3N5CA

Crystal structure of arf6delta13 complexed with gdp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
147
Chain Sequence
MRILMLGLDAAGKTTILYKLKLGQSVYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords ADP-ribosylation factor 6
publication title SAXS and X-ray crystallography suggest an unfolding model for the GDP/GTP conformational switch of the small GTPase Arf6.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 147
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3n5cA00
1IONA 4MGIR 4D4LA 3U7HB 2J7KA 2G0TA 1OLOA 2IYVA 2NO6A 3B82A 1IN6A 1OW3B 3A58B 1NIJA 4DT1B 4B75A 1DAFA 3HDTA 1I4LD 4TTPA 3QF4B 4OQXA 3JZMA 5CK5A 2PMKA 1XXHE 2OLKA 4PR0A 3Q85A 1I2DA 3KJHA 4EDHA 1DAGA 2PZFA 2A30A 1QHIA 2ZUBA 5JJLA 1DAIA 4JMPA 4MRRA 1EGAA 3GLHE 2R6GA 2XOKD 4B76A 1WCV1 5JI2E 1LFDB 4GDFA 3PUWA 5A5GA 2J0VA 1U0JA 4HYYA 5CM9C 4B3FX 1TF2A 4OK5A 2VA8A 5BN4A 3JVUA 3TH5A 3TUJC 1S2MA 5HR5A 2ZJZA 2WMNB 3QKSA 5J4HA 3PV0A 4B3GA 1RVDA 1NBMA 2ZE8A 1YRBA 3ZIAD 5BN5A 2I3BA 8OHMA 2IHYA 3TSWA 5LDDC 3KB1A 3K1JA 4ZDIA 3X2SA 5JWRA 2JLWA 1WBDA 2QP9X 1G9XA 3M6AA 3WXMA 2BBWA 2BV3A 4DLUA 1WBBA 3SBDA 1TQ2A 3U61B 1R7RA 2CVHA 1E2GA 2EFDB 4ZDWA 3WMEA 5B30A 4A15A 2KSQA 3AF4A 4WA7A 5CIQA 1XD2B 4RCYA 2I4IA 3GJ4A 2XJ9A 4BLOA 2CL0X 3TW4A 4YMSA 3OAAD 5L3QA 3V00A 2GZAA 4B73A 4OK6A 4U7DA 4C3ZA 1E9EA 2Z83A 2OCBA 3FYHA 2BVNA 2FDCA 1LF5A 2ZYVX 4Q19A 3EG5A 1LY1A 4A2WA 3VR1A 1F6BA 4FMDF 2WJHA 4DVGA 5HKKD 5DYIA 2PEYA 1VKJA 5HCNA 5FTNA 1R0ZA 2AWOA 1ZP6A 4M53A 4RSGA 1Q22A 4JLDA 2C78A 4B32A 1II8B 5E3HA 4ON9A 1VDZA 5SZIA 3I5YA 2P6RA 2Q3HA 3U4QB 1AN0A 1LF0A 2QT0A 2YINC 3EXAA 3I32A 4Q47A 3LAWA 3GJXC 2A5GA 4W5JA 4IEIA 4L9SA 2FU5C 2HCJB 4BFUA 3AKDA 3O8CA 1M7HA 2J46A 2XTZA 3QXSA 4GZMA 4V0OA 3KX2A 4G5RA 1X1RA 1FQKA 1E1RD 2I1QA 4HAUA 5FUWA 4B6FA 5KUTA 1Z6YA 2ZRFA 5KTYA 2YVUA 3ND8A 4TL8A 5EP3A 5FL7A 5JECA 3EA5A 3CWQA 4D25A 2EFGA 2CVFA 3RDPA 1XCMA 1U90A 2KI5A 4KSCA 1XXHB 4OL0A 1XJQA 4BLQA 2FEMA 3ETLA 2FX3A 2ZU6A 3VNUA 2X2EA 1VIAA 1NIPA 4A0FA 1G5PA 2JLYA 3PXGA 3N2EA 1AA9A 2ZE5A 2ZJ5A 4TMVA 4POAA 1EWRA 3GLHB 2O5VA 4LPKA 4AC9A 1J90A 2J3EA 3P32A 2ZM5A 2ZRDA 5TY0A 1ZIPA 5KDOA 5EE5B 5J47A 2IYXA 2GXAA 1ODFA 1TUIA 2JIZA 3K0FA 1HQCA 3DZDA 1S0UA 1OXTA 1DARA 4Q9KA 3D8BA 1XPRA 5FOUA 3U7EB 5C4MA 2GEDA 4CF7A 3I62A 2J7PA 3EZFA 2B6HA 3DVLA 4TMZA 2ODWA 1P60A 4DDTA 4TSFD 4OQNA 3FMOB 1S3SA 4ARZA 4CEHB 5EJEA 1U94A 4FD2A 1E2NA 2G83A 3PEVA 4LBVA 4KSBA 3ZDQA 2QEQA 2QRZA 4Q21A 4M8NE 1PUJA 1ZM4A 3W90A 1RFLA 3U3JA 3WMGA 1TL7C 3BE4A 3JZAA 5DHAA 3RLFA 3OE7D 2QMUA 3IIKA 1S9HA 2X77A 4Q66C 2YC4C 3BAFA 4MGYR 1DAEA 1G7TA 1FMLA 4UJ3A 4WIAA 4LCBA 2IBMA 5LD2B 4JT2A 4URWR 2RGAA 4LWZA 4DLVA 4CGZA 3FPAA 4HB0A 3LVQE 1KY2A 3K8YA 5FPSA 5G40A 2C2HA 3QPWA 2ZRCA 2FFBA 3IQWA 4DT1A 5FPKA 2F3TA 2OCPA 4QBIA 2ATVA 3QVVA 2PT7A 3BRWD 3QF4A 4HB2A 3IBYA 6Q21A 1KO7A 1MRSA 3NDBB 3KKMA 1P2TA 3KUCA 5FUXA 4LHXA 4AG5A 1E2FA 2WOJA 3U6BA 2BHRA 1Q1BA 3DZ8A 3ZS8A 5B2ZA 1Z29A 1OPXA 2C77A 3B7GA 3FHOA 1ZYUA 1CS4C 3AP3A 3E1SA 4JBWA 2Z4RA 3Q7QA 1SZPA 2WICA 2WJJA 2PJZA 2ZRPA 3D3QA 2QE7A 5G53C 3W6NA 1G8HA 3OIWA 4PC3A 3VKWA 1NMZA 3AF1A 1E2PA 3CPHA 1X8LA 1VMAA 3PEUA 2XZOA 1LNZA 2O8EB 3VKGA 1JAHA 2W6IA 3QY0A 4JKYA 4B2PA 2ORIA 221PA 1NP6A 2E1RA 2FH5B 4Q1CA 2SHKA 4B6EA 1NF3A 4RD3A 2BEJA 2GEVA 2CHGA 4Z51A 2HYDA 1R8SA 1TQ4A 2C9CA 2VQSA 2ZRIA 5DSZA 1X1SA 3AB3A 5FPYA 4BZPA 1ZM9A 2G1JA 2GAAA 2RGGA 2XAUA 5K8TA 1JALA 1ZC4A 1TAGA 2NOAA 2YOGA 4JVMA 821PA 3NHAA 3VHXA 4DSTA 2AHOA 3BD9A 4EPTA 3HPQA 5CYOA 1OH5A 3NIBA 4ZIRB 2WHXA 1KO8A 3WMFA 4F7WA 1W1WA 3N2IA 1B23P 3T35A 5J40A 4QHYA 4FMCB 3UKDA 3V9PA 1EX7A 3U5ZB 3KQNA 4UQOA 3RWMB 3TBKA 1G291 1JQJC 2JJ2A 1UF9A 1K5GA 1LW7A 1D9XA 3X1WA 1II8A 4TL9A 2YYZA 2HF8A 5GJWC 1FW6A 3BIFA 2JDIA 4A6XA 2JLXA 1LS6A 3P4XA 3OEEA 2FEOA 2VLIA 1MABA 3TR0A 1IQPA 2BM0A 3BFKA 4B2LA 1SVIA 3PUZA 1UADA 3HYRA 2AWNA 2A5YB 4GT1A 4PZZA 2G3YA 4DLXA 2JLRA 2J0UB 4Z8XA 3B1XA 1UKYA 2KB0A 3PENA 4XSGA 4IXMA 2H8KA 1J8YF 3A4LA 1KI1A 4DXAA 1L2TA 3MMPA 4QL3A 4EFMA 4TT3A 1P7CA 4IW3B 1I4DD 1XXHA 1GNQA 1H8HA 1IJFA 4BQSA 1F3OA 3QPUA 4LBYA 3GEEA 4LV5B 1XPOA 2IS6A 2J5XA 4V03A 4ZI3A 4V0ME 1OV4A 1NBMD 4N0DA 3GLHA 1P72A 4JIMA 1VG0B 4RJLA 2MMGA 1W36D 1M1YE 1KO1A 2MSCB 2R65A 1IXZA 3UMSA 1T3SA 1Z6GA 4OJQA 3B9QA 5DO9A 2CMKA 5J5CA 4TLBA 1KK1A 1E0AA 1RKBA 1PJRA 3U44A 1GILA 3AF0A 2BC9A 3VHLB 5DH9A 3KL4A 2AXPA 1LS1A 1Z6XA 4KYIB 1UKZA 5FOXA 5DNYB 2FSIA 1Z08A 2WVJA 2GK6A 3GJ7A 3CPJB 4A1FA 4CEHA 4B3BA 5JRJA 1QZXA 5EUQB 1VCMA 1RYHA 2HCBA 3ICEA 3TR5A 3I92A 3MD0A 5JCZA 1W4RA 4P31A 4CVNA 1HQYE 1OYYA 4D26A 2RGXA 4BLPA 5KPDA 2DFTA 4NZYA 3FOZA 5CJ2A 2RGEA 2W83A 4PPQA 5EXSA 4G5QA 2F55A 1O87A 1KO4A 5FPTA 2ZRMA 2BEKA 3SEAA 2X2FA 2D2EA 1TADA 1N6PA 2IYWA 1G7CA 3MFYA 4HAYA 3TAUA 4L5BA 2YC2C 4U02A 3CH4B 2RMKA 1KSFX 1XDBA 1XJCA 4PC7A 3GEHA 2DYKA 1XX6A 2IYYA 1VYTA 4MITA 3S1AB 2IEYA 2WWXA 3RABA 1DG3A 1QHHA 4TLCA 3GLIE 4LJ6A 5G3YA 1PLLA 3IHWA 5D3QA 3OAAA 4PPFA 3RS5A 3V4RA 3Q3JB 5FL7D 1RW4A 2HJGA 3A4MA 1U81A 4NKRA 1FFHA 2ODNA 4DUGD 1KDTA 1NMXA 4IFBA 4LYJA 1GVNB 2P65A 1SHKA 5TV2A 1A7JA 3MWLA 1CF4A 