1U1FA

Structure of e. coli uridine phosphorylase complexed to 5-(m-(benzyloxy)benzyl)acyclouridine (bbau)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
243
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQTMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title Structural basis for inhibition of Escherichia coli uridine phosphorylase by 5-substituted acyclouridines.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 86
structure length 243
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u1fA00
3BGSA 1SD1A 1A9QA 3EMVA 3DP9A 4WKPA 1B8NA 1ECPA 1PW7A 5B7QA 1Z37A 1ZOSA 1A9PA 4TXNA 5CXQA 1PK9A 4L5YA 1ODLA 4TXLA 2AI1A 3PHBE 4WKBA 2OC9A 3OZEA 2I4TA 3DF9A 4YO8A 4F3CA 1TGYA 4LZWA 4UC0A 1Z5PA 4R31A 4F1WA 1RFGE 3MMSA 1YR3A 1T0UA 4TXHA 3OOHA 1ULBA 2AI2A 1U1CA 4TXJA 4TTAA 5F7XA 2ON6A 1PR2A 3D1VA 4M3NA 3C74A 4TTIA 1T8WA 3UAYA 3EEIA 1TGVA 5B7NA 1A9RA 1U1DA 5DK6A 4BMYA 1JDVA 1V4NA 4EARA 2OXFA 1SQ6A 5CCDA 3FNQA 5B7GA 3LBAA 4DABA 2QDKA 2QSUA 1ODIA 1V41E 1WTAA 2ISCA 3UAXA 5F7ZA 1VHWA 3UT6A 1JDUA 2A0XA 2RJ3A 4M7WA 2A0YA 4LNHA 4JWTA 3OPVA 1CB0A 1TD1A 1Z33A 2QTTA 3F8WA 1JPVA 4GKAA 2XRFA 1Z36A 3OCCA 1B8OA 1Y6RA 4QAQA 2HN9A 1U1FA 1ODKA 4X24A 5CCEA 1U1EA 4L5AA 3EUEA 3K8OE 5EUBA 3KUKA 3IEXA 4DAEA 1LX7A 3BJEA 4EB8A 4LNAA 1A69A 2GUWA 3TL6A 2Q7OE 4L5CA 1G2OA 3KVRA 4G41A 3KVVA 1YRYE 3DJFA 1OUMA 4D98A 3KHSA 4TYMA 4F2PA 1VHJA 1Y1TA 1K27A 4OGKA 3NM4A 4DA8A 4NSNA 1PR5A 3T94A 1PF7E 4DANA 1V48A 5JPCA 1JE0A 1RXYA 4JOSA 1OTYA 4I2VA 1TCUA 3UAWA 1K9SA 1Z39A 1PWYE 3P0EA 1C3XA 4YNBA 5F77A 1PR0A 4G89A 1V45E 1NW4A 1OTXA 2HRDA 2B94A 4DA7A 3E9RA 3QPBA 1N3IA 4RJ2A 1Z38A 4R2XA 3E9ZA 4QEZA 2IQ5A 1A9OA 3FOWA 3E0QA 4YMLA 2AI3A 3INYA 3U40A 1ODJA 2AC7A 1NC1A 4LKRA 1T8RA 1JP7A 5C80A 4OF4A 3PNSA 4F2WA 3EUFA 3NBQA 1OV6A 1Y1SA 3OZCA 4D8YA 3O6VA 1JE1A 3UAVA 3SCZA 5CYGA 3NM5A 5ETJA 3FB1A 4ECEA 1Q1GA 2OECA 4KN5A 3OOEA 4D8XA 3P0FA 1FXUA 3DDOA 4BMZA 1A9SA 3PHCA 1RXUA 3PNPA 1Y6QA 3OF3A 1V3QE 1OU4A 4PNPA 5B7PA 1RYZA 1PR1A 5CYFA 4IP0A 1PK7A 1VMKA 3UAZA 1A9TA 5KB3A 4D8VA 4DARA 1RT9A 3NM6B 2QPLA 4K6OA 1JDSA 1JDTA 4YJKA 4NS1A 4BMXA 3OZBA 5F7OA 1RXCA 1RXSA 1Z34A 4GLFA 2OC4A 1RR6A 2HSWA 4D9HA 2BSXA 3FWPA 3KVYA 1PR4A 1NC3A 4OEHA 4MCHA 4TS3A 1VFNA 1RSZA 2H8GA 4MCIA 1YQQA 1PBNA 1PR6A 1SJ9A 4WKCA 4DA6A 1OVGA 1TCVA 4PR3A 3MB8A 2QTGA 4U2KA 3KU4A 1CG6A 4JP5A 4MARA 5F73A 4QATA 1JYSA 5I3CA 1QE5A 1K3FA 3K8QA 1V2HE 4G8JA 5FAKA 4L0MA 3DPSA 3GGSA 5IFKA 2A0WA 4TTJA 1LV8A 4OGLA 4F3KA 4TS9A 3ONVA 4OY3A 1Y1QA 4QARA 4GLJA 2A8YA 4WKOA 3LA8A 4NY1A 4L6IA 5CXSA 3BSFA 1U1GA 1I80A 5F7JA 1Y1RA 5F76A 1Z35A 5EFOA 3LGSA 2P4SA 4DA0A 1RCTE 4TXMA 3GB9A 1YBFA 3FUCA 3ODGA 1Z5NA 1YQUA 2HWUA 4BN0A 1T8SA 2I8AA 1Z5OA 4E1VA 1ZL2A 2PGAA 4M1EA 3OZDA 5F78A 1ULAA 3FAZA 4H1TA 4FFSA 5EPUA 1T8YA 4GMHA 4WKNA 4P54A 1JDZA 1SD2A 3IOMA 4QFBA 4DAOA 1LVUA 3BL6A 3O4VA 5IU6A 4R2WA 3ENZA 1XE3A 4OJTA 1M73E 4LDNA 5K1ZA 4QASA 1PKEA
chains in the Genus database with same CATH superfamily
1JAZA 2F1RA 4V2UA 4OK3A 1V43A 3D8UA 2HRQA 2QLNA 2XUJA 3RAGA 5BR8B 4FINA 5AW6A 2ZE5A 5CB6A 4B47A 5BYJA 2PJUA 3KOOA 3KZ1E 3G2NA 3M81A 3MK31 1T29A 5KI6A 5CX1B 3TQSA 3V00A 5G0WA 2OD2A 3KPUA 1HLPA 2CXOA 1UJBA 2H92A 2QX7A 5I9MA 4PO1A 2V6IA 1G8HA 3EMKA 4UNNA 4BXOA 1PW7A 3K5HA 4S04A 4PAGA 2DPYA 3K15A 3EXIA 4EL0A 5JH7F 4C7OA 2HIAA 1N6OA 1KQOA 2E21A 2VAMA 3I0ZA 4J0HA 2C9DA 4TMVA 5KYYB 1MEEA 3MRVA 1R66A 3AQ4A 1GR1A 4BQPA 4PO9A 2R8YA 4GMGA 2I3AA 4GRIA 1GGVA 3C3YA 3EJWA 3T7AA 4CQMA 4IVNA 2DHDA 4LE2A 5CFOA 1G17A 2IYPA 3F1LA 2MIIA 2OHIA 2GO1A 3I6QA 4WZAB 5HIIA 4EATA 5CEEA 1ODLA 1Y8RA 3RSOA 1W0CA 1JH9A 4OMCA 3FKJA 4LWQA 3N7AA 3ZK9A 4Y7DA 1QUFA 1XCBA 1P75A 1V9SA 4YI5A 4WBNF 1U2EA 2QJOA 2WAOA 3O91A 4P35A 1OFUX 2BHTA 3CX7A 5IYZF 4Z7OB 3DZGA 5DULA 4LX8A 4UBOA 2B4AA 3OHPA 3GFBA 2V55B 5KU1A 1S3FA 3D6FA 2AMFA 2GLXA 3T95A 1IJEA 1NU8A 3VVMA 5JSHA 3JPYA 1XTKA 3GL9A 4YJ3A 2DLNA 4DLZA 1NQAO 1PJ3A 2VT7A 2JCGA 1RXIA 3QLVC 4ID9A 1YR3A 3GX1A 4NDNE 3ER6A 1AF7A 5KNDA 2XKAA 5HUJA 1O95C 1TW3A 2I0FA 2JHFA 3QW2A 4U6NA 2GJSA 4KPUA 2V74B 4DEYA 1Z4LA 3X0DA 4DDHA 1H5NA 3ACDA 2R1ZA 3WL6A 2XODA 4HH4A 4JBXA 1TKCA 4ZAXA 2DWUA 1EG2A 2OMKA 1GTG1 3AZPA 3DMYA 2W6OA 4QOSA 3C74A 1M54A 1RWPA 2RK4A 1W581 1A2BA 2ODAA 3GZNA 3N2KA 3R7BA 4OHCA 1I30A 1I3MA 4A2QA 2P3LA 4EMTA 4YCSA 5EJEA 4GAEA 3T3MB 4TT3D 1YUMA 4AK9A 4WZ6A 1KKMA 3IQIX 4KOEC 3OU2A 4BBAA 1QCCA 4ER6A 2R3SA 3PYXA 3UGKA 1NUSA 1Y89A 1Z6QA 3BGOS 4KFUA 2Q2OA 3AY7A 3G7NA 3JYQA 4PPFA 3E1GA 4QTTB 4DQKA 5JJCA 4CQLB 3AP2A 1R0RE 5FCDA 1Y4SA 1G42A 1ESZA 2H54A 2VKQA 2IHTA 2R47A 1GT6A 3FNQA 4PLYA 5B7GA 3LUFA 2ZPTX 4LVCA 3B52X 4IQ8A 3TLXA 2NO5A 1M0TA 3I5UA 2FPOA 3MGAA 5DM70 1BSVA 1MOSA 1OXSC 1AN0A 2HU8A 3HA7A 3L7AA 3WFIA 4A3SA 4C78A 2XRZA 3BDIA 3RFTA 1R6UA 1EK1A 1UK8A 2P78A 1FTSA 3A4LA 4Y2PA 1PJ4A 4BMNA 5L8VA 1GDTA 2EOAA 1YJBA 2QRKA 3CLVA 3N2GA 3PJFA 3ZE2B 4D92A 4FMBB 1SCQA 3AP3A 3TE7A 4MR7A 1QTQA 2YXNA 4IDAA 2AQIA 1JIQA 4L8VA 1Q95A 2IX9A 4HRAA 4IF4A 1F48A 1B23P 3CX4A 1O6FA 4J0IA 4V0RA 1PL0A 4TV9B 5KHOC 3DOUA 5DHUA 5T7BA 1R74A 3O8OA 4KBYA 2BEVB 1PO7A 4CTMA 