3N5CA

Crystal structure of arf6delta13 complexed with gdp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
147
Chain Sequence
b'MRILMLGLDAAGKTTILYKLKLGQSVYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 6
publication title SAXS and X-ray crystallography suggest an unfolding model for the GDP/GTP conformational switch of the small GTPase Arf6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 48
structure length 147
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3n5cA00
2QMHA 1N5IA 2JJ2A 2H17A 4NCNA 2IYSA 5KNBA 1BH2A 1JAIA 4MKIA 1RC8A 4IVRA 5HKKA 2ZYVX 3QG1A 2AXNA 5EE1A 2QE7A 4LUCA 1E9DA 5FTJA 3IILA 5TMPA 5FTMA 1G5RA 1G5PA 3CNLA 3VR1A 2CMKA 3TIFA 2CJWA 2YJTD 3D31A 4C0LA 1U9IC 4CEJA 1KO1A 3AKYA 5HTKA 2DHRA 2Z43A 4CZ2A 3AF4A 2WJHA 1E9RA 2ECKA 3W90A 4KYUA 1T5LA 2R9VA 4UKDA 2G0TA 4A1FA 2CHVA 3W8NA 1T8UA 3KXIA 3U44B 1N6KA 1OYYA 4IKEA 4PHTA 2ZJ8A 5KNCA 3K0AB 1QDEA 1W5TA 1JPNA 2OCAA 2WJJA 4HATA 4Q4AA 1VTKA 4OYHA 3KJGA 4DSNA 2BM1A 4XSHA 2QY9A 3W6OA 5EP1A 1YJ5A 1GP2A 2GJKA 1XPRA 1E9FA 4JL5A 3OIWA 5TB5A 2OUKA 3CZQA 2OSBA 5KDOA 4D4MA 1E2JA 2V6IA 2QORA 3TSZA 1YHNA 1M6NA 2FJUA 4FCTA 4Z8XA 3NDBB 4B73A 3IHWA 1IY2A 5DO9A 3KFVA 3B7GA 1R8SA 3GPLA 2BMFA 3EIQA 5E3HA 1J2JA 2BCGY 1XWIA 3WXMA 2CJWB 1TEXA 1HV8A 4TTPA 5EXXA 3VR2A 4URWR 4CEJB 2OCPA 1IXRC 5AWFC 4OJKA 2F9MA 3TVTA 1X1SA 3SYLA 1DAMA 3WBJA 4A92A 4W5HA 3DKPA 3P4XA 2KJQA 5F98A 3VR6A 2EFHB 4RZXA 1LF0A 4PPGA 4RFSA 2EYUA 3CF6R 1LFDB 3VTKA 3AVXA 1MABB 1KI1A 4QNRA 2HDNB 4Z1MD 5KYKA 2P6RA 3EG5A 3P27A 2FSFA 4CGZA 4TYYA 3EX7C 4TYWA 1CIPA 4MITA 2DBYA 1XCPA 4LK2A 1MRNA 4XIGS 1UKZA 4LOAA 4BLSA 3PEUA 3NH6A 2IWRA 1FW6A 1MO4A 3U7HB 2NPIA 2XOKA 2IYUA 1LB1B 3L0IB 5AJYA 3AVYA 2QM7A 5TVKA 1GIAA 4L8GA 4YQFA 4LBVA 4QBFA 4XTRA 2BKUA 4Q48A 3RNLA 3ASZA 3SYKA 2W6ID 1ZYUA 4C0AC 1DAEA 4JS0A 1RRPA 2WSSD 1VIAA 4TL7A 2EQBA 5TY0A 5KDDA 3CIOA 4LJ4A 4CEIA 3IQWA 3QIAA 3AV0B 1Q3TA 2X1VA 5CITA 1W0KA 1G3RA 4TLAA 3Q85A 3GJ8A 2F3RA 1US8B 1Z83A 4UXHA 5B58C 4Q01A 2CK3D 3NDPA 1K5GA 2Q9BA 1WB9A 4B3CA 3M4YA 3QKSA 4FI3C 4L4UA 3D8BA 2O52A 2BBTA 4IJMA 4Q47A 3PJRA 1MO3A 2R44A 4DUGD 4OQXA 2B8WA 3CKLA 3OF5A 3AEZA 4A2PA 4B3DA 4IOJA 1XMJA 3TGPA 2FFHA 4NHOA 2L0XA 3KTAA 1Z8FA 3NH9A 3QPWA 1AJEA 1XFAA 4KFTA 3BIFA 3NXSA 2ZE8A 2RAPA 2Q3FA 4E03A 1NVUQ 1LW7A 5FR1A 2N46A 3VNVA 4MRPA 2ODEA 4B71A 1KJZA 1Q20A 1OKKD 1KKLA 3EA5A 1KK0A 5JRJA 2FG5A 2JJ1D 4MRVA 3FTQA 1DO2A 2BV3A 3NEJA 4HZUB 4JVMA 4LJ5A 1HT2E 1XF9A 3WYGA 4BWYA 1PLLA 5J4HA 1SVMA 2WWFA 2GEUA 1E94E 4DLUA 4IOMA 4AD8A 1MT0A 3ZH9B 4LBWA 2DB3A 3R9XA 2BHRA 3VX4A 1S0UA 3UMSA 3LH5A 2GDJA 3H84A 3I73A 3VU9A 2OV2A 4ZDWA 5FPHA 3RWMB 3GFTA 1ZBDA 4L9WA 3QKSB 1BO6A 4BFZA 4EKDA 1NG1A 4M1KA 1XTKA 3TAUA 3CRQA 3W9YA 3GLGB 1XTQA 2REOA 2A3RA 4PHFA 3AVWA 2JDIA 3QSYA 3KTAB 2ODBA 3T1QA 2GVZC 5DYIA 3K0EA 2WSMA 1G7SA 2AK2A 1M2OB 3X1WA 2QBYA 2GTPA 4V0LA 4EPTA 3SQWA 1E1RD 1R7RA 1RRCA 1NY5A 5J4LA 1ZU5A 4M21A 2I1QA 5B30A 5CB6A 1P9RA 4RD4A 3U7GA 5EE5B 3GQBA 3RDPA 1Z63A 1AK2A 1OH6A 2UZIR 4BFXA 1KMHA 4B2LA 3WNBA 4EAQA 1MH1A 2W2XA 4C7OA 1G16A 2ZJAA 4D0LB 3BD9A 3PIRA 4U00A 1TF7A 2Z5FA 1XMIA 3KQLA 2WKPA 2YC2C 4XH9B 3LY5A 4R9UC 2ZJ2A 1W36D 5H68A 2TMKA 5CLQA 3VU9B 2JIZD 2D4HA 2G1JA 3GCGA 1E79D 1XPOA 3TQFA 3DEFA 3UPUA 1K5DA 2ZETA 4D4KA 2JLXA 2R2AA 3WHKA 2ZSBA 1AN0A 1V43A 3SJBA 4OI1A 2VO1A 3ND8A 2O0JA 4OHZA 3BK7A 4HDOB 2CCKA 1GWNA 4JL8A 4PHHA 3NBZC 2BIFA 2KBEA 2EFEB 3LV8A 1XJCA 4GZLA 2QBYB 3X1YA 3OIVA 4KYIB 4BE7B 4AIIA 1W44A 4ASUD 4WZ6A 1MV5A 5ELXA 1G3UA 1KMHB 4YLGA 2XNSA 1UBEA 2QT1A 1OXVA 2GZAA 4QGAA 3C5HA 2HLDA 3RRYA 2C9OA 1IN8A 1OT3A 3DMDA 1YZKA 2N42A 4D80A 4QM7A 2B7BA 4IW3B 3R8CA 1NF3A 1ZCAA 3GJXC 3U6BA 3THYA 4D26A 2CLSA 2KE5A 4C3ZA 1T4GA 4AG5A 3O8CA 3IIMA 4V0OA 4YXWA 2BBOA 2R6DA 1VIYA 4Q9HA 1U8AA 1XMSA 1N5KA 3W5JA 4MKFA 4U02A 3X1XA 2ZIAA 4X8OA 1JR3A 4LYAA 2PCJA 2PZFA 2F6RA 4MRNA 4A82A 2GJAA 4JL6A 3PFIA 3TNFA 3ZIAA 2GA8A 5SZJA 1KZGB 5CDFE 5C1BA 3SI7A 2ZRKA 3V9PA 3V4RA 3CB4A 3VKHA 1UJ2A 1NN1A 1FTNA 5IHPA 1A2BA 2H5EA 3KQKA 4M2LA 4CYMA 1DAHA 3BOSA 4G5SA 3TW8B 2IEZA 3AF0A 1S1MA 1OFHA 2Z4SA 4YMVA 2ZSEA 1OKKA 2JATA 2NZ8A 1W2HA 1GKIA 2C95A 2JJ1A 3CWQA 3VR4A 1Q12A 5KPJA 2I4IA 1OFUX 1F2UA 3HWSA 4JZKA 4QL3A 3O8DA 2A5YB 1R8QA 4JVSB 3K9GA 1E2PA 4UJ5A 1TUIA 4P4SA 3U7FB 2Y8EA 2XNDA 1DG3A 3SN6A 1QRAA 3L0SA 1Q3HA 3SHFA 1JXMA 3M1IA 1QHYA 1TUEA 4RKFA 2IC5A 4QM6A 4Z51A 3QENA 1XTSA 4A0GA 1Z6GA 1WF3A 4QFMA 1NBMD 3AVQA 4ZKDA 1E2QA 1OH8A 1QHIA 2MSDB 1JJVA 4DCNA 1UBGA 2XTZA 4UXIA 3ZD7A 3UANA 3B82A 2QGNA 3D6TB 4O2LA 4V0ME 5DN6D 2ZRIA 5FFMA 5BN4A 4Q7KA 1E1RA 2VEDA 3B5JA 1FOEB 2J0SA 1YZGA 2DYKA 1SKYB 3REFA 3SQXA 2ZVPX 2ATXA 2RGCA 1QVRA 4K46A 2VF7A 4KJZA 3DDCA 1LV7A 1N0UA 1XXHA 2BOVA 5JJLA 3O8RA 1G64A 1HUQA 1KSFX 1F5NA 3NTUA 4II7A 2ANCA 1IONA 3OIYA 1FUUA 5L3VA 4P4SB 2NZJA 3QF4B 3A4LA 5D3MA 3GLFE 1NG9A 4RCYA 1DADA 2IWHA 2NGRA 2JIZA 3NIBA 3QKRB 4HB3A 2NTYC 2H8KA 4DC9A 4WAUA 1E79A 1RW4A 2WBLC 3NBFA 1Z2AA 1N6HA 4NE2A 3DOEA 3RS4A 3CZPA 1CP2A 1XEWX 2F1JA 1D6JA 2NPFA 4NU0A 2PMKA 3ADBA 2FOLA 5H70A 3LA6A 4BPBA 5FUWA 2P65A 2ZAMA 3KQHA 4AURA 4RD1A 