2WY2D 3LYAA 3O8NA 1D8TA 4LRXA 3S2EA 3TJZA 1HE3A 3ZXIA 5CEJA 3A1TA 3OT1B 4ZOAA 2PRKA 3QSGA 3HK2A 1H0RA 2RMKA 3A36A 5AW7A 4NZZA 5JROA 1F0YA 1C8LA 5E4FA 4P3KA 5AXDA 1KVUA 2XA9A 5ALJA 3ZDEA 3Q3GE 4EHFA 4FE3A 3LWNA 3OE7D 5K3AA 4K5QA 4RPCA 3V46A 2ZB3A 1TTHA 3CW8X 4KNVA 5FL3A 2RKBA 1COWD 1G19A 1PGOA 3JQPA 2RHMA 4H77A 3U16A 4BFWA 3RSHA 3KQVA 1CZLA 2QVYX 4ZVTA 1U7HA 2DWPA 5KJ1A 5D01A 1IBSA 1D1QA 2XRFA 3BIXA 1TT5A 3HUEA 3OCXA 4QBIA 3U7QA 3NBMA 1Z15A 3I6BA 2CXPA 2RGRA 3PSAA 4Y6GB 4EO9A 1ML3A 1OFGA 1PEAA 4PG5A 2BTEA 1RYDA 1I6LA 3TUJC 2ZUCA 3BL5A 5KTSA 3GJXC 4HDCA 4KREA 1LTQA 1SHJA 1Y37A 3BKWA 3LKZA 3WR5A 3M3HA 4ZYUA 5FTLA 5LYYA 4ARZA 2WB4A 3RLIA 4KR0A 4LEIA 4OGFA 5H16A 5B3LA 1W59A 4B3JA 2W6IA 4RPIA 1RQXA 2IZ0A 5FFFA 5JJKA 3QPAA 4WVFA 3CEPB 1KSHA 1M5UA 1XFDA 1U4SA 2R7LA 3BBPA 3FMFA 3D1JA 4KMOA 4WX2B 3TI9A 2C92A 4QICA 1H5NA 1W8DA 4G0YA 2XT9A 1PLLA 3U61B 1MPTA 1X8JA 3NV9A 3QELB 4DLZA 1B1CA 2DUNA 4X1IA 1FUYB 1MV5A 1XEFA 2PO5A 2ZDGA 1G20B 2BGGA 3BFXA 1SZPA 4HDMB 2NSHA 4PF1A 4PTLA 2XOEA 1VSUA 3CR3C 2R65A 3KPUA 2QAJA 1DDOA 4XQEA 2IS6A 4PGAA 3A6ZA 2I7CA 3GJ5A 1ZN7A 4L72A 3A70A 2XWBF 2OCYC 3SQDA 4Q4HB 2V7EA 3DEFA 2HCFA 4FFWA 4AZWA 1O57A 1N5KA 3A1SA 4FNMA 3RVRA 1BVHA 4GKVA 3DT6A 2B5WA 3ZWPA 2ZM5A 4PO8A 4XWOA 4X3CA 2B6HA 5FOUA 3O4JA 3DBLB 1K4YA 2V8OA 2YWGA 2C0PA 3IOBA 5KTMA 1RS0A 1XCOA 2H51A 4QVKA 5I9LA 1PK8A 3LOUA 1U5AA 3SIRA 3U7HB 3V6MA 3EGCA 2UYYA 1BE1A 3AY6A 4D7AA 2GN9A 3MSCA 1YFJA 3L7LA 3CS3A 4OM7A 1TQ6A 4EKYA 1RYMA 2FE4A 1JLHA 5FI3A 4PONA 3WMXA 4NJMA 4PTYA 3ZX4A 4EYOA 2Q3JA 3R74A 5KOHB 4WBNA 4ALIA 1JKXA 4I5FA 2PL1A 4ZO9A 4DNFA 4C7OA 4KHPB 2VEOA 2E87A 4IIJF 1EQ2A 1W44A 3CNEA 3N59A 4JUCA 4XFDA 3KZOA 3L01A 5E2AA 2FOIA 4B82A 