2FSGA 3PC2A 1SK8A 1W4AA 3KPWA 2BH9A 3K1YA 4GI1A 2ZTMA 4F04A 4NCBA 1VSQA 2W9XA 1E9DA 3RHFA 2PRYA 2EBUA 2WI8A 3JZDA 4DZRA 4XOIA 3DS8A 4R69A 2R6DA 2X40A 1RHRA 4I0WB 2BBTA 2FFHA 3V7WA 3FTCA 5K0FA 4I2NA 3VPCA 2ZETA 1JPVA 3AOEC 5D3MB 2NW6A 4UASA 2YFYA 2WZQA 1IWBB 4YJ2A 1E6KA 3MT9A 2HNKA 5T4EA 2CVHA 4MHSA 3FMPB 3PJDA 2NO4A 5AJXA 1XZJA 1Z6PA 3K16A 4UCXA 3H1AA 4J0KA 5FNVA 2BTEA 4YMLA 5EMJA 2X42A 3QPCA 3R4VA 3R5HA 4YJ3B 2ZAGA 2QRUA 3GCGA 3HO8A 1XLWA 4GBGA 1TIPA 2VBGA 1R4AA 1VL1A 2NVUA 3A3YA 3F7TA 3EGWA 1HFJA 1YQEA 4U9HS 4E2ZA 3IAS1 4WFJA 1S89A 2V59A 3SEFA 2IH2A 3SIRA 4Z8XA 4A10A 2EWVA 2C94A 5E9JA 4XUEA 2VI5A 2AVDA 1DWQA 3NGLA 3HDVA 1R0YA 4P80A 4GM1A 4JUBA 3HNPA 4XA8A 5C5DA 5JAHA 3OJXA 2HF2A 2OVBA 1EFVB 2ZKIA 3LW8A 3ZHOA 2VL7A 1QB7A 3Q0TA 3H5LA 5LWHA 1FJHA 1R6VA 1Q7EA 2WZDA 4B9EA 2Q5LA 4PSVA 2OOKA 1J2EA 1FRQA 2NUPA 2NSHA 2WFLB 1CDZA 1ESMA 1MQSA 1SVLA 2H7VA 1DSSG 5KWEA 3KOZA 3EQ2A 2X5NA 1L2TA 1Q7GA 3AW9A 1FU4A 1YB5A 1YONA 3HWX1 1P4JA 1YGPA 3C43A 5IC5A 2X8JB 3H2SA 4JT8A 1EH5A 2Y1KA 4RKYA 1MPXA 2DB3A 3GQBA 3HI6A 3JASA 3UXMA 4EG5A 4Z2YA 1VSVA 3GPDG 3OTGA 1QMPA 1J9ZA 3R7FA 4R3UC 3BK2A 3CUYA 3NCTA 3O4HA 1Z5ZA 2KS6A 4AY2A 2VA9A 1W4ZA 3CH4B 1L4EA 4WWHA 1FTQA 3UA4A 5KSOA 2R7KA 1Y1PA 4UFOA 1QDLB 2O3UA 1PSZA 2WJIA 5AM0A 1CS4C 1H2BA 2D7CA 3ECAA 4MR7B 1DIBA 1RXYA 2PSJA 3OIGA 3VDNB 4DY6A 1KARA 2JF0A 1OLXB 1C2TA 4PZ0A 1J1IA 5ALQA 1D7OA 1DG1G 1SC6A 2I22A 4D7AA 4YASA 2W00A 3L7JA 3GNSA 1TLLA 4CMKA 4S1NA 1L1EA 4JB2A 1ZK2A 2DUUA 1J4AA 1HO3A 4OG2A 1Z2CA 1C1XB 2SECE 1GRNA 2C3OA 5DM4A 1CY0A 3LGXA 2L18A 4ZVNA 1WQ4A 4QO7A 1S6YA 1BGVA 1X77A 3LDGA 2ZVPX 3S27A 3C97A 5H9WA 3IL2A 1Q16A 3KLPX 2IS6A 2WHRA 4QOJA 4LMBA 4RVFA 1WVGA 3CG4A 3VZCA 1ZN8A 1XT6A 1RLTA 1OGYA 2IITA 4YJ2B 5EMKA 3S81A 3WWCA 2WQ6A 4FYHA 2DFKB 2NG1A 2B61A 1VJGA 3AWIA 3CNNA 2YL2A 3I6MA 3WWDA 3KNZA 4BKPA 2O14A 1VL6A 2OSVA 3P71T 2WDPA 1JHYA 3P19A 2OBLA 3Q3IA 4HV4A 1H22A 1EIZA 1FL9A 2VHJA 1WW2A 1QZ3A 3HEAA 2PZ8A 4OHOA 4ZRDA 5L3SB 2FVYA 3I45A 2CF5A 3TLYA 1WMBA 4XXHA 4HATA 3RODA 5C4IA 3JWIA 4UCWA 1IXKA 4UMDA 4UTNA 4LDPA 3OQMA 4C2TA 1T0PA 4LJ6A 1Z73A 2XNKA 4RE5A 3WRVA 2ZAMA 4CT4B 1HE2A 3C3DA 3L4SO 4XVUA 3BWEA 1NSTA 2J4CA 3DDUA 4NL4H 3ZXYA 4MYDA 4DCSA 4F2WA 5JU6A 3U09A 1DWUA 1BD3A 1FY2A 1S3GA 3A1FA 4PYKA 3U4QB 4RSGA 4RD6A 2UZAA 2AXQA 2ZATA 1G4HA 5H02A 5AUNB 5LR6A 3USZA 1G2PA 5A3VA 1LTHR 5F5XA 3ETLA 3OZCA 4QFCA 4G8BA 1YFZA 4MTCA 1E2MA 3QQPA 2QGZA 4K2AA 4JELA 1DC5A 4FQ7A 1E0AA 1JA1A 1W5EA 1JB9A 3RHTA 1C1YA 1E6CA 2BZSA 2VHWA 3C8DA 3JASB 3PFBA 3PX3A 5FXMA 3TN7A 3UHAA 1LTKA 4HN9A 3Q8MA 4BNFA 1W9HA 4FBMA 5ICCA 4GC5A 1KMCA 1EUZA 3BQMB 4ZAYA 4QUBA 2C0PA 3GH1A 1F9AA 2RD2A 4CTNA 2JI4A 2PV7A 2FZ4A 3EY4A 5DJ5A 2QNBA 3DAOA 4ZVVA 3D6VA 1GADO 3U3KA 2IOQA 1XRSB 3HCAA 4JLDA 3PTLA 4FCVA 2BFNA 1VP9A 2EGUA 3QYAA 3TOCA 1KTVA 2Z6UA 1CY7A 2M1ZA 1KK1A 1UBNA 3VDQA 4HUQB 1AQJA 2L19A 2FW8A 2P9BA 3M6UA 3ESDA 4ARBA 2C78A 2PKCA 2ZJ5A 3ASZA 3TH5A 9ABPA 1M2OB 4US0R 2WW8A 3JSAA 4EAQA 3HJGA 3G5LA 1G60A 2Z04A 4MVJD 1BS1A 3EQ8A 3HR8A 1AUPA 1HTBA 3KT8A 4HZGA 3RVDA 3F97A 4EYOA 3I05A 9GPBA 4D02A 3CLTC 4TMWA 4G07A 2HPVA 4MDHA 3DZIA 3FTDA 4RSHA 2I1QA 3DB1A 3NP7A 4EUSA 5AHXA 1O0BA 3OPNA 4A0HA 2D06A 3D7SA 4R8LA 5ADWA 4GLOA 1YR8A 1VLHA 1AZSC 1JL3A 3OF2A 1KSJA 3QLTA 4HYYA 3K0BA 2BRUA 4C0JA 5FADA 2Q3EA 1I5EA 2HXSA 5EZQA 3BILA 4C88A 5KOJB 1P91A 4ABTA 4WT7A 1EAYA 1Z15A 5G53C 1NW6A 4CDRA 7AT1A 4PANA 1VE7A 3OQNA 3KP1A 2OCIA 2DPHA 1D6JA 3N39C 1LBQA 3PR1A 4LY0A 2AGVA 1D6SA 4CE6A 3QKRA 4V1CI 1XZPA 2ZEJA 1UXIA 2X4GA 2KWIA 5I7SA 4K9QA 1SCBA 1ZZEA 2HSWA 5BVHA 3BBLA 3TFOA 5ERXA 4EHNA 4HB4A 1I1QB 2GT1A 1G5FA 3T5BA 2UUPA 3A36A 2YHAA 2G76A 1SR8A 1ODTC 5F98A 1P72A 5J40A 2YC4C 4DKXA 1GCUA 4BV3A 1H3FA 1XZEA 5AOAA 4LYYA 1PBNA 1YS4A 2YXPX 2O7SA 4G9GA 3PHIA 4YJGB 3SC6A 4KVGA 2ODTX 1OIVA 3KT0A 4QICA 2VDLB 2P9TA 3HBNA 5KSPA 4C2AA 1Z68A 1XYGA 3HKBA 2J0QA 4D4GA 2Z0MA 3VPHA 2G7ZA 2YV1A 1ILEA 1Q21A 2ASVA 2ZSEA 3NWPA 1H9BA 3L7MA 3PQ6A 3TQQA 4U2KA 5FPQA 2Z2ZA 1YT5A 5F23A 2FK7A 2PWYA 1JEJA 3EH2A 4WVLA 1DC6A 5DNCA 2CFTA 2X0RA 1N34B 3ZH2A 1CUJA 4RFLA 2C7OA 3GRPA 1U7WA 3LDHA 4M22A 4JS0A 3W6ZA 1QWSA 3VM6A 4O2BA 1MD9A 4Q34A 5LCXA 1YI0A 2FSVA 2FWPA 5M2QA 3DZHA 1GKIA 5EI5A 4L0MA 1WHSA 2PFSA 4X20A 4X7BA 3TZCA 4PBRA 1GUAA 5H80A 1TE2A 2NX2A 2D3WA 2XJ4A 1BXKA 3AM4A 3FUVA 4IO0A 2CVZA 4XR4A 5K9ZA 5LQNA 2JLUA 4FCTA 1IPFA 2GF2A 1U3GA 3BWYA 2RI1A 5LL6P 4TRRA 1A5AB 4AMBA 3BTVA 3Q0EA 5L6LB 3PUHA 1QGUA 4LOLA 3LO5A 3AG6A 3ONVA 1FX1A 4R9VA 1BWSA 1AK2A 2H4YA 1GZHB 5A5EA 2BMWA 5KDDA 1CY4A 4Y1RA 4ZHQF 1IHDA 1CHNA 2UKDA 3E2IA 4MULA 2VPTA 2G63A 1GD1O 1TPYA 2I6GA 1ZPDA 3GGGA 3LVFO 5K0JA 3P5SA 4R2HA 3MMZA 1KEZA 3CF2A 3BCSA 3DOIA 5CPBA 5A5VA 5K6AC 1Z07A 4XJVA 4R4JA 1S3IA 4ZVSA 4CMAA 1NE2A 2YZ2A 1DP4A 2P9JA 2Z58A 3M5PA 4CR7A 4DA0A 2DRIA 2W42A 4URFA 3IJRA 3IP1A 4W8GA 3ZGOA 4CIDA 1PJSA 4O1IA 4JGBA 4WV3A 4K1LA 2JAOA 2JVJA 1CFJA 1ECLA 2CFRA 2YVQA 3GAAA 1BKSB 3K4HA 5KOYA 3TIIA 4AICA 1ZL2A 4CQNA 2FLVA 3QKRB 3B60A 2A7QA 1YB2A 1PWEA 3CKLA 3OU6A 1D07A 5JISA 1K7FB 3WJAA 4Q12A 4UUNA 4PZAA 3C8HA 2I5PO 3LUKA 2ZDQA 4DM7A 