4LQCA

The crystal structures of the brucella protein tcpb and the tlr adaptor protein tirap show structural differences in microbial tir mimicry.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
136
structure length
129
Chain Sequence
EYDFFIAHAIEDKEAFVQDLVAALRDLGAKIFYDAYTLKVGDSLRRKIDQGLANSKFGIVVLSEHFFSKQWPARELDGLTTRILPIWHKVSYDEVRRFSPSLADKVALNTSLKSVEEIAKELHSLISAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords TcpB
publication title Crystal structures of the Toll/Interleukin-1 receptor (TIR) domains from the Brucella protein TcpB and host adaptor TIRAP reveal mechanisms of molecular mimicry.
pubmed doi rcsb
source organism Brucella melitensis
total genus 43
structure length 129
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4lqcA00
3JRNA 4W8HA 4W8GA 5FORA 4LQDA 2J67A 4C6RA 2JS7A 4FZ5A 1O77A 2Y92A 4OM7A 3UB4A 4C6SA 1T3GA 3UB3A 4EO7A 1FYVA 4DOMA 2M1XA 3OZIA 4LZPA 5KU7A 4C6TB 1FYWA 2Z5VA 1FYXA 3UB2A 4C7MA 3H16A 4C6TA 4LQCA 5H3CA
chains in the Genus database with same CATH superfamily
1T6YA 2XDYA 2ODAA 3DHVA 3EWAA 3SHTA 2WV9A 4P0PB 2JHGA 1SIBE 1OKKD 1M0TA 3N5CA 3SSMA 1I33A 1OFUA 1T5OA 2BGLA 3AB8A 5JV5A 5J63A 1GEEA 3LXUX 2JZOA 1EXVA 3N8IA 5J2UB 4KE9A 4U3JA 1LNSA 3MQFA 3KU1A 1JDZA 3KYBA 4RY8A 5CGZA 4FCVA 5JCOA 3UIEA 2GWRA 1KC3A 3OPYB 2J31A 1NLFA 4MX8A 4WBXC 2WPNA 2PQMA 2Z8ZA 3NUZA 2FWRA 3I83A 2BEVB 5DNDA 1DCFA 1RPTA 3HP7A 1AH2A 2OUIA 4ICIA 2QRKA 5F4BA 1MA3A 2DUMA 2R84A 1AUQA 4A3SA 4BRSA 4E09A 2FFRA 1TK3A 2QL7A 1LNZA 4X95A 1S7GA 3RV3A 3VKUA 2ZJAA 5I01A 2W2KB 4ABTA 3DOIA 3LUJA 2FMXA 4Q6BA 1FMTA 4L22A 1D1TA 2BGTA 2IHTA 4BRWA 1AVTA 5DLPA 2GPJA 2PZGA 2Y71A 3EVNA 3V46A 3CCCA 3HY6A 1WLSA 4ZXFA 2G7ZA 2PL9A 1Q1NA 4D3SA 2WWWA 1DE0A 2ZWVA 2F8TA 3PTAA 1SXPA 1BAPA 2GRUA 2JA2A 3LW8A 4EOGA 1PDVA 4ITVA 3VAZA 2ZR9A 4M9RA 3OZBA 1COZA 1OV4A 2QTVB 1HQKA 1R16A 2JPDA 3SBOA 1TQ4A 2IYQA 4L0QA 4NCBA 1XMPA 1OJ7A 5FLXA 4RYLA 5A3VA 4ZU3A 5L3QB 5FT9A 4YJHA 1I4TD 1BDIA 3W2EA 3LC1O 2HSGA 2NUTB 3KIPA 1LBQA 1USGA 4NPAA 5LP6A 2VTKA 2WC1A 3KT0A 3AUXA 3PXDA 3VVCA 4CDGA 1F2TB 1UH5A 1UT6A 3K32A 1DCMA 2QD1A 2Y9PB 3NAZA 4YJKA 5AW9A 5BXQC 4UBKA 5ICGA 5C52B 5K09A 3GGGA 1RWQA 2VPPA 4RD1A 2JJMA 2MSKA 4Z0PA 4ZEWA 3HP4A 4AKSA 2YZGA 3UUEA 4B7AA 1QBKC 2WVHA 3W2IA 5ICFA 1C3JA 1THGA 1TZBA 4PWZA 3JYNA 1SBIA 3JD3A 1OV6A 4L9SA 1JSRA 2IEAA 3RHTA 4IOJA 4G1VA 2VN8A 3BB1A 3RI3A 2G9ZA 1Q17A 1VHDA 3F1LA 2B3TA 3P2MA 4HQLA 4QXOA 4NJEB 1RKBA 3GV0A 4O4IF 5F73A 4OUDA 3EDRA 3WNDA 5BMOA 2BYTA 1ZW6A 3OM9A 4C0XA 4GNRA 2G80A 2C04A 2FJ0A 4OHPA 3WGYA 5CX1B 3QPDA 4BGUA 4ANFA 1RP1A 4KH0A 1G2PA 5A6VA 3RYIB 4KITB 4P3PA 1HSZA 5DBGA 1W30A 3HS3A 5EQDA 3RC7A 1YOBA 2B4RO 3GGSA 3L6UA 3PRKE 1ND5A 2H07A 5FWDA 5HF8A 3R5SA 4U2EA 2SCUA 3DBIA 4Y8VA 5JBIA 3EODA 3A4VA 4MWGA 4TTVA 3V7UA 4KMOA 4QYTA 2AOVA 1DVRA 2IW3A 4GE3A 1DRWA 3UT5B 3TGLA 3QIVA 3WSWA 4EHNA 2HCRA 2VWQA 2OV1A 3L8FA 2ZRHA 2VP5A 5IC6A 1PS0A 1LV8A 2ZJ8A 3PHGA 1UBJS 2BEJA 2Q4EA 2CXQA 4UUPA 4YMSA 4DLVA 5I45A 3JQDA 3GGPA 4GOND 5JR3A 1DBPA 2O8NA 5LD2B 1ZSYA 1UPXA 3LDHA 4RK6A 5CJJA 2YC2C 1A9YA 2VJOA 4Y9DA 1V26A 1H85A 3LQYA 1PVVA 1KGSA 2HJSA 3KAJA 1MA0A 2HNBA 1JMVA 1DBSA 2ABWA 4WUTA 2A33A 2W8BA 3KSUA 4BO7A 2A9KA 3I9OA 3LCUA 1QX4A 3EDQA 5MF6A 1BA3A 1EX6A 3F2IA 1VBKA 4XQ0A 3S70A 1U2QA 3LLVA 4I2NA 1VMIA 1R8XA 2IHVA 2WMOB 1GM5A 2AFHA 3D7MA 5LYJB 3O3CA 4WXEA 1P72A 2DUNA 2WE8A 4H1TA 1AF7A 4WAUA 1XVVA 4IMRA 4LFBB 2O7VA 3MD9A 4KTVE 3BXFA 1Y9ZA 1ZFNA 1V4BA 2AD1A 1BMDA 2O2CA 4HQFA 1G8JA 1E96A 1TCVA 1FTYA 3NYIA 3O4VA 1Z4IA 4GGPA 4NATA 5ALHA 4DQVA 2B9EA 4B2YA 1G7RA 3HWX1 2EKZA 3LCVB 4DBVO 3KD2A 5D2CA 1GO2A 1RM3A 3M6XA 2QXTA 3CVUA 2UYCA 3R44A 3THSA 2L19A 4BQFA 4G1MB 2DR0A 3THWB 1S9HA 1JU3A 3RC1A 3HV2A 3AR5A 4V0QA 4A10A 3ANXA 2A5DA 4H1VA 5A6SA 4F97A 5AW8A 2GN0A 4V0LA 3TTVA 3H3JA 2HBQA 2VHUA 3P5SA 4FEEA 1LGYA 2ODEA 4PC7A 4ZIRB 3MWYW 1OFUX 4C7BA 4YT2A 5K2OA 3NV9A 3RS4A 3BWBA 3RFFA 4P36A 5BORA 4CKYA 4K9OA 3IO3A 3D59A 3LQRA 2G25A 4G81A 4NK5A 4EPXA 2G82A 1NQXA 4MULA 1Q1BA 1QLWA 1I9GA 1GG5A 4G09A 3CEPB 3FH0A 3N0WA 3EZLA 1KZYC 4Q9KA 4M0FA 5CIYA 2C7VA 4LAFA 3RKRA 4BOYA 2XYHA 3TOSA 2ZS8A 2PT6A 3LUBA 1FX0A 5K0TA 1E89A 2HU7A 2XVYA 1RHMA 2YJ6A 4PLPA 4TKZA 4MV1A 4YLEA 4YREA 2ZBPA 3GLIA 2PJZA 5I7WA 3WGLA 1H1LA 2YNMA 3VM6A 3GRFA 4IUYA 1IJFA 3HB9A 4UUAA 5EN4A 1JEYB 1RQNA 1SXIA 3T4UA 4YFVA 4J07A 3W1VA 1GLGA 1PEKE 2OXEA 2W5UA 4MLZA 4FB5A 4RTSA 1Z26A 4LZZA 4O2BB 1WHTA 4QTZA 3UC9A 3EC7A 4N7RA 5LDHA 3PICA 3P2IA 1MC5A 2X4LA 4BMXA 3DV2A 4C7OA 2R7MA 3Q88A 4M3NA 2G71A 4N8EA 5CTJA 1EA7A 4X6XA 1BFUA 4ZJZA 1LPAB 2O3QA 2QN1A 4CEIA 3SC4A 3HTXA 1W87A 5K3OA 3RRMA 2FETA 3V8QA 3IGFA 5IVDA 1HQDA 4EB6B 1G7CA 1AHNA 4NHOA 4EX6A 5JD6A 2P9ZA 3NH6A 3FCCA 3U62A 3U3KA 1W47A 2IF2A 3DBOB 4RMNA 5ITSA 4PYRA 4FEYA 1A3CA 2NSDA 3MRVA 2WW8A 2AFVA 5B2EA 2Q6VA 4FFBB 1DARA 1MAAA 2J08A 3FZEA 1PBNA 4QU0A 1FFXA 1UZNA 1ENPA 3FETA 1WSWA 3OMLA 1GV0A 1CEQA 3KQSA 2X1HA 4HRVA 4KVAA 4OQLA 4C3VA 2NU7A 1XTUA 4ZTZB 3K5WA 4H0CA 4AJIA 3LOUA 2VYVA 4IKOA 4UQPA 3NHSA 1C14A 1J8YF 1H65A 5DI9A 4YR7A 3I6BA 2CFOA 2Q45A 4I55F 3I45A 2O57A 2R8YA 1CT9A 3KYDA 1YQTA 