1U1FA

Structure of e. coli uridine phosphorylase complexed to 5-(m-(benzyloxy)benzyl)acyclouridine (bbau)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
243
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQTMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title Structural basis for inhibition of Escherichia coli uridine phosphorylase by 5-substituted acyclouridines.
pubmed doi rcsb
source organism Escherichia coli
total genus 86
structure length 243
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u1fA00
3D1VA 3DJFA 3ONVA 1TGVA 3ODGA 1JP7A 4NY1A 1RFGE 3F8WA 5CYFA 2PGAA 4TXMA 2B94A 3FAZA 4MARA 1VMKA 3UT6A 2A0YA 2QTTA 1JDSA 4JP5A 1JDTA 4G41A 2RJ3A 4OJTA 4D98A 1V45E 3ENZA 3PNPA 1RXUA 4R31A 3EEIA 1T8WA 3E0QA 4D9HA 3OZDA 2AC7A 1NC3A 2OXFA 1TCUA 4TXHA 5ETJA 1N3IA 2QDKA 3MB8A 3OPVA 4P54A 4OY3A 1CG6A 4F1WA 4UC0A 1A69A 4E1VA 3E9ZA 4QASA 4H1TA 1U1GA 3UAXA 5K1ZA 4GLJA 1JE0A 5DK6A 1Q1GA 4L5YA 4YMLA 1B8NA 3O6VA 1T8SA 3NM6B 1OUMA 3MMSA 3FOWA 4QAQA 5F73A 1Y6QA 1ZL2A 4D8XA 1Z39A 1Y1QA 1PKEA 1V48A 4F2WA 1PR5A 4TXJA 1Z5NA 1OTXA 4WKPA 3FUCA 4FFSA 1PBNA 5CCDA 1XE3A 3NM5A 1Z5PA 4QATA 3DPSA 1PR2A 1Y1RA 4G8JA 3PHBE 3OCCA 1ULBA 4KN5A 4F3KA 1NW4A 1K27A 4LKRA 4M7WA 4TXNA 4TS3A 1Z36A 2HN9A 3OOEA 1U1DA 4QFBA 3FB1A 4DA8A 2OC4A 4D8VA 1ODLA 1ECPA 4DAOA 4L5CA 1ZOSA 1V3QE 4WKCA 4RJ2A 2XRFA 1U1CA 3PHCA 1QE5A 4IP0A 3NM4A 4L0MA 2HWUA 1I80A 1TD1A 2QPLA 1Z34A 1PR0A 3OF3A 3KHSA 2Q7OE 5C80A 2OECA 4NSNA 1B8OA 2GUWA 4BMZA 3IEXA 4QARA 1T8YA 1SD1A 3IOMA 5KB3A 3DDOA 4WKNA 1ODJA 1RXCA 1JDZA 3LBAA 3EUEA 1LX7A 1VFNA 2AI2A 3EMVA 1PR6A 1VHWA 4NS1A 3K8QA 4K6OA 1SJ9A 1LVUA 4F3CA 3FWPA 1RCTE 1Z33A 4DA0A 3INYA 1V41E 2IQ5A 1YR3A 1K3FA 1A9TA 3KUKA 4LNAA 2P4SA 1A9PA 3K8OE 2HRDA 3BSFA 3EUFA 1YBFA 2ON6A 4MCHA 2QSUA 3QPBA 5F78A 4BMXA 4LDNA 5CXSA 1OU4A 4TYMA 1PW7A 3O4VA 3E9RA 1TCVA 3SCZA 1RXSA 1T8RA 4G89A 2AI3A 4TXLA 1Z35A 5CYGA 5IU6A 1TGYA 5CXQA 1V2HE 4LNHA 5I3CA 4DARA 3FNQA 4DABA 3DF9A 4WKOA 3BGSA 3KU4A 2BSXA 3OZBA 4EARA 1SD2A 4X24A 2AI1A 5B7GA 1ULAA 1A9SA 3T94A 4OF4A 1OV6A 3DP9A 1JPVA 4QEZA 3U40A 5F7OA 2ISCA 2OC9A 2QTGA 4OGLA 5B7PA 1PK7A 4YNBA 5F7ZA 4R2XA 1PR4A 1YQUA 1FXUA 3UAYA 1U1EA 4MCIA 3GB9A 3OOHA 1Z38A 1K9SA 1RSZA 2A0XA 1ODKA 4M1EA 1JDVA 1CB0A 4DANA 4GMHA 4JWTA 4OGKA 4GLFA 5F76A 5CCEA 5F7JA 4TTIA 2HSWA 5F7XA 1U1FA 1M73E 1A9RA 3LGSA 4DAEA 2A0WA 4BN0A 3TL6A 1Y1TA 3GGSA 3PNSA 4YJKA 3P0FA 4F2PA 1T0UA 1V4NA 5EFOA 1YQQA 3LA8A 4TTAA 1PK9A 1PWYE 4ECEA 1JE1A 4I2VA 4EB8A 4TS9A 1JDUA 3C74A 3BJEA 1LV8A 1RT9A 1WTAA 1G2OA 3KVRA 3UAWA 1A9OA 2I8AA 4PR3A 4BMYA 1SQ6A 5EPUA 1Z5OA 1YRYE 1JYSA 4LZWA 4DA6A 4D8YA 4R2WA 5JPCA 3UAZA 5B7QA 5FAKA 1Y1SA 4GKAA 5IFKA 4PNPA 1OVGA 1RYZA 1NC1A 2I4TA 1PR1A 4DA7A 3OZCA 3BL6A 4JOSA 1Y6RA 1RR6A 1PF7E 3OZEA 5B7NA 1RXYA 1Z37A 3NBQA 5EUBA 4L6IA 4TTJA 3KVVA 4L5AA 4M3NA 4WKBA 5F77A 4YO8A 2A8YA 3KVYA 3UAVA 1C3XA 1A9QA 1ODIA 4U2KA 2H8GA 3P0EA 1OTYA 1VHJA 4OEHA
chains in the Genus database with same CATH superfamily
5KU7A 1KMCA 4TSFA 5I7VA 1AKYA 1GCAA 4YMWA 3E18A 5K03A 3AQ4A 1KBQA 1P61B 5H70A 1GKKA 1RWWA 2EBFX 2XTAA 4FCTA 1S8NA 2D59A 2HJHA 3Q4GA 1PFQA 3DNPA 4JCOA 5DLDA 4ZVTA 4Z1MD 1DBIA 2R25B 2V0NA 3K09A 1C81A 5C7LO 3BCUA 3DXFA 1AGPA 1XD8A 2YC4C 4OXXA 1G64A 2C8KA 1ML4A 4QXRA 3ZCRA 4CIAA 3BQMB 2PGAA 3CMMA 1E63A 3U7IA 1D0SA 2XUJA 4L7VA 2VAPA 2AR0A 5CLGA 3FFWA 4BJHB 1GARA 2ZSDA 3O2JA 1Y0BA 2Q4EA 3PFGA 3KWFA 3L7OA 3RVMA 3ICQB 2AQIA 3C5VA 4NG4A 4NDAA 3W4IA 2PSSA 1SQGA 1Q1NA 1R5OA 3F73A 1P3JA 1TLFA 4MUKA 4O4JF 1HC7A 4AL4A 1W94A 2A1UB 4MA5A 1JMKC 2EX0A 3E03A 2CNNA 2PLWA 3VH3A 1ZUHA 4N03A 4QELA 2Q7XA 2YNMD 3AWDA 2PEYA 3NW9A 4LVOA 1WUIS 1JKJB 3ILHA 3JZAA 4W6ZA 5DYIA 3KL2A 4N8SA 3ZZ1A 4EIWA 5K3OA 1L4NA 4ZQGA 3OZDA 3WB1A 1AQJA 13PKA 4AULA 4BUCA 2XUFA 4N39A 4I81A 4DTCA 3PX2A 3PEFA 1VL6A 2AG0A 2ZATA 1IRXA 1DC5A 1V5IA 2QDKA 1YOVB 5DNWA 2YHAA 1PEAA 4AYTA 2YWFA 5A5VA 3EMBA 4OY3A 3FMOB 2AMFA 1E2MA 1V7CA 3R9WA 2QVBA 3AUAA 4CL0A 2Q9CA 3R77A 2W98A 4HLNA 4R8SA 2ZUWA 3CQ9A 3HPRA 2OFXA 2QG4A 2Q7DA 3HI6A 1NHWA 1UBJS 3BFJA 3BTUA 2GAIA 2VFAA 3HA3A 2G70A 1AMNA 3QHAA 2E4UA 4B46A 2MINA 1Z5VA 3LBNA 1FE8A 3CW2A 3MILA 3UUFA 4HJXA 3NJRA 4QWMA 4QAJA 2OG1A 4WMLA 1VLQA 3A05A 2JJ2D 2O1SA 1N7IA 3P4XA 3W5SA 2N0SA 5JCZA 3R0XA 2FOIA 2IEAA 4F9EA 2ZZMA 1HX7A 4PXSA 2XXAA 4U5QA 5TDHA 2V54A 3WNVA 4CGZA 1F7UA 2P8JA 4TUYF 4MIOA 4JBNA 2AOTB 4PR0A 1EUCB 2HQRA 4O4HA 2R5WA 3A27A 1FUEA 1VE5A 4G8DA 3AWIA 3VAAA 3ZOKA 1HL7A 4B71A 5SYAA 2CFCA 3AEUA 4S1VA 4UNRA 3DHYA 2XE4A 3D3WA 5HZKA 2IITA 2IY8A 5GOTA 3QLVC 3D6NB 5KNBA 2GFIA 4MQLA 5AKKA 5DJ5A 4BBAA 3JU3A 2BISA 3EH1A 2CJWA 3MCAA 3K0BA 3NM5A 2W2VA 4LBZA 1KOLA 3LO8A 4WBNF 1S4QA 2IKSA 1UBGA 5IPFA 1ZFNA 2EGGA 2GXSA 3ANXA 4PV7A 4BJ5A 4XRRA 4RYLA 5JNLA 3TDNA 5LZ8A 4ER0A 4V3BA 1R0WA 1KAGA 1KDRA 3AHEA 3VISA 4FYHA 4D3ZA 1ZUWA 2F3TA 3OZVA 3ENKA 1ZMRA 1N3BA 2Y99A 5JR3A 3K1JA 1VHLA 1QYCA 3P2MA 1R2QA 4M1YA 4PYOA 5FORA 5CRIA 3VKVA 5JROA 5ICGA 4HQRA 2HJVA 4XRGA 3LWZA 1L4GA 4QTTB 3DS8A 1JH9A 3QWFA 1ZIXA 3EMKA 4QHTA 2RHCA 1TTPB 3NANA 5H8WA 1NW8A 1J0DA 3GAZA 2XMDA 3G2LA 4FMBB 