4LQCA

The crystal structures of the brucella protein tcpb and the tlr adaptor protein tirap show structural differences in microbial tir mimicry.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
136
structure length
129
Chain Sequence
EYDFFIAHAIEDKEAFVQDLVAALRDLGAKIFYDAYTLKVGDSLRRKIDQGLANSKFGIVVLSEHFFSKQWPARELDGLTTRILPIWHKVSYDEVRRFSPSLADKVALNTSLKSVEEIAKELHSLISAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Toll/Interleukin-1 receptor (TIR) domains from the Brucella protein TcpB and host adaptor TIRAP reveal mechanisms of molecular mimicry.
pubmed doi rcsb
source organism Brucella melitensis
molecule tags Immune system
molecule keywords TcpB
total genus 43
structure length 129
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4lqcA00
4C6TA 4C7MA 5H3CA 3H16A 4LQDA 4C6TB 2M1XA 4OM7A 1FYXA 4DOMA 4C6SA 5KU7A 1T3GA 3OZIA 3UB4A 4EO7A 2J67A 3UB2A 2Z5VA 1O77A 2Y92A 4FZ5A 1FYWA 4W8HA 3JRNA 4LZPA 3UB3A 1FYVA 4LQCA 4W8GA 2JS7A 5FORA 4C6RA
chains in the Genus database with same CATH superfamily
1OXTA 2OC9A 3OM1A 4F3TA 3KSDO 5BMVB 5E9JA 3BEDA 3I05A 1OMOA 1Q1QA 4DCSA 5DI3B 3HFSA 1ZU4A 2WQ6A 3AWIA 4GEKA 4H6PA 1B0AA 1K6MA 1N2HA 2Q21A 3H1TA 4HRYA 2O3SA 1Z34A 4JKIA 2R7AA 3EA0A 3LJKA 3W8RA 1X7YA 3AY0A 3OKPA 2F48A 3DULA 1I3CA 3DMTC 3TTUA 3TF5A 4NV0A 1S1CA 3DZBA 2GSDA 1NLUA 3NHRA 4EGAA 3WDKA 1TX4B 4OYRA 5K8CA 1Y8QB 1RI4A 4IILA 5GOTA 1YA4A 4OAQA 4IIFA 5D7NA 1ZI9A 4PRYA 2PH1A 4URUR 1KIMA 2I66A 2ZKIA 3ZLUA 1PK9A 1KEZA 5BORA 1X7XA 3NV9A 1CLEA 3QG5A 3B82A 3PR3A 3FPLA 2MYTA 1A71A 1KEPA 1NRIA 1YI1A 3Q7TA 4HLCA 4MB0A 1V8BA 2DX7A 3P9KA 1COWD 2YCBA 4NNPA 1D9ZA 4Y7DA 2BHRA 3ZWQA 4KNYA 2J7KA 4ENSA 2P3OA 2EW2A 5BV1A 2W6JD 4GD3Q 1O7JA 2DLCX 1KRXA 4G6ZA 3ZI4A 4V3CA 4GVXA 1QHHA 1ZVQA 1C2TA 4K8OA 3F4BA 2FP3A 1GVNB 2Q4OA 4TKLA 1SC9A 2O5VA 3BYZA 5DPMA 4CWAA 1X3SA 1E8NA 1JWBB 1ONSA 1J90A 1VL8A 2C04A 4HSGA 4LMRA 4WDQA 4RD4A 4XYMA 5DASA 5DGCA 4FMCB 4KDFA 1XVVA 2P2LA 5BN4B 4YCAA 1WY7A 4WT7A 1SWVA 1C50A 5A7GA 3VJMA 1L5HB 4MW9A 4NFHA 4ZICA 2AOTB 1JDZA 2AV6A 1SBIA 3LFUA 2PL5A 3PWSA 3IAM6 1UDAA 5ELXA 1C3OA 3E7PA 3AZQA 1F3OA 2EFEB 4QG7A 4S1OA 4UQOA 4P81A 4YLGA 1ULAA 1VCMA 3NIGB 5JPCA 3CIOA 4KUGA 3A0RB 3GDFA 2PBRA 5T7BA 1FYWA 3A6KA 3R3UA 4MUXA 4HP8A 3BMCA 3I04M 4ZYVA 3WV5A 1QX3A 1SRRA 1V1MB 1ZUNA 2QY9A 4AU1A 4DLTA 2XNDA 2QLTA 3KUKA 1HH4A 1SCAA 1Z0JA 2EYUA 2I1VB 3FHJA 4DLXA 1IM5A 3SSOA 3IRVA 3DFIA 4DMKA 1RI2A 2WJWA 3RJ5A 2REBA 2H2FA 2Z4TA 3QVOA 1VLHA 1CS0A 1ISPA 4CV0A 4ZK6A 1JS1X 1E9RA 4QBHA 4YVFA 5KC9A 3ZJ5A 3H9UA 1TM5E 2D6FA 2FQXA 4IMRA 4KHPB 1XE3A 3LHFA 3QVMA 4YK7A 1R2QA 4P54A 2CK3A 4ZAZA 3V33A 3SKYA 5FWXB 1FBTA 1U7WA 3NHJA 3PPYA 4FX5A 4FYWA 3E84A 3F2IA 4WOCA 5AOCA 3RH0A 3D7LA 1NTOA 2K7ZA 2VJBA 1BEUB 2W2XA 2OUKA 3CTPA 4M54A 3I6ZA 2OOSA 3ONFA 4FONA 1GU7A 3DHYA 3TLGA 1KI6B 3H5AA 3RWMB 5A04A 3BMNB 1N2BA 3TTSA 2I7TA 2WSBA 1BVYF 3BMOB 3ZHVA 1ZEJA 5E7QA 3SC3A 5E7MA 5LPNA 1J22A 1O03A 1ZGGA 5ALNA 1H2XA 3OE4A 5H82A 3SZOA 2VQDA 1R9GA 1Q44A 5BO5A 2CKDA 4C0LA 4K26A 4CKCB 1ZXLA 3CQ9A 2H31A 1R0RE 3PGMA 4RKYA 4MINA 1IY2A 4WKNA 4Z1MD 3OWXA 1UXHA 3EUFA 2WJZB 1G55A 1V5FA 1Z16A 4EA8A 1WHTA 1GRVA 1XVIA 1OIWA 3DKIA 4QBTA 5B58T 3M6WA 3UB4A 1WZCA 3RTBA 3CRQA 1L5YA 5IMBA 2PNFA 2ASEA 4GGMX 2XQVA 4MLDA 3RVDA 3S2YA 3TRKA 5JAIA 1B8NA 3MCTA 3KTFA 3VR6H 2ZBDA 5CNJA 2K5UA 3DOCA 2VF4X 4LDZA 2O54A 4O4JF 2HSJA 4I14A 3Q8XB 3CWZA 1U6KA 3SJZA 2YFKA 3OQJA 1WTAA 2GBGA 3G59A 1OXXK 3CVVA 1SBCA 1Y34E 1N32B 3JWPA 1DKQA 3GCXA 5B1YA 3R8CA 3G9ZA 3ZHQA 4CLOB 1VLMA 2W4IA 5BT8A 4OHRA 3JQDA 4L85A 3GRZA 3MG9A 4DLWA 2BH2A 5T67A 2PZFA 5KCZA 3LPCA 3BJZA 4PRLA 5E8JA 3DB2A 3K9CA 3I8OA 1E58A 3IVCA 3G88A 2WICA 4TM8A 1CUEA 2QRPA 3G89A 1C9DB 1JT9A 2B7BA 4J07A 5HEKA 3RKSA 2GM5A 2N1BA 3WYBA 3ZCPA 4TV8F 2G1UA 2HBRA 2XMQA 4I9GA 3GZJA 4HTAA 1XLTC 2UXCB 4L9RA 2P30A 4ZTZB 3OTOB 4UMVA 4ISBA 5FTJA 2YWCA 1G8YA 5HQTA 5HJ2A 4P83A 1XQXA 1TAGA 1YQDA 2H1IA 1R9JA 2BKXA 1GRRA 2IYWA 3HCWA 4BKRA 4FYMA 1S7CA 3AXSA 5JBNA 2CFIA 3TQRA 4OA8A 3HKCB 5LFAA 1DVRA 1E7YA 3H2YA 4CUKA 1UJ5A 1JL3A 2PX0A 2EKQA 2W6ZA 3I01M 3PQEA 4PSUA 3ZTYA 4RESA 4F72A 5K0GA 2HK6A 2NLOA 4KUEA 2BGUA 1U9CA 2WUWE 3LA6A 4V0RA 4ZARA 1T6NA 3UJ9A 2QP3A 4UHHA 5TQ0A 4R0MA 3NOOA 3P0EA 4EW3A 3IEMA 3TFWA 4CT4B 4OCZA 1PGJA 2H65A 1U1DA 3CNNA 4HFRA 1Q11A 3DAGA 3PG5A 1FSZA 1R5NA 3O8RA 4F8JA 1T1GA 1H0KA 1W5SA 2FPRA 3NHSA 4NBUA 3SC2B 1U3UA 2C2XA 5DHRA 2C3OA 5EKDA 4B31A 4BCBA 1IEQA 4IXWA 5FV4A 3MCVA 1YQGA 4OAPA 1JYFA 1HFWA 1Z13A 3SKVA 1PTJC 1XL0A 1OREA 1AZWA 3MZ0A 5JCOA 1RP1A 2Q4RA 3RR2A 2J3JA 2CHVA 2FDCA 3W5VA 3AM4A 4XTCS 3TPFA 2DRIA 4LXHA 3V4SA 3GOHA 3EGDB 2CVHA 4JI4B 1ULBA 5L6LB 2X8LA 5L51A 4Z1OA 3QW2A 3MUNA 4YYZA 5EP3A 4KR9A 1N9KA 3CWCA 5C8YB 2ID7A 5J1TB 1XXHE 3R9XA 1JZSA 4OIMA 1BH2A 1YH3A 2PMFA 1V1JA 4XFKA 6LDHA 1G59A 4R2WA 2R1VB 1YXMA 5FXMA 1FNDA 1TI7A 5KWIA 2YKGA 3HGTA 4GNKA 4NDAA 1TUBB 2C9CA 5D85A 3PSHA 1Z6AA 5BW8A 3E3NA 4X8MA 5F51A 2BM1A 5AVZA 2QGNA 2PZAA 4WLUA 1Z63A 4LYFA 3HP7A 2D0DA 1EXMA 4Y9TA 5EIOA 2R79A 4JOCA 1PR4A 2QK4A 3CRW1 3O8LA 3PXUA 5CJPA 1T3TA 2D0OB 3BPSA 1QV7A 2CJPA 4X3OA 5JHHB 3PVZA 4TYNA 4CL2A 