3N5CA

Crystal structure of arf6delta13 complexed with gdp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
147
Chain Sequence
MRILMLGLDAAGKTTILYKLKLGQSVYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 6
publication title SAXS and X-ray crystallography suggest an unfolding model for the GDP/GTP conformational switch of the small GTPase Arf6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 48
structure length 147
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3n5cA00
5GADl 4I81A 3R9WA 2CL6X 3FKQA 1KO4A 1US8B 2VHUA 2WM9B 4OJQA 5L3RA 5HKKD 3AVTA 3CONA 3QPWA 2C8VA 3C5CA 3QVVA 4LSGA 5EXTA 1KY2A 1R4AA 3BGWA 1OB5A 5AUPB 4EJSC 1RYFA 4XTRA 4IOMA 4Q9IA 4W9MC 2IYWA 4GMDA 3DM5A 1AJEA 2KSQA 4B3DA 2GCNA 3NTUA 3GLFE 4ZO4A 5D3QA 1G16A 1MO6A 4DLYA 4TN1A 3THWB 1E3MA 2V54A 4TMWA 3GP8A 2HCJB 3OFNA 1CRPA 2J0VA 1AZSC 4BRUA 2FSIA 4AIIA 1CR0A 3VX3A 1TX4B 3X1YA 1XEXB 3OE7A 1XMIA 2ZIAA 2ZI9A 3TRFA 2CLCX 2W2XA 2J7KA 4GT1A 1H8HA 1E98A 1RRFA 1W0KA 2F1HA 3T1OA 3X1XA 3AVWA 3CNOA 5M04A 3K70C 1QHXA 4HYYA 2XITA 3B9PA 2VPPA 3VR4A 3QEJA 2VL7A 3NEJA 1U9IA 3RAPR 4QBGB 2PJRA 2QPAA 3N5CA 4JBYA 1AKYA 5FTMA 4ZCIA 1QG2A 4TT3A 1MR3F 1JQLB 1P72A 1T0JB 1H8EA 4HB2A 1J99A 5P21A 4E03A 4YDHB 4HUTA 1DPFA 1T9HA 4E07A 4DSTA 1UF9A 2MSDB 3MLEA 1Z5ZA 5EUQB 3I92A 2D4HA 2NO7A 3K70B 4Q9HA 1E9RA 3KXLA 3B82A 3U3JA 1ZMXA 5KNDA 2PL3A 2LWIA 4FWIB 3T12A 3OEEA 3SNHA 2A5YB 2EYUA 3SJZA 4MKHA 2G0TA 2LKCA 1U0LA 4B3BA 1AS0A 1GSIA 1YR7A 3BB4A 721PA 1CKEA 3QG1A 3UIEA 1BOFA 1GFIA 1OB2A 2NO9A 1QVAA 4Q7MB 4KFSA 5CDFA 1BIFA 3B60A 3WBJA 3VU9B 1SHZA 3MD0A 1RYHA 3GLHA 2Z83A 4L16A 3RLFA 3AVPA 1Z0AA 1ETUA 2ZU0C 2HXSA 2J59A 3CWZA 3GJ7A 1CJVC 3K0CC 4QFMA 5JHHB 2SHKA 2OCBA 1TQ2A 3ECCA 4CT4B 4M9SA 5AJVB 3SI7A 1A5TA 3CRMA 5L8VA 3QKTA 2IEYA 1L2TA 4R98A 3HYRA 1HT1E 1HEIA 4MUAA 5BYKA 5DYIA 2VF7A 2YKGA 3LLUA 1X86B 5KDOA 1N5KA 4LZZA 4IDOA 1NVVQ 3FTQA 3P4YA 1T5LA 2DWOA 3VMFA 1NKTA 1RJ9A 3NC1C 3ONWA 5KTYA 1US8A 1HE1C 2WPDD 2GILA 1F2UB 1S2MA 1OLOA 1XCMA 3TK1A 2VF8A 2XOKD 4A6PA 4JLMA 4WW0A 4AYXA 1J90A 4HAVA 1FL9A 1SKYB 2FOLA 2OFWA 3LBNA 3DEFA 1Z0DA 2YZ2A 3RS2A 1P4SA 4BZPA 4W5WA 2JATA 4Z1MA 2D62A 3DVLA 4URZR 5HCNA 1OFIA 3FMPB 4UJ5A 3SN6A 4B6FA 2NO0A 2RGAA 4RZ2A 1T8UA 2QA5A 1W47A 2ZE8A 2PX3A 2OFXA 5EE0A 2O5VA 1YU9A 2FN4A 5K8UA 4JLOA 1ZUHA 3X1DA 5DI3A 4LBYA 3WNDA 3W8RA 2JLYA 2G0NA 3I4LA 2V1UA 1A2KC 1S8FA 2IUUA 1KAGA 1U0HC 2AHOA 2ZJAA 3O8DA 1OXTA 2JLSA 1W4CA 2L0XA 3AVQA 4Q7JB 2C03A 3SYKA 1ZYUA 1SVLA 4EJSA 5KDDA 4V0NA 4HB0A 1T5IA 2P5TB 2XZOA 2CCKA 2E1RA 4FIDA 5KNBA 2QBYA 1KI8A 4GOXA 4KSBA 3DHWC 4JBXA 2WHXA 2WKPA 3GLGE 2CDNA 2X1VA 4KBFA 2NOAA 3LQQA 3AV0B 2D74A 1GITA 4DWJA 1LF5A 2OILA 1G18A 4D0NA 2BDTA 2XXAB 4M0LA 3PQCA 3AVYA 1N5JA 3DOEA 4TTQA 2O8EB 3IGFA 4KODA 4A1FA 2ZI5A 1HH4A 1SVOA 2HF9A 5JECA 4URVR 4DKXA 2O0KA 2V7QD 1DAKA 3K0AB 1OH8A 1RZ3A 5CLQA 1Q1ZA 3CUEF 3T34A 3OAAD 2QMEA 5DO9A 1VYVA 1E2JA 1ANKA 3F3YA 3NIBA 1PLLA 4W5JA 4ILEA 4LJ7A 2O8CB 1TF5A 3DOFA 4C0AC 1LFDB 3QF7A 3VU9A 2P0EA 3CIOA 1XCGB 3AGQA 1NVVR 2J7PD 1XNJA 3SYNA 3ZQ6A 5L3VA 1BH2A 2UZIR 5HPYB 2HT1A 1II9A 3O47A 2HT6A 1BMFD 2BWJA 4PQFA 3U7EB 3GLGB 3TAUA 1Z2CA 4R7ZA 4MRPA 2R62A 4PPGA 2F7SA 1L8QA 4II7A 2F3TA 3X2SA 1UDWA 1G291 2WMOB 4I1SA 4Q1BA 1ZIOA 4DIDA 2ZSEA 5HKKA 1XD2B 2ZUBA 3GEIA 4X8OA 5AK0A 3KQNA 3U4QB 3AF0A 1HE8B 4KYUA 1UBGA 3MWKA 3RHFA 3CM0A 1JR3E 1E96A 2ZXUA 1WE2A 4TMZA 3UKDA 1ESNA 1F48A 4P4SB 3KQHA 4NL4H 4PANA 5DI9A 1G7TA 3DMDA 4POAA 4DLTA 1XMSA 4CEJB 2QE7A 3K0CA 1OIXA 1QHHB 2P67A 1G3QA 3IHWA 1OHHD 5EJEA 1ZCAA 4MGYR 1IBRA 2XSZD 2IA5A 3DKPA 4IXMA 1ZD1A 3Q72A 1ZNXA 1OXUA 4BFVA 2X19A 1SVKA 2ZVQX 3L82B 2O8BB 3G5UA 2CEAA 5FBWB 4XVUA 1E9CA 3EXAA 3BRWD 1DADA 4NONA 2C96A 1UBEA 2PBRA 3UMFA 4C0JA 1Q1BA 2DFNA 2ZRDA 4URXR 2PMKA 2HJGA 3D7MA 3C8UA 3VR5A 4M2LA 2IEZA 4F4IA 5B58C 2EFEB 3A1VA 5F9HA 4Q18A 1W5SA 4AK9A 3EA0A 1Z63A 4JVNA 1W48A 3QEOA 5HR5A 4B2LA 3W3AA 4BZXA 3NC0C 3OZXA 2FFBA 3C16C 2WOJA 3U44B 3QXCA 1AKEA 3MCAA 4I1OA 3WHLA 1Q0UA 3PIRA 1ZJ6A 5AJWA 4Q1DA 2W6JA 1UKZA 2RGBA 4M1MA 2YWFA 3FMIA 2R6AA 3RWMB 3MJHA 2ATXA 2I1QA 4DDVA 2JJ1D 2F55A 5JZVA 4GPTA 1WA5A 2QM8A 5LB4A 3VAAA 4JIMA 4QOSA 4FCVA 4PQRA 1GL9B 2X8AA 2YOHA 5B57C 2GXAA 4AD8A 1QHIA 3W6PA 2QP3A 3B85A 3KZ1E 1GNRA 1XD9A 2GZAA 3K0AA 1KDOA 1WRBA 5FOWA 3A8TA 3ZJYA 4RZUA 1OKKA 1JR6A 3TJZA 1YZKA 4CEIB 3AVVA 5F3WB 1II8B 4DC9A 2ZANA 1N0VC 3A37A 1TAGA 1RRCA 2O8CA 4JLJA 3K09C 3B1YA 1ZM7A 4LYAA 1ZNZA 4RZ3A 2VP2A 2QT0A 4QGFA 4GI7A 1MT0A 4LHWA 3TE6A 3AEZA 1A7JA 1CR2A 1TQDA 1G21E 3L8ZA 3SFZA 1M1YE 4PZZA 3GLGA 1GKYA 1NLYA 4QNRA 3TQCA 1Z06A 1WB9A 3HU1A 2IWHA 4BFTA 1LV7A 2WSSD 5AJYA 3LX8A 1XD2A 2BCJQ 2P65A 4M1OA 2XOKA 2C2HA 4HATA 1E9AA 1F5NA 4G5OA 4L9WA 2B8TA 4JT4A 2ZJ2A 4JLVA 3W90A 4A15A 1U8AA 1S3SA 1OH5A 3W6NA 2HV8A 4P4SA 3ASYA 4MRNA 1VCOA 3QSYA 4CEJA 2FFQA 1D5CA 4B35A 1W4AA 2J9RA 1E32A 2IHBA 4W7SA 1QHHA 1RRPA 1IHUA 1F2TB 2OG2A 1XXHE 2ONKA 5TDHA 3ZZ0A 3PV0A 1KSHA 4LY6A 1DAMA 1W2HA 4OBEA 2CHVA 4ITRC 4KV9A 2RCNA 3CNLA 3MWLA 1N6HA 1RW4A 1XFAA 4TLCA 3OFND 4F38A 2PEYA 3B13B 3W9YA 2ZYTX 1WF3A 4FCTA 3F8TA 4KJZA 5FOXA 