1XQ1A 4KXNA 4TLBA 5A4AA 2Z6QA 2QVCA 4U2FA 3OD5A 3CKYA 4P0PB 2RJOA 3S68A 1GKKA 1YBHA 3CZPA 3M2PA 2ZVDA 1RZVA 1U2ZA 3K92A 1YAHA 3PWSA 1PVVA 3MHTA 4JJAA 3AZQA 3K1ZA 4JYCA 4DIFA 5K4AA 1C9DB 3GGDA 1SD2A 1G3RA 4JHLA 1X7GA 4ZT3A 4CJXA 3NI2A 3T34A 4FT4A 3LBYA 2IV2X 1JTEA 1E3DA 2FETA 3CLRC 2AL7A 3O8LA 2WF8A 4XM2A 2X76A 5ANRB 2H4FA 2ODBA 3B20A 5A6SA 5A9SA 1TC2A 2HJSA 1E5QA 1PSWA 2J3IA 3WK8A 1YL6A 2JGDB 2JFBA 5E0KB 2PAAA 1O58A 3M34A 4U7PB 1R4NB 2HKIA 4R1MA 3QA9A 5I8ZA 1ZGBA 3C7KA 2JAUA 2YTZA 4LMPA 5IT0A 1BROA 3BFXA 3VH2A 1Z2PX 1YR1A 5E1MA 3AB7A 4IHAA 2JIDA 3R6GA 4PC1A 3AKZA 3KVNA 2RDMA 5EQFA 1AQLA 1E0SA 3L1HA 1JKMA 2LCQA 3LPCA 3WFJA 3O75A 1EK5A 1T9AA 2AMVA 4HPWA 3RROA 3ZV7A 2ZS8A 3WOVA 3ZKWB 1Q77A 2PZFA 3HJUA 3IA2A 5D6NA 1QHSA 4GL4A 1EX7A 4K86A 5FORA 5LYJA 4DIOA 5IKMA 1F2DA 1CEXA 1XXLA 4CM7A 1JXQA 4LGVA 4WDQA 1Z37A 1RD4A 5BMVA 3OIFA 3FMFA 4Z4HA 3HGQA 1CRPA 5JSZA 2N75A 4KR6A 5KYTA 1E4EA 3NBKA 5KTRA 3VHXB 2OYSA 1QGUB 1KNXA 4PZ9A 2YWFA 4EF6A 3VVBA 4DRXA 2AX3A 3ZVNA 2PNFA 4JK3A 4ZCLA 4P31A 2C7GA 2FSFA 1N6KA 4WKBA 1TOAA 2C7QA 2BSQA 4COKA 1QC5A 1CERA 3NPMA 1KFKB 1GSOA 2CJFA 3BF7A 3KZNA 1HG1A 1AU9A 1ZOOA 1G20E 3G2QA 2FA9A 3SXPA 4LVNA 1PJTA 2PXHA 4U3JB 1JLRA 4XQ0A 1YH3A 4BMDA 3QVXA 4INZA 1K8XB 4PF1A 2DKOA 3NT4A 3TPZA 4AZTA 4YPVA 3J81A 2D54A 3NORA 1D7AA 1JLMA 1HT1E 1T9GS 2WAMA 3F9RA 1U2GC 1USGA 4S1OA 4TN5A 2WK1A 4EVRA 1SOAA 1KY2A 1WCYA 2WV7A 4C03A 1W5SA 5IJ9A 3OKPA 3UT6A 3L8MA 1KYXA 2XNDD 3AI1A 5H82A 4GOKA 4RELA 3LRTA 4TMYA 5F12A 1GTVA 1XQ9A 3S6JA 1G2IA 5I01A 4TLEA 3LXMA 4XQEA 2HJGA 4TTAA 2W8ZA 1JFFA 4A26A 2ES4A 1S3SA 5LJIA 4BIIA 3KD2A 1PR2A 5FV7A 2DPXA 1E99A 1DB3A 3LYUA 3ZWNA 3D8HA 1JQDA 1LGYA 3NUZA 4NCAA 2XRMA 3NEJA 3IBYA 3IMGA 1M76A 1QQ6A 3NETA 3E2MA 4R2JA 3ZBPA 1SBNE 1E59A 3FGNA 5LIPA 1A9RA 1O7JA 1B6GA 4IKPA 3T54A 1ZN9A 3RC9A 4JLJA 3R0XA 2WKQA 5ECWA 2WVHA 1CQXA 1G8SA 1XKLA 3ODPA 4HLCA 3BJZA 3W1WA 5KNBH 4MQUA 3GT4A 1H0KA 5DM0A 4DLPA 1N92A 2QVBA 2QSUA 3ZX4A 3DBIA 5AH0A 4Z3DA 2L0XA 2P9FA 3CUTA 3AVTA 2Q49A 3GRVA 3AF6A 2J41A 1JWAB 1W2GA 4UCFA 2NVWA 1LSUA 2JLRA 1IQPA 1L4LA 2H4ZA 3OCJA 4BV8A 1LX6A 1MQ9A 3GLVA 4IJQA 2QEQA 5LYJB 2K7FA 5GP1A 3D5QA 3GUUA 1KZ9A 3QYPA 1BDMA 4RE6A 5FPHA 4QLBA 1P3DA 4RTMA 2XIQA 3DKIA 4IJKA 4N3CA 1GTSA 1NP6A 3TD2A 3NOQA 1RHKA 2OV3A 1L4BA 3N9IA 4P93A 1VBNA 1WSAA 3ETNA 1WZUA 4FFOA 2E82A 1XG5A 2WP0A 3SFVA 5GZ1A 3OBIA 4S1VA 2Y0CA 3C39A 1LDMA 2I78A 4JL5A 1NAHA 2ZBGA 5I7FA 1KMHA 1L5MA 4CL0A 1PT9A 4F12A 3L4BA 3PA6A 3QVGA 4IRUB 4UU1A 5KTPA 5C0OE 3ICQB 1JBKA 1IXYA 4F6RB 1XBTA 4RNCA 2CGEA 3PIRA 5AVYA 5K8IA 3DZDA 4KR7A 5SYNA 5FHRA 1TK9A 4MV0A 4F21A 1AUVA 4J49A 1SXHA 1U3UA 3NOOA 4MROA 5J5VA 5C1DA 2PRIA 1REQB 4HEA1 3O38A 3NUQA 4LYJA 5EZSA 1L5RA 4TWZA 5JROA 3K70D 3KHKA 4PCVA 2ZRLA 3S1AA 1L7OA 3IO3A 4GMDA 4QU9A 2EV9A 2IBMA 3NO4A 2NXEA 4P4TA 1O5OA 2OCYC 1OA1A 4DZTA 3WMXA 2X5KO 4IR7A 1AQIA 2HJRA 1PTJC 2PMWB 5AVOA 4IDQA 4OQNA 3I5YA 4PG8A 3GAFA 2G88A 4UUMA 2YOGA 3BJEA 5E6RA 3AF2A 3ZHYA 5JNSA 5ENDA 5KQMA 3OPXA 3DQPA 4PX2A 4DR4B 4MJXA 3U7FB 4LYFA 5FNZA 3DL2A 3DOFA 2QUHA 1XF1A 2GJKA 1OSNA 4ETNA 3NTLA 2FX3A 2Q1TA 3TM4A 4HVLA 3MIIA 1DX9A 3D4BA 2N9UA 5AJUA 4ZOLA 3B1WA 1BMTA 2UVPB 1PEDA 4MQEA 5B53A 3ROGA 1T2NA 1YRYE 3DJFA 5KAMA 3H0EA 1G5IA 2KLHA 3IP3A 3RS5A 2H17A 1USVA 2J07A 2ONCA 2REOA 4HYQA 4JKIA 5ESWA 5AW5A 1G20B 2O2IA 4E0BA 3ENNA 3L6CA 1FIUA 5CDFA 1GZVA 2XITA 3U1TA 4G09A 3U6KA 2OM6A 6ADHA 4ACBA 3L0CA 4TL8A 4YUAA 1O95D 4OGKA 2IZ5A 3RFFA 2JI9A 3VU0A 2ZRAA 3W4KA 4U1RA 1NP3A 2NUAA 3WGJA 4O5OA 2GASA 1BXGB 1SO8A 4PSAA 4YRPA 4F4IA 2OCBA 2GVNA 4Y0VA 4YGXB 4GXTA 2OCLA 2J1LA 4PHTA 1EX6A 1HI9A 5FKJA 2CBZA 4JI7B 1NNSA 4KMOA 4R7ZA 1WXGA 2P9QA 1L8QA 3NYQA 1TF5A 1OU0A 2VYCA 3AI3A 3VYRB 1GN9A 4EYSA 4D0SA 5FUMA 5INTA 1NOIA 3OQBA 4TL7A 2GCNA 1O94C 2RHJA 4N5DA 4RKRA 3ZI4A 1RRKA 3DP7A 2OT3B 3NXSA 3OEYA 4NK5A 2QUZA 4N41A 2WU1A 3ROKA 2EYUA 4P7KA 4HHEA 4JNKA 2W6QA 4WCFB 2JZNA 4FHCA 2C4MA 1Q1BA 4GYYA 4OFXA 5JWHA 2QOEA 1PT8A 5BWMA 3FE2A 3HKEB 5FOQA 4G9BA 5HTKA 4DY4A 3TGLA 3DXXA 1F8GA 1CBUA 4TVBA 1L7PA 4ZC8A 2YV4A 3EISA 4WW0A 1P9LA 1TKBA 5B2ZA 3QVKA 1Y1LA 1NL3A 1TTPB 3E8SA 3PP8A 4KO8A 4UCQA 5JRJA 1OH8A 1YACA 2KJQA 2D5AA 5ICMA 2I7TA 2Y66A 3HVUA 4ZEXA 4PLWA 4P3XA 2WUFA 2MYPA 4EZEA 5E1BA 1UBSB 1Z38A 1M2GA 4HNRA 1EK0A 3AKCA 2ZSHA 1TQ2A 1RAGA 4GI5A 4LZAA 4YV0A 4EG0A 2CZGA 2Z2KA 4JENA 4L1KA 2ZYHA 4KTVE 4RORA 4S2EA 5D51S 3KEMA 4AXXA 1ZD3A 2I4IA 5IVIA 2AS0A 1GVHA 4Q18A 4DLNA 4UM5A 5LN1A 4BEBA 2VP4A 4G4SP 4ZO7A 2JAQA 3R4CA 4IJ6A 4Y8VA 3WGMA 2X4LA 4UTZA 1ORRA 1VZ3A 3AP1A 3ETEA 4HB0A 3KUXA 5I7OA 4E3WA 2BGWA 2V6BA 1WF3A 2EIHA 2HCBA 3UG6A 4M9UA 5E6RB 1QGZA 1F0PA 3JYHA 1QKKA 2F1KA 5BPFA 3KJFA 4GX1A 2PMKA 3CRMA 1OFIA 2VSQA 4MYUA 5EESA 4B7ZA 4EZIA 4HPJB 3VOBA 4RANA 5JZ9A 4TLDA 5L4NA 2PGOA 3EUFA 4S1TA 2W2TA 4UTXA 1Q17A 1UZNA 5KQGA 2FEWB 5DYWA 1P62B 4LXTA 1FRVA 3BN3A 1IY2A 4PZCA 5KNLA 1Y1SA 1SC9A 4KIWA 3CNQS 2R5WA 2WF6A 3AX6A 2ZI3A 3RYIB 3EK2A 3FNIA 4EFKA 1JG4A 1A7AA 4ZD6A 2QN3A 2OXRA 1ZXLA 3BDAA 4I50F 5BQPA 4V0QA 2VYQA 4DUZB 3R8FA 2AMJA 1JU4A 3DEYX 1W2WB 3E27A 3F71A 2KPOA 3WIBA 5D3KA 