4GE0A 4L02A 4Q24A 2QN1A 3C3CA 3Q40A 3B9BA 5IZCC 2V3CC 3GVXA 1QIFA 1G8HA 3GPCA 4DFDA 4G23A 4MW7A 2FJUA 3EXAA 2A5YB 4JNCA 4DXDA 4Z7QB 4MWTA 4UBMA 5LIPA 4MZDA 2ISSD 5I9IA 3WLSA 3WWYA 4AYTA 2O1XA 3C6KA 4R4JA 1S8AA 3M6FA 4D0NA 1YB7A 5CT5A 3G0BA 3SF8A 4DW8A 4RXUA 4TWJA 1UQUA 1JMVA 3NRCA 4PLFA 4E46A 4ZJUA 5FOVA 3K09C 1YZKA 2H7XA 4OHZA 2FX2A 4BN4A 2IYLD 2Y1EA 4BVHA 4CLRB 5JISA 3VJMA 3R7LA 5AYVA 1YQWA 1WPRA 1J1UA 1GTL1 4QUHA 6REQA 5C7OO 1LBHA 1Z6ZA 4MHOA 4XSHA 2Z8YM 1AF7A 4HEA6 3CNNA 4YMIA 2C07A 2G63A 1JJFA 4R1OA 1K98A 2CXNA 3GMDA 2ID9A 3P9CA 3DMRA 4LBWA 4R8LA 4U7WA 4TMVA 4BNUA 2C0QA 3I5AA 1JPNA 1SU8A 4I3GA 2JLQA 4LVOA 1W0JD 4OAOA 1LLDA 3QFSA 2YRXA 4B7CA 2RKOA 3D7LA 5EE3A 4JI3B 1KSJA 2OAQ1 1X9IA 4GOLD 2I3DA 4BBJA 3LQ2A 2O8DB 2WHXA 3BSYA 1TM5E 2J6CA 3KFVA 3QG1A 5EUQB 4ZU3A 3L8MA 4RM3A 1RYNA 4DQVA 3S1AA 4R8SA 2OG1A 4YJHA 2X5OA 2FVYA 1Q1NA 3K9HA 3HYTA 3DVSX 3PTZA 2BFBA 5FA8A 4CPDA 3RSOA 2RBKA 2Z3VA 2CEKA 1KNQA 4BV3A 1S3FA 2C2XA 4LGCA 2Q5QA 2ZIZA 1HDCA 3L93A 3KV1A 2NSJA 4HRAA 4ZREA 3LY5A 2QS9A 4JV5B 3GPDG 4K9QA 2ZAOA 3M8KA 1G21E 2GBLA 5E7MA 1G8PA 3VBEA 3IDQA 1A8QA 2VDWB 1SQSA 2XV1A 4WEOA 3VC7A 4HT3B 4CLEA 5DI3B 3MTDA 3H75A 1P1JA 1IB6A 1KZ4A 4X00A 5L4NA 2DT5A 2HZBA 2IHJA 4KLNA 1LD3A 4U2BA 1KZ6A 1M72A 3GW8A 4R2HA 3B1YA 3SJZA 2PVCA 3AR8A 3ESBA 4HFMA 4YAOA 3SZLA 4RQTA 3D7SA 3WGNA 1E9EA 5LA6B 1BIFA 1NW5A 2PKQP 1HTBA 1TKRA 3SWWA 3GA7A 3CUVA 4WNCA 1U3VA 1SCUA 2VJLA 4GECA 2Y0PA 1CDZA 1I36A 5L95A 1R6AA 4EJSA 1MG0A 3K2IA 2XWPA 1DT3A 1O95D 3W7VA 3PQ2A 2VJDA 4BCCA 3DMHA 2MSKA 2Q1UA 5AVOA 2GOYA 1YKFA 2JBHA 3DFKA 3LPAA 1FFYA 2J30A 4CRWB 5K8IA 3CKKA 3WGJA 4HVLA 3WKAA 4HFNA 4EF5A 1Q7CA 4QPDA 2VH1A 1PFWA 3ZCTA 3WBKA 4TL8A 3B13B 5LP1A 