2QP3A 4KHZA 1COWD 1RE0A 4LV8B 3K70D 2IS6A 2QPAA 1WMSA 3EWAA 1W1WA 3KKNA 1ESMA 2CLCX 2PT5A 4BFTA 5FUYA 4MQBA 3AVUA 4BQSA 5C4GB 3U7EB 3LX5A 3VX3A 4WZBE 4HLUA 2OLKA 2X19A 4HUQB 3WP1B 4BFYA 4IDNA 1TU3A 2GESA 4EJSC 2BBSA 3EARA 3IO3A 4ASUA 4G0NA 2YHSA 1UEIA 2ZRJA 3A1UA 4X8MA 4OL0A 4ESHA 3E1SA 4NPHA 5FBWB 3NEYA 1TF2A 1KHTA 4OK6A 3EIEA 3TLXA 3ZDQA 5AUNB 2J3EA 3B85A 2CL7X 2VHCA 2X8AA 1CJMA 2ZAOA 4H1UA 1XCGB 3TRFA 3D3QA 2ZS7A 5FTNA 1W36B 1LS1A 1P73A 4ZI2A 1RRGA 3I8XA 3H86A 1Z29A 5EJEA 4MYCA 2NO7A 1NLZA 3HDTA 4DBLC 2GZHA 1JB1A 4QHSA 1NRJB 2V1UA 2IYLD 2UVQA 2WWWA 4BEJA 4F91B 2ZJOA 1G8PA 1X8JA 2O8BA 2ZS8A 4FMCF 4B3BA 1EESA 1BYUA 1CBUA 1GUAA 1B0UA 1EFCA 2AHOA 3CH5A 4OK3A 1KI7A 2BJWA 2QT0A 1QZXA 1SXJD 2GK6A 4EPWA 2VSFA 1E2NA 3FPAA 4XWOA 1OIXA 1SVSA 2FA9A 4US0R 1DVRA 2DWQA 4EUNA 3EASA 4RCZA 1GG2A 3I92A 3J81k 4UNSA 2GBLC 3CRW1 3E2IA 3K0CC 3CR8A 4HAYA 1E9EA 1OLOA 5BYJA 1ETUA 3FE2A 1WBDA 1NSTA 2HJGA 5DI3A 1JAHA 3BH6A 3TSWA 1GNQA 1S2MA 3LBHA 5E7IA 4NCJA 2WJGA 2AD1A 3KUCA 1VG8A 1HH4A 1QG4A 1L4YA 3CF0A 1OW3B 4DLTA 2FPKA 2FZLA 4Q1AA 1D8TA 3MWKA 3AP2A 521PA 1U98A 1G3IA 2P2LA 2OFXA 1CJKC 3CNNA 4FMBB 1A7JA 2NO9A 4M9ZA 4PAOA 4XVUA 5A4JA 1Z0KA 1ONBA 2QMOA 2WWGA 1KI3A 2FN4A 5K8IA 1L8QA 3B13B 3OIUA 3ND9A 3NBXX 1KO7A 4H9GA 1GNRA 1TQDA 2WJYA 3T1OA 5FOTA 1IN7A 5C4MA 5DH9A 2J59A 1NMYA 2FGKA 5EQTA 4PZLA 2ZANA 1DARA 1EXMA 3X2SA 1PLJA 4JLAA 4Q7JB 4LC1A 4JLMA 5FOUA 4ZCLA 1E4YA 3U61B 2JLUA 1CJUC 4OQMA 1GVNB 3LO5A 3MWYW 4I1OA 4IOLA 1SVIA 1KDTA 6Q21A 5JHGB 2WJIA 4P31A 5DI3B 3MAAC 2VQSA 1E98A 2P67A 3U3RA 2GVDC 3LVQE 4A8JB 4F4CA 2ATVA 1E1QD 2I3BA 4HLCA 2ZJBA 2AXPA 3CWZA 4ARZB 3CNOA 3NWJA 4I1VA 1NY6A 1R5OA 5HE9A 4BECA 2VA8A 2O8FA 2FWRA 1IY1A 2BMEA 2QP4A 3RWOA 1X8KA 2PH1A 5FOWA 2FEMA 2RGDA 1F2TA 1FTSA 4F4JA 5GJBA 1TF5A 3ZQJA 2J7KA 2ZSAA 1E9BA 1KSGA 2YOHA 3IGFA 1J90A 1XNJA 2CVFA 3EZ7A 3REGA 4GRAA 5TV2A 5JWHA 4JMPA 4LGMA 4E07A 3A4NA 1JXOA 1HE1C 2W2TA 4MRSA 4WOPA 2CE7A 2IYVA 3CONA 3W5IA 2CL0X 3IBYA 1QHHB 1OIWA 3PENA 1XEXA 4KODA 5FL7A 1JEEA 3UMRA 3HU3A 4A0RA 1EG7A 4HLQB 3K0SA 1YZTA 1GTVA 4MA4A 4RZ3A 4G3XA 2QRNA 2KWIA 1KDOA 1D9XA 3PEWA 2IYRA 2RGEA 3WBKA 1UAAA 2KSQA 1JNYA 4UNQA 1RYFA 3T34A 3BBPA 3EZFA 2YOGA 3IO5A 3QNUA 1X6VA 3EC1A 4DJTA 4PSAA 1D2EA 1W7AA 4B3XA 3Q7QA 4M0LA 3GD7A 1IN5A 4RJLA 3ADCA 2O8FB 3ZJYA 1H8ED 2ZRGA 2GXUA 1E2IA 1PJRA 1G17A 2A7QA 1Z2CA 3H2YA 5LB4A 2WV9A 4US1R 5FTKA 3K70B 1TPZA 1NVWQ 1RFLA 1NN0A 4GT1A 3BE4A 4N0EA 4ZCMA 2W00A 1SXJA 1ZC3A 5IK2D 3KJIA 3QXXA 1E0KA 3OE7A 1DG1G 3HP1A 4K8OA 4IDQA 4V0NA 4OQNA 3SBEA 2DFLA 1XTJA 1XEXB 2HYIC 3IEUA 5TDHA 4B2PA 2G0NA 1KGDA 3U44A 4O25A 2ZRPA 4M1YA 4GOJA 1JECA 4CDGA 4GOXA 1IHUA 5TARA 5DGXA 5FOVA 2XAUA 2P6UA 4D25A 2Z0MA 1UEJA 3U2QA 1BMFD 2CHQA 2OFWA 2IHBA 1P6XA 5AUOB 5G3YA 1BIFA 1HURA 5KSPA 5KPDA 3M6AA 4BLOA 4P4UA 1YZUA 1C9KA 3AUYA 2XX3A 4HAXA 1QHSA 4YDSA 3A58B 5GVRA 2W2VA 121PA 1SXJB 2ZI4A 3I3SR 5JCZA 1R10A 1OHHA 2GK7A 4AI6A 3CUEF 2MMGA 4Q4LA 3UXMA 1KSHA 5JECA 1JEDA 2ZM5A 3IUYA 4TTQA 4W5JA 3OEED 3KXKA 3MD0A 2V9PA 3BGWA 3RRNA 4N0DA 2A5DA 2NOAA 2AKYA 3FYHA 5AK0A 3QY0A 3U4QA 4MYUA 4LWZA 4TLBA 2O8EB 1W0JA 1SVLA 1WQ1R 4P4TA 2XXAB 4D6PA 2WMOB 2BCJQ 4RKEA 4ABYA 1MABA 2A30A 1ZVQA 1DBSA 4LHYA 1NMXA 2ERYA 4BEBA 3KB1A 3CW2A 2OHFA 4M1MA 2J87A 2MSEB 5P21A 2EFCB 5BN5A 3ZZUA 3MFYA 3LBNA 2C8VA 1P62B 1XD9A 1OH5A 4JIMA 2QPOA 3ZD6A 1VG9B 4ZPXA 3SU8A 2ZYTX 3TAHA 1YU9A 4A2QA 2QP9X 3ETLA 1LF5A 3U5ZB 4Q4HB 3PUWA 1J8MF 2ASEA 4LPSA 821PA 4OHWA 2JGNA 2MMCA 2QU8A 4NYMQ 2J1LA 4L15A 4EPRA 4Q1CA 4Q66C 4AK9A 4ZKEA 1VCIA 3CX6A 2WAXA 4A2WA 4NCHA 3Q3JB 1OYWA 2R65A 5UKDA 1US8A 1ZINA 3QI2A 3UIEA 4JT4A 4A0HA 3GJ4A 3U4QB 3SJCA 5CK5A 4GMDA 5EP2A 4L16A 4EPYA 1RPZA 2ZJZA 3VHXA 4DEXA 1K8RA 4QGHA 4JKYA 1AGRA 4LYHA 3DZ8A 1OPXA 5G41A 3LVRE 2Z83A 1H8HA 4JBWA 3GFOA 3LW8A 3EPHA 1G4AE 2O5VA 3A1SA 1G6OA 1ZNZA 3B1WA 1UPTA 1KDRA 1G21E 2AX4A 3LDAA 3WNDA 4TSFD 4PO9A 3T15A 3UWOA 4QOSA 3EPJA 2J41A 4NYJQ 1VCOA 1W46A 1XD2A 1ZC4A 2ZRAA 3OAAD 4HSEA 1TAGA 5CK4A 3NVAA 5DE3A 3C7KA 3T5DA 4R71A 1DE0A 4YC7A 1PV4A 2Q0HA 4LHXA 4Q1FA 2HJVA 3N2IA 4HAUA 3KB2A 1Z5ZA 4Q9LA 3TSOA 4CEHB 4M9QA 3TR5A 4Q4JA 3H4MA 1ELOA 2GXSA 4WVFA 2ZPTX 1I4DD 4KLZA 1VCMA 2OAP1 1UF9A 1U9IA 3PXGA 4HZUA 1KKMA 3TVDA 3CRRA 3GLIE 4LDJA 5FUXA 2GKSA 4AKEA 1N0VC 3AVPA 4MGKR 2CNWA 4I4LA 3AKEA 4BZXA 4D81A 1WBBA 2CXXA 1EFUA 1OXUA 2QAGB 2ZQ5A 4ZCIA 2FE4A 1E96A 4QGGA 4TT3D 5CM9C 3GP8A 2ZU6A 4LHVA 4TL8A 1SHKA 3VKWA 2J7PD 2OCYC 4BRUA 5AR1A 2OM2A 5A5GA 3MWLA 4F92B 1HQYE 3IIJA 2RB4A 2GXAA 1E2GA 4RD2A 4P33A 2XZLA 1N6RA 2ORIA 2ZS9A 2PBRA 4ILEA 3GLGA 1G7RA 4L5BA 3Q7PA 2RCNA 5CYPA 2DCUA 3DMNA 1XD2B 1VECA 2WM9B 3U3MA 3BB3A 4I81A 2R6AA 3BWDD 4FWTA 2HUPA 2OXCA 3NHAA 4DXAA 3CR7A 1Z0DA 1ZM3A 2JCSA 1TU4A 2C5LA 3E5HA 4Q4JB 1JQLB 4JYBA 5IT5A 3I5YA 3F0TA 4KSCA 5IF9A 1NJGA 3JZMA 3TK1A 5KO2A 1T3SA 3B9QA 1WDTA 1O3YA 3W8RA 1GZSA 621PA 2VPPA 5EE3A 3VHLB 1OXXK 2ZUDA 1U81A 3RHFA 1FPMA 2RGAA 1TEVA 3WMEA 4NBSA 1Z6XA 3QKTA 3OHMA 1YR9A 2LKDA 3K8YA 4QRHA 3TBKA 3LXXA 2GXQA 4S2EA 1Z6AA 1CJVC 1N5JA 3CPJB 3PUZA 4W5WA 3K9HA 5SZIA 2C77A 4K81B 1E69A 1XZQA 3C5CA 3RANA 