2Q7OE

Structure of human purine nucleoside phosphorylase in complex with l-immucillin-h
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
284
structure length
284
Chain Sequence
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title L-Enantiomers of transition state analogue inhibitors bound to human purine nucleoside phosphorylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 75
structure length 284
sequence length 284
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q7oE00
4R2WA 1V48A 3ENZA 1Z5NA 1TD1A 2A0XA 4OGLA 1PF7E 4TYMA 1SD1A 1PR2A 4WKBA 4TXHA 4E1VA 1RXCA 4TS3A 4QASA 4ECEA 1A9TA 1CG6A 1WTAA 1JYSA 4LNAA 4I2VA 3OOEA 4KN5A 1TGYA 1U1FA 3EUFA 3U40A 4D8YA 2QDKA 4L5AA 3K8OE 4D8XA 4QARA 1SD2A 1V3QE 3LA8A 1M73E 5CXSA 3NBQA 4RJ2A 3BGSA 4F2WA 1K3FA 1VFNA 1LV8A 2QSUA 4L0MA 1U1DA 1V41E 1YR3A 1RXUA 1PK9A 1YQQA 3UAZA 1JDTA 3OCCA 1ZOSA 1Z5PA 2B94A 1SQ6A 3BSFA 4NY1A 4DA7A 1LVUA 1QE5A 4D98A 3EUEA 2HSWA 4TTAA 1XE3A 4UC0A 1TCVA 2QTGA 3NM6B 1PKEA 1CB0A 4R31A 5FAKA 3PNPA 3FB1A 2A0WA 1PR6A 4YNBA 2AI2A 4F2PA 1ODKA 4QATA 1Y1SA 1TCUA 1B8OA 1RT9A 3OOHA 2ISCA 1Y1TA 5F78A 4LZWA 3C74A 5F73A 1PR0A 3KU4A 5B7GA 5JPCA 1A9PA 5CYGA 4D9HA 3EEIA 1JDUA 4YMLA 2IQ5A 3PHBE 1ULAA 3DPSA 4F1WA 5IU6A 4PR3A 4GKAA 3OZCA 2GUWA 5ETJA 3OF3A 1FXUA 1OV6A 1Z33A 1Z38A 2I4TA 1B8NA 4IP0A 1JE1A 3OPVA 1C3XA 1U1EA 2ON6A 3F8WA 3E0QA 3KUKA 5F7ZA 5F76A 1K27A 1ULBA 1U1CA 2BSXA 1ODJA 1Z36A 4OF4A 4TXLA 1T0UA 4U2KA 1V45E 4GMHA 4TS9A 1V4NA 1N3IA 2OXFA 4BN0A 3KVVA 3KVYA 3P0FA 4L6IA 1JP7A 3UAYA 3UAWA 2HRDA 1VHWA 2XRFA 1Z5OA 3INYA 4H1TA 1I80A 2HWUA 4QAQA 3ODGA 5F77A 1LX7A 3T94A 5CCDA 3DJFA 3TL6A 2QPLA 1Y6QA 1OUMA 1Q1GA 4MCHA 1PWYE 4F3KA 5CXQA 1A9SA 3FOWA 4BMXA 1Z35A 4TTIA 1RFGE 4R2XA 4K6OA 4OY3A 1T8SA 1TGVA 1RR6A 1Y1RA 1Z34A 1NC3A 3OZDA 3IEXA 4G89A 1Y1QA 2OC4A 4OJTA 1OTYA 4TTJA 3PHCA 4G41A 1A69A 4QFBA 5F7XA 4L5YA 3E9RA 3BL6A 3SCZA 1RYZA 3O6VA 3GGSA 1JE0A 5IFKA 5EUBA 1OU4A 1VHJA 2Q7OE 3FAZA 4WKPA 1ECPA 1T8WA 1PBNA 1Z39A 3BJEA 3MB8A 5F7JA 1PR5A 1A9QA 1ODLA 5KB3A 2AC7A 1K9SA 1ODIA 2P4SA 4DABA 3NM4A 4G8JA 2AI1A 1V2HE 5B7QA 1PW7A 5DK6A 4YJKA 4LNHA 5CYFA 4M1EA 2RJ3A 1YQUA 4D8VA 5I3CA 4BMZA 5B7NA 3IOMA 3UAXA 1RCTE 3UT6A 1T8RA 2AI3A 4M3NA 1JDSA 4P54A 3UAVA 4EARA 1PR4A 4PNPA 4MCIA 4JP5A 4YO8A 1JPVA 4OGKA 1OVGA 3ONVA 1A9RA 1YBFA 4TXJA 3DF9A 1YRYE 4DANA 4DA0A 4DA6A 1PR1A 4GLFA 3DP9A 3DDOA 5CCEA 5EPUA 2A8YA 3KHSA 1RXYA 2OECA 1NW4A 5K1ZA 3D1VA 1SJ9A 1NC1A 4DA8A 4NS1A 4L5CA 3O4VA 3FWPA 5B7PA 1A9OA 5EFOA 1RSZA 4WKOA 3QPBA 3NM5A 4TXMA 2OC9A 5F7OA 2H8GA 1VMKA 4TXNA 4WKCA 1G2OA 1JDZA 2HN9A 4GLJA 3LBAA 4DARA 4QEZA 2I8AA 3K8QA 2A0YA 3PNSA 1Y6RA 3KVRA 5C80A 3FNQA 4DAEA 1T8YA 3OZBA 1OTXA 3E9ZA 4X24A 4FFSA 3EMVA 1JDVA 4F3CA 3LGSA 4MARA 3FUCA 1ZL2A 4WKNA 4LDNA 4BMYA 4EB8A 3GB9A 1Z37A 4OEHA 4NSNA 4M7WA 3MMSA 2QTTA 4JWTA 4DAOA 3OZEA 1U1GA 4LKRA 1PK7A 2PGAA 4JOSA 3P0EA 1RXSA
chains in the Genus database with same CATH superfamily
1IY1A 5E2IA 5IJAA 4XM0A 4FR2A 2IU4A 4U2DA 3H42B 1X74A 2YTZA 3EZFA 2B5WA 5CVCA 2FW7A 3LSTA 3MMNA 3BFKA 3IQDB 3AB7A 3JVEA 3TCKA 2NTVA 3HPRA 3QOYA 1OHHA 4RH0A 4JH0A 4AW9A 4RXMA 3ID6C 3ANTA 3B7WA 3QU9A 3KDSE 4HAYA 5DCUA 3JSAA 2CNBA 3A1EA 3SN6A 3ZGNA 2NT3A 3V4LA 2HBQA 3N53A 4W7HA 4HV4A 3IE2A 4Y2XA 1Z6PA 4YJHB 2C61A 2RBGA 1DAGA 2P2YA 3KSUA 3NORA 3V6LA 1QK4A 3LVQE 3O4RA 3N8GA 1E79D 1M8PA 3I6BA 2OFPA 4KI0A 4WIAA 1ZZGA 5L3VA 4QELA 4RDIA 3EH2A 1SXIA 5D86A 1JYSA 2ZRLA 1JJVA 5DXJA 1C8VB 5LXTF 2B1QA 2E4ZA 1U3DA 3ZY2A 2J9GA 2XSZD 3H4VA 3VSCA 1FP4B 1TGYA 4HEA1 