2ZG6A 4LRSB 5GPBA 2QM0A 3WJ1A 2QTBA 3QBDA 2XNDD 2B82A 4MRMA 9ABPA 4IQ4A 4BS9A 1KL7A 3HY6A 1O5OA 1UR5A 2DP4E 2YYZA 4IOLA 4B74A 5A03A 3L4JA 2OKGA 1BXGA 4EPVA 5FNVB 2WNIA 3U9SA 1ZIYA 2OHIA 1U9IC 3IUYA 5KTKA 3OZDA 1YRYE 2IUTA 5D6NA 4OH1A 4RH0A 4QASA 4AMUA 4HV4A 4KO2S 4DIDA 1PHPA 2ZUTA 2OD7A 1DEKA 1GFWA 4V0NA 5KI6A 4ENRA 2ZVJA 5CG2A 3ITNA 4YJ2B 5JYEA 4G81A 2P2GA 3W2HA 3IRUA 1IBCA 1NQTA 1SXQA 2B9VA 4BP1A 1R5BA 3HXPA 5KO2A 1W44A 2OY0A 2C58A 2AVNA 3M4NA 2G5CA 4MQBA 3PC4A 1X39A 4GKAA 1DPFA 1WB5A 2DQZA 2UVQA 3L6CA 3PHHA 4MEAA 1V4BA 5CVVA 4E11A 1Q92A 2OV8A 3AHGA 3MWJA 2RBKA 3Q6NA 3P2IA 4O2BA 3N2EA 3BSFA 4EHKA 2C54A 4A0FA 5K3EA 5K8JB 3WDSA 4NPAA 3L4KA 1PR5A 4HK4A 2WUVA 2P9TA 3KSUA 2XTZA 5CB6A 3LM8A 4NIMA 3ILYA 5ESWA 4YJ2A 1LX6A 2P9BA 2W71A 1W48A 2RJ3A 2QZZA 2HWYA 4GBED 1HXHA 4DL9A 4MGYR 5ALRA 2IS4A 2D3WA 2OZKA 2E1PA 3S4YA 4PZPA 3HV0A 5HZKA 4LF5B 4MW6A 2J08A 2ZJ1A 4GM4A 3ZLVA 4D4JA 4GLFA 3EXHA 3UK7A 2ACEA 5FAXA 3E5NA 4RKQA 4X63A 3V97A 4DIOA 5A4JA 1RPZA 1KJNA 2XB2A 1RKVA 3Q7IA 4JLNA 1GG8A 5JTUA 5A4FS 1GT91 2HTEA 3FZGA 2C1EA 1H0HA 2OM6A 3HKDB 3P9CA 4LX0A 5EPOA 5DTIA 4EL0A 4Z6KA 4FE4A 1KDYA 1Q7CA 2O4CA 4EH1A 1XWWA 1RYFA 2FTKE 1T9AA 4M0KA 1JKJB 3QKTA 4JASB 3SF8B 4EJSA 1HMPA 4Y2YA 1Y4SA 2O1SA 3GAFA 4C29A 1KC3A 1E3EA 1R16A 2XYVA 1Z17A 4BTEA 2HJRA 4RZQA 4D6YA 3T1NA 4UBOA 4EG3A 1NRXA 3RHFA 3DTVD 2P41A 2QLBA 3EC2A 4O02B 3AVOA 3W79A 2O8DB 2M1XA 1JAYA 4MWZA 4C6SA 5JQGA 3KVNA 2QQEA 4V1CB 4V3BA 4DCOA 4KQXA 1KDPA 3R76A 2IYZA 3EXG2 1QTRA 1OILA 2XXBA 4K8RB 4N9WA 2AG5A 4YXFA 1J70A 2FZVA 1EEHA 2GZ2A 4C0HA 4CKEA 3B3JA 1Y6JA 4QD3A 4ZOCA 3D3WB 1E96A 3DOOA 3D7MA 3CSUA 1QIFA 1EFRA 3DFZA 4JVLA 2IXEA 1R8YA 1A7JA 4ILEA 2EGUA 2OGSA 3BRWA 3GJ3A 3KEOA 4PIVA 1UPAA 2YWDA 5TE9A 2PX3A 1UC4B 4P53A 4PLCA 1PJBA 3VR0A 3V80A 2DHQA 1I2BA 1QVAA 4FNAA 2SKEA 1C1HA 1JEJA 3I2YX 4UTOA 1G19A 2AJBA 1RLTA 3C1AA 5GONF 5HBRA 4R1TA 3SS8A 2AFVA 1JDSA 1SMKA 3EIHA 1ZPDA 3B1ZA 1U9JA 2IGBA 4Y1RB 3RRJA 5ICSA 1CWUA 2UZ0A 3PC6A 3F2VA 2RAPA 1GLGA 1ODFA 3W34A 3OPNA 2XX3A 4M2LA 5CPBA 3CKMA 3EXEB 4R2KA 4Y1FA 2NU8A 1PBNA 3EEIA 5IKPA 4OJYA 4KNWA 1Y4AE 3H4IA 4EA9A 3TUJC 2FP4A 4IIXA 1RP7A 3AJEA 4DCVA 3FLEA 2REQB 3UMSA 4R7ZA 1M1YA 3KVRA 1FP6A 2I1LA 4HVAA 1OYVA 1BA3A 1ICIA 1PUJA 3AXTA 3TL3A 4DR1B 1B42A 1XZBA 1SGWA 4EPTA 5DMHA 3BH0A 2WIKA 3ILXA 1EE1A 1IG0A 5DYTA 4EW2A 3ZY6A 1L1RA 2HMSA 3DC7A 1GUYA 3LLVA 3HYTA 2JVKA 2B4TO 2JLRA 1LTHR 4A0SA 1XU9A 4QYWA 4IDNA 1M6HA 2R3SA 3Q5EA 4OHMA 3ZC3A 3IV9A 4KIFA 4X1KA 1E6KA 3SNKA 3L46A 2W2VA 5CX1B 3GDGA 5GONB 4MHTA 1F5NA 3ROGA 3I4CA 3T7AA 2YMQA 3ZX5A 3PBKA 3HYSA 2UVPA 2XMGA 1X13A 4BKPA 1HYBA 4X1OA 1CY4A 1EP3B 3QNWA 3AH8A 4D4IA 4M86A 1EBFA 1YA8A 3OMWA 2Y1OA 1QLWA 2PGJA 4MWSA 1B0ZA 3E4DA 1GCIA 1ZY2A 4OIFA 2FJPA 3K5PA 3LP6A 3V2GA 3WQQA 4BVAA 4CGYA 1F6BA 2TMKA 1V41E 2B7CA 4YP1A 2DHEA 2OB2A 4L72A 4N5MA 1Y7IA 1ZUD1 3LIIA 1UXIA 3H86A 1V11B 1D3AA 4Q4JB 2XMBA 4XA8A 4PO1A 5F5LA 3WRVA 3SX2A 4R5HA 2HL6A 1E0DA 2BUAA 5GQSA 4JYMA 1PR0A 3PQ3A 3HDGA 4MR7A 2ZIWB 3KOOA 3ADDA 3GJ8A 3DFUA 5HJ5A 1XQ6A 1CP2A 1RVV1 3MWEB 3ORHA 4J3FA 3V7NA 1WU8A 2JJ2A 3UT5A 3TLXA 4C1BA 5ITVA 3FKQA 2BGWA 2RH5A 3OKFA 4TT8A 4A2QA 1T8UA 1XNJA 1JJFA 2OLKA 3ICVA 3D6MA 4QUIA 1UMDB 4M89A 5K3SA 4G86A 5F21A 4YMWA 3QPAA 4LTDA 2BC9A 3PPXA 4HDAA 5AFSA 4Z0PA 1XCMA 5ICGA 4KTVE 2MDTA 5B57C 10MHA 3G82C 4KODA 1M6WA 3M5WA 4CQMA 2UXDB 3T3MB 5KX5A 3FB4A 3QLUC 4WZZA 3H2KA 1GA6A 2B94A 1PG5A 1Z38A 2O05A 3HXQA 4WAUA 1Z5GA 3LUKA 1XTRA 4I4LA 4L3WA 4AJ4A 4EY4A 1QZZA 4IDDA 2JJQA 1ZH6A 3VSCA 1PJLA 2AI3A 4ZRNA 1TQHA 2YW9A 4G67A 4XWWA 1C7EA 3OZAA 3VR2D 3A6LA 2H1HA 4JFAA 5HMLA 2IE0A 4D1YA 3D54D 3JQ9A 2PZGA 4G25A 3ZVRA 3NV7A 4R0NA 2GCGA 3N2KA 4YJDA 4EKDA 5MN6A 3G8CA 4KXYA 4RFVA 1BMQA 1H4TA 2BW0A 2DHDA 4FINA 1M7BA 3VH3A 4YRZA 1CK4A 1FUUA 2PL3A 3OQ6A 4FDVA 4NYMQ 4ZODA 4Q6WA 4N03A 3SCZA 1ZVJA 3MUEA 3GGPA 4YALA 2PAFA 4BBAA 2GFQA 3X1MA 3OOYA 5T64A 4JZYA 2E9SA 4FMDF 5FDFA 2HCJB 2VHUA 2GLTA 3O4VA 4QGSA 2DB3A 2L2QA 4IUYA 3V4FA 1L5VA 3B8HA 3VTAA 1AO0A 2DPLA 3GLIB 1TO1E 4H6XA 1ZN9A 1V9SA 4NZNA 4DUYB 2PSFA 4YP6A 3WTBA 3H3XA 2YNMC 1FS6A 2Z09A 1QHHB 1KJWA 4ALMA 5BV2P 3OA0A 4M98A 2DE0X 2ZJBA 3JD2A 2DECA 2SECE 5FNVF 4QEDA 4L28A 4KITB 3LTEA 4MUFA 1OI2A 4R40A 3ZWDA 5C53B 4YJHB 1YDMA 2DSTA 3JWJA 3R6LA 4IRXA 3OOHA 4FB4A 4J49A 1C29B 3PYLA 1YR2A 1IMJA 3D6UA 1GUZA 1NQ5A 2GXUA 4B4UA 3RODA 1QVVA 2HW8A 1VDZA 3BHJA 4URHA 5DT2A 1F7UA 2HJWA 1V7CA 3AGQA 1GUAA 1DIAA 1PGPA 2I2FA 2NG1A 3CZ9A 1FU8A 3T7EA 2IHUA 3II6X 4B40A 4OX9B 1M8JA 3VZSA 1OX4B 2BM0A 4D9JA 4ENUA 3CRZA 4JLJA 4K9DA 2XV1A 3IMGA 2IHVA 4DDTA 1E6EA 2BSXA 4EUSA 4QPCA 3T1TA 3ND8A 3CN7A 1OLSA 3CVYA 3OZ7A 1D6JA 4P4NA 4UOQA 3T61A 1RM4A 1DLIA 1BSVA 2EP8A 3BCSA 1KGDA 3AU8A 3I28A 5G41A 3ZXIA 3UAYA 5GJWC 3HTXA 1YONA 3O4GA 1ODSA 4DSUA 5DI3A 2NZUG 1JG7A 2E6UX 2HJGA 2QMQA 2ZT6A 4PHHA 2VSQA 4X6YA 1L7QA 1YACA 2XE6A 4ROTA 1UC5B 3IEUA 5DH9A 2F8MA 4R16A 3KAQA 3BZWA 1BH6A 1OFHA 1W5TA 3LY5A 3OUUA 3EWIA 3ZZMA 3WB9A 5I7OA 4GC5A 4TXNA 2ADFA 3ZWAA 3I61A 4JEHA 1C9MA 5TMBA 4ZQBA 5FLEX 4RU1A 3USCS 3TVYA 3KD3A 1CEYA 5KNDA 3I6QA 2WF9A 4AM8A 4BO7A 4OQZA 4JP3A 2Q0XA 4JR2A 