3I73A 2OM2A 3CX7A 2CCGA 3B8HA 5UKDA 1G5RA 3CPEA 2GKSA 1DADA 2QZ4A 2ZI5A 4D6PA 3AUXA 3B78A 1SXJC 2IXFA 2NO0A 1KOFA 3VR6A 2O8EA 4JLMA 3KKPA 1T5IA 4QJ3A 3QKUA 1UAAA 3AKYA 2ZJBA 1FTSA 1E2MA 4P32A 2ZYTX 4ZCLA 4C0BA 2FFAA 1XTIA 1QHGA 2ZE6A 3UPUA 2JAQA 4JYBA 4LC1A 1U2RA 3FHTA 1HE8B 1G64A 3GCGA 4HLCA 2BKEA 1CBUA 3GQBA 3MCAA 2J7PD 2X1VA 1EWQA 4GMXA 2XTMA 1P4SA 4QC2A 3MJRA 4QBFA 4HLDA 1N6OA 1E9RA 4HZIA 4R2IA 5FTMA 4C2TA 3BWDD 1EESA 2P0EA 1JEEA 4YONB 1QVRA 4FWIB 4GOJA 3UMRA 1T3LA 2R6FA 4KFSA 4ZIRA 4FW9A 2NGRA 4FWTA 3SC3A 5JHGB 1OKKA 4GSYA 4TYQA 3TJZA 4URZR 2IHBA 1JJVA 4Q9IA 3KDSE 1Z06A 1TPZA 2HXYA 4F92B 3CF6R 2ZI9A 1O3YA 4IDHA 2QQEA 5EXTA 1W36B 4XWOA 2IS4A 5FR1A 3GMTA 3H1TA 4OI0A 3T34A 1KZ7B 1Z28A 1OXSC 1AKYA 3U6KA 3ZZUA 4YMTA 4MQBA 1XP8A 1WB9A 1LV7A 3LDAA 2CLSA 2QSZA 4JS0A 4A0RA 1P2VA 1E9BA 4O2RA 1US8B 5EZ6B 5CK4A 2J0UA 1KI4A 1L4UA 2VHTA 4QGGA 5L3QB 4AY2A 2FMXA 4PAQA 3OESA 2EW1A 2LCFA 2IWHA 5CB8A 2ASEA 1R4AA 4DEYA 5JLJA 1ZJ6A 2JA1A 2QROA 3GFTA 3OE7A 4MRPA 5BXQC 1RRFA 3W8RA 3I4LA 5JHHB 3GLIB 4DB4A 4GPTA 3T15A 4YMVA 3LO5A 521PA 3MWKA 1AQUA 4M9ZA 2QE7D 4E09A 3O8BA 2QRNA 2VTKA 4JJZA 2QGNA 5CM8B 4K8OA 1NN3A 2IYSA 2QN6A 4ZDKA 2W6ID 2HYIC 5C4GB 2OAP1 2QTHA 4OI2A 3T12A 5BWMA 3L0IB 3K09C 2ZRHA 2FPMA 4FCVA 1IN7A 4LGMA 2VHJA 2W0MA 1NVWQ 2WBLC 2L0XA 2UKDA 4C7OB 1GL6A 2O8BA 4Q18A 1G4AE 5M04A 4V0NA 1G16A 5DE3A 5E7JA 3ADBA 1N2CE 3L0PA 5IHPA 3A36A 5E7IA 4LBWA 4M2LA 3TMKA 4NHOA 3Q72A 3UK6A 2WMOB 4DIEA 1ZNWA 2OXRA 3OIVA 3KJEA 4A82A 5AUOB 2PBRA 3FE2A 1A2BA 1EFCA 4OQLA 2GJ9A 2PMDA 4IEEA 3HU1A 5JBQA 1TF5A 5JMTA 1XMIA 3CLVA 3SBEA 4NP6A 1KKMA 4NCKA 4M1KA 5BQ5A 3FKSA 3K0FB 3HP1A 4PHHA 2G6BA 1AIPA 1NMYA 3OEED 4DLWA 3IIMA 4B33A 1N5KA 3SFVA 3AQ4A 5A0FA 1G8FA 1Q1EA 3S1AA 2Q9AA 1SKYE 2D4HA 2DHRA 1KSGA 1EX6A 3TQCA 4C0SA 4EPYA 3KQHA 5JEDA 3AKEA 2XNSA 4I4LA 1KNXA 4EFLA 3KQUA 3CZQA 4M1YA 3A1VA 2Q3MA 1YZLA 4M21A 2IXEA 4NH0A 5G3ZA 1VHLA 4KFTA 2JLQA 1PZNA 3SYNA 1GKIA 1AS2A 4TT3D 1XEFA 3O47A 4YMUA 4I81A 4B71A 5D3MB 2ZE7A 2V1XA 1AQYA 2YV5A 3VR2A 1H8HD 1P9NA 5FUVA 3CF0A 1NY5A 4BUJA 4W7SA 3J81k 4IOKA 5H1YA 1W49A 3BH0A 4YC7A 1F2UB 3SOPA 1W7AA 4KXFB 3CNNA 1S1MA 3SJAA 3MWYW 4IOLA 4DWJA 4RD0A 5EP1A 1AKEA 1MOZA 4LI0A 2WWFA 3A1UA 4HDCA 3SI7A 4EJSC 4N0EA 1SKQA 1OFUX 5KSOA 1G21E 4DLTA 2AFIE 3FFAA 2WWWA 4QKQA 1OXUA 1N6LA 3KQKA 4I1UA 4Z8YA 3LX8A 1TF7A 1HH4A 1JPNA 721PA 2GRJA 3LQQA 3AF3A 4AKHA 4V0MA 4HLUA 1S9DA 1E9CA 1W5SA 2WJGA 3PUYA 4RFSB 3TQFA 3RS3A 1X3SA 3VNVA 3RS7A 5EE1A 1LVGA 3SDZA 1GRQA 4E22A 3B85A 2AD1A 1CIPA 2QL6A 4Q7KA 4Q4JA 4LDJA 3TUIC 4A4DA 1RRCA 4QJ5A 2ZRLA 5AJYA 5JCPA 3E2IA 5DLQC 4M9XA 3CIOA 1U0LA 3IPYA 2QQ0A 3EPHA 4RVCA 2YOFA 1XTSA 2PEZA 3Q8XB 4KYUA 4MYUA 4KFUA 2ZR0A 3AVWA 1N25A 3BK7A 4HAVA 2XZPA 3ZQ6A 4BLSA 2OESA 4YDHB 5JRZA 3LBIA 2GJAA 5HE9A 2CHQA 1DELA 3ZLJA 4OQMA 2BDTA 4HLQB 4EPXA 4Y0AA 5FBRB 5IF9A 4KHZA 1ZD8A 4IKEA 2A3RA 2ONKA 1GIAA 4XWKA 2PH1A 4RZXA 4PO1A 2WIBA 2J45A 1E9AA 2VL7A 1NI3A 1AJEA 4UNRA 1KTVA 4TQ9A 3R9XA 4LSGA 3UANA 4QHTA 1YZKA 4BFTA 2ZVPX 4B44A 1US8A 3R9IA 3THYA 1SVSA 4HSEA 2JJ8A 3DPUA 2GHIA 4IHQA 4A0HA 1F60A 1FMJA 3LD9A 1GDDA 3PIRA 4D0NA 1SHZA 2DWOA 1OXXK 2R6AA 3P26A 3ZS9A 2ORWA 1SKYB 1DEKA 1A5TA 4WVFA 2BJWA 2QM8A 1XNJA 4NONA 3OF5A 4LV8B 4B3DA 3N5CA 3GLIA 3EAQA 1UEIA 5P21A 4H1UA 1E4YA 5G41A 5BYKA 2V6IA 1UBEA 2Z43A 3UIEA 1CRPA 4A92A 1QG4A 1ZU4A 1JECA 4OHYA 4PO9A 1WE2A 3ZVMA 2IS2A 2H17A 3HR7A 2A7QA 3OZXA 2AKAB 1WA5A 4PSVA 2KE5A 5HPYB 1MABB 1EK0A 4GMDA 3I8SA 3GLFE 3N70A 1A1VA 2VP2A 4JVNA 4CZ2A 1OFHA 3IGFA 4J0QA 3GEIA 4AWXA 3EZ6A 1G6HA 3RHFA 2FFHA 1GNRA 2BIFA 1ZUIA 3BXZA 4BLTA 2IX3A 1L4YA 1JAIA 4MYCA 4C7OA 4DCNA 4NCHA 4GI7A 3NC0C 2QPAA 3SS8A 3MJHA 4DUGA 3K70C 5BN3A 4JLOA 1JI0A 1N6KA 1QHNA 3PJRA 1ZM2A 4DZZA 1D2MA 4LJ9A 3MG9A 4BE7B 2VP9A 3QJYA 3THWA 2C03A 1OKKD 1H65A 3NDPA 3TLXA 4JSYA 3NWJA 4BFXA 2HV8A 2YJTD 2NIPA 3C7KA 4IRUB 3TSZA 1OIVA 3IEUA 1GKYA 1T9HA 3CRRA 4MUBA 5HZKA 3ICQB 4UNSA 1D2EA 1P75A 3CRVA 3RC8A 4UNNA 2Q9BA 4A0GA 2BM1A 3W9YA 1KK2A 1D6JA 3X1ZA 1M34E 2QT1A 1DOAA 1XMJA 2WV9A 3U44B 3VX4A 3QEJA 3KFVA 2QA5A 1NVVQ 4DKXA 2GXUA 2XB2A 3SU8A 1XMVA 2DBYA 2N42A 3C16C 1E2DA 1Q0UA 2VHUA 3C5HA 4L15A 4MGZR 2F7SA 4ILEA 1WF3A 2PX0A 5KNBA 1PLJA 2VP0A 421PA 5K8LA 1QHXA 3MSXA 4S2EA 1ZUNB 4C0HA 2GETA 2OCAA 5C46F 1G7RA 1P62B 4LUCA 4D82A 3L43A 4RD6A 1E4VA 5TDHA 4HUTA 2OZEA 1G5TA 1E2HA 4OYHA 4PC1A 1W0JA 2V3CC 5D3MA 5L3RA 1U99A 2B8TA 4DHEA 2VSOA 2QUZA 4M9SA 1KDPA 4HZUA 4DCTA 1Z07A 3SQXA 2VYFA 2ZQ5A 1M74A 1F2UA 4LHYA 3SR0A 1U9IC 1AS3A 4NE2A 4TTQA 3K9HA 3U2QA 3SJZA 3AVUA 3Q7PA 1GL9B 2O52A 4F4JA 5KNDA 2C9OA 3CRQA 4WZBE 3FB4A 1GWNA 1SXJE 5LB4A 1Z0DA 1QHHB 3HJNA 3IDQA 2F43B 4LYAA 4Q1FA 5GJVC 1XTRA 5JJIA 1P3JA 3CB4A 4AIIA 2OUKA 2ZI7A 3SFZA 2N46A 1TQDA 3CR8A 3KJGA 2CL6X 4OKSA 4RFSA 4ASUA 1OH8A 2UZ3A 2ZSFA 2FZLA 3RSOA 2IA5A 2CBZA 1G3IA 4OHVA 2NO1A 4ZI2A 2AK3A 3K53A 1P5ZB 3OHMA 4Q7MB 4DDVA 3BS4A 3GLFB 4YXWA 3T1OA 2W2XA 1L8QA 2EFHB 4B74A 4MDEA 2FPLA 3L82B 4LV6A 3MUFA 5DI9A 5KNCA 2D62A 3F5FA 1RYFA 3KTAA 1R0XA 3ZD7A 1KSJA 3QBVA 4PSAA 4CEIB 2DPXA 4MGKR 4NYJR 3VFDA 2RKOA 3GJ3A 2RGNC 3ECCA 