2JLCA 2W98A 4RO0A 1ZIDA 3H1AA 1GDHA 1ISJA 2CZQA 1RRMA 3T95A 3B52X 4I9HA 5C46F 2HRQA 5ED4A 1R15A 3HZOA 4JQSA 5LWHA 1SZPA 2OWEA 3MJHA 4XI9A 5FBLB 1QU3A 3E9MA 3PT9A 4QARA 4XUGB 1XL1A 1SRQA 3IO3A 2C20A 4LRSB 2Q4EA 3MB5A 1CNEA 4KQEA 1H4TA 3HBNA 1P9NA 2Z1NA 2KPOA 1U8YA 3R2JA 3R5FA 4GG1A 3NHUA 2R79A 3PT5A 3R7WA 2XUAA 1MVLA 4O2AF 2QJTA 4D80A 5JROA 1QR2A 5CLLA 1NBMD 1U1DA 2AKYA 1QUEA 1WXQA 2QUHA 3CG0A 5G2OA 3ZU3A 4CR6A 5EWJA 1UDWA 5L9AA 1N7HA 4R4JA 3AZOA 4AN1A 1T5BA 4F3TA 1TO2E 1E1RD 1LDGA 5BMVB 1EQAA 3BMOB 4WZ6A 4B48A 1N2JA 5ILQA 3OCCA 3M3PA 2VUHB 5TQJA 1W36B 2G72A 2VYVA 4BWGA 4EH1A 1R0YA 3T12A 3AUSA 4MQEA 1EQUA 16PKA 2G83A 1QDUA 4EW6A 2ZE6A 4MA5A 3RR2A 1GG5A 1I30A 1JRLA 4GPAA 4QUIA 3EYWA 1N57A 3LZCA 4O8CA 1HKUA 3NUZA 3VZQA 3WC4A 1PFVA 3W2FA 5JLAA 3SC6A 3HVRA 1U9IA 1E4VA 4RZXA 1I7PA 2I4IA 3FSJX 4MHTA 5CJ2A 1EP1B 1VA5A 1OGYA 2QTGA 3B2QA 1C3LA 2IODA 4WQMA 2LTAA 1B14A 4X93A 2YWDA 1XRNA 1CB0A 2XOEA 3KUDA 4PAGA 4BECA 1C3OA 4B7AA 3WYDA 3PQDA 4AKHA 5FLEX 1KJNA 4M0EA 1D1QA 1NHWA 2YNMC 1VCMA 4ML3A 1B4DA 3DVLA 4MAFA 4W5JA 3ZI7A 4DCMA 5J4HA 3HO1A 4LJ7A 2PT5A 3B13B 2BW0A 4RS4A 2VBGA 1NDQA 3EVDA 4PINA 1Z6TA 2QUAA 4QATA 1UPBA 1LF0A 3ITKA 4YRJA 1T5HX 2CD9A 2V5AA 3A1NA 3P52A 5AXDA 4CN9A 4EK9A 2C88A 5JTUA 1XBTA 1RM3A 4QEDA 1U2GA 3F67A 4V02A 1B76A 4D0GA 2E3JA 1FUKA 3GWZA 4DJTA 5B6IA 3HNPA 2P8SA 1JFVA 3B9PA 3MW8A 4LZWA 2JGFA 2HXGA 3M1LA 2G09A 3OVMA 2G82A 5F73A 4EMTA 3H97A 1E59A 2GEFA 4E14A 3HA2A 1NRIA 4H18A 4IHQA 1IEXA 3V2GA 3ISVA 1R4MA 2NZJA 2OO3A 2IL1A 2Q3HA 3BIOA 4QJ4A 3TZQA 4EI2A 2OCKA 3PX7A 1FNBA 2FFAA 4W8HA 4AJOA 1U90A 1VJGA 2I3BA 2ZAIA 4J0GA 1U2DA 1T9AA 4JWKA 5D5HA 1E5LA 3PHBE 2ZIVB 3E2MA 2D1QA 3LMKA 3RU3A 3TINA 1NN1A 3FPGA 4QDZA 1FTNA 3OTHA 2ODNA 3DLAA 2VC2B 3NPAA 4LOIA 4B74A 4F1WA 2WRZA 4YALA 3GRCA 4MP6A 1RQXA 5CW1A 3UFXA 4H77A 1JEEA 3OF3A 1GT91 3D6NB 3KPUA 1G8AA 2PZAA 1KOFA 4ARZA 5AVRA 5CNMA 1PFWA 4Z0HO 1JSRA 4UU8A 1ZM9A 1AB5A 1GKUB 1APBA 5LL6P 2YMQA 1XZAA 2CY0A 2HL6A 3DOHA 3G85A 5E2AA 5F3DA 3WLMA 4ES6A 5IAEA 3JRXA 1C3XA 3GCXA 3GUCA 3Q2IA 2PX3A 4KWEA 3CH4B 3V3KA 1LBEA 3NXSA 1TQDA 1EWQA 4Q9LA 1DOAA 4KNYA 1EFLA 4BO7A 3D4LA 1QXSA 2CB9A 4HH4A 2JLYA 3BJMA 5ALWA 1T1GA 4I1RA 3IQEA 1IXRC 1SUPA 2K7ZA 4AD8A 5AKZA 3I9V6 3SVTA 3MJRA 4XD7A 1ULTA 1K68A 3DKRA 1C9JA 3B38A 2BZSA 3KT0A 3L82B 5ER9A 4DV1B 2J8ZA 4QHSA 2D6FA 4G37A 4IYJA 3KUXA 5EJMA 1SOVA 1Z36A 3K3PA 4IZIA 5G0SA 4A2PA 3PF8A 1W5FA 1BW9A 2P4HX 2PRIA 4RMNA 2X6QA 4TUYA 1RWBA 1X1TA 3B3AA 2C1EA 2D0OB 1AY0A 2VHEA 4H9GA 4J6FA 1Q0SA 2B7CA 3TUIC 4LV5B 1GAWA 5H59A 1Z15A 4O4JF 2XT6A 3TCNA 2IYEA 3JQ8A 1P0FA 3KQMA 1E9BA 4OBEA 2HNAA 1N1DA 3ZHSA 2FK8A 2IXBA 3AR6A 3JASA 4HCJA 1C81A 2WJ3A 3L8CA 3I1JA 2DLDA 2O05A 3M8KA 3NKVA 4XQGA 5CCXA 1HT1E 4BLTA 4UDYX 1XZBA 2WIBA 3V7UA 4ZANA 4KACA 3K1YA 2IUTA 3FHTA 1Y9EA 2AF4C 2AGVA 1WWKA 3B89A 3EIOA 3P0FA 4HNQA 2FN9A 2FSIA 3T3HA 2XDAA 1VFPA 1SKAA 4DCOA 3MAAC 4BRWA 1I6LA 4LN1A 1IY0A 1KI2A 1WKCA 2WTEA 4D4LA 1QHHB 4ZMSA 4IZOA 4GZ6A 1OZHA 4EZIA 3T3NA 3AL3A 1E8MA 3LF2A 4YMUA 4MYRA 2QR5A 3IP9A 1QRSA 3I04M 3CLSD 4UM5A 4ME6A 5LOVB 3HY3A 2DP4E 3L7KA 1LCIA 3KQQA 3R7AA 3VR4D 5FOTA 1E92A 1ZIXA 5J3JA 1BHQ1 4G5XA 2ZAYA 1ORIA 1NOJA 1T91A 3N2IA 2R6AA 4ZZ1A 4Y2QA 1J2YA 1AO3A 3X2FA 5KOYA 2RMKA 4MV6A 4MDEA 1WRBA 1T6XA 1TYBE 2PO7A 3T1HB 2Z9DA 4RNCA 3MTEA 3UEOA 3P45A 4DV0B 2LRHA 1OLXA 1FFAA 4RIFA 4D81A 1W29A 1XV5A 5EHIA 5I7OA 1PFUA 4PFKA 1PYOA 2RG7A 2F4VB 3LNTA 4ZAVA 1GL6A 3M6AA 1HF3A 1GYPA 4HUQB 4AVYA 4PYRA 3FPJA 3DD5A 1FDRA 4PLFA 3H4IA 1NXVA 2QLMA 2GERA 3LPDA 2OXCA 2J33A 3S0JA 