3U40A 3VHXA 1IZ9A 2EW1A 3EIWA 1I0LA 2J30A 2JJYA 2PEZA 4CDRA 4UTPA 1FMJA 1H9BA 4IIEA 1TM2A 3LLUA 2C7VA 3ZH2A 1YFKA 3VKFA 3R3VA 4DE5A 5LIRA 5HRUA 5DYWA 3PTZA 3HXTA 4IBOA 4W7IA 1Z0FA 4YAOA 5C5EA 5LNK1 4CF5A 4XWYA 5JAMA 1R0XA 3LX5A 1BQEA 3PKIA 3PPWA 4IJMA 3PXCX 1EFLA 2JFWA 1U90A 3IBGA 2FFBA 1GXSA 1BRMA 1WO8A 3AX6A 1ADJA 1PW7A 4IEFB 2Y4OA 4O3MA 5A9TA 1BKDR 1DAGA 5FB3A 3RAGA 3G2IA 3NKFA 1NVFA 1QTIA 4GWLA 3SJBA 5BWLA 1TMOA 3ASZA 2O8FB 1PGNA 1TECE 2V7WA 3AEQA 1IWBB 2V9CA 3HKDA 4NVRA 5K4HA 3BK1A 1KXZA 3JVUA 3MGCA 2CBXA 4HAXA 3UMVA 4DY4A 2CUNA 3CRVA 2G4LA 2VYNA 2GPAA 4NTZA 4QU5A 4NS4A 4XJSA 3ICEA 1G0NA 1M2OB 4CIAA 3GEHA 1YRHA 2JJ2D 3G2LA 4DHEA 1NVGA 3ZV6A 4D9HA 1NJ5A 1KPGA 5ERXA 2AF4C 4FSHA 4NWIA 1P60A 4EWLA 4TUYA 1FOEB 3HO8A 5AKGA 3AM1A 3T7SA 5F7XA 2D2IA 5GIPE 3O8CA 1FRFS 3SBOA 4Z4EA 3REOA 4M9UA 2PWBA 4NZZA 1L4FA 3WO1A 1MX3A 1I01A 4XFDA 1MGOA 3K0FA 1LLDA 1K27A 2OKCA 3OLWA 5DYGA 4A4DA 3AEZA 3KFVA 4UUOA 4YV7A 3JZFA 3U4GA 1E2DA 2J0SA 4U8HA 1JHQA 1FL9A 3LX4A 3M9LA 4O6VA 4BNXA 4ZIRB 1RXVA 1P33A 1E2FA 4Z9XA 4KV7A 4JXZA 1B6TA 3UWSA 1E0AA 2YOFA 1VIAA 2EDCA 2WUGA 3KKOA 5B1IA 1TAUA 2F9LA 1ZIXA 2OECA 2PDAA 2HEGA 2V6BA 5BSMA 1ML3A 1NW7A 4JJ6A 1EK2A 2FW9A 4Z86A 4DC9A 1GILA 3KVOA 4LC9A 4CGZA 4URXR 1TDJA 4JLSA 4OV6B 5HWSA 1EUDB 3F5FA 4M6WA 1QGDA 1QOQB 1JTEA 1TJYA 3DDOA 4H2DA 5F9FA 4H7PA 5LWQA 1WEHA 2GHRA 2ZRIA 4OI1A 2H5JA 4E15A 1AQJA 4AY2A 1KQNA 1L5HA 3U1BA 2EL9A 4FFMA 1N2CE 2INGX 1R3UA 1ISJA 1E1DA 1SH7A 2QD4A 1GGFA 2W6IA 2Y1DA 3EVTA 2XZLA 3M6UA 3J81A 2XKKA 1KH2A 2IRWA 4QXOA 3OFKA 3AO0B 3AESA 1RHMA 2OR3A 2ZIFA 3HK2A 3SBXA 5FBQB 3MILA 2VPXA 3D4NA 3BFKA 3QJ5A 3M4ZA 5CNKA 5E7JA 4BCCA 4ZYUA 4D2IA 1S1MA 3OJWA 4KXLA 4CKWA 3DLAA 2NUPB 4ZI5A 2R5WA 2WVHA 2FPUA 5ILGA 3HPRA 2B4QA 4C0WA 4ZHQB 2WZBA 4J7AA 1ESCA 3SICE 2HA3A 2QRVB 1XU7A 3IBSA 3L0SA 1NMEA 2QMOA 4UVDA 3IKTA 1R8JA 1MJGA 3DMPA 4ID9A 3B78A 4GUDA 2BL4A 4N0DA 3M3HA 3EDRA 4TLLB 2P77A 3N07A 1F20A 5JBIA 4Q4CA 2HLHA 1P73A 1WDKA 3F7TA 2DT8A 1GZ7A 1HRKA 1NATA 2C2ZA 2HCTA 5CCXA 2FCRA 5K8UA 5FUWA 1QC5A 3PS9A 3ZBPA 1TZCA 1QHFA 2A78A 1K0FA 2O2SA 4LJ4A 1DAIA 4DYHA 2JKVA 2G17A 3AKEA 5BWMA 3UMRA 3U1VA 4EX6A 4FCTA 4EMSA 2XH8A 5FV7A 3W3AH 1KZYC 3TL6A 1Y1PA 2JLWA 3K05A 3VU8A 4C89A 4PZCA 3PYMA 2VSXA 4ZKDA 5BYKA 1QG2A 1ODTC 2GLUA 4FMCF 1XTSA 3FPHA 2ADMA 1HEIA 3DWGA 2A4KA 3R6DA 4REOA 4TTVA 3MBOA 1DQYA 1BN7A 1KF0A 1X8KA 2QA5A 3RRNA 2RKOA 4GW3A 3QE2A 4RTSA 1O0SA 4G89A 4LY3A 2NYVA 4WZ6A 4INJA 5F23A 3GH3A 3H0KA 4MR9B 3U5TA 2MSDB 2PJUA 2BKAA 3HYNA 4RVFA 1OWOA 4U9IS 4X6XA 3IPRA 1J56A 4ER0A 1WSWA 4ITRC 3WK8A 5ITZB 2P4HX 4F21A 1PNOA 2HNAA 2VYND 2XMPA 3TXXA 5IVHA 3DMYA 3R8XA 2ISSD 2ZRBA 4PR3A 4ZYTA 2R9VA 1QH1B 2E4WA 4HNAA 2X42A 3WHLA 4XDZA 4IQGA 3TOXA 5C51B 4H7DA 2D1QA 1ECFA 3R3WA 5KTMA 3KB2A 1NIPA 3ROMA 4PZLA 1JFRA 2FWPA 2B61A 4GOLD 1BWPA 5JCZA 1KPIA 1E1CA 4R41A 1LV7A 2B4RO 2PYIA 2VYQA 3NAGA 2A0UA 2AMYA 4O0MA 4RPGA 4F2WA 3MWKA 3MWDB 1GL7A 5EE1A 1C3LA 2BF7A 3RYTC 2Z04A 2FZKA 4IDAA 1U5CA 4MPPA 3BE5A 2I4RA 2I4IA 4N5IX 3TR6A 4CLOA 4DV3B 3CPSA 1Z37A 3ICPA 2PIAA 1XZEA 2YUTA 1M2WA 4LWOA 3U3KA 4V0MA 2BT4A 1E1LA 4L51A 4PPNA 4KR6A 1SQFA 2XHZA 2EJBA 1Z0AA 4C76A 3DHNA 1C7JA 4DR5B 1DO8A 3SFTA 4FYXA 3EXIA 3W5IA 5EIEA 4UEOA 3TG2A 1SVMA 1AF7A 4IPTA 2NXCA 4ZDKA 3T12A 1DO2A 4QBGB 5I7FA 1TCCA 3IB3A 1GN9A 1D6MA 1JQDA 3T3NA 4MJXA 2W37A 3ENKA 3CUSA 4Q00A 3MXOA 4IXDA 4ZC8A 5ALOA 3ZWPA 2QUKA 4B82A 5C5IA 5J58A 4TSFD 2EKBA 1WMAA 1KBZA 4LEIA 3P97A 5E6UA 2OCGA 3UWOA 3YASA 3AK4A 4DCMA 3Q3EA 3NCHA 2FPWA 4ENWA 3MN1A 1XZ8A 4KZPA 3JAKA 3NQ41 4CQMB 1OLXB 2IIPA 2A0YA 4IO0A 3AZPA 2HHHB 1JHXA 4OLFA 3KOZA 4TS1A 1AK9A 2GRUA 3BK2A 4UHBA 1ABFA 4AO6A 2WE8A 2WSYB 5K2MA 2XMSA 3NETA 4OY3A 3N0VA 3TLGB 5DTMA 4BYGA 1LPAB 4BNDB 1Y8RA 1IPFA 5KSZA 4CKXA 2W6CX 4M0MA 2WWGA 1UAYA 1MV5A 4R2MA 5LIPA 4OI2A 4EGQA 3COJA 5IJAA 4QUDA 3GD5A 1U2DC 3G5MA 1XMIA 1L8LA 5J9FA 3JAMA 2XLCA 3I01A 1XZCA 5IBPA 2VF5X 1A9XA 1O0CA 3SZMA 3ROXA 2O7RA 1I36A 5BQ3A 5AXAA 5AICA 1JVBA 4PR0A 3K9BA 2WZQA 1KMMA 3DBRB 5JWOA 2HU8A 3L6EA 2W6ID 5L8VA 1O94A 4UU7A 5JJBA 2EHDA 4EHFA 1O3YA 3ZV3A 3ORFA 4FR2A 1Q91A 2R4TA 3KTAB 1OT3A 3IHLA 1W88A 3G68A 1L5NA 3RGWS 3L1UA 1MO5A 1L7XA 2VKQA 2H11A 2VNHA 3HABA 3MJSA 9LDBA 2OV3A 1LQTA 4WJLA 5CT5A 3HPQA 3OZUA 5L3SA 1NSYA 2V7PA 3ISJA 1OD6A 3JD3A 1KDZA 4US2R 1C9YA 4QDUA 4EBFA 4U6SA 2Y0CA 4NMXB 4G2NA 3KKQA 1RWKA 3H18A 4EVIA 5BVHB 1AKMA 3A04A 1UOQA 4G0OA 4TXHA 1P6UA 3NBQA 2XQIA 4BMDA 1PFUA 1ZZGA 2GF0A 4QFDA 3PZRA 1ISIA 2GEFA 3QUBA 1WXHA 4MB6A 1P61B 2GS9A 2Z83A 3NR2A 1ZA1A 2AG6A 3J81k 1U2GC 2PSJA 5CYGA 3UATA 4A0GA 4KWTA 3V7UA 2AI2A 3F3YA 3GA0A 5GM1A 3NP9A 3N74A 1NMXA 1S2LA 4LYJA 4ZRDA 5JAZA 3RAFC 5E4JA 3A6EA 3GLUA 3RC7A 2Y9PB 3FWKA 3EZ2A 3R5JA 2FP4B 4AN0A 3RUDA 1H0RA 2ILTA 2RGWA 3IESA 2O1WA 4FGLA 2PX6A 1RRMA 1WIWA 3DDZX 1R0YA 3C15C 3EFBA 3QXXA 3WK9A 4BAUA 3LUJA 2VXCA 4KGVA 3KDPA 2IV7A 5KMGA 3ICWA 4K0KB 2Z4RA 1Z4JA 4GS5A 4X6UA 4F4DA 4X60A 4MW7A 4NEQA 3WYAA 2F8TA 1QVZA 4Y2SA 4BUZA 2C5EA 2BFWA 1HNWB 5C3UA 3L7AA 4PX5A 3WL7A 3TXYA 3MJFA 4U7PB 3L79A 4D3XA 4XOIA 3VOBA 1QDUA 2AVDA 2MCFA 4R9NA 5A5VA 4EAAA 1DC3A 1E79A 1WMDA 3JSAA 