1FRQA 3GUUA 3L1UA 2OP1A 3OTIA 4KQHA 4RD0A 3U3ZA 2CLOB 3WIDA 5JS6A 3QITA 2DLCX 4G5OA 4EBBA 4M1YA 5CK5A 3OPMA 3E7PA 5C1BA 1PG5A 5LOVF 1NKSA 2NO5A 5DYWA 3A2KA 2J6IA 1OFVA 3V55A 4IS2A 1T8TA 4RKEA 3UNXA 4EA9A 5KQLA 4F9TA 5FD8A 4JL5A 1V41E 1M6NA 2ZU0C 5CAEB 2EAUA 4ISBA 2R2GA 4Q9LA 5BOSA 2E5FA 4AS2A 5FWAA 3TBHA 4H0FA 5EE9A 2O2SA 4YRSA 3A70A 5TX7A 2P4HX 1MVLA 3TSYA 1ZWKA 2HJVA 1LDYA 2ZBDA 4Z4EA 1I7LA 4LZOA 1NN3A 1PT7A 3T7DA 2YHIB 4TKLA 4P4LA 3K0KA 2JANA 3WAKA 4CCSA 1GRQA 1IN7A 4IPTA 5EJ2A 3ZV5A 2X5OA 1DG9A 1M72A 4KXXA 1JXQA 4A03A 4ATNA 2X3UA 2XXAB 2GM3A 4MMZB 4NE2A 4DG9A 1WSBA 4X1KB 4YXWA 3LF2A 4RQTA 1T8RA 3T38A 1SXJB 4OBWA 2EFDB 2NU6B 4IYJA 3HCFA 4ZAWA 3O2QB 1P0PA 1IM8A 1UBTS 1A77A 1YT5A 3ADPA 2DT8A 3G5LA 3H7AA 4U7FA 3I2KA 3FLEA 4X1YA 5I7FA 1IN4A 4LFCB 4I36A 5H0IA 4UTVA 1GUFA 3BG5A 1OXUA 1GNVA 2NGRA 3G6KA 1ZAKA 3JWGA 4TT3A 4K28A 5FHRA 1OPRA 4E31A 4G89A 4WXHA 3Q7TA 4HH0A 4AXBA 4ZO8A 3TIFA 4EG4A 5JZBA 1J8MF 1U7XA 3DBLA 5IT0A 4AZ3B 4QBIA 2FFJA 2HH9A 4XX1A 5F4ZA 3C8UA 2BTQB 3U44A 2IPLA 3PC4A 2UXBB 1ULBA 3EZ7A 5IJZA 3VNAA 1JR6A 1X0VA 1LH0A 2VAMA 2MSLA 2VJCA 1OHHA 4AN4A 1BMQA 1K8QA 2XHZA 4NBTA 3ZU2A 5KVAA 2RGBA 3PDIA 1Y9DA 2LCFA 1IK4A 4KLRA 3LUCA 1YTLA 2Q1YA 1QDLB 3EXEB 4HNSA 3U7JA 1GAQA 3FNIA 5DIFA 2J9FB 3SKYA 3ZE0B 3KJNA 3OM0A 3AQIA 5EI5A 2HEGA 4XYLA 1C1XB 2YMQA 3DBHB 3I64A 2AEJA 3G2LA 4EB0A 2ZYRA 3BH6A 4E46A 1U8UA 2M32A 1G21B 1XMJA 4IHJB 3TAHA 3RC9A 4E4RA 3T0FA 3DPIA 2AWNA 4IRMA 3UVEA 2O54A 1TX4B 4W9RA 2P4EA 4MRMB 5K4HA 4OATA 2X8JA 1XZBA 4S0ZA 3FBTA 2K7ZA 1ODKA 4XEHA 1BE1A 1VMAA 4N7JA 2XMSA 3K4PA 2H2WA 3NHFA 1U0FA 2OECA 3H2BA 4PZPA 3JRNA 5ESXA 4ZC8A 1SU6A 3DO6A 1MIOA 3PNOA 1JUDA 1WL8A 1ZO8A 2QTRA 1XEFA 5E3HA 4WXYB 4S05A 2VTBB 4MUAA 2RB4A 3VDRA 2YH2A 1R64A 1IDN1 2G7MC 3CFYA 3I9NA 3IPAA 2FRVA 1S2IA 3M4ZA 5IWAB 5E7MA 4RESA 2ATVA 1DAGA 2I1QA 1U9IA 1KAGA 4OP2A 4RIHA 3TLEA 5KYXB 2AJ8A 2NZJA 1RR6A 4O2RA 4PO3X 4R8LA 3H3XA 2VNJA 3EZ2A 2A0WA 1IOWA 3P9CA 4G0MA 4JC4A 4BNZA 1NVBA 4PIPA 3DOFA 1FFGA 5I9NA 3CIFA 3SQOA 3K20A 4QFBA 4DUYB 2NP7A 1LJUA 2CFSA 2EF0A 3PA6A 2HU8A 3Q15C 2OL4A 5AVOA 3M9LA 1U8TA 4P81A 5JXHA 1ZN2A 3VJKA 2CMKA 3QVVA 3OE7D 3H4MA 3M9XA 1ZK4A 2Z5FA 3PQ2A 4W7HA 3V6LA 2PT7A 1VBNA 2ODNA 3OIFA 4OA8A 4CIXA 1GVHA 3CEAA 3U26A 5JRDS 2DFTA 3RSGA 1LWNA 3WL8A 4D9BA 4F1KA 4F4DA 3UJ6A 3MHTA 4OLFA 1QRAA 2ZDHA 4R98A 5DOZA 1BTOA 2BIFA 2N3ZA 4H6VA 2PGLA 4B81A 2QU8A 4TZ6A 1CUZA 5C8VA 1FLAA 2OHIA 4JCOA 2OC4A 4X3PA 1Z47A 2FPGA 4EGQA 1IIRA 4ETMA 3FDIA 1GNPA 4Z1MA 3LWBA 3NIGB 3W5IA 3ZJUA 1H66A 4RSRA 3W5JA 4AWAA 1HV8A 3KJHA 4CG3A 4WW0A 1V8DA 1J42A 1NW4A 3FJ1A 4MQMA 3P9RA 1H6DA 1KOFA 4N7BA 4KXUA 3UJ3X 4FYIA 1OH6A 4NCIA 3AIOA 1U1IA 5DE3A 3CLUD 4EUNA 3W8FA 4CMJA 2BSXA 4KODA 2APJA 3MLAA 4Y2QA 3MGGA 5LLSA 5K7SA 4G0NA 1U9YA 4UVHA 4GZ5A 1E6EA 2CHGA 2PSHA 3IV9A 2ZYDA 3PYLA 4TXNA 4RTNA 3NBYC 1Q0SA 4QPZA 1WAMA 4U1RA 4C4AA 2PUWA 3Q2KA 3M6MD 4HFNA 4D3DA 1T5LA 1JQDA 3DL4A 3ORFA 2XKKA 2G5PA 2A6PA 3RKUA 1KY5A 1TIBA 5DMHA 4F7DA 4MLDA 1Q50A 1K63A 4GXNA 5T64A 5MN6A 1ECFA 1K6EA 1UQUA 3D6AA 3U81A 1JT9A 3DVLA 1U3FA 2XYVA 3MGCA 3NXKA 3LNTA 3KKNA 3N2NA 4HZIA 1FB5A 3R7SA 2O0LA 1EK6A 3FLMA 3HKEB 4Y2GA 3R75A 5CBPB 2H0RA 3ESDA 3K0AA 1RS0A 3NHAA 1M5RA 1QAQA 3EGWA 5BWNA 2HL6A 3AZQA 3NHUA 2IV2X 2QT1A 4W1RA 3FMVA 3N74A 4N0QA 2B6NA 2Q2WA 4I1IA 2D7CA 4HUQA 2EZ9A 1MW8X 2PL1A 4DR6B 3B5IA 2O7SA 1WSDA 3GX1A 2PBZA 2J87A 2NNWB 2VOEA 2ZVPX 4KPFC 5B3KA 1S8OA 2I4MA 1Y5IA 4QUEA 2KX7A 1IEQA 1J49A 1YJ5A 2HBZA 1T36A 5LWHA 4KJXA 2PRSA 3IUSA 4B4DA 1YR1A 4C0BA 1C8BA 3D6TB 1PNVA 4I55A 5ALDA 1DUIA 2Z5LA 4Z3DA 1PV4A 1CQXA 3WLNA 1ZOPA 3B38A 2EZ4A 4DXDA 3WBKA 4CLDA 1FS5A 4LIPD 2D1SA 1WXFA 4HNAA 5EE5B 4ZI7F 3EZ6A 1CSEE 1K8ZB 3AUAA 3JY6A 3V8NA 5LOVA 4D26A 3IXQA 1GDDA 1NURA 2YWEA 4MO2A 1XVTA 2B82A 3PDHA 3OZSA 4KZPA 4GKAA 1BS9A 5TF0A 4B9EA 3VZSA 4D92A 5B4VA 2BP7A 5FH9A 1QDEA 1I1HA 1S8NA 1UK6A 2P69A 1U7TA 3AHHA 3FPSA 1E1YA 3ECAA 3GJ3A 4H3VA 4YRJA 4EJ2A 2YUTA 1N6LA 1A2QA 2Q1UA 3HJGA 3K0FB 3FY4A 5K1ZA 1DEAA 1HE4A 3AEUB 1L8LA 1V7ZA 5F64A 1VSQA 1J4AA 1D2MA 3BXHA 3VTZA 2GM4A 1FDRA 1U99A 2GBGA 3FSJX 1X6VA 4HVTA 2WSSD 3HCOA 2WIFA 4MPPA 4NJMB 2BM1A 4JT4A 4J9VA 4LXXA 2W2XA 5C8YF 2YXPX 3FTQA 3JU3A 2JLXA 3YASA 1KMMA 3J7TA 5LIPA 4GI1A 3HKBB 4ZU6X 3B52X 2EXXA 3P9QA 1H22A 1MJNA 5TXGA 3FCUB 3HZRA 3PE6A 4YPFA 3SS8A 5HNKA 2H2DA 4Y9UA 2E5WA 2MINB 3EXHC 1BDHA 1AK1A 5A4KA 1W94A 1VPWA 1BVHA 1XE3A 1OXSC 4CF4A 2OFOA 3C6XA 2Q4OA 2WV7A 2IKSA 1DJLA 2GEJA 4PANA 2H5JA 5JS2A 4EG5A 1JZSA 4GQIA 3FOBA 2IEYA 1OPXA 2FPIB 1VYHA 2HIHA 3OFKA 4RPCA 4EB8A 2WJWA 4AQDA 1H8HD 1LA2A 3WKAA 4GSLA 2QTWB 4D9FA 4TVSA 4DR2B 1AOXA 2WMYA 5EQTA 1PWYE 4KBGA 3T12A 1U63A 3LX4A 2N1MA 1W9MA 2C8KA 4R8SA 2Q9CA 1ZJYA 4X54A 3TJRA 1H0KA 4C88A 4EFMA 2IPNA 3OOEA 3L6BA 1DMSA 1KK2A 4J29A 4Y6PA 1YTUA 5FFMA 3GMIA 3PHCA 4C0SA 2CL6X 2I65A 5C31A 1Y6QA 5E2AA 3ZV4A 2J46A 2J4FA 3BMCB 2IGBA 3GCWA 1ORTA 1ZSNA 2CXTA 4Q7JB 4CQMA 2FMFA 4F3CA 2XR1A 4FWTA 1DV1A 5HSGA 2ADFA 3MBOA 5SY9A 3B2QA 4OP3A 3ZHTA 4IFEA 2JD0A 2RGDA 2ZBQA 3OF5A 2J6HA 1QKIA 1GR1A 2JHAA 3OD1A 4FD3A 1RXSA 2C92A 3M49A 1B8PA 5FWXA 3IVAA 4YMLA 4IEEA 4QXAA 5BW5A 