3FLMA 1Z35A 1ONBA 3FIUA 4IMPA 3FNEA 3SDSA 2YRXA 3IUNA 3I5XA 2FMHA 3SZUA 4YRFA 3VTZA 1Z6YA 2BI4A 2TMGA 4Q1VA 4RD0A 4C7JA 5IZCC 2ZBPA 3ILHA 3QHAA 2HK8A 4KDEA 4P32A 3TJMA 5LN1A 3HYRA 2KWIA 3NLLA 3TLGB 4IRXA 1Q77A 3R3YA 3KQTA 1IM8A 4GOXA 4O1HA 5IAOA 1EIZA 3GVHA 2OFOA 1EFRD 1EJBA 1S8NA 1A5AB 2Q1SA 5A6VA 1GL7A 3E8MA 5JBQA 1LK5A 1SCJA 1JHQA 2PAAA 3I2FA 3D6VA 1DCTA 3F96A 3R3SA 1YZ3A 3RTDA 4ZIRB 3V8NA 3ENKA 4EUSA 3RJ5A 4KUGA 1HNXB 4QYXA 4ZYZA 4LVCA 3R5XA 4RLFA 1P39A 1LKZA 1GDDA 5HDBB 3QKUA 2Q3DA 4WXEA 1K75A 5KINB 1A4RA 4ZI5A 1Q15A 2Q7OE 1NQAO 5HF8A 1ZONA 3WYGA 3N59A 4ZQFA 4CLOA 3CR3C 1N0IA 2AG8A 4DTIA 4PGFA 4DNXA 4ENQA 1XQ1A 1Z5ZA 3BJEA 3LGAA 1CD5A 4RDHA 2V6BA 4MP3A 3A04A 2ZULA 5F7JA 4F45A 2HF7A 1UM9A 1L5RA 4RYLA 5ELLA 2J67A 4MQEB 4NFLA 3GA5A 2Y0PA 3CV3A 4P4TA 4LOAA 2ZWVA 4EELA 2X5JO 5IKXA 1W73A 2EOAA 3D4PA 2N0SA 2G08A 4RMJA 2AC7A 3W7AA 2QUIA 2J08A 2WF6A 3L7AA 1NQ5A 3CJTA 1UKZA 1CNFA 3KQPA 1FU8A 2R2GA 3L5KA 1C1YA 2YMLA 5KYYA 4RHCA 3CUSA 3O47A 3RM3A 1GV1A 3FYCA 2V4MA 3CKKA 1SY7A 1BCRA 1HV8A 3P2MA 1QDLB 4LDZA 1PJRA 1G41A 1AZLA 3FUWA 1AGYA 4JFRA 4UNSA 5ALQA 4B3TB 3EVTA 3PX2A 5K4HA 4PF1A 4K6FA 4DLXA 2WT8A 3G9ZA 2M1ZA 5ICCA 3R4CA 4BCDA 3H9CA 4P7JA 2AYYA 4PG7A 1AK1A 1E7MA 2J3LA 1L7PA 3IKLA 2WT9A 3SM3A 4Q1BA 1CETA 3JYHA 4YCLA 1NSFA 3EPLA 4TL6A 4XFDA 2I3DA 3IKVA 3LX5A 4JKIA 4C6TB 2JKYA 2RHLA 3WLNA 3HEMA 3LD9A 5GVRA 5IW8A 4BZXA 1X7HA 3RHSA 1CC1S 1Z17A 1LLFA 3KR9A 3PEUA 3CO0S 3V1TC 2OKCA 1P74A 1R12A 2I7TA 2ZSEA 3CLRD 4QPDA 2O0KA 2H4XA 2R62A 5COQA 5CT9A 5AVQA 2IYAA 1ITZA 1AMOA 1PV4A 5BOSA 6ABPA 4WOJA 3O8QB 4JR0A 3HP4A 5ELXA 4UTZA 4HAXA 4NP6A 4BGEA 4M36A 1T2NA 1PWEA 2G5PA 1G9TA 2Q1UA 1GTJ1 2GCIA 2XNDA 2V6FA 1XCPA 2CK3D 3AJRA 3O74A 3VPDA 4LZPA 1VSVA 1XL0A 2ZSHA 3TXAA 1O4VA 4J03A 1EDOA 5FBQB 3J7AC 3EBPA 3NATA 1BA3A 1NVVQ 4MUBA 1PL8A 5JSHA 1JJFA 3K73O 4KI7A 4LOKA 4DL9A 2ZBFA 4DWWA 2HM7A 2WSIA 4HPWA 2WA2A 4ZOBA 4N48A 3ND6A 1JDPA 1JG2A 3EEQA 3BICA 2JLUA 2QHXA 4BQRA 1G59A 1GTRA 3SAJA 1RXYA 4TN1A 4IQ0A 4DDTA 5KO2A 2O8EA 4FE3A 1UFKA 1XLUA 2IRWA 3CNOA 4FMPA 1KWKA 3HC7A 4XVCA 3D3JA 3BEOA 1TUEA 4XSVA 2LDXA 4DTCA 1K5DA 3QIAA 1K6MA 3PCXA 3W6PA 3VI3B 3BKWA 5IK2A 5JCOC 4DIOA 4WEOA 3X1KA 1U8CB 1R88A 4ARZB 2GUGA 1JHRA 2LIPA 3SF8A 4DIKA 1CV2A 1K7YA 4PV7A 2BMVA 1MT0A 1Q7GA 4EX7A 2PGOA 2EEZA 3SBDA 1J99A 1FFEA 3GRYA 2A59A 3IERA 4LYGA 5LB4A 1KPHA 2Q9BA 1BYIA 2D5AA 4HC4A 3TEMA 4L15A 4UHCA 4YT8A 1JWAB 1P91A 2AWNA 3NM5A 2UZ3A 2WIGA 3I2KA 4GWKA 4JUCA 4BO8A 2HB6A 2QGNA 3PC4A 3FPCA 1FFWA 2OVFA 3ZWMA 1PDVA 3HV0A 1NAHA 2HLHA 3BTSA 2OC9A 3AJ9A 3CN9A 2YWFA 3C7DB 2HDWA 3OCXA 3OPNA 3CURA 3HJGA 3TBHA 1Q21A 3R9KA 2YY6A 4BVFA 1GR0A 3L49A 4WKCA 1USGA 3GJ6A 3K0KA 4NQRA 1AS3A 4N5DA 4P3OA 3T35A 4WKGA 1RLOA 4QU9A 4YYEA 2WQ6A 3RFCA 1N6LA 1NUSA 1GSOA 3B2EA 4AY5A 3VO2A 1N5KA 2IOFA 1JUDA 4F21A 4BE4A 2XH8A 5AUQA 2N1MA 2HCBA 5DGTA 3TQHA 1IAVA 1XDUA 2QRJA 4A4DA 2PLFA 1P8AA 3AUTA 3ELYA 4A0SA 3CRNA 3K09A 1UDAA 4KMRA 1FPMA 4W9NA 1U0RA 2DTDA 3EY9A 1HDZA 2IHUA 4ISCA 3ZE9A 2IU3A 1DOHA 4QVGA 1NXWA 1FMLA 4CT0A 1AQJA 3AJ8A 5ALYA 5ITZA 4N5IX 2HOQA 4O4LB 4EEXA 3SKXA 3U48A 4MXDA 3VI4B 3S28A 4Q3BA 1NVDA 3DMTA 1DELA 1S3GA 4GM1A 4NV1A 4R3NA 5JCPA 3D6AA 3E9ZA 2E18A 4B81A 2IVZA 1QBGA 3WO0A 1OY1A 2CXNA 4TS4A 3TCXB 3RVOA 4FFRA 2X9NA 3ZYZA 3GUYA 5CHYA 1PS9A 1E2QA 1G8JA 1TMGE 3I76A 4LJ8A 2HFJA 5IAAA 1ZN8A 4D9JA 3LXUX 1AN9A 1BMQA 4GOMD 3KVNA 1Z0KA 4K8RB 4F60A 1VPTA 1D4ZA 1UZLA 3IHTA 5EZ5A 4DDVA 5KOHB 2WB2A 2BFOA 4M53A 2MYNA 1NU8A 1P44A 1SIOA 2FDRA 3EZNA 4NBKA 3EOBI 2QD1A 2X4GA 5DM60 1VKRA 2BKEA 