2XB2A 4JZKA 2XZLA 4MRVA 1JAHA 3NKVA 5K8IA 4NYMQ 3RYTC 5KOYA 3BERA 5L3SA 3EZ6A 1H8HD 1JECA 2BBWA 1W0KD 1VCIA 3KJGA 1I2MA 2VP6A 1DAGA 3ND9A 2AXNA 4JVLA 4MH0R 2ZR0A 4X8HA 5CIQA 4GSYA 1R8QA 2ZYWX 3EZ2A 4J0QA 3HYTA 2BEJA 2GXSA 2W6ID 1ZM3A 2XNSA 1MKYA 5TXGA 1BKDR 5C1BA 2Y8EA 4MDEA 4A0FA 3TUJC 2BM1A 5HZHA 1AIPA 2Q9BA 4M9XA 3A4MA 3B9QA 3NG1A 3BE4A 4C2UA 4JL8A 2ONJA 1AA9A 4PC1A 5AJZA 1E2MA 4FN5A 3V4RA 2ZE5A 4CVNA 3CZQA 1G5PA 2ZRFA 4LDJA 1E0SA 3IHLA 3ICQB 4B75A 3KJIA 1KMHB 1KGDA 1NN1A 3OIUA 3LH5A 1XZPA 2NGRA 4LCBA 1G8PA 5FPTA 3ZLJA 4A2WA 4TTRA 1LS1A 1Q3TA 1G4AE 3T5GA 1E1RD 4B3GA 2OFOA 3QBVA 1WCV1 1OFTA 5DGXA 3E70C 3LXXA 2FZLA 3SFVA 1YZLA 2XTMA 4CEIA 2J7PA 4KXFB 3A36A 2IX3A 3HWSA 3VNUA 3Q8XB 3VHLB 2UZ3A 1CLUA 3C4JA 1BMFA 2ZM5A 2JAQA 4PZYA 2OSBA 4L5BA 2YC2C 2CLDX 2JLXA 2CXXA 3RRNA 1OPXA 3KJEA 4V0MA 3CPEA 5BQ5A 2YWGA 5H8WA 2ZRHA 1FX0B 1CJMA 4B48A 3GJ6A 1HQCA 4LJ5A 3EASA 1U99A 3RS3A 3L0SA 2WZQA 4CT5A 2YC4C 4ZCMA 2CVFA 2OM2A 2XJ4A 5JJKA 3SHWA 1NVXQ 2EU8A 1MV5A 2RH5A 3OESA 4URYR 4ZKEA 5IRCD 4HI0E 4XD7A 1E9BA 3WMGA 4AY2A 4C0KA 4UNPA 1G64A 4PC7A 1JQJC 1OE0A 4HLDA 3WXMA 1KKLA 1UADA 5TY0A 4KFUA 3K09A 3KX2A 2QQEA 2XSZA 2OE2A 5A4JA 2FDCA 4MYTA 4PPNA 4MYCA 4DT1B 3ZGXA 2FMXA 1P9WA 3EX7C 1W4RA 4B3FX 1V43A 2O0HA 4IVRA 1TPZA 3ZZUA 4ARZB 1F2TA 4LJ6A 3C41J 1TEXA 4Q4HB 4YC7A 4S35A 3THXB 3IO5A 1QDEA 5DE3A 2QM7A 3T1QA 5H1YA 3SQWA 4KI0A 3DPUA 4JLNA 1D9XA 4ZV4A 1X1SA 3K0FB 5J47A 3TGPA 3FFBA 2B8WA 4IXNA 1XTQA 1ZU4A 2AKYA 3U3RA 1U2RA 3E2IA 3KXKA 4FMCF 2ZR7A 2ZE7A 2GAAA 4LHZA 1D2EA 4G5SA 2Q9AA 4MGIR 3REFA 5L3QB 3C5HA 2RHDA 3TIFA 3U6BA 1FTNA 1TTTA 2YHSA 1VIAA 1FW6A 3LRPA 2GKSA 5GJBA 1BO6A 2IW3A 3RS0A 3RRMA 1A82A 1GNPA 3LBHA 2CCJA 5JSZB 4DLZA 3LXRA 2P6UA 4Q21A 3QF4A 4DXAA 5AWFC 3NVAA 1NF3A 3I61A 4BLTA 2N46A 4K46A 1EK0A 3TW8B 1N2CE 5FPYA 4W5HA 4D0GA 2JJ1A 2YWEA 2WBLC 4FD2A 4NDZA 4Q03A 3Q3JB 5C4MA 3Q5DA 5FR1A 2QQ0A 1F3OA 4DLRA 4IOJA 3OHMA 1S0UA 3PUWA 4KYIB 3T06B 4TL6A 2JLVA 4QBHA 4EFMA 4RVCA 3K70D 2GEVA 1VG1A 3P32A 3TSWA 1MH1A 2J45A 4MYHA 2JJ8A 2FZ4A 5CLLA 2YWHA 1YVDA 4JLBA 3ADCA 1YRBA 2ZUDA 3LNCA 3KTAB 2BBOA 2QAGB 3NBFA 2KI5A 4K8OA 5KUTA 3KJHA 5ELXA 2WJVA 1U90A 1YRAA 3CRQA 2JGNA 1PVOA 5HE8A 2IBMA 1ZD9A 3FPAA 5FPSA 4B34A 1KI6A 2QZ4A 1KO1A 3UANA 4WAUA 1SXJE 3SEAA 1JB1A 1DAIA 4DLUA 1G3IA 4JKIA 4G01B 4MRSA 1G7SA 1BS1A 4EPRA 1W0JA 2FG5A 4FMDF 4PAMA 2J0QA 4DCNA 5JLJA 1KSGA 3PCRB 1FX0A 1QVRA 2AK2A 1TL7C 1GG2A 3NHBA 5AUQA 1GILA 4PC3A 1FNNA 2NQ2C 2JDID 1V5WA 1PLJA 3B1WA 3QPUA 1XTSA 2W00A 4I1VA 4DRZA 2GXQA 1KYIA 4DHEA 1XJCA 4WVFA 1NIJA 4GP7A 4QJ5A 1XTKA 1KOFA 3A1TA 2ZRGA 2OBLA 1S1CA 2E9SA 3A1SA 3AP2A 1XPOA 5FI0B 4DT1A 5GJCA 4B2IA 1HURA 1XTJA 2QE7D 3TAHA 2C9CA 1E2LA 4FMCB 2WIBA 3LY5A 4CIDA 5FL7D 4UNSA 3WP0A 1G17A 4A82A 4D82A 1Z6XA 5LD2C 1NMZA 3U3KA 4Q4HA 4HZIA 5JFGA 3W5IA 3THXA 2MMCA 2D06A 4MKFA 5CYOA 5IK2A 4DLWA 1T8TA 2F9MA 3AUXA 1LY1A 5EZ5A 2NZJA 4BEJA 4OHYA 4Q47A 3FE2A 3K0FA 5JWRA 1CF4A 1Z08A 2G77B 3W6OA 4IVQA 3EWSA 4JJZA 3REGA 4KU4A 421PA 4DSNA 4TQAA 4LOAA 4PO9A 2BC9A 1M7GA 1ZBDA 4HUQB 1E94E 2GVDC 3FHCB 4UXJA 1KNXA 1NG9A 1OH7A 2GESA 4P4TA 4BLSA 4AURA 1E0JA 4Q7KA 2BMFA 1UPTA 2W6IA 4B47A 5JWOA 2Q3HA 5K8LA 3GLIB 3L43A 3HP1A 1QHGA 4B3CA 2HEIA 3OIWA 2RGNC 4OHZA 5LD2B 5JHGB 2HCBA 5JSZA 4WIAA 2B21A 3QVUA 4P32A 4US1R 1P60A 2XAUA 2IS2A 2QMOA 3PEUA 2ECKA 5E95A 3WNBA 1SXJB 3VFDA 2ERXA 3KXIA 2A5DA 1WXQA 2F9LA 3WP1B 3TMKA 2W6JD 1B23P 1SVSA 1N3BA 4ZI3A 4D81A 1E4YA 3AF4A 3B1ZA 3K1JA 4L8GA 1UDXA 2FSHA 4E22A 3K9LA 1R5BA 2OBNA 1E9EA 1YZUA 4GZMA 3ZD7A 4EPTA 4X8MA 1E1RA 2OUKA 1TUEA 1P2VA 4Q02A 1OF1A 4XWAA 4CZ2A 1MRNA 4OQMA 1P75A 2IWRA 4QL3A 1WDTA 4NYIQ 2VIIA 2IYQA 3I32A 2WV9A 5F9FA 1CU1A 4TYPA 1OKKD 3KTAA 4A2QA 1XCPA 2FPLA 3IEVA 4A0RA 1N6LA 4MKIA 2CMKA 2CNWA 3BB1A 3GLFB 3L8YA 3IEUA 5BN4A 1K8RA 5DLQC 2ODWA 1Z22A 3QJYA 2Q3MA 4Q9JA 2R6FA 5E7JA 5GVRA 1XPUA 3U61B 1TUIA 4MQBA 5EQTA 1EGAA 4KITB 5IHPA 3FYHA 1ZP6A 3M0EA 5FBQB 1E2NA 3ZS9A 4AKIA 1XRJA 2W2TA 5JS8A 4OK6A 4ZPXA 3VKWA 4WZAE 2P6RA 1JNYA 3EG5A 3UWKA 1XBTA 1P2SA 3CNNA 5FPKA 1VCNA 2ZRNA 2Q21A 1XTRA 1TMKA 4CRWB 1UBFA 2XTNA 3H86A 3QPVA 4OJKA 3SE0A 1JI0A 3ZDQA 3T1VA 2WWYA 1N0WA 5FUVA 1NG1A 3MUFA 4PPQA 3MSXA 1IN4A 4B6EA 4Q1EA 2WSMA 4RFSB 221PA 5EP1A 3IQWA 2WJGA 2YNMA 3BOSA 4NE2A 2JEOA 4RD2A 4B73A 2FNAA 2GF9A 2QY9A 4TL7A 1JAIA 3THWA 1FMLA 3TVDA 1D6JA 1E2EA 1QBKC 4F7WA 4JSYA 1C4OA 3BFXA 4HLUC 3UG7A 1XEXA 1QHSA 3K9NA 2H8KA 1VKJA 1Z29A 3DL0A 4NCJA 3DM9B 4A0GA 3KKQA 1UM8A 2GVZC 2BVNA 4IVPA 3QQ5A 2VYFA 3OEHD 4TSFD 5EE9A 4C0SA 2W0SA 2VEDA 1FTSA 1G8FA 3CF6R 2H18A 1KI3A 3GCGA 4HUQA 1KSFX 2AFHE 4PXAA 1NLFA 2ANBA 4JL5A 2A2ZA 2YV5A 4IOKA 5DISB 1EFHA 4KFTA 2FX3A 1M2OB 1WP9A 3AP1A 2W2VA 4OHXA 4EFNA 3PUXA 2FPMA 2O0JA 3AGPA 3CR7A 2EWVA 3ZVNA 3MMPA 2ZRIA 3CR8A 2FEOA 3T15A 4GNKA 2VTKA 4NYIR 4LYFA 2QT1A 4OKSA 2C9OA 2ZAMA 5FTNA 3TBKA 4JS0A 2FSGA 1FZQA 2QORA 1P3JA 3GQBA 1KI1A 1P62B 1Z28A 621PA 1CIPA 1CJKC 2QMUA 3EZ9A 4YONB 4PO8A 2VP5A 3AF2A 1CTQA 1OT3A 3R20A 2HF8A 1IY0A 3C7KA 4LV6A 4G3XA 1IQPA 5EXXA 1R7RA 3BIFA 1A2BA 2RGNA 3C15C 2BEKA 3GJ5A 4CYMA 1G6HA 3A4NA 1KIMA 