3AVVA 4JVSB 2R6CA 5SZHB 2LKDA 3GJ6A 3TE6A 4CIDA 3KQLA 5FL3A 3IPXA 2ZR9A 2IYTA 3FKSD 3KKQA 5SZJA 5B64A 2QNRA 4PQFA 2OILA 2WSMA 4YDSA 1CJTC 2QMOA 2CXXA 1KJZA 3AEZA 4TMKA 3CWZA 4X8OA 3R7WB 1Q1QA 1VPLA 5FI0B 4I1SA 5J4KA 2FOLA 2ONJA 4V0KA 3K9GA 2IWRA 1OIWA 1K5DA 2K5UA 3LRPA 2OG2A 4CRWB 1QHSA 3EZ2A 4BZXA 3KZ1E 3GJ0A 1E0JA 4OQFA 3C14C 1U8YA 3H84A 2GXQA 4XWAA 2ODBA 2EQBA 1D2NA 4WBSA 1KIMA 1P2UA 3HWSA 3RS0A 2ZPTX 3ASYA 4URVR 3OIYA 1FNMA 1AZTA 5IK2A 3DDCA 1VG8A 1MR3F 4Q1EA 1G4UR 2YHSA 4OHZA 1E32A 2BJVA 2DWPA 3AVQA 3GFOA 4DSOA 4HB3A 4OI4A 2BMEA 4E5UA 2QAJA 1TTTA 2A5FA 4BWYA 3QKRB 4XVRA 3KUDA 2OFXA 3TVTA 1KI8A 4DDWA 1CR4A 4MDFA 2RB4A 1NRJB 2IF2A 1XBTA 3NC1C 5GJBA 4R9UC 1N0VC 3VR3A 3DOFA 2VEDA 4PHFA 4HAWA 5KDLA 1NNEA 1CEEA 1SVLA 4TMWA 2OFWA 5E95A 2IC5A 3CNLA 4DC9A 1KMHB 2VHCA 3TGPA 3I5XA 1YR9A 4JLBA 4JT4A 4LJ8A 2D2FA 5HZHA 4TYWA 1IN8A 3CO5A 2GK7A 1GTVA 5CIWA 1HT1E 4Q1DA 4CW7A 3FMIA 4DSUA 2WWGA 3LY5A 1QVAA 4Q48A 1GUAA 2GCNA 4NCJA 4WOPA 4RKFA 1SXJB 4CDGA 3BC1A 1ZRHA 3CBQA 2GWHA 2OBMA 1QDEA 2IT1A 2B92A 2W58A 1ZD1A 3EPKA 1Z3IX 1TEXA 3ZJYA 3T06B 3ADKA 2XEXA 2CCJA 3NBZC 1WXQA 2J59A 2GBLC 3RRZA 3WP1B 4MKGA 1G41A 2XNDA 4V0LA 4PAMA 3ZQJA 4URXR 4A8JC 2EWWA 2EFEB 5ELXA 3THOA 3PG5A 1DG1G 3M0EA 4A2PA 1GOTA 4TZ6A 1NN5A 4O2LA 1F5NA 1E6CA 1R0WA 3GFPA 4RCZA 4DLRA 1VIYA 3DL0A 3BH7A 1U8ZA 4BEBA 3FFBA 3QE0A 2VP5A 4KI0A 2BMJA 3R9WA 1P61B 2PCLA 3A1TA 3R20A 3TNFA 1NJGA 3A4NA 2O8BB 1OE0A 1FQJA 2XJ4A 1E9SA 3AV0B 1KHTA 2FE4A 2V55B 2KBEA 3UWOA 5CDFE 3MAAC 4PZLA 1VECA 1N6RA 4IDQA 2ZSDA 3DM9B 3DKPA 5AK0A 3GP8A 4P4UA 3QXCA 2RCNA 3CX6A 5JI3E 5IT5A 1L7VC 1JR6A 2QTFA 3U7GA 1Z0FA 4FN5A 1NSTA 2NG1A 1W47A 3WNBA 3HU2A 5DYGA 2W6JA 2ZRNA 4JKIA 1BO6A 4OHWA 4US2R 4Q01A 1HYQA 4AYTA 1M7GA 2ZI6A 3UXMA 1GFIA 1NG1A 1YRAA 2WIAA 3PQCA 4LZZA 4NDZA 5GVRA 4E07A 2ZROA 5IRCD 1E98A 4Q9JA 1I2MA 2WAXA 2IS1A 1J99A 1N3BA 4F4IA 5SZKB 3NVAA 2ZJYA 4PX9A 5EXXA 3HR8A 5KPJA 1DO0A 1TEVA 4GOKA 4IDOA 4R2HA 4K81B 2F43A 3SHFA 4ACAA 3F0TA 4C30A 5JS8A 2CHVA 2F1JA 3BFVA 3CRW1 4DLYA 5C1BA 1ELOA 2ANCA 2GCOB 2FGKA 2H5EA 4HB4A 3A37A 1GRNA 2VPPA 2FSFA 3GLFA 5CJPA 2ZJOA 2OEPA 1N5LA 2AK2A 1IHUA 2Q6TA 5EUMA 1OT3A 4EAQA 1A4RA 2JASA 1Q57A 2IYLD 4A8JA 1VTKA 3AKCA 1OXVA 3LQRA 1H8EA 3TK1A 2JLUA 2H18A 1TQ6A 5CLQA 4PPNA 1R6BX 3X1YA 2ZRAA 5TMPA 5FH9A 3T5DA 4D4JA 3TW8B 1FUUA 2G88A 4UXIA 4A2QA 4CEIA 121PA 2X8AA 1UBFA 4ESVA 3KXIA 1F48A 1W4AA 1MV5A 1M6NA 2KJQA 2H1LA 4BEJA 1Z0AA 4QFMA 1WRBA 1ZIOA 4KFRA 4FIDA 1KJYA 2WWYA 3QEOA 1K6MA 2OBLA 4QNRA 2CK3A 2BBOA 2OAQ1 2P6NA 2J9RA 2A2ZA 1KO5A 3R7WA 3I3SR 4C0LA 2J0QA 5F9HA 1ZINA 1OYWA 5AJXA 1G3UA 4C0QC 3QG5A 1PVOA 2VF7A 2YWGA 1P73A 2J87A 1Q3TA 1LB1B 1WDTA 5A4JA 5KSYA 3EARA 4Q4JB 1KKLA 2QORA 1NG9A 1TNDA 2GZHA 2VIIA 1Z47A 4GNKA 3IILA 2NPFA 4KLNA 2QAGC 1KK3A 4F91B 2QM7A 1AK2A 4JZKA 2BMDA 5K8IA 3GLGE 2CDNA 1Y3AA 3ZZ0A 2LKCA 3PCRB 1KZGB 5TB5A 1FZQA 3THXB 1W0JD 3REFA 3QKRA 3EASA 4Q5IA 5EP2A 3T1QA 2P5TB 2R44A 5DN6A 4Q1AA 3RYTC 2EYQA 1KI9A 2DWQA 5FTJA 2PL3A 4DB2A 4BFWA 3CH5A 2CL7X 2PLFA 4W5HA 3CNOA 3FKQA 1DE0A 3W34A 2P2LA 1NKSA 3EPLA 2VHQA 3VR5A 4QBGB 2WTUA 1KMHA 1Z6AA 3CKLA 3U7FB 4LJ5A 4MYTA 1Q1ZA 3FDIA 4JL8A 3K70D 3THYB 4XSHA 4Q4LA 1DBSA 1YQTA 3W6PA 1WMSA 5DHFA 4ASUD 1HV8A 2XX3A 1Z63A 3DM5A 2DY1A 1ZM7A 3G82C 2ZI4A 4QBHA 3LH5A 3EW9A 4PHGA 3P4YA 5CLLA 2CEAA 1X8KA 1C1YA 1CRQA 1SXJA 3BBPA 4L8GA 3K0EA 4ACBA 4DRZA 1FP7A 4M1MA 5H68A 3CF2A 4EJSB 4RD1A 1E0KA 1ZCBA 1N0UA 4G5OA 1EFUA 4X8LA 4LYHA 4PQYA 3CUEF 1Z22A 4LC0A 3OFNA 3W5JA 2FZ4A 3HYTA 2R9VA 1XRJA 2ZITA 4TQUS 4Z1MD 4OBEA 3WY9A 1ZD9A 3EZ9A 1N6NA 3RVBA 4DCVA 4IOMA 1G6OA 4W5WA 2WPDA 4QM7A 3B1YA 4NCNA 3DMNA 2O8CA 2ZRBA 4F4CA 4P4TA 1G3QA 1EFHA 1ZCAA 3H4MA 3OIUA 4JLNA 5E7MA 5EZ5A 4B35A 4IVPA 1P9RA 1EFTA 1UJ2A 1E2LA 4IFEA 3FWYA 4FI3C 5FOWA 4CYMA 1T5LA 2Q21A 2WZQA 3I1FA 4WAUA 4B47A 3U3RA 4BFSA 3PVSA 5JWOA 3PR1A 1XZQA 3QG1A 4WXRA 1CJKC 2REOA 3RRYA 1D5CA 2GDJA 2IUSA 2JATA 2X19A 2YWEA 4QOSA 2OSBA 1G18A 1UBGA 1GRRA 1EG7A 1CLUA 2C98A 3THWB 1GSIA 1R8QA 3RAPR 4HEJA 1BYIA 1G8YA 3PITA 5IK2D 3I61A 3NBFA 1GP2A 3PUVA 5J4LA 1W0KA 4LRWA 2ZUDA 2GF0A 4DIDA 4K46A 1R10A 2QG6A 4B3CA 4DBLC 2PT5A 1YR8A 3SYLA 1ZUHA 5DGXA 2IW3A 2XGJA 4TQAA 2CE2X 1FX0A 2R62A 3GLGB 3K0AA 4DCSA 2QPOA 4PXAA 1D8TA 3SJBA 2D74A 3SE0A 3LV8A 2V4ZA 1IXSB 3L8ZA 4NYIR 3ZH9B 3T61A 3O8RA 4BFZA 2PJRA 2NZJA 3BB3A 2A78A 4MRNA 2ZXUA 1VHTA 4M4SA 4GOXA 4XH9B 3AM1A 1E69A 2FF7A 1SVOA 2MMCA 1SVWA 2KBFA 3BB1A 3L0SA 4I99A 1JPJA 1P6XA 5CB6A 4AG6A 3QBTA 4Q1BA 4EFNA 3W8NA 3UG6A 1KI6A 2GCOA 1OHHD 3RRMA 1AM4D 2RGBA 3T5GA 1XEWY 4TLDA 3ZGXA 3W3ZB 1OB2A 4GZLA 1JR3E 4JLVA 2GNOA 1NJFA 1W4BA 1X6VA 4XIGS 1CKEA 4HZUB 3LBHA 4X8HA 1MT0A 3VAAA 4LX0A 5KSZA 2DB3A 3M1IA 3Q5EA 3K09A 1OFIA 3TSOA 2FSHA 2XNDD 4RZUA 1JQLB 4AD8A 4TYYA 1RE0A 1D9ZA 1FL9A 1GG2A 4ZKDA 5B58C 2OE2A 5FBQB 1VCNA 4PQRA 3IIJA 2D7CA 2GA8A 1UDXA 2FJUA 4WZAE 3NBYC 1G8PA 2GJ8A 2JGNA 3TRFA 3K70B 1PUIA 4KU4A 3NH6A 2WSSA 1N6HA 4C2UA 1YR6A 1VG9B 5C18A 4FMDB 3V4FA 1ZBDA 3AUYA 1IN5A 3WBKA 2FGJA 2DFNA 5JSZB 4P3YA 5EP4A 1KAOA 3SHWA 3C41J 4F93B 4KAXA 4MRSA 3SZRA 3EWAA 1T91A 3AP1A 3EC1A 