3SZRA 5LB2A 3IQXA 5F2EA 1JALA 3B1ZA 1JJ7A 2X2FA 4POAA 1L7VC 1Z28A 1Z0FA 4JKIA 4AKGA 2Q9CA 3RVBA 2G88A 1S3GA 2HT1A 5JCPA 3I4LA 3PV0A 1P2SA 4MUBA 3TUIC 2YWHA 1EWRA 4PQRA 4PTLA 1HEIA 3K53A 3RS3A 2CBZA 2CDNA 3V4FA 2PX3A 3FFAA 2NO1A 3PUVA 4KLNA 2FSHA 3RYTC 2WIBA 1E3MA 4D0NA 1ZNXA 1OFTA 1OXSC 4MDEA 3R8FA 5KNDA 2F55A 4G01B 2H92A 2G3YA 1GRQA 1G8YA 4R98A 2LKCA 1ZRHA 3EZ6A 2F1IA 4PPFA 4ZI3A 4JLDA 1CU1A 1EFRD 2VSXA 4PC7A 1S4QA 4C30A 1GDDA 3VQTA 4QNMA 5JEEA 4Z1MA 5J4KA 3RABA 2YC4C 1E99A 3BAFA 3RLFA 2JASA 4B6EA 2DY1A 3LQQA 3SEAA 2QNRA 3HR7A 3BERA 1YR8A 4C2UA 3H0KA 4PQFA 1N3BA 1XJ0A 1IXZA 3OAAA 4TMZA 2XSZD 3RS0A 1QHGA 1T3HA 3C14C 4MUAA 2ZUBA 4NH0A 2CCGA 2AN9A 3A37A 1FMLA 4MGIR 4IHQA 1I2MA 3AH8A 1JR3E 1XEFA 4OKSA 3C15C 2W6IA 3K9LA 4A4DA 4GI7A 3AUXA 2WSSA 3L2OB 4XWAA 4JLNA 2WOJA 4NYMR 4TYPA 5KTYA 2VP5A 2ZR9A 4KI0A 4EDHA 3O8BA 1J70A 4IOKA 3LW7A 5HCIA 4KSBA 4B74A 1D2MA 4TLEA 3DKVA 3G5UA 1P2VA 3VR3A 4NDZA 3EIHA 3IPYA 4Q9JA 1DAIA 1IBRA 3NG1A 2CK3A 1IN4A 2PEZA 4TL9A 3L0PA 4WXRA 1SGWA 2O0HA 4B34A 4BZQA 4URVR 1UM8A 1ZU4A 1W47A 4LJAA 2DPXA 1MKYA 1G3MA 2ZRCA 1QVAA 2D2FA 2IS2A 4DUGA 4TMKA 4BLPA 3KDSE 1ZD9A 2NO0A 1ZJ6A 2VTKA 5FH9A 2O0KA 4D2IA 3U60B 2YYZA 4NYJR 2GCOB 4LJ8A 5AJVB 3SC3A 1FMJA 3KQNA 4KFSA 2JEOA 1OJLA 3GLHE 3B8HA 5EE9A 4FMDB 1U8ZA 1P5ZB 3DM9B 4RZ2A 4FIDA 2Q3HA 4JVLA 2IS4A 2JLZA 4DLSA 3A6PC 4OQFA 1CXZA 5EXTA 2ZUCA 3MUFA 3QF4A 1P61B 2VP2A 3ZVMA 4FXPA 5DHAA 4C0QC 3TKLA 4QBGB 1S9DA 2JLQA 2KI5A 3QKRA 4PC3A 3AP1A 4BGDA 1A2KC 2QTFA 1EX7A 3MG9A 2ZJ5A 4HLUC 4NL4H 5FBLB 4G1UC 4BZPA 4F38A 1XXHE 5H8WA 2PLRA 1KOFA 4KU4A 3HU2A 1XRJA 4C9BA 2AKAB 2XTNA 1XBTA 3PG5A 2ZE6A 4C0JA 4DWJA 4ZO4A 2GCPA 3VKGA 1KK1A 3PEYA 2GNOA 4IFBA 4Q18A 3OFND 1KO8A 1RYHA 3VNUA 5EE0A 3UG7A 1ZM4A 3QUSA 2GETA 4P32A 4JJZA 3FHCB 1NSFA 2WWIA 2QTHA 4HUQA 2XTMA 3F5FA 2ZI9A 2VRWA 3NHBA 2PLFA 1WP9A 3HJNA 5JSZB 4LI0A 1IQPA 2AL7A 1R2QA 2QQEA 1R5NA 1S96A 3FGNA 1ZIOA 2V4ZA 5EUQB 2YV5A 3BFVA 1P60A 1II0A 3KKPA 1FP6A 1ZM7A 3AVVA 2Q9AA 2CHGA 2WMNB 2PL3A 3GJ5A 4PZZA 3EC2A 4CT4B 1HA3A 4KBFA 1GFIA 1KDPA 2W6JD 4TYQA 5DNYB 2F1RA 4R2HA 2MSCB 3I8SA 1BS1A 4DCTA 2ZRDA 3A36A 3UATA 2XZOA 2FNAA 2YWEA 5HE8A 2WPDD 4BFVA 3QOFA 4WA7A 1F60A 1G19A 4Q9IA 3R20A 3ZQ6A 4JLKA 2P5TB 2BMDA 4R2IA 3VR5A 4URXR 2OEPA 2QZ4A 1G8FA 2XSZA 1NN5A 4HZIA 4QBHA 3ZGXA 1G8GA 2V54A 2O8CB 3Q8XB 1P9WA 2IXGA 2OBLA 3BB1A 3BRWD 4OHXA 2IA5A 1Q21A 2CE2X 2ORVA 4GBMA 4P3YA 3B9PA 4G5OA 2QENA 5FPSA 1YVDA 2YNMA 3ASYA 1ZCBA 2VHJA 2D06A 3O47A 3TR0A 4EQ6B 3BS4A 3QVUA 4DT1A 4EPXA 1N6OA 4HEJA 5FI0B 4M1OA 4ITRC 1KY3A 3BH7A 1W48A 1OXTA 3AM1A 2HEIA 3GLFA 3PITA 3ADKA 2VHTA 3DOFA 1SULA 1G291 3HU1A 3OZXA 4LJ7A 2FFQA 4RD6A 4MKGA 5BYKA 5JRZA 4QJ5A 2EVWX 3CH4B 1TMKA 1T0JB 2OBMA 3EWSA 1AKYA 5JI3E 5F9HA 3DL0A 3W3AA 1YR7A 2NIPA 4DDWA 4Q1DA 2B8TA 5B57C 2W58A 2QQ0A 1WE2A 2QI9C 4G5RA 1FNNA 5G3ZA 4AYTA 1GILA 5KSOA 1AZTA 4DB4A 3OEHD 1VG0B 4GFDA 1J7KA 4Q5IA 1IJEA 4DDVA 2XITA 1A5TA 3EPLA 3FMFA 1Q44A 1W49A 1M7HA 3F8TA 3FMPB 2ORWA 4UNPA 3R9IA 4U5XA 3QXJA 4A6XA 3A1VA 3GJ3A 3R7WB 4F7WA 5KSYA 5IRCD 2WWHA 1FZQA 1IN6A 3SE0A 1VYTA 5E4FA 3WP0A 3B78A 5LD2C 2W0MA 2IYYA 4UQOA 3WMFA 4TQAA 4DIDA 4DT1B 1P2TA 2OFOA 2YOFA 1E9CA 1ZUIA 4AKIA 4BFSA 4A8JA 1AIPA 3P1JA 5L8VA 4HUTA 3GLFB 4ARZA 721PA 4HAVA 3W3ZB 3FKSD 1G7CA 1W4BA 2ERXA 2IX3A 4O2RA 1NBMA 221PA 1YE8A 1J8YF 4TMVA 2VP4A 1LS6A 4O0MA 2E9SA 2P0EA 2RHDA 2IYWA 4I99A 3QJYA 1XJQA 3OFNA 1FQKA 2ZRLA 4D0GA 2OILA 1Q0UA 5E7JA 1LTQA 1JI0A 4Y0AA 5DN6A 1G5TA 3TW4A 5AJWA 2H16A 3I72A 3JVVA 4P0TA 1M8PA 4JLBA 2KBFA 3A8TA 2JJ2D 5JWRA 2ZRBA 4IEIA 1QHHA 1NN3A 4LBYA 2QM8A 2GRJA 2NO6A 4FCVA 1RVDA 4XVRA 1ANKA 5HKKD 3DM5A 1IM2A 2QE7D 4ACBA 5BQ5A 2DWPA 4B44A 1YQTA 3FVQA 4DZZA 5E95A 2OLJA 3P4YA 1KI8A 4XVQA 5EP4A 1YZLA 3FHTA 2VP0A 2IBMA 421PA 4QJ3A 2RGNA 1KK3A 2A5FA 4ZIRB 4FW9A 4B75A 3LFUA 4GDFA 1Y63A 4PQYA 2EWVA 4NYIQ 3SFVA 4G5GA 1ZAKA 4EFNA 1PUJA 4PO1A 5J5CA 1COWA 1J99A 1OIVA 2BKEA 2C9YA 2F1HA 3UG6A 4Q1EA 5AUPB 1GL7A 3CM0A 4PPNA 3QQ5A 3AVOA 3QG5A 4TMTA 2AR7A 3C16C 5FUVA 4EIWA 1C1YA 1Z3IX 2ZROA 1W5SA 2PJZA 1Z22A 2IF0A 4EJSB 3AGPA 3T06B 3EAQA 2JLSA 3TUZC 3WHLA 1VMAA 3K0CA 4TLDA 2C03A 5JBQA 4YMUA 1NIJA 3AKCA 1KI9A 1DPFA 4LCBA 2QPTA 3C4JA 2IXEA 2IK8A 2XB2A 4MH0R 2CLDX 3KJHA 5L3RA 3FMIA 1NNEA 1CR1A 4NP6A 4PANA 1I4TD 4Q7LA 2BEKA 1ZNYA 5FBVB 2QTVB 2B7CA 3QXCA 3RRMA 2BWJA 1N6PA 4ACAA 3UK6A 1FL9A 4XWKA 2WAYA 4IRUB 3CPHA 1MO5A 5KSZA 3I5XA 1DELA 4B32A 1GNPA 2FU5C 2QG6A 4B3GA 2QEQA 4M22A 1NIPA 1GL6A 1EX6A 2Z4RA 1YZQA 4JSTA 2G9NA 1E2FA 5CIQA 2NMVA 3JZAA 1DAFA 1KTVA 1WCV1 1ESNA 1Z0IA 2CL6X 2EW1A 5DIFA 4U7DA 3OEHA 4PX9A 4FD2A 4EPVA 4MGZR 5ANRB 2DFKB 1F3OA 5KUTA 2J0UB 4M9SA 4XSGA 4BUJA 4S35A 2WWXA 1FP7A 1RRFA 2XOKD 4FN5A 4D82A 3ONWA 2RMKA 2ZYWX 1MOZA 4IXMA 2Q3MA 2O8EA 4DRZA 4V02A 2ZU0C 1RKBA 3LNCA 2XXAA 4LJYA 2XJ9A 5D3QA 2D7DA 1VHTA 2NQ2C 1W4RA 3IPXA 4XJXA 1VG1A 2QMUA 3W6NA 5HPYB 4JYCA 1TTTA 4IDHA 4DLXA 2C9CA 1Z6TA 5AJZA 1E0AA 1HQCA 4I1UA 3FKSA 2CEAA 2ZE5A 1DEKA 3MLEA 1E2EA 3SOPA 4DB2A 3LBIA 2DFNA 1CTQA 1PLKA 1II8A 4B48A 4XD7D 3P20A 2FGJA 2O8DB 4HI0E 3U3KA 5DSZA 2HCJB 2ZE7A 