4LV5B 3ADBA 1DARA 3EC2A 4GZLA 5H70A 2QU8A 1NN0A 1YKSA 4FI3C 1QHNA 2R6GA 2Q6TA 4ZDIA 5C4GB 4TZ6A 3LDAA 3GJ4A 2NO6A 1T3SA 5DNYB 1KJWA 3M6AA 2XNDD 1NJGA 1ZD8A 1AQUA 2WWXA 2GRJA 3T61A 4EIWA 3VTKA 1TU4A 3F0TA 2JDIA 1L4UA 4OQLA 1A1VA 4CW7A 4LYHA 2ASEA 1F60A 3ZD6A 1ZC4A 3CB4A 3QIAA 1PV4A 1GOTA 2EFGA 2XX3A 5C2JB 5JEDA 1OSNA 4X8LA 3QY0A 3QUSA 2CHQA 2ANCA 5AR1A 1OIVA 1W36B 4Q4JB 3DZ8A 1F2UA 5FUXA 3R9IA 4XD7D 4C4PA 4TZ0A 4A36A 5BWMA 2C5LA 2QGZA 2J0UB 1WMSA 5FL7A 2GNOA 2ZRLA 4OQNA 4V0KA 4WBSA 3KKMA 1QF9A 3NDPA 3GFTA 4HDQB 4ZDWA 3TR0A 5DHAA 4KLZA 4HDCA 2DBYA 2F6RA 4Y0AA 5G53C 1CJUC 4UKDA 3QI2A 1NI3A 4ZDKA 4IW3B 2VRWA 2IYYA 4IEEA 1MO5A 4UNRA 2OXRA 4Q4LA 1DG1G 3KUDA 2JLZA 4HSEA 3AVXA 1XZQA 3RDPA 2QMHA 2RGEA 1NIPA 2EFCB 3UK6A 1TF7A 2FH5B 2FGJA 5BXQC 4MKGA 4DB2A 1C9KA 2F1JA 3MWYW 2CL0X 1WBBA 2A7QA 3QKRB 3WRXC 1OFUX 6Q21A 1IN5A 1S1MA 4NCHA 1Z07A 3MWJA 4NBSA 4ZCLA 2IUSA 1AK2A 4AWXA 3SJCA 3AKYA 4V0ME 2ZJYA 1XD8A 4Q9KA 4A9AA 4NCIA 1JEEA 4Q5IA 2F43B 4XTCS 2PT5A 1L4YA 2A30A 2VHCA 4V0OA 4HAUA 4DSOA 4QGHA 1FQKA 4JMPA 3M4YA 1NNEA 2YJTD 4QHTA 1ZINA 1PUJA 5J4KA 2NPFA 1YR9A 2CK3D 3W3ZB 1X1RA 2N1BA 3FWYA 4GFDA 4HLUA 5GVSA 3NH9A 4DB4A 5JJIA 2LCFA 1X8LA 4LV8B 2H5EA 5GJWC 1EFCA 4C7OB 1GIAA 5IDVA 4G1UC 4C0LA 2XXAA 4LGMA 5F98A 1XPRA 1I4DD 3SR0A 2V3CC 2O8EA 1TQ6A 4H1VA 1FOEB 4JKYA 1D2MA 3SJBA 3ND8A 4KCGA 2QSZA 4RD3A 2KBEA 5TARA 4PSAA 4Q66C 4HZUB 2J46A 2GZDA 1NY5A 4IDPA 5EZ6B 3SYLA 2ZAOA 1IOZA 4DBLC 3CRW1 4EAQA 1NY6A 3CWQA 1Z6TA 4TLBA 1I4LD 3RS7A 3LWNA 2H1LA 3Q5EA 5E3HA 3L0IB 4JSTA 4Q00A 4U7DA 2W58A 3LV8A 4KAXA 1MABB 2N42A 3KQKA 3A6PC 2GJAA 1IJEA 3VR1A 3KUCA 5KNCA 1W0JD 4KVAA 4Q48A 3RS5A 1FNMA 2K5UA 1M8PA 4TMKA 4JBWA 2CLSA 3SHFA 1OXVA 2GK7A 4M1YA 4NKRA 4KO8A 1ZAKA 1M74A 3U4QA 1R8SA 3FB4A 3IIMA 1Q44A 4ZI2A 5EUMA 4C30A 2IHYA 4URWR 4PHTA 3KQLA 1L7VC 4Q4JA 4KFRA 4BLQA 1FFHA 2R65A 2WJIA 1JXMA 1J7KA 2RHMA 2ZSAA 3U7HB 5JRJA 2AL7A 4DUGD 2FEMA 3IIKA 1TQ4A 1Q57A 1S4QA 3PXGA 5EXPA 1B0UA 1XEWX 2ZRMA 5JCZA 1T6NA 3WNCA 4ACBA 4B71A 4Q01A 4TL9A 1GVNB 2O8BA 3CX8A 2RGGA 3KB1A 2WVJA 2OHFA 2VLIA 4C0HA 2CBZA 1KHTA 1ZVQA 2R6CA 2R9VA 1IAQA 2B92A 3OEHA 3VR6A 4C0QC 4TSFA 5IK2D 4V03A 2JLQA 4RFVA 3KFVA 1GL6A 1Q22A 1Q3HA 4F91B 3QNUA 3QKRA 1Z47A 5CK5A 3EPHA 4N3NA 4LJ4A 3EPKA 2BKEA 5B2ZA 4PFSA 4DDUA 1RKBA 4FWTA 4D4LA 2IF0A 4OYHA 2KBFA 3I5XA 5KSYA 2KB0A 4BE7B 4IDHA 3B7GA 4NP6A 4BFWA 3W5JA 1E2DA 4DZZA 2PZGA 1SKQA 2DYKA 3BH6A 1FUKA 4HAXA 4NHOA 3U44A 2IF2A 2VO1A 1P73A 3VKHA 1VDZA 2O52A 2O8FB 3LX5A 4LJYA 4AKHA 4G0NA 3S1AB 1WBDA 5JI2E 1KDRA 1LVGA 2GCOB 3DMNA 2GTPA 1COWD 2CHGA 2GZHA 2KJQA 3GD7A 1JALA 2JIZA 1OYWA 1DO0A 3THOA 1CR1A 3TNFA 3LW8A 3SQXA 2V6JA 4I1UA 2QENA 4L9SA 1XB2A 4CEHB 4O3MA 4LHVA 3W8NA 2IS6A 3THYB 4BLRA 1KTVA 2GEDA 2ODEA 4I4LA 2VSXA 2HJVA 3H0KA 5FH9A 1NVUQ 3IKJA 1NJFA 1D9ZA 1AZTA 3PEWA 1VG9B 3RNLA 1II8A 1N6RA 2ZRJA 2ZYVX 2ODNA 1R6BX 4YMTA 5FBVB 1MOZA 2O8DB 2EQBA 2ZR9A 4A4DA 2XGJA 4QG7A 2XNDA 1G5TA 4OI4A 1XXHB 2ZEJA 2QSYA 4KBGA 4QKQA 5LBIA 2CNWD 3AKCA 2QTFA 1Z6AA 5D3MB 4A2PA 1IN8A 4DLVA 4ERNA 2QN6A 2ZPTX 4G5RA 2B7BA 3FVQA 4ACAA 1MRSA 4MRRA 3U60B 1GDDA 3P27A 4A6XA 1MABA 3IBYA 2XB4A 2QG6A 4BWYA 2BBTA 3F5FA 3HPRA 2WMNB 1YHNA 1A4RA 4IKEA 4QGAA 1XMVA 4ASUA 1N6PA 1NL3A 2CJWB 3IBGA 1MO3A 3O8RA 1W44A 3FGNA 1U94A 1YZGA 5SZKB 1KZ7B 2OCPA 3BBPA 2ZITA 3SZRA 3A4LA 1CULC 2MSCB 1W4BA 3SC3A 5DIFA 2UVQA 2Z43A 4P3YA 4ABYA 4DLSA 2QNRA 1U98A 1O87A 2WWIA 3ASZA 4HB3A 1JPNA 4GP6A 4YMWA 2BJVA 4G5QA 3ADDA 1TEVA 1G7RA 3QKSB 1KMQA 1LW7A 3DKVA 3H2YA 2AFIE 2H92A 5DN6D 1LNZA 1W7AA 1S9DA 2IYZA 4Q19A 3WY9A 4Q1FA 1HT2E 4B32A 2GA8A 2VSFA 3QENA 3B5JA 2GAOA 2FF7A 4AKEA 4EQ6B 3EZ7A 5CDFE 3B8HA 5G3YA 3UMRA 1FMJA 2XZPA 2VSOA 3CW2A 1GKIA 3GLHE 3V9PA 3VR2A 1FPMA 1G19A 1NBMD 2IT1A 4QHSA 4CGZA 4LC1A 5KYKA 3TKLA 5FI1B 2J87A 4RD0A 4HDOB 3R9XA 2G1KA 3LA6A 3IDQA 1FP6A 4NCNA 3V00A 1UKVY 2F3RA 2ZETA 2EVWX 4OHWA 4PSVA 1G9XA 4BEBA 4OK3A 3TLXA 2QRZA 2RKOA 2NMVA 4PQYA 3R8CA 1KSJA 3WYFA 1ZC3A 3PENA 4B76A 4NMMA 3BH7A 4DEXA 2CK3A 4KSCA 3CO5A 1O3YA 2GJKA 5G41A 1KO5A 1Q12A 5TVKA 3M1IA 5JBQA 2PT7A 2RGDA 2QAGC 3X1WA 4GOJA 4PO1A 1G20E 2QEQA 1TADA 2GCPA 2BHRA 4IOLA 2A5JA 3EIQA 2BKUA 5UKDA 3S1AA 1P7CA 4DDTA 2ZS7A 2FGKA 2G9NA 5ANRB 5FFMA 3QG5A 1DEKA 2PCJA 1G3MA 1SXJD 3DZDA 3EW9A 2BV3A 4BFYA 3GFOA 4EDHA 4Z51A 1PUIA 4D4KA 1Z0FA 2PJZA 1D2NA 4B44A 1KMHA 2D2FA 3GEEA 2WICA 3Q7PA 4PC2A 2OCAA 4LI0A 1EESA 3QXXA 2QL6A 2DB3A 4ZKDA 4D80A 4G5GA 4CEHA 4XVQA 2QAJA 4MGKR 4UQOA 3EAQA 2GJ9A 2P6NA 5KO2A 1Z6GA 2CCGA 3E1SA 5FBRB 3THYA 1W5TA 5JCPA 2C98A 3IPYA 2H17A 2X2EA 1T4GA 1E9SA 4Q7LA 2J5XA 2VP0A 1XF9A 4WZ6A 2QTHA 1GRNA 4UNNA 4O25A 3NDBB 2JJ2A 1E4VA 5FTJA 2G1JA 2C9YA 3NHAA 4TL8A 1XJQA 1XXHA 2V9PA 3QE0A 1G8GA 1QRAA 2HLDA 3SBDA 2ZJOA 4BFXA 5D3MA 3L2OB 3PEYA 4L4UA 1E1QD 4IEIA 1E2GA 1OXSC 2NG1A 4A92A 1G41A 4TMVA 4FINA 4TYNA 1SGWA 2R6DA 1DS6A 1T91A 5FL3A 4RCYA 4TYYA 4OL0A 2VP9A 1G1MA 3CX7A 4M9ZA 1N6OA 2BJWA 2A78A 2CJWA 1G4UR 4B74A 2ZJ8A 4D0LB 1NRJB 1RRGA 2A5GA 2GXUA 2V55B 1M34E 3EWAA 4Z8YA 3RS4A 4LJ9A 4B43A 521PA 1KAOA 5KDLA 4DUGA 1PZNA 2ZRCA 3FFAA 3BXZA 3ZQJA 5KHOC 4JL6A 