3I9FA 4FX2A 3RT7A 2QRMA 3DE0X 3B7GA 4RMNA 4BGDA 2OHOA 5DHSA 1C0EA 2ZUEA 4BWVA 4JLSA 3FBGA 1PQPA 2XZDA 3ZNNA 1QLWA 2W43A 3CF6R 3GU3A 2W6JA 1BJRE 3MUNA 4M87A 4Q00A 1A5SB 2JFQA 3WGIA 1FFAA 2XCTB 2JD0A 1W5BA 2DPMA 2X15A 3O8DA 1ADCA 3DBRB 1ZAYA 3IMKA 2WT8A 3KR0A 4F0JA 3SLRA 2ZJ6A 4PXYA 3DCYA 5HWSA 5BPHA 4FQ5A 3G5MA 3JXEA 3DGFC 2DXIA 3DUWA 1HXHA 5C8YF 3AEUA 3RUPA 5C53B 1XUOA 3TXAA 3PI6A 4Z8YA 2NOAA 2E4UA 2CUZA 2I71A 2OILA 3WVNA 4H3SA 3KDSE 4H4DA 1EFRD 2XXBA 2FZLA 1ENZA 1Q0PA 1QFJA 4PCAA 3G5UA 3L49A 1O08A 1VJTA 2FE4A 3CNHA 4D8VA 2WYIA 4E11A 3TX2A 3VX3A 5CGQB 1IZ9A 3SZ3A 4X7PA 5CT5A 5G1NA 3DXYA 1JPNA 3ZLVA 2DGDA 4HYTA 3LVBA 2ZJYA 3OTHA 5I8PA 1VJCA 4YT5A 4FGLA 3OECA 4ND3A 1G5RA 2C8JA 1LPAB 1P2BA 4ZOBA 3Q6IA 3GVPA 4AU1A 4XD7D 4YJKA 5F5LA 3TFQA 4BKRA 3R7AA 1DRJA 4TTRA 5IAKA 2PYZA 3PFHA 4M99A 3TLGA 1T0JB 2F3QA 1LWOA 2HA2A 1KDPA 2OK7A 1WB9A 2AUMA 5DH9A 1E1RA 5FOWA 4GLFA 3W8FA 3QKIA 4XIJA 2OC4A 1ENPA 1ESCA 3MJVA 1NXWA 2I6FA 2HOQA 3MS2A 4H7EA 2MYNA 4A15A 1BDIA 3I5MA 3LBNA 1L7RA 4B9AA 4ZI3A 4PX9A 5L7WA 1GTL1 2YWHA 4AZWA 4NI5A 1ZO8A 3NDJA 1A2KC 3T06B 4EJ0A 1EM8A 1NBMA 2EWMA 3X1WA 4BV2A 4ZZIA 3GBVA 3LHFA 4BQQA 2NQ2C 3OOWA 2BGTA 2H8GA 4FI3F 5E4TA 2C98A 4DDTA 1XN4A 4PYLA 1CR0A 4TV8F 3L0YA 4YCBA 3V2GA 3NTUA 1JR3E 3F6BX 4DQVA 5IHXA 1FS5A 3MCUA 1N8NA 2GAOA 4XYEA 3HA2A 4ZODA 3DE5X 3LT4A 3OX1A 2ONJA 2VP3A 3ZR4B 3LIIA 3LOPA 1ZH8A 1GHTA 2J7PA 3E4CA 1YJXA 1U0BB 1ZA1A 2XNHA 2A5FA 2V9CA 2VTDA 4NNJA 4RD0A 3GLGA 3K9WA 2Q5HA 4JJZA 3VNVA 1JEDA 2AFHA 1T3ZA 2VPQA 3ZHRA 1OWNA 1U5BB 3F5FA 3PYMA 4R1OA 2OYCA 4FDAA 2GWRA 4IZOA 4DSTA 4AKTA 4DIEA 4V0MA 3X1ZA 4E6PA 3GBPA 3B2QA 5BMOA 2BM9A 1N4AA 3WSTA 2YHIB 2Y0EA 5ILOA 4D6YA 1EQUA 1N3YA 4R9RA 2QT0A 3I34X 3NDBB 4N40A 4BNGA 5J2TF 1UBMS 4WOBA 2Z56A 4BMOB 2AXEA 2J09A 4MWOA 2XUOA 1T43A 4HK4A 3UWDA 1TO1E 2B2NA 1Y33E 5AVWA 1ZGAA 1F3LA 3IURA 2M6KA 3JQCA 3LUBA 1U80A 1X1DA 1ZVMA 5TDHA 1FRFS 3CONA 3CX6A 3A8TA 3HGTA 1DFIA 2JGLA 3N75A 3MRTA 3QX7A 2RGBA 3BKXA 3Q85A 1RJFA 4OBEA 4A2CA 5JSKA 3VBEA 2FF7A 1E2BA 4CU2A 4FHFA 3GJ3A 1ADGA 3HB1A 3T9AA 4TKLA 5HMMA 4Z6KA 1QANA 4Q9NA 3GJ7A 3TEFA 4MQ4A 1UKAA 4QG7A 4M9XA 4W5NA 5BOSA 5CXSA 2HMTA 3PE3A 4D96A 4F96A 3F98A 1X80B 1Y5NA 3ORFA 1MDBA 3V4RA 2JW5A 2RGEA 4K6MA 3H4TA 4O3FA 3PDIA 3NHFA 2JLCA 5F76A 3H2BA 5LD2C 3OLYA 3CU5A 4RTNA 3UWPA 5JZOA 1EJ0A 2O0LA 4G1UC 1QF9A 4AG3A 821PA 4FQ8A 3VR3A 4DSAA 4YDSA 3K73O 3HN6A 3ODGA 5CTAA 1UOOA 4X61A 1E63A 3TLKA 5LA6B 1I7PA 2IYLD 3SJBA 2WICA 2C3UA 3N8NA 4ZJPA 3TLGB 2IYEA 1Z4IA 3M4ZA 2R8ZA 5B55A 1THGA 2PGAA 4TRMA 5DXJA 3T9FA 2VDUE 1CP2A 4L9WA 2JC3A 4QPZA 3CZ4A 3LUDA 4HRVA 4WEOA 2DG2A 3DWGA 4O4LF 3SYTA 2CEKA 2ZWIA 4F45A 1W88A 3B1KA 2WM2A 4C21A 3CLTD 2E9SA 1HZZA 1KY5A 2PKEA 4DLRA 1LA2A 4QBGB 1EM8B 1NF8A 4LHYA 5FD8A 1WOYA 4DJFC 3RC3A 1RYDA 4URUR 1RLUA 3E15A 3QIAA 3HXQA 1HNWB 1BKYA 2I6QA 4Y6QA 3TYXA 4BKQA 4E5VA 1HLFA 4ZXFA 3LBIA 1OAAA 3H4IA 1N6IA 4QRDA 2R00A 2E4AA 3E3MA 3EQZA 3HVIA 5I5GA 3BRCA 1QYVA 3AEYA 1XPJA 2MSEB 1C3VA 4ZVUA 5K0GA 1D1SA 1Z0KA 3TM5A 5K1ZA 4BC1A 5CB4A 4OQDA 2YV2A 3VDRA 4QASA 3ZGLA 4CMJA 4ME6A 2ZRQA 3QY9A 1RYEA 2AFHB 1H2EA 3LOQA 3D8RA 4HEHA 4DRZA 5DOVA 5GZ6A 5ILGA 3CUKA 4XGRA 1NBAA 2NXJA 1Z8DA 5D87A 1QYWA 3C98A 4A8JC 4RIHA 1N5IA 1SKUA 1NI4A 3UGTA 2YWBA 3DFMA 2W71A 2WOJA 3VVLA 4YRNA 3M0EA 3U4DA 4RACA 1KFBB 3V7YA 3MJFA 1SBYA 4NZNA 1KJ9A 5KCZA 4N5LA 4B4OA 1BHJA 3ONDA 1LBEA 4I3FA 5A3RA 5AI9A 1A27A 5CCXA 3OP1A 4OA5A 3B82A 3A27A 1C3EA 1QAOA 3A2NA 3B3AA 2J9YB 3CE6A 3D2BA 4FFDA 4OQFA 1PRYA 3A3KA 1UR5A 1FLAA 1N6HA 2FUG6 3PNQA 4AJOA 1R0XA 2JDIA 5ITWA 1KI3A 2Q6IA 1PQUA 5CH8A 3M1AA 2XECA 5JFGA 1B41A 1G0NA 3QF7A 1ZESA 3QLUA 1XJWA 4GOJA 4INAA 4HNGA 4BLSA 1S8OA 4OAOA 1XCGB 3RWBA 1Z08A 1AO0A 5IM5A 1TX4B 3ZDXB 1DCMA 1U0FA 5FBLB 5BOSB 1WX1A 4IIFA 4G5XA 5BSEA 1EHCA 3L4JA 1IVSA 2ZT7A 3PGA1 3GC6A 5JAQA 5C81A 5CVCA 3SEQA 3WLIA 4QA9A 3IR5A 1PDOA 5I9BA 1JR3D 1XCOA 2J32A 4G84A 4KQ9A 3PDHA 1DHRA 4G86A 5JT1A 3BCHA 3ZS9A 4WOPA 5JQGF 1OOEA 1GP2A 1LDNA 4CM5A 2PVSA 3ZHQA 1VRVA 1OR8A 3WK6A 5JBNA 2OBXA 4U6SA 4OA8A 5A9RA 1GGJA 3VR5A 5CURA 1NMSA 3KJIA 2KBEA 3NHUA 2BGMA 1MVNA 5JZVA 4IEEA 1T1IA 3FUXA 1UBEA 3RTBA 3IVAA 3ZV3A 3H65A 5IH3A 1GVNB 3HUTA 5BRNA 2FG6C 4PLFA 5DN9A 3MUOA 2FP3A 5LJLA 3F4BA 4EJSA 4P8RA 1W88B 1G8KA 4OX9B 3F9IA 4CEJB 2OV1A 1GAJA 1P8AA 3G23A 1R64A 1XK7A 1U2SA 2XW6A 3QZUA 1ZCFA 1UEJA 5F3WB 4PWZA 2GZMA 4W4TA 2R2GA 3AJ8A 2NAPA 1NZFA 2IYSA 4V1CB 2BE7A 4YS6A 5F2KA 2EFEB 5CLGA 4NFSA 4W1PA 5BUSA 3U9LA 2VRWA 1Z4OA 1T10A 2EZTA 3DM9B 4LWOA 1S4QA 1IN8A 4CKWA 5LNK1 2ZIUB 3ZOKA 4L9AA 1VKNA 1I2AA 1KEEA 2Y0BA 2CLIB 2C4HA 2A5YB 1X1SA 3KQQA 3KSRA 3TQOA 3I2GA 4BGEA 1NZDA 2EKLA 3LQ4A 1J5PA 1T3LA 2X1LA 3K9CA 4TMXA 5DI9A 1T15A 3OQ1A 1M0EA 2N0SA 4RH0A 1L5QA 2FN4A 1SQFA 4P6VF 5KOHB 1BWQA 2Q6VA 2IHVA 3E9CA 4X85A 5DYTA 2D1RA 2RIRA 3MLEA 1I2DA 1PZNA 5ERYA 4BRSA 1QGED 1C3OA 1W47A 1GARA 4H3VA 1OAOA 1DXOA 1XX6A 4LBYA 4YTEA 4B6GA 3UUFA 1OFTA 2OV6A 4HOYA 4RKFA 3SZMA 4CL2A 3U0BA 2Z08A 4TM7A 2NZ2A 5FFNA 4ONEA 4XW2A 4JLAA 4K6HA 2OESA 3WQBA 3GLSA 1H4QA 3GCWA 3GDWA 2IIQA 1BC5A 3NTOA 1ADBA 1ZH6A 4QC2A 4L3OA 