4Z54A 1E2JA 3BERA 4MKIA 5AUNB 2AN9A 3SJCA 3KTAB 1VCIA 1OH7A 3NH9A 1QRAA 1KAGA 1IY2A 1W2GA 2WWHA 4KVAA 3CW2A 1XJ0A 4LJ7A 4BFVA 3GD7A 2W2TA 3B13B 1II9A 2WM9B 4W9MC 1UDWA 1CXZA 3X1XA 3DEFA 2JEOA 4Q4AA 4XTRA 3THXA 3FMFA 3UG7A 2W6JD 5CDFA 1RRPA 1A2KC 2H92A 4TMXA 4QGAA 4ESHA 4QNMA 1HE1C 1KK0A 2G1KA 4RY2A 3UMFA 3EZ7A 1MO4A 5L8VA 1YHNA 4TWZA 5IDVA 4WXPA 1YE8A 4XOIA 4C9BA 3ZVLA 2DFKB 5BYJA 1OH6A 2ZUCA 4G3XA 2ORVA 4KVGA 3P20A 1G3MA 1Q12A 4MA4A 4YMWA 2GESA 1HURA 1ETUA 3IUYA 1J7KA 2GTPA 5EE3A 4F38A 1E2EA 1E94E 4JBYA 4TL7A 1DAMA 1T0HB 3QQ5A 1BS1A 4IDPA 621PA 1RIFA 3WYFA 1NKTA 2QMEA 5FBWB 3W5IA 3RC3A 2ZRGA 2WKPA 3U3KA 2C95A 1H8ED 2FV8A 4EJSA 5ANRB 5KYKA 3Q5DA 4EPRA 2ZREA 3LXXA 1RPZA 1QG2A 1G19A 4JLPA 3L2OB 4B3XA 2O0HA 3TVDA 2RGCA 1XFAA 1E2QA 1XTQA 2XZLA 1QF9A 4JJKA 3PEYA 1YU9A 1OJLA 4C0JA 3QSYA 1E9DA 2ZR7A 5J4VA 1HTWA 2ZETA 2CK3D 3BJIC 4HAZA 1T4GA 1KSHA 1BYUA 4JSTA 2O8FB 1XPUA 2V7QA 2Z6VA 2ZYWX 1FP6A 1ESMA 4PC2A 3OEHA 1MO6A 2D06A 4UNQA 4US1R 2ZRJA 2B21A 1SVMA 3WP0A 1G7SA 3WYAA 2AL7A 2VP6A 4L9WA 2YWHA 3FVQA 3ADDA 1YZUA 5KDDA 5B57C 2VBCA 2IYZA 1P2SA 3LLMA 1R5OA 1Z0JA 3QXJA 4KITB 1ANKA 1PLKA 4FCWA 1U98A 3EIHA 1W46A 1XB2A 1COWA 4M1WA 4JL5A 2QPTA 2F9LA 2PZEA 1Z6TA 3B6EA 3CM0A 4WZ6A 4BPBA 1MO5A 1E79A 1GM5A 2D3WA 3RANA 2XXAB 3BOSA 1UPTA 2JLZA 3NBXX 1CJUC 1XMSA 5DN6D 1AZSC 1IY1A 2CNWD 2RAPA 2Q0HA 2E9SA 1FNNA 2OT3B 4NL4H 3GLGA 3ZVRA 2EYUA 4FXPA 4M1OA 1GNPA 3I8XA 3AGQA 4OHXA 1CJVC 3FTQA 1B0UA 3RS2A 2F9MA 4M1TA 2FA9A 4B43A 1T0JB 2XITA 1TU3A 2O8DB 1GITA 2OXCA 5H70A 3ZYCA 1T6NA 3SYKA 2G77B 3QKTA 2GVDC 4DLSA 2F1RA 2WJIA 5DISB 4LJYA 1ZM3A 1W48A 1BMFA 1GZSA 2ZSBA 3M4YA 2WJYA 1CR2A 4R98A 1CJMA 4TYNA 1HY3A 2HUPA 2WKQA 1SXJD 2E87A 1MH1A 4EPWA 3LA6A 5FOVA 5AJVB 1V5WA 4Q9LA 2D7DA 3AH8A 4TMTA 3QXXA 4BRWA 4EPVA 3VMFA 5KU1A 3QI2A 3K9NA 5JS7A 1E1QA 1FUKA 1E2KA 1UKEA 4HUQA 5EE0A 3WNCA 1KI7A 3OFND 1MO3A 2NQ2C 4C0KA 2P67A 4ITRC 4HDOB 1NN1A 2C96A 3VU9A 3WYGA 5EE9A 3AVYA 1ZW6A 1Z83A 4U5XA 3BFXA 1J2JA 1BH2A 1HA3A 1MKYA 2WPDD 2WWIA 4QM6A 4LBZA 1QHYA 4QHSA 2KWIA 2AXNA 2HT6A 2PCJA 2CJWA 2ZSEA 4G5SA 4OJKA 1CP2A 2IL1A 4GBMA 5JSZA 4NYIQ 4EKDA 2BCJQ 4JLJA 4AYXA 3B1WA 1NLZA 2PX3A 5FOSA 4M22A 1OB5A 4A8JB 2H57A 5GADl 1YZTA 5JZVA 4LHVA 1Q20A 4YQFA 5JJKA 3WRYC 2YWFA 5HE8A 3RSLA 4PAOA 3NTUA 3QOFA 2C5LA 1E96A 3ADCA 4ZPXA 2HLDA 1F2TB 2A5DA 2Y8EA 4XVUA 1W0KD 2AX4A 2GZDA 4UXHA 1BKDR 2HJVA 1N5JA 4Z1MA 2JLVA 2NMVA 4BLRA 2QU8A 1R0YA 2BOVA 3K0SA 1II0A 2JJ1D 1XTJA 5KOYA 4AI6A 4NPHA 4ZKEA 2FG5A 4NBSA 1R5BA 2F6RA 1S1CA 4TLEA 2ZSAA 4A36A 1JJ7A 2V8OA 3QENA 4TYPA 4TLAA 2J0SA 1RJ9B 3DOEA 4S35A 2G9NA 3C5CA 3P1JA 4Y0VA 3B60A 1UBCA 4O0MA 5JEEA 4UXJA 4RZ2A 1KY3A 1NSFA 4PPGA 2ODEA 1XWIA 4EQ6B 5CYPA 2OO7A 4NCIA 1Z2AA 3LW7A 4LOAA 1ONBA 1GL7A 3GJ8A 1U9IA 3BB4A 1YJ5A 1S3GA 1JNYA 1IM2A 2PLRA 3B2EA 3LWNA 3FHCB 2YOHA 2VSXA 2AD5A 2OLJA 2HDNB 3BORA 4NYMR 2XTNA 4PHTA 3WRXC 4I1OA 1C4OA 1OF1A 1XD2A 1ZVQA 4IXNA 2ZYUX 1OIXA 2PZGA 2YZ2A 3Q9LA 3RRNA 4KO8A 1KDRA 1SQ5A 4D0LB 2C8VA 4QGFA 3E5HA 1EFRD 1JXOA 4G01B 3I72A 4CEJB 1JR3A 2REBA 3KXKA 1SULA 3DKVA 4FINA 4QRHA 3WBJA 2HT1A 2P5SA 3C8UA 3R8CA 4MYHA 1Q21A 3NKVA 3T1VA 2XSZA 1ZMXA 2IF0A 3IBGA 4TL6A 1TU4A 2BWJA 2WSSD 4E03A 3IO5A 2ZS8A 1M2OB 4P33A 2W00A 1VYVA 4XD7A 1UM8A 1KGDA 3VR4A 2O8FA 4YXWD 4KLZA 4JLKA 5J4YA 1X86B 2ZTSA 5F3WB 1OHHA 1Z0IA 2ECKA 3U4QA 2QP4A 1E0SA 3KB2A 2RGNA 1U0HC 3U3MA 1XD9A 2FPKA 4Q9HA 5LD2C 1J8MF 3L0OA 5JFGA 3KFXA 4LYFA 3W3AA 3BH6A 3VTKA 4HATA 4LPSA 2IUTA 3NEJA 4D0GA 3AGPA 1ZU5A 1GKUB 2V6JA 4URYR 4Q03A 4UKDA 3KJIA 4DSNA 5F2EA 2WAYA 4CT4B 1AS0A 3O8DA 4GP6A 2J1LA 4X8MA 1P9WA 4Q7JB 2XXAA 1YZGA 4GP7A 2ZS9A 2O8CB 1E9FA 2EFCB 1T3HA 2V9PA 2Z5FA 4G5GA 4BZQA 2CLCX 2OHFA 3E70C 1TX4B 1Z2CA 1ZNXA 4ZCMA 1NLFA 1IOZA 1JXMA 2FFQA 2QAGB 2VSFA 4JBXA 5FFMA 3TKLA 3LBNA 3A1SA 4BGDA 3H2YA 2CLDX 4PZYA 1CR1A 5K8UA 5KHOC 4IOJA 2O8DA 3X1DA 4XVQA 5DI3B 4R71A 2HF9A 2WOOA 5AUQA 4LY6A 2VO1A 3AVXA 3LFUA 1RZ3A 4EUNA 1FTNA 2QTVB 4IDNA 4FMCF 1W4CA 4DJTA 4C0AC 4MH0R 1G3RA 1ZNZA 1SVKA 3ZD6A 4Q02A 2ERXA 5F9FA 2H7VA 2GJSA 4MRVA 1X8JA 4PTLA 3A6PC 5CITA 1YZQA 2GJKA 5GVSA 4JLAA 5HTKA 3REGA 2VH5R 5FBLB 1KDOA 1FX0B 4TZ0A 1NBME 4II7A 2XOKA 3K0AB 1V43A 2W0SA 3UATA 3F8TA 4P4SB 3CZPA 1XEXB 3D31A 5FUYA 1GAJA 1TMKA 2XB4A 4NTZA 2F1HA 4JVLA 2RHDA 3DMDA 2RGDA 1U8AA 2B7CA 4L4UA 3W6OA 1NVXQ 2N1BA 2BMFA 3FGNA 4D4KA 5L3SB 3ZIAA 2HXSA 4JYCA 1QBKC 1A82A 3RWOA 5H8WA 2V7QD 4C4PA 5KSPA 4DEXA 1KI6B 4AYWA 2G0NA 2CCKA 1S4QA 3OEHD 4PANA 2GBLA 1T8TA 5LBIA 5AR1A 3LVRE 2FWRA 1VCOA 1YKSA 2REXB 2W2VA 2WKRA 3R8FA 1K8RA 2GEUA 2LWIA 2ZAMA 1BIFA 3HPRA 5AUPB 3ONWA 4KBGA 5TVKA 2H16A 1COWD 3FMPB 4TTRA 1F2TA 4D2IA 2QP3A 4KBFA 2IYQA 4O25A 1KI3A 1YVDA 2BBSA 4GL2A 2EWVA 4N1AA 2IK8A 4U00A 1E79D 4ZO4A 2I1VB 5GJCA 1WQ1R 2O0JA 3IQXA 3KXLA 4Q4HB 4RFVA 2ATXA 2RH5A 3KKOA 4PSKA 2A9KA 2NO9A 1VYUA 4M1SA 1E2IA 2QGZA 2F1IA 5TXGA 2FNAA 5HKKA 3IHLA 4LHWA 2Q3FA 5HCIA 3TIFA 1LTQA 4RZ3A 2ERYA 2Q9CA 2QBYB 1CTQA 1RJ9A 1XTKA 3QPVA 4UJ5A 1DVRA 2QMHA 2IYRA 4AKEA 3ASZA 3EX7C 3L8YA 5DIFA 3DHWC 4PFSA 4B48A 3LX5A 2DCUA 1NL3A 3KKNA 2GXSA 2JLSA 4V02A 3IO3A 