5JS2A 1PZXA 4FDVA 4IHJB 5JV5A 1DPGA 1QYRA 3V4ZA 2YINC 1SAYA 4PS0A 2OC4A 1PHPA 1PW5A 3PE4A 3E61A 4IOLA 3JSXA 1KWGA 2P2NA 2VJMA 3T0GA 4A0SA 3K0SA 1C9JA 5ENZA 3NHRA 2J6HA 4GVXA 5HUJA 5K8VA 1BKDR 1TEZA 2XODA 4WK6A 4ZWNA 2QNBA 3EARA 1B8UA 1R5NA 3D7KA 3G1WA 1T3LA 3UXMA 2VDKB 3SHQA 4C4ZA 2ZXUA 5BSTA 3QENA 2BBOA 2IU6A 3TEMA 3WOVA 1PIWA 3A6ZA 4KG7A 3WNDA 3X1ZA 1IVSA 2A5LA 3RFTA 3NM4A 2HYDA 1CJCA 3ONDA 1Z8HA 2JCXA 4OQEA 2QQ5A 1O9GA 4DMUB 3LGXA 1SVUA 2W90A 1XVTA 4GC5A 4JI1B 3ZV4A 2YJ3A 3GLUA 2H2GA 1MBZA 2WMYA 1C7RA 1I4OA 3RASA 4TKVB 1M2HA 4HLUA 4HVCA 1RYDA 2PEZA 1FS5A 3O92A 3V4RA 1ZESA 3RKRA 1T8YA 3PGVA 4QA9A 1TIPA 2D2EA 3VR4D 5KKAA 3OBBA 3CLRD 3I28A 4A6PA 3LA6A 1RPJA 5DHSA 5MN5A 3WOHA 2G63A 2AFHE 1XCOA 3H4VA 4R3UC 4KQHA 3BMOA 1TF7A 2PUBA 1V9CA 4QSHA 1T5DX 1JECA 3T3NA 1T2VA 3RTDA 3WI7A 4YMSA 3K5HA 3LX5A 1E2PA 1TKAA 4HH3C 1Z75A 2JGKA 4UE6A 5AO9A 4CHGA 2ODPA 4IDDA 1Z0FA 1C1XB 3K8QA 4P4TA 4TTTS 1ZD9A 4NQRA 4OAOA 1N5DA 2I71A 2BDEA 3ZNQA 4MLDA 4ZCLA 5BWOA 1IU9A 4W5HA 3MJEA 5LYJB 1NJFA 2VYQA 5TS3A 3PYXA 4X1KB 3M2PA 2XMPA 3LUGA 1JF8A 1JEQB 3RUAA 2ZZKA 5JWRA 1X7HA 3RU9A 1K3FA 2Y4NA 1A9TA 3GD5A 4XDYA 2VTDA 4HEA6 3X44A 5HGJA 4C3VA 4FDAA 1DMSA 4KHPB 2E49A 2VJYA 3EF3A 3QPDA 3A9VA 3O1HB 1I3LA 2FUCA 4TT3A 3TK1A 3VA7A 3IJ5A 5DHTA 5CVVA 2OPHA 1EXDA 1WXGA 4F60A 5BV8A 3LYLA 3QE0A 3S6JA 4IWNA 3VZCA 1HE5A 4F2GA 1SC6A 3IT1A 3LCUA 1RRPA 1VGQA 1CBUA 2LR0A 3EHDA 3GJ5A 3LW7A 4QOIA 2V7QA 3UN1A 3ZHSA 3DD5A 4QVIA 3OMWA 2F43A 4JEHA 1DBQA 2MWMA 1YZVA 3DFKA 4ZHSA 1JUDA 3UK6A 3KQVA 4GBGA 2QR5A 1ILWA 1J0XO 1KKUA 1QCZA 1LJUA 1X7GA 1YDFA 2VJKA 2VWGA 3BSFA 1ZA1A 2KE5A 1O95A 2VF4X 4O08A 2GKGA 1AGXA 5AHXA 1CVLA 4JLUA 3BTOA 3W5HA 1YZHA 3THYA 5C8VA 2NU9A 5A02A 3Q6IA 1EFDN 1JJ7A 3INNA 1P0FA 2A92A 5TARA 1EGMB 5HJEA 2GF2A 3E70C 5ADHA 3RRMA 5F2NA 4QODA 4CFZA 3E9RA 5JS8A 2NU7B 2PV7A 3CUKA 3K0AB 1BE8A 4IR7A 4AN1A 4B6GA 1NVMB 3G8AA 5I7EA 2GFQA 3KXKA 4LYEA 1ZHOA 3T4XA 3WO0A 1QFYA 5KBYA 4KRXA 3V4SA 5L7TA 2VHTA 4HGZA 1G18A 3LI2A 5ICFA 5ALSA 4OI2A 1X1QA 1AZLA 4LOAA 4NEQA 1PLLA 4XCXA 3V1LA 4PPNA 5FLKA 2IZ7A 5HOQA 1O54A 1P8AA 2UVQA 4I9UA 4YC7A 3MT0A 3QBJA 3ESYA 5T8KA 1QZ3A 4C05A 1S7CA 2NV0A 5KTRA 5GIOE 4MKFA 4EL5A 1GV0A 2MU1A 1QRDA 1MZPA 4MVJP 2PRYA 2AFIB 2ZYRA 5JCOA 1T3TA 1TJYA 5CAEB 3A26A 1J7JA 4DARA 2XD9A 3FCCA 3MJ4A 3DE6X 2YYYA 3TW8A 1UM8A 1A0OA 5G1OA 1M66A 1NVXQ 2H1HA 5AM3A 4J2OA 5LUBA 4K6CA 2BKVA 4ZALA 2NNLD 3T9AA 2GBGA 3CJQA 4EP1A 2C83A 721PA 1EK6A 1KC3A 4JLSA 4HG2A 4KYUA 5HE8A 4CTMA 5I7HA 1T34A 2P11A 4ES6A 4NG5A 1G5IA 1QF9A 1NVBA 4LRWA 2QPAA 3AF6A 4DR2B 1YQGA 1A9SA 3LBIA 3OF2A 1MJHA 4OBBA 3P5SA 5AM1A 1XAJA 1BCSB 1NKVA 3CISA 3DL0A 3STTA 2BZGA 3IEVA 2AKAB 5ALFA 4IJKA 3GPLA 1E5LA 2NUBA 3K8YA 3B8EA 4WJLA 5LOVA 1OTHA 2HMSA 2H1IA 2VF7A 2Z5GA 3DR3A 1NE2A 1M6EX 2ZANA 3HFRA 5G0UA 1M2VB 2PO5A 4Y2GA 1TZBA 3UKDA 5JAMA 2BP7A 2CCKA 2DBYA 2E0IA 2M6RA 2PQMA 4P33A 4PPYA 4ZJUA 5U9CA 2AB0A 4U02A 4KRFA 2J9GA 2C96A 3WFZA 1U9CA 1Y8RB 1U2DA 2NQ2C 3OHPA 4GX1A 4H7JA 3JYOA 1Z47A 2G6TA 4XVQA 2VJBA 4MGIR 1X7WB 2GEUA 4KU4A 4YRNA 2CHEA 1E1RD 1MVNA 2JJQA 2O8FB 1RRKA 1M1NA 1XTPA 1X7ZA 2ZSHA 4BN4A 3U4DA 1KJ8A 1TK9A 1LBHA 2OV3A 1G7TA 5I9NA 2AOVA 4R2KA 2B8JA 1RS0A 4PGAA 5MN6A 1S8AA 3IODA 2G6BA 1AM4D 3RRBA 4DANA 3FOFC 2PVSA 2B20A 2BD0A 4GMHA 4J90A 5A0VA 4CV1A 1NBEA 1QVAA 1J70A 4ZI3A 5EEGA 3ZBQA 2OHVA 3ASUA 2FKAA 1PGQA 4O5OA 5C46F 4JYBA 5BR7A 1J5PA 5TPWB 4RVFA 4CDNA 2LP4Y 4NEHB 4LY9A 1CVIA 2FK7A 3D4OA 3R24A 1JPNA 3QVSA 5BNWA 1GIAA 1ZW1A 4BEBA 2HMTA 5D00A 3BHMA 3UB3A 2I22A 5REQA 3WK7A 1FU8A 3DDZX 3AOEC 3L0OA 2PE5A 5JNTA 2JH3A 4CI9A 2Q3DA 3AU9A 4FDLA 2X1HA 4LTDA 1U8YA 4OHXA 4N0EA 4QUGA 2WB2A 2P9CA 5A05A 3TAXA 3GEPA 2O4UX 1JEJA 1NN0A 3P0FA 4E08A 5D6NA 2OHHA 5KAPA 2PZKA 4RHFA 2V6IA 3E3LA 3KOYA 1KEEB 1X9HA 2Y0DA 3AT1A 2YYSA 1GRNA 3RADC 4BXOB 2XA1A 1DTWA 1ECGA 4IXWA 4XLLA 2OM2A 5JAHA 3RLFA 1WQ1R 1N0HA 3UGKA 1UBFA 2XOXA 5FOXA 5ALMA 5LYJF 3IAEA 5FYQA 3A1TA 3IURA 4ZJYA 1EDOA 3QFFA 5KQMA 2JGLA 3MBKA 3W3AD 3FUUA 1HH4A 1ZIPA 1Y1KE 3B6JA 5JUWA 4HRYA 4MB6A 4YLYA 4GLBA 2GJ4A 4EA6A 1JA9A 3O8QA 1VIYA 2ERXA 1Z28A 3HUTA 2C4MA 2IS2A 5BN4B 4K26A 3GWZA 4OUKX 3CUTA 1E5DA 3BL5A 4W8GA 1RWNA 2AEFA 3T9DA 1F60A 3TLGB 1KOJA 1G4AE 4CUKA 1XA4A 1BFDA 5SZHB 16PKA 4BPRA 4W5WA 3M3PA 1PVDA 3AUSA 3IRVA 1CXZA 4M8NE 3QK7A 1R3DA 3Q9NA 1M54A 5T4EA 3C39A 1WNFA 1JNXX 1UDRA 3HRIA 3H5TA 3IBCA 4HXFB 3IP3A 3WKEA 1YRYE 1ZJ5A 3V3KA 1TUIA 3GLFA 2HA3A 1C29B 4XWTA 3RLIA 3QWAA 4Z9BA 1VLMA 4BFSA 2CCJA 2Y0PA 3F1LA 4EKIA 4YONB 3UV3A 2VHQA 3ZQJA 4JC4A 4C06A 4B47A 2H6EA 3QNMA 2WTEA 3ZXSA 4IVQA 4GKJB 1PUIA 2X9QA 1F2TA 3WAGA 1Y4ZA 1PT7A 1WE2A 1JSRA 2NYVA 3UHJA 2WHXA 4BV2A 2BKUA 4AMGA 5KOHB 2OXCA 2I6QA 2PK3A 3SYKA 4TRRA 3LYAA 3VNUA 3WLEA 5HQ3A 3VSEA 4S0ZA 3DQQA 2MSNA 1XEWY 2FR1A 3F6YA 4KR9A 1Y63A 2CNOA 4RBNA 4IRUB 2HRZA 1MD9A 3GAFA 1S2NA 3FKSD 4M1MA 3HR4A 5A1TA 1JWBB 2OV1A 3AHFA 5A3SA 1BOOA 4REMA 5ES3A 4YAKA 1XRQA 1U28A 3IA2A 3QUSA 3FMFA 3KE9A 5AOVA 3JASA 1BHO1 4JBWA 1ZH8A 3CXUA 2O19A 2ZR7A 4E4TA 4NV1A 3BWYA 3R76A 2NXJA 3AFIA 3C6XA 3OT1A 1BJKA 4G4JA 4L6IA 4KXLA 4Z4QA 4LOHA 