1RPZA 2AWOA 1KJZA 2GJ8A 2QP4A 3AKDA 3RC8A 2OAQ1 2ZSDA 4DLXA 3JZMA 4YDSA 1E2IA 1IN6A 2ZU6A 3QKSA 1EFTA 1RJ9B 1R5NA 3ETLA 4FW9A 4ARZA 3L0PA 5KSPA 1NMYA 1P5ZB 4XOIA 1J70A 1FUUA 2YVUA 3PG5A 2EFDB 4LPSA 1XEWY 3AVUA 4AI6A 2B7CA 4EQ6A 1Q1EA 1SXJC 2WJYA 2ZYUX 2RMKA 4R2HA 3D8BA 2ZSFA 1N6NA 2X2FA 4GDFA 4JLAA 2V8OA 4DJTA 4M4SA 1EFUA 4BASA 4OI0A 1ZM4A 3UMSA 5AUOB 1N0UA 1E9DA 3AP3A 2C99A 1GUAA 4XVRA 5L3QA 4P0TA 2DHRA 4M8NE 4TLAA 1ZRHA 3NXSA 2VBCA 2ZJ5A 1YR6A 1HQYE 2ZE6A 5DI3B 3WMFA 4ZDJA 3SS8A 2ZSBA 4JVSB 1DAEA 1COWA 4EKDA 1LTQA 1YZNA 2ATVA 1VCMA 5CB8A 4EJSB 2IYLD 4PZLA 1J2JA 2PZEA 3BK7A 5KSZA 1HA3A 4R71A 4QGGA 4AC9A 1ZIPA 1U8ZA 2A9KA 5FOTA 1SKYE 3BH0A 2QBYB 2Z4SA 4YXWA 3L0OA 4PHHA 3AM1A 1T0HB 2BIFA 4JJKA 4MDFA 3LD9A 5DHFA 2BMEA 3UPUA 4LJAA 3PUVA 1N5LA 2IXEA 1S3GA 3RVBA 3KKPA 2G3YA 2ZJBA 3N2IA 3BFKA 4FMDB 1DO2A 5B30A 1GZSA 5G40A 4WA7A 1U81A 2QAGA 1AM4D 1G3UA 5SZHB 2BBSA 4NH0A 4B2PA 5IT5A 3NH6A 1DVRA 3E5HA 4EPVA 4WXRA 3GMTA 1KY3A 4FXPA 1SVIA 5C46F 3DDCA 1K5DA 1CXZA 2REBA 1GM5A 2BMJA 2R2AA 3U7GA 4PC6A 3BJIC 1Q21A 1RC8A 4RKFA 5EP2A 3I3SR 1KK0A 2EYQA 4DSUA 5E7IA 4ESVA 2F1IA 3TUZC 2B6HA 4OQXA 1ONBA 3CH5A 1ZCBA 2FE4A 1IXZA 4HAYA 4FMBB 4N1AA 1KNQA 5J4LA 1X3SA 1XP8A 2H57A 3CF0A 4QM6A 3NWJA 5CYPA 4ZIRB 5HZKA 2WIAA 1M7HA 1N25A 3KKOA 1M6NA 4IDQA 1YJ5A 4BZQA 3WYGA 1T3HA 1CEEA 1FQJA 1GWNA 1ODFA 3I1FA 2NPIA 4QXAA 3KQUA 1YR8A 5HCIA 1HUQA 3H4MA 1R0YA 3RSLA 3GJXC 3RC3A 3FHTA 3I72A 3HJNA 2D7CA 1W36D 1ZUIA 4HB4A 3BFVA 3EARA 1XWIA 5DN6A 2D2EA 2V1XA 1OJLA 2FSFA 2P3SA 4UNQA 1S9HA 2CE2X 1E2PA 2GF0A 2G88A 1VECA 2G83A 4PTLA 1E99A 4MYUA 2IXFA 2Q0HA 4LK2A 4DCTA 1NBMA 2GEUA 1FP7A 4B33A 3N2EA 3PITA 2AKAB 3R7WB 2IYSA 2JLRA 4P33A 3VKGA 1NP6A 5J4HA 1NKSA 1NN5A 3P26A 4DEYA 5HE9A 1GP2A 4GL2A 3EA5A 2MSEB 4U02A 4XH9B 1XMJA 3D6TB 5EE1A 2QP9X 1NVWQ 5DSZA 5DH9A 3B78A 2BM0A 4D6PA 1DE0A 1KI2A 2QRNA 1PLKA 3D31A 3QXSA 2ORWA 1N5IA 1P2TA 1K5GA 2GWHA 2DR3A 3IPXA 4JT2A 4LPKA 3HR8A 4M1SA 5EE3A 2BOVA 1E2QA 5IF9A 4N0EA 4CF7A 8OHMA 3GLIA 4RJLA 1VHTA 1U8YA 2GETA 2CL7X 1QG4A 3Q9LA 4OI1A 2GJSA 1KK1A 2IS1A 4JLKA 3A1WA 4S2EA 3FKSA 3RRYA 3GFPA 3UWOA 2JCSA 2Z6VA 3CKLA 5TB5A 1SXJA 2PCLA 1G3RA 3B1XA 1K6MA 2X77A 3HDTA 4C2TA 3KKNA 2G6BA 4TMXA 5EP3A 4D26A 2WKRA 4LC0A 3SJAA 4BECA 4TWZA 3BORA 4O2LA 3HU3A 4L15A 2JIZD 4Z54A 1R0WA 2OV2A 3C14C 4Q4AB 4QNMA 3ZIAA 2E87A 2DPXA 2VHQA 1P6XA 4PX9A 3EC1A 4JLPA 2BMDA 3MG9A 2ZI6A 5FPHA 4BFSA 4HAWA 1LF0A 2PX0A 1UEJA 5GJVC 4LHYA 121PA 3AKEA 3U3OA 1JR3D 2WTUA 5AUNB 4QBIA 4HEJA 3TR5A 1W36C 2WKQA 3G0HA 4PAOA 4LBVA 3OIYA 4AG6A 3KL4A 4GOKA 4R9UC 2HUPA 4O0MA 3GLFA 1E1QA 2ZRPA 1E79A 2EW1A 1Z3IX 1SULA 3FMFA 4NTZA 2AN9A 1G7CA 2DWPA 4RD1A 4US0R 2DFLA 2VP4A 1IY2A 3DO6A 5BN5A 5JMTA 5TMPA 1VYUA 3T5DA 2GHIA 4ON9A 1E0AA 4BFUA 1VPLA 3PEVA 1C1YA 4A8JC 2RB4A 4D4JA 2OT3B 3ADKA 1JPJA 4MA4A 5F2EA 2J3EA 4ASUD 3CRVA 3MAAC 4RKEA 2ZS8A 3IQXA 3VR3A 2Z5FA 3GJ8A 4ZIRA 2WJHA 2D3WA 4TYQA 2KWIA 4JLDA 2I3BA 1OFHA 3ZVMA 4LBWA 3FHOA 2OCYC 1KO8A 3RANA 1E2KA 5J40A 4D25A 1EXMA 3GJ0A 1D8TA 5E7MA 2ZRKA 2ZREA 1IONA 3NEYA 3CF2A 3J81k 3N70A 1YE8A 3VQTA 3U3MA 1TF2A 1XJ0A 2DCUA 4EUNA 5FOUA 3ZVRA 3ZVLA 4BFZA 2EWWA 4D4MA 3QKUA 2XEXA 1ZM9A 4RFSA 1CRQA 5FR2A 4LBZA 4E09A 5K8TA 4DVGA 4A8JB 3MRSA 1KK3A 3CBQA 4P31A 4AKGA 1CJTC 1HV8A 4JYCA 3QXJA 3AH8A 5JWHA 3R7WA 2WWWA 1P61B 1J8MF 2H7VA 4IRUB 1ZU5A 4TMTA 5BW8A 1DOAA 1U0JA 2IYVA 2PZFA 3WRYC 2ORVA 1ZM2A 3ICEA 2IYUA 2HYIC 3K0SA 1EG7A 4RD6A 1DAHA 5J5CA 1DAFA 4IFBA 3VHXA 2AD1A 3LAWA 4RZXA 4H9GA 1QZXA 3HU2A 1X8JA 1CBUA 2KE5A 3D3QA 1PJRA 1GNQA 4QBFA 1TNDA 5BN3A 5KU1A 2WJJA 3OF5A 1JXOA 2VHJA 1MO4A 3PR1A 5SZJA 3CH4B 2ZI4A 1CP2A 1X6VA 2LKDA 5L3SB 3ZYCA 2J0SA 2ZI7A 4QJ3A 4QC2A 2NTYC 3I8SA 4TQUS 5JJLA 4LYJA 4GMXA 2VA8A 3JZAA 4XIGS 4WOPA 4RSGA 5EE5B 3QBTA 1IN7A 2GBLC 1VYTA 3I8XA 2OXCA 1GRQA 2P5SA 1XX6A 2J1LA 3P4XA 4EFLA 5LDDC 1DBSA 1GKUB 3ZH9B 1KZGB 3VNVA 5CB6A 3FOZA 2PMDA 3RABA 4RD4A 3B1VA 4EPXA 4Q4AA 5B64A 3NBZC 4YMVA 3BC1A 1XDBA 3V4FA 2JLUA 1DELA 2UKDA 4AYWA 1Z0KA 2RAPA 821PA 5CIWA 3BB3A 2FJUA 3Q85A 1SVWA 3PUZA 4F93B 1Y3AA 4A0HA 2W0MA 1Z83A 5HTKA 3SU8A 2WWFA 2IXGA 1N6KA 1W1WA 1RIFA 2VHTA 4HLCA 5FUYA 1KKMA 2OLJA 4TLEA 1AN0A 3SOPA 4PPFA 2JJ2D 5CITA 1GTVA 4U00A 1W46A 2HLDD 3K0EA 3U2QA 3U7FB 3Q7QA 2ZI3A 4LHXA 4Q9LA 2AX4A 3KB2A 4BRWA 5A5GA 3LVQE 1DG3A 4E5UA 3PJRA 3EPLA 1VG8A 1AGRA 1UKEA 1OYYA 4YLGA 3B2EA 5H68A 1YZTA 2WOOA 2A3RA 2ZVPX 1EFRD 4KVGA 2QUZA 2GK6A 5CK4A 2ZJZA 1IJFA 4N0DA 5FUWA 4AG5A 2YOFA 4PHFA 4Y0VA 1SHKA 1R0ZA 3K8YA 1KI9A 2ZRAA 3CZPA 3LLMA 2J0UA 3WMEA 1R5OA 3FMOB 4LRWA 4M1WA 1YQTA 1UFQA 5FOVA 5JS7A 1OH6A 4EPWA 2WPDA 4IFEA 1ZUNB 5CJ2A 2ZROA 4IHQA 1UBCA 1II0A 2FA9A 4YMUA 2PLFA 4LWZA 1Z0IA 4V02A 3IO3A 1OV4A 4R2IA 4LJ8A 1E2FA 4TTPA 1EWQA 1RVDA 3BAFA 4A8JA 1NN3A 4CDGA 3IIJA 3HR7A 3I73A 3RRZA 1F6BA 2AK3A 4DCUA 2HXYA 4F92B 4XWOA 2HDNB 5SZIA 2CE7A 3I62A 3QOFA 3ZZTA 4WXPA 1AS3A 4TQ9A 3O8CA 3K9HA 1P9NA 2PLRA 3G82C 1VTKA 4NYJQ 4C0BA 2DY1A 4JVMA 2IYTA 4M22A 1KI7A 4QRHA 4H1UA 1KDPA 1Q20A 1SVMA 2F43A 1Q1QA 2HYDA 1G6OA 4F4JA 1IXRC 2ERYA 1NMXA 2RGXA 1XU4A 2NO1A 4WZBE 3LW7A 4GRAA 3IUYA 