2BBTA 1XF9A 3AVTA 4MUAA 3C15C 3IKJA 2ZAOA 1BMFD 2JCSA 1UEJA 4EQ6A 3RNLA 4A6PA 4D81A 3TUZC 2OBNA 2JIZD 3T1TA 4OK3A 2QI9C 4BASA 1E1RA 1Z8FA 2ZJ2A 4M0LA 4XTCS 3MLEA 4HI0E 1KNQA 2IYUA 2Z4SA 4Q4AB 5JWHA 1N0WA 3PUXA 4XJXA 3QVUA 4LHZA 4D80A 1HT2E 4N3NA 2C99A 2IEZA 1E1QD 3D7MA 4RD2A 2R2AA 1YZNA 3EPJA 1DS6A 2CNWA 3LNCA 1PV4A 1IY0A 4DDUA 1Y63A 3AF2A 3CRMA 4GRAA 2MSEB 3ZVNA 4JL6A 1KI2A 1EXMA 2ZIAA 4NYJQ 4UNPA 4ZCIA 4US0R 3G0HA 1G20E 4CEJA 1SGWA 1XCPA 4QJ4A 3NG1A 4KV9A 2VRWA 3QKSB 2TMKA 1CR0A 3EWSA 2P6UA 4PC6A 3PEWA 1ZC3A 4ABYA 4NMMA 4DLZA 2B7BA 2QENA 1KJWA 2UZIR 3MGCA 3NXSA 3LLUA 1CULC 1R2QA 3SQWA 3H86A 5TARA 2IUUA 4AKIA 1JB1A 1S8FA 4EIWA 1IBRA 1W5TA 1M7BA 2EVWX 1DAKA 2ZANA 3MWJA 1T8UA 2UVQA 2ZRKA 4CT5A 1OSNA 1S96A 3B9PA 4QG7A 2AKYA 3K0CC 1DTSA 2ZVQX 4QXAA 4Q00A 5L3VA 1Z0KA 4D4MA 3DO6A 3NHBA 1AGPA 2DFLA 4TSFA 5LB2A 1UKVY 1XZPA 2A5JA 3AP2A 3ND9A 2HLDD 1NVUQ 1N5IA 2GF9A 2ZJ8A 4IVQA 1JBKA 2ZJAA 3WHKA 5BW8A 2R6DA 3AVOA 1CU1A 2DR3A 2NPIA 3QF7A 1IXRC 1RRGA 2QY9A 2FSGA 5LPNA 1J70A 2WJVA 4NYMQ 2OV2A 2CE7A 3VKHA 3AVPA 3EIQA 3U3OA 2VP4A 2C9YA 4H9GA 5EQTA 2BKUA 4ERNA 3MRSA 1NLYA 3CR7A 2QAGA 4MKFA 4DCUA 5FBVB 3EA0A 2R8RA 5FOTA 1NVVR 4FCTA 4KCGA 1KYIA 4KODA 1Q3HA 1XU4A 4G0NA 5C2JB 2OCYC 2Z0MA 1N6IA 4R7ZA 5DI3A 1XEWX 3G5UA 4FMBB 4BRUA 4BECA 1R5NA 1ESNA 1IN4A 1E3MA 1YR7A 1IAQA 3F3YA 4RD4A 3RS4A 1WP9A 1XD8A 5FPHA 5AWFC 2MSDB 2C04A 4AK9A 2HEIA 3BGWA 4BFYA 3GPLA 4AKGA 1XCGB 2VF8A 4OI1A 4ZV4A 4A9AA 4I1VA 4B2IA 4B34A 2NO7A 3PFIA 2JJ1A 2BCGY 4HDQB 1KMQA 1C9KA 5F98A 5FR2A 1I4TD 2O0KA 1HUQA 1BOFA 1G17A 4NU0A 3EC2A 3SN6A 4HLUC 2B8WA 3QNUA 2GAOA 4P4SA 1Q44A 1XEXA 3QUSA 5FI1B 1JEDA 2ZS7A 3LW8A 1JR3D 5KO2A 3U60B 1RC8A 1UFQA 2ANBA 2EU8A 4HAXA 2XSZD 4PO8A 3QXHA 3JVVA 1IJEA 3K0CA 5L3SA 4H1VA 1DPFA 2JJ2D 5EXPA 3WNDA 4LJAA 2YNMA 1G8GA 3A8TA 3B1ZA 1ZAKA 4L16A 4XD7D 3VX3A 2V54A 4GFDA 3ZZTA 2V1UA 1DAHA 1FPMA 1Z5ZA 2AFHE 1G1MA 2GILA 3GJ5A 4O3MA 1DO2A 2JDID 4MKHA 1VG1A 2FN4A 4P0TA 2F3RA 1W2HA 3B5JA 4Q7LA 5FTKA 3CX8A 2P3SA 2NTYC 3SNHA 1OFTA 2RHMA 3B1VA 3C4JA 1NN0A 1M8PA 4TN1A 4RKEA 1E99A 1W36C 1TUEA 2IXGA 2NZ8A 1HEIA 2ZU0C 4LJ4A 3TAHA 4ARZB 4WW0A 3A1WA 3H0KA 4HUQB 4YLGA 3NEYA 4QGHA 1W44A 3WHLA 2GCPA 2GVZC 3VU9B 4IJMA 5AJZA 1EFRA 3HU3A 4URUR 4Q4HA 1NY6A 1AGRA 3CONA 3D6TB 2OFOA 2AR7A 2ZEJA 1MRNA 2J41A 5FTLA 3UWKA 3P27A 3EIEA 1ZNYA 2QSYA 5AJWA 5E4FA 2CJWB 4KJZA 3VQTA 2ZI3A 4M9QA 3QIAA 3LXRA 4LK2A 2QBYA 3K9LA 1FOEB 4AURA 4IVRA 4G1UC 4ZDJA 2YKGA 3IEVA
chains in the Genus database with same CATH superfamily
4EY3A 4D4LA 3U7HB 2J7KA 1KP3A 2XDQA 1OI2A 2NO6A 3EHEA 3EJ6A 1JEOA 1I80A 4W63A 6GPBA 3AT1A 1XELA 4I4TA 5F2KA 4DT1B 3B6ZA 4B75A 4HWTA 4OQZA 4G07A 1ISSA 3HDTA 4MZDA 3UJ6A 4TTPA 4R31A 4QULA 5DWDA 5CNKA 4H0FA 2P77A 1Z6PA 3L40A 3WJAA 2I4MA 1NQOA 3AWIA 1GPBA 1Q0QA 2IP1A 4CKWA 4Z53A 2A30A 1N57A 5DW0A 1IUOA 4P22A 2FMTA 3AWDA 1BMQA 4WLOA 2Q5OA 2EARA 3TLCA 3W0LB 1VSQA 3C6ZA 3GLHE 3SAJA 3TLGB 4B76A 5HIJA 1FQOA 5JI2E 1LFDB 2PRYA 2Y1KA 2DC1A 4NARA 3RASA 4GDFA 3M6FA 1N0HA 1KYWA 3WLTA 3FYUB 5CM9C 4JI8B 1TF2A 2HA7A 4OK5A 2VA8A 2E0IA 2C4VA 1F6DA 4URFA 1VHWA 1S2MA 3PE3A 3OZUA 2PD4A 2RHOA 2OP0A 3FLAA 2L2QA 2N1MA 4KH1A 4LE2A 3L7NA 2G7ZA 3QKSA 4B3GA 3PV0A 5ELLA 2C42A 1T9ZA 1YRBA 5BN5A 4XR9A 2I3BA 2VUTA 1N0IA 4NZZA 5JPIA 2J0EA 1HDYA 2IHYA 2QUJA 3F8WA 3G9XA 3SE7A 3KB1A 1PT8A 3N75A 3DWGA 1XE3A 3LUDA 1JIIA 3X2SA 2JLWA 2H2AA 4UBLA 3WXMA 1G8SA 5L6MB 3E4DA 3Q2KA 1IZ8A 1TQ2A 4ISBA 1F0KA 1R7RA 4KHPB 4B46A 4ZDWA 3ER8A 4BMYA 4G0PA 3A25A 4E1AA 1ZDMA 6REQA 2ICAA 1KYQA 3A11A 3PYXA 2GRUA 5THQA 2LP4Y 5J2UA 3HZOA 4O8ZA 1QQ5A 2AFHB 2XJ9A 4DY6A 3PR2B 2CL0X 1R4NA 2VTBB 1GN9A 5LBUA 3L6RA 1DWUA 1VFPA 4YJ3F 4ARUA 5JOQA 2ZZNA 4OK6A 4V1CA 1KJ9A 2EFJA 4UUPA 4U7DA 3D59A 3FYHA 3HB1A 4L3VA 3PUIA 4CGYA 4ABTA 2C61A 5I9BA 1D3AA 2DG2A 1AHIA 3A1FA 4A2WA 1ZMTA 3JXEA 3VDRA 4DVGA 2A3NA 4FDVA 3T3PB 2PEYA 1NBWB 1REQA 3GCXA 3ETJA 4O59O 5EUCA 4GDMA 2QDKA 4DNQA 2QE6A 3LHDA 4JBGA 4PVDA 4B45A 3JARB 2OXIA 4RSGA 4EKNB 1QO0D 4DJDC 4P2BA 3AU9A 4UTVA 5E3HA 5ENZA 4C1NA 3DL4A 4PLCA 3PE6A 4NI5A 2P6RA 5HA5A 1YQWA 2Q3HA 1UANA 4KMOA 4JVOA 1LF0A 3I32A 3UT6A 9ATCA 2AMYA 3GJXC 3WGVA 1FDSA 1SD2A 4L9SA 2FU5C 5ECDA 5DOZA 4AP9A 1DZ3A 2ORED 3X2EA 1M66A 1UOPA 5FJIA 1N5MA 1X7WA 1EVEA 3CTPA 3ICCA 1TI7A 4GZMA 1SKBA 1H4VB 3E22B 2A4KA 4KV7A 1A9TA 2BELA 3ZI4A 4D8VA 5CXUA 1F8FA 2PWBA 2QUHA 3EY4A 3AM3A 3OPYI 1BMTA 1X1RA 1FQKA 5FO1A 5I9SA 2DBZA 5FUWA 2YVUA 3EPHA 2Q99A 3GRRA 1UP7A 5AXBA 5J1TB 1XLWA 4PG5A 2GBCA 3KDPA 2MDTA 5JBNA 1WULS 3IQDB 4HEHA 4UASA 2OHIA 1AT1A 4LVUA 1X9HA 5CH3A 1ARZA 1EUDA 2JHGA 1U90A 5EHGA 3HBMA 5BVGB 1U0NA 3LIIA 2FX3A 4R6XA 5ALKA 4ZQFA 4ZVTA 2X2EA 3JALB 2XRMA 4KGDA 3OZFA 1K98A 1QYVA 4U7JA 4MIKA 4TT8A 4ISCA 3RT9A 3ZCPA 3O4RA 2YHAA 2W6QA 2ZIXB 1CB7A 4FB4A 1XMPA 2ZJ5A 4QYIA 2L19A 2VNIA 2Q6IA 3IIIA 5K0BA 3R5FA 4MVJF 2J3EA 2QT9A 3DDUA 3P32A 3CZRA 3KZCA 1ZIPA 1GGMA 5CA1B 1LH0A 1AZLA 3W9UA 4FEYA 5EE5B 1ODFA 3DZDA 3IQFA 1S0UA 1OXTA 1DARA 4LZPA 5DXJA 2V7VA 4A23A 2VT3A 5H3LA 4IS2A 4ZQBA 3NM4A 2IIPA 2H5JA 4CF7A 3DVLA 4TMZA 2ODWA 3I5MA 4GBGA 3H05A 3PFNA 3O91A 4I5DA 