2FZKA 1QVWA 1NM5C 2BGTA 5K2MA 1U1GA 1E0KA 1JFFA 4XSGA 3EXEA 3OPXA 1QLHA 4RF5A 4BO9A 3BREA 4I5EA 1MZVA 3WB1A 5D7NA 1YS6A 3V42A 3E7WA 5F9FA 3OLQA 3U7QA 2X14A 4G5RA 4LZAA 1ZFNA 4EYQA 2I87A 4GRAA 1QHNA 1P9RA 5AK3A 1P2TA 1NVEA 4UASA 4EI8A 4AY6A 1PD1A 1ZBDA 2QX9A 5B3JA 1HLGA 3U5ZB 1RYHA 1BGXT 4EABA 1Z06A 4LPKA 1DRJA 4MR7B 1SUBA 2J0UB 2MSKA 2WSSD 4FB5A 2WVAA 4AJNA 1T0HB 3C8ZA 1RCUA 1NDUA 1YJCA 4YRCA 3DPIA 5IBRA 4GHWA 4BJ6A 3L2OB 1T2CA 1VCOA 4YRAA 1W36D 5HJ2A 5CT8A 5KYWB 4MW4A 1NW3A 4NDZA 4YJFB 1FLAA 3FDZA 4CN8A 4BP9A 3A9CA 2ZIXA 3H99A 4EW3A 4U7DA 2W9XA 1FJ2A 1VSUA 2ZYDA 4FFVA 2QE6A 3NBUA 2XGSA 4G97A 4YBZA 1G63A 3HWX1 2F9MA 2ZB2A 3U7GA 2JI8A 3GAAA 3Q3VA 3EUFA 3TMKA 3WP1B 4MHSA 3SKYA 2DY0A 4PGAA 1N6HA 2I3AA 1J1UA 4D8YA 3F4KA 1YQDA 2WJVA 4P4GA 4EEZA 2H2FA 2QG4A 3V9AA 3KEFA 3R6TA 3LA8A 2QX7A 5GZ3A 1AGRA 2B82A 2FWAA 2PKYX 1Z07A 1TKRA 2DPLA 2Q8NA 3BGSA 3PDHA 3R76A 1ZJ6A 2QL9A 3A32A 4NCHA 2J3JA 3ENQA 3I2IA 1FFXA 5I7WA 1LV8A 3GHHA 1YI0A 2Q3MA 4Q3NA 5A5VA 4EKYA 1XDZA 3OZUA 2I2XB 1J7JA 2JGMA 2IEGA 3ER9A 4YO7A 3R3XA 1C30A 1Q7EA 2UKDA 5K5EA 2GPJA 2ABWA 4F6RB 2QPTA 1OPRA 3UAZA 3I0MA 3CFYA 3WGIA 2EW2A 2JFYA 1TIPA 4U7HA 3GUZA 3UV6A 4GL2A 2F2TA 3UXEA 3WYAA 4N41A 4GPTA 1CQJA 1MPTA 4NCAA 4DYDA 2VJQA 2WK1A 1GQYA 1ZGHA 2QW0X 3UJHA 3JYQA 2W6IA 2ZJ2A 1JI0A 2X6RA 1WXGA 4R8RA 3SIXA 4AXBA 3LXRA 4QXRA 3D3QA 1HLFA 2VDWB 2GRUA 4RPKA 3WOHA 3OAAA 4X64B 3KETA 1VIVA 3HCRA 2H06A 4I2NA 4YV0A 3RS2A 3NETA 3B3JA 5DRTA 3MK31 1YU6A 2YW2A 3UQYS 1R6TA 2QGZA 2C7VA 4MQLA 4G23A 4NK5A 3H2KA 4WX2B 2Z95A 4NQZA 1XVLA 2P91A 1TCVA 4M55A 5LNK6 1XNHA 2RGUA 2ZLBA 2HCFA 3NWBA 5J4YA 1KFKB 4DUGA 1S5PA 4OAOA 2JZCA 4LISA 2PPVA 5A1TA 1DDIA 1X39A 1K89A 5TJ9A 1GNSA 4TV9F 2P9TA 2XF8A 2FSSA 3RFTA 1M5UA 3FOZA 1LNSA 2A0WA 2PZJA 5THQA 4ESVA 4YN3A 4QOFA 2Q4RA 5B53A 4R98A 3HXKA 3MTJA 4QNMA 4KW7A 5C8VA 4HWTA 4MR9A 3K32A 2ZWMA 1CR1A 1CEQA 1P2FA 3GIWA 4MV7A 2ZZMA 2QVXX 4J07A 1OAAA 5DNEA 2B35A 5FTWA 1M76A 3L6CA 3JQQA 4RZSA 4CTJA 1Q7RA 2MYUA 2ZJ8A 3OIGA 2GZ2A 4HWKA 1KO1A 2QQGA 3UJAA 4JI3B 5K20A 3NYQA 3QY0A 2VHVA 1XKQA 4ZEWA 2R1UA 4FDUA 4HRYA 2VYCA 4BQPA 1PHPA 1E98A 5K3AA 5IULC 5DN6A 1YJ5A 1IJEA 2EKQA 1KEUA 1VBNA 1F0KA 4HFNA 1M83A 3A6HA 1I5RA 2CMKA 1TMOA 1Z4NA 1ZEJA 2IPNA 3O3CA 3RRYA 2I5PO 4IS2A 3E70C 1WJGA 1SPBS 1KAQA 3TTXA 3CMMA 5HMLA 5IDQA 3WMFA 3G2NA 3A3NA 1NY6A 3H5LA 2X3YA 5J4LA 2P9YA 2H7YA 1TF5A 5JWHA 4A10A 2Q2QA 4W9RA 2C04A 3LQQA 2VBIA 3UXMA 3L1IA 1AM4D 1HYGA 1I2CA 4LBZA 2QV0A 2EBWA 1ZM4A 1FP6A 1RPTA 1XG5A 2CL6X 3DVAB 1N5JA 3JQ9A 4ZOCA 3IEIA 5IU6A 1NBOA 3MJEA 2IYTA 3KR1A 2D4HA 3FKSD 1ND5A 4PR3A 5ES3A 3DCYA 2POQX 4CM4B 3VH3A 4TT3A 1GGHA 3BKXA 3FR8A 4MGZR 1TZCA 1OV6A 1VKOA 3E0XA 3JQ6A 3P19A 3V8EA 3JCZA 1ABBA 2JH3A 2OHIA 3QUAA 4P82A 1SXJD 1RYEA 1QVZA 4UEQA 5I9NA 2R1VA 3WKDA 1D2HA 3ACBA 4JN6B 4UM8B 1VJRA 3IJ5A 4URYR 2D4AA 4X94A 1O03A 3RK0A 4PRYA 1XZJA 1SELA 4O1IA 1RJDA 3T4XA 3H16A 1FX0A 2IY8A 4NYMQ 4XDZA 1PI3A 2CBGA 3HI4A 2Y1GA 3KKZA 4QSHA 4N82A 5A71A 4ZMBA 1KZHA 4Z4CA 1N0VC 3IBCA 2UXDB 2FEMA 4KYTA 1UBTS 4XIJA 1K6XA 1LLUA 2BEWB 5IP5A 2YWRA 4DY6A 1AV6A 5F2KA 5KREA 5IJ0B 1XVUA 2HA2A 2H1SA 3A9UA 2HT6A 2Q4TA 5F35A 4CTMA 3R5TA 2QVGA 4Z49A 3O7MA 1XDGA 2IUFA 4NESA 5KSZA 3T4EA 5EJGA 2B6NA 2CMFA 2ZJZA 4GQAA 4OX9Y 2JGKA 1U7OA 2G4LA 2UUCB 3PLNA 5DNUA 1LRKA 1R5NA 2QZ9A 4P36A 4LXGA 2BM8A 2F62A 2YIDA 3KKLA 2GF0A 4JEIA 3DZ8A 3ZU2A 2VIIA 4U2KA 3LUAA 3A1CA 2OLJA 3QEJA 2IH4A 1R0SA 4FONA 4F97A 3EVZA 2BGKA 3MC1A 1W93A 3EVEA 1N2XA 4HUJA 2C4VA 1QANA 1E1LA 3G1WA 2WJWA 4NE7A 4R2HA 1U31A 1F2DA 4O8ZA 