5AJHA 2QTNA 4F9FA 3B5EA 1GTMA 3HSSA 3JQCA 4V2UA 4E94A 1BWQA 1WKVA 1USVA 3BFJA 4EYEA 4PFSA 5AKLA 4MUBA 3K5IA 1Z6PA 3GUVA 3VHXB 3QEAZ 3MUNA 1I3CA 1QXSA 3CT6A 1MJFA 2AZXA 2HCJB 1GL9B 2Z56A 1OZAA 1JQ3A 1HORA 1LF0A 4L95C 4OHBA 4XGQA 5C1DA 1YQUA 1KAHA 3GN2A 4L2IB 2NPIA 3AL2A 2ON6A 4PNPA 1WXWA 4PLVA 1DJOA 1M34B 1TRHA 4GLJA 1QIEA 4E2YA 2QVLA 3A8TA 4F21A 2FOLA 4MI9A 3LO5A 1T1JA 5LQMA 4FFLA 2F6RA 3F90A 4MVJG 5PGMA 4B6RA 5C37A 2IBTA 3NWEA 4P32A 3PP8A 3UAYA 5C5EA 2PD6A 3IB6A 4MRRA 4L9WA 1IY9A 2JCBA 3OQPA 3GHHA 1AKQA 3O9VA 3VU0A 1W4AA 3R6TA 3BMOA 5E1OA 5ALKA 3WFIA 5AW6A 5JMTA 4L15A 5K0FA 1OFIA 4HH4A 3CKKA 4KNVA 3UUFA 3ESAA 4Y67A 6GPBA 4IGKA 3E1GA 4ESOA 4RX1A 3W9YA 3AX6A 1FRVA 4QAQA 3G2QA 2NP6A 3C39A 2WG2A 3Q2OA 4KAXA 1SUIA 1ZNZA 3IPYA 4TRRA 3WDLA 4EHAA 3FN4A 5KKNB 5F2EA 3ECSA 4MUJA 3TN7A 3T9EA 4JWKA 2JJYA 4IIJF 5BOVA 1RIFA 4JXZA 5JNVA 4D4GA 3G0CA 1SIWA 5CITA 1QR6A 2JAXA 1K3UB 2VEDA 3HCWA 7ADHA 1VRWA 4N6GA 2VP3A 3QJ5A 4WDQA 2FQ1A 2IYRA 4IVNA 4MGHA 2E9SA 4J2OA 1EUZA 4MVJP 4WOBA 2AXEA 2JCVA 2VYNA 3NEYA 4TQ9A 3P5BA 3OZRA 2PCLA 3IVRA 2C4KA 3PK0A 4I9UA 3OF3A 2BMEA 5GP1A 3SGLA 3MIIA 4I50A 1Q0ZA 5I4BA 1DKUA 4TQUS 3FOFC 5BNFA 3LGXA 3PXGA 3TM5A 4BLTA 1DFIA 1H42A 4FMDF 1BDBA 4IVRA 1BMFD 1FSSA 4FDUA 3T61A 2W90A 4G5GA 5G1NA 1Z8NA 2Y8EA 3L18A 2W37A 1MJGA 5NLLA 4N5HX 4MI6A 5I9MA 1M8GA 2PUHA 2VRCA 3C7DB 1EVZA 1ZRHA 3AUSA 5ABPA 1VDZA 2Y1EA 5JSFA 5JWRA 4QJIA 3NDPA 4FGSA 2D54A 1IOZA 2FZ5A 3KRTA 3UXHA 3AEKA 1D3AA 1TMGE 3CN9A 2RK6A 4PX5A 2IHNA 3L9XA 1QU2A 1BCRA 3P19A 5GQSA 3A1EA 2C03A 4PGHA 3QHAA 4NBLA 2IV7A 4HN9A 2D0OB 5HIJA 5FO1A 5REQB 1UPAA 1QH9A 2XWJI 2ZCUA 3LQ2A 2P9JA 4RCZA 5GZ3A 1JAXA 1GU0A 1A97A 4JBIA 4OH7A 4BZXA 1H0RA 3NTUA 2YZ2A 1C7FA 1TD9A 4AZ0B 4AN1A 1ST3A 1FLNA 1TIKA 1Z62A 2OWEA 1CUGA 4GWKA 3HLTA 4BLWA 5KTMA 1XTPA 2LP4Y 1U98A 4IZ6A 4RF4A 4LS3A 2XOKD 1KGDA 4C4ZA 3E9RA 5E3IA 3GEIA 3T5MA 2DH5A 2AXNA 2FEMA 2SBTA 4QWWA 4QOEA 2EJBA 1F8YA 2PZBA 3E0QA 1KAEA 4YV1A 5AW0A 5IUNC 3NWPA 4P0QB 2NACA 2I7VA 1FF9A 1P1KA 3GEGA 3QU5A 1J99A 3W90A 3ZZNA 2QLMA 4M9UA 3L82B 1DIAA 3IALA 1XK7A 1CQIB 4PTYA 3TNYA 4A23A 3ONWA 1E9DA 1ESMA 3E2IA 3IEPA 1NXPA 1OYYA 3ENKA 1HMYA 1G20A 2F00A 2FUG6 4MUEA 1XPJA 3HDTA 1NYQA 5M34A 1QLJA 4Q37A 4NOLA 4PGMA 4DDHA 1BNCA 2LW7A 2VL7A 3IAFA 1Z0AA 3ZWVA 1DTEA 1USUA 1LRLA 2G3YA 2C5LA 2B8EA 3DTNA 5DB4A 3C97A 3UMFA 1DQSA 2Q4TA 2Q8PA 3P94A 1W46A 1AQIA 3LVBA 2JHPA 3D81A 4XLZA 3HBJA 4F11A 5K20A 1TL7C 1E63A 4F5WA 1CVLA 1WA5A 3PDWA 3W4KA 4C2UA 4BE4A 4GLLA 1LJLA 4XDHA 4NCHA 2XVAA 4BN5A 3ZCXA 3ZCPA 1EXMA 3JVEA 4BU1A 3TM4A 2HSZA 3LHKA 3QJYA 4NL4H 3VGPA 2JFQA 3OURA 3UKJA 3SMQA 4HDQB 4FQ7A 3PNMA 2CK3A 4GPAA 2DZDA 4MCIA 5EZSA 5IVIA 2DETA 1FUYB 4CKZA 5ICEA 3DW1X 2J3QA 3FDXA 3ME5A 3DXZA 2HIAA 4X85A 1L5VA 1DIGA 3CX8A 2VP2A 1BQEA 2G9RA 3HA3A 2DQKA 3DDWA 2FX2A 2EFYA 3ANTA 1AG9A 1HL7A 1E9BA 1QRDA 3HY3A 2BR5A 3PGLA 4KG7A 4LGYA 3P97A 4Q1AA 1WM1A 2BJVA 4Q4JB 1UZAA 4KDFA 1Y5RA 1T9CA 1QHFA 3Q2IA 4MI3A 2HZBA 2Y1CA 2YV1A 2J0VA 1TFUA 2RIPA 1WCIA 1MO3A 2WIBA 2M98A 3AIIA 4FBLA 1C2TA 5ALWA 1YZTA 5C8DA 4P7KA 3ETLA 1SWWA 5LQCA 4RPJA 3EFHA 3ZWQA 1HNWB 2JFBA 1Z38A 2GEVA 3MAGA 1JDBB 1S4QA 2H00A 4UU8A 5J4HA 3FCOA 4RPIA 4E13A 1XJ0A 4F4IA 5AVRA 5I51A 3HNRA 3BJIC 3V7FA 1ZUIA 5CCBA 1M8FA 2PYIA 1MQAA 3RVMA 4NV1A 5SZJA 5JRJA 4WESB 2HRQA 1GGFA 4Y6RA 2QZ4A 5KBYA 2V03A 1FDOA 1QGZA 2FUKA 2HFKA 2OTCA 3N2KB 1GILA 4K9QA 3SYLA 2OQVA 3WK6A 5A5FA 5A9TA 3RUAA 3DVQX 3LMKA 2NPFA 3NT4A 4OAOA 3ZBTA 3EA5A 2ZRPA 1E2NA 1OTHA 1IH8A 3KQYA 3AR6A 5LP6C 2QGNA 1UDXA 2XWPA 2C3YA 1ZK1A 4EQ6B 5KC9A 3DE7X 1TCUA 1PN3A 1U7ZA 5AUOB 2JGKA 3F5DA 2TMYA 3VX4A 4WLUA 3STWA 1NVTA 4A8TA 1KE1A 2AQIA 3TNFA 2WKWA 1BXRA 2WTEA 4U9IS 3BXPA 3PT9A 1SUFA 3ZXXA 2F3RA 5FIUA 3RK4A 2K87A 1YA4A 2QS9A 3BWCA 3OF2A 1GT6A 2PG3A 2CXPA 3TW4A 3E3MA 3GLQA 3ACCA 1XRLA 2GERA 4PHHA 4WXPA 4BYGA 4F38A 1ISIA 2AJTA 2ZXFA 3Q6MA 2X5XA 3V8PA 3OICA 5D3ZA 3U3JA 3L6RA 4URFA 3OTOB 3D4IA 4L73A 3SF0A 5BWBA 4FYMA 4TKVA 2CNKA 2Z3WA 4NAHA 5EUBA 5HOQA 2ZGVA 4WERA 3ICWA 1UBEA 3VR4A 4UUQA 4EY5A 2CLSA 2V55B 3ZTTA 1U7UA 4PAOA 1QOZA 3H5AA 1JNYA 4G8DA 2QR5A 4IV5A 4LRXA 5AXCA 3M3DA 5GMOA 2Q46A 1YCGA 3H1BA 1B6RA 2PBRA 4CT0A 4UJ3A 5E6UB 3RGGA 4BNNA 1XN1A 3AV3A 5MFZA 2B4KA 2I0FA 1BHO1 2WA2A 3RG8A 1C29B 3FOAA 1UFKA 3RHZA 1A69A 5BN5B 2VQ3A 3X44A 1K7FB 3KQNA 3PQ5A 1EKXA 4IIUA 3TAXA 2FZLA 4IZOA 3T7AA 1SOAA 4BUZA 2NO7A 3HCBA 4BS9A 4NZPA 4P86A 1TK9A 2R7KA 4HEA6 4BKMA 2OBFA 4CM3A 3H5VA 1ZA1A 1WMBA 4I4IA 4F84A 4HSGA 1OXXK 5BV8A 2B8JA 4KIUA 1VKZA 1V37A 4UE2A 5DHSA 5KOHB 1ODIA 1P19A 4UHHA 3TX6A 3U80A 5KYYA 3FWPA 2H1HA 1Y8CA 2Q0XA 1KPIA 5CVEA 3O8CA 4B47A 4X61A 1DKMA 4HI0E 5F33A 3M6IA 1UPUA 5FAKA 1YQDA 4W8HA 5CEFA 5E38A 1B8VA 1VHWA 3HR4A 2QMZA 5BR8B 1JI3A 1UKYA 1MC4A 1Z6TA 3MA0A 3EYWA 1UJNA 4HFRA 4J7CA 1A7KA 4MVXA 5J40A 3THRA 4CE6A 1N7HA 1HX7A 1WWKA 3SMVA 3HUUA 1NT2A 1KDPA 3O47A 3QUSA 5FFFA 3OKAA 3WQQA 3IQGX 1S0UA 3UHAA 1RLUA 2GVZC 1NUHA 2QSYA 4KXNA 2C8VA 1KRHA 4BIMA 1UAYA 3KLMX 3DFIA 1KBZA 4EZIA 2BH2A 4AY2A 2P78A 1R6UA 4MV3A 4PAQA 1QIIA 3BQ9A 4TMTA 1OVMA 5TT0A 3ST7A 3VC3A 1L1RA 1K5PA 3IELA 1C7EA 3ZHOA 1G38A 4MYTA 