4DDTA 4HDRA 5YASA 4J0HA 2PFKA 2PXXA 4ARZA 2H2HA 5EJEA 1U94A 4FD2A 5ICEA 2F8MA 1E2NA 3PEVA 4LBVA 3ZDQA 3R0IA 2QRZA 4EB0A 2O14A 2ZSHA 4C6TA 3R0QA 7AT1A 2J6IA 4EKYA 3U3JA 2PKYX 3IUJA 4NMXB 4B81A 3JZAA 5C8DA 4FZVA 4B9EA 1BVRA 5K6TA 2D5IA 4GR9A 2OBYA 2X77A 3V6MA 2QN7A 2R7MA 4YHHB 1LLFA 2ZXEA 3L7MA 4TMYA 3ETEA 1T8SA 1FMLA 3EDCA 3MJVA 2HGZA 2XNCA 2IBMA 2W2KA 5ECGC 3GGOA 4IQ8A 4NV1A 1NBIA 4JT2A 4URWR 2RGAA 3DEIA 5ER9A 1V1MA 2UZ4A 4YRNA 5CT5A 2Y93A 3L8HA 5G0SA 3TTSA 4WCFC 3ELUA 1KZHA 2CDRA 1H6AA 2HBQA 3LVQE 1KRWA 1KY2A 2YDYA 3K8YA 5FPSA 5G40A 2H5LA 1ZJWA 3VI3B 2PT6A 2QJTA 3I0MA 1NFQA 3WFIA 4B7ZA 3DV2A 4BQFA 1Z73A 1AK1A 4DJJA 1GPH1 2HWUA 3OD5A 6Q21A 3NVKI 2JB9A 1KO7A 3VNRA 1I9CA 2VAMA 5JZSA 1TU0A 2ZSUA 4C78A 1Y3HA 5FUXA 2Z56A 2W70A 3U6BA 3RC9A 4DR1B 1SCQA 3UCEA 3V7UA 3ZS8A 1Q1BA 3DZ8A 2XCTB 4OREX 2C77A 1WMBA 3FHOA 3S2IA 3CRNA 1JLMA 1U2PA 3VR6H 4CL0A 2WE8A 4G4GA 4G84A 3PNMA 3DZHA 3TR6A 4UZSA 2PJZA 3JQFC 3FA2A 4GD3Q 1JFTA 1HLDA 3OIWA 1JN0A 4PC3A 1RYMA 1UINA 4RPIA 4OHBA 4YJFB 3RRXA 5C3UA 3SHVA 1BXKA 3VKWA 2BTOA 3AF1A 4BGEA 1ECFA 1W94A 2PL5A 3VKGA 1LNZA 1X80B 1A27A 1JG4A 5L9AA 1USGA 1I8TA 221PA 2ORIA 4REOA 2HI0A 2NV2B 1U0GA 2EKLA 3ENWA 1ODLA 2I7VA 3HVUA 2PAFA 1A5BB 2CBXA 3BGIA 2YNMD 4FN4A 2O2YA 4W6ZA 2ZYSA 1FUEA 1DQSA 3RM3A 5FCDA 2HEGA 3KD2A 4TWRA 5DSZA 1X1SA 4FU0A 2C2YA 4CIYA 2GAAA 5KX5F 3EXHA 2IZ0A 1E4OA 1NJ2A 2HDHA 4JVMA 1KAHA 3H6KA 4XEUA 3ILXA 4MWTA 4IKOA 1LSSA 3IBFA 3BD9A 2QLBA 3P9KA 5E2IA 1RXEA 3RSZA 4BIMA 1VJDA 1B6RA 1OH5A 3UUWA 1NSYA 4ZGGA 3PSAA 3K9FC 2YZMA 1QV9A 2AVDA 2PRKA 3HYNA 3SFTA 3EUFA 1YOVB 3EZYA 1B8OA 2Q8PA 4G5XA 3WMFA 4NIMA 4F7WA 3O3NB 1A9PA 1P4GA 2XMSA 2C57A 4FR0A 1KOJA 3GQVA 1PBTA 2O48X 1Q91A 1HBJA 2Z95A 3QPBA 4O4HF 3T35A 1B23P 3KQSA 1G8MA 3UKDA 2BH2A 3GEDA 1EX7A 1UKBA 5B3KA 2HLNA 4EMUA 3A0UA 4NCXA 5AK5A 5AOCA 1MG0A 4UQOA 1J0BA 1BEZA 4IRXA 1HTBA 3REOA 1K5GA 5HIIA 4FDAA 2CDCA 1II8A 1DOZA 5KWJA 3ZGYA 1MORA 3G6WA 1N77A 2HF8A 3PUJA 3BIFA 2GPTA 4WFJA 2JDIA 3HCRA 1CVLA 3UW3A 4DV3B 5IDXA 2JLXA 4PIMA 1ZK0A 1YTLA 3P4XA 5CH5A 5KCMA 2FEOA 2UYGA 3A9CA 3G6KA 2QD3A 1WHTA 2D59A 4K1LA 4NENB 3TR0A 2VNJA 5JDCC 1SVIA 4XB1A 1RQRA 4HK4A 4MAAA 4PGGA 3JWHA 3ECAA 3C85A 4JCCA 4YRZA 1XQWA 1J25A 4JBNA 2I8LA 3QVSA 3QELB 4C01A 2KB0A 5L4SA 3A4LA 4YP6A 1WW2A 3V1NA 2QV7A 1W4ZA 2P30A 3H9GA 4NJEB 1L2TA 3MMPA 1CDOA 4J2HA 5T3YA 3R3ZA 4EFMA 4I50B 1MDBA 3IT0A 2J6HA 3ZNQA 1N32B 1M72A 4BMSA 2DLCX 1QM5A 4A0SA 3DLHA 1OR8A 1GNQA 2BN4A 3OY7A 1H8HA 3GZNB 2BUCA 3TLMA 3OCJA 1O95A 3OJOA 4FONA 4KPYA 1B1AA 4CTOA 5LQUA 2ZJ4A 3C97A 1WDLA 2G9QA 2JD0A 3QVLA 1YWGO 3DEZA 3WMRA 4B2YA 3GLHA 1P72A 3H2GA 3RUHA 3K15A 2O1XA 4JD5A 1PO7A 2G06A 3QEKA 4H3KB 4NG5A 1NAIA 3LQFA 3WRXA 2R65A 4EJFA 1M83A 3OPYA 4JI4B 4RO0A 1QNLA 1Z6GA 4PYQA 4U8HA 3N7TA 4OJQA 1YJAA 1QGYA 5LMUB 3ELBA 1MGOA 2CMKA 3PWZA 3Q7RA 5DKFA 1K0UA 1YB7A 3OO1A 1EX9A 3MC1A 5JDIC 1ZKMA 3TQTA 3AF0A 2BZGA 4JFAA 4DMKA 4JIGA 2ZJ3A 4JQYA 1JLRA 3FLEA 2P9FA 4KYIB 4C5CA 1NLMA 3AOEC 5JCOC 1RI1A 1L9KA 1RYYA 5EUQB 4M49A 5DGCA 3HM2A 2J3IA 3K0BA 1JSRA 4YV2A 2CKMA 2RHWA 4J0KA 4XCQA 1BDHA 4N5HX 1QP7A 5TQJA 4QPCA 4K6CA 1W4RA 3D8TA 2HOQA 2RGXA 3EQZA 3E7XA 1T9DA 3EIWA 4NZYA 4G1VA 2WF8A 1KXJA 3GRUA 4HTFA 4IIJB 1GV0A 2UVPB 2RGEA 1GLNA 2I2WA 3BDVA 4RDXA 4RF2A 1XCJA 1O87A 4Q7EA 5FPTA 5IT4A 2FSSA 2DR2A 1T0IA 3JATA 1Y6QA 2D2EA 4I55A 1QB8A 4WNIA 2XWSA 3TCNA 4A03A 3R6LA 4Y18A 4OP1A 1U80A 4HAYA 5KTMA 5DWQA 1RHKA 3MVEA 4DWVA 2P68A 5ALMA 1KEEB 3L8EA 8AT1A 1COZA 1WCIA 1RWQA 2PTHA 1L7NA 1XPJA 4G1MB 3QWHA 1GCAA 4O2BA 1F5SA 1JYEA 4F85A 1ADYA 3VMMA 1XX6A 2IYYA 4AJHA 4E13A 2O7RA 4QDZA 1O97C 1WTCA 1V7CA 2O8VA 2IEYA 3HP4A 3RABA 1WXDA 1H05A 3R0XA 4B7UA 4TLCA 3KKKA 3DW1X 5GV8A 5G3YA 3TD2A 4QGBA 4MP3A 4G86A 4L4ZA 3OAAA 2HA2A 4NQRA 5CLGA 3RS5A 7ADHA 4C05A 3R09A 2WKWA 3KU4A 1C9MA 1L5NA 5EJ6A 1A1SA 3QBEA 5K3AA 3WGHA 1VZ2A 4FWBA 3SP1A 3PEEA 5AKYA 1C3VA 1N7JA 4PF1A 4D45A 4NKRA 4QSHA 2IPMA 2BFAA 4IFBA 4LYJA 2I3ZA 3QFCA 3PPIA 4W4TA 4YLYA 4B3MB 1K6EA 3VTAA 4EVRA 3ZJVA 1QTNA 3F7TA 1WPGA 3SIWA 1CF4A 1HXHA 2BFCB 1A71A 3CX7A 1QK3A 4BQEA 1Y9DA 4EG1A 1QU3A 3GX1A 3S2ZA 2X1HA 1JHZA 3I4CA 2FPPB 3W4KA 3SJUA 3DFMA 1SXJC 2FPWA 4HUJA 4OM7A 3RJ9A 5LJIA 1RXVA 1TKCA 2PSDA 2G9UA 1EVJA 5EA2A 3KKPA 1A5SB 4WN3A 5AI8A 2P6MA 3O2NA 2ZJBA 1FTSA 4BNNA 3EYAA 1N78A 1QIFA 3ONDA 4R2WA 4DZRA 1A3CA 4Y9RA 2FFAA 4OHFA 5CW1A 3AC0A 2GK3A 3UM9A 1O96A 2REQA 3VZRA 3G2MA 2O0MA 3UPUA 1DIBA 1MC5A 1YIDA 4U4AA 4LC1A 1U2RA 3FHTA 1G64A 4HLCA 4PLYA 3UJHA 5HRCA 3GQBA 1S4MA 1EWQA 1X0XA 4GMXA 3PPVA 3U9SA 1E9RA 1M1YB 3D1LA 4FTWA 3A1NA 4II2A 5FTMA 5IBRA 2P0EA 4OH7A 4YONB 3ROTA 3AEKA 3G02A 4U2BA 2B25A 2FRVA 3R6TA 5D6NA 5DHRA 1AVTA 4FWIB 4BO8A 2PZMA 3AR8A 5JNLA 3A6JA 3I45A 4KFSA 4ZIRA 3NP9A 4RH0A 1GTL1 2NGRA 4KWCA 2H4WA 2IEDA 4M9RA 1ZL2A 2W5UA 4OIFA 4XQ0A 3V4SA 1ZOPA 5DNWA 2Y2UA 4TXMA 1LQ2A 2QVLA 5EWJA 1YQ9A 1FTYA 4C7JA 5HM8A 4QARA 5AVKA 4LTMA 1QC5A 4U6SA 1TPZA 2BM9A 2HXYA 2QV0A 2C4NA 4F92B 1T25A 1SHTX 3DTVB 1G5FA 1O3YA 4DPMA 5AK6A 4XWOA 3OQOA 3AHCA 2A0WA 5LOVF 2BFFB 1WPXA 2I7DA 3HDGA 1UXIA 3HG7A 4K9RA 5FB3A 4W9RA 4DCJA 