2D0OB

Strcuture of diol dehydratase-reactivating factor complexed with adp and mg2+
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
b'HSAPAIAIAVIDGCDGLWREVLLGIEEEGIPFRLQHHPAGEVVDSAWQAARSSPLLVGIACDRHMLVVHYKNLPASAPLFTLMHHQDSQAHRNTGNNAARLVKGIPFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diol dehydratase-reactivating factor large subunit
publication title Release of a damaged cofactor from a coenzyme B12-dependent enzyme: X-ray structures of diol dehydratase-reactivating factor
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Chaperone
total genus 33
structure length 108
sequence length 108
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 2d0oB00
5D5QA 3WB2A 1UC5B 3BRCA 1IWBB 2D0OB 3AUJB 5D5PA 1UC4B 1EGVB 1DIOB 1NBWB 1EEXB 3WB0A 3WB1A 1MMFB 2D0PB 1EGMB 1IWPB
chains in the Genus database with same CATH superfamily
2O2EA 5DP1A 1JSZA 3KZXA 1J0CA 1S0UA 1Z7EA 3EMDA 3ESAA 3FSJX 4GUDA 4LK3A 3O8DA 2Q6IA 3KXIA 4C7JA 5HIMA 3GVCA 3QLEA 2Q50A 1Z6YA 1MHPA 2C5HA 4IGAA 4YHBA 3RVNA 3KPVA 3NBYC 3IUNA 3SHOA 4B3HA 1RD4A 2XKBA 3UV7A 4MVCA 3BRWA 4MCJA 2FH5B 5TMBA 3TRDA 2VDWB 4LOLA 5JZOA 2QW1A 3IEXA 2A92A 1I0ZA 3OLYA 3LLSA 2JH9A 2MMGA 2DPHA 4FR0A 4PZ0A 5P8WA 4V1CB 1K6IA 3LC1O 4FIZA 4M9QA 2QWXA 4RWEA 1M2OB 3OZUA 1OXBB 2BF7A 4FGJA 4MMZB 3ZCXA 1Z37A 1ZW6A 4P3OA 1IBLB 1LPMA 2ZGVA 5ADHA 4F86A 3R3VA 4XCVA 1EWQA 9LDBA 5IVPA 3C8UA 1XZMA 3ENVA 4I5FA 5FHQA 2YY7A 1FQWA 2P6OA 3K53A 1GU7A 3OCVA 4NDNE 4RH1A 1GSAA 4EO7A 4W8HA 4P54A 1RQRA 3E8MA 2OPHA 2AZDA 3VVCA 1ODCA 3DJYA 3GLKA 4L4YA 3STVA 4F9TA 2GRAA 3G5MA 3SMQA 4AROA 4HAIA 3L7OA 1MGPA 2ZSKA 2WTAA 4AKIA 1XMIA 2OOSA 2FSIA 3K1AA 3S1AB 4JGBA 5AM2A 3PQ3A 5BT9A 4G9BA 1XJ0A 5AXCA 1O95D 1VHQA 2IUSA 4KO1S 3TVDA 4BV9A 3ZHOA 1NL3A 2N1BA 4QG7A 4URHA 4OKIA 2HR1A 2FP3A 1GV0A 3PEYA 1L4LA 1GP2A 4RSHA 3LH5A 4XDHA 1JHDA 1NYQA 1AHHA 4MYHA 1IBKB 2ZI4A 2YMMA 4DF3A 2JEZA 2XH8A 1ZINA 5F7ZA 4BMCA 2A1TR 4BZPA 4IUDS 1UBGA 1C30B 4O0LA 1V5FA 3CX6A 1SAYA 4IILA 1EVZA 2OAQ1 2QRHA 4QC2A 5A5VA 3UGKA 4EG3A 5EGSA 2ISCA 1B8VA 1U90A 1V9SA 1WKCA 5EZ6B 3WWOA 4RA9A 4DV5B 1ZPDA 4A1OA 1E9RA 3AUYA 3KG2A 5B6IA 5CMLA 2VVTA 4V0RA 2NO5A 3HFGA 3ROQA 1GZDA 1QGUB 4FFNA 4RLQA 1QMGA 1YGPA 3ASYA 4NE9A 3N70A 3ISVA 3NP7A 4CM1A 3U49A 3RT1A 3AKZA 4IAOA 2BCEA 4RA6B 1QF7A 2C57A 1U0HC 1AKMA 2ZUCA 2LIPA 4DR4B 3O93A 2JIZA 3NJ4A 2YVKA 1ZWLA 3I32A 3I73A 4G6ZA 3HXOA 3VBCA 1FIUA 1U0RA 1WSAA 2PL5A 2NQ8A 3OTGA 1JAXA 3D59A 3E9CA 4KTVE 2H5LA 1DTSA 4ZT6A 2R79A 4OI1A 4IQGA 4GSLA 5IU6A 1U8AA 1V43A 1LBIA 2A0YA 2V5AA 3I45A 4FYYA 1U6KA 4HYTA 1JKXA 1J9ZA 1F06A 2WFAA 4UULA 1TAHA 1Q2XA 2PMWB 1NE2A 1VE6A 3ITDA 3OCUA 4MLCA 3T7TA 4CMIA 5BSVA 5IAKA 3RHZA 1UMBB 1SK9A 3CX8A 3R8FA 2JA2A 3MJRA 3PF8A 5HOEA 2JI8A 3FPBA 5DLYA 2WMNB 1Y89A 2YDYA 4HXYA 1R66A 5DHAA 1DC5A 4E88A 1R4MA 1PNVA 1YDWA 4NRDA 1TVMA 4UCWA 3RI3A 1RR6A 1T5IA 4DMRA 1WV0A 4UU7A 5GONA 4CL2A 1OA0A 4CGZA 3QKSB 2WNIA 2P11A 4CMBA 5K3OA 2OFXA 1SHUX 2QRUA 1JEYB 1F8UA 4FYKA 4MMYB 4GXQA 3B1YA 3DOEA 2BZSA 5JVDA 4EYGA 3MWLA 1D8TA 3UH0A 3IT0A 3PFNA 4CLXA 5HKAA 3HWX1 2ZM6B 2CL5A 3T8YA 3VNBA 3LT1A 2G1AA 4MGZR 1CUXA 3EOBI 4FW8A 4RVSA 5BYAA 2WOJA 3C98A 3PG5A 4IZ6A 2W8ZA 4UDXX 1Z5PA 2DBZA 3HO6A 1BG6A 2YTZA 3A05A 4RYDA 4REQB 5HJ2A 3ZE0B 1J9EA 4NVRA 3FN4A 1BSVA 3QOYA 5AI8A 4NXNB 2RBGA 4N49A 1DLIA 1B1CA 4ICIA 5J2TB 4KR9A 1Y7IA 3DDSA 4E2WA 2EZTA 3IJEB 2UDPA 5KX5B 1NZJA 1BNCA 1UZAA 3JQ9A 1N9GA 3JRXA 4MYCA 1YO6A 4X1IB 4J2HA 4QDXA 1QBGA 1IZZA 1FXWA 2WTXA 3A4YA 4D6XA 1PR3A 1TU4A 2P35A 2W5UA 2XE4A 4AY5A 3C3WA 2YXNA 4EL0A 1ULTA 3F1KA 4MJXA 2Q3EA 3L7NA 1A69A 1X15A 3PQEA 3CHYA 2WHPA 4PTYA 4XYBA 4N7MA 1ATZA 1Z36A 1VBNA 3QPAA 4HDSA 4XUCA 3RV4A 3SHQA 5HIKA 4W1SA 1L4EA 1RABA 3CLSC 4MQBA 3RG2A 5I47A 3E2MA 3KT0A 1OYVA 4TYQA 4NI5A 3ZWWA 2OHHA 4DMGA 2J31A 3CLVA 4JYPA 1NVVR 1IN1A 5EY5B 1Y9EA 5CGQB 3MB8A 3HB0A 2R65A 4RXMA 1JAHA 4JLWA 2D0DA 2EARA 2GEJA 2PCJA 3WOHA 1D2CA 1T2AA 1UPFA 3AIIA 4J9VA 4X41A 3TKYA 1JEDA 3PXUA 4L74A 4X90A 2BFFA 1HQCA 2MSKA 2QQ5A 3E35A 4IMJB 2YUTA 4OFWA 5E1DA 4ZVLA 3DYVA 4CFZA 3GRPA 3RRYA 4F5ZA 2FA9A 4AZTA 2N75A 1T43A 4KFTA 4KOEC 1ZL2A 4YWHA 1LX7A 5AOAA 5JI2E 4NL4H 1ND6A 2VUIB 2E4AA 4HDKA 4WW0A 1J06A 1HEIA 3QE2A 4G65A 3IR7A 4KLAA 3VX4A 2B30A 2Q3HA 4EMSA 1W4RA 4BDTA 3BF7A 1CZRA 3QJ5A 3BA1A 5JPDA 2EDCA 1LPPA 3M5PA 3E23A 3P9NA 4I1SA 4I8DA 4CV0A 3P26A 3IB3A 3PQ6A 4R1NA 2OB2A 3A1UA 1CZHA 1GPAA 5ALUA 6PFKA 3MXTA 2C2WA 5T7BA 3DDOA 4GLFA 2LCQA 1V4NA 2FPRA 4PZEA 3H7IA 1QIKA 1FUEA 2B37A 3D81A 1PYOA 4GVPA 1L5KA 2BSQA 3CN9A 3GAZA 1I7NA 3D8BA 1I3OA 5D7NA 4O6VA 3CE6A 1WAMA 2WHXA 3ZDXB 2VT3A 2VZ8A 1XB2A 1YFZA 4ZT2A 2WFZA 1DGQA 1E9DA 1EFVA 1G20B 1PWEA 3LT0A 1NF8A 3CW9A 4GGOA 3T34A 2VG8A 2WG0A 3TLCA 3ANSA 5FHRA 4DILA 1EHIA 3QWHA 4U02A 3DQQA 4NYJR 5KI6A 3WK5A 4F11A 1W1UA 2B61A 4JYBA 1LF0A 1NUAA 1OFUX 1BVRA 2H3EA 2OO3A 2Z08A 3E22B 3NXSA 4GBMA 3B6MA 2UU9B 4JUAA 3PI6A 4DPLA 1XQ1A 2Y0PA 1R6BX 5K6AC 1X1AA 2I55A 2VQ3A 4I08A 1QLWA 4BMNA 3OA2A 1X2EA 1YZGA 4FCVA 3EZGA 3JQBA 4MAAA 2MINB 3PWKA 4H3KB 3L8FA 4YAIA 2LBPA 1DC6A 1YRWA 3KTOA 4DXDA 4TL9A 2GNOA 4RSMA 5EKDA 4KE9A 3WYAA 