5TMPA 3WGUA 1UINA 1KI2A 1T2NA 3UV3A 5FOTA 4C3ZA 3U7FB 3VJKA 3D7RA 2ZTSA 1CY2A 3EN0A 4JLWA 4L0DA 5EE3A 4PZDA 3L4EA 3AEYA 3RVPA 1ZOLA 1MW8X 5C1PA 5AKIA 3STYA 4OAOA 4YMLA 1U2EA 1P6QA 1EWQA 4BGDA 1JBKA 1MEJA 2A35A 4TS4A 3PSAA 3QKWA 4IRMA 1M1YE 4U39A 3HBAA 2TRSB 1E3QA 2OV1A 4LZLA 4FSDA 5TX7A 4DLRA 2IYAA 5CM9C 3Q8WA 1C9NA 3P0JA 2NYUA 3HM9A 4M7OA 4OBXA 3IX7A 1N5KA 1AA9A 3ITKA 1HO3A 3D3NA 2EYQA 5CNMA 3CM0A 1AHPA 4MP8A 1UBKS 1V2HE 3RSZA 1W49A 3D8RA 2A8YA 4FTWA 1AM4D 1S2IA 1U0EA 3HLTA 5IDYA 3GJ0A 1E6WA 4WNYA 3VZPA 3SIPA 1IXKA 3MF4A 3CMCO 1NVKA 1VHTA 4WNAA 4G0NA 3JU3A 2BJVA 4L8VA 5FPSA 3EY4A 1QPZA 4ER5A 1LF5A 4X93A 5D3MB 3E7WA 1RXEA 3GEMA 3GHHA 3GOQA 1E6UA 4BFUA 1DTWA 2NSHA 4BX3A 4HH3C 1J2EA 4WZAB 4C0KA 2YIVX 3OX4A 4KFUA 4D9CA 5B58C 1PKEA 4DA0A 4DUPA 1PEYA 2YYAA 2OBXA 3ESAA 4OU5A 2WQZA 2XRFA 2HXGA 3IIJA 1MV8A 4B7UA 1EZ1A 3O4HA 3R9KA 3H8JA 1QR6A 2PWAA 1C30B 4QTUB 3CHYA 1WMFA 3I9JA 3T0GA 4EB8A 2LRHA 3JQFC 4ARUA 4GGPA 5CA0A 1L1EA 1P0QA 2BCGY 4JYBA 5AJXA 3VPCA 3AEXA 1UBEA 4O4HA 3TBHA 3U0VA 4E0BA 1L4HA 5BXQC 4TWBA 1YKFA 3L7LA 3N6XA 1T0BA 1O6FA 2CHEA 1S2NA 3MTAA 4KRXA 2IBMA 1BRTA 5CVUA 2O8NA 4XIFA 3W6NA 1MB4A 2JGAA 1B7GO 3WMXA 2YHSA 1XXHA 4EJSC 3NOVA 2VAWA 3EJWA 1QCCA 2ZS9A 4QSMA 3PZBA 1UC8A 2B1RA 3ANMA 1NI4A 3RGGA 1W36C 3E3OA 3C39A 3TIXB 1TK3A 1GM5A 1R4NA 4R8VA 3TLMA 2CSUA 4M8LA 4L7VA 4Y6OA 4N65A 3UB2A 1P2GA 1XRMA 4QDTA 4ZAYA 4CCYB 1B2LA 3L0IB 1I7NA 3R6TA 5D5PA 4BBPA 1ZR4A 5ALIA 3AIOA 1CQIA 5J5CA 4TMVA 1PS0A 2PT7A 3OVMA 3PGJA 1YV9A 1NJ6A 3UV6A 3KWFA 1JA0A 4MZDA 1E6LA 1N2EA 1YUMA 4P7FA 4JENA 5FUBA 3T15A 4YPVA 1GG9A 4KU4A 3GFGA 3RVLA 5E6SB 2I4NA 4JT4A 4EG8A 1WKVA 2AZXA 1JP7A 2AGVA 3HUUA 3L6DA 4P7BA 2NTYC 3R2JA 4IXMA 4X24A 2FUG6 2BGNA 2GA9A 3AONB 3BCUA 3F7MA 4HGRA 5FNVA 1S02A 2O48X 3E4CA 1OPRA 4IVPA 4ND1A 1PK8A 2V6MA 1HYEA 2ZAGA 3H75A 4B7ZA 1WQ1R 2HADA 3H8SA 4XCXA 5KVCA 3ZY5A 3WIOA 2G76A 2DUWA 1AQLA 2H4JA 1CDOA 3GVIA 3EXG1 4JBHA 3T9FA 4E22A 1GKLA 1U3GA 3MTIA 3G3EA 4MQ5A 1LRKA 3KV1A 1QONA 3L6UA 1YI8A 2ODPA 5K0LA 2J3IA 4PNPA 4J2TA 2Q5OA 4E2ZA 3VUEA 1NY5A 2RGEA 1ZN8A 1UPXA 4LY9A 4D0SA 5C4IA 1K4YA 1RZUA 3GA5A 1L7NA 4JLPA 4Y2GA 5LQRA 4WADA 4PPYA 4D5EA 1MJHA 4XEUA 3K6KA 4MXDA 5P8WA 4ENPA 3R9XB 4EHIA 1XR3A 3E6AA 3HJUA 3EY9A 3MNFA 1UBFA 3D8NA 4FE7A 4G4JA 5J4HA 4D45A 1Z3CA 4EG7A 4BP8A 5KUTA 3WS7A 2WM9B 1T3GA 4E1VA 5I7WA 4KXNA 3N59A 2AW5A 3FYUC 3PUKA 4KQHA 5TY0A 1TZKA 2XBLA 1BA2A 1SKAA 4KHZA 4KRYA 2VDQB 1XQWA 2XNSA 4LG1A 1XTKA 1YTLA 4W5HA 2BJWA 5CAEB 4ENTA 3PDCA 4N0QA 1E1QA 4GI2A 4JYAB 3U62A 1QIJA 3UOWA 2FE4A 4FFNA 5IF3A 2AFIE 1UKYA 4N4AA 4RFSB 1OVMA 4POOA 2XRZA 2C95A 3P9QA 1NKTA 1BFDA 2QIOA 4Y6GB 3TTYA 2VXBA 1VHWA 5ERYA 4BMCA 3ZIAA 4GBJA 1GV1A 3U7JA 5HE9A 4A36A 1E3SA 3AERB 521PA 1UWVA 4TSKA 1T4CA 5KZMB 1MW9X 1E5LA 4KO8A 5T57A 1A27A 1LW7A 3NHYA 3EDYA 1G64A 2H54A 5CJ2A 3R75A 3UXHA 3PUZA 2R85A 3TD6A 3C6YA 2DUNA 5TV2A 3GUYA 4HH0A 1ZVMA 2ZR7A 5FPPA 2GR9A 2VJNA 1W7AA 2EL7A 3PC3A 3MMSA 5IW8A 3F47A 5F3RA 4FGUA 1A8HA 5KWEA 4AN1A 1O1YA 1TEZA 1OX4A 1DQNA 1GU1A 1KSFX 3KQYA 4NFSA 1B16A 1ECCA 1Z8HA 3E9DA 4R1NA 3RC3A 3A05A 1QO7A 1E89A 1G5QA 3RYIB 3UT6A 5LXTF 5HFJA 3MVEA 2WJ3A 3UENA 3Q2KA 4WFJA 5CFQA 4FGZA 2JFGA 3JASA 5INTA 3PPVA 1R8QA 1X8JA 2I7VA 4AC9A 2XHEA 3Q5DA 2IPOA 5JH7B 2HN9A 4AIIA 2EP7A 5C80A 2YJZA 5BUSA 1TEHA 2QG6A 4PYKA 4TXJA 2H1WA 3AY3A 2QRMA 4LSGA 5ALTA 3ZZNA 4UNRA 1I2DA 1NN1A 4G0XA 4B8WA 4ZCIA 4PX3A 4P2GA 4K9SA 4UASA 5L3QB 3IMEA 5K1ZA 2C2YA 2WKWA 4CHTA 1C9JA 2BI8A 3TRIA 4OQXA 1DP4A 3C45A 5SICE 3RF7A 2IEGA 3O3MB 2X3YA 3AJ8A 3WWPA 4KH1A 2XIJA 2VDJA 1F4VA 2UDPA 3VSDA 1GPAA 2P2ZA 2Z6QA 1YZGA 5J2TF 5KDLA 4UE3S 1JEEA 2GAJA 4UVHA 4D3ZA 2B5WA 2GWHA 1RJWA 2AEMA 1SUFA 1NULA 3AIKA 3AI1A 2X0KA 3Q72A 5EE5B 2EFDB 3BAFA 5BN5A 2ZRDA 5IEJA 4MQLA 1M1NA 4TROA 2C77A 5TMDA 1OAOA 1N0VC 2CLIB 2ZIEA 3I58A 5F7ZA 1SCUB 2FGKA 3QLVC 2BDTA 5LA6A 4E30A 3BWMA 1P5ZB 3LRXA 2WYWA 2CYBA 1Z4QA 1X86B 2AR7A 2P35A 5EZYA 4HWPA 3C24A 4WKPA 3IQHX 2IHYA 4D9BA 5CD1A 2I91A 1G21E 1MXHA 1IUKA 1TA9A 1YVDA 4V38A 4I8IA 5F1PA 3RPEA 4YIHA 1Q74A 1TB4A 2P4SA 1KI8A 6ABPA 4JI6B 1JVNA 3GQVA 3PCTA 2EX1A 3KFLA 3S2ZA 3UOGA 3KQWA 4I5FA 4ECAA 1Z7BA 1PIWA 5C32A 2WNHA 4JYCA 1T24A 2P7IA 4RJKA 4ZJPA 5KWVA 1LFDB 2VDLB 3RBXA 1AKVA 1K68A 2AG0A 2HA4A 4S2EA 1IPEA 5BNTA 2NZWA 1RM5A 3QVJA 2DPHA 3WL4A 1A8UA 4JWTA 1CZOA 3KPUA 1JJAA 3BE6A 4OBWA 1FRZA 4RMGA 1VRVA 3VO2A 2JC3A 4H1TA 1Y7HA 2F1HA 4NLLA 3FXAA 5KSWB 2QL6A 2G8LA 2EOAA 2QTVA 4MH0R 3F5MA 3Q7SA 4WERA 4BNDA 5MFZA 1Y0BA 3WKEA 3IP1A 4RW0A 2Q7XA 1FVFA 1T1IA 3HJRA 4M36A 3VPHA 4FEAA 2W8ZA 4KDCA 5C5DA 3HDYA 3NM5A 2ONCA 1ONOA 3TE7A 1OZ0A 2QVBA 1EB8A 5DGXA 4FEEA 2C31A 5EJ4A 5PNTA 5A0TA 1WL8A 3K0FB 4CRWB 3ACBA 4RS4A 3ZG6A 3ZJVA 1N6LA 4EJFA 4K6CA 2EKLA 1QR2A 3VR4H 1JIXA 2GO1A 5J59A 3VU9B 1V39A 2TMDA 3TRDA 4GXTA 4IYJA 3MT7A 3FCAA 5A5GA 5JXJA 2EX0A 4TMFA 2JLQA 4WLOA 4HWKA 4YJFA 4N49A 1NDHA 4G23A 1SK9A 2IOYA 1I6MA 3C5CA 5KAPA 1RZRD 1I2ZA 4JA2A 4A3SA 7ABPA 1WXWA 4YRDA 2P9YA 4P84A 2QL9A 4H15A 4MVJA 5KHLB 2VDVE 1YL6A 2F4NA 5IUNC 1GARA 1Y7LA 1AZLA 1WVGA 3E22A 4IUBS 1S9HA 2QRKA 3OPMA 3R7WB 4Z4IA 5G4KB 3MCWA 5LD2B 3LT0A 