2H1WA 3A1DA 5ITWA 2VHYA 3BG5A 3PB3A 1Z28A 3FPKA 4Z1OA 4EHDA 4RL6A 4N6NA 4FSDA 1DHTA 1UDBA 1JDZA 1E63A 1WB9A 5KWIA 2QL7A 3H2KA 1J23A 3SIPA 4MV5A 4A0RA 2HMSA 3R9XB 3UNXA 4NEGA 4O4JB 5D51S 2X5XA 4FI3F 2J4FA 1QSGA 4J49A 3MBOA 2HTFA 4QGGA 4E3ZA 5CLJA 5AVWA 4WVLA 4PAQA 5DM70 4QFCA 1C9DB 1VIDA 2R68A 1LVUA 4I5EA 1IY8A 2ASEA 1R4AA 4J0GA 4DEYA 5E6RB 3Q4GA 4DA9A 4BGVA 2FW0A 2I3DA 4J4TA 3OE7A 2IFTA 3DBIA 4X61A 3UJ9A 3GLQA 3I4LA 3OJCA 3GLIB 2QPLA 1HDIA 3FKJA 4YMVA 521PA 3ZKWA 4E3WA 1CUBA 1AQUA 3PQ5A 4M9ZA 4WMLA 4ND3A 3LWDA 3EQ6A 2XLBA 3DW3X 4FIZA 3O8BA 2QRNA 4B4OA 4JJZA 1P2FA 5CM8B 3A10A 1NN3A 4X1KA 5HF5A 4FBGA 2XCOA 2KPOA 3ZCUA 2OAP1 2ZRQA 3LX6A 2B2CA 4MI9A 4AO8A 3G7UA 4OI2A 4E2YA 1SO8A 2P8SA 3WK9A 4EG4A 2V74B 2ZRHA 5E7QA 1ONNA 3LHFA 4FCVA 3H7IA 4FHZA 2VHJA 5HF6A 3SOZA 1JL3A 1J1IA 1UXKA 2Z9CA 3GFBA 3IUNA 4LDZA 4J1QA 4YWJA 2IU6A 3SSNA 4MOWA 3W2GA 3HTXA 4KWHA 2QD4A 2X3FA 1JA0A 4HZGA 5DE3A 1G16A 1LLUA 1PVVA 2VUSA 3LWZA 1P39A 4OF4A 5AXDA 3DZKA 3L0PA 1KBQA 3A36A 2QM0A 2Y27A 4H77A 3RTEA 3SZOA 4DR3B 1DRWA 2IYNA 2CW5A 3TMKA 4A8TA 1OI4A 1WY5A 1RZUA 1Q1NA 3ITEA 4MR9A 4WACA 4D8YA 1KH1A 5HNKA 2LGJA 1NZDA 4G4IA 1CFJA 4HDSB 2NP7A 3DE5X 2YVLA 1KMMA 3KJEA 3UTCA 1ZMBA 4A82A 1TM2A 3AR4A 2TMDA 4ZYXA 2ISQA 1A2BA 4OQLA 1Y7TA 2YVKA 3N87A 1EX1A 2ATCA 4X41A 4YAJA 2B35A 3G0OA 1W5EA 4NBTA 2W2QA 2B8NA 3BCUA 4O1HA 5GONA 1KVRA 1NI5A 1Z4MA 2YJ5A 3K0FB 5EQFA 4H16A 4N3CA 4OV6B 4PHHA 5K1ZA 1GPKA 3E9YA 2ZQZA 1I14A 2C94A 2H0AA 4FR5A 4PNZA 4D44A 1NMYA 3PNYA 4RKQA 3FXAA 2HMTA 3AQ4A 3DHYA 5JG7A 3SNKA 3BXXA 5C35A 2PGJA 1SEVA 3H17A 1SKYE 2D4HA 1Z75A 4EPYA 3TQCA 3S27A 1E20A 3FNEA 4D96A 3C6QA 3G88A 1P1HA 4UM5A 5F3RA 4EFLA 2JFNA 3PXXA 3JPWA 4L4XA 5KC8A 2NPOA 1UZAA 3VO8A 3A1VA 4GIBA 1YZLA 2PWZA 2OY0A 3F3MA 2BFDB 3JS5A 2H4FA 4HDAA 1ZGHA 3Q1LA 2HPVA 4CM4A 3ROZA 4AICA 2AOXA 1NQVA 4HGNA 1GKIA 4RF5A 3OTHA 1J2YA 1RI2A 1H2WA 1S5PA 3O47A 4ZVQA 3G7SA 3OOHA 4BX8A 4B71A 4ITVA 4EHBA 2YWJA 1F20A 3BAZA 2V3VA 3CF0A 1DKRA 3D2AA 4P1ZA 3ES9A 1Y8RA 3J81k 2J9ZB 5AVTA 4X45A 2JD2A 2ZSJA 3SDSA 1C1XB 3M3PA 4FBLA 3B8EA 2ID7A 2WTAA 1S1MA 3LBAA 4OGWA 2C5BA 4L73A 4RD0A 4DWJA 2P6PA 2ZUUA 1NUHA 2WWFA 4I2VA 3W8DA 3Q1KA 4XFDA 4CCYB 1TO6A 2VT2A 3H1GA 1SKQA 4N0EA 1HORA 1NC3A 2GFQA 2ZKLA 1S6YA 1S2OA 1ZEJA 3FFAA 5CDHA 1WVGA 2PUHA 2YHIA 3LTEA 5E1MA 4U9IS 2LDBA 4Q12A 4OOEA 1H6BA 1GA4A 4QUBA 1LTKA 3TB4A 4ZMSA 2I6TA 3LQQA 1VPTA 1E4EB 4TM8A 4P5PA 1R16A 1JIJA 2EKBA 1UPFA 3RS3A 5J23A 1XK6A 2P1RA 3RS7A 5ITVA 1LVGA 2ONYA 1VKOA 1Z2PX 1GRQA 3FLMA 3PZRA 5K7SA 1UJ5A 3R3XA 3GGPA 3PJEA 2QL6A 2AN5A 3FWZA 3TUIC 3I2HA 3U4AA 4ALLA 5M2QA 4QJ5A 2QTAA 4U2CA 5JCPA 2DWCA 4B6OA 1G4HA 4L5JA 4M37A 1APBA 2F62A 5A0TA 2PEZA 1N5DA 2YJ4A 1QH9A 2PGLA 4NBNA 4KYUA 4RQUA 4MYUA 4QWMA 2WU1A 1E7MA 3DXFA 4KFUA 3FZNA 5JBIA 3CH6A 1ENOA 1SZCA 1N2CB 2BLNA 3ZQ6A 2AB0A 4TRMA 3UHFA 5AW8A 2M9MA 4UBKA 1QMGA 5I4IA 4YDHB 3SIRA 3LBIA 4RMIA 5DHUA 4OQMA 1XZHA 2AT1A 2DT5A 4ERXA 4HLQB 4EPXA 5JYEA 3TM5A 1ZD8A 4IKEA 4LCEA 3OX3A 4GXQA 1LJUA 1GIAA 4IX1A 4LI3X 3FCYA 4R8KA 2IRWA 3ANSA 3IJPA 2Y1GA 4P7GA 4DM7A 4KZKA 1M76A 1DAPA 1H0KA 1QVVA 1V8ZA 2VWHA 1NI3A 2X1LA 2QX7A 4KNVA 4BMXA 4AJJA 3VHXB 1AJEA 3M5CA 1CRZA 1KTVA 2Y2VA 4U7TB 3SQOA 3BPSA 1YZKA 4QNNA 4A7PA 2HU2A 2IVZA 5K6RA 1XWWA 3PT9A 1Z4IA 4Y1RA 3BTVA 1MH9A 4JELA 2GHIA 2VS1A 2VA9A 3HCFA 3FPEA 4DNOA 3M7IA 1JA1A 1I1NA 4XCVA 4BLUA 1SHZA 2C8KA 3HGTA 2F1KA 5DVZA 2R6AA 3C6YA 3Q7EA 5FT9A 4EO9A 3P26A 2X7HA 2P2NA 1DXQA 2VPWA 3ZJ5A 1FFAA 3PBKA 4M54A 2QM8A 3MGAA 2VAXA 4EHIA 5CDTA 3OF5A 1V2HE 2I6FA 3N5CA 4LV8B 3V8VA 4DYVA 2HCRA 4XUCA 2JKZA 1UEIA 2WHPB 2WVHA 4FT2A 4H1UA 4W8HA 5P21A 1YVEI 5G41A 3OWOA 1CRPA 2E4VA 4QYWA 3NVDA 4R8RA 2HBYA 4E7OA 1JECA 3NHSA 1WE2A 1Z2EA 1EUQA 2H17A 1L0BA 3MQ4A 3HXPA 1GGEA 5CGQB 3RIHA 2A7QA 5D3KA 3STYA 4KREA 3VPDA 3OZXA 4CMIB 2AKAB 2HWYA 1O9HA 1OTYA 2PLWA 1MABB 3DONA 3L6EA 2Z2XA 2B9EA 3MJEA 1Y5IA 2O9JA 2CLMB 1RWMA 2G8NA 3L7CA 5F76A 4NECA 3IXLA 5HRUA 4B3IA 3Q3VA 4YN3A 2W6PA 2HPHA 3GEIA 3G2LA 3RHFA 1GNRA 2W6NA 1YCDA 7MDHA 3N59A 3OC6A 4FDMA 4I5FA 5JR3A 1N2IA 1SU7A 3E5NA 3ENKA 4D92A 4QBKA 3NYRA 4EARA 1EB8A 1RCFA 3MJDA 3AL0C 2JK1A 4JB0A 5IYZF 1N1DA 2AFIB 4C7OA 4I4NA 3DWIA 2FRXA 5BORA 4DUGA 3SZLA 3SS8A 3HFRA 2D1QA 1N2EA 1O08A 1OTHA 5BN3A 3ZU3A 1C7RA 3MLAA 3DD5A 3UHOA 4I46A 4DZZA 4E08A 5FV4A 1E3LA 2GN6A 3HO8A 3QJYA 2R85A 3G49A 3TLXA 4JSYA 2BGMA 4N03A 4ZXFA 5IEJA 3MMSA 4GMFA 3TIXB 5BVHA 2WP0A 2NIPA 4C0XA 1ISMA 1EVZA 5J5AA 4IRUB 1EIWA 3EGCA 4EGCB 1O97D 4G2TA 3T9EA 3QTTA 2HIMA 1Y8CA 3C2QA 1DRUA 3CRVA 2X4LA 4MWOA 3SX0A 3B6MA 5IVKA 3D81A 3QFRA 1KK2A 4EX7A 1GNLA 1Y1KE 3GFVA 3UHAA 2G7MC 1XMJA 2XA9A 4C6SA 1I1QB 3WWPA 3QEJA 3RFTA 3KFVA 2XB2A 3RHSA 1KMCA 1JHUA 1P0PA 2G6TA 5HQTA 4KLCA 4E7PA 3X3HA 5GPBA 2N42A 2VDKB 1E3JA 3MCTA 4W1SA 5JV5A 3NMUF 3CU5A 5A06A 2UUCB 5AM4A 4L15A 2XMQA 2D1YA 2PX0A 4IMRA 5KNBA 1PLJA 4FFMA 1CHNA 5K8LA 4F4FA 1ZVMA 2HJSA 4TTIA 3RFFA 1K2WA 4UBIA 4WWHA 3RVKA 1ADBA 1E1MA 4KGVA 3D7KA 4U5QA 3TI9A 3W78A 5JH7F 1YVPA 3ZV6A 3L43A 1UIRA 4IWXA 2WT4A 2FR8C 4RWZA 2E6KA 3ANLA 3BDAA 3FDZB 3WL7A 5LL6P 5TMDA 1E2HA 4OYHA 3SZ3A 