4DSZA 2Z0MA 5ALJA 3N3BC 1PJ2A 1T6ZA 3P5BA 4WKGA 2WU4A 2EV9A 3EGWA 4GR4A 1V5IA 2JFZA 1ETHA 1OZHA 1Q2UA 2O3UA 3QG5A 1M67A 3UAYA 1J0BA 2QMHA 5TQVA 4FEAA 1IZ8A 4LJ7A 2PZLA 5KDOA 1GYPA 4CLRB 3ZCTA 4DLPA 2D06A 2A7XA 2KHZA 2Q2NA 2V9CA 2W6JA 3OURA 3EZ9A 3PYLA 4QJBA 1OB2A 2H1FA 2AQHA 4OP1A 3KTAB 4E1VA 3N86A 3A1VA 3PNVA 2OFFA 2ZJ5A 2DFKB 3DXFA 4O4LB 1L5SA 1QRAA 1URPA 4KWHA 4MS1B 1WMAA 1WOMA 5DULA 1VG9B 1OAKA 3QOFA 3E3LA 4XAQA 4PN3A 4OQQA 5EJFA 2YICA 3OM9A 3Q72A 5G53C 4DSNA 4GYJA 2OHXA 3KPWA 1WA5A 1SG6A 3ADKA 5AKJA 2WU0A 4MV5A 4NNPA 2R8RA 5CGZA 4HWSA 2VPTA 2PYZA 3DONA 3GAAA 2Z9DA 1XXHE 3CKYA 3OKAA 5E4YA 5HE9A 3ZNOA 5ELXA 1E2HA 1MZVA 3LLCA 1BDMA 1KEZA 1NULA 2F62A 2J7PD 3OTHA 2E9SA 2ZIXA 3EGXB 1KZ7B 3AHCA 3ESCA 3MMSA 5BMVA 2NWQA 1T2UA 2GZSA 2H9AA 5FRDA 3QU5A 4UHKA 4R16A 2ERXA 4GZ3A 3R3SA 4E70A 3KQPA 2O8DB 3AGQA 1S4QA 4DABA 1XU4A 4WXYB 4A2WA 4YJ3B 3M9XA 2PGLA 3F3MA 4XEUA 3TG8A 7MDHA 4DR2B 3WYEA 1GNRA 3T9AA 2YN0A 4FLFA 3TYXA 5E1MA 4JKYA 2ESRA 3KLMX 1CJMA 1K7SN 2WFMA 5EHZA 1UDCA 1B6TA 1TQ4A 3HLKA 2WWFA 2QK4A 3E9NA 3IOYA 3LQRA 4WAUA 2VPPA 5B3KA 1EVIA 1S2GA 2ZBEA 3PHLA 3HV2A 4JT8A 1MTOA 1S2OA 3BA6A 4IMIB 4PO1A 5A71A 3V9PA 3LC0A 1C1DB 2A2ZA 2Q9BA 3F3YA 4KQKA 3A2MA 5AXDA 1G8KA 4P7FA 5AFSA 2ZRBA 4G5HA 1E5XA 3FPHA 1P9OA 3B7PA 3Q7QA 3TQRA 4BBJA 2LDXA 3CEPB 3TB6A 1LI7A 1TC1A 2WF5A 2C31A 1N4AA 4ZV4A 2PS3A 4J6FA 4DLUA 3L18A 3UJPA 2CLKB 2FI1A 3PNOA 3VR1A 3SZGA 4MPDA 4YI3A 1R6AA 3GHYA 3LRTA 3WGHA 1C4KA 1U1CA 4MQUA 3LCJA 3AF5A 2CF6A 4Y9UA 1GQSA 1X7YA 1Z4LA 5CLFA 5BP7A 4E14A 3DZ8A 2B4TO 4BGIA 4C0JA 1M54A 2FUEA 4TMZA 2NV6A 4GPZA 1SUPA 2KBEA 2OECA 4TSFD 3QX9A 2FRVA 3FWNA 3EXEB 3E9ZA 2EG9A 2XMPA 5E1OA 3ODGA 3HZRA 3IUEA 3R6DA 2Y8EA 3UAZA 1IBMB 1ULAA 4G26A 2HAEA 1RP7A 1ZRMA 2VOEA 5EVJA 4QGBA 4Z4IA 5A5GA 4QRDA 2WHYA 4MWDA 2QMQA 4H1WA 2ZT5A 1XEWY 5IDWA 4WVFA 1OCEA 4PSKA 1QMPA 4MGEA 1F0PA 1RVDA 3O74A 1X7ZB 1COZA 2IHVA 1L3BA 5C1PA 2NQTA 1J39A 3ABSB 3H9GA 4HNRA 4AY4A 4TV9B 1IHDA 4BUZA 1HK7A 2JAUA 3IRVA 1QNLA 4HX2A 3MHPA 1EHCA 1VYUA 4U7JA 2B6HA 2GJSA 2Q5EA 2X58A 3O03A 3CRNA 3ESXA 2VLIA 3RKRA 3STHA 2I9PA 1ZL0A 4PLPA 4YPVA 4LXGA 3GRVA 4D0GA 2QA5A 3U3DA 3VTFA 1HT1E 5AKXA 5A4DA 2C0QA 3KB8A 3N2KA 4MGYR 3DV2A 2RGWA 4RV9A 5E9JA 3UUFA 1VPVA 4G36A 1PYDA 5JY1A 3EXHA 1XRPA 4AWXA 3PUZA 5TR9A 2QUHA 2RGDA 1PJRA 3GN2A 1FFDA 2DG2A 4KQ9A 4MDHA 4EH1A 2ZBRA 4LVOA 1WNFA 1P81A 2EBUA 1E2EA 3AI3A 3M6IA 2DKFA 5D3KA 4DM3A 1FYVA 4F3NA 3PVZA 4M37A 5B7PA 1JHAA 2QUIA 4UFNA 5EP3A 3ZJYA 3MNFA 2H6EA 2OWEA 2P8JA 3ZCSA 4BNNA 3ZGZA 2JEOA 1Y34E 3H1AA 1N7IA 4HQRA 3K70B 3FTFA 4MGHA 1CCWA 3C5VA 4EHHA 3OLQA 4G84A 1EFRA 1X19A 3JD4A 4RJ2A 3BD8A 4NICA 4LJ6A 4BWFB 4BN4A 2N46A 3D4OA 5H1YA 1BEZA 2PO7A 1RI5A 3CKKA 2WVHA 3ERCA 5AVKA 3HUEA 1M7GA 4EHJA 1B16A 3GLTA 3FHTA 4UOEA 1J8MF 3BK1A 3GD5A 3I76A 4JLMA 1FEZA 1DV1A 3GFQA 4MWZA 4MQFA 2EHDA 1TJ5A 3EUFA 5LQUA 3R3JA 4RM2A 5CR9A 3PUIA 4HAXA 1YQGA 2XEDA 4MAFA 3BHJA 3EXG1 2OK7A 3ZU2A 3B9BA 2HN9A 4DDHA 3WMEA 1QS0B 3H0EA 2GO1A 1HUQA 4L76A 5KQLA 3PDUA 1G291 2X13A 2ZK7A 2FVYA 1XTJA 2ZPTX 1C1XB 1EFPB 3VYVA 4AIIA 2PAFA 1T4DA 1EPUA 2CZCA 3IERA 4QDTA 4Z99A 3REQA 1KZHA 5A9SA 5FKJA 2F9MA 2P6RA 3FAZA 5HHTA 2DFDA 1ZSYA 3FRJA 3FPFA 5BSEA 2LE0A 2PU5A 4XQ9A 5BORA 2CUZA 3KB1A 2Z6VA 4EW2A 1Z26A 3BD6A 5AVRA 2XQFA 3ND8A 2ZZMA 4FXOA 1X8JA 2C97A 3CLRC 4MR7A 1SZJG 4JOSA 4RY9A 1O3YA 4LI3X 3MXOA 3L7IA 2NYVA 1P7YA 4X71A 2EEPA 2FMFA 4ARSA 1V7ZA 1HR0B 1C7FA 1Z5ZA 2HCBA 3IAM1 4MKGA 5HIIA 5H70A 1RM5A 1OASA 2XYGA 5E8RA 2ZIAA 4IQ0A 3P0RA 3K15A 2HXSA 4MA4A 4PRKA 2QQFA 1EKXA 2R1TB 5CW2A 3AR5A 4ERNA 3NWPA 4BP8A 1GPDG 4YQEA 1NN5A 1S3FA 1VCOA 3O2JA 3U09A 2HQSA 1Z16A 3FDXA 1ID1A 3KVRA 4GYWA 1RAFA 4OOFA 3IUJA 5EMNA 3ETGA 1NVKA 3MT8A 4IQ8A 4ARBA 4M0LA 4W4TA 4EFNA 5C1BA 5HW0A 2JLUA 1Q3KA 5BSWA 4KQJA 1M34A 3NIBA 4COOA 5E6SB 1JZQA 5B1YA 5JBIA 3U7GA 1ZFNA 2DUUA 4A0RA 1C0EA 1SA0A 2JANA 1L2TA 1CJKC 4R1OA 3PCRB 5F23A 2VF2A 1OH5A 1II8A 2A5YB 2OBXA 3JYNA 4MUHA 5AK6A 3DOCA 3O4RA 1UM8A 5TSDA 2JLYA 2D5BA 1XTPA 3F71A 5JDIA 2Q5HA 2V7EA 1E3WA 2OG2A 3UJ8A 1EXVA 5EXSA 1ESEA 4C6TA 3UB3A 1K8RA 1C7ZA 1PV1A 1XZNA 2SNIE 3NC0C 4IFEA 4N5NA 1WHSA 4WECA 2JGDA 3CUUA 4IFTA 3X43A 2NUTA 5PGMA 4JBGA 1W4LA 1GNTA 1M66A 5DX8A 5E1BA 2Z57A 2BBOA 2ZPAA 4EZEA 4AN0A 4URVR 1G66A 1RWMA 2DTDA 5ALPA 1VG0B 1T9BA 1RRMA 3IUBA 4PQGA 5JAQA 4ZYUA 4LTDA 1FY2A 1A3CA 3LIPA 4GU5A 1XQ6A 2BKEA 3Q98A 3IT3A 5B37A 1C9YA 2GZ3A 4B4OA 4W5TA 1TTTA 1YS9A 1TIPA 2R6GA 5DISB 2QHXA 1I2ZA 4EY4A 2ZSFA 2F9FA 1L5HA 1K4MA 1T15A 2DBRA 4U8GA 1I30A 2XAAA 4XM0A 3LV8A 3NKVA 3C15C 1R8SA 1CF9A 1UDAA 4EKGA 1SULA 2AD1A 3P9KA 3KKEA 1NVBA 4KDEA 5AKLA 5J2TF 1QQAA 3A6LA 4ZDJA 2PUWA 3HUDA 4NTZA 2QROA 4MR8B 1JEEA 4TS4A 3GGDA 3I6YA 3WQSB 2CV2A 4D9JA 1LI5A 2R5WA 1JS1X 1QHHB 3A58B 1L5OA 2ZIZA 4NCIA 3VMFA 3R9XB 4TZ0A 4WMLA 1IZYA 1I13A 1XKTA 2V6GA 4MRVA 4OBWA 4Y2JA 5ALQA 2YXLA 3OPXA 4JBWA 2WYUA 4R1UA 5CD9A 4F2PA 5G40A 3TSWA 4YA6A 2Y4OA 1FFSA 3VPHA 4C08A 1QP7A 2C82A 1RC8A 2QVLA 3D54D 5FDFA 1OMOA 2W93A 2HH9A 1YACA 1UIMA 3DT6A 4NEGA 3G1TA 4DR3B 1EFLA 2IYLD 3GY0A 3H19A 1SN7A 3OCCA 1EH5A 2PGIA 3FDJA 1OXSC 4EHNA 1ZD5A 