3Q3GE 3MXOA 4GUAA 3STWA 4G1EB 2BRUC 4F8YA 4Q48A 1AMNA 2IXDA 4AKIA 4MPDA 3OTIA 2J87A 1P2UA 1I4DD 2OGUA 2H4JA 4B2IA 5JSQA 4DR6B 4JI5B 2VP6A 2H9IA 4QRHA 4FOTA 4N54A 5L3ZA 4CTKA 1BVHA 4MUKA 2NZUG 4LHVA 1EVJA 2A14A 1QIHA 5GVRA 2PK3A 3HUEA 4BRUA 1KYYA 4Z9AA 2DOKA 2OV4A 2WB4A 4URYR 3DFUA 3ISTA 3KXPA 1UPBA 3CRRA 3PF8A 1TUBA 4OHBA 5FYDA 1KEWA 4B8WA 3LUCA 2XXAA 5FI5A 3NTXA 5FOVA 3TDKA 4ZV7A 3NJRA 5KJEA 1P31A 3ONFA 1XNRB 2HH9A 1FMJA 2UVQA 3ICPA 4K0KB 1IQUA 2ZB7A 5FA8A 5AM1A 4YCDA 3LKBA 2PBZA 5A0TA 3OE7D 4AS3A 3GYBA 4O2AA 2Q5QA 1I2CA 3EBPA 4EB8A 4XSHA 2EVWX 4EPXA 4CV1A 1VCHA 2IUFA 2R8RA 4EEXA 5FYQA 4C7JA 3IHKA 4WY5A 1OXBB 1OLSA 2G1PA 4IOKA 1T13A 1JEQA 2VC2B 4GVPA 5AVRA 2JGAA 5JXIA 3CQ9A 3FMVA 3LHIA 1YFKA 1KWKA 2QT1A 3TR6A 3WNVA 1AM4D 3ANSA 2F1IA 5FDFA 4LJLA 2OFFA 4QDTA 3GPLA 1DKMA 1BDBA 2DFTA 4G97A 3ZU5A 1J33A 4NCNA 2BUAA 1XEXA 4R6WA 4XH9B 3RPEA 4CKWB 3OTQA 3W5CA 4ITUA 4TUYA 3FZNA 1IG0A 2FSVC 3JQDA 5K0CA 2IH5A 2VK8A 1EVLA 4R5MA 2WG2A 2VSFA 3GT7A 3SEZA 4FM9A 2CK3A 4CU5A 4KLCA 2DR2A 4LV5B 4RA9B 2C99A 5LBUA 3CRNA 9ATCA 1YVDA 4YLYA 2D4HA 3HHPA 3BXZA 3ERCA 3IDQA 4C3VA 1QGDA 5JNUA 5KTNA 3RVPA 3ZOZA 5C5CA 3A4TA 1UDWA 1WUIS 3NVMB 4KEAA 2WC1A 1TYZA 4QOIA 1ZBDA 3LX8A 4AG6A 2FZVA 2P41A 1YTUA 3SJZA 1TQHA 1QNLA 2EFJA 3AUFA 2XOKA 4NE7A 4OB7A 3SSOA 1UWLA 4Y6LA 2TMGA 1K6IA 2NXWA 2XNSA 2IXBA 3H99A 3IOYA 4G0OA 4IJWA 3ZD8A 4F1JA 1RCFA 2R9VA 2FAXA 1EK6A 5JNRA 4C2BA 1ZHFA 1TQ4A 2VHTA 3OSZA 3SK0A 5HZGA 3GXBA 2NADA 2D1TA 3Q3HA 3ED1A 1PFYA 1HDOA 3ZWWA 3BMCA 2G82A 2WU8A 3F3KA 3I58A 4FJ2A 4ZOCA 1UFOA 2CY0A 2G09A 4FD3A 4ER3A 5C7LO 1COZA 2W93A 4LDRA 2OO5C 3CWCA 3PQ5A 4JOCA 2DWCA 2JAHA 1AY0A 1MRSA 2HJHA 2QUJA 3JVDA 2RHBA 4M9ZA 2ZXUA 2JKZA 3D4OA 3PNYA 3NLLA 1NU6A 1WMSA 3QK7A 3CZAA 3KYDB 1SGWA 5KTTA 4EB6B 1XQ6A 3T9DA 1LKZA 1E1NA 5IKOA 4AP6A 1LLUA 1R50A 4UAVA 4WLVA 1GQQA 1KOJA 4PVCA 2GLUA 1ZK1A 4LHEA 3H5VA 1DDOA 1HSZA 4E5PA 2RB4A 3IBFA 3EEOA 4LFCB 1VGQA 1E7QA 2AMYA 1E8MA 3I30X 3N6RA 1YSCA 3WJ7A 1TAHA 1TJNA 3CY6A 2FR8A 3ASYA 3IPCA 2YNMA 1JF8A 3TJZA 4QJ5A 4ANFA 1N5LA 1PL7A 2PH7A 3U9TA 2REXB 4OM7A 3SNHA 3HEMA 2BHSA 4HBZA 4C9BA 2C61A 1GGHA 2KB0A 4O2AB 4TMZA 4Q9HA 1GSHA 3L7DA 4IXTA 1MB2A 4OAQA 4W6ZA 4LK3A 3W5VA 2IPAB 2V65A 4RMHA 3HMKA 4I9NA 4JKOA 5FPSA 1W5AA 2GYUA 1PUJA 2QRHA 5DHPA 3LQFA 3SGLA 3VO2A 4EW3A 2Q7XA 1JEQB 3H0KA 5JMWA 1NRXA 2JJ2D 4HVTA 5FA5A 5T64A 2O1WA 4B6JA 3R24A 1YFJA 1B0PA 1AKNA 3NJ4A 5DP2A 4OD0A 2VVTA 3O1IC 2X2OA 4Q4HA 3RQSA 3RS9A 5C35A 1K0FA 1J1ZA 4Q39A 4RJJA 3FFAA 4GECA 4A0FA 1BMQA 2CBGA 1NJFA 1CR4A 1DCKA 2BLLA 3F5QA 5IP5A 3THRA 2GN0A 5BN5A 5JG7A 1QTIA 5CYGA 5JYBA 1WP9A 3BD7A 2P2LA 4ETIA 5F3RA 4B6PA 1H1DA 3OZSA 4MRAA 3VNSA 2Y67A 3HSSA 4OQZA 3IR7A 1L4UA 1PP4A 1QZZA 2QAGA 3FVQA 4P84A 1SXPA 3IXLA 1ITZA 1U2PA 1V95A 4Z1MA 2DTXA 4Q3KA 1ZY2A 4MK4A 1GPDG 4KIJA 3AV0B 1KI1A 3W2TA 4ETMA 1ISRA 1UMKA 3DTVA 4E6EA 1XLUA 3PRHA 4P5DA 4WY8A 1GPMA 4V24A 3OE5A 2GARA 3DW3X 1O2DA 1BWRA 3U4AA 3IUBA 3Q8WA 1QS0B 4Z9FA 5THKA 4E7OA 3LBFA 5IF9A 2G1KA 3KELA 3AHIA 3VYSB 5M7EA 1TRHA 3I42A 3IEKA 2VNJA 3B1XA 4FEYA 3V9PA 1JZQA 3BE4A 3SQOA 1HMYA 3FYHA 5DBFA 2FN8A 1DEAA 1RTTA 2D13A 3DWEX 1G7TA 1VIAA 3HR4A 3W3ZB 1RYZA 5KINB 5KYWA 1ZJYA 2O8BA 1IOLA 2E5FA 5M5BA 2GCIA 1CLUA 1NATA 1JN0A 1J97A 1CJBA 2JFPA 3AJ9A 1X87A 1XMPA 2LKCA 1II8A 4N01A 4CKXA 5B64A 3UK1A 2MYUA 5DLQC 3VU8A 2O5CA 3UOWA 1DTEA 4FYPA 3TXXA 1WMAA 5KYGA 1JDTA 4M1MA 3VNQA 3HXTA 3GVXA 1DIHA 1BU5A 3FPEA 5CDUA 3PPWA 2VDJA 4KREA 3IKJA 1I9GA 5F7OA 5ENVA 1Z34A 1M83A 4DIDA 1NXXA 4IQ0A 1BG6A 1C30A 1TTQB 4EVQA 1ISHA 1ACJA 1LDYA 2P3OA 1FW6A 3P27A 1US8B 4OH7A 1FRNA 1V9LA 1POXA 4G9EA 2FMIA 3VC1A 4C22A 3CNBA 4RTQA 2YY5A 4DV5B 1FMFA 3R75A 5ICGA 5D5HA 1QHEA 1RSZA 1DPFA 3OLVA 4MCAA 2I6SA 4BDTA 3M6IA 2H8KA 4KO3S 5BSUA 3O2NA 1K86A 4O4HA 3WBJA 1ZK4A 3ZJYA 4Z7JA 4MAMA 1TQ6A 2EDAA 5E3IA 4BX0A 1DCTA 4WK6A 4LZZA 1ZOPA 4HNAA 1GRVA 2CNLA 3FAKA 1FQKA 1GL9B 1TLFA 1ZVKA 2EFHB 3UMYA 3CEHA 4L73A 1QGAA 3PFNA 3S8YA 2PUVA 1KDRA 3KU4A 2JB9A 4CQJA 3BIXA 1ZISA 1ULTA 1U0OC 3FCUB 3L43A 4M8NE 4LHXA 4OXQA 2BJWA 2Q5OA 4L15A 1FNDA 4XUGB 2JFGA 3NAMA 2HWWA 4DR3B 4GXRA 4XWAA 3PXDA 3H7AA 1TNDA 2QAGB 4YRQA 1Y9AA 5EE0A 2KBFA 3SIXA 2ID7A 1JILA 3D7KA 3VC3A 4UZEA 4UNSA 1TVMA 2X3FA 3P9QA 3EGDA 4G0XA 4RA6A 4RPHA 3TTTA 1MJGA 2QORA 1EVEA 1E7MA 3N3BC 3O7WA 4U7WA 3FWKA 4UULA 2G36A 1Y3AA 4KQKA 4AI6A 4HAUA 4NMWA 4NZPA 3O7MA 3K6RA 5KX5B 3D0QA 1L5ZA 4YQZA 1O6BA 1NMYA 4OKNA 3MWYW 5A0FA 2R751 2NXCA 2B7CA 4FGKA 4IQGA 3G0HA 4BJ1A 1Y1QA 4Y30A 5CDGA 2AZ4A 5DLDA 3U3OA 4KSBA 1TVKA 4PPGA 4HQOA 4YI3A 5KYWB 2JLQA 3K6SB 2O8BB 2H2WA 1BE8A 2ERXA 1U0RA 3UWMA 4YQEA 3U39A 3H4MA 3V1MA 2ET6A 3VOAA 4OB6A 2YC2C 3SF0A 2O2ZA 2C2XA 4YO7A 2P4SA 3X1KA 3UB4A 1IVNA 2HPHA 1TT7A 2KHZA 3O8QA 4NFLA 3IEVA 2NU7A 4AP5A 4QG3A 4QTZA 3MTIA 1Z5NA 3W6OA 1YQUA 3REQA 4WVFA 1ADFA 121PA 1P2FA 3U37A 4C6TA 1GLNA 4JQSA 2XOEA 4UZSA 4OHZA 3BL8A 1E6LA 3HI4A 4IH4A 4ZCIA 2FLWA 1M1NA 1PV1A 3ZJ5A 3ZWAA 3AG5A 2Q4OA 3FVRA 2R25B 2YWCA 2AMLA 4L78A 3ANXA 2HIMA 4NNOA 2BM0A 2VDWA 3MTJA 3QWFA 3ZLBA 3K9QO 3CF4A 3MSCA 3T7EA 4DPKA 3GLIE 3IAS6 2IZ0A 5A5FA 