1NVEA 5SYMA 3GT7A 5ECGC 2JIZA 2AOXA 3DCIA 4RVUA 2XR1A 1EXVA 1KRHA 1NURA 4HLDA 5BWMA 3UJ7A 1DQPA 5EKXA 3SIWA 2C4UA 3GBVA 4L8LA 3IV6A 4FILA 2IZOA 2XUQA 2OGZA 4QICA 1FL9A 2ZWVA 3TWOA 2BFBA 4B3DA 4TV9B 2B92A 1L7OA 3FFAA 1MC4A 1E9DA 4Q48A 2VJNA 5C1IA 1YAHA 3G5MA 4CKCA 4DEYA 2O3RA 5HS6A 3RIYA 4YFYA 5JYEA 5BSKA 1VHQA 3N8KA 3ETGA 1FTQA 3HY4A 5G1NA 1M9NA 1PJTA 2V03A 2B5WA 3O91A 1SO8A 4K8RB 4FN5A 8GPBA 1PUXA 3P9QA 3KCNA 1OLSB 1I0IA 2V1UA 1BC5A 3VPFA 4B3FX 4RF4A 1TL7C 3TECE 2H31A 3FNIA 3IYLW 4F1JA 2HZ7A 3EPLA 4ASUD 4XW2A 1T1IA 4K2HA 2C9CA 2WPNA 4ZOLB 4WUVA 1HYBA 1OAKA 1KFEB 1GGJA 1X2BA 2M6SA 2C54A 4UJ5A 1U2PA 3H9BA 4HN4B 4XIYA 1NPDA 1ZD8A 3Q98A 4R2IA 2V5AA 1BWPA 2IU0A 1GPJA 1P77A 8OHMA 1HTWA 3O8CA 4TS1A 1Z6PA 4UCFA 1HXHA 1UADA 1BA2A 1JIKA 1HEYA 3Q8XB 1ACMA 1LUAA 5KHAA 1TQDA 2XJ4A 3EFHA 2IHVA 4D5GA 1T5HX 2RJ3A 3IDFA 4JI6B 1HRKA 1OILA 3P1JA 4AS2A 1PL6A 2B36A 3MTGA 4KQGA 2JLYA 3RAEC 1J25A 1EWKA 2BFEA 3QTLA 3ZOZA 4BO3A 4FCVA 5CBPA 4BY9E 2FW7A 3UBMA 1SKMA 1UK8A 3BS4A 3PA6A 3H8SA 1SCQA 1AC5A 4JYCA 2C2KA 5IC5A 4Y2YA 1FU4A 4EG7A 1EFKA 2H00A 4ZP1A 4NP6A 1R3UA 5CDYA 3TMKA 4Z53A 3GEHA 3FY4A 2RI6A 1QPZA 1HWYA 2GH1A 4DWJA 2LBPA 4OXQA 4OFXA 4FJ2A 3TRKA 4NNOA 3ZLTA 3U3RA 1O7JA 3QQPA 4DBVO 2DJIA 2I6GA 2Y0CA 4N5DA 4R6WA 3K05A 4AJLA 1D5WA 2CMGA 3HDQA 4GZ3A 4MUBA 2PA0A 4JJZA 1GZUA 3KZVA 2GKSA 3EGEA 3S1AB 4FB5A 1HYHA 5KU1A 3EGOA 3S2SA 1J49A 3FPKA 2C5FA 4YJ2B 2Q49A 3TGPA 1BEUB 4RABA 1FRVA 1ZZGA 2FUG1 1RW4A 2WSSD 5B4TA 1UDWA 2XB6A 3K1AA 3E3AA 4CKYA 2XBUA 2WMDA 2YIVX 2DFDA 3EBPA 3G3EA 4YQZA 2FPGB 1IM2A 1TFUA 3B1FA 4RD4A 1ZNWA 4W82A 2HFJA 2VJQA 5HNKA 5JI2E 3AM4A 1ESNA 1XD9A 3F90A 2HRBA 2CYBA 4PC2A 4MUHA 1J06A 3HABA 1OH8A 4RVSA 3DLHA 5CYPA 2G1UA 3GUZA 2ZIAA 3G2JA 2NMVA 1RAEA 3HVHA 3KTAB 2TMYA 3P2JA 4INZA 4AF8A 4RQAA 1TW3A 1LSJA 2X8WA 2ZKLA 1GVHA 3LX6A 1G8GA 2B8NA 3Q3IA 4PLHA 1Q7TA 3AFHA 3EDRA 1G2PA 2VQDA 3IHKA 3PQDA 5DU2A 3RVQA 2DCUA 2BZ0A 1MN6A 3BWCA 5BWBA 2CHVA 1IPFA 3NHPA 1UPFA 2UVDA 1ILEA 3C3YA 2ISSD 2VIIA 1JZSA 1FBNA 1OT3A 2SECE 4K6FA 3VR3D 1I4WA 3QNWA 5JDIA 1H8HA 4BNVA 1DDOA 1EEHA 3D3NA 3VKGA 2NACA 3C4VA 1VKHA 2Z3ZA 1V2GA 4A2QA 2HX1A 2A1UA 3VDQA 2VWHA 3AKZA 2QRPA 2HYIC 2JG3A 1E0SA 3AW9A 4N9QA 5KPDA 1Y3FE 1C7IA 4YRTA 5AW7A 1MXHA 3CBGA 4PYKA 5HUQA 3FTEA 2H29A 4DBLC 4J91A 2C07A 1TZKA 2HBQA 4P2GA 1VIMA 4RH1A 2G4LA 2JLSA 4PSAA 2P68A 3AETA 3QA9A 3HLKA 1SXJB 1Z3CA 4I8IA 3SYLA 4LKRA 5AOCA 1D2HA 1Z8DA 2BEWB 4K2AA 1SFRA 3HNPA 4ISBA 3QV1A 2HCRA 5K4AA 2XYHA 3IP7A 4Q3KA 1AA6A 1CQIB 1DX9A 1DIHA 1KR2A 2HFKA 2WTBA 4CEIB 1YOVA 3NATA 2R6GA 3H05A 4GMXA 4BV8A 3E5NA 3G0CA 3NV9A 4G9GA 4BHTA 4F2HA 3ETLA 2Q62A 1DAPA 3B89A 3KK0A 1AZTA 2MJLA 3MJFA 4J4HA 1DBPA 2PGNA 1ZJJA 2RGBA 4EVRA 1MO6A 2P90A 3CNLA 2RI0A 4M36A 2P6UA 4PRKA 2YFHA 1MR3F 1ABBA 1HEIA 1IVYA 2EZTA 2ZRHA 4QECA 2Y0EA 1P5ZB 4QFDA 3TLBA 4D6PA 3LVRE 4PNHA 3OQPA 1YWGO 2GCGA 2NIPA 4J1TA 1IY1A 1W9MA 2VYVA 1GGEA 2NO1A 5GTDA 1OHHD 4L95C 4DJJA 1CJTC 1MRNA 2V6GA 4RJTA 10MHA 5CNJA 3CM0A 2QRGA 4B83A 1OVMA 4B3HA 3A1SA 5HFNA 4HATA 5AXCA 2H1SA 1IK6A 4MS3A 4ARAA 1US8B 4FU0A 2FR0A 1U7TA 2VZEA 3IAS6 4GD3Q 1RLTA 1I80A 5FNZA 4RCVA 2Z09A 1EUCA 2EXXA 5GZ1A 2BFDB 1P1JA 3VOBA 1Y8QB 2BJWA 4GR5A 4AJEA 2D00A 2OQ2A 2PANA 3N0RA 4ZZ1A 1JT9A 4RZSA 2WHYA 1P7CA 4NBKA 4AJ9A 4V38A 3TIVA 3LPNA 4GMKA 3ZV7A 4WEQA 1EX7A 1JG4A 3ABIA 3GJ6A 3B20A 4D8UA 5B5SA 2C8VA 3L7CA 3VNVA 2J5QA 3ZJTA 1QGUB 3IEMA 3EAQA 1QAMA 1RXIA 3C85A 3ACBA 4X90A 3DEZA 1YR2A 1XFAA 3EWAA 4TV9F 3I3SR 1YZUA 2Y6VA 1H6CA 2PAFA 5BSUA 3QUAA 3QEBZ 3HC7A 3PXUA 4IIXA 1R4ZA 3RTBA 1I7DA 2Q5HA 3S3TA 1MC1A 3NKVA 4FYWA 3WGMA 3I01A 4FJ1A 2I6UA 5EKSA 1LNSA 2AI2A 3H5VA 1GZ5A 1SOAA 1RHUA 3BCSA 4CKBB 3I45A 1UMBA 1T43A 4L72A 1OLXB 4BP1A 4EJFA 3DLPX 3V8RA 3FNGA 5JD4A 1UCFA 2AJ8A 4K6OA 1KJIA 2EX4A 2RAPA 3NTRA 4IINA 1SUBA 4ZO6A 1ZNZA 2WF7A 2QVZX 1E0JA 4W1SA 1UK6A 4ZOLF 3IQDB 2ZTSA 4OV6B 2ZB3A 3ZHVA 5IDQA 2PCLA 3L0YA 4MVJH 2VJDA 1M0SA 3EDYA 3AB3A 3EC1A 3WK9A 3HS3A 4IHJA 4Q9NA 3ZCPA 2OB1A 3PD1A 4QVKA 3H5LA 2BONA 2AJDA 1DOZA 4ZVVA 2XEDA 3HXPA 2RAFA 3H1BA 4H1VA 1NE7A 2GERA 5AESA 3QKRA 4BEJA 4HMOA 2ISQA 4Z0PA 5FP0A 1WMEA 3P2IA 1X74A 3ZHZA 1QIEA 3DOJA 2JEZA 2FK8A 3Q7PA 4EPYA 7ADHA 1HZZC 2I03A 4URWR 4V2IA 2DT8A 2CB9A 2VHXA 4L16A 3ZE2B 2R7KA 4CF7A 3THRA 1XHFA 1Q0PA 4L0CA 4UHBA 2OENG 1AO0A 1WSDA 4KR3A 2V5VA 1YIAA 4HAVA 1J23A 5KYXA 1SMKA 4ZQIA 1GG8A 3FR8A 1DNPA 2IW3A 3H87A 5DULA 3EZ6A 3GLSA 3DLAA 3T38A 1ZISA 3VYTB 5BQFA 4FI3F 4C7VA 2WV9A 4JZYA 4ER6A 1JEYB 4QBFA 4PN3A 1XCMA 2TSYB 1UKEA 5E95A 3EUFA 3AFGA 2P8SA 1HSZA 1V5WA 1D1PA 2C0QA 3ZCVA 2W58A 4HSEA 4JY7A 4OMUA 2BUCA 3HJCA 4ETNA 2JBAB 4PGGA 4BQNA 3LH5A 4YJ2F 4UDXX 3OTIA 3JQAD 4LECA 4IRMA 1NXOA 3GEBA 3H83A 4O63O 1W5AA 2IOYA 3AZQA 5T6BA 5JDCC 1YKGA 1G1AA 3FPLA 3G9ZA 5CDFA 3RRZA 4U3JA 3C3KA 1KXZA 3MC1A 2AG8A 3SBXA 4N0DA 1PGJA 2AI3A 2O3TA 4NIMA 5FHRA 4TXLA 1IOWA 3VU3A 1KSHA 3DBHA 4EPVA 4DY4A 2JLRA 4IIEA 1C1XA 1TQ2A 1IZ9A 2JLQA 1B00A 4R81A 1PGNA 1QHEA 4WXMA 5BSGA 1IG3A 3HTXA 3U4AA 5C7OO 1VIDA 4WN9B 1E0DA 4ZREA 3SHTA 1FU7A 1IXKA 3DOFA 4M0UA 3N75A 5EL0A 4LJ5A 2JAXA 3EXG2 3I53A 