3OE7D 1XEFA 5CM9C 2IUTA 3CPJB 4NZYA 1X8KA 1S96A 4PR0A 1R0XA 4MITA 3RWOA 1UAAA 5LPNA 1N6IA 5FOSA 2FWRA 2BCGY 4QJ4A 1KO7A 3EPJA 4OHVA 2J41A 4RY2A 5CM8B 3NBXX 4UJ3A 4C7OA 3JVVA 1HYQA 3QF4B 3TSOA 2REXB 3K53A 1ZW6A 2AWNA 4YXWD 4KHZA 4TLDA 1OW3B 2DWQA 1GRRA 2C77A 4TT3D 2C95A 2OO7A 2P2LA 3WYAA 2I1VB 1JR3A 1KDTA 4HLQB 5AJXA 3K9GA 4DDWA 4BPBA 1H8ED 2MMGA 3KDSE 3O8BA 4HZUA 1RFLA 1E6CA 4M9QA 3CRRA 5DYGA 5FTLA 3SDZA 3A58B 1P9RA 2D7DA 4Q1AA 4YQFA 4P4UA 1ZNWA 3AF3A 2V7QA 1H65A 4BLOA 1Z2AA 2IL1A 2VH5R 5EXSA 5LB2A 1R10A 5G3ZA 1J8YF 1E2HA 3ZS8A 1UEIA 2GBLA 3OAAA 3OEED 4BGDA 2Z4RA 3MFYA 2JASA 2PH1A 2CVHA 4M1KA 4LUCA 3TH5A 1GL7A 3AQ4A 4B3XA 1W2GA 3JVUA 1VHLA 1WQ1R 4UXHA 2FU5C 1M7BA 1GAJA 1KI6B 3CPHA 4OK5A 1EX6A 3T35A 3H84A 1G8YA 4ESHA 4PHGA 4Q1CA 4QHYA 1VMAA 1VIYA 3FDIA 4M21A 3UXMA 5KSOA 5J4VA 2YYZA 1NSTA 5TV2A 1P2UA 5J4YA 4XWKA 4HAZA 2IC5A 2XTZA 4BUJA 2ODBA 3QXHA 2REOA 4DCVA 3UATA 2F1RA 1SQ5A 1UJ2A 1QHYA 4RCZA 4XSGA 2OLKA 2R44A 1E69A 3LVRE 4PSKA 1W49A 2IK8A 2FFAA 4NYJR 2XJ9A 5C18A 5JEEA 4XSHA 1TU3A 4M1TA 3PFIA 3SBEA 2PEZA 2GDJA 5JI3E 3AB3A 1KK2A 3KFXA 4AYTA 1OHHA 1G5RA 1BYUA 2QTVB 5KPJA 1CR4A 3LFUA 2I4IA 2ZTSA 4K81B 3U6KA 2AXPA 1U9IC 2FPKA 4C9BA 1CS4C 1JJ7A 1KJYA 2QROA 2ZS9A 1KI4A 4NYMR 4KLNA 4Z1MD 3PVSA 2JA1A 3GEHA 2IS4A 2Q3FA 2ZUCA 1LS6A 2ZRBA 3EIHA 3MGCA 4IDNA 1IM2A 3NBYC 2QPOA 3A1UA 3WBKA 4DIEA 5KPDA 3BWDD 4IJMA 1R2QA 1HY3A 1LB1B 2C04A 2V4ZA 5A0FA 4NPHA 2FV8A 1Y63A 3R8FA 1OIWA 1UKYA 1JEDA 1AGPA 1T3LA 2O8FA 2IYXA 4Z8XA 4I99A 3FKSD 2GCOA 2DFKB 2R8RA 3AF1A 4PAQA 3X1ZA 4V0LA 4FCWA 2YOGA 4YMSA 3TW4A 2AD5A 1NLZA 4JYBA 3VX4A 4TYWA 2WAYA 4MUBA 4DCSA 5BYJA 5FTKA 1AS2A 2WWHA 1DTSA 2WWGA 3RSOA 1I2DA 2V6IA 4XJXA 3BS4A 1Z8FA 2FFHA 3EIEA 3LQRA 2ORIA 1IXSB 4O2RA 3OIVA 2Q9CA 3ZIAD 1I4TD 4C3ZA 1JJVA 1G8HA 2OBMA 3IILA 4URUR 1NBME 4UXIA 3EZFA 1RE0A 2Z0MA 5JRZA 3CLVA 1ESMA 3B6EA 2IYRA 3T1TA 1XTIA 4D2IA 1SZPA 1Z0JA 1YZQA 1E9FA 2C78A 3UG6A 3GPLA 1Z6YA 5EP4A 2VQSA 2AR7A 3LBIA 2O8DA 4US2R 3CX6A 4F4CA 2TMKA 3I5YA 3P20A 3BD9A 3TQFA 1JBKA 2NZ8A 3MJRA 3TUIC 1VG0B 4BQSA 4EPYA 2H16A 5FBLB 3U5ZB 2JLWA 3P1JA 3LO5A 1ELOA 2A5FA 1OXXK 2EFHB 2OEPA 1E79D 2OZEA 2RGCA 2QI9C 4U5XA 2QGNA 3GLIE 4M53A 2ZQ5A 2OAP1 3WHKA 2QPTA 3GLHB 1EFRA 3TVTA 1E0KA 2OESA 3GJ3A 4NU0A 3W34A 2YINC 1BYIA 4LX0A 3H1TA 1EWRA 3PUYA 4GBMA 3AUYA 3TSZA 1IY1A 4QM7A 5E4FA 4OI2A 1EX7A 1ZNYA 5CJPA 3HPQA 2W83A 4BLPA 1AQYA 3AVOA 1NSFA 2DFTA 2WSSA 4OQFA 1HTWA 4MGZR 4NCKA 2WAXA 2NIPA
chains in the Genus database with same CATH superfamily
3FDFA 4IDBA 4I55B 4U2KA 1X7ZA 4R1QA 4I4TA 2VHUA 5DHQA 4OJQA 4LJKA 1NNSA 1L7RA 4YJFB 5KZMB 5HKKD 1U2EA 1Y9DA 3ZTTA 4F9GA 4ZU1X 4BNFA 3DDNA 4H4DA 2FFJA 4LSGA 2E85A 2X8WA 3ZDZB 2C2WA 3DZHA 3E22A 1PL7A 2FWMX 3C70A 4DG8A 1V7QA 4HZGA 5AUPB 4N7RA 5DHTA 5KQLA 2V5VA 1RYFA 3DDZX 4HXEB 3HN6A 1C0EA 2IYWA 3EOAI 2FSSA 4UUOA 3CT4A 3GLFE 2YIMA 4L8LA 2G07A 1T2EA 4DLYA 1Z5GA 4O4JF 3VO9A 5E7QA 5DDIP 5CM2Z 4G1CA 1DC3A 2HCJB 4Q1VA 3UUEA 4WLEA 3IVCA 4Q34A 3UWDA 2YY6A 4KPEC 1P1CA 2CBGA 1PNRA 1NR7A 2CMGA 4AJLA 1FYVA 1JIIA 1KY5A 1ZMTA 1XMIA 2I80A 3TD6A 1UODA 4RLFA 3TRFA 4X64B 3MERA 3M33A 4GT1A 3TLEA 4E2ZA 5K0BA 3T1OA 1W0KA 3X1XA 4IAOA 3F97A 3AVWA 3PI7A 5AJTA 1QHXA 4DNPA 4M7PA 4OX9Y 2XITA 3B9PA 3H7AA 2F8TA 4KSYA 3FWZA 2VL7A 1GLGA 3OOEA 1BMTA 1HYEA 3NEJA 5B1DA 1PDOA 3JQEA 5DBEX 4Y2RA 2CYCA 4JBYA 1GPKA 2FSVA 2JFGA 1NKVA 1I51A 2QM0A 2XQVA 3ND5A 4LMPA 4TT3A 1O77A 5FTMA 3RD5A 1MR3F 1Q2XA 2B1GA 3JWPA 3WGLA 5IBCA 2XDQA 3K1TA 5BSEA 1AE1A 4LWOA 2FSUA 3GARA 1YI1A 4HB2A 1TM2A 5KYYB 3GG9A 2QYHA 5P21A 2Q7XA 1JEAA 1GPUA 1CVRA 1DPFA 1V3UA 5K0LA 2ZCJA 4DSTA 2P6PA 1EPUA 2W71A 1P0MA 2ZSJA 2NO7A 1SVNA 3GAZA 5IYZB 5C51B 1H1TA 1T34A 2XQKA 3B82A 3KXLA 5AYVA 2PRKA 5I4KA 7REQA 1FRNA 2JGMA 3ACCA 4KE8A 4MW6A 2EYUA 3FVWA 1FNCA 1S4MA 2XYRA 4GZ3A 4UU8A 3U4DA 4D9HA 1NXVA 5AI8A 5GV7A 3U9SA 1F8UA 4B3BA 4W63A 1AS0A 3BB4A 2GPAA 2OGZA 3KK0A 3UJCA 3X1KA 1CKEA 1FK8A 2FUCA 4KIFA 3QG1A 5TNXA 4CETA 1U0SY 2V45A 3D4NA 1WZIA 4EKGA 1OB2A 1UBUS 4TV9A 4CMGA 1QVAA 1VHWA 2P3OA 3BHIA 4O33A 1SBTA 3F9CA 2FRXA 1Y3BE 4FYMA 3VU9B 4QU8A 1VJ1A 2G0AA 2Z83A 4OB8A 1RWBA 3TGWA 1RLUA 5F2KA 1GZ4A 1Z0AA 4QO7A 4CFYA 3CWZA 2EP8A 3P0FA 4MUGA 1CJVC 1DRWA 3K0CC 4BVHA 3FIUA 3L7BA 5A5FA 1W5FA 3CR3C 3K5IA 2G1AA 3D8TA 4IIVA 4NVRA 1AX9A 2DP4E 5SY4A 5HIIA 1YR3A 3QUCA 4R98A 1QP4A 1Z18A 1IE3A 2VDLB 2H3HA 2DUWA 4PSCA 5DYIA 1RXEA 1GTZA 3EXFA 4D8WA 4TMYA 3HJAA 3SYTA 1PZXA 3H99A 3PC4A 4IDOA 4IHJF 4MARA 4F2PA 3AOGA 2DWOA 3AINA 3QVMA 3VMFA 5EWJA 1US8A 3WIVA 1EP1B 1U9ZA 4INOA 1VYHA 1XPJA 1G20A 3CLRC 1JXQA 2C0CA 2D1YA 4JLMA 1J0EA 2PU5A 4WW0A 3INRA 1FL9A 4GHWA 4AUNA 3DEFA 4M0MA 3IVRA 4NFYA 4ZCRA 5BOSB 1AF7A 1BX0A 5C31A 4W5WA 3ZH2A 3W05A 4Z1MA 2D62A 3I6MA 5HCNA 1R16A 1Z5WA 2I8LA 4B6FA 2YXNA 1H3EA 2XVMA 2MCFA 3TN7A 2O5VA 1O4VA 3PDCA 3FF1A 1J42A 5FADA 3GCDA 4DQUA 3PD1A 4HH4A 2PSDA 3BJZA 1T9ZA 1HX7A 4IGEA 2WTAA 3I09A 4HWGA 1HL7A 1MVOA 4R6XA 2C3UA 3EOZA 4GOLD 4HT3B 1HZJA 3W8RA 2HXGA 3GVIA 4F45A 1K06A 5B12A 4WUVA 1A2KC 4GPBA 4P3XA 5IJ0A 1RLOA 4MICA 3V97A 1OXTA 2B2NA 2BEWA 4LNUA 2C03A 4AECA 4AY5A 