3R3UA 1M6VA 3UEOA 4AD8A 4NBKA 4F2HA 1QGZA 3EJ6A 4N0EA 3RAGA 1XXHB 2WE7A 5HSGA 1FUKA 3KYBA 2EZ8A 4BNZA 1DCTA 1VA5A 3M1IA 1W75A 3N2YA 4TTRA 5I8PA 4LHYA 3U60B 4F4CA 3WLLA 2NXJA 3PDCA 2DR0A 2QM7A 4YAFA 4AMBA 2B6NA 4H17A 4L16A 5M3BA 5HCNA 5KYXB 2RDMA 1AH2A 3FSGD 3LHIA 1NC1A 1MO5A 3EBOA 1RJFA 3DT8A 4W1RA 5DSZA 4ECEA 3QV2A 5ES4B 4MDYA 1GKIA 3PWZA 4FZVA 3QFTA 4DNXA 5I4BA 2D1RA 4L0MA 2I0FA 4R0NA 4B44A 3TW8B 4C4ZA 4FYVA 5HK9A 1CJVC 2AJ8A 2H4WA 4FOTA 1XFDA 3JSXA 2J6HA 3CPEA 1Z5UA 3PL5A 4PYJA 3PE6A 2DUNA 3BWBA 4TKLA 4X7PA 1UPBA 2A1UB 3CLHA 5FOTA 4G0ZA 2PJRA 4PHGA 1N5LA 3NH9A 1JHZA 1LLUA 5LBIA 3UENA 2C5BA 3V80A 5EMMA 1LDGA 5LQMA 1UZLA 2QUAA 4O29A 5KTOA 2Z5VA 1T8RA 2IY8A 3KKKA 3PQ7A 3IEUA 2XRYA 3B2NA 3OE7D 1ML3A 3RB8A 5AJZA 3V55A 5I7OA 4N7BA 4BB0A 1G21A 2Q5OA 1QUFA 4LC1A 2BONA 3RU2A 2GYVA 4CTNA 2W98A 3N58A 4MVJM 1CHDA 5LN1A 3ED5A 6LDHA 1KYVA 2X4DA 5DU2A 1DO8A 2GRJA 3AKYA 3RTBA 2W6OA 2F00A 5C3UA 4KZPA 1YQUA 3OTQA 1I80A 3HA3A 2ZUWA 2XUGA 3MTGA 5DNAA 2WIDA 3RC9A 4DSOA 4G8DA 1GKYA 1G2QA 1TF2A 4RV5A 4TMVA 3RRBA 3QJGA 1A9XA 2NU7A 1A2OA 4NU8X 2FV8A 4OFZA 4Q47A 2DSTA 3F3SA 1FFEA 4FHGA 2R4QA 5L3ZA 5B12A 5I7VA 1DJNA 1I2DA 4R3UC 2PGXA 2BGWA 1SB8A 3IALA 3OX3A 1KDPA 3KK0A 4N1AA 5CYPA 4A8TA 1TO1E 3B89A 3D64A 4BC0A 2ZR7A 1FFHA 2GETA 2YYYA 5EUBA 3W5JA 4YYEA 1RLUA 1CS0B 1GZ7A 1THMA 5CDUA 2PS9A 8MHTA 2X9GA 4MI3A 2YWFA 4WCFC 5D2CA 4X92A 1THTA 2GK6A 3KP1A 1TM3E 2PH7A 1PFWA 2ZWPA 4HO1X 1P9RA 4U7FA 2IF2A 5FPHA 3G9TA 3FGNA 1KQNA 2CD9A 1R0KA 5DSTA 4KYIB 1SXJD 4RA6A 1MRSA 1PJZA 4OSEA 3LY8A 1OBHA 3OZFA 1N8SA 1YK1A 3ECSA 3V2IA 5L3SB 2VF4X 1TTPB 5KJEA 5GIPE 2HK8A 4UEWA 3LS2A 3RUHA 2I4TA 3L6UA 4LEIA 1P1RA 4G0NA 2DY0A 1DX6A 2QZ4A 4OYYA 1E2IA 4JA2A 4C76A 2Y93A 4JGIA 1XMXA 4C4OA 1E3LA 5CEJA 3IAFA 2IYNA 1T6NA 2FR8C 4IRXA 1W4CA 1TIBA 3HN6A 1U7OA 5EMJA 4BFUA 1WRBA 2CNDA 2Q8QA 3L7YA 1NN1A 4K1LA 2V74B 1LEHA 3NONA 1YRBA 4KXYA 4YC7A 1Z0FA 3G8AA 3RF7A 3ZW8A 5LU9A 2X4GA 5KNLA 2I6GA 4XOUA 4EYSA 1Y9AA 1DBQA 3JAKA 3GHHA 3JCZA 5FEUA 3C87A 1H8HD 4ECAA 1JAZA 5F21A 4US1R 5IZ4A 2HBQA 4B3FX 1R7RA 3PHHA 4JGGA 4QXPA 3ZGLA 3MBOA 3RYHB 2C4KA 2XXBA 5E0OA 3WZ2A 1O0SA 1JKJB 1ZGCA 1CIPA 1NHWA 3BGWA 3MW8A 1Y1TA 1YOBA 1IB6A 2DUMA 5E7QA 2ZBVA 1R3UA 2WIFA 2NO4A 2C83A 4MMXB 3WTCA 4IGFA 1JIQA 4FGSA 4RF2A 3REFA 3BMNB 5J1TB 3S27A 3T52A 3S2GA 1J07A 4ZAVA 5K8IA 5LZ4A 4O25A 4IO0A 2XWSA 2CGEA 2H2WA 3ZN2A 5BRJA 2PA0A 4TV8F 4REQA 1UMDA 2HWXA 2QM3A 3ZCVA 1EWKA 3ME5A 4MUGA 5DKFA 3N5KA 1BCRA 4GKBA 4UARA 1ZUNB 2QVXX 3CF0A 1DZ3A 2P40A 1E0SA 1GR1A 4PFSA 4MRPA 2YV3A 4AJOA 2F90A 5D84A 2WIBA 3T54A 1EB9A 2BWJA 3F6SA 5HDQA 5BVHB 3UOWA 4MRSA 1XTQA 4OLAA 4X1IA 4K2HA 2FZEA 1ODFA 1V4VA 2HIGA 2O2CA 3DD1A 3P9XA 3VDQA 3GLHA 4RQBA 4RFSA 1F0YA 1OX4A 1A7JA 3D3KA 4FE3A 3RBXA 4CMJA 4J1QA 1E3TA 1YJXA 2A7QA 4LRUA 3IHTA 2XVXA 3KT3A 4OKSA 1UADA 2H92A 1N2HA 5IAGA 4HYQA 3AIOA 1AS2A 3AYXB 1VYHA 2ZB2A 3NANA 3DR5A 3E9EA 4L7VA 2KB0A 2A0WA 3J7AC 1H05A 2JZCA 2M1XA 1EYZA 4P2BA 4FCTA 3G85A 3ZKWA 4C0XA 4EW3A 4HNUA 4EZBA 5IDXA 1I1NA 3HXKA 3FNFA 3L7DA 2C7OA 4Z9AA 2VUHB 1T0BA 4L8YA 1DO0A 4HLUC 2AF3C 4TS9A 4FFRA 4Z4FA 1I14A 2AH5A 3SF8B 2FFJA 3C14C 2A5GA 2C9YA 2AEFA 1E3QA 2J7KA 4JLAA 2CXXA 4TSRA 4FNAA 4BQNA 4BV3A 1RJDA 2EXXA 4EMBA 4LFBB 2F1HA 2XXJA 2UVDA 3GGCA 2GASA 1SZCA 2D2IA 2PWBA 5KVQA 3C7CB 2WAMA 3OLXA 5LC1A 2FMKA 1YHYA 1RPJA 1SXGA 1FX0B 2I6QA 3BK2A 3COSA 4C03A 2JLVA 1P2GA 1Q19A 3ZWNA 4AZ0A 4F2GA 4ON9A 4CHTA 3C5EA 1A9QA 1OC4A 3DVSX 4G3XA 4IVQA 5HBGA 1ZNYA 2ACEA 1S3GA 3BRSA 4JHXA 3EEFA 1XCLA 1P29A 2PR2A 1XRSB 1Q1NA 3CZ5A 2QGFA 2WOOA 1PTJA 2OUKA 4IKPA 4XRGA 3H8SA 3B1KA 4EJ2A 2GVDC 3WIEA 3CW8X 2QRVB 1S8AA 1J5EB 4OUDA 3AJ8A 2VBFA 2W22A 3W5HA 4NZMA 4OOEA 4RE5A 3INYA 3AFMA 1M1UA 2QT0A 1MJHA 1Z25A 1KORA 3U6KA 2BMVA 1HURA 2VP9A 5DWDA 1PT7A 1X80B 2OM2A 5G02A 2QE6A 2VWPA 3ETEA 4O3FA 1K8XB 4TYNA 1N2IA 1MB3A 1RE1A 3RBAA 4EJMA 3C2QA 1ZNZA 1UBLS 4H15A 4CMEA 2IEGA 5TQ2A 2OORA 3GR6A 3E22A 3EG5A 2GXSA 3WHIA 2BD0A 4PNPA 5JRZA 1P75A 2X23A 4B6EA 4EJ6A 4CFYA 3GLIA 16PKA 2YWCA 4WL0A 1HG1A 3PGLA 4YJ2B 5LOVB 2ONYA 1U3UA 2OFPA 1FSZA 2ZIWB 2YN4A 2H1SA 2X7XA 2EJBA 3L8YA 3OHPA 2TMDA 4C43A 4AY2A 1FW8A 1Q0ZA 3AYZB 4RANA 2V9PA 5K0FA 5CYOA 3BUSA 3G8CA 3GMSA 4JT2A 4W6QA 4Q1BA 1Z2NX 1YNSA 1U8CB 1O6ZA 1XNJA 3AVPA 1UOOA 3NDIA 2HPZA 3SZUA 1N5OX 2VP2A 1WHTB 4Y2QA 2F3PA 4PXAA 3U39A 7ABPA 2G25A 2XNHA 2XAUA 4C07A 3CO0S 4M8SA 3B6EA 1OV6A 1AA6A 3PQ8A 3VR3A 3AU9A 1KZYC 2QG6A 3HWWA 2DXIA 3I9OA 1TM2A 2DT8A 3DTNA 3MGCA 1BOFA 4E07A 4JI4B 4LJ9A 5BOVA 4X91A 2NOAA 1M0WA 2ABWA 4MS1A 5IEBA 4FFBA 3HDQA 1R8XA 4HDMB 4HRVA 4F2DA 4RMNA 2YZNA 3GLVA 2XB9A 2Y2UA 3BCHA 3QKRA 4KXUA 2AEJA 4UCQA 3D1LA 3PXAA 1U1DA 2JC3A 3BJMA 3W9UA 3FSRA 5SYMA 4GNRA 4B3BA 4B0PA 3GROA 4C0LA 2KLBA 3AY0A 4X8HA 5CIQA 3TR0A 2VATA 4KGDA 3UMRA 2WKRA 3ZNQA 5DMXA 3KR9A 3OZSA 4KI7A 4MIOA 3VC1A 5DTJA 3EGXA 5LYJA 1QV9A 5J4LA 3DUFA 5LZ8A 4ED9A 1L7EA 2OMEA 1G64A 3A6DA 5CHYA 4D2IA 4S05A 8ABPA 3OEED 1U2RA 3LCCA 2VCYA 3FNHA 3BB1A 3BXFA 4WWHA 2C61A 5EIWA 2H2HA 1KVTA 1DRKA 1E5QA 1RWVA 1XA0A 1BCSB 1WPGA 5CNIA 2O8DA 1MORA 1NAHA 1SBHA 4CLOB 5F2KA 4R9VA 1WBDA 2RHOA 4I8XA 