3S2GA 5JVDF 5BW5A 1A8QA 5TY0A 1KAHA 3M33A 3HP1A 1U28C 4QWWA 4MR7A 3L1KA 1XZDA 4H27A 1P7PA 5D3MA 4P3PA 3EEOA 1JZQA 3NHSA 5JMTA 2HBRA 1JJ7A 1ZL0A 3I42A 1YZUA 3BCRA 1SHJA 3KJHA 5FNVA 1T3TA 1KMNA 3DMYA 2J3QA 2OQ2A 2PRJA 1E3LA 2XMDA 2R6GA 4ZAWA 3AFMA 3EXEB 3MA0A 1GGJA 1K66A 4MRAA 5C1BA 4ZAYA 2O3RA 4MUIA 4W5WA 1CQIB 5DULA 4FN4A 3CR8A 1TK3A 1V96A 1XIVA 3QEBZ 1XN1A 2ERCA 1BYUA 1NLUA 1S2OA 2IV7A 1QJCA 2FZWA 2HIGA 4B46A 2QPLA 4QJBA 5IT5A 5J1TB 1V25A 2FW8A 2B3DA 3WFJA 3M5WA 1U5CA 1FY2A 5AR1A 4CI9A 2J0UA 3TW0A 4F3KA 4TLEA 2OA0A 2AQKA 2PPLA 2REQA 4KIJA 1MHPA 2J3MA 2XMBA 1CQPA 1IHPA 5KC9A 1WCIB 1CYEA 5BOSB 3KXPA 2L19A 2GD0A 4O5OA 5BSUA 3IUEA 1NC3A 3S40A 5LPNA 5ECDA 4PYJA 1XZEA 3KAQA 3RQIA 4LE1A 1CJTC 5SZHB 3CRW1 4AJKA 1MABB 3EEFA 5DLDA 2H4JA 2FXIA 2I6QA 4EFLA 4UW9A 2GILA 1KFBB 2PMFA 3DA8A 2GZ1A 4FK8A 4NCXA 5EJ4A 5JJCA 5IVHA 2QE7D 4ITRC 1O57A 1UKCA 4BOYA 3I61A 4G5HA 3TSAA 3OIVA 3DR5A 4Z8YA 4EY6A 2GZ3A 4LVUA 3PPYA 3UKDA 2UYCA 1K3TA 1IZYA 1KYXA 4HAZA 5FV4A 2H00A 1EG2A 2EFCB 4RMHA 4BS9A 1U7PA 4FX2A 1LWNA 3C1OA 3F5FA 5EMMA 4W9MC 2C5LA 1R5BA 2LIVA 2QTRA 3MTAA 4R2IA 2H2HA 3P8ZA 4BO3A 2VSYA 2NW6A 4ED9A 5JFGA 2AUTA 4N5NA 4Z8XA 2RHWA 3R7DA 3KLBA 2A92A 4QX6A 4NPAA 3LY9A 2F3PA 4EHJA 4EI7A 4BTVA 5E1MA 2W6MA 5G53C 2FUKA 3FWYA 3NDRA 4MWDA 1X42A 5F98A 2UVDA 4RV9A 1E9CA 1Y8AA 1UAYA 4RETA 4XVRA 1WCWA 2Z3WA 4G0PA 4MW5A 1M2KA 2PT6A 2Q45A 3B6JA 4TLLB 2CSXA 1E5TA 2HLDD 2FV8A 1S2GA 1TXGA 1UJ6A 2WTMA 4BUCA 5C4MA 4Q7KA 5K8TA 5KHLB 3HYNA 2BMFA 2AN5A 1QK5A 3N8DA 1EFAA 2D5LA 2AF3C 1UMKA 2LD4A 3MINA 4HLQB 2VQEB 1UJMA 2Z08A 2ZYSA 4DABA 5HJ5A 3IV7A 4BDSA 1O95C 3MFQA 4F56A 3QVWA 1DP4A 1Q44A 3WV5A 4LQDA 2AJBA 1CVLA 1XELA 1GXSA 1S1CA 2INGX 1K8YB 1O9HA 1V2HE 2X9QA 4PS1A 3B12A 3ONWA 4YDRA 1ZNWA 3HEAA 1JU9A 2NYAA 3QF7A 4EPWA 4E3WA 3DDUA 3PQ2A 5JXIA 4PTYA 1EXVA 1QKJA 1J23A 2NZUG 3IAEA 4JKOA 1P2DA 1GQFA 3ZW9A 2VZLA 1NONA 2E49A 3OEEA 1U6JA 3DTNA 5DNCA 3TW8B 3A31A 4GUAA 1UBJS 3JALB 1NX6A 3LYUA 1W9HA 4JQOA 1YC2A 2O52A 1C4KA 4KNVA 3CNQS 3ADOA 1T8RA 3IODA 4F5EA 5CB8A 2VRNA 1K5PA 1SB9A 5AVXA 1KYYA 3C7AA 5FAXA 4UM9B 3L41A 2A67A 5FFFA 1V26A 3PQ8A 4BB0A 4DJDC 1ZJYA 2BAGA 1BDBA 3BQ9A 3GLHA 1NI4A 3SSMA 4GI1A 4F3NA 2PANA 2VJMA 2ZREA 3KXDA 3B5EA 4ITUA 2G0AA 3GPBA 4CKZA 4R2LA 2OV3A 4RHEA 2Z09A 2FCAA 4JJ8A 1G9SA 1U65A 4MCIA 2M6RA 3ASZA 4QPCA 3GQBB 5AJHA 4YPFA 1TEVA 4JELA 2Q5QA 3IDSA 3ONVA 3TDNA 3TE7A 1QRUA 2V1XA 1WUTA 1U98A 3QFCA 3QELB 5E38A 1DQYA 2GYYA 2ZQ5A 4NOJA 4DZTA 1DKUA 2PV0A 4DA6A 2Y05A 4GLFA 1V11A 1A4IA 4E5YA 1JEDA 2Q99A 5ENVA 1Z3CA 2QMQA 3GD5A 2A8YA 3U9SA 3R75A 3OBBA 1XQ6A 4RJLA 3UH0A 1CZHA 1NW4A 3ZKWA 2V7QA 2D1TA 5K1ZA 1G5FA 1YJAA 3CZRA 3AY6A 4Y1EA 4CM4A 3S2IA 4Y6PA 1HTTA 3L0BA 3L84A 4DA8A 4RVNA 3VNUA 3HU1A 2GDZA 5I8PA 3DMTC 1WF6A 1Z0UA 1QYRA 3TSOA 3ZDBA 4IIXA 1QFYA 4JT9A 4J0KA 3PTZA 2XADA 1TU4A 2QIOA 3G2QA 1DTSA 1F6BA 5JCXA 1Y9DA 3B8EA 1JTFA 4ID9A 4V2UA 3AH8A 2CV2A 3IPAA 3NH6A 1K86A 2JIDA 3WSTA 4AO7A 5E7JA 4HJXA 2P67A 2VHXA 5DH9A 3OZGA 4BU1A 1QS0B 3JV7A 1NJ6A 3Q15C 3W9SA 3CUWA 1PT9A 3CRQA 3OE4A 3ZKAA 3L0CA 1M9NA 1NW9B 1FFSA 2JLQA 3CVYA 2HQ1A 5AM1A 1CQWA 1N3BA 1S8FA 1Q22A 1SVNA 2C5HA 4OOFA 4DCTA 1EZ1A 1SB8A 1ZITA 4U2CA 4NPCA 5FOWA 5DPMA 1T1RA 1XTTA 3GFFA 2PU7A 3SJBA 3QFRA 1DJQA 1D4AA 3E7FA 5AI8A 2J85A 3M9XA 1EM8B 5CVEA 4Q4LA 2OESA 3ZD6A 4DREA 3K1JA 4MVJI 1T29A 1H6DA 4JNCA 4X8OA 3JQGA 4EENA 2RK3A 1A9YA 4BV8A 1RI2A 2EX1A 3S68A 1ESZA 2AJCA 5HOEA 3PRHA 4CKYA 5HWSA 2BGJA 1G8GA 5FI1B 2X77A 1Z4KA 3GGJA 3RABA 4YJ3F 1L5FA 4A8PA 1ZGGA 1AJEA 4NKRA 4CKEB 1VHQA 3ECCA 1L0BA 