3EODA 3K3PA 3RAEC 2C82A 5BOSA 4NCIA 3D3JA 4CQLA 1T5TA 4DC9A 3HKDB 2ZBRA 4IIJB 1N6NA 3A9SA 4CF5A 2BI4A 4JVOA 1PQWA 2A5LA 3HKBA 4NBWA 1P7PA 1TJ3A 5FAXA 4R9NA 4C6TB 2UYQA 3KYBA 1W5FA 3TTVA 3NS7A 1OHHD 2FQWA 2XLBA 2PAAA 3JTMA 2Z98A 3QEMA 5BSGA 3K4PA 2WE7A 4LY6A 4OBBA 3FSEA 1JFRA 2JH9A 5FKJA 1DWUA 1OLUA 1V5GA 1ODTC 1DKPA 3A26A 3G49A 4QXPA 2IYUA 4RIGA 2FFBA 1K5DA 1O96B 3EUAA 4KPUA 1GZDA 4P1ZA 2GWHA 2YXBA 4AWAA 2F62A 4YLGA 4ZCSA 4RZSA 3BD9A 1AIPA 3PNSA 1UPFA 2QU8A 1R37A 2Q5JA 1XZAA 2CD7A 1VP3A 3QPWA 3PXEA 3V4RA 3QMWA 2KI5A 4KPUB 3A4LA 5FBWB 1FFHA 5CBKA 1LY1A 1YB1A 3BJIC 2EHJA 4EJMA 5AW6A 1AKNA 1UBMS 4LK3A 4DADA 3TECE 3PFWO 3PUVA 4F84A 2YC4C 5CM8B 1EFTA 2HSDA 5KNCA 1TO6A 2RI0A 4JQOA 2OV8A 6LDHA 3MHTA 3BMOB 2COEA 3PQ8A 2H5LA 3FI9A 3R76A 3LGSA 4F1WA 3ZK9A 4NZ9A 4OHRA 1JQBA 1CR6A 3O3NB 4U2EA 2DQSA 4JVNA 3RIXA 3FDJA 1VKNA 2E4YA 1RAGA 2HTFA 5FUXA 4BLTA 4HEHA 3FPGA 3A4NA 3MMPA 1VE3A 3DWFA 3H2GA 4IM7A 1T4GA 5F5LA 3ZCQA 2VAPA 3EF3A 3ND7A 4NFSA 1GZ6A 3Q0TA 4MSUA 2P1ZA 4OPMA 4PCLA 1DPFA 1KAMA 1VJDA 1RHJA 1BGXT 3USZA 3SHOA 4CM7A 4MVXA 3INGA 3V6LA 4HSEA 3LU1A 1ZRHA 2FG6C 4EHHA 2LCQA 2YDXA 4S1VA 3HCBA 3VPBA 4D41A 1CIPA 1Z7EA 3LL4A 4EQ6A 3GZTB 1MC5A 5EJFA 5LQCA 5KINB 5JRDS 4QLBA 3VVCA 5GV7A 1R4NB 3RSCA 1SUBA 2ERXA 5DEOA 1A9XB 1XMSA 3CB2A 3ONFA 4KU4A 4BV8A 1JZSA 1Q1ZA 3U0VA 4HRVA 2ZTVA 5GOZA 3VO2A 1M0TA 2MJLA 2AE1A 2JGIA 2TRSB 1PJSA 2BELA 3D59A 3NM5A 4FOSA 3WYFA 1M3SA 2FF5A 2WF5A 1PVDA 4U3JA 4FGWA 2WEKA 2XBLA 5IAJA 2HWXA 4F8EA 5L4SA 1DKQA 3HEMA 4HZUB 5FPHA 4OHUA 4M60A 3S7ZA 2EWWA 5G1OA 5TT1A 4B3IA 1QX4A 4PPFA 4EJ6A 1QC5B 4LRTB 3TAUA 4WFQA 1E0KA 3W7AA 1DKNA 1YSCA 2RDMA 5T64A 2APJA 3KOZA 2ZRCA 1ILWA 1YVUA 1AKUA 5JCOA 1H94A 1N6IA 