3KQLA 3E53A 1G63A 5HJ2A 4BKQA 4WEQA 1YMQA 3NAQA 2EJVA 4X00A 2GSDA 3COVA 1VA5A 4NRDA 3NX4A 3D3WB 1N5KA 2WYOA 4RDXA 1AHPA 3AK4A 1X8XA 1ZVMA 4AUNA 3AVXA 4BP9A 5E1MA 1UODA 1J39A 3Q5EA 4IXMA 3QW2A 4RKWA 4IM7A 3DOOA 1JDVA 3OY2A 5CLGA 5J2TF 6PFKA 4A2CA 6ABPA 3N2ZB 2IL1A 3U49A 2C9YA 4OFBA 2AA3A 4UHJA 4NDNE 3U6BA 5L6LB 2EWWA 4HC4A 5HKOA 3FI0A 4B6JA 1U6IA 3IB3A 2QW0X 1P9LA 5B1EA 1PHRA 1IY0A 3U4AA 1S8FA 4XIFA 4Y9TA 5IXYA 4C0QC 3LP5A 2C2OA 1EVJA 3FNRA 1Z34A 1VI6A 4FHDA 2VT2A 4N0DA 4BDSA 4JR1A 1AKWA 1ZMXA 2WILA 4L5YA 4ILEA 4QVGA 1JHAA 2A0YA 4ZEOA 1GZ7A 2FW6A 3G2IA 5K3FB 3PNKA 1YBVA 1M76A 4PSVA 4I9NA 1JSLA 5T4BA 3LOPA 1ZA2A 3NUGA 1G3RA 3LX5A 3OEHD 3SE0A 3RYCA 2IOHA 2BDUA 1JFLA 3AUFA 3CEHA 1Z07A 1BSVA 3KG2A 2O52A 4FOSA 4KZKA 4UMEA 2YNMC 3SIRA 2QPLA 2H5IA 2JEOA 3TOXA 3EXG2 1M8PA 3QFRA 1RC0A 1T0PA 5CVTA 1GFSA 4L5AA 1OR8A 4G0XA 4IFTA 2P75A 2W6JA 1BWPA 3MWKA 4YO7A 4CNBA 3FIUA 2AFRA 4DMKA 2ZCJA 2CJXA 3WFZA 3BFKA 5DM70 4F3YA 3RT9A 1QM5A 1IBSA 1F20A 2NSYA 2PBFA 2PXAA 4HXGA 1F2DA 1RWWA 3A27A 2V7XA 5C7IO 1A2KC 3AUYA 2XUHA 1OYWA 5IT5A 1L3CA 4DHEA 3SEAA 5E6RB 5KOJA 4HLUC 2VS1A 3OJEA 1SQSA 1TECE 2OCIA 4HAIA 2OG2A 2P3SA 3A11A 3CJTA 2M1ZA 3F8WA 4QLAA 3WKEA 3RJ5A 1VC2A 3ZWDA 3DQZA 4EJSA 4F71A 1GV1A 4FLMA 3N9IA 4XIYA 4YECA 4IH1A 2D2IA 2OLJA 2PDAA 1X7ZB 2JL1A 3UJPA 3ZQ4A 1ADYA 1YOVB 5JTUA 5KDOA 1QH0A 4M46A 4DG8A 2IT1A 2QX4A 2FTKE 2VJAA 3FSRA 1OBHA 1PWXA 4FZ3A 5E2BA 1O6GA 1TAHA 3JYPA 4J91A 4LXUA 1ZM4A 5TGDA 5IJ0A 1X1RA 2HFJA 3KPYA 3GLSA 2IGTA 2PFSA 4O4JF 1YZNA 4Y2RA 5DXJA 4EKGA 1IUNA 2H6EA 1U8AA 4TVBA 2C7RA 1M2GA 3CTPA 4WJLA 1UK7A 5IWCA 3L4SO 4QHYA 3A1FA 1CUCA 2JGDA 4BUJA 3T3IA 1UMCA 1ZXBA 2ZWMA 1J1UA 2QQ5A 4LHSA 4MDEA 3GLFA 3TS1A 3R6DA 1L4KA 4TVOA 4BO8A 2GPSA 4JS0A 5D00A 1LJ8A 1H93A 3L04A 4FWBA 1VHJA 2BN4A 2RJNA 3F7MA 2EX4A 3PA8A 4QGHA 4B73A 4Y0VA 3FYUB 4KQIA 5F5LA 1UPBA 1MR3F 4JOQA 1E18A 3HL4A 1DP4A 2Y4NA 4RKRA 5LL6P 2VZ9A 3R3VA 3C7AA 3ON5A 3U7QB 1BJTA 1WUIS 4CL8A 3ILSA 4RA6A 4D79A 1M66A 1ZHHA 3DS8A 2DB3A 4PYOA 4JNCA 1QQ7A 1AA9A 2AX4A 2C98A 3CLHA 3VH1A 2C29D 4BLSA 3IUJA 4LHEA 3M7IA 1OFHA 4IQFA 4G8CA 4IV8A 2QN3A 2P0YA 5AK3A 4B3TB 1XWWA 4XGRA 3MTQA 4MMXB 4FX2A 4JV5B 1FYEA 3BA6A 1NJFA 4QG3A 1G2OA 3BQNB 4C2BA 4BNGA 5KPJA 5K6AA 3ONVA 3TVDA 1E2KA 5DSXA 3TG2A 1Z5GA 2OAP1 2F3PA 4F4FA 1Q3HA 5FPKA 3VNSA 2QBYB 4C7MA 2COKA 1GN9A 3ENVA 2A9OA 2B25A 2XLCA 1WXGA 3D2AA 4PSCA 3DLAA 2PMEA 5E4TA 2IEDA 1Z35A 2QM0A 3M3HA 4QQFA 1A8HA 4MVJH 4R2HA 1C3LA 2HLDD 4TKUA 4DC0A 1ZLYA 2A92A 1PYGA 4WK0B 3Q0TA 3DDHA 1NOJA 4PHGA 1GZ6A 1OAKA 3KOUA 4CIVA 2W6CX 3GG2A 4FZRA 5DYNA 4KXWA 3R9KA 2GNAA 5JANA 1RSZA 2CSUA 1OXMA 1POWA 4FKBA 2PQ6A 4IS3A 5CW1A 2GXQA 5EGSA 2CXRA 1V11B 3CURA 1H2YA 4OQ4A 4JJ4A 3H4IA 3QEMB 1PFYA 4JJGA 2YHUA 2HGSA 2A8YA 1Z4KA 2R1ZA 3O82A 1AV7A 1ZK3A 5KVQA 4E1BA 1LQUA 2GM5A 1E64A 2ZIAA 2ZK7A 3KZKA 2IU6A 1TZJA 4OHFA 1Z4LA 4Y0NA 4DLTA 3JQAA 3PKIA 1TEZA 3QFCA 5ALEA 2CJFA 2YV4A 4WADA 3DFFA 1MBZA 1UDBA 3PFKA 3SC2B 1QFJA 4XPIA 4CCYA 4BVHA 3Q98A 1HG0A 4BX0A 4YRZA 2A7QA 1PVDA 2QWXA 1QHXA 4IJKA 4KI7A 1ILEA 4MS1B 3RE1A 4RVCA 2C2YA 4OKIA 1FFYA 4DV6B 3E9DA 3CG4A 3RS8A 4AZSA 2QX8A 2ORVA 2A1UA 5A3RA 2H1LA 3DE2X 3HACA 5F2OA 3F6YA 4FE7A 1SCUA 4B7CA 3HI6A 3VV3A 2C31A 5KU7A 4KQ2A 5CIWA 4MUMA 3HFJA 4B0PA 8MHTA 3ZBQA 1L7QA 2VCYA 3W4IA 2D1TA 3QSGA 2HF8A 3FUXA 2VYVD 3HXLA 1ZXXA 5IBQA 1QH1B 1IZ9A 2R751 1P8AA 2HAEA 5IBPA 1SUBA 2VZ0A 4KYUA 2Z5GA 4DEYA 4H17A 2NQ2C 1FP1D 4GVXA 1U9IC 4K6HA 4E5KA 1WUKS 3R0ZA 4CG0A 2DWUA 4E5DA 1LZKA 1U3CA 5G3ZA 1KE2A 2WA1A 1M83A 3A1DA 4U7HA 1GPAA 3SJBA 4IO0A 4M99A 1SBZA 1Q77A 3PXAA 1N7GA 2EDCA 1NI4A 2GHIA 3ZE8A 2ZJ2A 3DYVA 2HMVA 3JARB 3RYTC 1MJHA 4R1UA 1L4NA 2A2ZA 2EDAA 5FADA 5EJ5A 3S28A 5FBQB 2D8MA 4EF5A 4MGKR 2PUAA 1UMBA 1WHSB 3O4IA 2WAMA 3X1WA 1SCNE 2FN3A 3D3KA 3SYKA 4B6QA 4MAAA 3ROMA 2CBXA 3FTDA 2BHTA 4G0PA 3U2QA 2K6GA 2ZRAA 4RA9B 4JITA 4DV3B 2ZW9A 1A5TA 2I1VB 3E4DA 4P7JA 4G9GA 3O90A 2QRPA 1YR3A 3ZVMA 4DSUA 2JH9A 2FSHA 2RHHA 4N6NA 1CYEA 2B34A 4J16A 4P4NA 1NPYA 1YVDA 5PNTA 2ANBA 2HSDA 2UUBB 2X6QA 3RFVA 1RWKA 2VHJA 4LBVA 4RTLA 5A0VA 1XKQA 5HW0A 1D4FA 1HLDA 3C3WA 4TT3D 4US1R 1V47A 2ZRJA 3S68A 3S99A 3SLRA 3VU3A 3AKZA 3LT4A 1DKOA 3LQQA 2IYUA 2DY0A 2HLHA 5AW4A 2FPUA 2IF0A 2UZ4A 3PHBE 4M4SA 5H3HA 8AT1A 4IIFA 2MSWA 1PWHA 1XL0A 4RW0A 5EKDA 1KQOA 2X9QA 3L7MA 4RZIA 1Q12A 3GEDA 3KJGA 4MQEB 2CE7A 1YAHA 1Z8FA 2HJHA 1JIVA 1V1MA 3F6CA 3N87A 3IQWA 4WZ6A 3RIMA 4CUJA 4EHIA 1QE5A 1T8YA 2AMLA 4N48A 1E2BA 5F51A 1OHHD 2F43B 3E2PA 4G5YA 3ZOZA 1T4MA 2XCLA 4MITA 4OU4A 3RJZA 2PX6A 1YASA 3KVOA 1ZINA 5KPDA 3N28A 2CNDA 3KQPA 2YY5A 1U2PA 1MLDA 3QKTA 4TRNA 1TZ2A 4N47A 1AC5A 4L50A 1F1BA 2IQ5A 3SAJA 2QK4A 3R9XB 2A9PA 3CF2A 1RYNA 3MELA 4EIWA 1M7BA 2EWMA 1PT6A 4EUFA 1X74A 5GV8A 2OOSA 5JI3E 3C3XA 1EHYA 4QL3A 4A6EA 3MXOA 1NMQA 1OTYA 1RI2A 1BJKA 2G9VA 1T1SA 2UYGA 4O4JA 3JRWA 4Q4AA 5DP1A 2AXQA 1FJXA 4P3NA 4DDMA 1E0AA 1LSSA 4ZO4A 1D6NA 4X97A 5FTNA 4XWKA 3HXTA 4AN0A 2C5SA 3TIGA 2CVHA 2CF6A 4P83A 4C6TB 3BMNA 3RAPR 2O50A 1AT1A 3RSHA 1CWUA 2XXBA 3E9EA 1N6KA 1PZNA 2XW6A 4TS3A 3VTFA 2JCSA 3JVUA 4CF5A 4YRIA 1K8YB 1KI7A 3TRKA 1MORA 1SXGA 2IIQA 4PHTA 