3AHGA 1QCCA 5L3RA 1U99A 2B8TA 2ST1A 4JOSA 2C3PA 4O5OA 3WYBA 3RC1A 4B8ZA 3NJRA 3TDMA 3LMKA 2C9BA 1Z07A 1FX1A 1NRWA 2VYFA 2ZBPA 2G9ZA 1BE6A 3SR0A 3H0EA 4S12A 5JXIA 3PHIA 4JX8A 3U2QA 3TZLA 3AVUA 3KR9A 4YUYA 2O52A 4DA4A 2C9OA 3CRQA 1GQOA 3FB4A 2AJDA 5LB4A 1WDWB 3QE3A 2GEJA 5CCDA 3ROKA 4DMLA 5LUBA 2Y77A 1M73E 1FIUA 1GAWA 1R12A 4LYAA 1TC2A 5AI9A 1XTRA 4FEAA 5JJIA 4AIIA 2OUKA 2ZI7A 3SFZA 4HNUA 1NDQA 3QWIA 1OH8A 5EJGA 3OLZA 2AHRA 2FZLA 2VRCD 1D2CA 3KLNA 5DGHA 1EDOA 2DR0A 2HSDA 4OHVA 4UMDA 4WGGA 3K53A 5LP6C 3OHMA 4MPDA 2C9ZA 4R1LA 4S24A 4JEHA 3T1OA 3QW4B 1L8QA 3LFHA 4HWGA 4J1NA 4FFPA 1J1UA 2VNAA 3MAGA 4B74A 2FETA 3ZJ4A 4MLCA 2GKOA 3OCWA 3WDLA 5DI9A 5KNCA 3FWKA 1YC2A 2D62A 3F5FA 2ZB8A 2DPGA 1R0XA 2FW6A 1U2TA 2VR1A 2B94A 4YCCA 5ITSA 3UC9A 1VJRA 3QBVA 2QMQA 4KWIA 4NJOA 4CDRA 4CEIB 3GLKA 5ICFA 3T3GA 2FMFA 4J76A 4JYZA 5IASA 4RE6A 4KE8A 1EZZA 5L7TA 3GJ6A 3FUUA 3IP5A 2GN2A 1CUSA 2HBZA 2PL1A 2PKQP 2EZUA 2AZ4A 2MTBA 3DE1X 3F5QA 1ES9A 5CTJA 4YFYA 3G2HA 4PGAA 1C8KA 3ZN2A 4DV6B 3HKEB 1KC1A 3FKSD 1G2QA 1R9GA 5E9QA 2QNRA 1B3RA 2YXPX 5SZJA 2OILA 1ADFA 2WSMA 4YDSA 2AQHA 5FLYA 5ICCA 2C4WA 3H4IA 2P75A 1KJZA 2IHKA 3AEZA 3PRKE 1ZGJA 2WU0A 1EUCA 1VPLA 2P11A 1S2LA 1IK4A 3JQDA 5F2OA 4EYGA 1DCTA 3KZVA 4V0KA 1B43A 3STTA 2E4AA 4LOHA 1PT6A 1OIWA 4H18A 3U26A 1VMEA 4RSRA 2OG2A 1QHSA 5AM0A 3BMNB 5KYXA 3DUFA 1WR8A 4OQFA 1GT6A 3C14C 3V7WA 4MVXA 1KEVA 3H84A 3LRTA 4OBBA 5AW0A 3IAEA 5EJMA 3OA0A 3VO1A 2ODBA 2EQBA 3A2LA 3KSBC 3RS0A 4E5SA 3IE1A 1JSZA 1YC5A 3LT0A 1SOUA 3OU2A 4MB2A 1AZTA 2BE7A 4P54A 2NTJA 4JK3A 3A4VA 3PGXA 1G4UR 3Q7TA 3U39A 1D5WA 3PE4A 1JLSA 2BF7A 1GNVA 2L18A 4OI4A 3V7NA 4K40A 2OCLA 4HNAA 4HG2A 3ESBA 2BEUA 3D4PA 4XVRA 4DIUA 2VDQB 3GJSA 3VR5H 3TLBA 3LRXA 1EJ2A 1F38A 1KI8A 1XZKA 4HRAA 1JU9A 2HUNA 4Y2XA 5E6UB 3TVTA 5H4GA 3EF1A 3W6NA 1XU7A 4D5EA 4R9UC 1EP9A 2ZAGA 1GPAA 2VEDA 4M8IA 4OKNA 4GKBA 3DAPA 1VPEA 4HAWA 4MCJA 2CNDA 4PAWA 1CEEA 4TMWA 4L76A 4DC9A 3H5RA 1RXUA 2QSUA 2VXOA 3IELA 4KE7A 5H3CA 1FLNA 1I9GA 4J29A 1YR9A 1KMIY 3FROA 3GJZA 1NBOA 1PDOA 1XTVA 2FQXA 4NQZA 3CO5A 4XQ9A 5HZHA 4TYWA 3OJFA 1HT1E 1XDGA 2BGRA 5EJ2A 4DSUA 5DZSA 1P4RA 4F11A 2CV0A 1QVAA 3K9WA 1U7TA 4NCJA 1ODIA 1ZZGA 4WZAA 3EG9A 1ZRHA 2XVAA 2GWHA 4F84A 1QDEA 3RHZA 2W58A 2GLUA 3L04A 3V1TC 2A57A 1YL6A 4E94A 1G0OA 3UZUA 3K6KA 1Z3IX 2OBBA 2GZSA 3A6KA 1T24A 3ADKA 1G38A 1DTEA 2GBLC 3WP1B 2IOYA 2C1XA 2Q5LA 3U13A 1C30B 1OLSB 4URXR 4LDNA 4A8JC 4MA5A 2YZ7A 2EFEB 1MVOA 1WEHA 3G3EA 3TEMA 5AESA 2A9JA 1UBRS 1CZOA 4UVHA 1W5FA 3HUEA 1R0WA 4O2LA 1POWA 2JAWA 3ANTA 3U09A 1J5XA 4RCZA 4D57A 1O03A 1YHYA 3PX3A 1VIYA 5EC8A 3BH7A 1PR3A 4X20A 3RC7A 3FFBA 4BEBA 1M1NB 3QE0A 2VP5A 3KO8A 3DG9A 2Q9UA 4P5EA 4QTXA 2PCLA 3R20A 2YX1A 3F6YA 1V9SA 2QRKA 5ECYA 1MAVA 3B9BA 2MYNA 1ZAYA 2BL4A 4RPCA 3TE7A 4KXMA 1BMDA 4XUEA 2XJ4A 2B0JA 2AMFA 3PICA 1E9SA 3D6UA 3KJZA 3P2MA 4TQGA 3S70A 5IBCA 1LDGA 4KG7A 1UC8A 3UW1A 4ZYLA 2FE4A 4HFMA 2V55B 1OREA 1WQ3A 1Q3KA 2CXUA 4PZLA 2BONA 3V55A 2ZDGA 4F04A 1IQ0A 1MA3A 2PZBA 5AK0A 1RHRA 3HCPA 2RCNA 1ECGA 3IDOA 4CTMA 1JR6A 2WYOA 3I9V1 3BXGA 3RGWS 1TK3A 3HDQA 2C1ZA 3RYFA 3U7GA 5KKNB 3ILVA 1Z0FA 3T7RA 1CZLA 1V96A 5TJ9A 2R1VA 4OJTA 3LDGA 1KEWA 4KNWA 2W6JA 1CEQA 1DXHA 3KYCB 4JKIA 2B5WA 1FDUA 3V4ZA 1VKHA 3DDHA 4NDZA 3PQCA 2FPIA 5IXYA 1SR8A 2B1RA 2BE9A 3PX2A 1QG0A 2WAXA 1O94A 4RPKA 3CNHA 2MU1A 4TS4A 5IDYA 4F4IA 1WB4A 2IS1A 3SM3A 5LXTF 2NQ8A 4PX9A 2ZJYA 1I2AA 1CNMA 1Y9JA 4B3HA 5KPJA 3KZKA 2J5KA 1ACJA 2FRDA 3IDZA 2Q41A 3E3LA 3TNYA 4Z7QB 2G80A 1THGA 2PR7A 5AVVA 5AJHA 4AUKA 1FDTA 1FU8A 4LMAA 2BGNA 2Q49A 4GG1A 4QQ8A 2ZB7A 1HGXA 5EPUA 2ANCA 2DBVO 2H5EA 2P40A 4HB4A 3A37A 4BQOA 1U7OA 2ZJOA 3C5VA 4P34A 4HNSA 1IHUA 2QZ9A 4NESA 5GM2A 1A4RA 1QTRA 3FAKA 2E2WA 4E12A 1OPRA 5ALPA 4R8VA 4XGIA 4DYHA 1TQ6A 1E3WB 5ALTA 2C2BA 1BWQA 2D0DA 4HGOA 5HP4A 4P7BA 4PZ0A 5FH9A 1QFJA 2FKNA 2Z8XA 3Q15C 1KJIA 2EP7A 4M0PA 4Q3KA 4TZTA 4DWWA 121PA 1X1QA 3G9ZA 1GLGA 3ET5A 1Z2OX 4Y6PA 3KSDO 4MV0A 2ZB3A 2OD2A 5BXYA 3V4VB 4AKTA 1NW5A 1MJNA 1Y5NA 2H1LA 3EAFA 4UVEA 1O89A 4OLFA 4RACA 1YGPA 3U7RA 1WRBA 3OTIA 3BJZA 3X43A 5B12A 3NC4A 4KVFA 2LUOA 4LQDA 1EVKA 3IFSA 1CF9A 1TRKA 1K6MA 3QEOA 2AEFA 3DBHB 3CVUA 2XMRA 2A2ZA 1KFCB 2YQZA 2XWBF 4JEUA 4MV9A 5LCXA 5CFZA 4UUNA 2ERCA 1U1CA 3OQMA 2JGKA 1RXIA 1C0KA 4QG3A 3IERA 1P73A 4KLAA 4AU1A 1LB1B 5MFPA 3TGLA 5A4JA 5CDUA 3EARA 4Q4JB 2RI6A 5KSYA 4UU0A 3W6UA 4WK4B 3PTZA 3ZBTA 5JQGF 2VIIA 4OGGA 1V5FA 1H9AA 1MDFA 1PJ8A 2NZ2A 4KLNA 2JC3A 2QAGC 3LK6A 4U7WA 2JG3A 4KQMA 3OPVA 2KHZA 2GUGA 2M32A 2ZJ1A 5H83A 4F91B 1V6SA 1ZJ5A 1A95A 1KL7A 2AFVA 2Z2JA 4JB3A 1F1BA 5JZ9A 1KZGB 1RCTE 4Q24A 5JAIA 1GFZA 2Y6VA 1W0JD 2OB1A 3I53A 4GPD1 1PJBA 4QJIA 1HE5A 3K5IA 3IA7A 5KTSA 2QL5A 3QKRA 1F7VA 3FUCA 1KFEB 1ZO8A 2XECA 2QUIA 3EASA 2P5TB 1VLVA 2CSUA 2R44A 4Q5IA 5DN6A 5DTJA 1U1IA 3T1QA 1HL3A 4WXHA 1ISPA 5C5EA 1WPRA 2ZDQA 4BFWA 1M33A 1VA4A 1F17A 2H1HA 3R0VA 4GRDA 1P91A 4W5HA 5SYMA 4C0WA 3EULA 5DFAA 4OAOA 5KU7A 3BCRA 1V4VA 5KNDD 1JQAA 3EPLA 1P19A 2Q1SA 3UV7A 3EFBA 3OZSA 1KMHA 2D2VA 3U7FB 3FWPA 4QU0A 4CKBB 1M2FA 1L8XA 1YACA 2QVZX 2R1ZA 4Q4LA 1DBSA 1VJGA 3KVNA