4X1KA 3V55A 2D1QA 2PRJA 1JEQA 3BTSA 2NV2B 1A82A 3CZAA 3UXHA 3WB9A 3ZQUA 1WPQA 3D7MA 1FFEA 2BWJA 1QZUA 4HN2A 4Q1EA 1QRAA 3KR0A 1BGWA 5BN3B 4IF4A 5LU8A 1IHPA 1M1YE 2K4MA 3BSWA 4Y6GB 1XMJA 3LXUX 5AUNB 5HOEA 2RHJA 1JA1A 3HBLA 1SC3A 2YOGA 1CJUC 1EIZA 2WF6A 1YQEA 2EGHA 1JFFA 3ZE7A 3X2EA 2E82A 1VI6A 4NKRA 3H18A 2HF2A 4Q9AA 3C3AA 2DTEA 5ER6A 3SS7X 5KVSA 3RTEA 5C51B 5BPFA 4EWLA 4LFBB 4YI5A 1JPVA 1XWWA 1K7EB 2JA2A 2C77A 2D4AA 2VPTA 3CRZA 4IRXA 5JJKA 2ZIUB 1XJQA 4LJLA 4C2BA 5F7OA 1FMFA 3H5NA 5CGQB 4LDRA 3VH4A 3P4UA 5EJIA 4QUKA 1CJKC 1N6OA 2VC2B 2QAGC 4ITRC 4Q24A 5BN5B 1BDBA 1ZKMA 1XQ9A 5AW1A 2X42A 4RESA 3ST7A 3EA5A 1V6SA 1XZPA 4XYEA 4DC0A 2LVBA 4QYIB 3WYBA 5J5AA 3CNBA 1U4SA 1YE8A 2FSUA 3F1KA 3LSTA 1WUTA 3IVRA 5CLHA 4AZWA 2CXPA 2NU7A 3ORSA 4MKZA 4R2XA 3K9WA 1JQAA 4OTZA 4IWYA 3UAYA 1OYOA 2G0TA 1Z2AA 1IPEA 3IRUA 2EBUA 3LMKA 1Z38A 1K9SA 2Q2WA 4X6UA 4FIZA 1YL6A 1GM5A 1KFCB 2R8PA 1BN7A 2HXYA 4QXPA 3SYTA 2AK3A 3SSMA 4CF6A 2BDUA 1FRQA 3L18A 1II8B 2C4VA 2ZAGA 1NKSA 3WQSB 2OXEA 5B37A 4XOIA 4ZVKA 5EJ2A 5CD1A 2BH2A 3ENWA 2CHQA 2Q3HA 1H2HA 2GRAA 1M0WA 1VOTA 1K98A 4OJKA 5L3ZA 3CUSA 3WQHA 2KX7A 4ABYA 5JXHA 2B5VA 1OOEA 2BCJQ 3TUZC 1AUOA 1CR2A 1LWNA 3WZLA 3QPCA 4DV1B 2Z2XA 3DE7X 1N9GB 2WHRA 5CH5A 1KEZA 5H4GA 3A1VA 3L41A 1H0RA 4KWHA 4Q9JA 3KU1A 3B52X 2D74A 3ITDA 3W5AA 3O4RA 3FUXA 1YL5A 1XL0A 4PG5A 2W9XA 3RIMA 1QLHA 1VJRA 3G0IA 3ZVRA 3BWDD 1O89A 1R0BA 2V9CA 4RMHA 4DS3A 4RE6A 3KC2A 3VHQA 2C5EA 4N3BA 1AKMA 2R97A 3NOXA 3CR8A 3S1SA 2CF5A 1PWYE 2PZEA 3U6KA 2Z2ZA 2WRZA 1L7BA 1CUDA 3DE0X 2ZRAA 3ABRB 3KYCB 3RWMB 1X1AA 2HB6A 1PJ2A 4DMCA 1OY1A 3H7IA 4QX6A 1ZI9A 3GFVA 5ALWA 1JHOA 3GRFA 4DIUA 5K4HA 1CRPA 4XJVA 5GGYA 5H3CA 4ATNA 2UUBB 1IEWA 1K7SN 4JVMA 4WZAB 4YP1A 1WW3A 1DHRA 3KDAA 5D5QA 5TEWA 4GWKA 3GX1A 3A6JA 1T6BY 3AQIA 3I83A 4QQRA 1DUSA 3PUZA 2H92A 3BUSA 3FE2A 3QU4A 2WVHA 1IONA 3AEZA 5LQSA 4WFJA 4ZMBA 5FWNA 1DT3A 2R5FA 1CJVC 3Q85A 3VR2D 3ELBA 1UAAA 2ZIVB 4KVZA 5I3ZA 2MSDB 2C94A 4PPFA 1JYSA 4FSXA 4EG3A 3BXPA 4UPEA 3DW1X 4KC0A 4PSCA 4V0NA 3QLUC 1KVRA 3UAZA 1W6UA 1KQNA 3EUAA 2DUJA 3PNMA 3I0MA 1V39A 2O1WA 3WK8A 1G38A 4RTLA 4RORA 3R3HA 3TQHA 1W2GA 1UR5A 4Z8XA 2WU0A 3HZRA 4FEAA 3TQOA 4P5EA 1QF6A 5H59A 2SHKA 2HHLA 3DUWA 3OP4A 1E3EA 3A25A 3IQZA 1JS1X 3GLGB 4A10A 4KJZA 3KKPA 2FPLA 3JWGA 3RTGA 3IHTA 5DE3A 3Q3HA 3I04A 4J0CA 5AJVB 4HLCA 2Z6QA 3LPLA 3MWDB 4R9VA 1ZMTA 4E7PA 3QSYA 1C4KA 2B8WA 3V32A 4DCJA 1MOQA 3R1IA 4OSOA 1ONNA 1XDWA 1H2WA 2G06A 4YJ3A 2CUZA 4GE0A 3M4YA 2NPFA 2FHPA 3OD5A 1J2RA 4TX1A 5JQGA 2MSWA 5KSYA 4JR2A 2FMIA 1KEEA 3R7AA 1QQ7A 2A30A 4BXOA 1UAGA 1WPRA 2OCKA 5KJ6A 1PAUA 4Z5XA 4BBJA 1N2EA 3OM9A 6GPBA 1E3SA 4F04A 4GPIB 4TMTA 2X41A 2HMVA 5C52B 4G36A 1Y8ZA 4PM4A 1XTKA 2PL1A 3DE3X 3P0IA 4YJGA 1VKZA 4ZAXA 1Z7WA 4M7OA 3STVA 2A8YA 3I9FA 3COWA 1YRQA 3ZPXA 5JC8A 3Q0IA 2PRZA 2NG1A 2QENA 2C7BA 1E9VA 1HDIA 2O2YA 1LS1A 2ZSIA 2CEAA 2CDNA 3F5SA 3OO0A 5EZYA 2QS9A 4H27A 4DJFC 3KB1A 1XCLA 2QXTA 3M6WA 4RD6A 1WDMA 2JVIA 1B0ZA 3TLGA 1CZRA 5FUBA 3DWFA 1AUVA 4KXQA 1FP1D 5BMOA 3U6BA 2XB8A 2XV1A 3HKCB 1H3NA 4YR7A 5BSHA 3QMMA 1OXUA 1TPYA 3PC2A 4QBTA 3VOTA 5LXTA 3B7PA 2QTCA 3HJUA 3SXUA 2OYCA 4NU5A 3RHSA 3P9CA 1E3DA 2C2XA 1EVJA 3IUQA 5CJPA 2ZITA 1NZFA 1Y5IA 4MR9B 1KZ9A 2G9UA 2PO7A 3VZRA 2QZ9A 2HA4A 3CFYA 5L9AA 5KTYA 1LLFA 3RV3A 3TOVA 1QRTA 1K8QA 1MDFA 4M2LA 1RLMA 1R18A 2OQIA 1KSFX 4A03A 4DLKA 5GIPE 4K28A 3RT1A 2O8BB 3NX4A 1WCWA 2CXUA 3Q9UA 2QP9X 2IYNA 4JP5A 4ZO9A 4DG8A 3PICA 4W6QA 5KOHA 1EP9A 4LXUA 4KHZA 2D5IA 2A57A 3QKWA 4I0WB 4LV8B 1H85A 1KHTA 2VA9A 1GZ4A 2MMGA 3FN4A 3HRHA 4I3FA 4JJ6A 1KZ4A 5DLEA 5CM8B 3G9QA 3RSOA 4TN5A 3EXHA 4BN5A 4PHGA 4HDRA 2X4LA 3PNPA 1OWPA 3L8CA 3S55A 1KMNA 4TZKA 1U7UA 4RD1A 4BE7B 3D0KA 4R5MA 4M1KA 4X44A 2NSYA 1QU3A 1XNRB 4M46A 3M1IA 4P3NA 1YOBA 3QSGA 2JFFA 3MWGA 2D1TA 1K68A 1TIBA 2YDYA 1FXWF 3EF0A 1TRKA 3H1AA 4XUCA 4QG3A 2B98A 2HSDA 4C1BA 5JNUA 2QYHA 1ICIA 4DR6B 3ANMA 4I1YA 3DZBA 3U7HB 4P54A 1NY6A 1UPBA 2F9LA 4JYAB 4WRRA 2ZWPA 3X1WA 2EJWA 3JQCA 1Q50A 1CG6A 3I3OA 3V7WA 1YE3A 3VZBA 5G3YA 5G40A 4F5DA 3GRUA 5HZGA 4EUKA 2ZVDA 4JUFA 9MHTA 3RRJA 2XF2A 3FTPA 3ET5A 1WU7A 4QASA 1BX0A 3KB2A 4IXTA 1UPCA 4HX5A 4KQ9A 2GZ3A 1R6DA 1XXHB 2J3LA 4FOSA 1RRGA 4G1BA 1NSYA 4RPKA 3SHFA 4EECA 1JX6A 4GDFA 4QU9A 5HS4A 1JFRA 2YRWA 1ENPA 2I3AA 1TDJA 1EUQA 1T6NA 1EPUA 1OLSA 2QLFA 1BMDA 1X1CA 2QU8A 3M89A 3MTQA 2PUFA 3GCZA 3SM3A 4URUR 2YQ5A 2DTDA 2QJWA 1VBMA 1Z5UA 3CPSA 3DKVA 1R0CA 4GLLA 4XGNA 4YAWA 4CT5A 1JIVA 2JGJA 4MGHA 3KLNA 4NQZA 1U3UA 3KZMA 3DD1A 1WB6A 4TMYA 4A73A 3EFBA 4EG1A 2WU4A 1Y7LA 2VQ3A 1T8UA 2A86A 2ECQA 3S28A 1FW6A 1QWOA 1T4CB 4BKQA 2VHJA 1A1VA 2COUA 1QFXA 2QUHA 1XZGA 3P9SA 2AVDA 4JP3A 1M2GA 2EZ4A 3GA7A 4TXJA 5KTSA 3OQNA 4WNCA 1PJBA 4QUAA 4EGQA 1KK1A 2QTAA 4Q66C 2JL1A 1XZHA 3WLKX 4RO0A 1EDZA 1NKTA 4EKNB 5KVCA 4D92A 1GGFA 1NUAA 5AW2A 4UNQA 3BE4A 3G9TA 4EFMA 2BFCB 3VYVA 4AIRA 1XQVA 1WUKS 3RVJA 3L4BA 1SGWA 3GRCA 1NW4A 1QHHB 4N47A 4P4NA 3UATA 3T8YA 3U3ZA 2X1MA 1XX6A 3RHFA 4AJNA 1WUJS 4OM8A 4Q7EA 2YV2A 1LK5A 1RXEA 4L9RA 5CIQA 3WAJA 2V4MA 2O2ZA 1SA0A 2VOEA 1WDLA 4MVYA 1DQSA 2BZ1A 3PRJA 3PQ2A 