3I1JA 4MIOA 4CU5A 1QQ7A 2YZ7A 5IXYA 2GK6A 3DZHA 1YTUA 3FSJX 3EA0A 2WYUA 1W47A 2Q3BA 4HNHA 1C2YA 1L1RA 3PRHA 3RVKA 3UT6A 3VKVA 1G8GA 5SZJA 2DKNA 1YL5A 1G1AA 1FDSA 2B3DA 3GF4A 4C22A 4S04A 1TLTA 2LD4A 4UHCA 3H86A 3S4YA 3D0QA 3PDUA 1S1MA 4F6LA 4OQDA 3A14A 5JWHA 1JMKC 3ENQA 3VC2A 2BJVA 4KGZA 3O2SB 1BDMA 3DVLA 3WQSB 1ZISA 4QASA 3C3AA 4CN8A 3ZDFA 1L3BA 3JWGA 5D3MA 3OTWA 2ZP1A 2AMYA 2YMQA 3BGWA 1WP4A 2R8YA 3TIXB 4Q01A 4YR9A 1JG3A 4K6KA 1J20A 3QU4A 2VPZA 4ACAA 5HGXA 2PBLA 1QO9A 2TMYA 3GLVA 1MT3A 3AVQA 4FMDB 3RARA 5KTPA 2Q4TA 1P0QA 2I76A 2Q07A 2W5UA 1WMFA 1SQ5A 4LECA 4AYXA 1Z9BA 1ECBA 5EQDA 1YHYA 2PUCA 3S44A 5JNRA 2EAUA 1XI2A 5CDGA 2WK1A 3DKIA 4K05A 1WSBA 2FB9A 5E9AA 4C04A 5K0ZA 3D2AA 4BDSA 5CJPA 3SS8A 1A69A 2C3OA 2PX3A 3F6YA 3KL4A 4HS4A 1LA2A 2AOUA 3NB0A 1JXQA 1AUVA 1SEPA 1CR1A 1E4EB 2J9FA 3WNVA 1C3EA 2PUVA 2VZ8A 3OLVA 2EG5A 1E64A 4HDSB 3EF0A 4WI1A 4EMTA 2YVLA 3CV3A 4DWWA 4XOUA 2HM7A 4UXIA 2OHFA 3X1MA 4YP5A 4B2LA 2REOA 1V6AA 4FGSA 5CT9A 1RC8A 3ZDAA 2J9FB 3WKEA 3OD1A 2NM0A 4IQ8A 1E2JA 2GJSA 3M5PA 3QWAA 4EVSA 3WG9A 2WZCA 4WCVA 3PPIA 2ZJZA 5U4QA 1WVMA 4C4XA 4Q9NA 1FX0B 3KR1A 2NGRA 1QIGA 3L6OO 3LIPA 2DHRA 1U0RA 4HPXB 3VYSB 3WK8A 5JS1A 3GEMA 3UKOA 5AUOB 4P98A 2QE6A 3WOVA 1FDIA 4LVUA 3LQ4A 4X9XA 3ZIAA 4A0HA 4Z4QA 3HUTA 1C4KA 1Z8HA 4M1YA 3V4LA 4QJ3A 4YRBA 1GVNB 4K6GA 4QBHA 1WOMA 1I7PA 2FR1A 4Q1VA 4MKZA 1HPLA 2BHLA 4I4LA 4X0EA 3EFOB 4DZRA 1QAQA 3UM9A 1JU4A 1NAHA 3ZGLA 2F3RA 4EPRA 1Z2CA 4QOHA 3U3DA 1DINA 1GQSA 1W0KD 1IN8A 3CG0A 3SHWA 1YRQA 4Z4GA 1XQYA 5KVAA 3OEYA 3S1LA 1QR6A 1ZA1A 3VO1A 4PWYA 5L53A 4EGJA 3E18A 2FW0A 2O3UA 4Q18A 2WTMA 3CO5A 2BFCA 4JEHA 5EJAA 2QRPA 4JOSA 1C3VA 3WY9A 2BVNA 2DC1A 4I9NA 2Q1WA 1JE1A 1LBTA 