4JVNA 4PPQA 5SZHB 2IUSA 4Q4HA 4QHTA 3RSOA 3BJIC 1XPUA 1OFIA 4QHYA 4AY2A 4R7ZA 3EZ2A 1R0ZA 2AWNA 1VCNA 3B1VA 2G1KA 3CF2A 3LRPA 1DAGA 2ODNA 2QSZA 1QBKC 4OI0A 4HYYA 1CKEA 3CX8A 3PUYA 2ZR7A 2D62A 4F4IA 2OZEA 1FX0A 3WY9A 5AUQA 4DHEA 4TLCA 1T6NA 4IDOA 5TXGA 2C96A 4CF7A 2QN6A 3K09A 1ZP6A 4O3MA 2WVJA 1G3QA 1NVXQ 1E1QA 1E9SA 3TJZA 5F9FA 4B33A 1QG2A 4DSUA 2VYFA 3Q9LA 2JAQA 1T8TA 1DAKA 2FX3A 1LY1A 5EZ5A 1P9NA 1XB2A 2V55B 3PR1A 5L3QB 2RGXA 1E0JA 1II8B 1AKEA 2HXSA 1GM5A 5JJIA 4TMWA 3X1ZA 3GJ7A 2LWIA 2YWFA 1G9XA 2REXB 4C0KA 5J47A 2R62A 2B21A 2RHMA 4A36A 4CEHA 1XX6A 4X8HA 4LSGA 1KJYA 3KKQA 4YMSA 5K8UA 4I1SA 1KI6A 3F3YA 2JDID 3EA0A 2RGGA 2J45A 5FPYA 4IVPA 2QAGA 1KYIA 1FX0B 3T1VA 2BC9A 5CJ2A 2ANBA 2QA5A 3CBQA 2H1LA 3THOA 4B2IA 3RSLA 2PJRA 5FPTA 4M1WA 2REBA 4WIAA 5DHFA 1UBCA 3K0FA 2BMJA 2WTUA 2WHXA 1AQYA 1HY3A 3MWJA 1GRRA 2FPMA 1TL7C 2FMXA 1S1CA 1TX4B 3WMGA 3THWA 1H8EA 2IW3A 2PZEA 1AS3A 4NCIA 4ZDJA 1UFQA 2HV8A 3QXSA 4DCVA 1YKSA 4OHVA 4NYIR 3TUJC 3ZVLA 1GSIA 3B1XA 2OXRA 5GJVC 5C2JB 4N1AA 5JJKA 1CF4A 2VIIA 4Q4AB 3GLGE 4W7SA 2YWGA 1KSJA 3GEHA 5IK2A 3T35A 5JMTA 5K8TA 4RD0A 1M74A 3FB4A 1S3SA 3UWKA 3AP3A 1G4UR 3ZVNA 3KFXA 3ZZ0A 5GVSA 1AA9A 1KI6B 3SNHA 4US2R 3QXHA 1HT1E 1W2GA 2B6HA 2R8RA 2EFGA 4KFUA 1P7CA 4JT2A 2Q6TA 2K5UA 2IL1A 1KO4A 1GOTA 4NZYA 2V7QD 4Q21A 2IS1A 3U3OA 3W6PA 4Z8YA 3L8ZA 4C0BA 2H18A 5JFGA 1Q1ZA 3A1TA 4CT5A 2FSIA 3IHLA 3RS2A 4PZYA 4ERNA 5BWMA 3K0FB 1BMFA 2HLDD 2DR3A 4QJ4A 3QF7A 4FMCB 2EU8A 1G6HA 1P4SA 2OAQ1 3THWB 2AWOA 5FBRB 5H1YA 1GKYA 4D4LA 2C2HA 3HPRA 3WRYC 3PVSA 3E70C 3P26A 4RFSB 2G83A 1U0JA 2F7SA 4LV5B 4XD7A 4YXWD 5JS7A 1XD8A 2IYQA 1F48A 3KL4A 3RAPR 4PC2A 2QSYA 2DWOA 1NLFA 4YMWA 5DISB 2ONJA 1ZD1A 2AK3A 3UKDA 4GPTA 1U2RA 1SVKA 5A0FA 1LVGA 3MJRA 5J4YA 1Z0AA 1JR3D 2FV8A 2XEXA 3G82C 4JSYA 1GRNA 3OEEA 4RD3A 4DKXA 3SHWA 2VHUA 1P3JA 5GJCA 3SDZA 1VYVA 2GJ9A 3ZIAD 3BB4A 2QRZA 3C41J 4TZ6A 4TQ9A 3QBTA 4TN1A 4CVNA 3GLIA 2EWWA 1W4CA 4RSGA 4M8NE 3WRXC 5K8LA 3AB3A 4LRWA 1IY0A 2VH5R 4GZMA 2JLYA 2PMDA 4OBEA 5DI9A 4QC2A 2W83A 4CEIB 4Q02A 3AF2A 4AWXA 4KAXA 3TE6A 1KIMA 1O87A 1Z07A 1XU4A 4DSOA 1KNQA 4IXNA 5J40A 5C46F 2ZSDA 3KJEA 2IXFA 4QG7A 5CLLA 2XNDD 4DSTA 3HYTA 4M9XA 5DLQC 1NKSA 1VKJA 1TQ2A 3ZS8A 2VLIA 1SKQA 1AZSC 3IKJA 4LZZA 2FFBA 4UJ3A 4HDCA 1U8YA 3CO5A 3KUDA 2W0SA 2QAJA 1T5IA 3CRMA 3BFXA 3LLUA 4Z54A 3ZS9A 1P2UA 1IXSB 4TQUS 1E32A 2KB0A 1AQUA 1E9AA 1ZNWA 3FDIA 2OESA 2AD5A 2UKDA 4DLVA 3FHOA 3GLIB 5FOXA 3QVVA 3QEJA 4PR0A 4JLPA 4KFRA 2GHIA 3QKUA 2ZVQX 2J5XA 4LX0A 2GJ8A 3KX2A 3SJAA 4AG6A 1XZPA 2WIAA 4JBYA 1G18A 1QHXA 3Q5DA 3U6KA 1GAJA 2VBCA 3PUXA 2R6FA 2IT1A 2BVNA 4NONA 1MRSA 4UNNA 4GMXA 1G8HA 2QMEA 5BN3A 1I4LD 4TSFA 4ZDKA 3R9WA 3W34A 4DVGA 4C2TA 4DCSA 1WA5A 1WXQA 5JI2E 2CCJA 3LWNA 2WICA 2HT6A 2IEYA 4JLVA 4V03A 1DO0A 2GCOA 3OESA 5HZKA 3I61A 4E09A 5E7MA 3TQCA 1T91A 1UBFA 1UKEA 1BOFA 1AS0A 2P3SA 2EFDB 3LX8A 5KDLA 1NVVQ 1E4VA 4BRWA 4DDUA 2PZGA 4G5QA 2PT7A 4M4SA 4TL6A 3ZZTA 3ICEA 1CLUA 4BLTA 1D5CA 1TQ4A 1CR0A 1SKYE 3BORA 3N70A 4D4JA 2AFIE 1ZUHA 2VP9A 4TT3A 1U99A 4B3FX 3I32A 3UMFA 3SBDA 2A5GA 2V7QA 1GL9B 2P6NA 2WZQA 3CLVA 2J7PA 4B35A 4AKHA 1SVOA 2FEOA 1R0WA 1X3SA 2OE2A 2BM0A 3DVLA 4C7OB 5LDDC 1N25A 4WZAE 4YMTA 1E0SA 4IDPA 5AJXA 3CX7A 4PSVA 1NLYA 4PSKA 5JWOA 1KZ7B 3THXA 1W36C 4HB0A 1P75A 1YZNA 3RRZA 4ZV4A 3RC3A 4DEYA 1T9HA 3QPUA 4LJ6A 2YKGA 4LY6A 4GL2A 1BKDR 2X77A 3VFDA 5EXSA 4RY2A 2IUUA 4RZUA 3WYAA 1N0WA 4OK5A 1V5WA 2V1XA 4URYR 1NI3A 5JSZA 2XJ4A 5HR5A 1Z6YA 2N1BA 1R5BA 3GJ0A 5LBIA 1JR6A 2FZ4A 3RS5A 1OV4A 4E22A 1MO6A 3ADDA 1ZM9A 4PXAA 2PCLA 1Q1BA 2F9LA 2YZ2A 1QF9A 3T1TA 1ZW6A 4LHZA 2ZI3A 2P5SA 2OBNA 4IVQA 1U94A 1SHZA 4WW0A 4Q00A 2V8OA 2ZR0A 1R6BX 5CYOA 4TYNA 4OQLA 1Z47A 1OH7A 4N3NA 2FFAA 3L82B 2HXYA 4BFWA 2WKQA 2IF2A 3GEEA 4FCWA 4EFMA 1RIFA 3A4MA 2C98A 1C4OA 1AM4D 4ZDIA 1B23P 4PO8A 3THXB 3THYB 3SYNA 2ZI5A 2BBWA 4CRWB 2J9RA 3QE0A 3ECCA 4X8LA 2J46A 5CDFA 2O8CA 4LYJA 1JBKA 4DCUA 2QGZA 5KHOC 5CJPA 1DTSA 2RKOA 1QHNA 2JLRA 3GLHA 4OJQA 1MR3F 2YVUA 3MMPA 4DDTA 1G41A 4A15A 4OI4A 1X86B 1M7GA 4FINA 2OCBA 2Z6VA 1U0HC 2GZDA 4PC1A 1ZUNB 3KKOA 5JS8A 4EQ6A 3T61A 1OB2A 2ZREA 3SR0A 1UKVY 3AVTA 5EXPA 1CJTC 5HZHA 1M7BA 1ZM2A 1FFHA 4GP6A 4HB2A 1FNMA 1OB5A 3Q72A 1EFRA 2ZXUA 4ON9A 4URUR 2I1VB 2H57A 3DZDA 1CR4A 3B2EA 1NL3A 4QBIA 3H1TA 2IYXA 3FWYA 1KAGA 2XZPA 4HB4A 3ZVRA 2J0QA 3EPKA 3I1FA 2VL7A 3A1WA 4HDQB 5JHHB 1F2UB 1AS2A 1DS6A 3AKDA 5FBQB 2ZEJA 1CR2A 3AF3A 4A6PA 1DOAA 1UKYA 3PQCA 1KMQA 8OHMA 2GILA 4TWZA 2D7CA 4A8JC 2HYDA 3L8YA 4Q7MB 5JEDA 1KK2A 2FH5B 4JLJA 2ZRFA 3M0EA 5CM8B 1N2CE 1VHLA 4GSYA 1HTWA 4V0MA 4E5UA 5JLJA 1R4AA 4KXFB 4YONB 3R7WA 4AC9A 2ZI7A 5GADl 3GLHB 4Y0VA 4LHWA 1BYIA 4M1TA 3V00A 5CIWA 2R6GA 3VAAA 2E1RA 3LXRA 1M34E 1Z0JA 4CIDA 4PFSA 3GFPA 1CULC 1S8FA 3L43A 3BFKA 2ZSFA 5FTLA 2V3CC 1CS4C 2ONKA 1E6CA 2JJ8A 4GOKA 2G77B 3HPQA 3MRSA 4RVCA 2ZTSA 5KU1A 5L3SA 2R6CA 2WJVA 2BJVA 2QROA 3IIKA 4TZ0A 1NP6A 3EZ9A 1Z06A 1E2LA 1R0YA 5FL7D 3HYRA 1NKTA 1N6IA 4A0FA 4MDFA 4FWIB 1IAQA 4TTRA 4LYFA 1XXHB 1FUKA 4JLOA 1A4RA 1PVOA 5J4VA 2E87A 5M04A 1EGAA 5D3MB 4J0QA 2DFTA 1XTRA 1JPJA 2EYQA 4Q19A 