4ALIA 4H3KB 4C2AA 1XAJA 1ZVQA 4IIEA 3UF0A 4K86A 2G07A 4ENSA 1RLIA 3I9KA 3I9JA 3L43A 1Q3TA 3PC2A 4QUGA 1XI2A 4C0LA 1SO8A 1Y7TA 2BFFA 1K2VN 2HRZA 2H4YA 1JA0A 5H9WA 2EQ5A 4OU5A 1EM8B 3SHOA 2Q3EA 2O5EA 4OLJA 5LBIA 1Q74A 3W6NA 5JBNA 3ROGA 3G0BA 4ACAA 1FZTA 4YRRA 1IZYA 2NQTA 4HH3C 1E1LA 1UPTA 2PFKA 4XM2A 1E79D 4W1PA 2WDZA 2AFHE 4WVLA 2HCBA 2W58A 3GJQA 1YIOA 1RRMA 2XQIA 3STYA 4AZTA 1NZDA 5D86A 1T3TA 2YJGA 3BAZA 4DLXA 4DLZA 4B3SB 1FSGA 2YQ4A 4CV1A 4EL0A 1Z3IX 2XF8A 3WADA 5BSVA 2YJ3A 1M33A 2ECFA 1CPYA 2QQ0A 1MB0A 1VKRA 1X7HA 1YB4A 5CFNA 1FBNA 5CT5A 5IDWA 4FDVA 2O8BB 3CX3A 1B0AA 4A16A 2PS9A 1Y5NA 1J9ZA 4Z1MD 6ADHA 1H2XA 1ORIA 3M6VA 1T1IA 2VDNB 2O8EA 2CNOA 3A2MA 5TDHA 5ALLA 4DCTA 4LF9B 2OZEA 2PEZA 2A84A 2PH5A 3BDAA 3K9CA 2Q50A 4NH0A 4RD3A 5JAQA 3FXAA 4MGEA 5BNTA 3OX3A 4L4YA 3JZFA 3OQ1A 1TOAA 3R0VA 1L5YA 1MHPA 4L4ZA 3GFQA 4RSGA 4G3XA 4WNAB 4DA9A 3A0UA 1P1RA 1Y3FE 1GAEO 5KSZA 1Q19A 1RRCA 2WD7A 3HL0A 3OHMA 2UZ1A 5BQ5A 3FYSA 2HJ9A 3UA4A 5AKXA 2M2IA 3BJZA 3DDCA 2F3TA 4KYIB 2WWVD 4I08A 2O1XA 2GO1A 3C8HA 3KUKA 4H18A 1UM8A 3VU9A 2DE0X 3ZVRA 1UT5A 4YMHA 3ZK9A 4C29A 1QIFA 1G0OA 2ASVA 3JYLA 4HXEB 2DC1A 3K8OE 4J75A 4X92A 9MHTA 4BRUA 2VPWA 4UEKA 1PGJA 4EI9A 1HO3A 3OAAA 5L3ZA 3OX4A 1U2RA 3PJEA 4D8WA 3AIKA 1UEXC 3PFGA 1SRRA 2V4ZA 2DCMA 1WXIA 4LKRA 2XE6A 5J4LA 4XQEA 2DHEA 3EEYA 1PG2A 1E2MA 1IVNA 1XYYA 1Y1KE 3L7YA 4OCZA 4RHEA 3GLVA 5L3SA 1OZFA 3G1WA 2YXLA 2QDKA 5JJIA 3AQ4A 3M70A 1UUFA 3N7TA 4KO4S 5LMUB 5JMWA 4I1SA 2B83A 3DMNA 4B17A 1SURA 4UCFA 2BTOA 3HUTA 3O1IC 4CTJA 4DAOA 4RTMA 3N2GB 3GF4A 1XEXA 3PXBA 4A1FA 2JCXA 1QVVA 1HBJA 1I6LA 1RNLA 2COEA 2Z9DA 1BU8A 1UCFA 3T7RA 5CDFA 1CQWA 3SP1A 3BK2A 2DTEA 3OZFA 4REMA 2XCUA 1GVNB 3IULA 3WWDA 5IT9A 2AJBA 2OSVA 3KOWA 4Q1EA 5DNAA 2PS0A 3EA4A 4RADA 2AFIE 1SC6A 2WKQA 2WJZB 2P2LA 2PU5A 4JZYA 1FP7A 1NBMD 4JLKA 1L7RA 4S35A 1LI7A 3QIAA 3WLQA 2IPMA 5IAJA 1H2ZA 1KEPA 1QQ5A 1TIPA 1R6TA 1UPFA 2BUAA 1TUEA 2DBZA 2ZRMA 1N3LA 1WCWA 2IEGA 3CNNA 4OEHA 4QG7A 1T15A 4H4CA 3JQQA 1G9XA 5EQFA 1T2VA 4G26A 1RPAA 4R4JA 2IPXA 2QYHA 3BSYA 1DTWB 3R3XA 4QTYA 1NNI1 5BUZA 2DSNA 5T5QA 1QPGA 1JR3A 1NV8A 1P6UA 2ATEA 4KGDA 4B82A 1U3UA 2GN8A 1EGVB 3C0KA 5LJLA 3I61A 1N2BA 2BAGA 3GLGB 3E5MA 4W6QA 4JX9A 4GKKB 1A04A 1I24A 1FYFA 3OFNA 4UTRA 3IJEB 1M1XB 2Q8NA 3K5HA 5KNDD 2ZUTA 1HKUA 5J5AA 3ZWCA 3L8EA 5T8KA 4L4UA 5BR1A 4ROSA 1N6NA 3DW3X 1NHGA 1FFCA 2XJ9A 1IY8A 1FFWA 4DV4B 1P3Y1 1MOPA 4I8XA 1XRMA 3DEAA 4V0KA 5KNBH 4PZYA 3U3RA 3PUHA 4MYUA 4Q48A 1G19A 1T6BY 4WZBB 3DVRX 1G3IA 2DU8A 2O2YA 3OCZA 4YVFA 3DONA 3VPCA 4CMIA 1B15A 1JU9A 5EP1A 5IYZF 4CEHA 2V1UA 4PXYA 2IUFA 3RB8A 3K2IA 5LC1A 4XCVA 3P0JA 1Q1EA 2Y2UA 3EGXA 5CVCA 3EH1A 2E7ZA 1T34A 3ADCA 5H16A 3FLBA 1KO8A 1G55A 3EDOA 4CHGA 1X8LA 4LZWA 1EI9A 3JQBA 2P6PA 1DU4A 4PSUA 2P2NA 4GP9A 1RJ9A 1M73E 3LLSA 1H1TA 3O8BA 3TTYA 4KQFA 2AK3A 4A7PA 1KS2A 1ULZA 1PWZA 2XDQA 5HGXA 4GMXA 2AOTB 2Z2ZA 4UVDA 1UBCA 1P5HA 2ECKA 2RGCA 2XH8A 1ISJA 4GRIA 3ZI7A 2EW1A 2CB9A 3G23A 3N6RA 3I37X 2E89A 1SBQA 4I8IA 5KTTA 1YS4A 2BFCA 1BQ3A 4A9AA 3ZI4A 2HQBA 3WHPA 5CDUA 1U8YA 2ZSIA 4W9NA 4XJVA 2ZBGA 1IXYA 1TZCA 4G0YA 1XMIA 1ZMTA 1NI3A 4FFRA 1B6SA 5GM2A 1FSPA 1M75A 2ZBUA 4BGDA 3GQVA 1ICEA 2WTXA 4ZVKA 1PUJA 3C87A 5KAMA 2B7BA 2IELA 2YDXA 3EE6A 4XVUA 3NNSA 5IG2A 3DTYA 2WNIA 3H8VA 3RUPA 5EVJA 5JAZA 4N49A 1OIWA 3NGLA 1KYTA 4FHEA 3S2IA 2WHRA 2XNHA 2L0XA 2PCJA 3AGPA 3EC2A 4X91A 5AKGA 5EVCA 3ZQJA 4QTXA 3SX4A 3ZHRA 4X0EA 2JVIA 2O5VA 2VPTA 5FBKA 3LC0A 4UUNA 2Z9BA 5D7NA 5K8UA 4GP6A 3WNCA 4DZZA 2XZDA 3IIJA 1FPMA 2K5UA 5ER9A 3VO2A 2YRXA 3ZWOA 4GLFA 1MEEA 2A88A 5E8JA 4HGRA 5BVHA 2R1TB 4OGFA 3EPKA 3THXB 1BVUA 3U0VA 3A05A 3ANYB 3KOOA 4Q1DA 3C6ZA 4DE5A 3ESZA 2YOFA 3HDQA 1II8B 3TJMA 1PJRA 5B4TA 1M2NA 5KTNA 3F4BA 3BFVA 3H75A 4OHMA 5JXJA 3TG8A 3U7IA 1WUTA 1YC2A 2FLKA 4FNMA 2GKGA 1ULAA 2W6ID 3FM9A 2WJ3A 4TUYB 4FILA 3UOAB 4YCCA 3D3EA 1OAOA 1CRZA 1K86A 4EMTA 5AHWA 3QI7A 4HWTA 4L51A 1BFDA 1SK9A 2OORA 1A76A 3UJNA 4GOMD 2BM8A 4TN5A 3ZZ1A 3D1JA 3IUEA 4EY4A 2A0FA 2PD3A 3ISJA 1DEOA 3WGUA 4E5SA 1NU6A 13PKA 1D0IA 3BBLA 2ZE7A 3H9JA 1NGSA 2RBGA 3KZCA 3QWFA 3WNQA 4W5QA 4QRIA 3HJBA 3ZKWA 5CM8B 2KBEA 4KE8A 4RZQA 5KTYA 5ADHA 3L6DA 1NXSA 4BE9A 2QR2A 2RAFA 4M0UA 2H7VA 3M5WA 3R76A 5ANRB 4F04A 1BWSA 1RI3A 4YJ2B 2I6QA 5FUQA 5IN4A 3HWSA 3VTAA 1GZSA 4Q7MB 1RRVA 3GUCA 2PWPA 3IP1A 4J7XA 4OSEA 5CA1B 4HYYA 4R16A 2WVAA 3B51X 5EJMA 4J0GA 3D6HA 3CZCA 1W5AA 3B6ZA 3PUVA 5JZSA 2GEUA 4MUXA 2XUOA 4YAFA 3A1TA 2GDZA 4IX9A 5LQKA 1CLEA 1Y5MA 3TLGA 3L8MA 1R5JA 1YL5A 3H6KA 4OKSA 1TM1E 1FX1A 4DBZA 3R7BA 3QFSA 1JYEA 1RBYA 3O83A 2P27A 3RBXA 1W36C 2AMYA 2WPDA 2VTVA 3GL9A 3IMKA 3EMVA 3Q9LA 5T6MA 3IE1A 1JJ7A 2ODPA 2LRHA 4HDMB 5FKJA 3IVXA 1C0PA 1PKEA 1SBNE 1PCXA 1XZCA 4JOSA 4RM3A 1KIFA 5LU9A 1NN5A 1LK5A 3KYIB 5E6SB 1LDGA 1XCPA 3H04A 2GM9A 2X3YA 1ATZA 1LX6A 1ISFA 3DM9B 5AM4A 4N1AA 4QQ8A 4P38A 3L02A 1JZTA 3WV5A 3ZWMA 2IYVA 4TMVA 2AZTA 2KJQA 4PG5A 2YIJA 2C5FA 1FQJA 3T5AA 4B85A 2W2LD 1A7JA 2QVCA 3KFLA 2WFLB 3DG9A 3FI9A 4NOMA 4EJ6A 4NBVA 5JADA 1ZXLA 4JHXA 2ZE5A 2H08A 5J4KA 4O8ZA 1U2DA 1BXGB 3SEZA 3QVGB 1DXHA 4CIDA 1U5CA 3T7JA 3JAKB 4ZVSA 1WQ4A 1BDJA 