4OREX 4BL5A 2QE7D 1AK2A 3COYA 3I73A 1JKXA 1I2DA 3L0DA 2NV6A 4K40A 3TZCA 2HOQA 3CU5A 5EP4A 3TNFA 3E6AA 5FL7D 1ZKDA 4Q1DA 2IZZA 2PRSA 4KMSA 1HORA 1SUAA 3WISA 4UNSA 1QGYA 1ADGA 4M0EA 4AP9A 4BUJA 5KWEA 3OC6A 5L3QA 3FBWA 1VI2A 2VXCA 3OIWA 1M34B 5CFZA 3IKJA 2WWVD 2HXSA 2FPGA 4TM8A 1CD5A 2O9JA 3W1EA 3EX7C 2Z8YA 3CLTD 4B3IA 1UIMA 5M3BA 4OJMX 2ZIZA 2FVYA 2CXQA 4ND4A 5IASA 1NVFA 1T91A 3AZOA 3GOQA 3ZKAA 4A1FA 3ZC3A 2P2CA 1U99A 3PYMA 4MPTA 3ZK8A 2XH8A 3KTAA 2RH8A 3KLPX 4NENB 4I5DA 5AUPB 5LZ9A 3QF7A 5EHNA 4QBKA 3OQOA 3NP9A 3G2IA 3OQ6A 3TI7A 4PFJA 3H9CA 3LHSA 4IZOA 3ADOA 3KHSA 1H2ZA 2BGUA 3PG5A 1HURA 5DVZA 2GCOB 3PNYA 4R9SA 4DPLA 4IIYA 3UC5A 3WK6A 1C80A 2N42A 3PGMA 3OLXA 1G6OA 4DRXB 1OWNA 2H4FA 1UFKA 2JFHA 2Y92A 2ZSUA 3EGIA 4HMQA 1XTJA 1P7WA 1ZICA 4J16A 3I2IA 5LR6A 3LY7A 1UEJA 4MVWA 2GT1A 5FL3A 1TM3E 2AH5A 1MB2A 3THOA 1Y8AA 2X9VA 1EDEA 2NTVA 2QSYA 4Z9FA 7YASA 3K72B 2ZKIA 4BKUA 1FA9A 5DX8A 3D8TA 3PHGA 2WHPA 3E7DA 3G13A 2HRCA 2AFIE 3TR5A 4MYTA 2HJ9A 5F4ZA 3J7AC 3N8NA 2AYYA 4JAVC 1L7QA 1YS6A 2FG5A 3S8EA 3UMYA 4O33A 5DYYA 5IJ9B 1CQIA 1T24A 4AX4A 1LVUA 2RGUA 4OHCA 4BX3A 5BSEA 3KBOA 1O94A 4H3HB 2H3HA 3E22B 5FUXA 3P2OA 1Z06A 2R6AA 5COAA 5L4SA 2VYCA 1KDTA 3FIUA 4ZEXA 3E5MA 3ZU3A 2W2TA 5JIBA 2XWBF 1XCPA 1W0JD 4GNRA 3BDVA 4IEEA 3KUKA 1ODSA 1PL8A 4IZIA 3Q8LA 5HKKD 2B8TA 4E4RA 4ZOCA 3KJXA 5FJIA 1HNXB 3R5JA 3U13A 3KEOA 3PEVA 5TQ2B 3ZCXA 1EQ2A 3BIFA 3NNSA 4PX9A 1JIQA 1NNLA 3A3YA 3MXOA 4JX9A 3LUAA 2CK3D 4IVPA 2PD3A 3B2NA 4OHWA 4Y9TA 3T1NA 1HOTA 4BATA 4EHDA 4LN1A 4FYKA 3EPJA 1L5GB 3ER9A 1G0NA 1R5JA 4OJYA 4E1AA 3DWEX 2QP3A 2B4QA 3WDKA 2CDBA 4EKGA 1ONPA 1US8A 4BKRA 1ADYA 4OATA 4P3YA 4QGAA 2ZRIA 8ABPA 2Z1MA 3DFMA 3UW1A 2J5XA 5D7BA 4CV3A 4JJEA 2BFDA 5GZ6A 2L19A 2PX0A 1L4KA 4O8CA 3FOBA 5FA8A 1E8DA 1P2SA 1Q1AA 5IABA 3I62A 3JPYA 1OFUX 3IXQA 3CVVA 3CUWA 4F8YA 1RLIA 1FUUA 4FD2A 4JLWA 1G19A 1QGUA 4UOQA 4ZVPA 3D31A 1MG5A 5AKZA 4E94A 2Q1WA 5EE3A 1OU4A 4KXYA 1T2NA 1PW7A 1V4VA 4CQLB 4E22A 2RKOA 5HFJA 3U7GA 5F4BA 2IYPA 4FFDA 1A9YA 2E4VA 2I0FA 4UUQA 4GBMA 5EXSA 5BSFA 1NL3A 2PFSA 5FB3A 3T7AA 4I2NA 1E94E 3IOEA 3H11B 2R6FA 4P4UA 2V7UA 5HKOA 4NHEA 4NBRA 5AVZA 1O0SA 1OLXA 1K9VF 4DLYA 4D6YA 4EUFA 5F5LA 1D0VA 1TGYA 2RGYA 1U4OA 2A1TS 3IVMA 1XJCA 4V0LA 1N6NA 4X6XA 3W6UA 2IA5A 4RENA 1SU7A 3GG9A 4JOCA 2P4HX 4Q4AB 4A26A 1U5CA 2JAWA 3FSRA 1R15A 4D26A 1NDHA 3KTOA 4B3CA 1FLDA 3V1YA 2E6KA 2P77A 1EP2B 2X58A 3LYUA 3AP3A 3TE7A 3BGSA 4BX9A 4RE5A 5M34A 1P2GA 2D7DA 2VN8A 3HM2A 1CFZA 1FSGA 3ADBA 3KZCA 4I1PA 2XMZA 3DO6A 2WJ4A 3MSXA 3NWEA 3NIFB 3OOJA 2IHKA 4X6LA 2NNWB 3ZTWA 3AXTA 2A0FA 2DPYA 1BGXT 4EA7A 1U0GA 5KS2A 1ZVVA 5B6IA 3LE8A 1QQBA 3IQFA 4Q3DA 4TSFD 4IEFB 1XAHA 3T94A 3AVQA 4F0JA 4CRWB 1VJGA 4NULA 4IFBA 4PX3A 1EFTA 5AVRA 1FB5A 3DEAA 3AVUA 3RB8A 3VAZA 1JEYA 2I2CA 2FR8A 1ZI6A 1GL3A 3B1VA 1H0KA 3JQFC 3QJ5A 4ALNA 2OC9A 1ADBA 1FNMA 2FN3A 3NHZA 4IQ8A 5F3DA 3D0OA 4DIKA 4PZ9A 2ZCUA 1J8FA 3KQWA 4XFDA 5BWNA 1HV8A 1OXVA 5ALOA 2HU8A 1JLKA 2JBAA 5FR2A 3OKFA 4N12A 1HFJA 4WERA 4JIGA 1FIUA 4KXFB 1YRHA 2GWRA 4L3VA 4EUNA 3OEHA 4N82A 2J9YB 4EA9A 4IPTA 1QRRA 3D81A 3C8UA 1U1EA 3CRW1 3S8MA 3ZJ4A 4CR8A 2DLNA 4HGYA 4AKTA 3TTTA 4O8ZA 5HWSA 1C2YA 1CT9A 3AKYA 2GHTA 2VNHA 2XB9A 4K9KA 1F14A 2NYAA 1N5MA 1Z6TA 2GLTA 1EX9A 4HQFA 4L22A 3LC0A 3IALA 5FR1A 5CNMA 3SLGA 2G9ZA 5BYAA 1YZQA 4ID9A 3ZGOA 3R3UA 2BMAA 4HFRA 4OHRA 1UBEA 1RBZA 3A1NA 4XWOA 5D3MB 3A6GA 3EXAA 5ER9A 4QXQA 4EY4A 1XRLA 3ZE9A 3ZGZA 1VKNA 4D41A 4UEJA 1XLTC 3G9XA 1JFLA 3JQGB 3JD1A 1C7FA 1TU0A 4HWOA 1V11B 1H2AS 4RIIA 5CVJA 5JARA 5F5XA 2G1KA 2CFTA 2ZG6A 2C4HA 2W8ZA 2JHAA 5BN3A 2FRDA 1HG0A 1YZ3A 3GDFA 5JMTA 3TKLA 1PEKE 1YFZA 1VKRA 3NGMA 4QM6A 5MF6A 3ELUA 1YDEA 3LGSA 2X3FA 4I9HA 4EOGA 4Z4IA 1U3TA 1ZCZA 2ZI3A 3V2UA 3WLAA 2FSIA 3PQCA 4F4JA 4WK0B 2ZUSA 1USWA 5HF8A 1L5KA 3RRYA 3INGA 4AY4A 5FUYA 2ODBA 2D4HA 3SC2A 4H4CA 2M1ZA 1D3AA 3EJ6A 3EVTA 1IMOA 1T1GA 2GZMA 3AY6A 2QVGA 3GGPA 3NORA 4FQ5A 4HJRA 2JFZA 4JQSA 4BVBA 4DSUA 4M6WB 5K0TA 4KXXA 1GAJA 1PT5A 1EESA 3LA8A 4C5BA 1S0UA 4RV5A 2XA9A 3L49A 3QU9A 1USUA 5DF1A 5IJAA 3V4FA 1P33A 4RK1A 3NDBB 3FCXA 3Q3JB 3QELA 3T1OA 4A3SA 1XCGB 5JZVA 2WJZB 1KYIA 5CM9C 4BMCA 1PEYA 3LL4A 4D81A 4E5YA 4Y2QA 2QL7A 4B84A 1PNTA 4ON9A 4C4AA 1EJ6A 4TS9A 4QYIA 4DUPA 1PP4A 4IOMA 2FEPA 1JDUA 3IUBA 5D86A 1SIUA 3IDQA 5A03A 1BIFA 3LK7A 4UZEA 4EB0A 3HSSA 3PA8A 3WO1A 4F6RB 1XTQA 5LA6B 3SR0A 1NNEA 3GP5A 2Q5QA 3ACCA 1ZU4A 2IW1A 2GDZA 1BQ3A 4XIGS 1H22A 5B3AA 4HN9A 2WW8A 1JSXA 3HL0A 1J33A 2Q0HA 3HYTA 4CJXA 3NVDA 2FF5A 4MUNA 2C2ZA 1CX9B 3A3NA 4Y9SA 4ZKDA 3AF5A 4HDKA 5ITZA 2BF4A 3HZHA 4QE3A 3DDWA 1NJGA 1ICEA 2XDAA 2GLXA 2RBGA 1K89A 3A9UA 3HB0A 1TC2A 1F3LA 3RJ9A 3VR4H 4AJJA 4CR7A 1U7XA 3HFJA 1NMYA 3OE1A 4BMNA 2C5SA 2ZXFA 3T7EA 1YHZA 5JAUA 1PUJA 2WYIA 4R3NA 2J4DA 3W7VA 4LC0A 4B09A 4D97A 5B7QA 3UWSA 3CNEA 2IT1A 3ZGYA 5FAKA 4FLMA 1ZN7A 4RLFA 4IV0A 1J1ZA 5BOVA 3U3XA 4R51A 1U8ZA 1RYZA 3IX7A 1NC1A 1N9GA 4FNAA 2G7ZA 4XJTA 4NU8X 1RAIA 1XTIA 5CA0A 3SQLA 1COZA 5BUSA 4EZIA 4Q12A 2OWDA 2R68A 1THGA 3RE1A 4H7EA 4K05A 1WXEA 2QAIA 2LWIA 4PLFA 2CXSA 3L05A 5A5EA 1DGQA 1RJ9A 5K0JA 