4IFEA 2A5JA 2A9KA 2WOOA 4BFUA 4LV6A 2PX0A 1KI2A 2GJSA 1N5LA 1UDWA 1NBME 2D74A 1RJ9A 2RGNC 3EXAA 3PEVA 4KBGA 1R0XA 5CB8A 5FR2A 3LD9A 2FF7A 3FMOB 3GEIA 1YRBA 5G53C 1JQJC 3MJHA 3N2EA 3U3JA 4LPKA 3VMFA 3FOZA 2A78A 3G0HA 2IHYA 1NVVR 5FL3A 3K70C 3SS8A 2ZITA 4KITB 4BLQA 5FPKA 2RGBA 1A1VA 1I2DA 2BEJA 2F43A 1W4AA 3B1YA 4EFLA 3S1AA 3OE7D 3MGCA 1F6BA 1T3LA 5JZVA 1G7TA 4JBXA 5L3SB 4GP7A 1XEWY 4NCKA 2ZJYA 4Q9KA 3BH0A 3C8UA 2V6JA 4ZIRA 1XP8A 3HR8A 3KXLA 3LAWA 4KVAA 4URZR 4C0HA 1E2KA 2IUTA 3AF1A 4XOIA 4XTCS 3X1DA 1Q57A 1RZ3A 2D3WA 3NC1C 4PAQA 3FFBA 2Q21A 4UXJA 3AGQA 1N6LA 2JLWA 2BDTA 4W9MC 2UZ3A 3K9NA 1TNDA 1RJ9B 4NKRA 3I62A 4KO8A 1GKUB 1TQ6A 4EJSA 1S9HA 2PEYA 3K1JA 5G40A 2O8BB 2ODWA 1KY2A 3MCAA 2ZYUX 3NKVA 4GNKA 2HF9A 2LCFA 3EW9A 2NG1A 3QPVA 3WYFA 4OHYA 2WKRA 1GITA 2FDCA 5F3WB 4NTZA 4B6FA 3CPEA 2ZRHA 1PUIA 1Y3AA 2F43B 1SQ5A 1SXJC 1OHHD 3S1AB 3SJZA 1OF1A 3T12A 1ODFA 4L9SA 1Q1EA 4DLYA 2VP6A 4AYWA 2FSGA 4MKHA 5LPNA 1OE0A 4UNRA 2W6JA 4JJKA 2VHQA 3GJ6A 1L2TA 3N5CA 5C18A 2IYZA 4WXPA 1ZIPA 1W0JD 2GAAA 1L4UA 4F93B 1ZD8A 3DPUA 3TH5A 4AYXA 3KQUA 3WNCA 1YRAA 4KCGA 3SFZA 3TMKA 4IEEA 2WPDA 2QUZA 4WBSA 3AQ4A 5B64A 4M1SA 1N6NA 3JVUA 1U90A 4H1VA 1VPLA 2B92A 1IJFA 2HF8A 5IDVA 3ICQB 1ZMXA 3Q5EA 3B6EA 5DYGA 3ZYCA 2AFHE 3LLMA 4BASA 5BW8A 4B47A 2J0VA 1VDZA 5EP3A 3LQRA 4C0SA 2J0UA 1YR6A 4DLRA 2GBLA 1X1RA 3IBGA 4YDHB 1SXJE 2RH5A 1IOZA 4LJ9A 2QL6A 4B76A 1A82A 2ZRNA 3NC0C 2XB4A 3BXZA 4Q1BA 1KAOA 2YINC 3QEOA 4BLRA 2VSOA 4KV9A 3DO6A 3P32A 5SZKB 1OSNA 4B43A 1WRBA 3FKQA 1SVWA 1AGPA 1CRQA 1EFHA 3D7MA 2JLVA 1T0HB 1FQJA 5HCNA 4M53A 5EZ6B 1E2HA 1KO5A 5FOSA 2C04A 3GMTA 2FPLA 4HAWA 1KNXA 2WWYA 4KVGA 4OI2A 4QXAA 1XTIA 4MRRA 4QGFA 4V0KA 4PC6A 2X2EA 1HE8B 3QBVA 4HAZA 1HYQA 1CRPA 2O8DA 4MGYR 1NMZA 1H8HD 3NBYC 1UDXA 3K09C 2C99A 2G6BA 3KZ1E 1K6MA 1XDBA 1NJFA 4MYHA 4PAMA 1UADA 1KJWA 2IYTA 2ZI6A 4A9AA 3RC8A 3DHWC 2GAOA 1Z08A 4NMMA 2H7VA 5BXQC 3RS7A 3L0OA 4QKQA 2XGJA 1EFTA 1F2TB 2JA1A 3PCRB 5KOYA 2ZRMA 3MSXA 5LD2B 2GCNA 2OT3B 1VYUA 1LNZA 1SZPA 1D2NA 1XMVA 4Q03A 3IDQA 1G20E 1EK0A 3B60A 2CVHA 4DLWA 1II9A 3IEVA 1TADA 1U0LA 4ESVA 1X8LA 4FMDF 1XCMA 2VF8A 4LBZA 1W0KD 2GEDA 1D9ZA 5FI1B 1Q22A 2CNWD 3ZLJA 2GWHA 4TMXA 1G1MA 3BC1A 2HCBA 1CEEA 5L3QA 2GEVA 1E2DA 2QAGC 4RFVA 5EUMA 1EWQA 2D2EA 2SHKA 3T5GA 1M1YE 2C78A 4C4PA 4PHGA 1H65A 3K0AA 2F3TA 4LC0A 1Q1QA 4DIEA 1P72A 2GF0A 4CW7A 4DLZA 3CRVA 2OO7A 5GJWC 2OG2A 1E2MA 4MYTA 1PZNA 3KKMA 1KI4A 2A2ZA 4HLDA 5B2ZA 2GF9A
chains in the Genus database with same CATH superfamily
5GWXA 3QMWA 4RPJA 2JJ2A 4RNCA 2ZAGA 3WL8A 3STYA 3MUNA 4XARA 3R0IA 2V3WA 1IHOA 3T4XA 1KQPA 2G9ZA 3PPWA 1E6UA 4P6VF 2WABA 1RC8A 3HB9A 2ZB3A 1GHTA 4R83A 3H11B 4DFDA 2WUVA 2WJ3A 3AOGA 3Q7IA 1F8UA 1C1DB 3QG1A 3KETA 2AXNA 5EE1A 2IS1A 4LUCA 2ZB2A 1DQNA 1Z26A 3G1TA 4E2YA 1OZ0A 5FTMA 5KTPA 3CNLA 3I0ZA 4E13A 2WVAA 4RXTA 2HRDA 1D4AA 3ND7A 1R37A 2AUTA 4XFDA 4CM3A 2PUEA 1PBNA 2OGSA 4K8RB 4MLZA 1U9IC 2CW5A 1RWQA 3N2KA 3WLHA 4C7MA 5JCXA 3BWVA 4CEJA 4CZ2A 4DJAA 5CCDA 3I5UA 1T5LA 2V5VA 4MAMA 1M2WA 1FXSA 2CHVA 3W8NA 4RHYA 1JXQA 4W5RA 4H35A 1PT9A 4Q12A 1PL8A 3L4BA 4BE4A 3QRWA 1ABEA 4CR6A 1XRPA 2DSNA 2OCAA 4ANFA 4Q4AA 5JUWA 1V1MA 2OVBA 4OYHA 3ZTTA 4DSNA 4HWPA 1OTYA 2BM1A 4DNFA 1CQPA 1N2EA 3D3JA 2GLXA 2ACWA 2ZBGA 3D54D 5AW4A 3NOOA 1E9FA 3MT0A 1XPRA 2FRDA 3GA7A 3HP7A 3OIWA 4HRXA 3GPCA 1PNRA 3TM5A 4GGMX 2VDJA 4LWPA 5TEVA 3L9XA 3TSZA 3OQBA 4RZIA 4FCTA 5EIXA 3NDBB 1N2ZA 2BFOA 4B73A 1IY2A 5KX5A 3EIQA 2IW1A 2HMVA 2OWEA 3G0CA 2AR9A 2LCIA 1J2JA 3WJ2A 4Y6QA 1ZGGA 4ND7A 1Q0RA 4MWBA 5EIHA 5B1YA 1DDGA 1FS4A 2AJTA 3DKIA 1B76A 4PPYA 1TKRA 4KLRA 1TEXA 4M76B 4NBWA 4TTPA 4WX2B 4E3WA 5EXXA 5I9SA 1T29A 3GCZA 3IKVA 4YRGA 2CF6A 2XA1A 3N2KB 4BLVA 4CEJB 3OCYA 4YJGA 2EW2A 3GI1A 3TVTA 2C5HA 2CJYA 1ATIA 5H4GA 4YRNA 3ZDBA 3C7CB 1C2TA 1L5MA 4NBRA 3W4IA 1WUTA 1WXIA 3NHSA 4ECEA 3DGFC 3B53X 4B5KA 3SQOA 3AUFA 4X5OA 1U0EA 4PINA 1R4NB 3JRXA 4YQYA 4DIOA 4F6LA 2CLMB 1KI1A 1ZGJA 1ADGA 1V1MB 4FDTA 5A7HA 3U9LA 5KYKA 1KEKA 1QX4A 2YY5A 1DJOA 3AFGA 2I65A 3QUAA 4URFA 3W79A 4B6JA 1KBOA 1AF7A 3CW9A 1JHUA 4K9PA 2E55A 3EMBA 5BSMA 2FZKA 3WRXA 3EGWA 4YRTA 4EG4A 4KYVA 2YUIA 5BR1A 4LOAA 4PVDA 2G25A 5B55A 3PEUA 5IU6A 2NPIA 2H1OA 2QM7A 4YQFA 4L8GA 5LL6P 4LBVA 4BMNA 3MTBA 4QELA 1OASA 4KHPB 3LS2A 1A5SB 4M54A 1JFFA 3RNLA 2QSUA 3ASZA 3MJVA 2R6HA 4AROA 3QV2A 1DAEA 1U8TA 4JS0A 2W4QA 3AU9A 3V2UA 4NG5A 4QDTA 3CIOA 3U3XA 3FRHA 5DBGA 4XYGA 3FAZA 3OZWA 3DXZA 3CW8X 3JD1A 4AP6A 1U7DA 1W0KA 4KNYA 3KR2A 3TTYA 2CWDA 2FPWA 3GPIA 4O4JF 2XODA 5DNWA 1FJ2A 3GJ8A 2AN3A 2HLNA 2J30A 4FR5A 2BGNA 3H5IA 4E0BA 3HB1A 4Q01A 5A9RA 3Q3VA 2CK3D 1KFBB 1TO2E 1K5GA 2QM3A 1XZLA 4AF7A 4JUFA 2BH2A 4B3CA 1GR1A 3T8YA 3M4YA 3QKSA 4C4OA 1SEVA 2O52A 4Q47A 3PQEA 1LNQA 4FX5A 2XQVA 1UC4B 5K4AA 1N3YA 3OCVA 4MV8A 4BFLA 4UD6A 4DUGD 4EM6A 4FLMA 4AUKA 4B3DA 4IOJA 1GPJA 4XAQA 1FBNA 1CW2B 3JSAA 2G9VA 3F2VA 5AW7A 3MIZA 1Z8FA 5FWNA 4D74A 3U1BA 3FTPA 2Y2UA 1V11A 2EX1A 3QPWA 3NVMB 4KFTA 3AR2A 4OHPA 2DUUA 5CDYA 2RAPA 3HUTA 1GA1A 1QG0A 1VMIA 3QVWA 4I55A 4E03A 4UU7A 1LW7A 5BV0A 5C8XA 2N46A 5AW8A 1BSVA 2XD9A 4WL0A 