3VDNB 3SEAA 4Q66C 3RPEA 1SUEA 3C8HA 1L4YA 2IIQA 2IXGA 2PA0A 4QXRA 5E6RB 2WPNA 3N6XA 4JJ7A 4D45A 3WLHA 2ZB2A 3CZQA 2Y1DA 2O8FB 3OWXA 3TSZA 1FZTA 1TDJA 4JU8A 2V03A 1ISJA 3IPYA 5CT8A 4W9NC 3WGKA 1L4GA 4JROA 5KNBA 1YBVA 2REQB 3MERA 1P7ZA 2JKVA 1VSVA 4G5XA 4Q7MB 3SQMA 4A1OA 3KE8A 1HDXA 2BH2A 4P31A 1M1NB 2XUDA 1HA3A 5KWVA 2ZTLA 3LDHA 4NWIA 3VU8A 3OCYA 2V7QD 5FTMA 4ENQA 1PL8A 4O4LF 4RW0A 3BWMA 3RNOA 3KKMA 4WEQA 1KYVA 4PRZA 5AW3A 1E1CA 3OQJA 3R5KA 2OP1A 3A6GA 4YHHB 4TZKA 3K1AB 4UFNA 4AJKA 3HWRA 5IDYA 3PK0A 3SFVA 1USWA 5JWOA 3D6AA 1QUFA 1A9RA 3TLXA 4RIFA 4C89A 1T5HX 4TL9A 3WRYC 5I9MA 4XR4A 3ZY2A 5DI9A 3JR3A 2CXRA 3Q7SA 4PQEA 2QTBA 3ORQA 2XQKA 5JALA 3IPCA 1TU3A 4L3OA 3RD5A 2VYND 4TSRA 2CDAA 4F9EA 1EVQA 3RYFB 4KFTA 3SR0A 3SLRA 4RXTA 2FQXA 4H59A 3HSKA 3IRUA 4QC2A 5HS4A 1G98A 2QGNA 5F73A 5H82A 2E37A 4MWGA 4GS5A 5DTMA 3WQHA 1DXQA 4OK5A 4B6FA 1PJ2A 2J4CA 3EZ9A 2P2SA 2VDOB 2QY6A 1RBYA 3Q5DA 1L7VC 2CN1A 3EDRA 4FR0A 1KL7A 2OLKA 5F2OA 1MF7A 3AQIA 4GX0A 4MS4A 4Q4HA 3G82C 2IS1A 4LV5B 3AU9A 3KCNA 4UVGA 5IUKC 1ZH6A 2C9ZA 2X3FA 1GFSA 3QXJA 4Q9JA 4QYWA 3R3SA 4R7GA 5GJWC 1QQAA 1G5PA 4RKYA 2IYQA 4QSHA 4NZMA 2ON6A 4JNKA 3PTAA 4LVNA 3CVXA 5BT8A 1ZVQA 4E2YA 5K6TA 2ASVA 2W0MA 5GGXA 1C30B 3D8TA 3OFSA 1S9DA 1M66A 4CETA 4ZYTA 4IQGA 4PIPA 2X42A 4ZHQF 4QX6A 1GHTA 3HYCA 3ER6A 1PR3A 2P2LA 3AZQA 4FGZA 5EI5A 3SJUA 3TEJA 2DUJA 1A98A 1SRQA 2CJWA 1DBVO 4UUAA 5B2ZA 3COYA 1VG1A 4ZDWA 4X1YB 1GL9B 2GLXA 1MTZA 1RHQA 3EXHC 4Y6SA 5C7LO 3U5ZB 3UJAA 3FHCB 5HJ7A 1RIIA 1S3SA 1GA4A 3JX9A 3OC6A 5AJXA 3IULA 4YRMA 3FPJA 2B1QA 1U4OA 3D64A 4GWGA 3TDMA 3VU3A 2AR7A 3ZIDA 5B3KA 4NE7A 2OV3A 3OFVA 1AHHA 3GGJA 4BO6A 4KLRA 4D1YA 5IFKA 1J8DA 1KY2A 3LUAA 1EK0A 2LP4Y 4W6QA 