2GEBA 3D43A 1XXHB 2AOWA 1U2GA 4GYKA 4PRKA 3JQ7A 2J3LA 3FFTA 1HQYE 3RD5A 2P11A 3EXIA 1Z2OX 4NZYA 4Z3OA 4TZKA 3QG1A 5FL7A 1A5SB 1R2QA 2H92A 1J8FA 3W8NA 5T3UA 3ROTA 1YH3A 2WVGA 3HVUA 3O7WA 1QIMA 3BAFA 1X19A 3M81A 1ZUNB 3FWNA 1L9XA 3SZ3A 2R2AA 3JR3A 3MEQA 4IJWA 4BKPA 5JS8A 4EUHA 2P8SA 3BIJA 2PXCA 5E7JA 1OA1A 3WV4A 1HQCA 5JSUA 4ZO7A 2QE6A 1QK5A 3HJUA 4DJFC 1NBIA 3VR2D 4WKBA 2FEOA 2FJUA 2MTBA 3M5PA 4IIDA 5ALIA 5IUJC 1YZ3A 4QUHA 3QZUA 1SHJA 3PUXA 4QFDA 4RORA 1D0SA 3HJAA 2QVXX 3U4QA 3D7NA 4I1OA 1NBME 1U8CB 3W5CA 4LY6A 4XEUA 3SF8A 3ZU3A 1L5OA 5GIPE 1JEAA 2HDHA 4CM9A 4BFUA 3WL6A 1FL9A 2ZYHA 2FWJA 3CF0A 4BFTA 2WT9A 2QN9A 4GOKA 1QPBA 4DJEC 1YD7A 1M2HA 3R3UA 2GN4A 2Z08A 1RHQA 1UM9B 1K98A 5P8WA 1PL6A 2RGXA 4Q1FA 1HDXA 2BEWB 1T5HX 1KZ4A 2RCYA 2XECA 4WZAA 3GP3A 1DC8A 5A4JA 3LDAA 4RE5A 5G1OA 1OGIA 1GWNA 2ILTA 4DWWA 2CXOA 2ACVA 1Y4UA 3R1IA 5DCLA 3VZBA 2LR0A 2ZSFA 1I0ZA 4O02B 2HDOA 5K3CA 3BKWA 1UMKA 4IIYA 4OLBA 1AXEA 3IKMB 1SHTX 3HLKA 3VKHA 3LKVA 4QBKA 3NT2A 5DWQA 3WVNA 2YRFA 2VAXA 3AESA 3D0QA 1B3RA 4KKVA 4LDNA 3EFOB 1L7AA 3IOMA 4XE5A 5I7UA 4JL6A 1GXSB 4W4TA 3GARA 1M2JA 2JFOA 4XRGA 1VGRA 5JD3A 1CY7A 5GVSA 1YGYA 2J5BA 1J20A 1L7MA 1GRCA 2HLNA 3RYHA 3K0SA 2VFAA 3GEHA 1SWVA 2IXTA 4X1IB 3UKDA 1ZGHA 2VBGA 1YXMA 1XCGB 1E2JA 1ICIA 1ZN7A 2JLSA 4IWYA 1L4YA 3QXGA 4GD3Q 3WNVA 3VZQA 1JS1X 3W9UA 3FTNA 3R5JA 4L7QA 3WYCA 3FFWA 3I76A 2PTGA 4JEIA 5IM4A 1O95A 1DRUA 1MXFA 2XMQA 4A2QA 1IZ0A 1G18A 1XHEA 3F74A 4L3WA 1C0IA 3VZDA 5DBOA 1I6MA 1K2WA 3VISA 5JD4A 1HLFA 3FG9A 4X20A 3QVLA 4FFOA 3QI2A 5HZMA 4NABA 1HY3A 4N0PA 1FQKA 1OC2A 4DB4A 3G9QA 3IXMA 3UPTA 1QTNA 1P3DA 3GAAA 2I62A 3UGQA 1SBHA 3AUTA 5CXXA 4AROA 2Z30A 2H1CA 2VA9A 3IUNA 4R01A 2OB2A 4YMTA 3T3EA 2BOVA 3GEBA 3HLYA 4Q9IA 4D0RA 5ULLA 1YU6A 4XX0A 4YASA 5FEMA 5JCZA 3GCGA 1OH8A 4FHCA 3ZXYA 3BSWA 1UDRA 3DZIA 3CWQA 4KXFB 4ZOEA 5L3QA 1OIVA 1VGQA 3E61A 3NGMA 5IJ9A 2A1IA 2A30A 5BNZA 1APBA 3EEFA 4HWOA 5IDXA 2VBCA 2WHXA 1LPMA 2FP4A 1ORDA 4PYKA 2QLBA 1Z63A 1U1FA 2BC9A 1XNQB 1FP4A 4G8BA 1H9AA 3I58A 3MRTA 4PZUA 4X5OA 4DDTA 1NUAA 3EQ6A 6LDHA 4C0KA 5CW2A 3DKRA 1MOSA 2P6OA 5AVTA 4BTLA 5AHKA 2YYSA 3CRVA 4BQEA 3SS9X 3CB4A 5KS2A 2QV7A 2ZG6A 1R4ZA 3FGPA 4BO4A 4FINA 2P7HA 4FOPA 4MEAA 2R87A 1XMOB 4EJSC 3S2FA 4R51A 3WKCA 5YASA 6AT1A 5L51A 3OCWA 4R31A 2FRDA 5BQ3A 5LQDA 1N5DA 4KSYA 1I3KA 2WYUA 3BF8A 1GKUB 4X94A 5K0BA 4OQQA 5C2JB 3KQUA 4R7GA 1KEEB 2AF4C 3EZYA 1GGEA 5CX1A 2V0NA 2BZ1A 3C3BA 3RTCA 4MLPA 4IV0A 2CFIA 1A95A 1KZ7B 3GZJA 3RYIA 1PR3A 3LC7O 4H7FA 4RY2A 4UU0A 1O6FA 4WBNA 4FNOA 3GDWA 5KMGB 1A9XB 1AGXA 1X80B 3KQMA 3MTJA 4JT2A 3UHJA 1RQPA 3T35A 3IDSA 5D5HA 4HB3A 3WZ2A 4LYFA 1EVKA 2OGWA 1XP5A 3NUQA 3VSAA 4ZMSA 2PUDA 2ZUEA 5SY6A 3AVPA 1XHLA 2X6TA 3EPLA 3BL8A 1HYGA 5FYQA 2J7KA 2MSEB 1NVMB 1XBTA 2I99A 2X23A 2P9EA 5EKXA 3CRZA 3KE9A 5E1DA 1MOQA 2DEUA 1M6WA 2JBAA 4NYMQ 2BBWA 1THTA 1GR0A 1CJSA 1SC9A 4PLCA 3AEQB 1U7OA 3O7MA 2IY7A 1N5OX 3RJ9A 1UXKA 2WWIA 1AGNA 2C7GA 1ADBA 2BGNA 3GFRA 4BAZA 4CTOA 4ZHQB 2BW0A 2DFKB 2PMDA 2FEWB 1K8RA 2HXSA 3KVVA 4BFCA 4HVLA 2CNWA 3K2BA 3RS2A 2QSZA 1ZS9A 4YGXB 4ARBA 1ULSA 3IPCA 2Y67A 1UAGA 2DHDA 3K70C 2PX5A 3PIRA 4EJMA 5DM60 1DAFA 2EYQA 5KQSA 2C88A 1OX4A 2X7JA 1AIPA 4K3VA 2EW2A 2WMNB 5LYJA 5TR9A 3FNFA 3ZJTA 3AF6A 4DILA 1TYEB 1XXLA 1MTOA 5F1OA 3TSAA 1YULA 2BEKA 3TEJA 1JHUA 2OZPA 6REQB 2O8VA 4UZFA 1EFDN 3AEZA 4M0CA 2QM7A 3DTVB 5T7BA 1D9ZA 1OI7A 1CF9A 4TRMA 5A4FS 5TVKA 3K9HA 5K6AC 4NICA 4I3FA 4DIDA 2QN8A 3W4JA 1VOTA 3ZHSA 4CM8A 1COWA 3V2HA 4OK5A 1S02A 2QMYA 1B8NA 5HUJA 2BVNA 1ONOA 2X4GA 2Z8YM 5CDTA 1IM5A 1ZSVA 2XYQA 3UV7A 4Q3BA 3F7NA 4LF5B 4RQUA 2XXAA 4ZV9A 2R6AA 3I9V6 5G53C 3T1YB 1NIJA 1CQPA 2Q5HA 2GLXA 5BUQA 2H0QA 4E5YA 1PI3A 1T8PA 4OX9Y 5DNEA 2RHWA 2OCPA 4QZVA 1W2HA 1I2AA 3T0GA 2REQB 3I23A 1AURA 1WU7A 1YB1A 4ZMRA 5B5SA 4ZIRA 3QA9A 1SOWA 3LM8A 2CW5A 1KA9H 4L74A 4MTLA 4NVRA 4OQXA 4PO1A 4Q34A 3AM5A 4QTUB 4RS4A 4ZRDA 3SXPA 1JIKA 3ROXA 3GJ5A 4R69A 2ZRIA 3C7CB 2DWPA 3GJSA 1WPRA 1M1NB 3WNBA 3L7BA 3PIDA 3AM3A 3GDHA 5ALMA 1G3UA 5HE9A 3UK2A 5ILOA 1J07A 1NQAO 2BJWA 3EQ9A 4DA8A 2OCXA 1DZ3A 1M1YE 3MT9A 4JBXA 3DE5X 2E4WA 4S1VA 1E0DA 1FDTA 2PSJA 2QRUA 3QJGA 4JY7A 1VP3A 4D3XA 1MFPA 3KB1A 1WLYA 1OWPA 3D6MA 1RLMA 1BW9A 1M2OA 3G2PA 3LRTA 4HK4A 4YP5A 2RGRA 2WJIA 3ZGYA 1W581 4G5QA 2PIDA 3IBYA 4DMUB 5EMJA 3VHRA 4O2BA 2EZ8A 2IYZA 4ZDJA 3ZE9A 4BWGA 4DMMA 2XLBA 3PKZA 2D7DA 2BMWA 1ZHOA 4INPA 1JB9A 4P34A 4NDZA 4TLMB 2BDTA 4G56A 2O2JA 5JQGB 2E48A 2FPRA 4BVGA 2BRUA 4JLAA 3T7SA 1NL3A 1R9NA 3C3EA 4LF8B 4RD6A 3QBDA 3WGTA 1DV2A 3P45A 4DCJA 1P4SA 1PDOA 3MERA 1RP7A 4ZMBA 5AKHA 4PBRA 1ZCZA 4KPUB 3M6LA 5EMLA 1KP3A 3OI7A 3H2IA 1DS6A 4Q4DA 5LMZA 1VJTA 3QEJA 1X3LA 1JIUA 2G1JA 3NEJA 1N6OA 4WY5A 4D02A 1OSNA 5HUHA 4MVYA 2BBSA 5G41A 1QF6A 3FPCA 2R1VB 3S55A 1G3QA 4GL4A 4GVLA 2YFKA 3O8RA 4TYMA 1XOIA 3PR3A 4HEHA 1RXCA 4Q00A 2XRMA 5LVAA 1JLLB 2PT9A 1JFFB 3TIXB 4QU8A 3HE3A 5K99A 1WPQA 3ZHUA 5H59A 3ZU4A 3KTAA 5JH7F 3AH8A 1QS0A 2EATA 1G8MA 3PGMA 3I1FA 1I3LA 1XO1A 3M4NA 3K70D 3S0JA 2P79A 2IHYA 2KLBA 1E2PA 3L0DA 2RKBA 1S2LA 2O4CA 2GAJA 1YVUA 3I1YA 1AMOA 3I5YA 1RZRD 1JVSA 3HVJA 2FDXA 1GL3A 3CMCO 4H3SA 