4Y6LA 3FNBA 2ODEA 2EARA 1P4AA 3EA5A 1SEPA 1NI5A 1TD9A 3KT0A 4FHFA 2JJ1D 3L3BA 3FTQA 1DO2A 1BX0A 1PNOA 3QUCA 5FWXA 1DXYA 4AX8A 4PONA 3ELYA 1HDIA 4LJ5A 1HT2E 3PZBA 4Q1VA 3WYGA 5KJ1A 3WQQA 2QTBA 1MA3A 1YH3A 1RLUA 3L8GA 5HRCA 1HKUA 4WCFA 1EVYA 3LXUX 5L7YA 3LGAA 5MN4A 5LNK1 2P35A 1CJCA 2O2DA 3UMSA 3H84A 2E37A 3DBVO 3I73A 4M86A 1WCIA 2OV2A 4ZDWA 3RWMB 2XVMA 1G8SA 2Q7OE 2VJCA 5J2TF 3W5SA 4BO1A 5GTDA 1BG6A 3QKSB 1BO6A 1LC3A 2XAAA 1QQ6A 2BR4A 4XWWA 2MOKA 2I2WA 1LW6E 2QX4A 4KBYA 4M1KA 2NYVA 1ZOLA 3KQYA 5FRDA 1YZHA 1XTQA 4O2BF 1TYZA 4DQLA 1DTEA 1ZN8A 1XTUA 3A7EA 1XDZA 1NKVA 3JQAD 1QZ3A 3WYBA 4REMA 1STOA 3Q7SA 3FSGA 1E1RD 4ID9A 4V0LA 3ZWOA 4EPTA 5JAPA 3CH7A 3CVUA 2NP6A 1D0IA 2BTQA 2P9YA 3OJOA 4N5MA 4MUKA 4X61A 3LBFA 4RD4A 5CB6A 3SKXA 5EE5B 1MQ9A 5I7HA 1OH6A 4JJGA 3GNLA 3QLVC 3SQDA 4H7PA 1WQ3A 1KMHA 2LV8A 3CIFA 3VJMA 3WNBA 4RGBA 2DQZA 5DTMA 1AGYA 3U4IA 4NFYA 1XN1A 2ZJAA 4GLLA 3VYWA 3W2GA 4U00A 2UDPA 1TF7A 1XMIA 3CR3C 3Q15C 4NS1A 2YC2C 4XH9B 1H6BA 2TMKA 5CLQA 4KMSA 1N2HA 1MPXA 1P77A 1WCIB 2D4HA 2DWUA 4IIVA 4Z9AA 1DO8A 3HGTA 2IV7A 1JJFA 1PFUA 2OZLB 4TN5A 2HQBA 2ZETA 4OHBA 4WCVA 2ASVA 2BKLA 2RONA 4EW6A 1IK6A 1ADFA 4TVKA 4GPBA 4KIFA 1FDTA 4KOEC 2PR7A 1GLNA 3L0YA 4GSKA 1Y4DE 1X13A 1ORRA 4OHZA 3OZGA 1Z0SA 5L4LA 3KZMA 4ZAXA 3QE2A 1EFLA 1EGHA 1M6WA 1Z5OA 4OB8A 4DQUA 5K09A 1P0FA 2HADA 1XKTA 3BILA 3LV8A 4XVHA 3U3ZA 2CY0A 5CVCA 1XDWA 1OZHA 1GTJ1 1Z4OA 3DE1X 3N75A 3MJDA 4FGJA 4N6OA 5EERA 4KYIB 3WLFA 2XMDA 3IIEA 2KPOA 2BTQB 3E9ZA 5KKAA 1FS6A 4ISBA 2A33A 5KQRA 3LPLA 1Z16A 2Y27A 3GO4A 1PVDA 1MV5A 3LI2A 4XWTA 5ELXA 1Z4QA 1KMHB 2YJNA 4YLGA 4EZBA 1FZTA 1OXVA 2GZAA 3C5HA 3ENKA 3OLZA 1SC4A 3FVRA 1G2PA 3JYHA 4CUJA 4EW2A 4N3AA 1KRHA 5JXWA 2OZVA 2WW8A 3LP8A 4D80A 5HUHA 1YU6A 3Q5GA 5F7XA 5L40A 2QU7A 1G4HA 2CLSA 4JASB 2XD4A 3MHPA 4D9BA 1QO7A 3FHJA 1XXLA 3IRUA 4AG5A 2BR5A 3IIMA 4V0OA 1EG2A 1TIPA 3AEKA 3UXHA 4CNQA 1U3TA 1BFDA 1H0SA 2NUAA 2WJWA 3IPAA 1ISHA 1BKYA 4XIIA 4ZEXA 4AZWA 4BZWA 3ZKWA 1U8AA 2X0IA 4MKFA 2VTVA 3PHLA 1M2HA 2XMCA 1HMYA 1R12A 2ZIAA 3WWDA 1JR3A 1RXYA 3OZRA 1GQOA 4LOLA 3TQTA 3EEOA 4LXYA 2CJXA 3KE9A 1ZUNA 2GJAA 4IGFA 4JL6A 4A8PA 3TD2A 1Z15A 1EMDA 1LSOA 3PFIA 3ZIAA 2P5YA 1DXQA 4N82A 2PFGA 3WFZA 3UJ9A 2IDJA 1ZUD1 4GGPA 4G1BA 5KVQA 4N12A 1J9ZA 1I1OA 3V4RA 1U2QA 2BLNA 1ABFA 4KXUA 4M2LA 1DAHA 2JW5A 3VR4D 1AKRA 3KBOA 2IP2A 1OFHA 1QIFA 2Z4SA 3PVCA 3N58A 5JZ9A 1P1JA 3KM0A 2E3JA 2ZSEA 3I3OA 4DR4B 1OKKA 5JAOA 5BO5A 2P0AA 4PLVA 2VPTA 2NT4A 1YDWA 2WNSA 4KQJA 4LDQA 1Q12A 5JMPA 4LKOA 3TX6A 3VR4A 5EIEA 1OFUX 4N5HX 3HWSA 3ABIA 3O8DA 1R8QA 2ZT6A 3IPLA 1E2PA 3K9GA 5KHAA 2JEYA 3ZWBA 4AUMA 3E3AA 3GN1A 4WZAA 3E82A 3GFRA 3L0SA 3QFSA 3QU5A 1CZLA 2NWQA 4YACA 1JXMA 3SN6A 3NHPA 4EHNA 5KYNA 3AEKB 1TUEA 4MWSA 4RKFA 3U4GA 1X9IA 4QM6A 4M8KA 1CE8A 1KP3A 1MVLA 1Z6GA 3WWOA 2HL6A 4N7BA 2QPLA 2PGJA 3AIKA 4W7HA 4QFMA 3JYLA 5IJ9A 4C4RA 1N5RA 3A6JA 3EWIA 3OFSA 5KNCH 1XTPA 1JYSA 5B6PA 4BIIA 4PCLA 4ZHQF 5I7FA 3K35A 1EKXA 1RZRD 2I22A 2HU2A 2X13A 3UANA 3U62A 1IN1A 2Y1WA 1KQGA 1LK7A 1OGYA 3D6TB 1KVUA 5DBOA 5G4LA 5F7OA 3JXEA 2OMEA 1K0UA 1E5DA 1MDBA 2ZRIA 5JIBA 4QYMA 3B6KA 2XT6A 2GARA 4Q7KA 2VEDA 1DZIA 1FOEB 3B5JA 5H0IA 2J0SA 1SKYB 3B2NA 1XHLA 3F46A 2QD2A 1W76A 2ZT7A 4K9OA 4TM7A 1DUVG 2JVKA 3M83A 1U6KA 2RGCA 1QVRA 4U2BA 2P9TA 3ZI0A 2I6UA 3ZBQA 2GD6A 1VE9A 4HNTA 1Z5VA 2P91A 1AX9A 1P0PA 2BUBA 2OGUA 4M0UA 3ZDYB 1KRWA 2GZ2A 1I94B 1MB2A 4TXMA 3GG2A 2AW5A 1CVRA 1RCTE 4U7WA 3SCZA 5H3HA 1A97A 5IC5A 4JOSA 4WZAB 5ED0A 1DFGA 2F90A 3D2BA 3U9SA 1DADA 4J0HA 1K8ZB 4DAOA 3RAEC 1JZSA 1U2SA 2JIZA 3LVFO 3UW3A 3ZW7A 1RW4A 5AOVA 3TGWA 3NBFA 1CE8B 3P9QA 3MVEA 3HABA 4FLFA 2XRYA 2A1TR 2F1JA 1D6JA 4WACA 2YH2A 5IJ9B 4RLFA 4UTPA 5H70A 1B6GA 3GW8A 1IVYA 3AHDA 2J07A 1COWD 2YDYA 4L2IA 1WHTA 1UXIA 4MDYA 2WDPA 1ZOIA 2J0QA 1VHJA 4LSZA 4DMGA 2CN1A 1WM1A 1FUIA 5AXAA 3WWEA 3SZOA 3WYNA 1SXIA 2GERA 5FUYA 5I48A 3G68A 2P4QA 3GD5A 1YONA 3O8NA 2WPNA 3IKMB 1MORA 4N7RA 4HLUA 1A95A 1SA0A 2OLKA 3HA2A 4OQDA 3WP1B 3Q7EA 4BFYA 1EUYA 2GESA 2OA0A 3IO3A 2JNWA 4MOWA 4RVUA 4WK0B 1UEIA 3DBHB 3A1UA 1EVLA 4MKXA 2HFKA 4FGKA 4OL0A 2Y0PA 1PGQA 2HJSA 3NEYA 1IG3A 5FBWB 5JALA 2HHLA 1KHTA 1AHNA 2IXAA 3PDJA 4OK6A 4OO3A 2UYHA 2I62A 3A4YA 2J3EA 4C4XA 4EHIA 2CL7X 4L5IA 3O0DA 1L7NA 4TTIA 1JHOA 1R6AA 1XCGB 1R0SA 3LUFA 4HS4A 1HLFA 2I6FA 4QU8A 4X7BA 5CPBA 4DV2B 4ZI2A 4EHLA 1Z29A 4TZKA 4X54A 4MEAA 4MYCA 3WV4A 2JZCA 4EFDA 5ICGA 4ZVQA 2GZHA 3F7OA 4HN4B 4ENPA 1JUDA 1NRJB 1XMXA 2IYLD 3AIIA 4YR9A 3VTAA 3FUTA 3I6IA 3RU3A 1J23A 3KHTA 3IEKA 1BZYA 1DX6A 1OGIA 2O8BA 1CY6A 3ANMA 3MTGA 3R3VA 4R8VA 4AMVA 3RASA 4G37A 4B3BA 5JANA 1V3UA 1X1DA 2KLBA 4L2IB 3HLTA 4OJNA 3PT5A 5IKEA 4EG8A 2PA0A 2AHOA 2VDPB 3LF2A 4L5AA 3ELUA 4OSEA 1KI7A 3CGWA 4S0ZA 1QZXA 5I7AA 4CIVA 1BDIA 2I1WA 3OKAA 1HDEA 3JWGA 4UCWA 4XWOA 4ZYYA 1RT9A 2FA9A 4HS9A 1PGOA 1S7CA 4ZYVA 4R1PA 1LLCA 1YMQA 1ZMOA 1MJHA 4J2OA 4MPRA 4X6UA 3Q98A 4C22A 3EASA 1YL5A 4X20A 4RCZA 1UFRA 2RG7A 3DH0A 3J81k 3F73A 4GZ6A 3UWPA 3CRW1 4LECA 3CR8A 3UJAA 4DQXA 1CK4A 1OLOA 1PSDA 1J1ZA 1ETUA 1TOAA 2BEVA 3A9RA 4ZRDA 5BYJA 1SBYA 1RXSA 1S8AA 3L06A 3STUA 