5HFJA 4AULA 3L0CA 3AT1A 4PZ9A 1JSZA 2GDZA 3JD3A 4W1SA 2Q3MA 2PZAA 3LF1A 5ANRB 4EHLA 2O7SA 4ZZ1A 1G5IA 3ENWA 1TAGA 4B33A 4H1WA 5I3ZA 5ADWA 5K0EA 4CM6A 2XWSA 4WA7A 3IUYA 2QJRA 5GINE 4OHYA 1ATZA 1II8B 2I3ZA 2ZYSA 4PZPA 1AK1A 1Z06A 3SX0A 1L7DA 1Z82A 1M2EA 1PTKA 5LB2A 5ULLA 2AUNA 2BBTA 2EFJA 2Q29A 2R8ZA 1AB5A 3KR0A 3O2QB 4QXMA 4MZXA 4LTDA 5IYZB 4HR7A 3BTOA 3IELA 4CQMA 3IOYA 1KPGA 4QGSA 3PL1A 4LZPA 3IB3A 3I45A 4AIIA 3I9JA 3PWSA 4F3TA 3OKCA 1SBHA 3ROEA 3O21A 4FUTA 3SKXA 2O8DA 3PICA 3ZGXA 3BRWA 4NXMB 2Y1XA 3GY0A 2C2KA 4JT9A 3UWMA 1A4XA 1VA5A 1XAGA 4LA4A 2X0EA 2FDCA 2ZITA 3STHA 2VPQA 4HBZA 3ZJVA 4M1WA 1RLMA 2BGLA 5BMVA 2YNMA 4NJEA 1ILEA 1HX7A 1UC9A 5L7YA 5DN6A 5GZ1A 2ONJA 3LT2A 3PHCA 3SCZA 1MABB 1VRCA 2ZSUA 3IMGA 4X8OA 5JC8A 3BDIA 3E8MA 4Q9KA 1BA3A 2DBVO 2WT8A 3G0HA 1MO4A 2JVJA 3LFUA 1MH1A 1GN9A 3JQCA 3R41A 4JASB 1DKUA 4UU8A 1CYDA 4ARSA 1WXGA 5A6VA 4CNBA 4GR4A 5B30A 1HQKA 1HQDA 3ZG6A 3SSMA 2O5CA 3R6DA 3INTA 3R0JA 4F2GA 1EWYA 4Q34A 1PWHA 4OKSA 1G9XA 2OORC 1RZRA 1KAGA 4R41A 1M1XB 4PX2A 2E2WA 5HG0A 5K6AC 1VMEA 1HL3A 4HNQA 5JMTA 4MQBA 3ZY5A 4G1MB 2I6SA 4R9SA 1RYEA 5ITWA 2XIJA 2DF8A 3JWJA 4O29A 5HZHA 1O6FA 2CFCA 1WZ2A 2ILVA 3H5VA 3I73A 1OH7A 4JIMA 2AQIA 2GJ9A 2NTEA 2W6OA 4J0DA 3UXEA 5FLYA 5JH7F 1RMQA 4HQNA 3AEUA 2FPGA 1QG4A 3TM4A 2BRUC 4HQKA 1FJ2A 1XL0A 1N6OA 3V8QA 3FWYA 4RSGA 4EG8A 3ZWVA 2GD2A 1FMLA 2GPWA 1T6ZA 4LHWA 4D0GA 2O8CB 4H0FA 5B55A 1EB9A 1M83A 2F90A 3BIOA 1HETA 1QMPA 3FCCA 4PQGA 5BYAA 4GEKA 2WU3A 2O1WA 2P6UA 3RSGA 3B38A 4CM8B 1TTQB 4GPEA 5C35A 2B1IA 5FLEX 4RK4A 1L4BA 3KOYA 5HNKA 3SJBA 3ZWXA 3AILA 4IHQA 1BDBA 1XXHA 3DONA 5CYPA 4ZHQA 1WLSA 2QX7A 3PXCX 1VPTA 2W4MA 3OLWA 4FYPA 3DMTC 4HFRA 1JT9A 3A8TA 1I6MA 4Q3CA 