4LXHA 5EJ9A 2B8NA 4IDAA 1R1DA 3H9GA 4V0NA 1TIBA 2WU0A 3EXIB 4Y3UA 2P5TB 1FFYA 4EBFA 3GY0A 2CCKA 4F2HA 4JP8A 4OPMA 3I12A 2HSZA 2GH1A 1L7PA 2VHXA 4QE3A 1SXQA 2QBYA 4B3HA 1KI8A 1JYEA 1KDZA 1O96B 4BBJA 4NV1A 5HUJA 2WHXA 3U4GA 3GRUA 4Z99A 3U4IA 2D74A 1GGJA 4AF6A 1CE8B 2X7HA 3RRJA 2WWRA 4YRGA 3EGOA 4CIVA 1KYQA 2OILA 2H85A 4Y9UA 2BSXA 4YJ2A 1HNXB 1ST2A 4GAEA 3KL2A 1N5JA 1NF2A 1IHDA 4KODA 4KYTA 4A1FA 1FVXA 2X4IA 3L9WA 1PFWA 5FPQA 5IC6A 5B1YA 2HF9A 3H9CA 2C20A 2G40A 2INGX 1VE7A 5BP7A 1T2CA 2RI6A 4V0RA 1T6YA 2HJWA 3K0AB 1DAKA 4K6CA 4PXSA 4KYVA 4EB6A 2HMYB 2CLLB 3IT1A 1RZ3A 2WD9A 4JV5B 2RBKA 4ZQEA 1BE8A 1Q1ZA 2HC9A 3CUEF 3PNKA 1FNSA 3LZ6A 2QMEA 1APBA 3SM9A 1GZ6A 3NIBA 4F86A 1PLLA 3QVXA 1WP4A 2EERA 3L04A 2JFWA 4LJ7A 2O8CB 4IGKA 4C0AC 4J1TC 3DQZA 1PI3A 4LZLA 1C3VA 1SUFA 3V1NA 1FF9A 2H4XA 1CNEA 2DXIA 3A6JA 3AEKA 1JXAA 1FXWF 3W79A 1XNJA 1FFGA 1YNOA 2I3ZA 1PK8A 3SYNA 2COEA 4BNGA 4MINA 1JG2A 4C7KA 1QDLB 2UZIR 2HT1A 3M2PA 5HPYB 3O47A 2HT6A 2FUG6 3LU1A 2WHRA 3U7EB 2A9JA 2VT2A 3NW9A 4PLYA 2PGXA 1Q6ZA 4RVFA 1P17A 3TDKA 4DA7A 4Q3AA 2FRDC 4PPGA 2IYEA 1LI4A 2QXUA 4II7A 3Q8LA 1IPHA 2FRVA 3SQOA 1G291 4ZARA 1WM1A 2PDAA 1ZIOA 4DIDA 1M0EA 3AL0C 1CRWG 3I37X 3KQNA 1SC1A 5IULC 3AF0A 3GEGA 3U4QB 2ZIFA 1P8AA 4KYUA 3ZWMA 2NT3A 3CM0A 1IPEA 2ZIGA 4K26A 3GAFA 1XMOB 2ZIXB 1RAGA 3GU3A 3ZOZA 4BB5A 13PKA 3E84A 3F7MA 3OCCA 5J2UF 1TCVA 1NYQA 3IPCA 1G7TA 2IZOA 4XGNA 1XMSA 3DUFA 3ZNPA 4DLTA 2QE7A 4BEWA 1M8KA 2X41A 2YASA 1OIXA 1JU4A 1G3QA 5ECGC 4FQ7A 5EJEA 2ROQA 2JD2A 4MGYR 4MQEB 5A5VA 2FWIA 5DNEA 3TZHA 3C3BA 4HX5A 5JYBA 4WBNA 2IODA 3IKMB 4MWDA 5T3YA 1UDRA 2Z9BA 2FY8A 4P80A 4DBZA 5TIIA 1J2YA 2FP4B 4HWKA 2ZULA 2CSUA 2XA1A 3L4EA 5IDQA 4XVUA 1E66A 4RMIA 4EG0A 2V4UA 2DUUA 5C32A 4UHHA 1GZUA 4YJGA 3OBBA 1Y34E 3DLTA 3V4VB 4B17A 1ZJ5A 1UBEA 3GPCA 4QT4A 1BA3A 5JDIC 1EXDA 1NUSA 1Q1BA 2DFNA 2PMBA 3VR5A 5COBA 2EJWA 5A9TA 3QYAA 2BAGA 1FJGB 2EFEB 3KJZA 2K2QB 3EY4A 2FUG1 4IH1A 2ZUFA 1Z63A 1DQSA 4BNIA 2AI1A 1RQPA 3MS2A 3QEOA 4TZTA 2XZTA 1N2OA 1N7HA 2WAMA 3OJXA 3ZZNA 3SXPA 3T9CA 5IABA 3PGJA 3O4IA 4EHJA 1YRHA 3QXCA 3PQFA 3MCAA 4H59A 4I1OA 4XQ0A 2HW8A 1RWXA 2VRCD 1ZJ6A 5AJWA 4Q1DA 4RTRA 3A9TA 1CY2A 3LI2A 4LQDA 3ZBUA 2QZ9A 2WABA 3P45A 4DV2B 5JISA 3PUIA 4N40A 1H6BA 5AKLA 1ZISA 3KQYA 1Z39A 1GEEA 1H6CA 3KT3A 3O0TA 4L0DA 1UEXC 4M0EA 2JJ1D 4Y1FA 3S2FA 3TYXA 1PKEA 4DDVA 2I8AA 4GPTA 2IU4A 3IC5A 4JIMA 4QOSA 3D6AA 4FCVA 5F2NA 4PQRA 3ZVKA 2X8AA 1KYTA 4U2GA 2GXAA 3LXMA 1C9YA 1JF8A 4MV1A 1RU3A 3QVGA 1UQTA 4OSOA 4BO9A 4F3YA 2QP3A 1GNRA 1FDRA 2GZAA 5FOWA 2UU9B 3ZJYA 1WUKS 4ZT4A 1MORA 3H2GA 2DY0A 1P8JA 2ZDHA 3PL1A 4KNWA 4U6QA 1RXSA 1G5FA 3DEKA 4FHDA 4O2AA 1SQGA 5F3WB 1SG9A 4PLVA 2ZANA 4RQAA 1LRKA 2O0MA 4DC9A 4ZQFA 4QQRA 2EHJA 2BF4A 2EV9A 2GN9A 4JJ8A 4LYDA 4JEHA 4ER5A 3DE7X 3PDIA 4I5IA 4C6SA 2OO3A 1O6GA 5GWXA 3BIXA 3QJ5A 5AM2A 2OQ2A 3AX6A 2VAPA 1NUPA 4FVTA 1UXHA 2H11A 3TE6A 3IUPA 4RJJA 1CR2A 1TQDA 2R1UA 1BEEA 3IB3A 4D9GA 1GKYA 1NLYA 1T8PA 3DZFA 3H1BA 3UAWA 1WB9A 3P96A 2AXEA 1M6VB 1M9NA 3JPWA 5H81A 3L6CA 1L5OA 1P4RA 2CNLA 4M3NA 1NF9A 4YRPA 3H0CA 1XD2A 2GBGA 1V3QE 3CLTD 2BCJQ 5D00A 5AKEA 1H2FA 5COAA 4M1OA 2QUJA 4GSKA 5DT2A 3CNQS 4XSVA 5K2MA 2VWPA 3GRCA 4BV2A 3RK0A 4YUXA 1GNLA 4FNAA 1U8AA 4CIAA 1S3SA 1Z2OX 3W6NA 1OH5A 3E1KA 3WA6A 2EQAA 3ASYA 1M75A 2WIKA 3H2JA 1O6FA 2XRZA 1HOTA 4YREA 2FFQA 4MWZA 3KPWA 3B9RA 1E32A 3G1WA 4W7SA 1RRPA 1IHUA 2W43A 1RPAA 2QTWB 4Q9NA 5CPBA 4PZCA 4A10A 4ALNA 3GPBA 3PLNA 4L5AA 8MHTA 1W2HA 2VN8A 3H6HA 1XZBA 1C2TA 1UWKA 3RUPA 2RJ3A 4TLCA 4R8LA 1WVIA 5BMVB 1V9SA 5KYUA 3UWMA 5JC1A 1CW2B 3IS3A 3NCTA 1DLIA 3OTWA 3B5IA 4A8PA 1NQXA 3GA0A 4UU7A 1NULA 2D1FA 1GUYA 1UKAA 1X1EA 3AC0A 3F8TA 1Y5NA 4KPUB 4N47A 2NTJA 2XMDA 3N6RA 3LPCA 4MRVA 3T3PB 3SYRA 3MT8A 3PYLA 3USES 3PQ2A 4LS3A 2P2NA 3D0QA 4EHFA 1QP0A 1G8AA 3BERA 5A5EA 2GUWA 1A71A 1NRXA 1FDUA 1PR1A 1VCIA 1W0KD 2C5SA 2RHJA 4M1ZA 3ZKWA 5EUCA 4DWVA 3ND9A 1K3UB 2AXNA 5TS2A 4Z2AA 3E6AA 4R1MA 1QLHA 3GVPA 1A76A 1U0OC 2HA5A 2PBZA 1VE9A 4OFXA 3WKEA 3NLLA 1Y48E 1A5SB 2BEJA 4FOOA 4KO3S 2E2WA 2K4MA 4KIUA 3H87A 4NECA 5TXGA 5C1BA 1YUBA 4OO3A 4YCNA 3CUTA 1GTRA 1AIPA 4M9XA 2Y76A 3TECE 2K7FA 3CMCO 2E7ZA 4NEGA 1XRRA 5IJXA 4B87A 4PC1A 4A2WA 1OU0A 4E33A 5AMXA 3CZQA 2VZ9A 1OAOA 3C6QA 4TWAA 1G5PA 2ZRFA 1LVUA 2X0EA 1X87A 1TC1A 3ICQB 3NJ8A 1ODIA 1QH8B 1RHJA 2O6HA 3VSDA 2VTBB 3LH5A 5J5VA 2HCRA 2I2AA 2R48A 2H2WA 1DJQA 3H16A 5SICE 1WEHA 4YAFA 2YICA 1U5CA 1JKFA 2L42A 2VKQA 1WMBA 3BGSA 4JJ6A 3FUTA 4MUHA 1E1RD 5E6UA 2OFOA 3QBVA 3IYLW 2GYYA 1PGJA 1TVKA 1WUHS 3D8SA 3E70C 3HYCA 5IT4A 2X86A 3CN7A 3SFVA 1YZLA 3OZVA 2HQSA 3G23A 4CEIA 2B94A 3A36A 1Q91A 2FQYA 4ERXA 1YHZA 4PLPA 2GWRA 5A3VA 3RYIB 2UZ3A 1CLUA 4AICA 3C4JA 3CNHA 1BMFA 3T5MA 2KS6A 1OLXA 3KOUA 3UWPA 5JH7B 4PZYA 4EY8A 2YC2C 4LRQA 1W88A 3RRNA 1NJ2A 5KJFA 3KJEA 3PF9A 4MKXA 3QV2A 5BQ5A 3K1ZA 4UM9B 5KOIA 2QRMA 5T6BA 4MI6A 1LBIA 3WTCA 2ZRHA 3K92A 5ALEA 1LDGA 2E1PA 2HIHA 2NLOA 3EASA 1K68A 3DR3A 3HHPA 3JASB 4P8RA 1U99A 4CKZA 3L0SA 1GLNA 2YC4C 3C6YA 3OBIA 2XJ4A 4YRLA 1JH9A 2EU8A 1MV5A 1QK5A 2RH5A 4X90A 3VC1A 5C8YF 2VRNA 4ZKEA 3KTDA 4HI0E 