1OI7A 1VKJA 1NVFA 2Q9UA 4GXQA 3A1NA 4URZR 3RREA 2Z2XA 3FPHA 1L4FA 2XTAA 3DMDA 3I8XA 1BMFD 3IPXA 4HQRA 2FR1A 3L8CA 4M1TA 2EBHX 3VYVA 2IIBA 3SBEA 2QN6A 1M1UA 1X14A 4BO6A 4MV7A 5KNDD 1UC9A 2DY1A 2I6UA 2O4CA 3JTMA 3KZKA 2EL9A 2NUTA 5IU6A 2I2XB 4GP6A 3FOEC 4IDPA 4R9UC 4MB0A 4DIKA 3RK0A 4OQ4A 2Y1CA 4A73A 2RGXA 3VR6A 2IE0A 1E92A 1R5NA 1W44A 4MA0A 3MBIA 1JJVA 2W2NA 2VZ9A 4H6PA 4QRIA 4CMBA 1XLVA 2C4KA 1N7GA 5TY0A 5LUBA 1KI9A 3G8BA 3LH5A 4L6AA 2O1SA 1ZITA 2VNKA 4YHHB 4HGNA 1DT3A 4QDKA 4RPIA 2C8KA 1D0SA 2J31A 3HLTA 4KXLA 4L28A 2OK8A 4BO4A 3N1UA 4GH5A 4AULA 1ECPA 5KQPA 5ICFA 1CIVA 1X7DA 2C9CA 3U49A 1AHPA 3E22B 1FP1D 5TQ0B 3DSRA 2X22A 4O4IA 1EEXB 5HQJA 3PHHA 1VHQA 1X1TA 2OBYA 4LISA 2ZI7A 4KUGA 2NZJA 1EFCA 2VR1A 2XUFA 4S0ZA 4KB5A 4R8KA 3MJ4A 4EYEA 2A84A 5AVZA 2COEA 3BM5A 1P5FA 3G1TA 3H84A 4MQ5A 3ND5A 4M53A 2G9NA 1ETHA 2FPKA 3BMOB 2DBZA 3I92A 4II7A 4UHEA 5DWQA 3BEOA 1A96A 1K0UA 3QMPA 4PBSA 1NBEA 1KSGA 3NGMA 1DQPA 2ZUSA 2Q0HA 4G5GA 1CUVA 3DVAA 3ADPA 4X5OA 3HL0A 4P38A 2VAPA 5EIEA 4Y18A 3BEDA 1TGYA 5BQ5A 3P26A 3EZ9A 2DWPA 1G19A 3E9MA 3REQB 3OZWA 3ACBA 2YYSA 1ZNXA 1PU2A 2QVXX 3PFIA 3DNFA 4PC3A 4C6TB 4EO9A 5HK9A 5L9AA 1MTZA 2R8BA 3TKYA 1T6BY 4ICIA 2D0OB 4HR7A 4NYMR 3MILA 2PL3A 2CLHB 4LI0A 3OOHA 4C3ZA 2FR0A 1EZ1A 4PPYA 3ILXA 1ODSA 1WMEA 4XB1A 2OO3A 4I3GA 3PVZA 1WUJS 3SYNA 5I7EA 2QRQA 3LC7O 3CO5A 1JT2A 3F7MA 4LE0A 1B2RA 3JAWB 4YRRA 3VH3A 1GU1A 1ZGJA 4L51A 2QL5A 2ZRHA 3X1JA 4BJ5A 4QM7A 5SY4A 2GM9A 2DULA 2NYVA 1NP7A 2DFPA 1HMPA 1QTNA 1WV1A 3INGA 4MKXA 5A03A 1N0UA 3PK0A 3GJRA 1DC4A 2RHRA 3IQGX 4I1UA 4Y2SA 2MINA 5DGHA 1XNHA 1T1JA 5KU7A 3WLNA 4HDNA 1GA6A 2I1VB 3Q3JB 5FL3A 3ICWA 4P4SA 2WABA 5DK6A 5T6MA 3C85A 5J4YA 1UADA 4R40A 1JHPA 3AUTA 4CM1A 4HB2A 2OXFA 4EARA 5HQTA 1Z2AA 4RK6A 3EFOA 3EXAA 2Q45A 3O9MA 5HF5A 3T9BA 1OLOA 1U9IC 2BWJA 4RGQA 2VZLA 1STOA 3OA0A 4X45A 3VMFA 3GQVA 3RC8A 2Z4RA 1GNLA 1H5QA 4NH0A 5JY1A 3SD7A 4BX2A 1IN5A 4YQYA 1ZH4A 3SVLA 2DU8A 4LMRA 4IFTA 1HUQA 2PD4A 4FMCB 1J8YF 5J59A 1K98A 2I4LA 2DFVA 1S1MA 3LQYA 4M8KA 4QOFA 3T5DA 4YYEA 4D9BA 5LMZA 5D1NA 1H66A 2E4XA 4PW0A 4TLAA 4D1YA 3ZG6A 1T26A 2FUCA 4IVQA 4Q1AA 5FIUA 3RTAA 2XDQA 5B3JC 4M38A 3M82A 5IKPA 5E2IA 1KEUA 1GYRA 1XXHE 2PXCA 1U8XX 2R5FA 1XZ8A 2HA4A 4TV9F 1KGSA 2EKBA 2PLWA 4JLMA 2V7WA 5IK2A 3GLIB 1KMNA 3TRFA 3UVEA 2C57A 2FOXA 3N0XA 4V3CA 4JY7A 3A1DA 2LV8A 1TD1A 2OORC 3EUWA 3G9TA 3DE1X 3LPLA 4BATA 4N12A 5KSYA 2BH2A 4R1TA 1P5RA 2QTTA 4DIBA 3SVTA 1UP7A 4O63O 4QGFA 3VAZA 1O87A 3AETA 4W63A 2MSCB 2WU3A 3D59A 3LQ2A 4HDSA 4QYIB 4E4TA 2WB2A 3F3MA 3ULKA 2R8EA 4JVLA 3D8BA 1CF2O 1WQ1R 5KVSA 1NV8A 1YS1X 3PL1A 1VIDA 3HY3A 3WK9A 1OFGA 1RYBA 1B8OA 5EL0A 3Q1LA 3SBXA 3RRBA 3VGJA 4X3PA 3FVWA 2B4QA 3P2YA 3LSTA 4E31A 3U7EB 4LEIA 4M88A 2X7XA 3UZUA 3LKDA 4EMSA 3NHAA 3ER8A 1ECCA 1UL1X 3NTQA 3ZCXA 1N2SA 2VFAA 4IKOA 4RKWA 3RVQA 3SX2A 3IPLA 1UZMA 3VH4A 3N74A 1MW8X 3LDFA 4F91B 2X6TA 3MRSA 2O7QA 3QELB 2I3BA 3RANA 2PLFA 3Q7QA 4DCJA 2DETA 2XAAA 1HDGO 3N7UA 4BZQA 3MZ0A 2IF0A 3M6LA 2EKPA 5AJVB 4CMHA 4DREA 1F6BA 1P5JA 1VPTA 4GICA 4C7VA 4EKIA 4RLHA 4I8XA 4N5IX 3RRYA 1Z2DA 3MGCA 4C7XA 4ZVTA 1TT5B 2XYRA 4X3OA 3GLQA 1XVLA 4Z4FA 4DTCA 3KQNA 2H63A 2W2OA 2PDAA 4ES6A 1K89A 2AE1A 2QDXA 2QLJA 4H17A 4HLNA 3HM9A 2VQDA 1XPOA 4HDNB 4QSHA 3BREA 1JEYB 4E94A 2WM8A 4KV9A 2BI7A 2EFCB 3LBHA 1XTBA 3O92A 4BNTA 5BURA 3OOJA 1XCJA 2J6HA 3LP6A 4K9PA 2PWPA 4NEGA 4NPAA 1B74A 2ECOA 2WM3A 1J0BA 2YJNA 1Q12A 3ST7A 3K9FC 3ZJVA 1QTRA 4RSRA 2EFDB 3BE6A 4KRFA 3TSWA 5DPMA 4B81A 2HC9A 1EFLA 2FPGA 3PGLA 3JVUA 1KO7A 1PWZA 3GO4A 4TTVA 4DANA 4TT8A 3L7IA 5KYXB 1JIJA 1U0JA 1ZVVA 1XD2B 4IDFA 1C2YA 4Q4AA 1WKVA 2IVZA 3D8SA 3BRSA 4ZZ0A 5GZ3A 1OTYA 4R9NA 1VBMA 2PA0A 1IG3A 5GONF 3OLWA 1NY5A 4PO8A 4QGBA 4Y2HA 3ZIDA 1KL7A 4BBJA 3EZYA 3W8EA 4DLKA 4CQLA 3NMUF 4X92A 4IINA 2BGRA 2CJWB 2X7HA 4YNBA 3AOGA 3F96A 1YCHA 2BMDA 3LY9A 4FDLA 1UBJS 4MHOA 2L42A 4X6XA 4JEMA 4PIPA 1JJIA 1A76A 1V45E 3E7WA 3DEZA 3UKOA 1QXSA 3IIEA 4U7JA 1KAGA 3O3MB 1UBCA 4HDSB 3JYPA 1EHIA 1YZKA 3IS3A 1EEHA 4GSKA 4RC9A 3JARA 1L4MA 2W6PA 1Y0BA 3HACA 3BB3A 4C0LA 3W2EA 4DCCA 3TG2A 3ZJUA 1KORA 1YCGA 4HEQA 3OZFA 5K05A 3SWWA 1J5XA 1LNQA 2ZT8A 4TQ9A 3QE0A 3BXEA 5EGNA 3KQVA 1ZHOA 1MVOA 1E4OA 3UG7A 5IFLA 1XMJA 1EVZA 4FFRA 1HURA 2FDRA 2GPSA 1L5KA 1HZZC 2AI3A 3RAEC 2PPVA 3NH6A 5JH7A 1ZQ1A 4J2TA 2VRCA 3C7CB 3IEUA 4PLTA 1P2GA 4OTZA 3ZHBA 3FRJA 3L1VA 1K06A 4JLOA 1EIWA 2O8FA 1IH8A 2HFKA 5JMPA 5TMEA 3H1FA 2XSZA 3EG9A 4UUQA 3AKEA 2QBYA 1E96A 4LBWA 4O08A 4BNHA 2AHRA 1XXHB 2ZIFA 2VZ8A 1NSYA 2BGLA 2R00C 1Q83A 2PRKA 1K63A 1BYIA 1N7JA 5I51A 4YP0A 4RTKA 1Q20A 3VISA 3HKDB 3VKGA 2B8NA 4QUEA 1WS6A 3UN1A 2NACA 3R9KA 1VIMA 1UKBA 3QV2A 4WBNA 1I0LA 2C8LA 2OAQ1 3PVCA 3EGOA 3OEEA 1I3NA 1DG3A 1EFHA 2MSDB 3KDPA 3I4CA 4J4TA 3WDSA 1J22A 3MRXA 2HTEA 5BYBA 4OQEA 5LZ7A 1EP9A 4BNIA 4EYQA 1DU4A 3DT6A 2RGDA 5JAZA 2VSYA 1HQKA 1NY6A 1QSGA 5JASA 3IV6A 5JS6A 4JUAA 3GCZA 3NFRA 4I6EA 3OPYI 1JDJA 1SFRA 2I66A 4G1MB 1BA3A 2O1XA 3Q7TA 4I46A 2RB5A 4BNUA 1QOQB 3T38A 3CEPB 4JT2A 1F0KA 3KAQA 3VR2A 4PGHA 1JIUA 4RD4A 5K8CA 1J8MF 5JEDA 5JRDS 3LK7A 1CZOA 5M29A 5KTYA 