2HU2A 5EE0A 3MA0A 3QI7A 3OIUA 4G5QA 1YH3A 2VKTA 4L8GA 4B74A 4MVJP 4OY3A 4I1UA 3RNLA 4QICA 4OBBA 4MH0R 3QWIA 4O5AA 1RRKA 3IGFA 5COBA 2MTBA 4U5XA 4MUEA 4WK0B 1XN1A 3D0OA 5L53A 3FFBA 4NS4A 4DSAA 1KKMA 2WSMA 4JOCA 4YRFA 1V8FA 1F1BA 1CDDA 2FGKA 1F51E 2X5KO 3MS4A 4CCYB 1SVOA 1Q3HA 1ENZA 5DF1A 1JYEA 4J2OA 5EWJA 2FVXA 1YR8A 3SS8A 3UO8B 3NO4A 2X4IA 4CV2A 3VC7A 2COKA 3DF9A 2X77A 2XT9A 2IY9A 4S1VA 2PANA 5C8VA 3AEXA 4IYRA 1SEPA 2WU3A 2DPGA 4X6XA 4G5XA 1O96B 3G3EA 4R1LA 4GR5A 4ZWNA 1PUJA 4C7BA 4D43A 3EEQA 2R8XA 4JB0A 2NXWA 5EL0A 1LBSA 4KGZA 4TVKA 5IFKA 2RCYA 1G7TA 1GGMA 1P7ZA 2BJHA 2PSSA 3DNMA 1JKFA 5EXEA 3VR4D 4TKVB 1IRXA 3WLIA 3E27A 1FQJA 1F9EA 4JEUA 4CKCB 1ZICA 4YTEA 5IXYA 5LQRA 5FNVB 3UTCA 4HEA1 4MCHA 4QQNA 3RRNA 5GADl 1G8AA 4H6PA 4DPKA 2GPAA 3NHZA 5DBHX 1KDZA 2K5UA 1L8XA 1X7DA 2BFDA 1ZRHA 3DP7A 4WNIA 1J97A 5LMUB 2FPOA 3V6MA 2J46A 3JPWA 4BNWA 2B5OA 4ZOCA 1A77A 4ID3A 5DHRA 3WYCA 4A8JA 1ML4A 1QE5A 2R8BA 1L4MA 3H4MA 4XQ0A 5TRTA 4R8VA 4BX3A 1Y5MA 3DHEA 3B1WA 5AJXA 1N9ZA 2VBIA 3I9NA 5A4JA 4EEKA 1QOPB 2PLWA 1XL0A 4C5BA 5K3AA 2DLCX 3OPVA 2GEUA 3VR6A 1BH2A 3VR4H 1PR1A 1ZH8A 3B60A 3K4QA 2RHTA 3GDOA 5KC8A 4EA7A 3U80A 1MNAA 4L9AA 1ADCA 2R4UA 3IIEA 1TAQA 3GJZA 5AKKA 1ZVKA 4E6EA 4PCLA 3SNHA 3PZRA 1P3Y1 3DB2A 3MCTA 3C3AA 2IPXA 3DCIA 1LFDB 1KMHA 4TMKA 1Q91A 3F5DA 3DEHA 3HSSA 4WQMA 5GOTA 5K0GA 1KOLA 2GPSA 1IHUA 1TW3A 4W9RA 1JAYA 2BZ1A 2VK8A 5ES3A 3SIXA 2VRBA 1Z56C 3G0HA 4IZOA 1NUQA 3GFSA 2EBFX 2OOKA 3UMFA 1TQ2A 3X1YA 4DAOA 1T1RA 3SKVA 5AD1A 2ORVA 3I5MA 2ZZNA 4PX5A 3VHQA 4Y18A 4KQMA 1VQ1A 1E3IA 3AW9A 2PRJA 3GCDA 1XCMA 5LPNA 1WXFA 5DM2A 1YR1A 3JV7A 2AL7A 2G5CA 2X5XA 3ETDA 1W2GA 3O8NA 1XPUA 1UDXA 4I55B 2UZ1B 4H27A 4HWTA 1RKQA 5LDGA 5T64A 4IINA 5TDHA 3TQHA 1HDEA 1H9CA 4JY7A 3CVXA 4YRAA 1KJWA 5ARCA 1MD9A 3QVVA 5KJ6A 4IIJF 4NK5A 3CN7A 1DEHA 2PVCA 3G49A 2JPDA 2O19A 4MO9A 2PA3A 5TPWB 2D54A 4IIUA 5H82A 4BJHB 3ML1A 1MQ9A 1OJLA 1UXHA 2RAFA 3MM4A 3HDJA 4LE2A 4XYEA 1W7AA 1NONA 4UJ3A 4BNKA 2RHWA 3F4LA 2YJZA 4RYLA 1B43A 1PZGA 4YAUA 1IM5A 1KPGA 1QOQB 2FR0A 2HMYB 2J6CA 2I6TA 3RYIB 2GHQA 1M8PA 1SUDA 1A7AA 1ZUD1 3GK3A 3WICA 3WK7A 4C30A 1PG0A 3Q0EA 4M2LA 5EP1A 3EQ9A 2BGKA 3ILVA 4ZO7A 1KO8A 3I4CA 4GUAA 4WTOA 3Q1LA 2NSLA 3QRWA 3V7WA 4AL4A 1YSCA 1OTXA 4I50F 3HKBB 4OA5A 3LO5A 3MBKA 3O1HB 5CB4B 5HUJA 1U7WA 1TXGA 3G5TA 1HDGO 1NTOA 1L7BA 1O87A 2LW7A 3BH6A 5KEIA 4DQXA 3EZ7A 1WWKA 1JR3D 3IUYA 4JC5A 2WABA 4JBIA 3B1JA 2Q3CA 5BV0A 4Q4AB 4CIWA 2D5CA 1WUTA 1VJTA 4N0QA 4YLYA 2FK8A 1WZ2A 1NMEA 3AF6A 1F0NA 4H4DA 4K2AA 2BI7A 5ALOA 4Q6BA 3GLQA 1GCAA 2HC9A 1P1FA 4OGFA 1U3WA 4RXUA 1LDBA 2QL5A 3E1GA 4KE8A 2J5BA 1NPTO 2JGEA 5E8JA 3WE7A 2ORWA 4R2XA 3A8TA 4GMDA 1WPQA 4ARZB 3CJQA 2QMOA 3QX8A 4JVNA 3U13A 3E9MA 2NMVA 1RQXA 3UJBA 2Q3JA 1FDUA 3B3FA 1XGKA 1MRNA 4TS3A 2XUKA 4UHHA 1FDVA 5C7YA 1D2EA 1F4PA 2CK3A 3IPLA 5HX7A 1SKUA 1VJ1A 4M7WA 1LZKA 4CL8A 1CR0A 2MSLA 3TTUA 5B64A 1H42A 3CRRA 3THSA 3H17A 5CH8A 2OBBA 5IRCD 4TZKA 1ZK1A 3INTA 5D87A 2QIPA 1E89A 4UBOA 2DHQA 2C07A 4J8PA 3RS2A 3S2FA 4N18A 3VPXA 5ICMA 4ZOLB 1VOTA 5KAPA 3O7WA 2JIMA 4C4XA 1F4LA 4OKNA 1A5AB 3NVAA 3ZWBA 4ZJUA 3DFUA 3TO5A 3KTFA 3VYUB 1DG1G 1XD2A 3AESB 2I29A 2J9FB 2CXOA 1M8FA 2Q3BA 3ITNA 3MG9A 3HXLA 1R8JA 1ZN8A 5DMHA 2H2AA 1YZHA 3KIPA 3G88A 4R5MA 1ICIA 3LPLA 3K0AB 2J3HA 3O1JC 1V1RB 1PL0A 1QJCA 1L5GB 3A9UA 1I94B 3LX4A 4EM6A 3B3JA 3M1YA 3TOCA 5KINB 3CLUC 3H8WA 3ZTYA 4YAGA 5J2UA 1XCOA 4REMA 4RVNA 1YFJA 4PAWA 2I8LA 2B7BA 2HWUA 2V65A 4QO8A 3T9DA 4IWXA 4RDXA 2FPXA 1JPJA 3F7TA 1NVWQ 4FYJA 1RWPA 4UXHA 4XDYA 4BX9A 4PLFA 3HJAA 2ETXA 3ZOZA 3VOBA 2VZ9A 5FB3A 5AXBA 3CG4A 3B36A 4L15A 4PYLA 4DUPA 5AKZA 2I7VA 3C6MA 4KO2S 5G0TA 4WXRA 2QAGB 4AKSA 1S8FA 4XVCA 1J8QA 1N1DA 4RZUA 2ZT6A 4G0VA 1V1MB 4Y2RA 2A8YA 4KKXB 2ZATA 3H5AA 4B84A 2AJTA 4EHAA 4AJHA 3IQDB 1PEKE 1ONPA 2IJGX 3W90A 4A03A 2BH9A 2CLFB 3NXKA 2M9MA 2H29A 2HA4A 621PA 1ZGHA 3UJ6A 4E15A 2FMTA 4Y1EA 3S3TA 4B71A 3NCHA 5HF9A 1CY1A 4EKDA 3P2MA 5IC6A 3ZWAA 4Y6GB 4FJ1A 1K66A 1GSOA 2NACA 3E8SA 3KV1A 3DE1X 3VKHA 1T25A 5KHLB 1DS6A 3UWOA 1WETA 4BJ6A 1VB3A 4HMQA 4YR9A 5EQFA 1GUAA 3W4JA 1QHNA 3FYUB 2IUEA 4CT5A 1Q11A 2WJGA 3UMBA 4EATA 3UHAA 1XLUA 2ET6A 1U3VA 1XMSA 1VG1A 3ZI7A 1T0JB 1AKWA 1OIVA 2EEZA 1Z22A 3H3FA 3RROA 3OBIA 4UVDA 3B78A 5DLQC 3WL6A 2LKCA 3AJRA 2ZRJA 3G2MA 2GBLA 3HLYA 2WVJA 1D2MA 1JLLB 2FUNB 2J0UB 2ZWAA 3EOZA 2QUBA 2ZANA 3GA0A 1GRVA 2ST1A 2OB1A 1P45A 1ZXXA 3NHKA 3SYTA 1ZITA 2MYNA 3GUCA 2FQXA 4IV8A 3STTA 5LDDC 1DWPA 3EUEA 3II6X 1CQPA 1Z3IX 4BS9A 4EG0A 2XVYA 2AD5A 2IS1A 1JLSA 1OAOA 3D02A 3GJ3A 5BNTA 3L7AA 4JLNA 1GHTA 3ISJA 3OKFA 3OZEA 5D6NA 3ZXXA 5HNKA 3PX7A 1ZU4A 1I0IA 5FTNA 1AKVA 1WZCA 1EBFA 1X1TA 2RMKA 4C20A 1JIXA 1J1ZA 4GOND 4TT3D 5TQ2B 2VSQA 1GCOA 4HJXA 4ER0A 5AMXA 1GA4A 1P7WA 4URZR 5B55A 1TT5A 2QNBA 1VJGA 2FAXA 1IPHA 1SG9A 1WIWA 2V7BA 4ZMRA 5EYPA 3HXPA 4RH0A 3WL4A 3WRYA 3PTAA 3HG7A 3I0NA 2FY8A 4RLFA 5LNK1 3W06A 4PVDA 3B1XA 5C18A 2FZ5A 1PLKA 3EVBA 1INLA 4YPFA 4FX5A 1XZLA 4Q66C 5TGZA 5JISA 1PTKA 3KSAC 5F3RA 2P9BA 3L6RA 2NT3A 2QVZX 1KQOA 4B82A 2CLEB 4QFBA 1D9ZA 1QC5A 1Q0TA 2PUEA 4U2FA 2C88A 2V7UA 3R3ZA 2ZYGA 2H5IA 1KERA 