4EPXA 3DUFB 3Q3JB 1YJCA 3OH8A 4FYVA 3KKKA 4LBWA 3EGOA 3SYNA 2O8FA 3KB6A 3DTTA 3CX6A 3NTLA 4ZAXA 5K0FA 1F2UB 3DKRA 1SUDA 4QRIA 4CVNA 1U1CA 1ZRHA 3FAKA 5H3CA 4X91A 2Q6LA 2Z30A 2OCLA 2WTEA 1DKNA 3DZIA 4KC0A 3RF6A 4A2WA 3DEYX 3NNSA 4YUXA 1DX9A 2FGJA 2R7MA 3GIWA 3FGOA 4WWHA 3DMDA 2FY8A 2W6JA 4HDMB 3V4RA 4BZXA 1VSUA 3DMGA 2HCBA 3L8HA 1SXJA 2H8KA 4ICIA 5FUYA 2XIQA 5I8PA 1CUJA 3IE1A 2FN8A 2CL0X 3CINA 1OYWA 2JG3A 1V0JA 3PHGA 4AF7A 1UIMA 2IYYA 4FDMA 2P40A 4EHDA 4L57A 5M34A 3D9QX 1NXOA 4HXFB 4PSCA 4MHSA 1K8YB 2MYNA 2VI5A 2D1TA 3O4IA 1LD3A 2O2ZA 1W4RA 3SYTA 1J9EA 2BM9A 4UM8B 1MB0A 1N36B 5G0WA 2R5FA 2O5EA 1WCYA 1KZHA 4ZANA 5LP6A 5LOVB 1VB3A 1D4AA 3RWBA 3LY8A 2OO3A 4Z3DA 1HE2A 4MQFA 3AQ4A 1FNSA 3A37A 3IUJA 4IF4A 1AQUA 1ZH0A 1EX1A 3OM9A 4HOYA 4B46A 3PA6A 1RAGA 4OHZA 4BX2A 1SA0B 4ZI3A 4O2AA 1RHRA 2AJ8A 4HDSB 1T0PA 3RUCA 1OT5A 1LSUA 2NVOA 3DG9A 4PLFA 3WL8A 1DBIA 3P8ZA 4FZ5A 3M89A 4CN9A 4GP7A 4BLTA 2DGDA 1SQ5A 2QRHA 5EWJA 4X62B 4CFZA 3IR7A 2ZBUA 1T4GA 1TFRA 4RPKA 2B5OA 1BTOA 2VSYA 3NXKA 3OJCA 4HDRA 4KI7A 1AKTA 1TUIA 4P4SA 4L5AA 4Y2VA 2PA3A 5EHNA 2VQ6A 3VC1A 1VJ5A 5EHGA 5IABA 4P58A 3AG5A 3G7NA 3VHXB 3QMPA 4MVWA 4OHXA 2FSIA 4MGKR 3FRIA 2BSQA 2HJHA 1EK0A 4ZVOA 4GQBA 4TTIA 5JNUA 1OASA 1VZ2A 4G9GA 4IDEA 4TWIA 3SYRA 3TUZC 2BDEA 2B0JA 4GM1A 4PVDA 3RCBA 3FF1A 4XJXA 3GVHA 4UM9D 3VOAA 5LLTA 2HR1A 2IPNA 3IEXA 3OOEA 4ZQFA 5F76A 1MC5A 2Z8YM 1BKYA 1UBNA 5IC5A 3U0BA 4NMHA 1H6DA 2AD5A 2P9ZA 2QP4A 5HZGA 4ZHQA 3W9BA 4D4LA 1GG5A 2A30A 4MVYA 4F9FA 1SD1A 1HKHA 5EUMA 3PRHA 2HQOA 4RPHA 1ORHA 4B09A 2MMGA 1EVLA 5CEFA 1C1DA 1E4OA 1OI7A 3SQNA 4EW1A 3OECA 3KWJA 2WIGA 3A1EA 1K0UA 1OFTA 3EFEA 3V1UA 4W9NC 4AG5A 1E0JA 4Z3OA 2BFPA 4EP1A 1QG6A 1P4HA 4LDNA 2P75A 1G3QA 1HQDA 3OX3A 1WBJB 3K72B 3M70A 4DZTA 3DE0X 4ZMSA 1P6XA 2QNIA 2QE6A 2AKAB 4LWPA 1H2HA 5CLFA 4F86A 4KXWA 1DV2A 1DC8A 1GCUA 1V8ZA 2BI7A 4FE3A 1ANKA 2IDKA 2FQQA 5ESXA 2JIMA 2XVXA 4IG9A 5LKRA 3ZWWA 1NOKA 4K9QA 2G08A 1RU3A 5IDVA 2QJRA 4JP8A 4PINA 5ADUS 2QE7A 1A72A 2XUFA 4YRBA 2ID4A 1JW9B 5HRAA 2WA1A 5LQDA 3DO5A 3GC6A 3I76A 3NDPA 3KJFA 1YJ5A 1RRPA 1T6YA 1TCAA 3ESBA 5JVDA 4J7CA 4BVJA 3EASA 5BV8A 1ZRSA 2A5DA 5L3VA 3A4VA 3OZRA 4TTJA 1NVEA 3T3PB 3OG9A 1BDBA 2ZDHA 3I04A 4FLMA 1U2DA 2BF4A 4MUKA 4CJXA 2D5BA 2RHJA 3UKOA 1BQ4A 3PUXA 3KT6A 1Y1RA 3DTVB 9MHTA 2ZVDA 4BFZA 1DAFA 3JW8A 1QO9A 2WSMA 1KQ3A 4CM9D 1ESZA 2YFQA 3BXZA 2Q5CA 5AKJA 4R1LA 1ZD4A 4YRMA 2FR8C 4NKRA 4YQFA 4B3HA 1OVGA 1DV1A 2C7RA 3HDVA 3H97A 3MMPA 4OK5A 2B6HA 3V4PB 4CKZA 2FQ1A 1T9HA 5CX4A 4XYLA 2WAOA 1UJ6A 2MOKA 5JMPA 3SR4A 5AIBA 1JQBA 4V0QA 1XDGA 2GKOA 1K7XB 2FG5A 1FPQA 4LXXA 1RWMA 4MVJP 4PXYA 5DWDA 4DNFA 5EJ2A 9GPBA 3Q2OA 1UKBA 1LUAA 2QVYX 4IRUB 4JLUA 4TTTS 2BGGA 1I4OA 1V1RB 4OO3A 2Y93A 2LZ0A 3KLNA 2ZSFA 5I5GA 1DO0A 1YZFA 3K8QA 1VPVA 4EO7A 3ZHSA 3FNGA 3ZHZA 3RIEA 5DOVA 1FA9A 2Y92A 1H4VB 1VCNA 2VCEA 1IY0A 4F11A 2A5YB 4RWZA 2PKRA 2QLNA 2X4LA 1FFXA 2JGDA 4COKA 5JBQA 1IM8A 4K40A 4TQAA 5I9SA 3OU7A 3V4OA 1MEOA 1XDZA 3A06A 1TXGA 3CVJA 3EFOB 3HVUA 5FULA 4I3GA 2M6KA 4PC3A 3THSA 2QVXX 3KG2A 4B9EA 3ZE9A 2B34A 1VRCA 4YRSA 3BK7A 3DM9B 3NEAA 1V96A 2JZCA 3F1KA 2PRJA 1MO2A 1TT7A 3BX1A 3FTCA 2ZIGA 4EY6A 1EM6A 4FB5A 3WTCA 3MS2A 2G70A 2IOFK 5EP2A 1KEWA 1U80A 2GASA 3RJ9A 3T9EA 4P80A 1C7QA 2AN3A 2DERA 4HGOA 4CM8B 2SICE 3PT5A 4JQYA 5DWQA 5ARDA 3GQBA 4MUYA 4CM1A 1CJUC 4KCGA 3BM5A 4KMRA 3A26A 1EZ4A 5A3VA 1NN3A 5JVDB 1D1SA 1T2DA 3ZBUA 4GPZA 3DZ8A 1L9XA 1QHYA 2D1YA 3JYPA 3K92A 3L1JA 4PZEA 2WAXA 3OIVA 5HIKA 4KQFA 3BULA 1G20A 2CFTA 2BFOA 2IOQA 1U4OA 1A9TA 2QMYA 3RVKA 4S2UA 3W4IA 3TJMA 1TVKB 3DAYA 1T6ZA 1E4EB 2JGFA 4TTPA 1JZQA 4CR8A 1TM4E 2W7TA 3L18A 2XMCA 4HX2A 1SIOA 4RM2A 3ZDZB 4AP9A 4A8HA 1IK4A 4NPCA 4CXMA 2PD4A 1T9KA 3AKYA 1HE5A 2RI1A 4JT9A 1GPUA 1ULSA 1QVRA 4ZVVA 3TW8A 4MP6A 4BLQA 4AWBA 3B6MA 2A3RA 1ONBA 5L6MB 2W48A 1J42A 1YOBA 1Y98A 1T0UA 1ZQ9A 4RK0A 1LPSA 5FJJA 2EIHA 3P4XA 4H4DA 4PGMA 3EYWA 4X0EA 3DYBA 3TCKA 3D7NA 1HT3A 1DKRA 3OEEA 4RTRA 1H2RS 3CU5A 1M33A 1RJGA 4AP5A 1C1DB 4JC0A 3KEMA 1H6AA 3OKAA 1XI2A 2KMLA 4Q3OA 3WICA 4UAGA 3FY4A 3WISA 4B6JA 3GXBA 4PVCA 1U94A 3SQMA 2Q5FA 3VQTA 1GPWB 1Z6GA 4JYZA 4N40A 3GRRA 4D56A 3AY7A 3I8XA 4HEHA 3KZNA 1ODLA 2JHAA 2Z8YA 4PIMA 5HS4A 4ZA2A 1ILWA 2OXTA 2F8LA 1C4XA 1FDTA 1I0ZA 1HZZA 4M60A 3VRHA 3TG8A 4Z2YA 1EP1B 3MAAC 4NJMB 1CUWA 1EVJA 5D1NA 2XXAA 1Q0UA 3KDSE 3A4IA 1QDEA 2OFWA 3QU4A 4DIEA 1MOQA 2NTEA 4B7XA 5D1HA 5FCDA 4W4TA 5EN4A 1UT8A 1P2VA 4GWKA 4J4BA 2YJ4A 1HFKA 4Q93A 1IOZA 3N2YA 4XEHA 3T3GA 1N6RA 1GTG1 1T13A 5AKLA 2QRNA 5EJFA 2BBTA 1XGKA 3JYQA 1JMKC 2YDXA 3K1JA 3VV3A 4N1AA 1Z5OA 2R25B 3M6XA 2QXUA 4NABA 4FR5A 1V4VA 1KFKB 2OD9A 4MB2A 2WIAA 4X00A 5HOEA 3HB4X 2HHLA 1FTWA 1EP2B 3C7CB 4TXLA 5TSDA 5DTEA 4UE2A 4DJTA 1WSAA 1KIFA 4BMZA 5KYWA 3ZIAD 4J0CA 4BYMA 2RGAA 3VNBA 4IDGA 4UNPA 1KMHB 4JX8A 2NW6A 1JEAA 1MC1A 5H3HA 3S2SA 2A5LA 1JFVA 1TU4A 4L95C 1A9PA 5SY6A 2FMXA 2ZPAA 4WXRA 4P32A 2VK4A 4NP6A 5B3LA 2O2EA 3JQ7A 1T15A 1QZTA 2QXYA 1NVVR 3H83A 2IP1A 5JSZB 1PFWA 1SM4A 1QC5B 3AJ9A 1FBNA 4JI5B 1X80A 4WOKA 4XDGA 2CB0A 2QPAA 1PGQA 1KEUA 1NLMA 2GHIA 1SVIA 4UULA 1AN0A 1QK4A 2GJAA 3V55A 3B6ZA 3U4AA 4F3CA 