4BZPA 3WMWA 3GAZA 5ICGA 1D2CA 2L2QA 3H83A 5KC8A 1P1RA 3S8EA 1C1DA 1C9JA 1ZN9A 1RAAA 3LQYA 4AN4A 1MHPA 3JAMA 1OX5A 2GUWA 4X1KA 1OLUB 1AM4D 2XDAA 3OHMA 5TPWB 9GPBA 3C4QA 1K3UB 1WS6A 1WRBA 2FUG6 4UHFA 3KEQA 3MGAA 5JTUA 4TGLA 3DTTA 2C95A 1M2WA 1EEXB 4Q0MA 4FJ0A 4WASA 3AL2A 4F85A 2F1RA 3G2NA 4C5AA 2JLYA 3Q1LA 1SBYA 3WLFA 2REXB 4RQUA 1BWPA 5L9AA 3D7NA 1XV5A 1MHTA 1DL5A 3ICCA 4DRYA 4WY5A 4KP7A 2DFPA 3BCUA 3THXB 4GC9A 3PT9A 4MROA 4QUIA 4QODA 4WA8A 4D9MA 4TTAA 4LE2A 2P62A 1ITZA 4ZGGA 1Q14A 1BE0A 4PRYA 1CP3A 4IIYA 2Q62A 3I92A 1R0XA 3HY6A 2IYSA 2AF4C 4KDCA 3T1TA 2WB2A 4IMRA 4UNIA 5A0VA 3GYGA 3HHEA 3Q9UA 1ONBA 5DGXA 4QU9A 2Y1LA 4I55A 4PQYA 3KQHA 4PZDA 4C43A 4QWMA 4PS1A 3P45A 2E89A 1VL6A 2IKQA 5TIIA 5AOCA 3AWIA 4DEVA 2ZRNA 4IEEA 2FJPA 2PLFA 4JL5A 1AKRA 1YIOA 2A58A 4M0KA 3I1FA 3U4AA 1MX3A 5GAJA 1QO7A 2Q45A 3RHFA 4QYSA 4UFPA 2Q4BA 4RK1A 2BHNA 2WA1A 4DCCA 4B43A 1KORA 5CDSA 4QTZA 3CNOA 3KUDA 5CFOA 2ZIXB 4DBVO 1TCBA 4Z53A 1YJQA 1BEUB 2VHEA 1NSTA 3WI7A 3EC1A 3QKRB 1SUWA 3UPUA 2VHXA 4FJ1A 3BD7A 3GPIA 3VYVA 4AL4A 1OXVA 2HIMA 3IUNA 4OD0A 5FI1B 4Z4HA 1V2HE 2ZIXA 2FZKA 3H1PA 4REMA 1FFGA 4WL0A 1UWVA 4ZP1A 4I7EA 2W2OA 1ZJJA 1BROA 4TWIA 3RKRA 3FVWA 3AM3A 4H1HA 4LJLA 1Q0RA 2Z2IA 2VZEA 2GF0A 1RVDA 2GFQA 3IUEA 4BJ1A 2V7GA 3FWPA 3KXIA 4FHCA 5DGIA 4HVTA 4YYZA 3M6XA 2AQKA 2AEEA 3BXPA 4TSFA 1QPBA 3A3YA 3QNUA 4EKEA 1QQBA 4D9NA 3F6CA 3LQQA 1Z3IX 2VIIA 1MZVA 1AURA 2B35A 121PA 1KFKB 2C77A 1A9ZA 4HZUA 1ISRA 3GX1A 3VKGA 1G18A 1XROA 3UAVA 2JGMA 4OP1A 2AYZA 5F3DA 3LC2O 4ZQCB 4XX1A 2GARA 3WYCA 2IRWA 1CJBA 1XZMA 1MB9A 5LKAA 3OZDA 3W4KA 3WJ7A 4UULA 5JVDB 4BLUA 4X1IB 1H23A 1ZYUA 2YFYA 4X1OA 5CNKA 2AWOA 5EKXA 2BFAA 3R4VA 4WWHA 2RSLA 1I4DD 1SWWA 2F55A 