3IUSA 1XP8A 1NATA 1VIMA 2QTBA 3KHSA 3P4YA 3QELA 4MOWA 2NU8A 3UAGA 5FUQA 4FU0A 4FOPA 3L84A 5F4BA 4AXXA 1XAIA 4MPJA 3H65A 2Q7OE 1J09A 2CXNA 4A1FA 1QG0A 1BJKA 3NP9A 3WGJA 2HDHA 3E03A 1NIJA 4AMZA 1NI3A 1U28A 3HUFA 3FYTA 3MZ0A 4B9AA 4CR6A 4O4IF 2WHRA 4P7KA 3PDIA 4GOKA 1U7TA 4UOQA 5DM0A 4A2CA 5DN6D 1QHFA 1K0UA 3I58A 5TVKA 3ZZMA 2F8SA 3T7IA 1CHNA 3BAZA 2I1QA 4PGFA 3LUFA 3HBNA 4XRRA 4L8FA 1YKGA 2FN9A 2O0JA 2VWQA 2Q7DA 1ZA1A 3M4JA 2COEA 4BUCA 4UAJA 3TZHA 3BKWA 2WJ3A 2ATVA 3TEMA 5DBOA 4KRFA 5EE1A 1ZJ4A 3KEMA 4MHTA 5L3SA 2JNWA 4AJ1A 3K9BA 2WD8A 1HYGA 1CUZA 4PPNA 5A05A 2YVLA 1R27A 4L9SA 2C42A 4JB3A 2HLHA 1KAGA 1RBZA 2CYAA 1E7YA 1P1KA 1K2WA 3ZD6A 4XCXA 1XZBA 3N2LA 4YT8A 3QZUA 1W0KA 1VIAA 2FSSA 3HYLA 4B0OA 3TDMA 4RW0A 1E94E 1BEUB 5LMCA 4MVJF 2ZIGA 2CXSA 2GMWA 3BK7A 3OA0A 3OSZA 4GRDA 4MSUA 3R5TA 4NG4A 4OAOA 4R41A 3SI7A 5IVHA 4D3FA 5JAOA 2J33A 3WWEA 1QOZA 4A16A 4DFDA 4Y2YA 3HDVA 2VRCA 3HY6A 4J0KA 1W581 5T41A 3BM5A 1G9XA 1M76A 2IYSA 3PA8A 5CT4A 4F5EA 1QVRA 3ZD7A 3PFGA 5WRFA 2HRZA 4KHZA 5D51S 4DLVA 5JSZA 4EB6A 3L05A 3E58A 3TX2A 1XC7A 3L9XA 5B7QA 5KAMA 3OPYA 3MWGA 5CAEB 2RI6A 3RS5A 4D8YA 2X8JA 2D2XA 5EUQB 2VH2A 3BIXA 5IM4F 3UOGA 2I4IA 1EP1B 3ABQB 5JCXA 1VPDA 1JKJA 3P2KA 3QKWA 5TLSA 1FYXA 1JXMA 2AUTA 2R1VB 1IY1A 2NADA 3KOOA 1V96A 5EIAA 4C3ZA 4N9QA 2C5FA 4D4KA 4EIWA 1KY4A 4PEVA 1R74A 2JFVA 4RNCA 1CE8A 3GJYA 1V3QE 2VTBB 2QZZA 3VM6A 3T99A 5G3YA 3L4EA 5FI5A 2AFIE 3KQOA 4ISCA 2PX0A 3NBQA 4NQRA 4P81A 3AKDA 4OXIA 1W5BA 1U2GA 2XMCA 2ZYRA 2WYOA 3RUPA 4DA6A 3GA7A 4XWTA 4N5DA 5FOQA 3HM2A 2A14A 2VR1A 3LBAA 3QFRA 3I39X 5CPFA 2WD9A 4X60A 2I3GA 3T0IA 5EZYF 3G2JA 5G3ZA 1W85A 1OI7A 4TQUS 1NBHA 1JWBB 2C9CA 2REOA 3DTVD 4G1FA 1NF3A 2XWJI 3C97A 1NW7A 4OJMX 3GDHA 3L8HA 4A0SA 3CLSD 4QFCA 2PKXA 4URFA 1W52X 4QOSA 3SSNA 4PRZA 3PJRA 2OQ2A 1KXZA 4V1CI 2ZTMA 2BEWB 1K9VF 1UPTA 3F8WA 1BGVA 3NEYA 4C0KA 4HT3B 1JHOA 4ZVKA 1PUXA 2O20A 1NYLA 2PFSA 3A6HA 5A6SB 4DLYA 2R8ZA 2AE2A 3T12A 3ZHVA 2RHCA 4C6HA 1POWA 5CK5A 2WEKA 5F2OA 5JADA 3HXQA 1X2BA 3SBEA 3ZIUA 1YU6A 5BNFA 4O4HB 4U6SA 4O3MA 1NVXQ 2GZAA 3FH0A 3INGA 5CFRA 1LSSA 4FYIA 3THWA 4HQNA 2NV0A 1JHRA 4MVJD 4RL6A 4HB3A 2J4FA 1QRTA 1Q16A 3ZY6A 1AIPA 1GAJA 1TJ4A 4E5MA 3BWCA 1A4IA 4NU6A 3DDHA 4OMDA 2BRUA 2E5WA 4GS5A 3AF2A 4K9DA 5G0WA 4HB0A 1XTUA 1CUCA 1DFGA 4FZJA 5B7GA 4QZVA 3BHIA 1TZMA 3TGWA 1O9GA 3PFHA 4FMBB 4IF4A 4A92A 4FFWA 2CVOA 4IGIA 3UN1A 3VYSB 1W9MA 3DLCA 1G7CA 2W43A 4NBLA 1RI4A 4NZZA 5AM1A 3PRJA 1ZI9A 4ZT7A 3WGVA 4EI7A 4C5CA 3TJMA 3HKCB 1MPTA 1DKPA 2UAGA 5BN3B 5ITVA 4JYAB 2QR5A 1N3YA 3AQIA 3AR8A 1X80A 2BTQA 3GG2A 4DLTA 4YDQA 1NM5C 3HJFA 1E32A 4MVJH 1IC6A 4LC0A 5DCYA 3RHSA 3TNDA 1OBVA 3LFHA 3UJ7A 3I28A 2NP7A 1IUKA 4B8WA 5EIFA 4JR1A 4X20B 5EXDA 3FDZA 2GEBA 5B2ZA 1UXIA 3AJDA 2QUJA 4F4UA 1MCZA 5ADVA 4M83A 1WNTA 4I6JA 1VSTA 3FXAA 3PX2A 4Q21A 2V1XA 5AK5A 4BV2A 3HNPA 5FOSA 2AFHA 2AEEA 1QQ6A 1XZ8A 1J20A 3KKPA 3HGTA 2H07A 4PFKA 2XWBF 4H7IA 1UBOS 3ESZA 1G5RA 2A58A 4YJDA 1NT4A 4DM4A 5IAJA 2HU5A 1XRQA 4OLFA 5FUMA 1EU1A 3PL1A 1OX6A 1OLUB 3MT7A 1QIHA 1SWVA 1RAAA 1AF7A 1FK8A 4HTFB 4BKRA 3GD7A 2ISSD 3PKZA 3F73A 2G0AA 4IJ6A 5HOQA 4UAUA 3J80A 1MO6A 3LGAA 4KN9S 1H65A 3CVJA 4D41A 2HJVA 3IUMA 3T5AA 1QHYA 2SECE 3V32A 5DDIP 2IH4A 4GICA 1X1EA 2A9JA 3WDLA 2C7QA 5IC4A 1P4RA 5K01A 3UFXA 4XX0B 4EZIA 2ZIEA 2OR3A 4Z4EA 4N6OA 5D5HA 3VJMA 2ZUTA 1ULBA 3BWDD 2AXEA 3EGDB 3UMJA 4ALJA 3WB1A 3RR2A 1W5EA 2PXCA 2COUA 3EA5A 3LO8A 3BICA 4QASA 5E4FA 4BTVA 4S24A 3HVRA 2YFHA 4JQSA 4K26A 4MV3A 4Y30A 3CKLA 4EBFA 1Q77A 4G89A 4TM7A 3RE1A 1ZMRA 4M9CA 5JCZA 3VYRB 1YF3A 2RGAA 3N53A 3ZC3A 1Y4UA 1Y6GA 3W8RA 1TQ6A 2HQOA 4DCNA 1O0CA 1EA5A 4PBRA 4DDUA 4M0UA 2IPOA 4E4TA 1FDOA 3GVHA 2CV0A 1QFSA 3GRZA 3C43A 3MIZA 2VOJA 3PC7A 1YJCA 3DLPX 3ITEA 5BSMA 4AS1A 1G60A 2QYOA 2XUAA 4DT1A 4GEGA 3K71B 2P79A 3LCRA 1BCSA 3FMVA 3JU3A 5JZMA 3KHKA 4FZ3A 2C5LA 2C95A 4IOMA 1ZCJA 1DB3A 1GU0A 3CISA 3HB4X 3IVXA 4N8EA 4BMYA 4BRUA 1R0YA 2J5XA 4W8GA 3EPPA 5GQSA 1TFUA 2IQ5A 3AI7A 2G9RA 4HNAB 4OEHA 3RJMA 3NOVA 2FZLA 5BW5A 2BZGA 3QBEA 3S2UA 5CCEA 4RKRA 4RIFA 2AI2A 2QMYA 1U4NA 2OCIA 1VIYA 3IBFA 3UK6A 5BQ5A 1N2JA 3O3OB 4K88A 1X86B 4PNEA 1H6CA 1VL2A 2JLWA 1LNQA 2X8BA 4FEYA 1P2VA 3KQUA 4UHFA 2JDIA 2PY6A 5AKIA 5ENZA 2RHBA 1R37A 2XOKA 1GLGA 3TKLA 3WXBA 1G8SA 2F43A 4JVSB 5FPPA 5ALHA 3R6LA 4D9FA 3QE4A 2XCOA 3QU7A 1I1QB 2VS1A 4YXWA 4M0DA 2VNHA 3LUBA 3TCKA 3U0BA 3H6HA 3UQYS 1ZOIA 4DG8A 2DE0X 1SB9A 4F6RA 3WDMA 1BX0A 2QMZA 2X0RA 1BD4A 1CUHA 3HB1A 3KJXA 8GPBA 4ZU3A 1R4AA 3JD1A 1ZD1A 4KQGA 1CY6A 4WHMA 1SXJE 2BUBA 1H6BA 2EKLA 4KV7A 5DB4A 2X14A 2X0EA 5CTAA 1GPUA 1HFEL 1MH1A 1Q50A 2A9PA 1G1MA 3DMTC 5FNVA 1ZI6A 1PFQA 1U3FA 2KQUA 1A7KA 1GRNA 3NBUA 4D0LB 2G28A 3FTNA 2WIJA 2X0FA 3A27A 4IHQA 4XE5A 4A3SA 3A2NA 1BU8A 2K4MA 2C7VA 4Y7DA 5KTMA 3TLMA 2N47A 3KSZO 4FILA 4H59A 1DIOB 2W7TA 3HE3A 3I42A 5T4FA 1SKQA 1VHTA 4S2UA 4Q39A 5FTLA 3T7EA 1ISPA 1I7LA 1YULA 3V1MA 2IT1A 4LXQA 2XE7A 3TE7A 3H2YA 3WWZA 3ZWKA 1E0AA 4IOJA 5B1SA 1XVLA 3ZHZA 3L01A 1DELA 4PRLA 3FE2A 2CHVA 3IPCA 1CTQA 2ZRMA 2WF6A 5I01A 3DE6X 4YREA 3EC7A 4KGVA 5HYVA 7MHTA 4ZCSA 2F1JA 2JFNA 2OZEA 2Y68A 4I7EA 