4JD5A 4XD7A 4BP8A 4HNAB 4F21A 3ODGA 8GPBA 1Q83A 2XD9A 4NJEA 2GNAA 3DVQX 4TV9F 4N5HX 1KKLA 4FOTA 1UADA 1Y9EA 2XSZA 2WF6A 1ZY2A 3HKDA 1DSSG 3ZGXA 4XUEA 4NNJA 3IJ5A 4AZ3B 4EA8A 5DSTA 2IY9A 4MI1A 4B3FX 5KX5A 5KAMA 5T8KC 4KNVA 4IVRA 4L76A 3EMDA 2IH2A 1NONA 2QWXA 4R81A 4UDOA 2JIDA 1F2TA 1T2NA 4LJ6A 3A4YA 4HS4A 4Q4HB 4PQGA 5DMXA 3THXB 3IO5A 1A8QA 1QYIA 3OHSX 3SLGA 4AQYB 3KEOA 1Z9BA 3DGFC 4FGZA 3SQWA 1Y8AA 3HBNA 3L46A 3DPUA 4OCZA 1TYBE 2B69A 4UVHA 4XIJA 4OVKA 5TLSA 4UOZA 4AUKA 1XK6A 2B61A 2C7VA 2AKYA 2B4YA 2NZWA 2O7VA 2I91A 2V3WA 3E2IA 4MV4A 3ZR4B 3LVFO 4FMCF 4P08A 3G17A 3JR3A 2ZE7A 5JQGF 1Z2PX 3LRXA 1AKWA 3OLZA 1JMYA 3GW8A 5B7PA 3L5OA 5C34B 2F3PA 3OC0A 4GX0A 2FZCA 3REFA 4MLPA 2CUKA 3C5HA 1GAQA 1KZ4A 3TI7A 4DLNA 3E5NA 2YHSA 4IG9A 5AW6A 4TKMA 5CH3A 1VIAA 3ESDA 3ZLUA 3U13A 2GKSA 1MP0A 2VCHA 3S1LA 1TMOA 2H2DA 3VYUB 4AY6A 4ZAZA 1MC1A 4OFZA 3EGXB 2P2ZA 1O95A 5EVJA 5IDYA 4CMCA 2X9GA 1X7WB 3NVAA 5F4ZA 3I61A 4BBPA 4KFCA 1YE5A 3KSZO 1BXGA 4XLZA 3IMCA 3TW8B 4OLBA 2VUUA 3EC7A 5EKXA 3G2QA 3ND6A 4MA0A 3LDFA 2D1RA 2QD4A 3QVKA 3EA4A 3KJQA 4FD2A 2VK4A 4RSRA 4JFRA 1DC5A 4XD2A 3Q5DA 2YIJA 4ZQBA 3F90A 5C4MA 1MIHA 1RYMA 5I5EA 3G3EA 2B78A 4PR3A 3RYHA 4ZMRA 3OPYB 2BH2A 1HO3A 4U9HS 2Y1CA 1QJ4A 3TE7A 3KG2A 1VKOA 2C54A 4EFMA 4YRIA 2I4LA 4RVCA 3OC6A 1QIEA 2GEVA 5G0SA 4JQZA 2M6SA 4MVJA 2HWKA 1RT9A 3FJOA 1MH1A 4J07A 2JAWA 1WUJS 4YV7A 2PX6A 2Q6VA 4BQFA 4NBLA 2E3JA 2NO4A 3DD5A 3SJ7A 1DV2A 1V1JA 2CWDA 3H13A 1DB3A 2RBEA 3IH5A 4JLBA 5EMKA 4AZWA 2ZUDA 2CLEB 3AW8A 5L3ZA 3OLCX 5LQMA 1UMBA 2VTVA 1SNYA 5LMNB 2BDUA 1DRVA 1T4CA 4K8OA 4ND8A 3G9QA 5ELXA 1SUPA 1U90A 1YRAA 3UMGA 4DSAA 4FP9A 3WLQA 1ZD9A 4K9LA 1Z5PA 3L6DA 4YUWA 1JTFA 4R1NA 4G9EA 1CHDA 4DLUA 1RWWA 2I33A 4MRSA 4CHGA 2YJ3A 3E4CA 4PIPA 4K6GA 3H5NA 1K2WA 3T3IA 2J0QA 1XCBA 1WPXA 1JTEA 4WKBA 4DCNA 4GOOD 1FYWA 2P9CA 1GZHB 3BCUA 1F0NA 3IMEA 1FX0A 2XOEA 4JGIA 1TL7C 1GG2A 1BH6A 5K4HA 1M54A 2X0NA 2M1ZA 1FNNA 3PCXA 4OD0A 1EB9A 1MIOB 3CXUA 3KOMA 3OKFA 1F20A 3MOIA 3PEFA 3MINA 1C1DA 1SM4A 1LQUA 4CR8A 1NQUA 4I1VA 4KRXA 2Q1XA 5LZ9A 3KUUA 4DRZA 1NYLA 2CN1A 4OLJA 4KXXA 4AJNA 4ENQA 3F1KA 4OMFG 1N4AA 4DHEA 3ILYA 4WVFA 3FW1A 3TTUA 2ZW9A 2ZT6A 1LJUA 2VBFA 5JADA 5DK4A 2ZRGA 1I7NA 5FA6A 1XPOA 5DLDA 3PFWO 5FI0B 2GKGA 4YTEA 4WESA 5DASA 4DXHA 1HURA 3JSAA 2QE7D 5DOVA 3UJBA 2C2XA 2C9CA 2IDMA 1HC7A 2UYGA 1WUTA 1PL6A 2P9TA 3H1FA 1CDZA 5BQOA 4G8JA 4GDMA 3WP0A 5JO0A 1E1YA 1Z6XA 1W85A 1E59A 1A9RA 3GJZA 4J9VA 2MMCA 4PINA 2VQDA 3VPXA 4AZ0B 5JXIA 3WE7A 1NP3A 5KJEA 4FGWA 2JJQA 1T8TA 3N0RA 4RCVA 3AUXA 4BZZA 4DLWA 2PQMA 2I6GA 2J9YB 5K8CA 4FGSA 3GEPA 4DYDA 1CY4A 3DCYA 8ATCA 4JJZA 1D7OA 4PO9A 1D5WA 4ZOAA 2BC9A 3O0DA 1Z4QA 3JQFA 4AN0A 1SUIA 1ZBDA 4HUQB 1JG7A 1NXSA 1YL5A 4P86A 2GESA 5E9JA 4BLSA 2D00A 3ACDA 3FPGA 2IELA 3MGKA 4FEAA 3L43A 3CEAA 4N3AA 1GTG1 2EKBA 3AFIA 3FUUA 3OIWA 3PNBA 2RGNC 5TE9A 1L1FA 2ZQYA 5HW0A 2DHEA 2GFQA 3JCZA 4QXQA 4JITA 3MQ4A 1V25A 5AVSA 5NULA 4P32A 3QVUA 3R5KA 1L0BA 4N01A 4US1R 2B7LA 1QB8A 3PEUA 1QGDA 2NV0A 5E95A 4YWJA 1K3TA 3WNBA 1RWMA 3M6XA 3OLVA 3KXIA 4CN8A 1YVPA 1WXQA 3WP1B 2AQKA 3OEWA 1NWHA 3RRBA 3H75A 4WSOA 4PNZA 4RA9B 4ZI3A 2HA0A 4D81A 3LCRA 3GA5A 2C0PA 3B1ZA 4OSEA 1D3AA 3ROPA 2HSEA 2FEPA 3HSKA 4PHCA 2AEJA 2GN6A 4KQCA 3F78A 4RE6A 3K9LA 2GX6A 4YAGA 3FPSA 4RLSA 4EPTA 4X8MA 1N3IA 2WC1A 3LWBA 2AFIA 3HHEA 3C1TA 1AKMA 1VMKA 3UT0A 5CFLA 3RASA 2WM2A 1J23A 1MRNA 4OQMA 4HBZA 3P71T 4RESA 5CBPB 2A94A 1A3CA 1HLPA 5DTMA 3KVOA 4TYPA 4MWTA 1CUWA 1Z5UA 5THQA 1QTIA 1NG9A 3RG2A 3U7IA 3NHWA 3BGIA 1N6LA 4L5YA 2CNWA 3B20A 3I4FA 1MX9A 1W5EA 4A26A 5TT1A 4WKNA 2QRKA 4G9GA 2X0DA 1V41E 3LC2O 4J91A 3GMDA 4ZGWA 5KQSA 5E7JA 4RIGA 4I9NA 1V45E 4MS4B 4I66A 5T4EA 1EGAA 3DD1A 4GIBA 5FJJA 1ZP6A 4CLDA 3M0EA 3N0WA 4B4DA 3I2JA 4AKIA 3PX3A 1Y4ZA 5DFAA 5D6OA 4X3OA 4BYGA 3FNQA 2I3AA 1VB5A 3HFSA 3NWBA 1FS4A 3EQ7A 4G1VA 1UPCA 1WULS 3GUZA 4KR7A 1PS8A 2P6RA 3ABOB 5FKJA 3AOEA 5JD4A 3PZRA 4MV8A 1PK7A 4O4JB 4Z3KA 3NRJA 1XBTA 3DFMA 4FN4A 1B6GA 2C5FA 2Q0XA 2ZRNA 3PIIA 2UYCA 3C5EA 2O20A 4R1PA 2I66A 1UBFA 4CRWB 3QEAZ 3ZHYA 2PSFA 3H86A 4EEXA 1PEDA 1WQ4A 2KHZA 1CVLA 3FOCA 4IQ4A 2VWQA 3BHMA 5F35A 3SE0A 4DQLA 2WWYA 1EFVB 1VL8A 1NG1A 4L02A 2HQRA 4LMBA 4RY8A 3C74A 1P31A 4EFDA 3SVLA 3CG0A 2OCIA 3R0ZA 3EYWA 4HPXB 2XRFA 4P54A 5EP1A 3IQWA 2MWMA 4A8HA 1JHAA 2YNMA 4PYJA 2PZBA 4HMQA 2JEOA 4RD2A 5KNLA 2EKZA 1XQXA 1JAIA 3QKIA 2Q5LA 2VA9A 1LWNA 4PSUA 3SEZA 2FHSA 2VPQA 3DQQA 1G2QA 5D84A 3ZWYA 3BFXA 3PTZA 1YRYE 1XEXA 3EF0A 3UG7A 5KVSA 4YRJA 1NXWA 1VKJA 1BSVA 5BVHA 4N03A 1KA9H 4E1VA 1Y3FE 1T5SA 2AOXA 3DM9B 1Z4KA 3D4PA 1P0FA 1UM8A 2GVZC 3E7XA 3KKQA 4P3NA 3ESBA 3ETHA 3M3HA 4TTAA 2FQQA 5L4NA 3OEHD 3T7JA 3FVRA 4AY4A 1OZGA 1ULAA 5DTRA 5CDYA 4C0SA 7YASA 4E5VA 1MAVA 3CF6R 2DTDA 1OLUA 4MMXB 3N74A 5DXJA 3VHXB 2A4KA 2PYZA 3B38A 4TPKA 1RXUA 2AFHE 3FTEA 3NHFA 1B7GO 4D74A 1L5VA 2A2ZA 2YV5A 4IOKA 4M49A 3HR4A 3CHYA 2BGLA 3GPDG 4OMCA 4CIXA 4KGXA 1ORWA 5DNVA 3PUXA 2FPMA 4K1XA 3V8QA 2ZBUA 3ZCXA 3CR7A 1YI8A 4RVDA 2LNDA 1TC2A 4UPEA 2Z8YM 1L4NA 1TKRA 5DWQA 1VLMA 4MLDA 1NQOA 1P5HA 1KE1A 3ETNA 3FTNA 3GVHA 2SBTA 3N7AA 