3ZWQA 3BRSA 1JAHA 3TSWA 2PBFA 1GNQA 3LX6A 1S2MA 3G5AA 3LBHA 4WJZA 4IMRA 4BN5A 4ZCRA 2WJGA 3DLHA 5KBYA 1O96B 1QG4A 1E7SA 2AI3A 4FT2A 2FWJA 4QZVA 1HTTA 2FPKA 3QH4A 3AEUA 5CLIA 3VYSB 3F47A 521PA 4UPDA 1A9QA 4MP6A 4BKUA 2OFXA 2XLBA 1OJ7A 1U9CA 2BI8A 4H31A 1CJKC 5G2OA 4M8LA 3WGYA 2NO9A 4PAOA 2QMOA 4EOGA 3AUTA 5ENZA 5I3CA 3AL0C 5CU7A 3ZCUA 2YWDA 2FN4A 1FYXA 2WT4A 3B13B 2VFAA 4QRIA 4XX0A 4H9GA 4ZJPA 1GNRA 1YS4A 3QQPA 2HRZA 4H0CA 3JYOA 3PNYA 1ESDA 1NTRA 1TQDA 2C3PA 5KEIA 5LN1A 4MO9A 5IMBA 3T1OA 3HVRA 5FOTA 3N0RA 1K7SN 4F3NA 4ZICA 4ZMBA 5C4MA 5AVSA 1C4WA 1G60A 4LC9A 4N0QA 5DH9A 3FMVA 4POOA 1DARA 1EXMA 3D1JA 4X20B 2H06A 4BQPA 3JQCA 4Q7JB 4JLMA 3GRKA 5FOUA 1ZN2A 4JEIA 5LYYA 3E1KA 1X94A 1IFXA 4OQMA 4X95A 2WR8A 3LO5A 4I1OA 1L5RA 4QO7A 4MYRA 2WJIA 4Z2YA 2BSAA 4NCAA 4N3CA 3NU1A 2JIPA 5FJIA 1E98A 4RGQA 2CLIB 2N3ZA 1P1BA 2GVDC 2YRWA 3HG7A 3LVQE 4N3GA 3S2YA 4ICIA 4A8JB 1J6UA 4I55F 3RWBA 1H69A 2C8KA 4HLCA 1T1SA 2JFHA 4H6XA 1RTTA 4I1VA 2HJ9A 4EG6A 2EQAA 5AI6A 2KYRA 4BECA 2VA8A 4D8VA 1L8LA 2I9KA 4GKKB 16PKA 3H65A 1H66A 3R5FA 2ZSIA 3S2SA 1PS8A 2B98A 4NESA 2PH1A 4M7OA 2RGDA 5FOWA 4K28A 3RS8A 3SDSA 1RXEA 4BQEA 5GJBA 4PM4A 1T5BA 3PXBA 4MTCA 1KMNA 4W9RA 5AVJA 3SXJA 4XX0B 4ZCSA 4F7DA 2YVKA 5AHRA 1JJIA 4IR7A 3EVBA 4Y9UA 1J90A 1KSGA 4KQ2A 3EZ7A 1JF8A 2BZSA 3DZJA 3REGA 2A3NA 3BMOA 1DPGA 2WIFA 3WLIA 4M9UA 4TVSA 5TV2A 1KFCB 4RUKA 4F3KA 2B35A 3A4NA 3ROTA 1S3IA 4ARVA 2DUMA 4LF6B 2ZVJA 1VIDA 2XQJA 5ELLA 4RHTA 4MCHA 2P8SA 2NXEA 1VI6A 1XAGA 3K20A 3HM9A 4KREA 4KODA 5FL7A 3ZG6A 1EGMB 5JNLA 2DLNA 5DSTA 3DV0B 3KEQA 3HU3A 5KTRA 3ZJTA 4O4HB 1YZTA 3C45A 1CLEA 5I5EA 1P1HA 4YHBA 3GDOA 1F8YA 4G3XA 2GZ3A 4RZ3A 1RVV1 1GV0A 1K08A 1ND6A 1YO6A 3V3KA 3ZZ1A 5BOSA 3PEWA 1AUVA 2WZBA 4WNCA 1UAAA 1K2VN 4KPFC 1NVDA 3EZFA 3LOUA 1DDOA 3KEOA 3QNUA 3DXFA 2IEDA 1Y1KE 2Y05A 3ZLTA 1D2EA 4BIMA 2VG8A 3LDHA 3QVMA 3ZJYA 2HBYA 2JHFA 4UVEA 1XKQA 1PJRA 1G17A 2A7QA 2BFPA 3K6KA 4Y9RA 5LU8A 3SXUA 1ZH4A 5LB4A 2WV9A 5CH8A 1LU9A 3PSAA 4US1R 5E7QA 1UT8A 4BMOB 1MENA 1RFLA 1JLRA 1LBEA 2PSFA 3AF5A 2AI1A 3BE4A 4GT1A 4JC8A 3VZDA 7ABPA 3BMOB 1ZC3A 1JHAA 2VDVE 1ODCA 2Y6UA 4Y98A 4ZOEA 1SUWA 4K8OA 2XE6A 4V0NA 1GGMA 3H5TA 1GJRA 4QFDA 3EFBA 3SBEA 4RK4A 2QL7A 4NK4A 5EEGA 4NU8X 1OA0A 1XTTA 4MHSA 3UAVA 5KYWA 4Z1OA 1QIMA 1DQZA 5JVDB 5HRUA 2JBWA 4DHWA 1X80B 3DEJA 4QX6A 3U44A 2WFAA 2WNIA 2ZRPA 4O25A 3U56A 4GOJA 1JECA 1SG0A 3I2HA 5BOSB 4M9CA 1CV2A 3L7AA 1ZOOA 2YWBA 2Z0MA 4ND2A 2X5OA 5I8PA 4U63A 5L4SA 4PGFA 1WEKA 4D25A 2CNKA 5FULA 2OFWA 2MU1A 2PWAA 4PIMA 2IHBA 4AZSA 3DE4X 5DMHA 5B4VA 2AQIA 1DRJA 5BPHA 4QPDA 1Y1RA 1SHTX 3RREA 5KWIA 5AOBA 1N7HA 1QR2A 3M6AA 3PNKA 4P4UA 5DJ5A 2PBLA 2VJMB 3AUYA 3EDQA 1P4HA 1QHSA 3O3MB 4NG4A 1YDHA 2P4EA 4N48A 1UDAA 4MIYA 3PIDA 3MYRA 5DULA 1OWOA 2O3TA 3DBOB 2AN5A 4EHBA 4WRRA 5BP7A 1ISSA 3ZDCA 4AI6A 2MMGA 4BQQA 3QA3E 5U9CA 4HDKB 3CKMA 3KOMA 3PWKA 3OEED 2IU4A 2R85A 3D59A 3MD0A 4GKBA 1LLUA 1VHDA 1VJRA 1WUKS 2LIPA 2J3JA 3DJYA 5CVDA 5LQKA 5K6AC 4RMGA 1UQRA 2H11A 4N01A 1PFGA 2HMTA 3H05A 4B4UA 2EBFX 2O8EB 1W0JA 5CT9A 1K88A 4A73A 1WQ1R 3HXKA 2ZB4A 1NWCA 1EQAA 1T2UA 1LFAA 2BCJQ 4ABYA 2A30A 5TQVA 3TR0A 2O1SA 3PPVA 1DBSA 4LHYA 4XRGA 2ERYA 2B1QA 3LUJA 3I6ZA 1V25A 1KPIA 5E1BA 2HU8A 2OHFA 2JK0A 3E15A 3JWEA 4NQRA 5ALWA 4UU8A 1U7OA 1X38A 3EXFB 2ID4A 2X3UA 3F7NA 4II2A 3V3TA 3DFMA 1EDOA 3D3NA 1E8NA 4PGGA 4R4JA 3ZZUA 3L0CA 1L5KA 1OH5A 1YA8A 2XV1A 2Q5JA 4Z53A 3OLYA 3GLTA 2ROQA 1JHDA 3E8SA 3EQZA 1NASA 2D2VA 3R5KA 4DJEC 4W5OA 1IZ8A 3LE8A 4S24A 4UEOA 3UCFA 1BHSA 1O6GA 1R27A 5J2UB 3PUKA 3DTVB 1O5IA 2JGNA 2MMCA 1ISGA 1PE0A 2J1LA 2QU8A 2WT8A 4DJDC 4XDGA 4OP1A 2V7EA 1SOAA 3G6KA 4MRMA 4YO7A 1AXRA 3PWTA 1R4MB 1V8ZA 2WAXA 1RAFA 1MVOA 3M6FA 4IIFA 3VZBA 4NCHA 4WT7A 4YPFA 4CMHA 2PQ6A 2WJ6A 1MAVA 1RI2A 3AUAA 3Q3CA 2FYTA 5IXSA 3THRA 3IT0A 4JT4A 3GRCA 4PAGA 3SJCA 5IFKA 3R44A 4NIMA 5KJCA 1L5OA 4XGNA 4DEXA 2W5UA 4IZHA 4CT0A 1YTUA 1L5WA 5KYYA 1VE3A 1T1JA 3DZ8A 1OPXA 5EL0A 4RF2A 1CUDA 2X9VA 1QC5B 4JBWA 1WETA 2VDMB 2RDMA 4GX1A 1UPAA 2LP4Y 1RNLA 2B83A 1BHQ1 3B70A 3E9DA 1G21E 1IBMB 5BQPA 3QLJA 2PMBA 1CUBA 3MPUA 3S2ZA 4MYDA 1YKGA 1I01A 4FR2A 4QOSA 1JDBC 3TFOA 4R2WA 4D98A 2ZRAA 3E7WA 4WK4B 3T5DA 5AM1A 3TN7A 4EMBA 1UWCA 1V1JA 1DE0A 3MWEB 2LW7A 5IKPA 4LHXA 2ZBUA 2C4KA 4L8FA 4ZVPA 5ERXA 5CT8A 3WKBA 1SUFA 5SY4A 1MD9A 2XE7A 2UYQA 4M9QA 2ZTHA 5KWEA 3RIEA 4LS3A 3RD5A 4KLZA 5F4BA 4MMYB 1OWPA 1JKJB 1KKMA 2Y1XA 3OZSA 4HZUA 4WKPA 2WG2A 3PXGA 3TVDA 1L4GA 3AKEA 3LUAA 3IBCA 4J75A 2PBZA 3NQ41 1WUHS 1ZXXA 2XMRA 4C3OB 1OXUA 3OX1A 4DAEA 1PN3A 2O7VA 4YV7A 2FE4A 1E96A 1W5AA 3GP8A 2ZUSA 4QDXA 1H3FA 3GXOA 3IC5A 2XDAA 1GA6A 4CV0A 3E9CA 2AOUB 2AZTA 5AR1A 2OM2A 3U48A 1H4SA 2XTJA 4ZMSA 1U2PA 3BHIA 5JQGB 1XRLA 4PZEA 5H3CA 1G8JA 3TTTA 2GXAA 5B1HA 3LKDA 1N6RA 3WIVA 2JVIA 3GLGA 3VO1A 1Y9ZA 1X7WA 2C9DA 1PHPA 3RE1A 2MINA 1IUPA 2OB1A 2FLWA 3N76A 3HEMA 2VLBA 3KYDA 3U3MA 2I4MA 4QARA 1CQJA 3ZY3A 1M2OA 1L6IA 2R6AA 3F6CA 2PK3A 4R6XA 2EX4A 1SC3A 4F5WA 4HBGA 3S4YA 2DH5A 3H6HA 3WQRA 2H63A 4EENA 3PSHA 3E5HA 4HH3C 5CUQA 2IEAA 7REQA 3MWDA 4L75A 4PSUA 5LCXA 4KE6A 4Z3OA 2OYCA 3ETJA 