5EIEA 4E09A 5JQGF 1EP9A 4PYQA 1E77A 3IP6A 4HN4B 4NG5A 2FW0A 4QDUA 5TQJA 3SK0A 5F9FA 2QJWA 2AC7A 3OQIB 4BFYA 4LZNA 4ZI3A 3ID6C 2G36A 4RL4A 5E4TA 2IU4A 3A4TA 4P3NA 3W6OA 1WQ4A 1V35A 3ZH2A 3A31A 3VDMA 4D44A 1GGNA 1JQ3A 3G59A 4UUAA 3DVAA 3NEAA 4BN5A 3HXMA 4KTTE 1Z4JA 4QNMA 1T36A 3I3OA 4AZ3A 3DVQX 4FE7A 4ALMA 4MQ5A 4TKUB 2A9OA 4C7MA 4OD0A 4OPMA 4BTEA 1N3BA 4RK5A 5CLLA 4Q4CA 1CRPA 2FMHA 3SNKA 1CUIA 4B9EA 4RD4A 1R2QA 4LY0A 5B2EA 2FUCA 1VLQA 3H8JA 4LGMA 5FA5A 4QGHA 1WPRA 1TCUA 2UZ1A 3FI0A 1RLOA 3G79A 4BBPA 1CRQA 1Z0AA 2DPMA 2PIDA 1GITA 3PUVA 1KI8A 4AQ7A 2VLBA 4MUKA 4RTKA 1U1EA 1FLVA 1JYSA 1RWNA 1SU7A 2CMGA 2IIQA 4IIHA 3WL3A 3QUCA 5AI4A 5C8ZA 3HK2A 1X8XA 2AVNA 2XCSB 4IICA 5JTUA 5CITA 5CD1A 2NZJA 2HBYA 3DOJA 4KE6A 5HEKA 2HK9A 4XVQA 1FL9A 2L0XA 2QX6A 2Y1GA 3N28A 3VX3A 3LQ1A 3LL4A 3SC2B 4EUFA 4A6DA 4AJIA 2AFIB 2IHYA 2E82A 4NK4A 3KU1A 4PR0A 2OPBA 4CKXA 1ZVMA 1U0SY 2P4UA 1WJGA 3A9WA 1CIJA 2DLNA 4CGYA 4XCQA 3QTBA 1GU1A 2QJOA 4Z53A 2KPOA 4EENA 2VXCA 2LD4A 2VDMB 4M36A 4PLYA 1N2BA 5ADUS 2FRXA 3BEDA 2BHSA 2EFGA 1KAQA 1SIWA 4WOJA 3ADDA 4GI2A 3A36A 4TLBA 1W36C 1XZDA 4TLAA 1PT8A 4BNTA 4C2UA 3DBLB 4M9XA 1BD3A 1VI6A 4P93A 4EG6A 3IEVA 3ZDCA 3OFSA 2OSVA 3V5NA 2YIJA 2QD5A 2YASA 3K0FB 3SZRA 4DQKA 2RHMA 2ZBPA 2ZDQA 5LCXA 2FQ1A 2XTNA 2XB6A 5D1HA 3KSBC 4MPPA 2F67A 2E2WA 1PX2A 2O0KA 1G17A 4NZYA 4CF6A 4E12A 3CTPA 4TWZA 3PNYA 1HSZA 4HN9A 5TY0A 4J49A 1KGDA 3HFJA 1SH7A 1E64A 1Y81A 3PC6A 3I52A 3L8GA 4KLCA 5DXFA 4QAQA 5FFMA 3RKUA 3T7AA 4B3IA 4MYTA 5C4IA 2KM1A 4O2AF 2HSZA 4NBTA 3NKFA 3E0XA 4ATNA 5IPFA 3KR1A 5HBRA 4D8VA 4NZOA 1ZJJA 4AKHA 2JBAA 1RWQA 5EA2A 3LCMA 1GA1A 3ONDA 1OQAA 2G1KA 5EMKA 1PBTA 1PQYA 1H2AS 4PFQA 3T1OA 3V33A 1CUDA 4TUYA 2J3LA 3O83A 3P0FA 1FDRA 3M1LA 1E8DA 3AJ9A 1ORTA 3CNBA 3S68A 3WJ7A 1QZZA 1NLUA 4P98A 5K2OA 3LP6A 5FOUA 1U63A 3D1VA 3LG2A 2J3JA 3U81A 3ZV3A 3MTIA 3RIGA 1G5PA 4QRHA 1ECFA 1U4SA 2CXUA 4AJKA 4CM3A 3DLTA 4QQKA 3NGXA 2OZLB 5E2BA 4AC9A 3OZTA 3V42A 2PH3A 5CVUA 1BGXT 1PK7A 1MOPA 3MN1A 2E4VA 5I9NA 2JJQA 1ZSNA 5JPCA 1K89A 1TJ3A 1UK9A 3GJ0A 3Q6IA 1JHYA 3R3XA 3E0QA 3DP9A 5IKMA 2Q4EA 3AFHA 1GN9A 3KTDA 5CFPA 3U3KA 3CQ9A 1JDSA 5GM1A 3CINA 3RAEC 2DR2A 1H9BA 1PSDA 1F48A 1Q7TA 1UZNA 4YGYA 4AG6A 1V7CA 2OP1A 4PXYA 1OPRA 4RIGA 4W5NA 4CKEA 2CMHA 3KEGA 1Q7BA 2I7DA 1I4DD 1PJTA 3C3CA 3B70A 3ASZA 3MQ4A 2RARA 3HMKA 1W46A 2VK1A 4JJFA 4BGUA 5EJ9A 4I6EA 4I36A 1TYEB 3UFBA 2MYUA 4C4RA 4KXWA 4RDIA 1J0EA 3P2JA 5KOJB 1BYIA 1J2TA 1W5AA 4EI2A 5JXJA 3AVOA 1PT5A 3N2GB 4E21A 1IWBB 1N36B 4ME6A 3ZY4A 2OWDA 5KQMA 3GRRA 4KYTA 4YO7A 1PEAA 3FBWA 5KZMB 2HMTA 2ICAA 4QE3A 2UXDB 1TVKB 4YUAA 4MB2A 4BMSA 2WWRA 1Z06A 3KVNA 3SYNA 2AI1A 1GUZA 3ZWOA 2D7CA 3FPEA 1JVSA 1SKYE 2YJ4A 5FWDA 1YZ3A 4HWRA 3IILA 2LUOA 5CX1B 5ALNA 4B6RA 5KSYA 2ZU0C 5LIPA 1VJRA 1HLFA 4TGLA 4BCBA 1D2AA 4PG5A 4WCDA 5CLHA 4NPHA 3H9UA 3IURA 1NJ2A 4PPYA 3IL2A 2NLOA 1JJFA 2B9VA 1AZLA 2NVBA 2VCEA 3GP5A 4TKZA 1JDVA 4BWYA 2HBZA 1WP9A 2I6XA 4EL5A 5C51B 1DAPA 5MFZA 4HLCA 4BZXA 4I1OA 1KAOA 2PUVA 1OE0A 2L69A 1FRQA 2ZPUA 3AF1A 5F2EA 2CW5A 4MV0A 4YT4A 3BX1A 3ZKAA 3INRA 4GX2A 5HQJA 5LD2C 3ZK9A 1FFWA 1TUBA 3K2QA 3QQPA 3L0SA 4K9NA 4WACA 4M9SA 2GI4A 1KBQA 3JQFA 3MD9A 2B4YA 2XVMA 4X93A 4D9CA 4EPXA 3T35A 5A1JA 2RKBA 2I4NA 2AG0A 3U3JA 3ED1A 1KAHA 2BCJQ 3BBLA 4UTPA 1JU3A 2FZWA 1Y5RA 1Q21A 1OZ0A 2XWPA 4MRAA 2EP8A 2IYUA 2VDPB 1Z83A 2HTFA 2VTEA 2ZRGA 3ENZA 3IOEA 1ZIDA 3C3PA 3ZHCA 3RUAA 4PLZA 2VHUA 3BXEA 2A4MA 4R98A 3K6SA 1JLLA 1W48A 3DLIA 1WG8A 5AICA 2H31A 4Y2XA 1E9SA 3ZU3A 1XZQA 3JPYA 2FSUA 4IDEA 4J76A 3Q9SA 2ZYTX 4YRNA 1NFFA 2JGLA 4DQ0A 3QHQA 3KSRA 4PLGA 2JAOA 3STWA 3MS7A 4DWVA 5CDSA 2EFYA 2Y0DA 1VLJA 4IGEA 3SVLA 5B5SA 4Y6PA 1QRSA 1H23A 4IDAA 4YJGA 1IMJA 2OP0A 4PBSA 1JDZA 4FJ0A 3NAZA 4OHKA 3I01M 3TZEA 3AIMA 3M4ZA 2R87A 5THXA 1U0JA 3ECCA 3SBDA 2AMFA 3C24A 3UAVA 1JEJA 1FRZA 4AWAA 3HCDA 3LA6A 3ACDA 3JQ9C 3EFOA 2HM7A 4FFLA 4R1QA 4I19A 2VDRB 4AY3A 5JANA 2VDLB 1SXJB 3R7AA 3MINA 5EHQA 4B76A 4HNSA 2B5WA 3OESA 4LRXA 4QUBA 3EVDA 2UKDA 2M98A 4MI9A 3PBKA 1MR3F 4QXOA 3EE6A 4DCSA 2HY7A 3LUAA 4F8JA 2Y1WA 3OLVA 3HJHA 3MT9A 4MPRA 1K7XB 4YFYA 4B4WA 2ZSBA 1NXOA 1NMSA 1UODA 4R9UC 3MJSA 3ZZNA 3PP8A 3WDSA 2PUJA 4BP3A 1KE2A 2O8CB 4BY9E 2CWDA 4Q9HA 3R7BA 4DY4A 5JS1A 4NAHA 4UM8B 1Z3CA 3FOCA 2YV4A 2HL6A 3OY2A 3T0GA 5JXHA 1QZXA 2EKDA 3HEMA 1IH8A 1BN6A 3LRXA 4FHFA 3QU9A 1T4CB 4IS3A 1M8GA 5K8VA 5JHHB 3ZWQA 1MJFA 1YA6A 4G81A 3NAGA 5ALIA 1R88A 2G40A 4XASA 1CW2B 1XUOA 4JLPA 1RAIA 3FYHA 3ESYA 3BXZA 3SHTA 5DCWA 5TQ0A 5C35A 3M82A 4P4SA 4C1NA 3ZWMA 3ZBTA 1DCKA 2NZVG 3EVGA 3NG1A 4Q1CA 5BT8A 4DV1B 2LNDA 1GZ4A 3TECE 4IV0A 2CNKA 3R6TA 3WLEA 3GB9A 4X63A 4CETA 3F6YA 1PT9A 3CXUA 3N2IA 1QR2A 2JCBA 4D92A 4YT2A 3WZMA 4E7PA 4KDFA 3I0MA 2NUAB 2GTIA 4K6FA 3VFDA 1G7RA 2R44A 4I66A 1XRRA 2R2GA 3ONNA 2ENUA 4Q9LA 3WGKA 2JLXA 1JEAA 2IVZA 1CEQA 3DC2A 3FCYA 4ZXFA 3ZXIA 1X8KA 4EGJA 4YPOA 4NCAA 3NYWA 5JYBA 3U7EB 1MXHA 4KN8A 2HREA 4RHFA 1M7BA 2NZ2A 1HO3A 1G16A 3T5DA 3JVVA 2ZS7A 5AHOA 1DTWB 3NVDA 3PC4A 3T95A 4LY6A 1LY1A 5TNXA 1JR3E 3CH5A 2WB4A 1UBUS 1V16A 1JFVA 2O7RA 3P52A 3JQBC 1SEVA 3CT4A 3X1WA 1KS9A 4M8LA 1G0NA 