1ITZA 1NQAO 2XTAA 3W1EA 4CV2A 5J9FA 3PFFA 3KHTA 5GOTA 2WF5A 1EINA 4X6LA 1FZQA 4F6CA 1CNFA 1OD6A 1DTEA 2QORA 4FSHA 2HMSA 1KQFA 3A6EA 5CNJA 1VE3A 2NSLA 4NQRA 4ZYTA 3OQPA 2MSKA 3AL2A 3C39A 1RI4A 4PO8A 4LV6A 1PGQA 2YJ5A 2HF8A 3C7KA 1W4ZA 1VI6A 4O29A 1MHTA 2WJ3A 3EDYA 3GJ5A 2BEKA 2XMRA 3D2BA 3F67A 1KL7A 3FPLA 1PTJC 3QVJA 4GBED 3UQYS 1UH5A 3A4NA 3ZUPA 5CDSA 3ADBA 2COKA 1H69A 4LRXA 5H70A 2J31A 3SYMA 3UYKA 1QWSA 5EZYF 4E1BA 1JB9A 2E21A 1QHNA 2Q6TA 3OUTA 4FHCA 3QWFA 3OLWA 2H4WA 4MAAA 5JAMA 5G1NA 4D3DA 3G8BA 1LK0A 4TZ6A 3WL3A 2Z3VA 4DPLA 1NXQA 2PWAA 2H1HA 2NO6A 2Y6VA 8ABPA 5DNYB 1G8SA 3D3EA 16PKA 1J8VA 2P75A 2QD5A 2WWXA 3BIJA 1XTPA 3EAFA 4EIWA 5BQFA 3VTKA 1GZ7A 1TU4A 3F2VA 4YQZA 4HDRA 3F0TA 4HHEA 1H6DA 1ZESA 3NTVA 3F9IA 1AKVA 1MTOA 1DIAA 3MS7A 4OQLA 4QDZA 3VR0A 4CW7A 4EX7A 1JHQA 3RODA 2ASEA 2A9VA 3X3HA 3ZD6A 1I24A 1U31A 5I3ZA 1ZC4A 4FSDA 5TMBA 4BRSA 4EUSA 4B84A 4JX8A 1VKRA 4YBZA 4XB1A 1H1LB 5C2JB 4QTYA 1MB2A 4A2CA 4DIFA 3B3FA 4ND6A 5JEDA 3QUSA 1VPWA 4IEFB 5KMGB 4M86A 1YL6A 3GNTA 1W36B 4Q4JB 1NWCA 3ZIUA 3GPIA 3BXPA 5FUXA 1GSOA 4XD7D 3CCCA 1SD1A 2H0AA 3RVRA 3U3XA 3KWFA 4MS3A 4L9AA 3DB2A 2J0UB 3T0FA 4FKMA 4FQ8A 2GNOA 4OQNA 1E2UA 3IV9A 4KQ9A 5LZ5A 2J85A 4J0JA 3GFTA 4ZDWA 1MC8A 3TTVA 1NMEA 2F6RA 4MLCA 1ZCFA 4ZDKA 1I94B 1KJQA 2VRWA 4UNRA 3HACA 3IVGA 4JDPA 3ZU5A 4BB6A 1HETA 4HSEA 4FC6A 2JLZA 4M6WA 2QMHA 4S12A 1E58A 3UK6A 1TF7A 2X6QA 1B8VA 1R5JA 2WP8J 3L7KA 2Y1FA 3MWYW 3ZGOA 4EI7A 1MQAA 4L3WA 3A11A 3R8XA 4CF5A 1XOIA 4RADA 1IN5A 2SKDA 2CC2A 5CHYA 5TQ2B 3SKVA 1UT8A 3TOVA 1AK2A 4AWXA 1I1OA 4D42A 3AKYA 2PGJA 2JNWA 4P38A 5LLSA 4NI5A 1DKQA 3HXOA 4NCIA 4BNJA 1IBKB 1XV5A 4F8JA 1EAMA 2A0WA 2B82A 2B36A 3NZEA 3OJLA 4HAUA 1UANA 4QGHA 1I14A 2Q99A 2R47A 4RZHA 3WOVA 2G25A 5CX4A 4U2BA 4IKOA 5KX5F 3DAOA 2I34A 4LFBB 2O2YA 2WYOA 3TW0A 2WF7A 1PUJA 4BJ1A 2RAVA 5J4KA 1SFRA 2W6QA 5F2OA 5TS3A 1X7YA 3ZLTA 1PJ4A 1Q7TA 1W76A 2Y3IA 3L1VA 4M0CA 3COVA 4XIYA 4B83A 1X1RA 3N0TA 1BN7A 2UYHA 5BWLA 3FDXA 1L5NA 4DB4A 1UCFA 5BRJA 4HYQA 4LG1A 4MV3A 1GPH1 2JI7A 2VAMA 5LKRA 4LV8B 1Z25A 3KPYA 1EFCA 1WTCA 2SKCA 4C7OB 3B53X 4LGMA 4S0XA 4MGEA 5F98A 5AI5A 1I4DD 5K9ZA 5BSVA 3ELWA 2NQTA 1PBTA 3A05A 1VC2A 2V3CC 1U0RA 1AH2A 1D2MA 1LQ2A 1QRDA 2A67A 2BKVA 2Z57A 1FU7A 2IHUA 2WE8A 5E6SA 1CUJA 3TOXA 4DLLA 3DVRX 1QR6A 2UXCB 1DTWB 2X9NA 1ORRA 4HZUB 4BGIA 2J46A 3GDWA 3SYLA 4AY3A 1L7DA 5EZ6B 3RSGA 4EJMA 2MYPA 5KVCA 1TVCA 4GP9A 4R9SA 2GO7A 3WO1A 5C7YA 5I7WA 5DTQA 2AG6A 2CFSA 4RKRA 1NY6A 3TR6A 1I4LD 5CUQA 3ENWA 3ZGNA 5HM6A 3EYAA 4DIOA 3R3VA 1KR2A 2B4RO 2H1LA 2VPXA 4JSTA 4CLOA 1OZFA 1SUAA 2GRUA 3CGWA 5IJAA 4EJ0A 3CZCA 4KG7A 4MVYA 5HBGA 3KZNA 2P3QA 3A9SA 4RVNA 2NSYA 3Q0EA 2QRGA 5CA0A 1GNSA 1SEPA 4K9QA 3S2ZA 3DVAB 3N58A 5KNCA 4PN7A 1N8TA 3OE4A 5A5DA 1FNMA 2K5UA 1F0KA 4YO7A 4JBWA 1YI0A 3C48A 1SBCA 2AZXA 1OWMA 2PFKA 3OTQA 4NMLA 5DX0A 3QBDA 2YWBA 4NKRA 3PC6A 3O4VA 4KO8A 4RKQA 1ZI8A 2XUGA 1M74A 4MAFA 3E8XA 2UVDA 3V1YA 4DJFC 3FI9A 5BVGA 4A0SA 1QIDA 2NZUG 1FZTA 4PHTA 2FPPB 1Z33A 3RT7A 3KTFA 1CUBA 4UAVA 5LJLA 2QXTA 4OQZA 3KM0A 4BLQA 1FFHA 1OR8A 2WJIA 4LSZA 1Z4JA 1J7KA 4CDRA 1O5TA 1UWCA 1NLUA 2P11A 2UZ0A 2QUHA 1IZZA 3ANTA 1TQ4A 4UTXA 1Q57A 4MR9B 3NNDA 3PXGA 4ILKA 3RR2A 3ZHBA 5EMLA 4B4WA 4C6TB 5AW7A 1KEZA 2I1WA 3IUJA 5JCZA 1MFZA 2B3DA 4ZO6A 3C8HA 1KJ9A 4RHEA 4WWHA 5CVUA 1WXWA 1EBFA 3DDUA 5AI6A 4J29A 4QUIA 2NU8A 4TV8A 4QTTB 3DZCA 2CBZA 1KHTA 2CLIB 3T5BA 3KVRA 3VR5H 3UGJA 1Y1PA 2Q5QA 1ZHOA 2IYFA 4LDQA 3VR6A 1GR0A 3JARA 4IIHA 4TSFA 3T7IA 4MQ4A 5C7LO 1Q3HA 3OMWA 4BO6A 3UOGA 3S4YA 3STYA 4LJ4A 1WWKA 3AJ8A 4K86A 5AM0A 3ONNA 4ZGBA 1D1PA 2HF7A 2ZP1A 4MPRA 4N6OA 5H4HA 4HDNA 2JFYA 1J2TA 1KYVA 3KYBA 4BE7B 4AO7A 4G9BA 3PRJA 4J0FA 4W1QA 2HRDA 3ZE2B 2QZZA 3JAWA 3MJEA 2CKMA 1ECGA 1X70A 1U5BB 1TGVA 2DT5A 2Q4TA 3BH6A 4QVGA 4GRIA 2HIGA 3BCSA 1P73A 3P2YA 1VDZA 5DP2A 3T3DA 2O52A 1HNWB 2ON6A 1KEUA 3VKHA 2O8FB 1OT5A 2YV2A 4CCSA 4LW8A 2Y0PA 1WBDA 5JI2E 2GCOB 2IHVA 1COWD 4CG0A 2CHGA 1J06A 2OBXA 1G21B 4NF2A 3GB9A 3TOSA 4JC5A 1QGYA 2G5CA 1DO0A 4MVJP 4OH1A 5IFLA 1CR1A 3DT6A 1JLLB 1ZXLA 3HS3A 3NWEA 3WQHA 3SE7A 4PZPA 1XN4A 3AONB 2P4QA 1XWWA 2V6JA 2TMDA 4YH1A 3SR3A 1RPJA 4B6PA 4RO0A 2C4HA 4IXTA 4F2DA 1PDWA 2I4OA 3FYTA 5JALA 2C4NA 1Y8QB 1DBPA 1D4OA 4QODA 1NBHA 4O3MA 3D6UA 2FWAA 4JQSA 3W8NA 1ZGHA 3PE6A 3GP5A 1IK4A 4S1OA 3M4XA 1FVFA 2R00C 5ISMA 5EGNA 2VSXA 1IQ0A 1PR4A 1J0DA 2B83A 3H0KA 3FTCA 4KL8S 2PUCA 3IKJA 5CVTA 4Q3BA 4B4OA 3DXYA 1VG9B 2IXTA 4JJ4A 3RNLA 4KQGA 1II8A 1N6RA 1GA4A 2PWPA 1PEYA 2ODNA 3K32A 1MB3A 3KYDA 1MOZA 4S1NA 2ZVDA 4ESOA 2ZR9A 2PT9A 2ZAIA 1PTKA 4GQIA 5K0ZA 3E9DA 4L22A 2CL5A 2Z6AA 2XNDA 2XVXA 2ZEJA 2F2TA 3CU5A 3PJEA 3N2ZB 5LBIA 2Q2VA 2CNWD 4B8YA 4A2PA 4DLVA 1NJSA 5IXSA 2Q6KA 2I7DA 1KWGA 3W9SA 4IJUA 1Q3KA 3CT6A 3HXPA 3KELA 3A3YA 3HZRA 1MABA 3KWMA 3QX7A 4YYZA 5KWVA 2QG6A 4FE3A 2BBTA 3OFJA 4YRRA 3HPRA 4MHTA 4YCSA 2HLNA 1A4RA 1JR2A 4IKEA 4Z3DA 1XMPA 1N6PA 2CJWB 2OO5A 2VUHB 2GT1A 3G1TA 5U1PA 4BNDA 1W44A 3LT4A 3DBOB 3I01M 1ZVKA 2AC7A 5B7GA 2O50A 4ZYVA 2WZDA 4GGOA 2D5BA 4NS1A 4XDZA 2QRLA 1Q7BA 2NQ8A 1QOZA 3K5HA 3SSAA 4E2FA 1EFDN 1W4BA 2FZWA