4R9SA 4E5VA 2IH5A 2ZK7A 3B3QA 3QBTA 1HPLA 2E48A 5DX8A 4O4HB 3T5BA 1M10A 4X24A 4B31A 2YWGA 3EMVA 2CLSA 5F2EA 4QUAA 1X7YA 4AG5A 1V1RA 3UK7A 3QX3A 2X7HA 3C4QA 3JASB 3LX8A 3V8VA 4EYSA 2QVBA 2IHNA 3ELDA 1IYZA 3JSXA 1CRLA 3DHNA 2C2BA 4BMYA 2QG6A 2RGWA 3L7IA 4DLSA 3X43A 2WAXA 2QXUA 3DGFC 3OEWA 2H9IA 1EM6A 2R8OA 3AU9A 4GOJA 1XCMA 1U2ZA 4HGRA 3P94A 3G49A 4UFNA 1CFJA 1HNNA 4Q1AA 4UPVA 2I4LA 4WCFA 1A2QA 1AF7A 3D8TA 1W19A 3A1DA 4B75A 4TUYF 5JD5A 4DLRA 1EJ0A 3LXXA 2PYDA 2P9JA 5LQMA 4F6CA 5BV0A 1LPNA 4Y1RB 1LBHA 4OGGA 4C0WA 1V48A 3FOCA 3OCUA 3R7WB 2FQYA 4OAQA 4IKPA 3RUAA 1JSCA 3OFVA 3I9OA 3VJRA 1GAXA 5ALGA 3NTRA 5CGQB 2PBRA 4HNUA 2W93A 2BH2A 1Z28A 1JHDA 1QQ5A 4P4LA 2WVGA 3DHEA 4IEEA 4EMBA 2BHNA 4PZDA 3BTVA 5BSWA 3T5PA 3EFOB 5A02A 2DQZA 5MFPA 4GFDA 2BJVA 3GU3A 2OHOA 1TW2A 1Y4SA 4RY8A 4EB0A 5C51B 4QASA 3AINA 3WBFA 5TLSA 4H08A 1N5RA 4IW3B 5TEVA 2XYGA 1MNQA 3HDVA 2D0PB 2I7CA 3NB0A 3UV3A 1UXHA 1LSJA 1E7WA 2F1RA 4I2VA 4DDWA 2X6TA 1PEYA 4YCSA 4Q9DA 2HREA 1QDEA 3CVOA 3KQYA 3LCCA 5M3BA 3ZE1B 1KEPA 1ZWLA 4C03A 4W4TA 3LG2A 2Y76A 1GFSA 4D9CA 2H1VA 1ADYA 2PCJA 1C4WA 2WY2D 1RAEA 1E79A 2HSDA 1O94C 2PA3A 2CDCA 1IN5A 3IBFA 4X7MA 4CLXA 1C0EA 1LNZA 3L02A 1G2IA 4HQRA 5EAIA 3OQIB 4D8XA 1FQJA 3S2SA 5EJ7A 1SEVA 2UZ1A 3ML1A 1X1EA 2X40A 3HEBA 3N2YA 4YI5A 3BHJA 5AI0A 2H7CA 1Y3BE 3EMBA 3KXLA 1AXEA 4IQGA 5MF6A 1LFAA 3U4MA 5D1HA 3K16A 1MC8A 1NHGA 4WASA 2BTQB 5FADA 1V7PC 4H1VA 1ZD9A 2F67A 3DTTA 4IPTA 2WJPA 9LDBA 5HGXA 4AI6A 3AW8A 2P4QA 5JZBA 5C1IA 1DAIA 2DWQA 2XTMA 1NVMB 2BFMA 2H1WA 2V03A 4M7PA 1RXUA 4IGAA 4ETWA 4OYRA 4C5BA 1YQQA 1JKXA 2W2NA 3TD9A 1Z5UA 3AEYA 1F12A 4C0BA 5KQLA 3H3FA 3K2BA 3TOSA 4G1EB 1FEZA 3OTWA 4DIUA 3HBJA 3K0CC 4PZYA 5BSVA 3WDMA 2DHDA 2ZRNA 4DLLA 1Z5PA 3L6BA 5DIZA 1U4NA 3C4VA 4PBSA 4PSKA 3NHJA 2P9QA 3ZHQA 5JUWA 5KTPA 2GPSA 2FP4B 1QAMA 2R7AA 2OFXA 4FGJA 4EP1A 5HIAA 5GIOE 4Z99A 2G6BA 3WO1A 1ZD2P 3WGZA 3NHRA 4P0QB 2ZP1A 1SUDA 5IMBA 1E1RA 3WKEA 1I5OA 4IIJA 1O77A 1VGVA 3AB8A 1JQ5A 1W581 3F3YA 3GJTA 2AZ4A 4RNDB 5HP4A 1P33A 2WPNA 4RXTA 4BJ5A 1KSJA 4KIFA 1Q14A 2YZGA 3E5MA 3KX2A 2HX1A 2X8JA 3OQJA 3QWBA 1NATA 2X2PA 4QVKA 4XYMA 5FI0B 1LLCA 4O4IB 4G1MB 4HQLA 3RSOA 3PNPA 4CMEA 5HKKD 1JG6A 3UGQA 4IF4A 4R9VA 1EUCB 3BRCA 2XBLA 3PE3A 2GTHA 3JQEA 3DCJA 3GARA 1NI4B 4MUXA 3P4UA 3V8QA 1OH8A 1Z4OA 4MPDA 2YASA 2FXVA 3MLEA 2JFFA 4GX0A 4M9RA 1FLNA 3FNGA 4F71A 2HMSA 3PGA1 4YDHB 3FROA 1E2DA 3NBMA 3WHPA 1WS6A 1E9AA 3D8UA 3G2PA 3TQIA 3HYCA 1Z63A 2BOVA 3QW2A 1PFQA 1I3CA 2VH1A 2V6IA 4AQYB 1LLQA 5F78A 1V16B 5AICA 2X0FA 3AU8A 1YVUA 3VR0A 4KJXA 2PV7A 3RJ9A 5MN4A 2W8BA 2CLHB 4FCWA 3NR2A 4QKQA 1YOBA 1CLUA 4MEBA 4IDNA 3DULA 5NULA 5B55A 5IZCA 2PWBA 2FRXA 3PNOA 4B82A 1TF7A 5HF6A 4HPJB 1ZM3A 3RW9A 1DIBA 3YASA 1ZGJA 5H4GA 1MQ9A 4DYVA 1ZJ4A 5LZ8A 3W4JA 1G20B 4A27A 1GR1A 5KTNA 2RKOA 2X0NA 3PC6A 4WZBE 5MHTA 4C4YA 1VL6A 1J21A 4H1WA 3Q7EA 3KD3A 4CLEA 3VZBA 2HK9A 3CZ9A 2WF7A 2MMCA 3P32A 4XA8A 4F8YA 5EJ5A 1YBMA 3A05A 3PDIA 5DBFA 1O95A 4GXRA 5C1DA 1JXMA 5ESRA 2XRMA 4JA0A 4TS1A 3U39A 4CGZA 1T9KA 4HBGA 3GYGA 6LDHA 4E32A 1OT3A 2Z8YA 4EPVA 4ZHQF 4ERXA 2CNOA 5EJ6A 2R86A 4HLNA 4MV8A 4NDNE 3A6PC 1Y5RA 2GUWA 3QJYA 1U9IC 3CPSA 5C3UA 1QQBA 1EBUA 2BKUA 5JTTA 5AJTA 2VF2A 4FOLA 2YQZA 5CDTA 2PX4A 1E2LA 5FWAA 3W2TA 2F7SA 1E1KA 3QLVC 1QF6A 3UT0A 4UXHA 2IHVA 5DSTA 5IVDA 4HYQA 2QD2A 4OOEA 5GV7A 3U37A 4C29A 2JGRA 4FR0A 4ICIA 1NZFA 4C0XA 1K5GA 1RBZA 1RD4A 2YINC 3TIGA 1E77A 2BUAA 3HDYA 1B15A 5TB5A 3W3AA 3T61A 5DKFA 4B4KA 3A2MA 3E2PA 1DEAA 3FNRA 2PFGA 3M89A 3RIHA 3K9LA 3AHJA 4GMFA 3R7NA 1RZVA 