3MT0A 5ALZA 4Q7MB 3AEUA 4KKVA 4PXSA 2VZ0A 5DTMA 5BSHA 3R5JA 2VXYA 4FCWA 5IJ9A 4HNTA 1AHNA 2J1LA 5SYAA 1WF3A 1Y4AE 1B42A 3THYA 1K5GA 1TZKA 4Y6OA 5FYDA 2VJBA 1GQQA 3OMLA 2CDCA 2VYND 3T06B 3PLAE 1IJFA 4PZ9A 2O7SA 1F2UB 1OA1A 3COJA 1KIFA 2FN3A 2OD7A 2WWXA 2HT6A 4OXRA 4TTAA 4Z51A 2TMYA 4PM4A 5GTDA 1BKDR 1OZGA 2YS6A 3ANTA 1IQ0A 1VBMA 3U5ZB 1JI0A 2F3TA 2QRQA 4QUIA 2VEOA 3JZAA 1HTTA 2X76A 5DNCA 3IMEA 1WY5A 3OX2A 4BVGA 1Z0ZA 4L5AA 1XZJA 1Z2DA 3W7BA 4RVCA 5CT5A 4M1YA 1L7OA 3HJGA 4ZI2A 9ATCA 2NSDA 3MWEA 1FU4A 3ET5A 1IJEA 1L5MA 1R6XA 1XN4A 2IQIA 3KX2A 3QGMA 5IDQA 5JWRA 3UKDA 5IBRA 4IUCS 4C2BA 1EGMB 1UKVY 2VH1A 4P7JA 4JQCA 4CUKA 1I32A 1XNGA 3CV3A 3LKDA 2I6SA 5KSPA 2Q1UA 2Q5LA 3HPQA 2XRMA 3OEWA 1P33A 4MS3A 1PW7A 1I5RA 3KZVA 2HSDA 2FG5A 3IMFA 3EEIA 3SXJA 3DZHA 4F4DA 4HLNA 1EXMA 1WB5A 3N8GA 4ZHQF 4Z1MD 2QRLA 1NJSA 1Y4DE 3DE7X 1Q74A 3TNYA 3D8TA 4JS0A 3I2KA 3H9CA 2II6A 3R0QA 4NHEA 1UXOA 3A28A 2O52A 3R20A 4J7XA 1KFKB 1AKEA 2BZ0A 4L0CA 4UEKA 1ZU5A 3VTAA 3W0LB 3G7SA 2I78A 2GESA 1KYTA 2AR0A 4L4ZA 2CHGA 3HBLA 1Y1RA 2XGGA 2XXAB 4QM6A 3ZQKA 4QYXA 2GGSA 2VJDA 2YXPX 2O8BA 2Z3WA 3LDUA 4OBXA 4UNSA 4OL0A 3R24A 4Q3OA 4EKNB 1XMOB 1SCUA 1R00A 2XF2A 1Z6GA 4TX1A 3O3MB 1HKHA 4N8DA 3W2IA 3AB3A 3O8OB 4INPA 3QEKA 4IH4A 3R7DA 1EM8A 1T24A 4C7OA 1XP5A 3PNQA 3DQPA 1KWGA 5FV7A 4H6VA 3WK6A 4HDRB 1D6JA 3GMIA 5CXQA 3GEDA 1NQUA 1Z7GA 2W4QA 2YX1A 5JBNA 5BN5B 5B4UA 2EX4A 1RJEA 2B1QA 2VBCA 1SK8A 2IIPA 1R16A 2L19A 5JNTA 4D9NA 3GJSA 1CDOA 2PZGA 1Y6RA 3LMKA 4C04A 4HBGA 2F3QA 1YCGA 3A4NA 3KCNA 4LG1A 5LZ2A 3QEBZ 1RHKA 2ZR9A 4NECA 1ZCBA 2I5PO 3DMRA 1QLJA 5IAAA 3FHJA 3TXXA 2GERA 3STXA 2PD4A 3L1HA 2B92A 3L8ZA 3Q9UA 5JCJD 1BMFD 2XHEA 5G4KB 4D9EA 1SKYB 3GPDG 3KAPA 1K4YA 2EGGA 3UJ9A 3A4VA 1ES9A 1E79D 5H02A 1P19A 1YZQA 2BY4A 1U8TA 2QX9A 2ZZKA 5FPQA 5YASA 3FMFA 2B8EA 2FPIA 2G83A 1EI9A 3DKPA 4I1RA 1R0SA 2PFKA 3H2SA 4X7RA 4MUYA 3T7SA 4PRYA 4OLBA 2GFQA 3DO6A 5DN9A 5KWJA 3T41A 4D4LA 1ZEJA 3SMVA 3RWBA 3RTEA 3SHFA 1ZCAA 5ALWA 2VDVE 5AW6A 2WICA 2FPSA 4X1KB 5TEWA 1PQPA 3EYAA 2OGWA 1IN4A 4M1OA 4BB6A 1Z75A 4GW3A 4ZA2A 4QUAA 4QEKA 2WG2A 1RZRD 2WJVA 1LLDA 3OPYI 3PJGA 1IN8A 1WXHA 4XGIA 3LT2A 3R8XA 1J23A 4JCOA 1C0KA 3EXHC 1HY3A 1B8NA 4W82A 5ICFA 2EYQA 3N05A 5J5VA 3ZV4A 1NSTA 4E94A 3U7QA 2O8NA 4QYTA 3K9FC 4D25A 2EW8A 1BXRA 1K08A 2H1CA 2W8BA 4HRAA 4B2LA 3IE1A 5KOHA 1Y7PA 4FC6A 1NI4B 3R9KA 3OZXA 2W6ID 4GWGA 4OCZA 1FYEA 1K7EB 4IO1A 4YH1A 3AVWA 5K1ZA 1WEHA 3E1KA 1L5NA 4U6NA 2DOKA 3W1VA 1L5QA 4II3A 2DAPA 2Z5LA 4EHFA 5FLXA 3ZW7A 3JATB 3HJTA 5EJ4A 2HQ1A 2O48X 2QL9A 2VTBA 4DB4A 1CJCA 1J2UA 1U5BA 2E1RA 2IXBA 2QSUA 3NHSA 4XKJA 5AOBA 4ZVOA 4IHJF 1KDYA 4YRGA 1P1IA 1PGPA 1OGYA 3AEQA 4D57A 2DGDA 3AM4A 4TSFA 3NBXX 1BS2A 3FZQA 4YUWA 1LLQA 4DSTA 4ZVVA 3M6VA 4ND8A 1NP6A 4HQ0A 4XI9A 4YJHB 5KB3A 1GTRA 2GLTA 3FWZA 1RDFA 2C7BA 1X77A 2UVPA 2FW1A 4LHVA 1ZD9A 2FFBA 1IVNA 1XKLA 1YBHA 2ZYWX 3MTBA 3NASA 4RACA 4R71A 2Q2QA 4EI9A 1CRZA 1LKZA 1ZUWA 4R2LA 2C7RA 4NXMB 2D0PB 4XVUA 5A4MS 1E63A 5KDLA 3FHOA 1TL7C 4RPGA 3U37A 3T4PA 3H05A 1P5HA 3EAQA 3KSDO 3LPNA 4YMWA 3KUCA 4GZ5A 4JYMA 4DV4B 3PXDA 1KFCB 4O0MA 1F17A 4H3VA 5JCPA 4MI1A 4C0WA 2XYHA 3USZA 4C2AA 3MELA 1RRCA 3DMDA 2F8LA 2G0TA 4NPCA 3OI7A 1PZHA 3BXXA 3MGBA 3EIOA 3PEEA 2VHZA 4U2CA 1AB6A 3BMCB 4IDDA 2J67A 3DGEC 4HEJA 1ZJWA 3FTPA 2YH2A 1F5NA 2CXQA 1MNQA 2PSHA 2D59A 4GRAA 1PGQA 2Z1MA 3NC1C 4NABA 4EPYA 4EY5A 1T6YA 1DAIA 3AG5A 1AKRA 1KR2A 2Z2XA 3L4SO 2HGSA 2L17A 1VL1A 3EDQA 4GX5A 3KJQA 1MABB 4TLDA 1QJ4A 5K09A 4RTRA 1FU8A 4M8IA 1NWHA 4WADA 3EW9A 3NI2A 2HEIA 2Z6UA 5AHKA 2Y1CA 5GMOA 1DFHA 4QRIA 1XDZA 5FBLB 1HQDA 4BEJA 5CFQA 1LPOA 1SC4A 3Q7IA 4AURA 4AY6A 3IIKA 4BQEA 1CNMA 1O9BA 1QHGA 1FYDA 1E4OA 1GN8A 1JVNA 4L50A 2VJOA 2NP6A 3V1NA 3E48A 1E96A 4HC4A 1NJ5A 3WADA 2EJWA 2OXEA 4RK1A 3F6CA 3ZE6A 3PEWA 1R4NA 3KOMA 2DLDA 4DWOA 2GM9A 1JG3A 2YWEA 3AUFA 4M1TA 3AINA 2IYXA 1LA2A 1U7UA 1KBZA 3DV0B 1N2GA 3EISA 4GPAA 1YJAA 4JJZA 3HKEB 5BOSA 5C8DA 2VHQA 1G6KA 3RAPR 3W7VA 3H3JA 4WKBA 2QB5A 3KHTA 2FEXA 3CUSA 4XYGA 3TTVA 4DJ5X 2QP4A 1NVTA 2M2IA 5AVYA 5LUAA 1HM5A 2VJNA 1FUUA 1T2VA 3A37A 3T7DA 3B13B 3Q0IA 3ONVA 4WBXC 2AN4A 1CK4A 4JL6A 2NPFA 1H2HA 4IOLA 2P0EA 2BT4A 3O4JA 3TNLA 2Q6OA 3JD3A 2J9ZB 4IMPA 1RTTA 5FWAA 4FI3C 5TMEA 4R2HA 3OPNA 4RFLA 3L8DA 3RYCB 1OILA 2GCGA 4RK0A 3TBKA 1NG9A 4LW8A 2VJPA 3VC3A 3WL7A 4UM5A 1WB9A 1CWUA 3RFCA 4DMUB 2QRPA 1I3MA 2FRDA 3F2IA 5KQGA 1I2BA 3EDMA 5CA1F 4JLBA 3MWDA 5KYYB 2QKYA 1I24A 5KTPA 3TPCA 3NIWA 1E1QD 1Y1SA 4I14A 2SCUB 3G2IA 1PFVA 2YQ5A 3UG6A 1HMPA 4P0QB 2VCHA 5HIJA 3NNDA 1NXWA 1Y8QA 3D4IA 4HGPA 1V3VA 2WA1A 3BAFA 3CB4A 1W96A 3H11B 4YP9A 2BN4A 5KX5F 4GP6A 2D6FA 3PIIA 3LHDA 3G0OA 3GBVA 1KH3A 3TTSA 3SEZA 2YZKA 4Z3OA 4NU5A 1DIBA 3AUJB 4LC9A 4K9QA 1F1JA 2R00A 3W8EA 5DEOA 5FCDA 5DNUA 4WLOA 2ROQA 4PX9A 2Z8YA 3OZGA 2W2TA 4UVEA 3ETHA 3QBDA 1MB9A 3IJRA 4DJDC 1ZD2P 2FDRA 1WKBA 4B7AA 3B7WA 2ZRHA 3TD6A 4MVJE 3QM1A 3AQ4A 5H81A 2PWPA 4M0CA 1C50A 1CQXA 4HGQA 1GKUB 2E49A 5AUQA 5FP0A 3S0JA 3EH1A 3GN1A 3TFQA 4RXTA 2GZ1A 3C6BA 5I7AA 2JGIA 3VU9A 1NN0A 4BYMA 2F4VB 1U0TA 4G56A 1W1WA 4HR7A 3FUUA 4F9FA 1XI2A 2XQJA 3UCEA 1XLTA 