5ETJA 4BMPB 3G0IA 3E53A 1DTSA 1LFAA 2P3SA 4WPGA 4NEHB 4XX1A 3VZSA 4D25A 1CUIA 3JY6A 2QG6A 2B2XA 4FT2A 4M49A 3GT0A 4QXPA 4XFJA 3AO0B 3K94A 4Y2GA 2HQOA 3OLXA 2IXTA 3HFSA 3JWGA 1HYQA 3HM2A 2VPWA 4X90A 5EJ9A 3QLUC 1PGJA 3C5CA 4Q4AB 4GKJB 1NE7A 1THTA 2VF5X 3HADA 1CT9A 4D81A 5LM3A 1DZ3A 5GGYA 3BHJA 2RHDA 2WA2A 2WD9A 1OQAA 4BMCA 3G3EA 1R8SA 3BGVA 4URHA 4UM9B 1YJQA 4YDQA 1WZEA 2X19A 1FP6A 3FTFA 4D80A 1VKHA 3GVIA 2UZ4A 4F5YA 4MS4B 4KRXA 3RYCA 3R74A 3L8EA 3LFTA 2NAFA 4H15A 1KAHA 1LRLA 1MOZA 5LC1A 5DNEA 4C29A 1R6TA 4IYJA 3N0RA 5BNTA 5CA1B 2IYRA 3ELDA 3OICA 4AZ3A 2QJTA 1I0IA 3BE8A 5EZ6B 2M6RA 4LPKA 4DCUA 1RRFA 3GY0A 2H2GA 2IDMA 1PE0A 4XCQA 1A9XB 4YP7A 5G41A 1LDBA 1OZFA 3IV7A 4LBVA 2H9AA 5DT9A 1JDNA 3KXLA 3ZIAA 5JZBA 2EJBA 3BYZA 5HOEA 1DRKA 4IFIA 1U81A 4F2GA 3IQDB 3LCJA 5B1EA 5AVXA 4RCYA 2P68A 4EJSC 1B3BA 5DBGA 5BORA 5K8JB 5LLTA 4NVRA 1DBRA 3RVNA 2Z9DA 4D79A 4F3NA 1EUCB 2O7RA 3NHRA 3OM0A 2BP7B 3PR2B 4MJ7A 1ZR4A 1E77A 4FMDB 3T7DA 4MXDA 3D3JA 4YAOA 5TS3A 3ZHCA 3QTBA 2A0UA 1O0SA 2XHZA 3HLKA 4FX5A 2QNIA 4B6FA 5JD6A 3MJSA 3E9NA 1NRWA 1Q19A 4INOA 4OBWA 4WD3A 5JDIC 4RWZA 3AJEA 3K0FA 1YWGO 5JJ5A 4EA9A 1V16B 4C4PA 1ISGA 6YASA 2GFIA 2JARA 2W8BB 3ASVA 3MAAC 1VMAA 4LYGA 5IYZB 3BKWA 3ZZTA 4DA6A 1TFUA 5JWOA 1VYTA 1U8FO 1T3TA 3VR0A 4BWFB 2XCOA 2PUTA 2CBXA 4RK0A 1K4MA 1RBQA 1FK8A 1D2HA 4MR8B 5B2FA 2DR0A 4QDXA 1G9SA 1SWWA 4FP9A 2GDZA 1VL0A 2FRXA 2W6NA 3HRIA 4IGAA 2KM1A 2MSWA 2YWEA 4OHXA 2WJJA 4J6EA 2Q46A 1OB5A 1P1FA 1TJ4A 4P7FA 3KWJA 5FUVA 3HCPA 1RPZA 3MVEA 1OAOC 5I3CA 1IHYA 1SG6A 3O4RA 2MWMA 4B8ZA 5CITA 4WTOA 2X1VA 1GTRA 1CV2A 1YIAA 3ELWA 1JHXA 1O9GA 3EPKA 3OQPA 3TRDA 2IP2A 2QENA 3P0IA 2O0JA 3TRIA 3TG8A 2FOIA 4WXHA 1S9DA 2PX6A 3QW4B 3ZDFA 2QUAA 4MW9A 1R9MA 3NCHA 2IYQA 3R5FA 1KXJA 1C9YA 2A5LA 2DHRA 4HT3B 2YJZA 4QDUA 3IP8A 3S2EA 2M9MA 4CDNA 1U1IA 4A6DA 4YMGA 1NGSA 2FCRA 1FUYB 1O6ZA 3CGWA 4QYWA 2P1DA 4ACAA 3UFBA 1TD9A 2HWXA 2QMZA 5ALFA 3QM1A 4EFNA 6LDHA 4I55F 3CF4G 3P97A 4X0EA 5F2OA 4EGSA 2H1VA 4LF4B 4EVSA 4QPPA 3MYRA 1GGMA 3D02A 3CBGA 3BSFA 3IQHX 2E18A 1QQ5A 1DAMA 4CLRA 1Y1RA 2VJNA 2W4QA 2YDXA 5HCNA 3ZE0B 4HUJA 2V6JA 4P32A 5CFLA 4JXKA 2VSOA 4OQYA 3HBJA 4NICA 2ZUTA 3C1AA 4W9RA 3FB4A 4TXMA 3V8BA 2H4HA 3SQWA 4EKYA 3AHDA 2IS4A 2WWHA 3BWVA 2C3YA 4XWGA 3BVPA 3ESAA 4NR0A 2AFIE 3WB2A 1W0KA 4EF4A 3FLMA 4Y98A 3RG2A 1MT0A 3B9PA 2ZJ0A 3NEAA 4CETA 4IUDS 3AGQA 1KVSA 3LQKA 4B87A 3DHVA 1BX3A 2VT3A 3DNPA 4AS1A 1TKAA 2J5QA 1HV8A 2GFQA 4H1TA 1T8PA 1LDGA 2B8EA 4TN1A 3E5NA 1F0YA 2OFOA 1MZVA 2FPSA 4P54A 2RGGA 4UPDA 1R0LA 3LLSA 5FO0A 3LG2A 4E09A 3K0FB 4RQAA 5JXJA 3G6WA 4DLSA 4B3DA 3GARA 3FCCA 4MUYA 5AI6A 3RRZA 2VJYA 4B71A 1X7XB 2FE1A 5AM5A 1DRVA 5EMMA 1LVUA 1VE9A 5DHQA 8GPBA 1N77A 1N6PA 2JH9A 1BZYA 3QFHA 1Q11A 1WRBA 4TOIA 5DEIA 2V0CA 4YCJA 2FHSA 5DVZA 3SI7A 5IANA 3ENZA 2NMVA 4OP1A 3QG5A 4LDNA 3CMCO 3B9BA 2BAGA 3K0AA 4NIMA 3AR3A 2Q5EA 3CCFA 2I87A 1XZNA 3ZU6A 3U4HA 4PYNA 3T0FA 1X7ZB 4DQUA 721PA 2CMDA 3OQIB 5LB2A 5ES3A 4MYTA 2WBLC 2XQKA 3GRFA 3HE3A 3BGSA 3I83A 2BBOA 2N47A 1SD1A 4MP8A 2OGSA 1E7RA 2GPNA 2FN3A 4KXUA 1P80A 1QGYA 5JCPA 4MR9A 3FOAA 2VWGA 3KLOA 4LNUA 3UK6A 9MHTA 1E3EA 1TLTA 5G3ZA 5B3AA 3RT9A 1OWPA 5SZIA 3PJEA 1B8NA 1RQRA 2Q29A 3D6MA 5H3CA 1Q0LA 4J91A 3BMNA 3DEHA 5AW4A 3LL7A 4XIFA 1FNBA 5AI4A 1YZLA 1WMDA 5CBPA 3VMMA 1HFKA 4LXQA 3TNJA 5KNCD 2REQB 2VTEA 1ORWA 4UMFA 2VKTA 3IB3A 3QPAA 5IWCA 4FZ3A 1A88A 5EWJA 4WERA 2HX1A 1Z4QA 2FEMA 3WRYA 3R9XB 5ITZA 3EC1A 3EIOA 5AOVA 4ALIA 2BC9A 5K3DA 3I6YA 3MOIA 3CJTA 3RSCA 3L0ZA 5H4HA 1DQZA 2Z5FA 4I6GA 4MWDA 4YO8A 5DV9A 3IRVA 3TLBA 2AF4C 3HYRA 4NOKA 1KRHA 1NNUA 3A6HA 3HJCA 2GEJA 4N6GA 4KWCA 3RIEA 3O9VA 3PXCX 4LJAA 3EBOA 2OQIA 4MKIA 4CT0A 4BO2A 2GJ4A 1V71A 2IHZA 2V54A 3PQ3A 3WKDA 2FFJA 3ZDRA 2YNMC 5L40A 3B38A 2WTXA 2VHUA 1IUNA 2X6QA 5IEBA 3V9AA 3G0OA 3SN6A 3VOSA 1B6TA 1H05A 5F35A 3H13A 4ARAA 2A9FA 5AUQA 2V7TA 4REQB 3NEPX 1KZ4A 4ZYVA 3A37A 1Z74A 4PX5A 3T3EA 1YL5A 2CNWD 1GYQA 1TIKA 5E1DA 2OAGA 4LZPA 5M3BA 1ZUNA 2HPAA 3G5AA 5B1SA 3M6WA 5E6UA 5IEJA 1XFAA 3TUIC 3UAGA 3D3WA 2R1VB 1L5HA 1ZOIA 2JLAA 1Y8CA 3VSBA 2BBSA 1QH8A 2ZTUA 3GJQA 4BNNA 4FNAA 3W8DA 3MWDA 1UT5A 1H23A 1R0ZA 1GGFA 1WEHA 3IBGA 1D4FA 4YRGA 5A02A 3DO6A 4NJOA 1SHUX 3DZBA 2VJQA 4QU8A 3EH1A 3UJHA 3LCUA 1GTMA 1UBLS 3H86A 2ZAIA 2IYXA 1GIAA 3JQ8A 3ZX5A 3KDAA 5EXEA 5DYIA 2WTAA 2AJCA 1D5WA 5E8JA 4QELA 1N3LA 4Z0TA 2GN8A 5ALVA 1KP3A 3EA0A 3HB7A 1ODIA 2P9HA 4EW6A 2CMGA 2FKAA 2HFJA 1DXYA 3RT1A 2GM5A 1L3CA 4DNQA 1Q7TA 3EDCA 5B36A 2W58A 1UWKA 2AFIB 4UDOA 1ICEA 2HJWA 3BH7A 1DFGA 3K0CA 1EFPB 2EERA 2M98A 2BLNA 1RM5A 2B99A 1AZLA 3OZTA 4L07A 2C5SA 1PZFA 5DTEA 3RKSA 2EZ8A 5IUNC 1CQJA 1YK0A 1FPQA 1MP0A 3K53A 2F6RA 4AJHA 3LQ1A 1O89A 3K96A 3ZBUA 2BGGA 3BHIA 4HP8A 4HL6A 1L4NA 2XCSB 4BKOA 3MCVA 1XZMA 4B4VA 4Z49A 3ZHTA 2IDZA 2GAFA 4G5FA 3ENVA 3REGA 3ZHXA 4B2LA 1E1CB 3IP9A 2SBTA 3BFKA 1ZRMA 1AVTA 2QUKA 3D8TA 4HS4A 4YBRA 1E69A 1Y7HA 2A9KA 3G79A 4R1SA 3RAJA 4HX9A 5K8UA 2VF2A 3AUSA 3FCEA 3TEJA 3W2FA 4K9DA 3FTPA 3PGVA 4XTCS 4PAQA 3NC4A 1WLSA 2R7NA 3H7IA 4CM9D 3E23A 3EGIA 1K92A 4NABA 4Y67A 1PNVA 4B0OA 4MAAA 2CYAA 2WVGA 