1KK0A 1XRRA 2QLBA 4HAUA 1FVHA 2Q4EA 2VNIA 3D4LA 5LQJA 2Q2VA 4G0WA 1KS2A 1O2DA 2GWRA 3E3LA 3JD1A 1TIBA 1T8WA 3DBRB 3ZD6A 4A0RA 1I2ZA 2XUJA 1S8NA 4JLWA 4NK4A 5DOZA 2GBPA 1QANA 2GJ4A 1UQRA 4BNJA 3M6UA 3WFIA 3M4NA 3OPVA 1T13A 3I2FA 3M89A 2ENUA 3RVJA 1NTRA 1Z0DA 2B7CA 1ZGCA 3MJEA 3KIPA 4X64B 1OH8A 3LK7A 3FR7A 4C20A 4WH0A 4NQZA 3D5TA 1FC0A 4XDZA 4A0QA 1VLQA 1DIGA 2GZHA 2JA2A 2ANBA 2WM3A 3ED1A 1SBNE 4UREA 3VTAA 3HN6A 1U28A 1XN1A 1TD9A 4IIXA 4XB2A 4ZJYA 5HM6A 2YJ3A 2W71A 3COJA 4OA5A 3EC2A 4X7MA 3WRXA 4EDHA 3CB4A 3NNNA 3REQB 3A4YA 1UJ4A 1E8DA 1VC2A 2LDXA 1R16A 3Q3HA 4TV9A 1E89A 5KOHA 1MIOB 5BR4A 3G5AA 3LO5A 4Q4DA 1ULZA 1TTTA 3MIZA 1GWNA 1IY8A 4IZHA 4K1XA 5GONB 1L3CA 1KIFA 2A9QA 1WW3A 2QN2A 2NP6A 4F7DA 1N1MA 4FNGA 3N39C 3PYLA 1ZC3A 4B76A 5LUAA 3TSCA 3DR3A 4MQEB 3MTEA 3R7WB 3LQ1A 5CBPB 5A7FA 4MTCA 5HKAA 1K7CA 1O97D 4K6MA 4IS3A 1H2HA 2AJBA 1QQ6A 1YFKA 3HJNA 3A3KA 3ZS9A 5AVTA 1O95C 4GQIA 1A5BB 2W83A 1QB8A 4G1UC 1ZVKA 4EX7A 2VH5R 3OEHD 1OFIA 1TU0A 2VRCD 4B6PA 1B73A 3HCPA 2PIAA 2I7DA 2YOFA 3AGQA 3EFBA 3KXPA 3HR4A 4MUGA 1LWNA 1IE3A 4UTNA 3U44B 3ZE7A 4XYGA 1JEYB 1LC0A 1QZ3A 4CEHB 4L5AA 5ALQA 2QR2A 1CY4A 2BKUA 3BGSA 3HWSA 1YACA 1NLUA 4YMHA 4GM4A 3R8XA 5THQA 4DEXA 4JVLA 1RWPA 3U17A 3K96A 2OO7A 2VT6A 3LI2A 4OYRA 2JC3A 1DP4A 2XMZA 3PF8A 5F12A 1M6VA 2I7TA 2GAAA 1I3MA 2UZ1A 2FUCA 5DLQC 4HLNA 4Q7KA 3AFIA 3KLNA 4U7HA 3U3KA 4ETWA 1SCAA 4IOLA 2G1JA 4LI3X 2G4LA 1Z6XA 1FSZA 5FUYA 1GTMA 1B16A 4UEKA 3OPYI 1YA8A 2F8MA 4A23A 2XTNA 4CLXA 3DMGA 3DMTA 3SJCA 1H2EA 1QBKC 5IUNC 1JRLA 2AQHA 1QHNA 3G9QA 3U48A 2N75A 1XDWA 3IAHA 4D9CA 3QUQA 4RX1A 5KDOA 3EVGA 3VI4B 821PA 4WXHA 3CLTD 3TL6A 2B1GA 4JBYA 3GAFA 1EXNA 1X80B 4Z9YA 1QG0A 1GPKA 2ZKLA 3LIIA