4GPBA 1YDGA 3AUJB 3GYBA 3LOQA 3ZWYA 1MO3A 4QHYA 5LU8A 1YR7A 1Q19A 1PV1A 1Z6YA 4LOIA 3S2GA 2H1LA 3BEOA 4G1VA 4PAWA 1ZIDA 4WGGA 5FTNA 4BQIA 4OQMA 5I4BA 1E7SA 1T2VA 2IYPA 4AECA 5AK6A 5ER9A 2PUWA 3PP8A 2PUBA 4BNZA 1CUVA 4MKGA 1EFTA 3AFIA 4LC1A 1ZK2A 2QVGA 3FFWA 1A95A 3JQQA 4MV8A 2XNJA 3UIEA 1LBTA 1W5FA 2JA1A 4OH7A 4BO6A 3PITA 4ZO7A 5D84A 4AJKA 2OAQ1 2ERYA 1T2EA 1GYRA 3LK7A 3OJOA 4RVUA 4XB2A 2I8AA 3O82A 2Z57A 1Q2UA 3NHWA 4KWHA 5DSZA 4AZ0A 3QVTA 1AUQA 3HS3A 1SUPA 3RIYA 1K98A 3HMKA 3HWWA 1RHQA 2AKYA 5BUCA 2EWWA 2QTHA 4J0KA 2JFHA 1E4VA 4KO1S 5IJ0B 4W6ZA 1C3EA 1QSGA 1T3HA 3AR9A 4Y18A 1OBFO 1SJ9A 1PS8A 1A82A 3KK0A 2H18A 4U63A 3F6SA 1NUQA 4HBGA 5KOYA 5E1BA 1USGA 5LL6P 3HV2A 4LWZA 1ZM3A 1XZGA 3A6PC 5HA5A 4ATNA 3BIFA 3FPAA 3P2JA 3LWBA 4F85A 1XA0A 1RAHA 2ZS7A 1TZ2A 2V7UA 1V9LA 3B2QA 3IUMA 3SYKA 4MRMB 4E03A 5JOQA 4FKBA 4S1WA 5CLLA 1RYYA 3DE4X 2JLSA 5IN5A 4E32A 2X7XA 3BGOS 1I10A 3IKJA 1K6EA 4JB8A 4BB6A 4O33A 1WW2A 4DN6A 4YO8A 5LJLA 5JH7F 1CYEA 2GPSA 1VJ0A 2WM2A 3ZWMA 3GU3A 1VE7A 3R0IA 1B4DA 3GT7A 2IF2A 3O8OA 3I34X 1W35A 1GXSB 5JRZA 4L4UA 3AJAA 5HTOA 1PSZA 1R64A 1XXHB 2BGRA 4PZAA 4F3YA 4DBZA 2J41A 1GPKA 3W6OA 3UPDA 1N8KA 1Z25A 2H1FA 3R0JA 2MU1A 2IBSA 1ZM9A 4QELA 5EXXA 2R6HA 1O2DA 4EVSA 4CMIB 1FSGA 1PT5A 5DBGA 2VRWA 3OBIA 4PN7A 2WF6A 3AL3A 4RDCA 2BFMA 2L69A 2WU1A 4I99A 5JR3A 2A1TR 3LMKA 3X1DA 2JIDA 4HKTA 4QTZA 3ZJ4A 4DLZA 1AGNA 2AH5A 3PFNA 3FSGA 3WV4A 1KEKA 4XIJA 3LDHA 1Q7BA 3DV0B 1D9XA 1ZYUA 2QX8A 3CLVA 5LVAA 2PHZA 4IJVA 3AUYA 5DP1A 1PZGA 3HYRA 4QOHA 3Q3CA 2UUPA 1OTHA 1Y33E 2W4QA 5KEIA 5FOQA 2AKEA 2YR0A 2WHPA 4MVJE 1ESEA 3KSMA 3CF0A 3FF4A 3WY9A 1U8EA 2FJ0A 4M1YA 3SD7A 3MTEA 2QM3A 3A6FA 5HQ3B 3LIPA 1VP3A 1W2WB 5IJZA 3KJZA 4FMDB 1F4PA 4RNCA 4D8YA 1R6DA 1XXLA 3RVQA 4RY2A 1ONPA 1NAIA 2AD1A 1D2HA 1QBGA 1T9BA 1XJCA 4XQ0A 4V03A 1C7FA 4J90A 4LNUB 4NOLA 3DBLB 4OMDA 4R84A 1B00A 2F3UA 4IIHA 5I9BA 5HUQA 1RPJA 3G2KA 3GFTA 4JUDX 5ECDA 1CUZA 1N9ZA 2AXQA 3PNPA 4GKJB 3OZBA 3QU7A 2JEZA 3PHIA 2ZAOA 1YUBA 2QRGA 3QEKA 1UBJS 4WNIA 4HAUA 3F9RA 5HX7A 4PLGA 5ALSA 2P5TB 2I3DA 1M5TA 2FVYA 3EHDA 4PTLA 1Z2OX 4M0CA 2V7VA 1SIBE 3F8WA 3QTLA 5BSVA 2IEBA 4DA6A 3E70C 1LK5A 1QNFA 3VR5H 3KWMA 2RHTA 2G71A 3FGNA 4NENB 3ELBA 4JVMA 1PJZA 5LQCA 3PIRA 5I8WA 2R8OA 3PWKA 2MSNA 1W87A 1SHZA 2YINC 1CVLA 4RY0A 2ZAYA 1AHIA 1FB5A 1MIHA 4XCQA 5WRFA 1RPNA 3HDJA 1JHOA 1JPJA 3HI6A 5TXGA 3EJ6A 1U9ZA 1MVNA 4FFWA 1P29A 4OXKA 3TSOA 1L5WA 4LGMA 1UMCB 1RWWA 2ZTVA 4B0PA 4IJUA 5EMLA 3V34A 4L9AA 3SOPA 1Q3HA 4K0RA 4IOKA 5EESA 1QQ7A 2N46A 2OG2A 1TYBE 4PO9A 3PX2A 2JFOA 4JLVA 5FPKA 4RF2A 4O1MA 4B87A 5EGNA 5EPEA 2QAGB 3JCZA 5DCWA 1VFPA 2HU7A 4MGIR 4W8GA 2W2PA 1GGMA 1C1XB 1PJ8A 3D6FA 5DYIA 3WXMA 5HRCA 1JEDA 3CKYA 4I8DA 5L7TA 4DS3A 5ITSA 1MENA 3SK0A 4DGQA 1X7ZB 1RXWA 2O8BA 3RVSA 4YGXB 4BLRA 5EZ6B 1UBGA 4ZU1X 4LOLA 4C4TA 3S2UA 2SBTA 2RARA 4IFBA 3VR6A 3FB1A 1TT5B 5HK8A 5JW6A 3QWBA 3SFZA 1P0IA 1WMBA 2J9FB 4LY0A 3HBFA 3V8EA 1W36D 2QT9A 2VNIA 4HWGA 5LDDC 4WESA 3ZGOA 3UO8B 3BJMA 5JT1A 1E5DA 1SBNE 3PUYA 2IYVA 1ZW6A 1PR3A 4J3NA 1C0LA 2UZIR 4X8HA 4EBBA 1YNOA 2QDKA 2XUDA 3OEYA 3Q7PA 4XQ9A 2Z2KA 3ZU4A 5DMXA 6AT1A 4DRYA 4P5PA 5GMOA 1ZX1A 4Z49A 1KI9A 3NC1C 2QTVB 2VDNB 4R0VA 2QTFA 1EAMA 4JHLA 5CCEA 2WKQA 2NP6A 1R0ZA 3KZVA 3AFHA 1FFXB 3GFRA 2PU7A 3TQOA 1LRLA 1E2LA 5B3KA 2LV8A 3C4VA 2GVZC 3QVKA 2BP7A 1LS1A 1OXBB 2FEXA 1H3FA 2ASVA 2CVZA 2WTBA 3QH4A 1NV9A 2WWXA 3HR7A 4TPKA 3P9PA 2WHYA 4BDTA 3EGEA 2YVUA 2JFFA 3L3BA 4MCIA 2ZBVA 3PK0A 2FFRA 4DWJA 3VOTA 3VI3B 1RAEA 4I50B 2R87A 2PGIA 4UTZA 3BMNA 1DX6A 3TB4A 5KJ1A 2ZTHA 1SC3A 3H5VA 4LJYA 4W5RA 1Z5UA 1SU7A 3OIFA 4M76B 2M2IA 1E99A 4O29A 1M0EA 1EFHA 4BNKA 4MYHA 5BN5B 4B3CA 5LM3A 1BHO1 2DPXA 3MWFA 5AW3A 3PEUA 3RYHB 3DE1X 2NP7A 4C4XA 2ZYAA 1BU5A 1KI1A 4QNMA 4RKWA 2EG5A 2ZOSA 3O84A 3RKUA 1XJWA 2COUA 2VHQA 2R7KA 3LYUA 4B4DA 3JV7A 3DQPA 3ZGXA 3EXAA 1D8TA 2H2IA 1YGYA 3IOEA 5ES3A 4TWZA 1QKIA 5GONA 4MIYA 4TTRA 2EZUA 2ZRFA 2SKDA 2JLAA 3UCXA 2J9FA 2EQ5A 4WKBA 4ZAFA 3V7WA 2JBAB 5GWXA 3WGLA 3E2PA 1E94E 3RUHA 5ED4A 1M5UA 2AZ4A 2X8BA 3N87A 4O4HF 1C1XA 3NM4A 2ZIAA 4YPOA 2RAFA 2ZRLA 3AYXB 4UHJA 3OIGA 4RQBA 2VJOA 5ALJA 1T6BY 1RYMA 1E66A 1T2UA 2W2KA 4HYYA 4OD0A 3LF1A 4L78A 2YVKA 5CTJA 5DF1A 5IVKA 4FKMA 3G5AA 4JL8A 4XFJA 1EGAA 3CUTA 1ZXBA 3VKVA 1RRCA 4DSOA 4DG8A 3ER9A 3OIDA 1XZFA 2GPNA 2HSZA 2R60A 5JSFA 3OD5A 2O07A 2GARA 3I2KA 3BT7A 1J8FA 1THTA 4XIYA 3UJBA 2BEWA 1P7CA 1CY7A 1FNCA 4JJIA 4BU0A 2UU9B 1JQKA 1PJ4A 5G1PA 1IN4A 3FJYA 4WOBA 2VT6A 1BDJA 4TRRA 2NO4A 4ODIA 1RQNA 2KPOA 3WDMA 5B55A 1F2TB 2AUNA 4UHDA 1X14A 2YS6A 4FKZA 4Z4FA 5G1NA 2ZVPX 4D0RA 1BDMA 1EGQA 2O06A 3N8IA 3TTXA 1U5AA 1QRRA 5HQ3A 2Q1TA 3HN2A 3FAZA 3DZHA 3KELA 1QRSA 2WG0A 1IB6A 4QDKA 1SU4A 5LLDA 1IQRA 1H69A 5JO9A 1ZC4A 1A97A 3CB4A 5TVGA 3AV3A 5SY9A 1ZJYA 3KP1A 2IDMA 1VKJA 2JHGA 2Y27A 2B1IA 3SC6A 1LU9A 2W11A 5HHTA 2JFPA 1T5TA 1AE1A 1J2TA 3DCJA 4NCJA 4Z0TA 4AB1A 4CTNA 1XQVA 1NFFA 1YK0A 2ZRHA 3GFQA 4TRJA 3RHSA 2OBFA 1LSSA 3AEKA 1Q2XA 2ZT7A 4HVTA 5A0FA 3CW2A 2QPLA 1H6BA 1OV4A 1N2GA 1YBMA 2WSSD 3BRWD 5EFOA 4COOA 1H8HD 2I80A 1PNTA 4M8KA 4A1FA 3KCQA 4Q3LA 1IRXA 1P2SA 4HYTA 3WAKA 