1GAXA 1POXA 3OZWA 4Y6LA 1N3YA 3DKIA 4YT8A 3LVQE 3QX8A 4DPKA 1J8QA 1N9ZA 2PX3A 2QD4A 3F6EX 4WADA 5HSGA 5IAEA 2W2LA 4ZDWA 3MS7A 2R2AA 4B6FA 1RXYA 1Z37A 1ZK3A 3B38A 2PUGA 4MDEA 4M9XA 2RCNA 3A7EA 1M6WA 2CXNA 3GJ3A 4E51A 5CB4B 3EGXA 4TLLB 4UFOA 3O4GA 2OXTA 3VU0A 4EG8A 4J0EA 2FLWA 1LVHA 1HFKA 1B3BA 3SC4A 3VNSA 2JJMA 1JEEA 3GRKA 3O8LA 5F2OA 5AJUA 5E6SB 2RIPA 4BB0A 4R71A 5B1EA 4LDJA 2H8GA 3NO4A 2EARA 2JLBA 3HB5X 4WZAA 3EPRA 1YZGA 2OBYA 1DLJA 1GG2A 1L5VA 1VGRA 2W6ZA 4TL9A 5C1DA 1R00A 1IXYA 1J20A 3PIRA 4NCAA 1TEXA 1VL2A 4O02B 3G1UA 4FOTA 1EVKA 1SK8A 2ODAA 3D1VA 4WX2B 3TCNA 2X8JA 5IDYA 3ZY3A 4CMIA 3RK4A 2B2XA 2GYUA 3ODGA 1N8SA 2ZVPX 4BS9A 3ZU6A 1DQZA 2AX4A 4G2NA 5DGHA 3RUIA 1ZJ4A 5CK5A 2RHOA 2HL6A 5EE1A 2VAWA 2O8EB 4HDSB 4DLNA 1CEQA 3LL7A 3M1YA 4RA9B 5AKJA 3RIEA 1H4SA 4TKMA 3V2GA 4UPDA 4MQ6A 3DW3X 3L6RA 2FZLA 3WNCA 1LFDB 1LX6A 3V46A 1LDYA 2C8LA 4BEWA 2BEKA 2BTOA 3O03A 3C3BA 4CNQA 3Q3VA 2GN6A 1E4YA 1UZMA 1X80B 2W6CX 4Z99A 2VK8A 4M8LA 1TE2A 2B78A 2PMKA 2A0YA 1W44A 2QTTA 2Z0MA 3ORHA 8ATCA 2CNKA 1N7HA 1GCUA 2QRMA 3IBGA 1L7RA 4FW8A 4OHBA 3DMNA 4OP1A 5ALQA 3L1JA 4Y1RA 5AVKA 5JPDA 3GLGA 4UVEA 4JC5A 4OHVA 4Z6KA 3UTDA 3VH2A 3G2KA 1CRZA 2JRLA 3H3XA 2RK4A 1SXJE 1DRUA 3R0IA 3IT0A 1ENOA 3M3HA 3ENZA 3MWDA 1J39A 1KS2A 4KE6A 4TT3D 2J3QA 3LC2O 7MDHA 4V1CA 1HRDA 1YRWA 1NYTA 3HU5A 4NFSA 4BLWA 5DHQA 4WY8A 1A95A 4CEJB 3FYUC 4FOPA 5LP6F 3EAFA 3CY6A 4KWEA 2V7QD 2HSZA 5B1SA 3E9NA 3KAKA 3RSLA 4IXMA 2A3NA 3OICA 4JBGA 1XZEA 1LSSA 5FTJA 2VP6A 3ZZ0A 4ETMA 1WSBA 1ZK1A 3HCNA 4EUEA 1MT0A 3MB8A 3ROXA 5B1YA 1Z17A 3OJEA 2D13A 2YJGA 5ALJA 1YC2A 1NXSA 4Y0VA 2HH9A 4BTVA 3UGJA 1PZMA 4EBBA 2OMEA 3TJRA 4F4DA 4XKJA 2QPOA 2IYSA 4EA8A 1Z0ZA 1NULA 2GVDC 1RKBA 1Q84A 3CEJA 1W36B 2F1JA 4B73A 1WHSB 4BAUA 4DCSA 2OMKA 1KS9A 4B81A 1W9HA 1IM5A 2OCIA 3LLMA 3NP7A 1ATZA 1SHUX 2PTHA 4RS3A 4HB0A 5ITSA 5FBVB 2VTKA 4ESHA 1D04A 2Q3BA 4EG5A 1BDIA 2HJGA 1H2YA 2FWJA 3DFIA 3KQKA 3G02A 4FWIB 1RJFA 2PJDA 2ZIWB 3PSHA 4J6EA 4G5RA 3SWWA 1HTTA 1XA0A 4G8BA 3U49A 2XHEA 3JVUA 2RJNA 4FEGA 5KOYA 4RK7A 1LQTA 5ESXA 5I8WA 4G5GA 1QFSA 3ZV3A 1G9TA 2AC4A 2PS0A 3LOPA 4ILEA 4M1WA 4LVCA 3TG8A 2HW8A 2WE8A 5LQNA 1BO6A 4UBOA 1NVUQ 1Z0KA 3BJRA 3HKDA 1N4DA 4ENRA 3RF7A 1GZ7A 1C7QA 6LDHA 4C7XA 4OPMA 3BWXA 1PYGA 3GDOA 2AMVA 4JJ7A 2C20A 1QHSA 3O95A 4RHUA 1OTXA 5F3RA 4N18A 2JASA 4ESVA 3OEEA 4CN8A 1A4RA 2NUPA 3OJCA 5CR9A 5TQVA 4H18A 3V80A 4NV3A 1RPNA 3D4IA 1M7HA 4XSHA 4PONA 1GG9A 1WTCA 3QLVA 1ECFA 2WP8J 4MRNA 4WPGA 3U26A 1IJEA 3CNQS 3DPSA 5KQPA 2PKYX 2EJUA 2IX3A 3U19A 3KR9A 1D6JA 3QVVA 1NW6A 5IEJA 2FVXA 4L78A 2C7VA 1SN7A 2BT4A 5K8UA 1ZH4A 5A4IS 5DIFA 1C8KA 2CNBA 2YJNA 1QJCA 1S8OA 1ULTA 4X97A 1KVQA 4YQYA 2WWYA 1E2BA 2IS4A 1NUHA 1KEKA 3FSEA 4PBSA 4MQBA 4QRIA 2JC3A 2QORA 2IOHA 3AR5A 4I66A 2XKBA 4L57A 5ICSA 4Z3OA 3L7JA 4MPDA 5CURA 4V0QA 3TGLA 3PNLA 1JI3A 3CX4A 1NUQA 1W4BA 3AM5A 3CW9A 3HV2A 3M9XA 3P2EA 4MK4A 3U3KA 4GOND 2XUAA 1IHXA 3ZYZA 3U5TA 1LDNA 2QX6A 4OLAA 1E0AA 1WB5A 4CMJA 1UH5A 1QNLA 4R1MA 3TB6A 4G25A 5HIJA 4AJPA 4D9FA 3IQIX 1AHNA 3H6HA 4OQXA 4BO9A 1KH1A 1QKJA 3A14A 3WZMA 3AR9A 5B53A 1U1CA 1CC1S 2F1RA 3PHCA 2HWKA 3DBLA 1V8DA 3LFHA 2HQBA 1EJ2A 4MP8A 4RHCA 4D42A 4PQRA 4Y98A 5IZ4A 2QN7A 1N6HA 4U2CA 3M2TA 3PHLA 1QH8B 3W3AH 2HQSA 3D0QA 4AROA 1L8QA 1G21B 3FPEA 1TUEA 1C0PA 1RWMA 1Z8FA 2Y67A 4B3MB 2D62A 5CB6A 3LP6A 3ZX4A 3LKVA 1WUHS 5KPJA 3ZUPA 5CB4F 3RC9A 3LT1A 4HNQA 4ENWA 2RD2A 1IL0A 1JJVA 1SHZA 1USIA 4G86A 4O1HA 2GZHA 4GGPA 2G9VA 4GL4A 1W5BA 3S8YA 4ALKA 4YV1A 1D8TA 2AZTA 1MJFA 1Q0RA 3DM9B 3IEXA 4L9AA 5IM5A 3CPEA 4GMDA 3ROMA 2ZJOA 3DAOA 2P6RA 3H6KA 1EFAA 2HPVA 3IOMA 2BFMA 4V0SA 2J67A 5F2KA 3K9QO 3F9IA 1VL1A 3OHSX 4J7UA 3QEAZ 3GH3A 2VSQA 3VMMA 1AGRA 1E62A 4ZYYA 3TFWA 1K06A 1MB4A 1U2EA 2ZTVA 4P98A 4ROTA 1L4LA 2B34A 4JQCA 4FZ5A 4KAFA 2ATCA 4YRCA 3SMQA 2EJBA 3BF7A 4PZEA 1P5JA 3PEWA 4CF4A 1E7MA 1QHHA 2VBGA 2CYAA 5LZ4A 3AVOA 1PZHA 1KJ9A 3VC2A 4QJ3A 4QDKA 3KXDA 2OKCA 5G4KA 3FZYA 2ORVA 4EY3A 2G83A 3I9V6 4FQ8A 1KPHA 2V45A 5AVTA 3JAMA 3O38A 3EPKA 4ER7A 3U7RA 5A0TA 5DNDA 2IQ5A 4YRGA 4Q3EA 1GFWA 1Z0UA 2VVTA 5CPFA 2ZTMA 3BGIA 2P4EA 1D9XA 3DE4X 4EFLA 4TYWA 5IT9A 1GRQA 2GZ2A 1HQKA 2GJAA 1NYRA 5EP1A 3THXB 4L9SA 4UU0A 4GKVA 2IQIA 3NTOA 1OW3B 3DE2X 1PZFA 5EJAA 5EI5A 4MGKR 3AJDA 3BIJA 3I2HA 4MUAA 3HU3A 3I9JA 5TMDA 3UPTA 4F7WA 3AR7A 1G63A 1GQOA 2H2WA 3WLQA 3FDXA 3U7QB 3K8OE 5AKLA 3PFKA 4K9PA 1NASA 1KJQA 3GF4A 3Q8WA 5DX1A 5FDFA 5IT0A 4BGDA 1KI7A 1AA9A 1BJRE 3KJFA 3OZGA 4NENA 2C5BA 2O52A 1PLKA 2EFHB 4FLEA 3W6OA 3BZBA 3WGLA 4R9NA 2ZULA 3PL1A 3N5KA 4MCHA 4TQUS 2I6SA 3TQSA 2ZZNA 3QPBA 1XQXA 3JVIA 2ZUCA 4GGOA 5TY0A 2FEWB 3WMGA 1TW2A 3GLRA 1IN7A 3HP4A 4U7WA 4DRXA 1SB9A 4OFWA 3R6WA 3L8EA 1YNSA 3O4VA 3QH4A 4KLNA 3U2QA 2CE7A 2RARA 4C6SA 1PWEA 1JRLA 1OI2A 2G28A 2QAGB 2H65A 3SCZA 3E0XA 3RJTA 4MWOA 1QVWA 4YAOA 2FZ4A 1UT6A 3AKDA 1HDOA 2QRNA 1J0BA 3DBRB 4ZAWA 4LZOA 1APBA 1VRCA 1FJGB 3ER6A 3G5TA 2IIBA 3VC3A 3KS9A 3I30X 3K5IA 3UHAA 3HY6A 4NBLA 4I1SA 5A6SB 4KPEC 1VSVA 1P0QA 2X8LA 4FYXA 1ODTC 2NXNA 4HOYA 1KI9A 2GEVA 2GOYA 3E22A 3FVTA 4ZYWA 4FXOA 5H02A 3RTAA 4E5SA 1KSGA 1DAEA 