3N8KA 3WRWA 5KO2A 1T3SA 2C88A 3B9QA 4WECA 3W2EA 1GQSA 1ZJZA 3WA7A 1WUIS 2HC9A 4TWJA 5EE3A 3SY8A 4U7HA 4ZYLA 2ALJA 5BVHB 1OXXK 4IDBA 4IG9A 1U81A 2CLLB 3EEBA 1UANA 4O4LA 4UUAA 2CB0A 1FPMA 2RGAA 1OYOA 2HF2A 4L8YA 4QREA 3V8EA 3WMEA 2WAOA 1Z6XA 3QKTA 1NRXA 4JSRA 1PL7A 1YR9A 3TOVA 4YRPA 1D2HA 1VJDA 3TBKA 4X91A 4P93A 4S2EA 2H29A 1CHNA 1DC7A 4WUVA 3ELBA 2B37A 1L5ZA 3PUZA 1P91A 4MW5A 1TTQB 3LFHA 4W5WA 2YMQA 3INTA 5SZIA 4YYEA 2ADMA 2V59A 1EU1A 5C52B 2NZYA 1V6SA 3EDRA 5FBKA 5LB2A 3NM5A 2VNHA 3OX2A 2X2FA 1FNDA 1L7VC 1Z28A 2X0KA 3A1NA 4POAA 4Q6WA 5SV2A 3RVBA 4RPLA 7ADHA 2O06A 5JCPA 3PV0A 3JSXA 1MB4A 3TUIC 1DIRA 1WY5A 4M37A 1QH1B 4EP1A 5DTEA 2W7TA 5DM70 3M6WA 1U8FO 3E2PA 1Y8QA 1P7PA 2CBZA 4MW4A 1FQWA 3UEOA 3V4FA 3ANYB 1H4QA 7REQB 4DMCA 3O82A 2FSHA 4KLNA 4K6MA 1E3MA 1QIEA 1IATA 3GCXA 5SICE 4OH1A 4N8DA 2F55A 3BSWA 5ES4B 1Y81A 1O6FA 2XXJA 1Y3BE 1FRVA 2WAMA 3DLPX 1EI9A 1G8YA 1QS0A 2WSYB 1WMAA 2LKCA 4DPMA 4DR7B 4Q3LA 4UHDA 1C7FA 4GOOD 3OPXA 4PPFA 3WRYA 3ZLVA 3R0ZA 4P5EA 2JB9A 1J00A 2LR0A 5A2GA 4V1CA 3GY0A 1H85A 4PC7A 4KVFA 4IIGA 2B94A 4CI9A 5A7FA 1X92A 2OHXA 3UHPA 1WVIA 2B4QA 1YJCA 2ABWA 2RJOA 3OLWA 4EDFA 1SR8A 1FNSA 1PIWA 1O95D 3FWKA 5BSVA 3N2GA 2JASA 2H4HA 1DC4A 1Z2NX 3UZUA 2DY1A 3SEAA 4YWHA 4ZMRA 3C39A 2VF4X 4BDTA 5FNVA 1TFRA 4PQFA 1WY7A 3E0QA 1IXZA 3LGXA 3NYQA 2E6KA 3MFQA 4PLWA 4TMZA 5J1TB 2VTEA 3RS0A 1QHGA 1T3HA 1O9HA 2QI9F 4KR0A 1OWNA 2OG1A 1F9EA 1RRKA 1U7UA 3CG0A 5BUCA 2AEJA 1I2MA 4IHQA 3TW8A 1G6Q1 4N47A 4WI1A 1ACLA 1LSUA 2ZTLA 3AUXA 2R8PA 3DA8A 3LL7A 3CVWA 3CNQS 2PKWA 4JLNA 2WOJA 3EUWA 1KOGA 2VP5A 1XROA 4FFBA 3O8BA 4AQ7A 2NADA 1D2MA 5CPFA 4I7EA 5DLPA 1Z0UA 2O2JA 4NDZA 3DV2A 4UHFA 1SKMA 5KAPA 1USKA 5I9NA 3NG1A 2CK3A 4FLEA 4MI6A 3RU2A 4L57A 2X5KO 4GRIA 1IN4A 1D0VA 1RAAA 2FWBA 3L0PA 3SMVA 1SGWA 4BBJA 4RZQA 4URVR 5A3JA 1T9GS 1U5BA 3Q11A 4AXBA 2GN4A 4HVCA 4GEGA 1ZU4A 3GPBA 1FYEA 3IAHA 4N5NA 5K3EA 2ZRCA 4HWTA 4YIHA 5EOVA 2C2YA 3N2GB 4NDAA 2H1WA 1PZHA 4JEMA 4DUGA 1ZD9A 2XYGA 2NO0A 1GPYA 5FNVB 4XEUA 4D2IA 3U60B 2E49A 4KQ1A 3TNYA 1CETA 4MV4A 4G2NA 1PWXA 1H6AA 1XYYA 2H2HA 1KH1A 3OM8A 1E58A 1FMJA 4KFSA 5C5IA 1NZDA 2R79A 5KNBH 1FX1A 5KHLB 4DDHA 1FLDA 2ZYGA 1V9CA 3BDVA 3GUZA 1NJ5A 4N8SA 4JVLA 1U2GA 1CERA 2OLEA 2CZQA 2E4AA 1IOLA 4FEGA 3HKDA 4HMQA 4K9KA 4NOJA 4DCJA 5T41A 2JAHA 2JK1A 3HDYA 4PNHA 3Q8KA 1C9DB 3GF4A 1UWVA 3C70A 2EJVA 2ZUCA 4L0QA 1KRXA 4JI8B 1UBTS 3KQQA 2ZCJA 3OT5A 4FHGA 3SKVA 3QF4A 4Y7DA 1IUKA 4MINA 5AVOA 1E6LA 1TYBE 4FXPA 3DQZA 3DOUA 5CAEA 4V39A 3VBCA 1PFVA 3F5MA 4AMYA 1PJ8A 1U1IA 2BFNA 1C3JA 2KI5A 3QKRA 2YV2A 5AHOA 4ZVMA 2QTFA 3MG9A 1ML4A 3T3PB 6REQB 1CNMA 2WLSA 3T9FA 1XXHE 1PGJA 5JNTA 3ND6A 3HU2A 1XRJA 1P44A 1TECE 1XG5A 3ICOA 4C0JA 1QMPA 5K0TA 4ZO4A 3O21A 4WLUA 1MT3A 2GNOA 1Q6ZA 3WFIA 2VRBA 1ULZA 4MUFA 1ZM4A 3ZQUA 3EZYA 3ZJ5A 3CZ9A 2Y0BA 3VJRA 3JQAA 3QUSA 3CE9A 4NH4A 3SSMA 3ZI7A 3AHFA 5EQDA 1C41A 1NP7A 3VZSA 4XB6B 4ZD6A 1DJQA 1NATA 2XTMA 1VP9A 2AT1A 2VRWA 1MFZA 2IDZA 2BTEA 2EKLA 4LI0A 4UEQA 3IUJA 1GA4A 1MZPA 2AL7A 5HFNA 3KZVA 10MHA 2BY4A 4O4IA 2QQEA 2OO3A 3GEGA 3JQBA 4YFYA 4EW3A 2PAFA 1UFKA 2X4GA 2WF9A 4FYXA 2ZUVA 5ECYA 2IITA 4XEHA 2GB4A 1ZIOA 1KYWA 1RP1A 4MV3A 5EUQB 5BUZA 5CAEB 1TVKA 3R6GA 3ZE2B 2FN3A 2DXIA 1GAQA 1TZJA 2QRKA 1PYOA 1HDZA 2C2ZA 1HA3A 1P6UA 4TYQA 4CT4B 1DWOA 5DNYB 2J3HA 3AZOA 2MSCB 3BF8A 2EKQA 4NS4A 3UATA 4DNPA 2PT6A 4ETNA 3ZWVA 2GFHA 1K8YB 2QR5A 3QJGA 4XQEA 5GP1A 1YC5A 1IH8A 3IB6A 3K2EA 3NVDA 5HE8A 4BFVA 2FR8A 4KEAA 3GMDA 5ALYA 4ZTZB 4R2IA 2BE9A 2NAFA 4NLLA 1PJQA 2AN4A 3JQAB 4URXR 5JH7B 3BJMA 1G8FA 1GG9A 1V45E 2EJBA 2H85A 2VI5A 1H0KA 4HZIA 2DCMA 4KQWA 3NYRA 2V54A 2XUPA 2X2OA 1ZGCA 4MS1B 4RJ2A 3VPGA 3L6OO 2PRKA 4RACA 3HJUA 4GI2A 4M1QA 4PQGA 2CE2X 1L1EA 4GBMA 2C00A 3TLAA 2MYTA 4JXJA 2CXQA 3DZKA 4O4IB 5EZSA 1E18A 4V1CI 1QDLB 1YVDA 4GX2A 2JI9A 1OMOA 3GLUA 4HNUA 5G4KA 5LBUA 3RVMA 1O0BA 4IJ5A 1NNLA 1OTXA 1YUMA 4QTUB 4EPXA 4EWLA 2M2IA 1TVKB 2QKYA 3FXAA 4IDFA 5FWYB 2GNPA 1W75A 3H6GA 4P38A 1NOJA 1U2DC 3BH7A 3FFWA 1DX9A 3VXKA 4N18A 4JNCA 3GLFA 4YYZA 4ALMA 3DOFA 4FUTA 4CCYA 1SULA 2F8SA 4C6RA 4KUGA 1U0SY 1KQOA 2FFQA 5CP8A 5EUCA 1APBA 2OBMA 3EWSA 1UL1X 1V4VA 2YICA 3DL0A 3T7IA 3A70A 1YDEA 4C87A 1R0CA 3AC0A 4HNAA 4L76A 1C7EA 2QQ0A 3QVSA 1QKJA 4G5RA 3U9TA 3K92A 4YJ3B 5G3ZA 1GPMA 4DTCA 1PD1A 1AZTA 4DB4A 1VG0B 1YI1A 1ORDA 2OV6A 3I76A 1DBWA 1M34A 2RHCA 4RHEA 4DDVA 2D8AA 1QPZA 2JBHA 3FI9A 1A5TA 1A0OA 1U31A 2I71A 2V7XA 4I5EA 5MDHA 1W49A 3F8TA 3T7DA 1D3AA 3K1AA 1LPBB 3QXJA 4UDOA 3R7WB 2NNLD 4QPJC 3IDZA 5I8ZA 5KSYA 4MHTA 1BE8A 3H1GA 1OBHA 3UNXA 1FZQA 2PSJA 1EFPB 3R6DA 3MCUA 5TRTA 3SE0A 4DB2A 2CBXA 4LDPA 1Z8HA 5E4FA 1XGKA 3DL7A 3IAM6 3WP0A 2YY6A 3ZU4A 2MR5A 5EJIA 4DM4A 1D6MA 3ZNOA 5CIYA 4Y2QA 4UTOA 1Y6JA 1PD0A 2WM2A 3P1JA 3ZD9A 2YMMA 4N5LA 5DYTA 3GLFB 5H3LA 4ARZA 4CCYB 1QNFA 2VSNA 1BN7A 4W5TA 4N8EA 2O59A 5F9MA 1C3VA 3I8OA 3U7JA 4U3JA 4F4HA 4R0NA 3UY4A 2BFWA 4IQFA 5JTUA 4BGDA 1X7YA 4WZZA 4DG5A 1XVIA 2E9SA 1RZRA 4NPCA 1L5VA 1ZNQO 5LMCA 3QJYA 3DOIA 5K4GA 2UYCA 4PGHA 4FGUA 5KVAA 1HFEL 1OR8A 3OFNA 2WYHA 3V8NA 1Q0UA 1RWPA 2EWMA 5E7JA 2ZTUA 1LTQA 3WGNA