3P27A 3U9TA 1RD4A 1ZJZA 5FKJA 5ILOA 1DT3A 1KAGA 4FGJA 4F04A 1I5OA 4RMHA 5CU7A 2JAOA 4MO2A 4ESOA 2NTJA 3AVWA 3IPCA 3V7YA 4YAIA 2X77A 1UOPA 2OTCA 3QTTA 4KSBA 4YAFA 5IM4A 4BWGA 1QWSA 2ECKA 2PQ0A 3A11A 2E1RA 3ZD8A 1K3FA 1GUFA 2WIJA 3LPLA 1YZUA 1VMIA 2DKFA 2DU8A 3A10A 4I50A 5AW7A 1IVYA 2DFPA 2GPTA 1QH8B 2A0FA 1CT9A 4ZYYA 5HF6A 4O5OA 2LKCA 3ITDA 5K8VA 1QO0D 3DXXA 3B51X 1W29A 3MBIA 5KCMA 4R9RA 5BUQA 1O58A 4JUIA 4D7AA 2CKMA 1F8GA 2W4MA 3RM3A 4H7HA 1H93A 1UFVA 4IMPA 1QK5A 1X7WA 2EZ9A 1V35A 2JGMA 1N34B 3DT9A 1E0KA 3PL1A 2CVPA 3W8EA 1YU6A 2Q4EA 5HFAA 1G8PA 5HF5A 4M0PA 4B4VA 3E03A 1ZCBA 4YAUA 3PF9A 2RAUA 3DV9A 5BQFA 4MQEA 2FEPA 1FW8A 1WF3A 1T4DA 1ZESA 2O20A 3DEIA 3PCXA 4E2YA 4DR2B 2FN7A 4HLNA 4X20A 4CI0B 3D6HA 1WRBA 4J43A 2HOQA 3L8YA 2GA8A 1K7SN 1E1QD 3LQQA 4ZK2A 3OCXA 4RQAA 1HSZA 2HHCA 5IT4A 2BTQA 3ZW8A 1I4DD 1S96A 2YNMA 3R3ZA 4R3WA 2HEIA 1W9HA 1G8FA 5GV7A 3WI7A 2VT3A 3A3KA 2LKDA 1TTQB 3ABZA 3RYFA 2HFKA 3OC0A 2I2DA 4IHJB 2ONYA 1JLMA 4TLAA 5C8YF 2ZBRA 1NI3A 2HTFA 1V3VA 3M1LA 3PWTA 1W34A 1ZICA 5EUBA 4B45A 4KXVA 1N57A 2PV7A 4TTAA 1HG0A 1CU1A 4IWYA 2NXEA 1KYZA 2HLNA 2IKSA 4OM8A 5DP2A 1SFRA 2QZSA 1J5PA 2GEBA 3KTAA 4H35A 1ISSA 4DCGA 2HREA 3X1KA 2FLVA 5JDIC 2PYZA 1Z2EA 3RBAA 2G0NA 4CF7A 1TIBA 3PE6A 2V8BA 3IUBA 3TGPA 2W93A 3OOSA 2ZETA 2CWWA 3H1FA 4HG2A 5BPFA 5T6MA 3EYAA 4A6EA 3NIBA 3FDFA 2FWIA 4QATA 5FQOA 5IKMA 4QGBA 2AWOA 4QFBA 5CW2A 5EWLB 2HSEA 4LE2A 4U5QA 5J4VA 4EHJA 3CR8A 3QPUA 3RU3A 3WHIA 3FR8A 4I50F 1CIPA 2REOA 3BD6A 3W05A 3KJQA 3C7DB 4OFWA 3GNSA 2DJIA 1MG0A 3OO0A 1TZMA 4C4ZA 1E6MA 3KD2A 4H77A 2JASA 4CLHA 1GUDA 5TEVA 3T5DA 3JR7A 4ALLA 1WJGA 2X2OA 4DLUA 4K9MA 1X87A 3W7BA 3T5AA 3WRYC 5FAKA 2ROQA 1VJTA 1U28C 2VYVA 1FQOA 2YWRA 3K8ZA 4G5GA 4H08A 2CCJA 4Q24A 4C4RA 2ZSEA 1U7TA 4NHOA 4ITVA 4PGFA 3HZHA 1D4ZA 2WJGA 2F55A 3LX6A 1KMHA 3H4TA 1B76A 1KMCA 1P39A 2JPDA 3I83A 1VZ3A 3V8PA 1KJQA 4D98A 5EIXA 1FZTA 2V8OA 1JG2A 5H0IA 2E4YA 3T3EA 2B92A 5CDSA 3SS7X 2C78A 5EZYB 1D5CA 2XRYA 5BQ5A 1DZIA 1YB2A 4MHOA 5AW5A 1WPGA 1C41A 2UZ4A 1Z7WA 1XFAA 3URKA 3IXMA 1WPXA 1JFLA 1I32A 3M3PA 1RWQA 1SB9A 4JBNA 4MQFB 5AM4A 1Z4NA 2QBYA 1V6SA 2QYSA 4UAVA 2Q49A 3M7IA 5AO9A 1SCJA 1V5EA 3QE3A 4AYXA 3ZBQA 4YR7A 4UU8A 5DYNA 2Q45A 2PXXA 2R8EA 3QUCA 1UPCA 4ZQEA 3QYFA 3RVNA 1BJRE 2IQIA 1WABA 4W5TA 2Z9DA 3QOWA 1KRHA 3MCZA 2GKSA 1INLA 3ZWXA 4BQEA 5BSWA 2AR9A 3WYDA 1JJVA 2LBPA 1E3WB 2W8BB 3L0BA 1SZCA 1XTVA 1EHYA 1GV0A 1VOTA 3AVPA 3ZU2A 1V48A 4OUKX 1A4UA 2WM8A 4HBZA 1MOZA 3CR3C 3E9CA 4FCVA 4N7MA 4BJ3A 3NRBA 2XXAB 2CVFA 4BJ5A 1T4BA 5JALA 4K9NA 3HRKA 2KBFA 1Z82A 4XDYA 1RYDA 2BY4A 4OFBA 4BEJA 4ZQHA 2R6DA 2ZYGA 4AAYA 1XPUA 3JD0A 3X43A 3F0TA 3F46A 1BS2A 4M9XA 2R62A 3AF4A 1SULA 1ZSYA 1OWNA 4HGNA 1UMBB 4J8PA 2VFAA 1LI4A 2VIIA 3GRUA 4P5DA 3GT0A 1JR3A 4GU5A 2FLWA 4WN9B 3WNVA 1HDGO 4J1TC 3WSTA 5DXJA 2PKYX 621PA 4Y3UA 3UJPA 3SXUB 3A14A 3RRZA 3D8BA 2C2OA 2QYTA 1DL5A 2BTOA 2H5IA 1XU4A 1ZC3A 1A5AB 1JSRA 1LVUA 4PONA 3UCEA 5KC8A 2VPZA 2IUSA 5K0NA 2OSBA 1LNZA 3NDBB 1QHXA 1WNFA 3O92A 3TLAA 3JS5A 3NDIA 4FXOA 3TOVA 5ADHA 3PGA1 3ZUPA 3BXEA 1BGXT 1DLJA 2ZI3A 1UAAA 5FI3A 4DR4B 1WF6A 5LZ2A 3V6LA 1SKBA 3RO7A 4AUMA 4ZGWA 2C5LA 1GPNA 3V1MA 2VOJA 3TEJA 4LJ9A 4AJ1A 3HG7A 2CNWD 4G2TA 2X0NA 4LJ8A 3M1YA 4G4SP 4DAEA 4ML3A 1RXIA 4XSVA 2CNOA 1O97D 1CJMA 2C82A 1PJAA 2NO6A 4O4LB 4RFSA 1P2UA 4FN5A 4URYR 5CLHA 4GRAA 3PWZA 4E5UA 1JPVA 4OTZA 4RIEA 3G9XA 1JG3A 1ARZA 1CJSA 4W1RA 1UWLA 5CA1F 2ZSHA 2ZPUA 2QR5A 5A4DA 4OK3A 1FXWF 4F84A 2X4DA 1T1EA 5LDGA 3RS9A 2UUAB 2R8ZA 3KQTA 5EJEA 2FPGB 2R68A 3ZGNA 1Q7RA 1C9KA 1C1YA 2YXBA 4RKEA 1NMQA 1DS6A 3ND7A 1OI4A 3RS3A 4N6OA 1U2SA 1HDCA 4CM3A 4DCUA 3C16C 1N75A 2OHOA 1UQTA 3K9WA 2VDRB 4CIVA 2WA2A 2XPCA 2PCLA 1ZN7A 2O0KA 4B83A 3I6YA 1VJRA 1R0CA 4HAZA 4RIIA 3THOA 1EWVA 4H4CA 5AM1A 3L7KA 3UT5B 3UH1A 2ZM5A 1CBUA 1FTYA 2V7TA 3EVCA 2QAJA 4ND3A 3TWOA 2VF8A 1D2NA 1VCIA 3MQFA 4G84A 4CKBA 1KDOA 1SVNA 4DA7A 3TSZA 4Z9YA 4K9OA 2B3DA 2XSZD 4REMA 4DG5A 2IT1A 4YR9A 3SSAA 2H52A 2WFLB 3OLZA 3IT0A 4RDIA 4Q9LA 1NWCA 1IDN1 4N3CA 4XSHA 3T0FA 4C4SA 4DREA 2VHVA 2VWGA 1BVRA 1E7MA 5F52A 1QFJA 2VSOA 3TLBA 5LA6B 1KS9A 3VNQA 4EX7A 4KGXA 3NHKA 1CULC 2GJSA 4YS6A 2BHLA 1CUSA 2YBEA 3OTWA 4Y67A 3KJHA 2W6QA 1N4AA 4BQSA 2I6QA 2R6AA 1I6LA 2WRZA 4JXJA 5EP4A 4X7MA 4KAFA 2HO4A 3LOUA 2P7HA 2BLNA 1EDDA 2ZW9A 3RG8A 3I6BA 3FJOA 3UNXA 4BX0A 5KSPA 3D1LA 5KTNA 1ZNQO 2HRZA 3RASA 2ZATA 2FG7C 3CO5A 5DNCA 2HMTA 2AJCA 2ORED 4H0FA 2XKJE 4G65A 1JRLA 1ZKMA 4ASUA 3WR5A 4TS3A 1PLJA 3ZWBA 3PFFA 3ZWCA 5AUOB 2J9ZB 3W8DA 3A6ZA 2VP0A 1KP9A 3IV6A 4UOEA 1BX3A 1ODCA 3L8CA 2QNRA 3ENZA 3VH2A 5AW4A 1RJFA 4JSYA 4IIVA 4UREA 4XVHA 4FT2A 1MEEA 4A5OA 1GZVA 3UKJA 2C88A 2X8JB 3NVAA 3IP7A 2VTDA 4E6EA 3L7OA 3V32A 3QKUA 1OC4A 4ZDIA 1EP9A 3OPYA 4B3RB 1JBEA 3BIWA 2IY9A 3MC1A 5EYPB 2CNKA 5L9AA 4Z9BA 4NH0A 4ZJYA 1Q7TA 4KREA 5E9WA 3GNLA 5LP1A 3TQTA 4AMVA 4C20A 5KQRA 4ZZ1A 2NU8B 4GPEA 3JQPA 1OWPA 2JHFA 2CUTA 4A7PA 1Y5IA 1Q22A 1KI3A 3A1UA 2PX8A 2E2WA 3D3KA 3QV1A 2EERA 3GGDA 3S29A 4DQVA 3C3MA 3ZIUA 3B1FA 4Y6PA 1NNEA 5F33A 5JEDA 1AHHA 4AY6A 3IHWA 1VL2A 4UC0A 4CEIA 1KYQA 3COZA 5D5QA 1MOPA 4HDNB 1QORA 3RTGA 