3AR4A 4IUBS 1RWOA 2DHRA 3CC8A 5FAXA 4ZAXA 3IUQA 1OBOA 1M75A 2AR9A 2UYQA 2EQBA 4PZLA 2FCRA 1K92A 2FSVA 3CPHA 1Y3HA 1BFDA 3N07A 5FWXA 4MX8A 2J45A 3O2SB 1CFJA 4IIJB 5EWMA 3J81A 6NULA 1LDMA 4R9SA 5CBPA 5JSFA 2XDQB 4PANA 3DO5A 5CLGA 3WAGA 2ZB7A 4GOOD 2VO1A 3H1TA 4H08A 1G19A 3Q8MA 2ANBA 3PGKA 4RD2A 4YRTA 2QQ0A 3GVIA 4Z0TA 3PGMA 1G3IA 2BM9A 2HMUA 5FXMA 1J2RA 1A97A 4TXLA 4C4TA 1QQ5A 1MQSA 1XZKA 4ZPXA 3RSCA 4BVLA 1Z8NA 2GVZC 1EXNA 4MP6A 1THZA 3ACCA 2R47A 3RVQA 4EDHA 5HE8A 4R8SA 4LF6B 3ROZA 4JVOA 1E66A 3E1SA 4RD0A 2CBGA 1VJCA 2CYBA 2F9LA 3K4PA 3PYXA 1E92A 4H35A 2C2HA 3RKSA 1KU6A 2D2EA 4FGUA 4BMXA 4EELA 2DFNA 1QAMA 4J0QA 4RHYA 2P69A 4I50B 2Z6QA 3ND5A 3IV7A 1W8DA 3JQ8B 5HRCA 4EYKA 1CQIB 2JIRA 5TX7A 2B20A 2AX3A 1CY2A 2HNKA 1KR5A 3LDAA 2V3WA 4CKBB 3T3GA 2IYYA 1G59A 1YB2A 3DEJA 2BEVB 3OZIA 4MV8A 3SZOA 1EM6A 1VCMA 3MOGA 2TSYB 3T1VA 3TDKA 3QYFA 4BJ5A 2V5VA 3EA0A 5EPOA 1PU2A 3ZJ5A 5AK3A 1Q12A 3JQRA 3H9EO 4MWGA 3SQDA 2ARKA 1SM4A 3EIEA 2XPCA 1SY7A 5LMNB 5A04A 1WS6A 3DWFA 1S89A 5DYTA 5J1SB 5I4IA 3MTEA 3RS9A 3WHPA 1IVYA 3NFRA 2IBSA 2QS9A 5KOJA 1Z73A 2H7XA 2YJ6A 5FUYA 3HABA 3V8VA 5EEHA 4F7DA 4QUDA 2Y6UA 5EJ6A 3B1ZA 3R0ZA 4GYYA 1AS3A 2PNJA 1DRWA 2Q7XA 1IM2A 4PGGA 4ZO6A 4EFLA 2RIPA 4DVJA 5CT9A 2WD7A 4MJ3A 1E59A 1TRHA 1YVRA 3A1DA 3C3YA 3ENWA 4E5NA 5F33A 3U4MA 1NY6A 4Q05A 3QXSA 4PHFA 3EFEA 2Y1EA 3AR6A 1CT9A 4OSPA 1HYHA 5CX1A 2LIVA 5E9WA 3BT7A 1YS4A 3L0CA 5T5QA 3HUTA 4RGYA 2QM8A 3LF1A 3EF1A 2G3YA 3WV5A 1MX9A 2B83A 1RP1A 3NT5A 1H0RA 1V4BA 3QMMA 2CLCX 1P0IA 4RZSA 2C9BA 3E5RA 1VMDA 1P5JA 4WDRA 4UTRA 4GL4A 4B31A 3B6KA 2FYTA 1NYRA 2ZB3A 1LPBB 2P78A 1T5OA 2DWQA 2GCOA 3BE5A 4IG4A 3ANLA 1A5SB 2UYOA 2DZDA 3WP1B 3A32A 2OFOA 1CQZA 3G0DA 3EWSA 3SY8A 1I10A 2GO7A 3K0CA 5IF3A 2A0KA 5HILA 1WEKA 3SR4A 4LWPA 4P58A 1OU4A 1ZW1A 2BMFA 2PBFA 2Q6KA 3P9ZA 1IXKA 1JG7A 1CEEA 1IVSA 4RSGA 4GZLA 4BNYA 3NHPA 2VT7A 1MQAA 2D5IA 4M21A 1AUPA 3BQMB 4DA0A 4OQYA 3DCJA 4R8MA 2V45A 4LZPA 5TMDA 1IBCA 2PUAA 4I9UA 2YIDA 4E4RA 3ILHA 4BBZA 1K6MA 3ETCA 2PPLA 3ROEA 2CLHB 3C3XA 5LMZA 1M2JA 2QUZA 1J5XA 3QP9A 3T3MB 3THOA 1JB1A 1RJ9B 3COYA 3FBGA 1PJAA 1XZCA 2CEKA 1PHRA 3PJDA 2EGHA 2FOLA 3CX3A 3QU2A 4R1SA 3X1JA 4N5IX 4F3CA 2OUIA 2QVCA 4TT8A 3X1DA 4CLEA 4EAAA 5CB6A 5T6MA 3MFQA 4J16A 4OYLA 3H8VA 1KYWA 3CRZA 3UCFA 1QCCA 1OF1A 3OT1B 4JDPA 3F47A 4LFAB 3F90A 3EXIB 4GKAA 4ZRNA 3I6QA 1MVOA 5IAEA 1II0A 2G8NA 4M1ZA 4DMKA 1GFSA 1KSGA 3BQNB 2G5TA 2XUHA 3BFJA 3OWOA 4FOSA 1E7SA 3H83A 1UH5A 1ARZA 2C3UA 3O6VA 3CNOA 4L5JA 1E6WA 1WCWA 5EJIA 1QK5A 1MV5A 4LJRA 3BHNA 4RJLA 1YE8A 5KBYA 5DTRA 4OHYA 1HE8B 4HXFB 4RCZA 4OJYA 4H1TA 5ALEA 3HRKA 1EQUA 4D4HA 4FB4A 2XTZA 4NARA 1BQ3A 3WBKA 4LOHA 2L18A 3A6GA 3I1FA 3K20A 2IHBA 2XSZD 3NM5A 1NGSA 4C7VA 1YKSA 5B4VA 2NUPB 2YWRA 5JZBA 4O4JB 5AK0A 3I62A 4WY2A 4KSCA 3KAKA 2PLAA 4P3XA 4ZQGA 2PWYA 4ZPJA 1QO7A 3MUNA 4R2WA 2JVKA 2VQSA 4FKMA 4EG8A 3IH5A 2BFCB 1CZUA 2YRWA 4BAUA 2OYSA 2C9DA 3ZEIA 2ZRNA 2WZCA 4OJTA 4B85A 2B4KA 2GN4A 4WE3A 3RTAA 3V4RA 1O94D 1ZA2A 3BGVA 2G07A 3FIJA 2C0PA 3KXKA 4N5HX 2FP4A 4S2EA 4CM6A 4EX7A 2KWIA 1H8HA 3QVWA 1PN3A 2DQYA 3ND9A 4KPUA 1X9HA 4NBVA 2OCXA 3D3WB 3A9SA 5L3QA 4Q48A 5TV2A 1HGXA 3NVKI 4LNUB 1BA3A 3PRKE 4CCWA 3B3AA 2FEKA 1LK7A 3CRW1 4X44A 1K8QA 1P9WA 2O3TA 2QTZA 1GT6A 1VGVA 1EQAA 4Q7JB 1CETA 3ZVLA 1PTJC 2ODAA 5HM6A 3IDZA 1A8UA 1C4XA 3TQIA 4F4HA 2I6UA 3FZGA 1A8PA 2XNDA 4CQLA 1MO3A 1M5UA 1AD2A 3NOXA 1QYRA 3RUCA 4ZZ0A 2ZVQX 3RVBA 1BVYF 1T8WA 4RLSA 2YUIA 3KQVA 4IX9A 4GVXA 4CQMA 1VJ0A 3WA7A 4OXQA 5I9LA 3F7OA 4WA8A 3RASA 4KX3A 3VGPA 3RTGA 3MTAA 4RS4A 3PENA 4RO0A 3K96A 1I2MA 1LUAA 1QPGA 2A1TS 1JZTA 2IYWA 2FWAA 4RCYA 4BVJA 2XCTB 2O3RA 1UEIA 4IR7A 1E6UA 3GFGA 3F6RA 1J1IA 1J8VA 5ALGA 1KJQA 3D0KA 1UFVA 3D6FA 3H5IA 5JMTA 4CMEC 1XVUA 3EODA 4DCMA 1EX6A 2C5EA 2HPHA 2OORC 2MJLA 3DTVB 5IAOA 3GP8A 1DTWA 1IHPA 4O4IB 2ZS9A 3CONA 4ZYLA 2WUGA 4CEHA 3JQGA 4PG8A 3EWIA 4P3KA 4C0HA 2C4HA 3GJ7A 3NT4A 1FBTA 2H18A 2VHYA 4MR9B 4TTSA 2Y71A 3L0PA 3QXCA 4C89A 5JEDA 2AW5A 2HHAA 4JP8A 3W77A 4UBNA 2PV7A 2GM4A 1Y8RA 2DCUA 5KYNA 1L6RA 2CUKA 3KPYA 1SOWA 3IHKA 1S3SA 1HT2E 4YMSA 4HV4A 3HCFA 2PGAA 2F1RA 4GAEA 3TQQA 2PH5A 2RG1A 1BDBA 4BLVA 4N82A 1KY2A 1UQRA 4BO6A 1XZGA 5T8KA 2Q45A 3W5CA 4BQQA 1KYXA 1ZD4A 5FTMA 1ESCA 3O90A 5K6TA 3ZY2A 4AF6A 4MW9A 1G38A 2VA8A 3L07A 4HSGA 4XFDA 4XPIB 5DM1A 1R9JA 1SC9A 1YR6A 4P2GA 2QN6A 4B09A 3C45A 2WYHA 4X94A 2Q28A 2H0QA 2OXCA 2Z2YA 3BXOA 7REQA 2VQ6A 1XVTA 5FULA 3UBTA 2J6BA 1MVLA 4HUJA 4NR0A 4NYJQ 2QQEA 4BXOA 4Q3LA 3SVTA 3Q2KA 2XR1A 3DMNA 5IH7A 1TECE 3ZU6A 3JYQA 2WR8A 3DPIA 1OIWA 2R68A 2IP4A 5E2AA 5JJ5A 1F4VA 1D09A 4NOLA 2WK1A 4LVNA 4R0VA 4F71A 5LM3A 4W9NA 3T5PA 3G23A 1ORDA 3I23A 4E5YA 5AVOA 3QF4B 4A82A 1OREA 2ZM5A 2ZRPA 3MRXA 3WGZA 1T2CA 2A59A 3AZOA 3O4HA 4RY2A 4DMCA 1DDOA 3NHRA 1Z4PX 3O8RA 4M7PA 5CJ2A 2QW8A 1T8UA 1FUYB 1VDZA 3E61A 1OLSB 3IIJA 1EX7A 1ZXBA 4V02A 5KHAA 4CKWA 4V3CA 5C3MA 1COWA 1CR2A 4FN5A 2WUWE 4NE2A 1N5DA 3CUEF 4MUJA 3KVVA 1RHRA 2V8BA 4JZKA 5HPYB 1E4YA 2FPWA 3QVGA 2EATA 3HRIA 3HJRA 4JQYA 3KPUA 1XA4A 4TV8A 2JIQA 1N2OA 5E6UB 4GZMA 1OZAA 1WXXA 2YV2A 2HMAA 1Y3DE 3OJLA 4JJAA 3H0CA 4M0MA