4L4SA 5KVCA 2D1YA 2XCQA 4GW3A 2FW0A 5AJHA 4A1OA 2XYGA 3KUDA 4HZUA 4CM3A 4OUKX 5C52B 3EPRA 1RU3A 5A0VA 3T7SA 4PSDA 1ZP6A 3I04M 2AKAB 3PEWA 4NH4A 4XYMA 5FFMA 2H31A 5BNIA 3CTPA 4DCGA 4J16A 4Y9DA 3A6EA 2MSLA 4YX9A 4NP6A 2GBLA 1L4KA 1OB2A 1DBVO 5E6UB 1RABA 4C5CA 4DDVA 1FC0A 1FLDA 1NR7A 3F67A 4ZHQA 2PH3A 3D3WB 1MEOA 1ESEA 2Z30A 4KODA 4ZDKA 1KFCB 1QH8B 3ESQA 3CA8A 3MWDB 5MHTA 2GD1O 5CVJA 1JEOA 3S8EA 3WA7A 3ETHA 2DQZA 4GRDA 2DJ5A 4RHTA 2ICAA 1R4MB 1RVV1 1JHUA 5FPKA 2AYYA 4D98A 3EDOA 1LQTA 5D8DA 3WX0A 2A9QA 4HNUA 2AG6A 2BFMA 1E9RA 2QLBA 2QSZA 2YJ3A 3F6PA 4B6OA 4ZVRA 4DMMA 5KWVA 1KQ3A 1Q22A 5ADHA 1E0JA 3QU9A 3SC2A 3R9IA 1T5OA 4HFRA 5ABPA 1KS2A 5E6SA 1P7PA 1DQNA 3JAMA 4DS3A 1DUSA 4HDKA 1SXGA 4NSNA 1XN1A 1DAIA 1NVTA 2VIIA 2GN1A 4BP1A 2UZ0A 5AIBA 1K3TA 1AUXA 2QTBA 1OI3A 2C3MA 3Q7EA 4LV8B 2JGRA 3UJ7A 2IS1A 2YJGA 1EE2A 1PGPA 4Q82A 1MAUA 3WMRA 2RHCA 4PGAA 3TW8B 1TM3E 3MINB 4UARA 4RU1A 5LKAA 3DBLA 3HRKA 2PS1A 2ACWA 2G71A 1T4CB 4O1MA 1KYTA 3CPJB 2VDPB 3WJ1A 3R1IA 1YQWA 5B3LA 1E5LA 5JD3A 5E38A 4JSYA 5HG0A 1TAGA 1X1EA 1CSEE 2WQZA 2J30A 3M5WA 3Q5GA 4OHWA 5K3SA 3RS0A 1NW4A 3DF7A 4NJEB 4DDUA 4UKDA 5KNBA 1JHAA 3WL8A 4DA7A 2JLWA 1O0CA 1NMQA 1DBWA 2WRZA 1YKFA 3H1PA 3LLUA 5EZYA 5A7HA 4PICA 2CKMA 1BMDA 1AXRA 3AVQA 1ZNWA 2I1LA 4AJEA 2QW8A 5JD4A 5MDHA 3AVWA 1DRWA 2PQ0A 4EWLA 3C6KA 3THWA 5JJLA 1HOTA 4Z2AA 3KFLA 3PQCA 2NTEA 2G9QA 2J5XA 3EGCA 1YBVA 2FUNB 3TTUA 1NSFA 1QJCA 3P9IA 3SQMA 2B92A 2GF0A 1T34A 2P5YA 3AERB 3DLPX 5TXGA 1X7WB 2QGNA 3QJGA 2A1UA 3S0JA 4BUJA 4DQLA 3GLFA 2AN9A 3T7KA 2QAJA 1HDRA 3F8TA 3FPLA 3IEIA 2GQ0A 3IAFA 4BFCA 9LDBA 1Y6GA 5CDSA 4ARIA 5EHXA 4ZA2A 2O8EB 1VPWA 3GRZA 5JNLA 2AZTA 1T8RA 2V8BA 1JX6A 3GWGA 1ZM4A 5LWQA 3GNQA 1U99A 1CNMA 2VBFA 3KZXA 3PNSA 4RVGA 4UDNA 2C1XA 4BB6A 2ZDGA 4R0MA 3KOMA 1F4VA 3PFKA 5CD1A 1GPKA 4ZQHA 1IUKA 5K20A 1FYEA 1GPYA 3F4LA 1FEZA 4HSEA 1C9EA 1MTOA 1RJEA 1LK5A 3CSDA 4ZV9A 1EWYA 3TAXA 5ELMA 4B3HA 5GQSA 4CWAA 3GLTA 2QHXA 3R20A 5FI1B 3USES 1KFJB 1NI5A 2C3PA 2PX3A 3DL4A 3QX9A 5SICE 3EW7A 4FEGA 4YEDA 1Y7LA 4C2UA 4HDMB 1NBMD 1MAWA 1JZTA 3CZ9A 5E6SB 4WK0B 3ZZUA 1CJUC 4WEQA 3OP4A 4KLZA 4FNGA 2ZULA 2JGEA 2FKNA 2CVFA 1SNYA 2GPTA 3F1KA 3IPYA 1LRKA 2XYVA 3TNFA 3SYRA 3ZZMA 4LHSA 3KIPA 4O25A 2VPZA 3MQ2A 4QBFA 2EG9A 1YZHA 2FY8A 4RS4A 3IILA 4R7GA 4NONA 5EVJA 3RBZA 4C87A 4N7BA 4XR9A 4DNXA 2A35A 4OHRA 1J9GA 2QRVA 1FXUA 4RETA 4WCDA 1D04A 2WSSA 3TWOA 1DKOA 3F6EX 1P8JA 2G0NA 3DOCA 2ZUWA 1BCRA 1RXUA 2Q3DA 4DJDC 4DF3A 2CXHA 4PWYA 1EXVA 3FNFA 3HK2A 2C1ZA 1KYIA 1V3QE 1VCOA 2G17A 3GGJA 1X3SA 3IJPA 1W0JA 3OFKA 4UZFA 5LDGA 3V42A 3WXBA 1AS3A 3KE9A 5AK5A 3JSXA 3HA3A 4DPMA 4DV3B 4IP0A 1FSZA 1XA4A 3F5DA 3LUGA 4C0BA 2HU7A 4FWTA 2IGTA 3P2EA 3MCAA 2QNRA 3OWOA 2BTQB 3LLVA 3IODA 3ADBA 1W36B 3NM6B 5EZYB 2OBFA 3KQSA 1B0AA 3HZOA 4GP9A 2Z1DA 4G0UA 5C3MA 4R41A 2H2IA 2VZ0A 2NNWB 3MC1A 4RVDA 2QE7D 3CNEA 5F3DA 4ESHA 2NZXA 1A4IA 1TAQA 2H0QA 1HETA 4HMPA 1F2UA 1NFRA 4BCBA 3P9SA 4DT1B 2BDTA 5AOBA 4F5EA 4URXR 5KJ6A 2FG5A 1UM9A 3GLFB 4NAHA 2A1UB 5IUKC 3IBSA 2R5NA 3QY0A 4GBED 5DCLA 1FYVA 3AFIA 4HDRB 3TSYA 4RENA 1F2VA 3L77A 2WSIA 1PJRA 1IU9A 2JIMA 5BW8A 4X1KA 4UEQA 4WASA 2XYHA 4TS3A 4D3DA 2ID9A 3F2IA 3CYFA 1IOWA 3SKYA 1C3JA 1W85B 3OIYA 2I91A 4Q1DA 1PR6A 1IBRA 4BGVA 3FDIA 4XM0A 4AO8A 2A9OA 2EX1A 3FGZA 5JRZA 3C8MA 2F8SA 4EYGA 4MLCA 5K03A 4TKVB 2H2HA 4LGYA 4CIBA 1ST2A 5I7UA 4IIGA 4OX9Y 1Y80A 2MSNA 1IEVA 3EWNA 3MB8A 2N1MA 4M0UA 5ALNA 1LWNA 4PS1A 1IY9A 1GPAA 4O0LA 3OHSX 1FDSA 1LSOA 1WCWA 4PVDA 4R01A 4ZZ3A 2JJ8A 2OZLA 3AR8A 5LNK6 2WHYA 2P2YA 3HP1A 4KAXA 4NBKA 1SIBE 1QE5A 1NJSA 4C4AA 4Q05A 4DJAA 3PZRA 4C0WA 2ZJOA 3MTBA 2C4UA 4JV5B 2PBFA 1MN6A 2YWGA 2CXUA 1V2HE 3NKVA 4DA4A 4FB5A 1VG8A 5AVJA 1V8ZA 1A2OA 3G2IA 3GCXA 2QTWB 1C8LA 3TTWA 4UHHA 2O2JA 4C0QC 2ZYGA 1FS6A 3CJQA 4WKGA 1QPZA 3A3PA 3KJHA 1KU6A 3FHCB 1COWA 1XU4A 5IHPA 5LQKA 1DAKA 1ZN2A 2J67A 5AW1A 4EI2A 1G5QA 4OY3A 4NBVA 1DKPA 3J81k 2FPMA 2ZZMA 1L4HA 1MHPA 3FZYA 5DW0A 4ZGBA 4GLJA 5GV8A 1GCAA 2C9ZA 3LT0A 4WKOA 1Q3KA 3LA8A 4KVZA 3KFXA 4MVJP 4A8PA 5TS2A 2ZT6A 2J3JA 4EHHA 5FR1A 2YXDA 4E21A 1SIWA 4DV0B 5F7JA 3KT6A 1E2HA 1FQJA 1JSCA 2ZRNA 4JC5A 3VYTB 5A4JA 2IQIA 4MV3A 2H52A 3VZBA 1YR7A 3PD7A 1ATIA 2C5HA 4CLOB 3QLJA 5LA6F 5K3BA 3RVJA 2FQYA 3TMKA 4RAQA 4A9AA 5C1BA 3JD1A 3JAKB 2C9BA 4U2BA 5DIFA 1UPCA 1ZVJA 3S70A 3J80A 2J08A 4QDZA 1A1SA 4RD1A 3DWIA 5A3SA 1HYGA 5J4HA 2EF1A 1J0CA 2OTCA 2FPUA 2D7JA 4TROA 5FI3A 4KX3A 2FK8A 4FLFA 3FTNA 4NF2A 3I62A 4KUEA 1SVOA 4YMSA 3CN7A 4QQ8A 4RTOA 5LZ2A 5AHOA 1ORTA 1KDVA 3MT8A 4I5EA 4N49A 5EPUA 1EAMA 4OHKA 2BONA 4RMGA 4YMIA 4KR2A 4GMHA 2H1WA 2W6MA 3E35A 3HZHA 5IBPA 4C5BA 2Q4RA 3BTOA 1IK6A 4JBGA 1QPBA 1I9CA 4L4RA 4QXMA 3BUSA 4FUTA 2AN1A 3VR5D 3H8WA 1DLIA 1KYVA 1VHDA 4UTVA 5ARBA 3R5TA 2A1TR 5E7JA 5I7RA 5I9NA 4OK6A 3ZI0A 1UMBA 2FI1A 1L8LA 3D4LA 3LX5A 1RHMA 2IW3A 4EA6A 1UKEA 3LHDA 1K6XA 5EERA 3RKRA 4CZ2A 4B73A 2QKYA 1Q74A 5KMGB 3ZDBA 1G59A 3GJ8A 5GY7A 4DV4B 5DXFA 3RC1A 4QSMA 2HHHB 1S02A 2FH5B 3TLCA 3EMBA 4PN3A 4WZBE 4X84A 1PW5A 1M1YA 3NR2A 2HK6A 2IHJA 3C1OA 5KYUB 3MWKA 4FYMA 4Z0HO 2EKDA 4I36A 2V7BA 1ZUD1