2Q5LA 3EQ7A 4RZQA 2O7SA 2J1LA 5EP2A 1QUEA 1T9ZA 3DF9A 9ATCA 1A2OA 1R0XA 4U5XA 1YUMA 1Z4JA 3OKCA 1L5HB 3SX2A 4DQKA 2WBLC 2VNIA 3HCDA 3LSYA 2VAMA 2VDOB 5E7IA 3EBLA 4E5MA 1QG2A 4QYXA 3OZBA 3WYNA 4C2UA 2KBFA 4EUSA 2H0QA 2JIPA 5TQ2A 2GO1A 1X38A 3VM6A 4P7FA 3DOUA 1LCIA 2ZDHA 3LCCA 2QX7A 4M87A 4NMHA 4UAVA 2J0SA 2DFLA 3BORA 4Q4JA 1E1NA 2R1ZA 1NXVA 3TLEA 2VHWA 3ZVKA 1O6GA 2XYGA 3BDAA 4WDQA 3N2GB 2ET6A 1D1TA 1SXHA 2CDRA 4P53A 2JD2A 2RONA 1XCJA 5L4NA 4QU5A 3NWOA 5KTMA 1QMPA 3KSDO 1KQPA 4OQPA 4WNAA 4WZAE 4KW7A 5EVJA 1T3ZA 5C0OE 4DCVA 4YACA 1GTL1 2OCYC 1DTSA 2PX8A 3GHHA 4OGLA 3MIIA 1VTKA 4OMDA 4JDPA 5BWLA 4PYIA 4NJOA 5HE9A 4B80A 5IJ0A 2QT0A 3ES9A 3D6FA 1NZDA 2VATA 2HA6A 3OPYB 4B7CA 1E66A 3SEAA 4UUOA 2PWBA 1X1DA 4YCAA 1PFKA 3TPCA 4NECA 3C8ZA 3IOYA 4BE9A 4YMVA 3GB9A 2F55A 5GONB 1D1QA 1PTJC 2QX8A 2FPKA 3X2SA 4A92A 4TWRA 1SXQA 2MTBA 4DVJA 3V8MA 1FDWA 3HGQA 3TQRA 1PFYA 2H4XA 1JDVA 5IUJC 3A4TA 3IILA 3IPRA 1CVRA 3NYQA 3OLQA 3F7TA 2PPVA 2Q3MA 4HWPA 3V97A 1T0HB 4BU0A 1OH7A 1W2HA 1KR5A 4ZO8A 1D2MA 3V1UA 1UBLS 3DDUA 4JL8A 1HM5A 3GMDA 4Q4AA 4RCZA 4WZ6A 4D3SA 2HADA 4HI0E 4LSZA 4H1HA 3ETEA 1FZTA 2ALJA 3PENA 3QGMA 2GBLC 3DBIA 3LUBA 4WSOA 3MF4A 3HBJA 3KP1A 5DW3A 2Q27A 3DC2A 1QM5A 2I2WA 3DKRA 2P79A 3FOCA 2B2CA 3F96A 3UJ8A 3ONNA 3CIFA 3FI0A 4V0ME 2WF8A 1TYAE 1QDEA 1UXHA 2JARA 2PD4A 4EITA 2CV2A 4WJKB 3R44A 2I55A 3K20A 1V9LA 5DT2A 2J3JA 4OI1A 1WLSA 1FFXB 2DB3A 2LTAA 1WOYA 1Z68A 2Q9AA 3NAZA 4HH4A 1VBKA 4H0FA 4RIEA 3HR8A 4JCCA 1AUQA 1VLVA 3WKDA 1IB0A 2R1UA 5D85A 3CLUD 3AOEA 1E2KA 1VP3A 2VXOA 3P8ZA 3U7JA 5KQGA 5EPOA 3O4JA 4X3OA 1T0UA 3SP1A 1V4NA 5IF9A 5EFOA 1CLEA 2F3SA 4I36A 1PJSA 1W0CA 3H0EA 2W42A 1DEOA 1QXSA 2WZDA 2OOSA 3CSDA 1QC5B 3R7BA 4QPNA 4FKZA 2HDHA 4QYSA 3LC1O 4HYTA 2QEQA 3CH6A 5AI0A 3L01A 4EB8A 2XOEA 3UMSA 2P6PA 3TQFA 2Z8ZA 3C87A 4ZYUA 4B43A 1SCKA 3B85A 4IV8A 1ZK4A 3UA4A 2A9RA 1E5TA 2Y9MB 1JU3A 1UT5A 1H8HD 1U6JA 3CC8A 2BE9A 2IXTA 5ECDA 4MROA 3ZHCA 4E11A 3MJDA 4II2A 3FCUB 1DAHA 4IFTA 4ZT7A 4UZFA 3LZ6A 3S7ZA 3TDKA 1WY5A 4CQJA 4DCCA 5IFLA 4BMYA 1OX5A 2DPGA 3F6SA 1E5QA 5JQWA 2AXPA 3OTOB 5CDHA 3NYIA 4G84A 1MGOA 3NJ8A 4M21A 5PGMA 1OZGA 3NRBA 1MVOA 2HI0A 4LRUA 3EQ9A 1KNXA 3O84A 1BH6A 5CG2A 2B9EA 2XZTA 3KYBA 4I4TF 2J3MA 2DHDA 1NBMA 2PX4A 5J1TB 2QI9C 1IEXA 5E1BA 1NDQA 3G2NA 1YZLA 1ZN2A 5A9SB 2AZMA 3QVTA 3H8JA 1V11A 1XNGA 5IKPA 4YP0A 3VO8A 2P2YA 4TV8F 2I5PO 1XZJA 2PQ6A 4PNPA 4CT4B 5ADUS 3L5KA 3W9YA 1P0PA 2Q9BA 5DTRA 4DSNA 2ZI6A 4Y9RA 3OZCA 4O4LA 2CGEA 2JANA 2R9VA 2BDTA 3V1NA 2FNAA 3RIXA 1EFUA 3ZK9A 2WJVA 1C8LA 1GL7A 1GPUA 4ONEA 3D0RA 3A4NA 4QOFA 5J2TB 1RR6A 1TQ4A 2IVZA 4G5QA 1EXMA 2J41A 3CX6A 3ELDA 2BGJA 2VYVD 4HFMA 4TLBA 4EGSA 3RC3A 2FP3A 2DH6A 3GLHA 2RHHA 3TFOA 4D0NA 5FTNA 2GA8A 1XKLA 3LBYA 4LGYA 1TKCA 3U80A 4M6WA 3R7FA 2FUNB 5AHOA 3WS7A 2WTXA 3BA6A 3HBAA 3ZJ5A 4DMRA 3NBQA 1KVUA 2Z5VA 5CPBA 3F9RA 5KOJB 1PGOA 3U1BA 1GGHA 1QTIA 1LS6A 2A1TR 3STUA 4FDTA 4FFBB 4QOGA 2B1QA 3TQIA 4RVDA 3L7IA 2P9HA 1XXHE 4DBZA 1YR1A 5LMCA 2AV6A 4URVR 2UYCA 3DTTA 2PNFA 2CUTA 4BV3A 1OFGA 3H5OA 3KHTA 1CTQA 3GROA 4L4YA 4LW8A 4E5NA 1OTYA 3FNRA 2VT3A 4XUGB 5BOSA 5KJCA 2ODQA 2NAPA 4CLRB 3QWBA 2XE6A 3DL7A 5LA6A 3WWPA 4F6RA 4WLVA 4DCOA 4JI4B 3BGDA 2OG2A 3F67A 4W63A 1UJ2A 2AG5A 1OBVA 3CBQA 5U4QA 3N28A 3FTFA 2FPUA 3A1WA 4PPGA 2CWDA 2BFNA 4XE5A 3B7WA 3CLSC 4FHGA 2BUAA 2IP1A 3CUVA 4R2HA 2XQFA 1KWKA 1SVIA 3UAGA 1PZEA 3IAM1 1N2ZA 2Z9DA 2DBRA 4WJZA 1IULA 4MPPA 4I1UA 1JZQA 3WV4A 1PNRA 2AYZA 2D0OB 1NLMA 2DULA 1ULSA 2A88A 3CKKA 1EHIA 2FQQA 4P4SB 3D6HA 4BZQA 3WLFA 1Q3KA 1C4WA 1KSJA 4X6YA 3IDAA 4BLQA 1YB7A 2HK7A 1ZH0A 4WKGA 3KQLA 3DE1X 1B43A 5K20A 1GGKA 2HHAA 3G89A 4S2EA 5LZ7A 1BDJA 4C89A 1ZOLA 5FRDA 4PC3A 4DIBA 4H0CA 1UKZA 1N5RA 3A6EA 1NFQA 5GONF 1KDVA 4YMHA 2P6OA 4LF7B 2BHSA 1RHQA 1SUSA 3HHEA 3I0NA 1SM4A 4GMFA 4HVTA 1IBMB 3FD8A 5BNTA 1E92A 1Z2DA 2EFDB 2OXFA 5CVDA 4FFMA 3EBOA 3QYFA 4FB4A 1HDXA 2QM3A 4M1TA 5HPYB 3FCOA 3OM1A 3OLVA 3VR5A 3KQTA 4OI0A 2MSEB 1O2DA 3BMCB 3DT9A 4C04A 2ENUA 3VU8A 3E9EA 1M34E 4HT3B 5DTQA 3IQGX 5E1DA 1JHYA 1HQYE 2HNKA 2RBKA 1YB1A 2FSFA 2YNMA 3ABZA 3BM5A 3GEIA 4PLYA 4YK7A 4Z8YA 5KYUA 1P1FA 1CIJA 1U1GA 2AE1A 2IPMA 3CZPA 4GZ5A 3HJAA 2P4UA 4O1MA 1X15A 2ZTUA 3ZXXA 4BTEA 1NU8A 4DCTA 2E5WA 3NWJA 2QRVB 1YBMA 5KHLB 1XZDA 3F5QA 2YN0A 3C1AA 2ZUFA 4E70A 2W48A 4PSUA 1HGXA 2C1XA 3NKFA 1E2GA 3CNNA 1YXMA 2RHWA 2C97A 1C1DB 3FVVA 1E6LA 3GRAA 3HLTA 4FNMA 2W2KA 2GSDA 1ZYUA 3MMSA 1ZJZA 4HDSA 3ECAA 4U2BA 1MAVA 1ONSA 2O0MA 1CYEA 3WSWA 3I6MA 4L7QA 5A04A 5E6UB 2MIIA 3IESA 4D8XA 1XXLA 2GZSA 2WSBA 2RAUA 4TS4A 2W2QA 4JL5A 4HTAA 5A9TA 4B0OA 3AUJB 2WIKA 1S89A 3A11A 4K46A 4ACAA 7MHTA 1RQ7A 1Q20A 3ABOB 4P35A 3KWLA 4KUGA 3G9UA 2NZJA 4GXRA 1FOEB 1FP2A 2JJ2A 3COSA 2WPDD 4KIGA 2XMBA 4IMRA 3FUCA 1UDBA 3PDJA 2ZRQA 3AJ9A 4FHZA 3MWKA 4LTNA 1L4UA 2DQZA 4QU8A 4X8MA 4DREA 3V1TC 3A06A 4D9NA 2D7JA 3QIAA 1OAOC 4QNNA 1IWPB 2MSLA 2WE7A 1A8QA 4G8JA 3EZGA 3ZIDA 2ANCA 1AF4A 3HB1A 3OCCA 1Z6YA 3WIOA 1NBOA 2Q6KA 3MCTA 4KN5A 2DHQA 4CEJA 2ZRMA 2WQ6A 4L85A 4FHCA 3R7SA 3PI7A 4TS3A 2VDJA 2H5EA 1VSTA 3H9JA 4J6FA 5KTNA 4XYGA 3RC2A 3V48A 