3VPSA 5K01A 2WHPB 2JFVA 3L9WA 2ZJ3A 5L95A 1KFEB 3PHLA 4KFRA 3M33A 1DBVO 1R0BA 2IYNA 4M99A 2ZT8A 4IGKA 4NBSA 5BRJA 2JI6A 1AZTA 2VJLA 4O4LF 2Z5FA 3OZEA 3UAGA 1U0OC 3NRCA 3DAPA 5H16A 3I3SR 1D6NA 3TZEA 1VSTA 4INAA 1W94A 1NWHA 3LO5A 4PF1A 1JQ5A 1G20E 1P3Y1 3AF6A 3URMA 3OHSX 1B0PA 1PEKE 2FKNA 1PQ4A 4AWAA 3Q5GA 3E9EA 2CMGA 3ABIA 1CF9A 1IOLA 2GH1A 1UP7A 4KXUA 4OMFG 4CIDA 2D13A 2VNAA 1PSDA 4DMMA 1U2PA 2F59A 2YHUA 5GGXA 4ZYXA 4ZAGA 1GL6A 5B64A 1KYTA 4Q9NA 2VJCA 1YR9A 1UZAA 5IAGA 3UA3A 3V8MA 1DBRA 3D2LA 3KAPA 3OJ0A 4V2UA 2WU3A 1T3SA 4TKMA 2WQ7A 4FHEA 3IVAA 5F9HA 5CB4B 2A0KA 3U7QB 2V1XA 2X1HA 2X6TA 3H11B 1L6RA 4IIUA 4RDXA 1KE2A 2VATA 1WVMA 3HB5X 1JDBB 1DQRA 2NYRA 3AESB 3EZ7A 2XEXA 1F1JA 4NU0A 1KU0A 4JI1B 3IIEA 4ENQA 2PUDA 5G2OA 3FPFA 3IP9A 2EV9A 1XZAA 3L0YA 2H3HA 3PQDA 4CKEB 2OE2A 3MRSA 1KVTA 3B1KA 2QLLA 3OPYB 3LKDA 5EMMA 1UDBA 2PK3A 1FVXA 3JD1A 4BGIA 4AROA 4CW7A 3S68A 2NVUB 1IG3A 1ZM2A 2ZSUA 3NT2A 4X1YB 4BDSA 1ECGA 1NUPA 1IH8A 3UG7A 4Z7NB 5IDWA 3K1ZA 4LDJA 2X58A 3ZLBA 3KKEA 5BRAA 4N82A 1YS7A 3KQHA 2H9YA 1NAHA 2H08A 2VXYA 2HMAA 4MJLA 4H17A 4C3UA 3UFXB 1RC0A 2WU4A 1RRFA 1HZZC 1PL7A 3MJEA 1XBTA 4W99A 4BP9A 4Q3DA 4EEKA 4WPGA 4CCYA 4XH9B 1FUKA 2GXQA 3PGXA 3O8OB 4YXWD 4XIGS 1OBOA 5BSGA 2ID9A 3GLTA 2UYOA 2WY2D 2B4AA 3RSLA 2GM3A 2GBPA 3EQ7A 3GARA 3HB7A 4KEAA 4TMXA 4B7CA 3NNDA 4F7WA 1UDCA 2XKAA 1RFGE 4GLLA 1A5TA 5BVHA 2CXUA 2QUAA 1ZRNA 4YRPA 1Y6RA 1CVIA 4YRGA 3PQ5A 1RXSA 1JEQB 5A3SA 1XCGB 2QR2A 4EGCB 3L4BC 4L8WB 1WB6A 2Q1YA 2GXSA 3NBAA 1G2PA 1FRQA 3AF5A 4L0MA 4GRDA 5C18A 1DKPA 1JFSA 1B6SA 1ISGA 5AH0A 3ZK7A 1H4SA 3TBKA 2P5SA 2D62A 3DZJA 2YQ4A 1E0SA 4IHJA 5F9MA 2C83A 2PUCA 4PFQA 4R2HA 3Q7RA 4ARZB 5A6SA 3QTBA 1CUFA 3QE0A 5KDOA 4L02A 4OF4A 5A0VA 1PR2A 1U0SY 1MX1A 4OBEA 2IYXA 1R9NA 5CMLA 1J0AA 1JTVA 3TNFA 5DLPA 3GWGA 3GZ4A 3VC3A 1U8TA 1JF8A 4X20B 4ZQCB 4Q9JA 2PTGA 3FUVA 4FQ5A 4M0FA 1MIOA 1EVIA 4UM9B 1QZ3A 4EB6B 4NU8X 1YRWA 1MT3A 1PUXA 5IAJA 4B3GA 1BE0A 1S2OA 4L8LA 5KB3A 3ZS9A 3SHOA 2CXHA 3OCVA 1ZAKA 4MYTA 5TARA 3IQEA 3UBMA 4XWAA 5AUPB 3NUGA 1V3QE 1Z7YA 1NVVQ 1YJ8A 5KYVA 1TKBA 5JIBA 4XYGA 7ADHA 4PU0A 5ER6A 4MUEA 4XD7A 1DCFA 1KK2A 1QV6A 2D2FA 3MHPA 3JX9A 4BMOB 1YGPA 3SDBA 4WECA 3DD1A 1NVUQ 3F8SA 1H2EA 4EZEA 3VBEA 1RACA 5AKKA 2QU8A 2Q5JA 3H05A 1UK9A 2Q28A 3KJEA 1IXZA 2XWSA 1TF2A 3QLEA 4QO7A 4EKGA 1SQSA 3QY9A 4AUKA 2QPOA 4V02A 3HZOA 3X1XA 1L5QA 3F8TA 2OPBA 4QUEA 4BIMA 5C4MA 1NW5A 2VYFA 1YK1A 4A6DA 1M9NA 1NUSA 2Y1WA 4NCNA 1P75A 4I1IA 2KX7A 3M81A 3ZQJA 5EJMA 3IPLA 4PQGA 3RYIA 1U2TA 4J2OA 4W63A 5T3UA 2ZQYA 4M9SA 2PJDA 5BQPA 1GYQA 5H1YA 2XUHA 1G17A 3I1YA 1OLSB 3RJMA 2BWJA 2F3RA 3QHQA 4Q3AA 2QSJA 3M1AA 3MELA 4NBTA 3LBFA 1KK0A 1NG1A 1WXDA 3CF4A 4YY3B 3OQMA 1A5BB 2W6MA 3SHQA 4C6RA 3K6SA 2YIMA 2BCEA 3CEPB 1T8RA 1KZ9A 3IO3A 1HRDA 1UANA 3CWQA 2CNLA 1T4CB 5DX1A 5KDDA 4FI3C 3L8DA 2J5RA 3NHAA 4P0QB 1A1SA 2J9RA 1V26A 4OB8A 2IY8A 2MYPA 3P20A 4FEGA 1I80A 4MYSA 4TQGA 3TLEA 3KZCA 3KL4A 3G85A 4HH1A 3FNRA 3K0BA 1FLDA 3IOMA 1BFKA 2I8LA 1QKJA 3C5EA 2ZWPA 3FUXA 3KSZO 2CXXA 3DFFA 2A9KA 2AEJA 4Y9RA 1STOA 1UZLA 3UGKA 1DWOA 1H5QA 2Q1UA 4K87A 2CSXA 1A9ZA 4LQCA 1Q0PA 3S28A 2OAP1 2GOYA 1UEJA 4KACA 3UUEA 3M83A 3PUVA 1RE1A 1Z26A 2X9QA 1V71A 2R48A 4TMKA 3R7AA 3V6MA 8MHTA 3BL6A 4TS9A 1F0NA 5ITWA 4LF7B 1XRJA 4RHXA 3DAFA 4EGJA 5FBVB 5JEEA 1LKZA 2OHFA 2C7GA 5CGZA 4MEJA 1WBBA 2SKCA 2XDYA 4E5NA 3ZHXA 2NQ2C 5CB0A 3GF4A 3IEPA 5G4LA 3VZCA 1QGUB 3TD9A 1U0NA 2ODBA 2R65A 3EODA 4MKHA 2Z5VA 1N2CA 5CDYA 5KU1A 1LXCA 4C2BA 2R47A 4OG2A 3O75A 1G38A 1AGXA 2OORC 4HD8A 2C29D 2IU6A 4KQ9A 4KQEA 3BMXA 2VK1A 1EDBA 3OLXA 1PWYE 1T2AA 3DEFA 1RJEA 4HAVA 1TW3A 2WAYA 3CLSC 3ID6C 3NGXA 4ZMRA 2F00A 2OD2A 4NQZA 3CNBA 3QEMB 4MUJA 1NXPA 2DQ4A 2HY7A 4YJ2F 4DLNA 3T7JA 1EUCA 2YASA 4AG3A 1AMOA 4FILA 1R0WA 3ZXXA 4EVQA 2WKPA 3HCAA 4R7GA 1N0HA 4Q1BA 2Y99A 3TUIC 4L5CA 5GM2A 2VLIA 4C4OA 4R8MA 3MS4A 4YCCA 2A9OA 4RX1A 1EFRD 3A4NA 4YO7A 3NHUA 2ZU6A 1VBMA 1JMYA 4D44A 2GCOB 4P6VF 1LB1B 3UMJA 5KYXB 2W2LA 3C74A 3ZXSA 3IBYA 4V0KA 4A9AA 1GRNA 1EGVB 4CI9A 1BC5A 1XD8A 1NFRA 1OLXA 1R6BX 3D6TB 3O3NB 5JTTA 5BYBA 1PTJA 3IILA 1M2JA 3FBWA 1KZ6A 3E2IA 3EQ2A 2NU7B 5IDXA 4IJWA 5DN9A 1U0FA 2PVPA 1G3UA 5HP4A 1XTIA 4HAOA 3UUGA 4U7FA 1WCV1 1AUPA 1JSCA 2RIRA 2ZS8A 5JASA 4H3HB 4AJ2A 5ALFA 4YDRA 1KNQA 3KJGA 1IZZA 2CDRA 3A70A 3EGVA 3PI6A 4PAQA 1U0HC 5DCLA 1QGAA 3TRFA 2QE7D 2AJLI 2QTGA 3WMGA 2XCTB 4LRTB 3NDRA 4LQLA 3KZ1E 4HO1X 1T5IA 1PVDA 3DOFA 4IOJA 2OM2A 2F62A 3PXGA 2CLOB 1ZD5A 3KM0A 3B20A 3L7CA 2XQKA 1W1WA 2HK9A 3QBJA 2IZ7A 4LTMA 4M37A 5A9RA 1IBLB 1JEQA 3O2QB 3GN1A 3DUWA 5EUQB 5I6DA 3E0QA 3K0CC 1Q0HA 3EEYA 3QK7A 2WIBA 4DZRA 4KB5A 1WPRA 2Y4NA 2P9QA 4Q4DA 4RAOA 2E18A 2V65A 3IDAA 3EULA 5DXAA 3FCUB 1PHRA 1RS0A 4ZU3A 1RE0A 2ZBFA 1Z5PA 2XODA 4F5DA 1VQ1A 2EEZA 3N28A 1YZNA 2AK3A 3N7AA 4WDRA 3HVKA 4MV5A 4GHWA 4TWJA 2NMVA 3ZN2A 4E09A 3HA5A 1H1DA 3SVLA 2ZRJA 3IQDB 4B3SB 5JD3A 2HIAA 1E2EA 2Q3CA 1JE0A 4YT5A 1KQGA 2AG8A 1L5RA 3VZBA 4W7SA 3ZW9A 4EW6A 3ZD7A 2P6PA 3OQIA 5EUCA 5TVKA 3DH0A 4J4TA 5LZ5A 3UWDA 2NVUA 5AI0A 3KHUA 3RVMA 4BIIA 4S05A 5FEMA 2PSSA 5D3ZA 3DOJA 1V8FA 3GK3A 4ZALA 5TPWB 3TM5A 4OUDB 4DQ0A