2ANBA 2CHUA 3F4LA 1QGZA 1U1CA 1KZYC 4NFSA 4QVIA 4PBTA 3ZY6A 6CHYA 1IZ8A 1Z68A 2DF8A 4G2NA 5LOVF 4P3YA 2B9VA 1XHEA 4X3OA 2C95A 1AHPA 5H7XA 1E18A 1PGPA 3GGOA 3M5DA 2I2CA 3VDRA 1YB1A 4L5IA 4CW7A 5AVVA 3IT0A 2WJYA 4C0AC 4CL3A 5CB0A 3KZ1E 4LMPA 3D8SA 1IJFA 3DVQX 4K5QA 4O1MA 3WK8A 2QT9A 4LNUB 5G1NA 2OYRA 3C8HA 2NO4A 4MVJM 4J75A 3SNKA 5HFJA 1V1RB 3HYLA 2VKQA 3FHLA 4E03A 1V4NA 4BTLA 2HW8A 2DBZA 4U7JA 4ZZIA 3JR3A 3NHAA 2QZPA 1SVOA 4QC2A 3SE7A 3SG0A 5FJIA 3UJ3X 4AY2A 3T0FA 4IXTA 1G60A 3EQ8A 3PHIA 4BN0A 5K0FA 4LFBB 2UVQA 1H8EA 5BR8B 3L0DA 3N3BC 3Q3JB 1WPGA 3HKEA 4CDNA 4PX2A 3LVFO 4C3ZA 1YZKA 2WDZA 3B3FA 1VHWA 2AXPA 3CG4A 4JJGA 1TT7A 4WN3A 4NHEA 1GVHA 1YCDA 1P3Y1 3ZWAA 2XIQA 2GD1O 2B4YA 3EGDB 2GS9A 2QAJA 2L17A 3FHOA 4FHZA 4I08A 5F4BA 5J59A 3RNOA 2NSHA 3KQUA 3FWHA 3HJHA 5D51S 1X1QA 4UBLA 3UPUA 3R0IA 4MW6A 1G21B 2VXCA 3DZGA 4C78A 4WJLA 2LV8A 1JXAA 5B1YA 3I6IA 5CEEA 5EIAA 1G8KA 1EFDN 3T94A 5BT8A 2EQAA 1ENPA 1Z4IA 3L0IB 3HU5A 3MD0A 4PW0A 2PJDA 3F9RA 1FFHA 2GASA 1OI3A 3CUUA 2ZVPX 5GOTA 1G5IA 2IEYA 2IY7A 3ZJYA 4DILA 3PFCA 3PKIA 4P53A 1NG9A 5IDXA 3RRBA 2BN4A 2K6GA 4I1OA 4RFSB 1Q1GA 1P18A 1YIOA 1IN7A 1YOVB 3A3YA 5DFAA 1JZSA 1NE2A 1P72A 3L92A 4WADA 4RJKA 2VJMB 4QLAA 4PCUA 5IT4A 5KNDD 3I62A 4HAWA 1BH6A 3QMPA 1OAOA 1P6UA 3T3MB 4MPJA 3WG9A 4CWAA 4K6OA 1SIWA 4LOJA 5DRYA 4DQXA 4OY3A 5I6DA 2XQIA 5DYTA 2YYZA 1RLUA 2CSUA 3HCEA 4YCJA 1IU9A 1QIFA 4DMRA 5IF9A 1BFUA 4LZZA 3DHYA 4OQFA 4OJTA 2WTUA 1DQZA 3TH5A 3TPFA 4D4HA 3ZOKA 1LBTA 2XBUA 3KZMA 4KO3S 4D44A 4X62B 1SOAA 2ORYA 2Y1OA 5L95A 2UYGA 4RXUA 3LHSA 1V11B 1QHHA 3QBVA 1U81A 1QPBA 2J5XA 4RE5A 4OCZA 2WICA 4YLEA 3JVVA 3UJ6A 3VPGA 1CLEA 1RQGA 3SHVA 4B3CA 3C8MA 4PLTA 2JC3A 5TF4A 3RG8A 4B8WA 4EYGA 1QKIA 4NEGA 5B5SA 1VL1A 3K1AB 1N4AA 1EK0A 4B44A 3L0ZA 1CUWA 4ZOLF 4G84A 3O6VA 3P9QA 2YHIA 2BSQA 2VJLA 3ZI0A 3P2IA 3JPYA 4ZO6A 1CRZA 3ZY5A 1JLKA 4H7KA 3ZU5A 1M34A 4CE6A 1BWPA 4HWPA 1I32A 1M66A 1R37A 3GRZA 4GM4A 5AJUA 3REQB 1WZUA 3BD7A 4UNPA 4CMHA 1DKLA 1X9GA 2RJNA 4M1ZA 4QUEA 5GZ1A 3KD2A 3PUXA 2BFNA 1B6RA 5AMXA 1E6WA 3ZCRA 2RKBA 4AG6A 4JQZA 4DV4B 4AZ3B 3KKNA 2ZM5A 2WTAA 1DMRA 4PLYA 1YNSA 2J48A 1WTCA 2NU7B 3ZGOA 3ER8A 1BH2A 1K1EA 1XU7A 1YQWA 2BF4A 3K70B 2ZR0A 2XX3A 2QD4A 4OQ4A 2CD7A 2CFCA 4AICA 2DAPA 3W05A 2P9BA 2HO5A 2IEIA 1FBNA 4KTVE 4LOLA 2HWKA 4EFDA 3RVQA 3H2YA 3KJGA 2B9EA 3OOSA 2V58A 1FNMA 1XTSA 1JG4A 1PX2A 6NULA 3EDQA 1FJGB 1K3UB 1T5OA 1FQOA 4MS1B 2H1FA 4ETMA 1XVAA 4CF6A 4IRMA 4GQBA 3NV9A 4YAJA 4F06A 4GEKA 1RVDA 3TM4A 1K0UA 1L7AA 3A4YA 4BLSA 1WHTB 1DJOA 1E0AA 3SC4A 3COZA 4L7VA 5LQDA 3UAXA 5DVZA 3VKHA 1ZRSA 3SZGA 3WTCA 2OD9A 3H5RA 4LECA 4D2IA 1RAAA 4L22A 1HNZB 4WBXC 1IY9A 2AI3A 4DCCA 5LLTA 1FOEB 4Z4HA 1E0SA 1H0HA 3CR7A 4FILA 3LGXA 3V4RA 4BNKA 4P2GA 3L1UA 4TQAA 4L4ZA 1VIDA 1ZMRA 3F74A 3PGVA 3KE8A 5DEIA 4UZSA 4H3SA 5DN9A 3GPIA 2ZSKA 3BF8A 2C5SA 2ZB4A 3KDAA 3MTIA 3BFXA 4U4AA 1MC4A 1SU8A 2HMUA 4Y2VA 3LC1O 4N6GA 4S0ZA 2O3UA 3L4BA 2JFBA 4JXZA 4DSTA 1GTZA 1RKQA 1WP9A 5ARCA 4F5DA 1RQNA 2O4UX 1FS6A 3RQSA 5ITSA 1XYVA 5H3HA 1LPBB 4F5ZA 3D4IA 2V45A 2BGWA 3D0KA 1ZOOA 2WD7B 1BG6A 2FR1A 1G17A 1HLPA 2L69A 4YLGA 4TRJA 4BP3A 3COJA 2PH1A 1PTJC 1CX9B 1CJVC 3STTA 3ZHZA 2ZUFA 4HEA6 2M6KA 1CIVA 2P9GA 4HDRA 3UJ8A 2OCXA 4A7PA 1II8B 4BX2A 1N2CB 2ZTLA 5A2GA 2ZTVA 3RT7A 1BTOA 5MGNA 1ZYUA 1ZN7A 4ESHA 3TUZC 5EQFA 5ADHA 4MULA 1NX9A 3U3JA 4ZJUA 4O59O 3B1ZA 3W8EA 1KS9A 4QPZA 5KTSA 2LBPA 4Q02A 1NY5A 2QTZA 2WHPB 3RUDA 3ZJTA 1XQWA 1KNXA 3ETCA 1W1UA 5B1SA 2ZE5A 5E9QA 5EFOA 2FW9A 3UBTA 1SVSA 2PSJA 4RY9A 3GW8A 1X80A 4CPDA 1I4DD 2GBLC 