2X5JO 1EB8A 1PAUA 5U4QA 2ETVA 2SKDA 3OSUA 1JBQA 1WNFA 1Y4DE 3U5ZB 1RZUA 1Z17A 5KX5F 1YE5A 4J16C 2WRZA 3OOSA 4FS3A 2JATA 2FH5B 4JI7B 4QFMA 1T3GA 2AQKA 4HDKA 1JEQA 4PCLA 3JATB 4LK3A 1ZCBA 4GEGA 4UARA 5EP4A 1XQ1A 4FGUA 2IXDA 1F38A 2P3QA 1B93A 2YHIA 1PSZA 1ZC3A 1VFNA 1QV6A 1DCTA 4KUHA 2IYEA 4UOQA 4B8WA 2ZZMA 1QP7A 2X2PA 4RHYA 1CNEA 2EFGA 1T25A 3KX2A 4EY8A 1KFKB 2EFHB 2VHEA 4XIGS 2X8AA 2WJJA 4B7UA 4BRZA 5DT9A 4EJFA 1SXJA 5I8ZA 2REXB 5KAPA 4HLCA 2QG6A 4XFDA 4EGJA 1MV8A 4B7XA 5EEGA 5I7HA 2WJ4A 3WFJA 3KETA 4JX8A 3C4VA 2DHCA 3FTEA 3B6MA 3STUA 3HO6A 3TUZC 3K9QO 4GPBA 3RV4A 4WVFA 4A27A 1WDWB 3JQAD 1OCEA 2WK1A 3GRAA 3AI3A 5HF6A 1K3TA 4LRYA 4F4HA 3UAGA 3GO4A 2NXWA 4GSKA 2VF8A 5GV7A 2NXNA 1BKDR 2WSLA 4QEDA 3EAGA 4W7SA 3UXEA 5DISB 3HYCA 1I51A 2I2CA 3UICA 2IITA 1KMHA 5BO5A 2I66A 3A6GA 3IBCA 5AK4A 3WGQA 2BTQA 4U9UA 3HM2A 1EEXB 1D4ZA 1Z4PX 4CU2A 4GZ6A 3EG5A 4RTOA 4Z4QA 3Q72A 1KJ8A 1JALA 1PG0A 1RE1A 3IAUA 2QTAA 3KWMA 5KQGA 1F1JA 2PXXA 3EXEA 4PZLA 1DC6A 3PJDA 4BJ5A 4ZOLB 4BTVA 4BFWA 5IKPA 4HDRB 3LHDA 3IA7A 4AWBA 5IM5A 1C1XA 4ZZ3A 2ZWPA 2CWDA 3HM9A 4KMMA 3P0EA 2WF6A 5EJ9A 4U7WA 5CNMA 1EUQA 4IHJA 2LKCA 1NFRA 1QF7A 1UQRA 3DC7A 4XPZA 5CM9C 3UBMA 3V8BA 1E5QA 1LBTA 5AICA 3WB0A 3WP1B 1ZR4A 4O1IA 4HD8A 4UC0A 4LQCA 3IUQA 1AKYA 4EBFA 3ENNA 3HRIA 5A2QA 3H83A 1OLUB 4J1TA 5D85A 4RD2A 5EWJB 2XMCA 1UZUA 4RHCA 3BWVA 2WJAA 1U02A 4G0UA 1I7NA 1KYQA 4PPYA 4L8VA 4NBRA 3LIIA 1Q7CA 1U2ZA 4J0EA 2ONCA 3ANSA 1TU0A 3WXMA 2QXUA 1CBUA 4TMFA 3QA3E 4MPRA 1QGUA 3NTRA 4QAJA 1PEDA 1STOA 3PE3A 2VP6A 4L8YA 2FSVA 3QXHA 3RASA 5KVSA 1G42A 3I01A 3NMUF 3SQMA 3NT5A 5KYXA 1JVNA 1CJVC 3F49S 3T9FA 3I5XA 2HT1A 1JWBB 1SOVA 3PVSA 1UIMA 3LI2A 3HEMA 3TR6A 4NQRA 4BLRA 1NJ2A 5INTA 2FQQA 3AW8A 3JASB 3LL7A 3TW0A 1ZJ5A 4FVTA 2VDWB 5L4NA 1C2YA 2AX3A 3E03A 3GU3A 3ZIUA 4P2BA 2RD2A 3NC1C 2C1ZA 1W5EA 3PBKA 5FLYA 4DXHA 2DBVO 2O14A 1QZXA 3MINA 3L0BA 3VJLA 3DWEX 4D99A 4NCKA 4HDNB 2CDCA 2GN9A 2VZ8A 3GMSA 4O2AF 5EZYB 5BVGB 1Y1RA 2AKYA 3CNLA 2ZUBA 3GLHA 4GBJA 4LBWA 4R1NA 4YRNA 2VKTA 3FUCA 4KSBA 2EX1A 5ECGC 3VH3A 4DA6A 4TSFA 1R6VA 1NVAA 1TJ5A 5DW3A 4U0KA 3TH5A 4B4UA 5JHGB 2YWFA 4LJ9A 1GJRA 2Q6KA 4MVJD 1FLDA 2UUCB 5JXIA 3LG2A 1JQAA 4MOWA 2P0AA 4YBZA 1J24A 3NVAA 5KWEA 2OE2A 3MQ4A 3N2LA 1ESNA 4KSCA 1QFZA 4RMGA 4TL6A 4C89A 4DLPA 1V16A 4KFUA 1F14A 2EKDA 4DRZA 4N9WA 3OZDA 3LHFA 4M1OA 2C2BA 2QN7A 3D9QX 4BWVA 3HNPA 1XDGA 1J90A 1EAMA 1OLSB 5MGNA 1FMLA 4DJ5X 3CR8A 3QOWA 4MYRA 5HP4A 3ZY2A 1U4OA 3BREA 4UNSA 2DJIA 2ZJZA 3T9CA 3OD5A 2I34A 1ZM3A 1KI6B 3TLBA 5LB2A 4YC7A 4BO3A 4ER0A 3L0SA 4FB4A 4BGEA 5I4KA 2ZS7A 4ERNA 3GWZA 2OV2A 3ZE6A 4KUEA 1YRYE 5B58T 3WLTA 1TQHA 2HXYA 2ZTHA 3P52A 2VHYA 4FLFA 1X3SA 1VB3A 4MUHA 3NHKA 1QJ4A 1S3IA 1N1DA 4URUR 1R7RA 1ODFA 2YHSA 3QYAA 2P2DA 4N40A 4AP6A 3ROFA 5C9ZA 5JZVA 5AW3A 3R9WA 2BFWA 4KQMA 3LZ6A 5ELXA 2Q29A 3OP4A 4DIKA 4GQAA 4BU0A 1II0A 3H9BA 4X93A 1U8XX 1GU7A 1V7QA 2VDVE 4ZT4A 1DT5A 3TTUA 3H97A 1V7CA 3QKSA 3FZYA 3OX1A 5JNRA 4PBTA 1XQ9A 3EDCA 3RBAA 3WAJA 3IBFA 4CR7A 4M76B 5F9MA 3ITNA 3JALB 4H7PA 4IXWA 5F77A 3ASYA 4CFZA 1UADA 1EHIA 4LWQA 5EXXA 2QJTA 1Q6ZA 3D4PA 2AG0A 5JH7A 4LMAA 3BCHA 4MTCA 4PWYA 1MIHA 3NHJA 5D6OA 1GP2A 2QUHA 1U0EA 5DX1A 3ZHZA 3QW4B 3GNLA 2XB4A 2O1WA 4UTZA 3OZVA 1SZDA 4Q1VA 1RWVA 2Q1SA 3F5SA 3DJFA 1EIWA 2VNIA 1X2BA 2ODQA 1IY1A 1GNLA 3ORRA 4LQ4A 5FJIA 2EGGA 5E7QA 3ZXIA 4LQLA 2VVTA 2E18A 4E2ZA 4FXOA 1I3OA 4CKCB 1AQNA 1U6KA 1JILA 3GLFE 1DDGA 2ZTMA 1Q92A 2CHFA 4M9SA 1DBQA 1GT91 1RRKA 5T8KC 5KX5A 3G5MA 3Q4GA 3ADDA 3IO5A 4NYIR 3UG7A 4AECA 1DFGA 3NHWA 4ZRNA 1SHUX 3QMPA 5FR2A 1AHHA 3AUJB 3ZHBA 3ZLBA 3FNQA 4GIBA 4JI2B 5JNLA 1GG8A 4Q1BA 2JAHA 1E6LA 2NO9A 3PGVA 4NJMA 4DRYA 2OYSA 4XVHA 4CN9A 5CB8A 2PUFA 4MCHA 4MW0A 4HADA 4JLPA 3CONA 3S6JA 2WTMA 5DGTA 2HADA 3LFUA 3ZGLA 4HZUB 2P2CA 1YZUA 1RE0A 2DHRA 2EX0A 4H6XA 4D6PA 5C0OE 1WZNA 4D4LA 4W5WA 3PHIA 5IAKA 4PNEA 2MINA 1ANKA 3UT0A 1W52X 3GJTA 3IOYA 5IXSA 1WDLA 4B46A 4WPGA 2JZCA 1PFGA 3W2GA 2EEPA 1W19A 2C4VA 5K0LA 1DKRA 4LE2A 1SKAA 2VR1A 1HWYA 1N8TA 4S1PA 4G0QA 4TSKA 4MI1A 2O48X 1Q0HA 3RVBA 1DRVA 1JXAA 3FMIA 1TUBB 3ECCA 3HMQA 1J5EB 2I3DA 4Q0MA 1Q7EA 5DGIA 1YKGA 1AZWA 2E37A 4DABA 1V43A 1N9ZA 3UK7A 1T9GS 4L07A 4W9NC 1FSZA 1T1EA 1PBTA 2FUCA 3EPHA 4PRYA 4A0SA 2H18A 3OAAD 2ZOSA 4LGCA 5HEKA 4AY3A 1PEYA 2QAGB 2RHLA 1E2UA 3FDZA 3PSHA 3OQOA 2GZMA 3GZ4A 3BERA 3MAJA 2CYAA 1YZYA 2ECOA 2ID9A 4RF2A 3UWDA 2X15A 3I1JA 3LFHA 1J21A 3KFVA 4U7TB 2FPOA 3IBTA 1G6KA 2V7TA 1XRSB 1RM4A 4HATA 3W7VA 4M6WB 1QR2A 3QPAA 4UHKA 3W6UA 4B3IA 2E87A 4FT4A 4IUBS 4GU5A 2X0NA 1T4CA 1QKKA 3BSFA 3ZDEA 5IKXA 1UQTA 2XGSA 2ZXEA 4XDYA 3P4YA 4MUYA 1YFKA 4DBLC 2IYYA 1SHZA 3HPRA 1QHHB 4BLPA 4R1PA 2J6BA 3MTBA 5I9IA 2W6ZA 1SVKA 3CKMA 1K88A 4NYJR 4LCEA 4B6FA 4E70A 1ZAYA 4FW9A 4O4HF 4IP0A 1E1MA 3CNOA 1GA1A 1GUZA 5UKDA 3VPBA 4LYHA 5FLEX 4J9UE 3U19A 1NJ1A 5JCXA 4DSAA 3KJQA 1NVKA 1EUDB 1YZFA 3V00A 4AB1A 5K0CA 2WKRA 4EG7A 1UJ6A 2XJ4A 4UMDA 4FGJA 2JK0A 2YW2A 3EOBI 2JIPA 5E3JA 3PXEA 5HZGA 1WCV1 2FGJA 3BN3A 3B13B 5FPPA 4COOA 4LBZA 4WKOA 3WHKA 4HMOA 3VR3D 3K92A 1I1QB 5KWVA 2QUZA 1NR5A 4CF3A 2I54A 2JRCA 4MRVA 2H3EA 1M34A 1U7HA 3IA2A 