5HJ5A 4NR0A 1JQLB 3DYVA 1SOMA 5K0EA 3NC1C 3NDRA 4FE4A 4GXNA 4I6EA 1NMEA 1TUBB 2PH3A 5K5EA 3H75A 2WJWA 5H3LA 5ECYA 3ZZUA 1JHQA 4DLBA 2HBZA 5AD1A 5EJFA 1G66A 1GVNB 3G5UA 4GSYA 1RWVA 2Y0BA 4TMVA 2B3TA 4YP7A 1ZUD1 2J9FB 4B6JA 4W5QA 3TW0A 3I1JA 4JLNA 3UWDA 1E89A 2XE7A 4LJ4A 3RK0A 2HU5A 1OFHA 1CF9A 1ZQ9A 1PQYA 1RNLA 4ZD6A 3I4CA 4IF6A 1OKKA 3LYHA 4DDKA 1SWVA 2PZ8A 3HV0A 5IAJA 4MWTA 2PCJA 4A2PA 1JPJA 4LJAA 1S2IA 5AM4A 3K9HA 4BC0A 3UWMA 2OAQ1 3WWOA 1U8XX 5J2TF 4TVOA 3B6MA 3QG5A 1TD9A 3TXAA 4UVHA 1GN8A 5FXMA 3P9XA 4G5XA 4TSKA 4L0MA 1J5EB 4WECA 4FFRA 1YB5A 2WP0A 2P3LA 4O2BB 3UCEA 1ZCFA 2UYHA 5K3FB 2FPMA 4YCSA 3WGYA 1W34A 2P9QA 2EWVA 4YYEA 3HCBA 3R0ZA 4GWGA 4Y3UA 3ZZTA 1FFAA 1ANKA 2J0UA 1ZUIA 1UP7A 2RHLA 3F6PA 4AIIA 1EK0A 2ZS8A 4BMZA 4L08A 5A71A 3H17A 3DBOB 3A4VA 4LXIA 4QVGA 3MRTA 1PWXA 2AFVA 3WYFA 1P2FA 3JVDA 1UBMS 1A9XB 4P4LA 3PVSA 1Q1BA 3ILSA 5JWHA 5A2QA 2AKEA 2XQIA 3KPVA 3QX9A 3ILXA 5KO2A 2XLCA 4HEJA 3AINA 4UHEA 1R4NB 1A8IA 3V42A 3QVUA 4TLMB 2BIFA 3LZCA 1MX1A 1LX7A 3K9CA 1NP7A 1CR1A 4Z2YA 5EQTA 1CPYA 2PPLA 1Q7GA 4RZUA 1A27A 3D8SA 3IOBA 4BV9A 5FOVA 1TA9A 2GF0A 4OOFA 2VSFA 5FOQA 2L18A 1HNNA 1QVRA 2XECA 2VH5R 3FMVA 3PGA1 4YEDA 4UMVA 2GEFA 4J94A 4P93A 4JXZA 1K63A 3LQ1A 3LXXA 5TXGA 2I1QA 1GO2A 5DM2A 3ZCUA 1LXCA 3ZR4B 1GQFA 3JTEA 2QLBA 2I91A 2ZQ5A 2DFNA 4I1VA 4MEJA 2OFOA 1UBKS 4B7ZA 5F51A 4UQOA 2BBTA 3GA5A 1V7ZA 3I2JA 1G0OA 3TLAA 4FKMA 1UK7A 1USGA 1A9PA 4W4TA 4G4IA 5IN4A 4DL9A 3RNLA 5DX0A 3ESZA 3HVKA 4Q1AA 4ZRNA 4ECAA 5AW6A 3GT3A 2MYNA 4GP7A 3N7TA 4I19A 1WDKA 5C8XA 2ZEJA 3G23A 1SXPA 1JYFA 3RJZA 4YCLA 5KTPA 3QLEA 1QH8A 3CEHA 3G79A 6REQA 1H4QA 2XE8A 1HZZA 2XUPA 3OWXA 4WCVA 1XUOA 1G21A 1WSWA 4YJFB 3UCXA 1N32B 3NBFA 1GPKA 1FP7A 4JKOA 5GP1A 2EAUA 4XCQA 2VYNA 3RYFB 5DN9A 1UKBA 3BC1A 2HWXA 4UMFA 4NK4A 2PAAA 3TCXB 4NICA 4P9NA 2CLMB 4H9GA 4O2AB 3TZKA 3VR0A 1V3VA 4JGIA 3GZNA 4XSVA 4JUAA 3W0LB 5K6TA 3KVNA 2PUCA 3ZEIA 3OIYA 1G16A 5L95A 1G3QA 1OROA 4X61A 1EFLA 3EZNA 2AIRA 2H1LA 5IAAA 2LE0A 3C8HA 3EZFA 2V6BA 3IUSA 3D59A 1XTVA 3SSAA 2EF0A 2OAEA 3GPBA 4M37A 5C5DA 5DHFA 5FH9A 1Z4IA 1V0JA 3AB8A 4RZXA 4X00A 5E2AA 4ALMA 1OYWA 1QQAA 1HL3A 1DZIA 2GD0A 1NBME 5TGZA 1YB4A 1TJPB 2IUSA 5CDTA 5JDCA 4JITA 1ORTA 3DC7A 4FC7A 2MR5A 4OQMA 1T9DA 1TO6A 1MXFA 1PR3A 1T2EA 2DQ4A 4JK3A 1ISIA 2POCA 3VGJA 4CIDA 1JVBA 1WM1A 2DR0A 3O1JC 3UG7A 1Q0UA 1KY5A 3DR5A 5LWHA 1RTTA 3ZS8A 4C2AA 2R86A 1X19A 5AK4A 2Q6LA 1XEXA 4C1NA 1CY2A 4DDWA 1JHZA 1Q92A 4H6WA 4RJKA 1U9YA 1M1UA 4FBLA 4PEVA 4XIIA 5IAGA 5KWSA 1IXSB 5E1MA 4C9BA 2BSXA 1KARA 3I76A 2BC9A 3ADKA 3IP8A 3D6JA 3JCZA 3U31A 1T1SA 4MQUA 2FHSA 1CUIA 4HS4A 5K8TA 3QVWA 3RGWS 4GW3A 3LCRA 2OCPA 1R8QA 4G1VA 3OIVA 1ULAA 1ID8A 4JEIA 4QIHA 1UMDB 1NLFA 4A0RA 4HDOB 2C7RA 5KJEA 1N2XA 3UMVA 1QQ6A 4Q9KA 4EELA 1VG9B 5ARDA 2HMWA 4D9CA 4M1SA 1P6QA 2CVQA 3BH0A 3LWNA 3VPAA 5DM60 2WAYA 3MQ4A 4QJ4A 4KI7A 4JLJA 4NATA 4BO5A 4C6HA 2ISCA 5KTOA 2E4ZA 4E5KA 4KN9S 1LDBA 4UEOA 1KDYA 1AHPA 1WV1A 2O23A 1MB9A 3H8VA 3T5MA 5JNRA 1NG9A 2II6A 1OBHA 3H4MA 5J4LA 3DOCA 1LPMA 3G0DA 3ODPA 4S2UA 3AG5A 4K9DA 4C07A 2ARKA 1UXIA 1OB2A 1DCFA 1TVEA 5K7SA 1GKUB 3MHTA 5FYDA 2XT6A 3R3WA 4KXNA 4PQFA 1TM2A 3RFCA 1U2SA 1ZP6A 5AVWA 2IBSA 1RIIA 1L3BA 4MA0A 2DFTA 2QAGA 3NPAA 2Q6TA 3DPUA 4UVDA 1U31A 1XD2B 2EKPA 2PLRA 1WF3A 4QDUA 5G41A 2HDWA 4GYKA 4LRTB 4Z0NA 5ICMA 1OWOA 1A4IA 3N2LA 1I6KA 3TM4A 1YJBA 2ZSJA 5T5QA 2EHDA 1Z25A 1QGED 2W6NA 5JTTA 1UBOS 4B4KA 3KM0A 1R74A 3D8RA 3FZEA 4MWEA 1ISSA 5A6SA 1YS9A 1G5QA 4KO2S 5EWLB 1KQFA 4MQ4A 4YO7A 1GADO 2ZJ3A 1RWXA 2PH1A 4Q03A 3KOUA 3WMEA 3WYDA 3RVOA 4E46A 5C8YB 2IHZA 1G9SA 1ZCBA 5JSZB 3E9QA 3X1DA 5LD2C 4F3TA 2WKPA 1WXHA 2G9NA 1DELA 3RVBA 4CMEC 1CUJA 3NBZC 4F12A 1BX3A 4MQEB 2BCEA 4LJ9A 1U0JA 4PNZA 3TTYA 3WIEA 1XYYA 4K03A 1Q91A 4M1ZA 3M6MD 3DKKA 3DCYA 3A31A 1RLJA 3AHCA 3HWWA 3TL6A 4C43A 3CG0A 2ZIXB 1U7PA 5TEVA 2WQZA 2YH2A 5DYTA 1GU0A 3U62A 4FIDA 3U81A 5IH7A 3PNSA 3RVSA 1VQ1A 1F06A 1BAPA 3CUUA 4DMKA 1VB3A 3JWIA 3FKJA 4HEHA 3ZGLA 3UPUA 3WMFA 4RQTA 2FZCA 4P7GA 1GZ3A 2OVBA 1W4LA 2Q2QA 3ECSA 3JWHA 4AKIA 3B2QA 4C30A 4Q1VA 2BHNA 2HLPA 3Q87B 4Y9UA 3V2IA 4IZHA 2ZXEA 4MNTA 2JKVA 5AXAA 5AW5A 3VJMA 3T0FA 3I52A 4Y18A 4F9TA 1GPWB 1IXRC 1KDPA 1WMFA 1GNVA 2IV3A 4WXYB 4N01A 3C7AA 3CZQA 1XDZA 1KGDA 1TK3A 3S99A 5JANA 3WG9A 1BHQ1 4CF3A 1FTGA 2WU8A 2YHSA 3KPYA 4AO6A 4BLRA 4NPAA 1J2UA 1JT2A 4UTPA 4Z4GA 4MVJF 2WT9A 1DAKA 2AUNA 3T4UA 1YDMA 2XHZA 3SVTA 3GLKA 4K9OA 4EAAA 1U5BA 2X22A 1VRWA 1JDPA 2XNJA 3IERA 3DVQX 1QOQB 4X1IB 1DP4A 2C59A 1DO8A 2FG7C 2I8AA 5L3SB 3QVGB 1QOPB 3K9LA 3PR1A 4INAA 4K6KA 4EEXA 4C0JA 4F4CA 2N47A 1CUCA 3G2QA 1XMQB 4CI0B 4V0RA 1NF3A 2JLAA 3W3AA 2XSZA 3ICCA 4C22A 4RLQA 4YRSA 2CLDX 2NTJA 4IKOA 4KH1A 2CSXA 3G0HA 5G02A 5LNK1 1WXDA 2FPPB 3EULA 5TPZD 3TM5A 2QF7A 4LF9B 4UPVA 1ORRA 1I7NA 1D4ZA 1E96A 1WNTA 4M9ZA 4QL3A 1B3RA 4BB9A 1RJEA 3G49A 2ORYA 3RSGA 2OGWA 4UBNA 3MWYW 5LDDC 3QLUA 2OLJA 1U9JA 3PXEA 1X8XA 2EYUA 2JGMA 2Q5OA 4GX2A 3LHDA 4LYDA 1KBOA 3TPZA 3PIDA 1P5FA 3G6WA 1W85B 4C4PA 4LOJA 3BEOA 2Q0SA 3FMPB 1QGOA 1NF9A 4RX1A 4YV2A 1E2FA 3LX4A 2ONZA 2Y1XA 2QLTA 1FFXA 1RBYA 2VS1