4IIXA 4MUNA 3WL3A 3QKUA 3GBPA 2RC5A 3G2NA 1OAOC 3HYTA 1H94A 3KVRA 3CT4A 3OQIB 5ALGA 3S5UA 2OHOA 5KTOA 2HX1A 2ZPTX 4B5LA 3LDGA 1ZI6A 2EL9A 4EFNA 1R3DA 2AOUB 2OORC 3BSSA 1EVIA 3GCXA 5DSTA 3V8RA 1XPOA 1TLTA 3EF1A 1HNNA 1TCAA 2H2AA 2WOJA 2ZATA 3KC2A 4DV5B 1Q5PA 3K30A 1MO2A 3LBFA 3OFND 1EFAA 2WTAA 2P2SA 5G02A 3H5NA 1WY7A 5A5VA 4MB2A 1Q1QA 5DTQA 3BMQB 2AS0A 2ADOA 4I4LA 1UEJA 1V5EA 2RSLA 1K08A 4O2AA 2RBKA 4WX2B 4K6GA 3LLMA 3C24A 2QRJA 4QU9A 2R44A 1HETA 4CXMA 4BO5A 1IAVA 4CODB 1ZY2A 4EAQA 2ZJ1A 5IEBA 5T3YA 2OENG 3OX2A 3COWA 3RABA 4DUZB 1E4EB 1F0PA 2NV0A 2XMZA 4ASUA 1HGXA 4KO2S 3FKQA 4L85A 3I2IA 3WL7A 3O3MB 2EVWX 3SJ7A 2WICA 4LX0A 1A71A 4AMZA 2A35A 5BWOA 1L4GA 3IOCA 3O95A 4JQCA 4D3FA 3ETCA 5DNVA 3CR7A 2IHUA 4IGEA 5GVRA 2E3JA 4MINA 3SNHA 4M0LA 1SA0B 2I76A 4UVIA 1BS2A 3A4YA 4CT5A 2V5UA 1L5NA 4F8EA 3PLAE 2GGSA 1KYXA 3O3OB 1DZIA 2XADA 3GVPA 5BUCA 4RVSA 2BFOA 1EE9A 1SULA 2IP2A 2HW8A 1IUOA 2A4MA 1E7WA 2PRJA 4DLRA 2DTDA 2W43A 4JI3B 1Y8QA 2Q5EA 5FAXA 1FUIA 4MVJE 3TOVA 3DBRA 3WDMA 4KWIA 2VT3A 3ND5A 4DA0A 2YR0A 2HMYB 1UBHS 3HXKA 3PJFA 4UXJA 1Y3BE 1LC0A 3Q0IA 3UTCA 1E2IA 2OO5A 4PZ0A 3ABIA 4I5DA 2PYZA 4MIEA 3R74A 2GF0A 4CIWA 1XX6A 2HRCA 2Z83A 1VSBA 2DPMA 1VL5A 1I32A 1OU0A 4WOKA 4LCBA 3F4KA 1Y7HA 4S12A 3NONA 2D4HA 2LCQA 5TT1A 3QVSA 3T06B 2RHJA 1WXQA 2QTHA 3QVTA 3F2VA 1U2GC 3HG7A 4JVMA 3EVBA 4OBBA 4Y2TA 4HTFA 4ARZA 3PL5A 1DT3A 1IMOA 1QG4A 1ZVKA 2F9FA 3LW7A 3KO8A 2AMVA 4DPLA 3G0IA 3FOWA 4KQWA 1GPNA 1TJPB 2JLWA 1MRSA 2O06A 3ETGA 3IC5A 1JKJA 1H9BA 4BKOA 2Z57A 4LEIA 5LA6F 3G1TA 4JJFA 3GGCA 1EYZA 2AHOA 1MX9A 2C00A 5FP0A 1WIWA 2E55A 4IMPA 3WLKX 4XVQA 3SQWA 4D0SA 4KR2A 2AI3A 2QJFA 721PA 2QDXA 5BN1A 3HDJA 3G2MA 4PG7A 3TBKA 2C7QA 2R60A 3CSUA 1KOLA 1M9NA 1Y48E 1F4PA 3OJLA 2GN6A 3C3PA 1CQIA 4O29A 5JW6A 1ZMBA 1Z88A 2P6MA 1Z7YA 3RIXA 4F1WA 5CA0F 1G3MA 1GSIA 3ZD7A 3B9QA 3T1OA 1GQ2A 1JTEA 1E3WB 2OBXA 5HMLA 5B6IA 4KQ9A 5J3JA 3LVFO 2O2DA 1N0UA 3QPUA 4RKFA 5FBZA 4PNHA 2HA3A 1VA4A 3PC8A 3WLSA 2VWPA 1OKKA 3KZMA 3V5NA 1HUQA 1X1CA 1I36A 4DEXA 3CKLA 4GRAA 4R1LA 1U7PA 2FCAA 3D6VA 4L76A 1JQEA 3CXUA 3ZD9A 3IV6A 3ICEA 5EIFA 4K8RB 4E6PA 4CLRB 1EFCA 3OM8A 4FQ5A 3ZCSA 2AGVA 1TA0A 4D8XA 2AN5A 1E9SA 2IY8A 4BNTA 2ZTVA 5HCUA 2O2GA 2CVPA 3EXG1 3VPXA 1NMSA 2Q9BA 1OF1A 1AMUA 3M2PA 1DQYA 4IIBA 4F6RB 1AB5A 2CLIB 2ES4A 2JHCA 3AT1A 3STHA 4DMHA 5KNBD 1FP6A 2LTAA 1R4MB 4G4SP 4H15A 3VR6H 2JAPA 1Z28A 2OCGA 1KK0A 3LKZA 2ZI5A 1QJCA 4ID9A 3V2UA 1BXKA 3IAS6 3KR9A 2NUPB 3L77A 3N5KA 3VSBA 1P6XA 4WEOA 4BEVA 3A4IA 2IH2A 5FWNA 2EIHA 3Q12A 1EX9A 1QQTA 4JJ7A 3OIUA 2PX3A 4WMLA 4H1WA 3E5HA 4NU0A 1T0HB 3TL6A 2XTAA 1PR1A 3QBTA 4MS3A 4DR7B 4GNKA 4IJ5A 2HU5A 3GLTA 2Q2OA 2ZIZA 5GGXA 2B8TA 2QRVB 3FA2A 4DR5B 3VNQA 1WZEA 1QLHA 2NZ8A 3NANA 4QSMA 3ZHVA 4DJTA 5L45A 4DMCA 2ZBEA 3OA2A 1W73A 4XQ9A 3FX2A 2OFPA 4JVLA 5EERA 2RGWA 4FFNA 4YALA 2J32A 1PTKA 1O95C 4LMPA 5IK2A 4CDRA 3L7IA 1JH8A 3U1BA 3OKPA 1I4LD 2JJ2A 3L41A 4NWIA 1FFDA 1BEEA 4IUDS 1ZJ6A 5I7SA 1ENYA 1E0JA 2BY4A 4KN6A 2X2OA 2VDPB 4RXMA 3OJFA 3ZV3A 5JSQA 4UDNA 3C6YA 4KFTA 4I14A 4U0JA 2ZSEA 2GUWA 2WZBA 3G89A 4X7RA 4S2UA 1IXZA 5A05A 3GFGA 4QUIA 2A3NA 4FNGA 3HBMA 1PJCA 4QFCA 4KIFA 4BFVA 3K16A 4EPTA 4U6QA 3EUEA 4B2LA 4O4HA 4CKBB 3UATA 1B6GA 1VL8A 3NBQA 4PLFA 4RLFA 2FUEA 1TQDA 3AFGA 2VYFA 4QO8A 1C3EA 1QUFA 4HVAA 1W5BA 3T15A 1XUOA 5AW2A 1J33A 2C77A 1KQ3A 4F5DA 2CXNA 1LPOA 3TD9A 2F9MA 4TV8B 1DG1G 3BA1A 4RABA 4NPHA 4OQNA 3ICQB 5ADUS 1EWRA 1RWMA 3K1AA 3R0XA 1RJWA 3TZKA 3VKFA 4AYXA 4C14A 1ZZGA 1IB0A 1NQOA 1SR8A 1V4NA 3KSAC 1Q0UA 1V48A 2AYZA 1CY6A 1SFRA 4RZSA 4UJ5A 1ECJA 2GZHA 3AB7A 2PMWB 3SDSA 1O96B 1QHNA 1O9HA 2OQRA 1J09A 4HWKA 3SOPA 5IHPA 1SUEA 4G4GA 4AKIA 1XTTA 2L82A 3P2YA 2Q9UA 4QO7A 3AERB 1ML4A 1ZIDA 1UL1X 2QEQA 3R9IA 3OETA 4LHXA 1SH7A 3DSRA 2P2ZA 3E22A 3Q85A 4FFWA 4MKXA 4MR8B 5HF5A 3WBJA 3AG6A 4Q82A 3JXEA 2FRDC 2GYUA 3FKJA 4NR0A 5D1NA 5IDVA 2TRSB 3FD8A 3GELA 3MOGA 4TS1A 2XX3A 1Y7PA 2PLAA 3LLUA 3PXXA 2WBLC 1XHFA 3HZOA 2VRWA 1H2EA 5CG1A 2RB5A 3VOBA 3VR5A 4XVCA 2GPNA 2Q5IA 1IC6A 2VPIA 3H11B 3O2JA 4KW7A 4NY1A 5EYPA 4CM9D 1CUUA 4BHTA 5IANA 2R5NA 3W5SA 4M60A 3I4LA 2AEMA 2EP5A 2NUBA 4LXHA 3AOEA 3L93A 2PPLA 3MCTA 4PZEA 4XLTA 1LVUA 5T4EA 1D2CA 5BN5A 2W7TA 4EKNB 4MS4B 5AUPB 3C1AA 1ZG3A 1WR8A 1I7PA 2C07A 1EGAA 4M53A 4LOHA 4P08A 1NMEA 2O8DB 3BIFA 3EVGA 2F2TA 4E1AA 2EKBA 2I7CA 3V4FA 5K0GA 4FDMA 3D31A 2BGUA 3IX7A 3PQFA 4MDYA 3OZTA 4MV4A 5DGCA 2IZOA 1F2UB 4LNUB 4GAEA 1O97C 1L1QA 4O0MA 4G4JA 4OXXA 1A2OA 4F2GA 3K96A 3NFRA 5AOAA 1N6IA 5ESDA 2DQ4A 3ORYA 2VK1A 4UCXA 4JCCA 1P77A 1AS3A 1P5RA 3OLZA 4LDZA 2X0FA 3NVMB 4MWSA 4MYCA 4LXIA 3GA5A 2O2EA 3CPEA 1E1NA 4ZT3A 1KOGA 3HHPA 1XCJA 2PGDA 1QO0A 4WFQA 1IPEA 1O5OA 5GZ1A 3BOSA 4EVIA 1XD9A 4CIYA 4EARA 4OGLA 3HWWA 3IHLA 3KYJB 2BUCA 2O7NA 2FW8A 3NTQA 4NHEA 4S1OA 1USKA 5K4AA 3SPXA 1P74A 1JJBA 4CMGA 1P5FA 1VE7A 1CZNA 3OH8A 3PPYA 3K6SA 4MYHA 4NESA 1O4WA 2FZ4A 3FWYA 3HV0A 4W99A 4XLLA 4AJ9A 4ZV4A 5BURA 5AW7A 3MJCA 4GPZA 4MVWA 1O95D 4I3GA 2WUFA 2XTNA 1A8UA 2VJYA 4LC9A 5BQPA 1GTRA 2Z04A 5FLKA 3VOTA 4EF4A 2XZLA 5GPBA 2YRWA 3CW8X 3R3WA 1SKQA 4NEHB 4AS1A 1E2GA 3D3WA 1BS1A 2QD5A 3RLIA 4YR9A