2PR7A 1JN0A 3E03A 4Q7EA 3U1VA 4B71A 2EWMA 3S1SA 1SVMA 2HCTA 3K71B 4OATA 5JNLA 5CX1B 3OFSA 2APJA 3PVSA 4IO1A 3LHDA 4NLLA 5DHUA 2PH3A 5CFLA 1PQYA 1D5WA 4JU8A 1A4UA 3RVLA 1G2OA 1XVTA 3FSGA 1A04A 4Y2RA 4P4SB 5DGDA 5TQVA 2B83A 3L7JA 1RQ2A 4LSMA 1KK3A 1J25A 1UBKS 3HVHA 3KOWA 2DHQA 3L3BA 3EARA 2W4IA 2FLWA 1XYYA 4LC1A 5HUJA 5IT0A 1MA0A 3DE3X 5HF9A 4FHFA 4KWHA 4XXHA 2PZKA 1T26A 1WPRA 2QAIA 4IVPA 4V03A 4WZBB 5JARA 1LDNA 2Z5LA 4RKEA 4A03A 1EVJA 3FNQA 4QTUB 3ZVMA 1HQCA 1VOTA 2OV2A 4JJKA 7YASA 3EGVA 4KQ9A 3Q2KA 1O6FA 1GG2A 1OTXA 1P73A 3RAFC 4OQDA 1IZ0A 2W11A 5JANA 1VJCA 4D9GA 1I3KA 2NTNA 1YHYA 2FE1A 5GM2A 5A9SA 3B60A 4PFQA 3WLJA 4N7BA 2FKNA 3U26A 1Q6ZA 2D62A 4JFAA 1JAZA 2VHJA 2VXOA 4J4BA 3H1GA 3L4JA 3SC2B 3C16C 3C3DA 5F3WB 2W6JA 3W1VA 4ZO9A 4C07A 1G42A 4LYJA 1Z7EA 1PT8A 1ACLA 2ZSDA 3TR6A 4BUZA 1P4HA 2J41A 3HJBA 3HV2A 4WINA 4RPIA 1EK5A 1O6CA 2FSUA 3GI1A 1P2GA 2DPYA 3HNRA 1XDBA 2C97A 1Q57A 2WHEA 4I4TA 4S35A 4FFWA 3I04A 5BN1A 4A16A 4URUR 3UOWA 4BNHA 4M0FA 1HEIA 2ZBGA 2P5SA 2ZSBA 1ZSYA 3NHFA 1X1RA 3I0ZA 2Z2IA 1C0PA 1B8VA 4ZI3A 5IPFA 3QYPA 3SD7A 4JUBA 5IG2A 1MW8X 4GIBA 3HXTA 3DE0X 1UWKA 3DDCA 2VFAA 3QX9A 2EHDA 4FPXA 2XUHA 4S1VA 1QYIA 5I4KA 4OGLA 1DPGA 4TKMA 4DNFA 3PSHA 4JUAA 2MR6A 5EESA 5DM1A 5AW9A 3IMEA 4Q00A 1D8TA 1SD1A 4MLPA 5HKOA 1NJ2A 1FVOA 1PR2A 2R84A 3VA7A 1CQJB 2IHTA 3D0QA 2AFIB 1RYYA 1MAWA 4NG4A 2Y1FA 4ARVA 2KHZA 1VL8A 4C04A 3UFBA 1J2EA 4QGSA 5LLSA 2DPGA 6YASA 2X8AA 5A0TA 4YAIA 2W0SA 5DM0A 1BXGA 4YJ2B 2P2ZA 1RRCA 4QOHA 3RBZA 3DE7X 2GETA 2PZLA 1EFPB 3PQ6A 1DJLA 3DO8A 3QW4B 3ADBA 4I1PA 2QU7A 2WSSA 1CUCA 1QIEA 3QPUA 3DOFA 1WUHS 4EPYA 1W8IA 1MV8A 1N4DA 1W4AA 4WUTA 1WZ2A 2Q9UA 4PPQA 2QDKA 1PJBA 3SP1A 3S2ZA 4C4AA 1XQ9A 5IXJA 3WRYA 3KC2A 5C32A 1RMQA 3F73A 4AYXA 1E6MA 2FMXA 1V3QE 1WKVA 4US0R 2AYXA 4GECA 1DCKA 5GWXA 4OBWA 3HLKA 3KJQA 3OIWA 3UF0A 4XQ0A 5DGHA 2GK4A 1JMKC 4B6JA 4LFAB 2NQ2C 2LCQA 3WLHA 2WG1A 3I32A 4AZ3A 3U5TA 1RYFA 1T6ZA 3BTUA 3FMIA 3RVSA 5EJ2A 1YR3A 1YJ8A 5IUJC 3N3AC 4YCAA 4V0LA 5HG0A 3KDPA 3HM9A 2GCNA 1W6RA 4AJLA 4Z0PA 3Q72A 3IQWA 4BP8A 1I3OA 1Z82A 3AM3A 3RGWS 2QD3A 4OB6A 1SXQA 2WFMA 1ZXBA 5H5JA 5KMGB 1XAJA 4KV9A 3Q88A 2BEVB 3N39C 1F48A 2B8JA 4OM8A 1F38A 3DFZA 4MV9A 1OASA 2W6PA 2CHGA 1YS2X 4E09A 4RD2A 4B4UA 1OWLA 2Z1MA 1TIKA 2ZU0C 5JT1A 1DKQA 2O1WA 1BMFA 4YK7A 2ZIZA 5F64A 4AWBA 1YS1X 3IR5A 3GJ3A 4Q15A 4F04A 4HX2A 1DX4A 1PGOA 2ECQA 3UENA 4Z1MA 3QYFA 3DEHA 3RYHA 2TYSB 1T3SA 4DQDA 4E31A 4K0KB 1N33B 1HL7A 4KSBA 3AONB 2IH2A 1QH1A 1OYWA 4JI5B 3K9QO 1B93A 2PUVA 4ZPJA 1JHYA 1E5QA 4BCCA 3AHFA 4MV0A 2DFVA 4J4TA 4ZYYA 1K5HA 1CR4A 1N9ZA 2PT9A 3FDXA 5C7OO 1TO6A 1N6IA 1O8CA 3AVQA 2EV9A 3JALA 1D3AA 1ODKA 1FRNA 2CL7X 2QTMA 4Q3DA 3T7TA 3JWHA 4CYMA 3QFFA 5AJVB 1UKEA 2ENWA 3WGGA 2O19A 3FBWA 2MSWA 1U99A 5KTRA 2PS3A 1E99A 3EGWA 3VNQA 4YB8A 5HVNA 5LU8A 4U7TB 4YBRA 2NVUB 4PAQA 4ZQBA 4QU8A 4Z6KA 5AXBA 3GCDA 1OIXA 2AE1A 4HH0A 2Z5GA 4ZT3A 1JHUA 1N9GB 1W88A 4X0EA 1V9SA 4AMVA 1UUFA 2B2CA 2QNBA 3BC1A 3L7YA 5I4CA 2O7SA 2JLXA 4Z86A 4B3SB 3GQBA 4B2IA 3OJFA 2BFCA 1IC6A 2HJHA 3F46A 4ZKDA 4JI7B 3TL3A 4D9HA 3ES9A 4IFTA 1J07A 3FPKA 1E9FA 1P17A 4JYCA 2FPLA 4OA8A 1H6BA 5HS6A 2R7NA 1RPJA 1NUHA 5LZ5A 2ZXEA 2XTAA 1TVEA 2PFKA 1LB1B 1Z8HA 2JFPA 2GAFA 2NZ2A 4ENPA 3RYCA 1P5RA 3QXHA 4HSEA 3N0TA 4I14A 1W4BA 1TUBA 3NV7A 2GTIA 1FMJA 2I4OA 3LM8A 4LZOA 4O2BA 1XMXA 1AVTA 2VPYA 4PSDA 1YZQA 2FPIA 3RU7A 4TWIA 1YOVA 2IIBA 1YA6A 1ACJA 1J70A 1KC3A 3PEFA 4KGZA 5FPPA 3VVBA 1K8ZB 1SK9A 1GA1A 1HRKA 1C14A 3WWPA 4WZBA 3N7AA 4GX2A 5AJZA 2ID8A 2A78A 3A37A 4LMAA 4LX0A 2XZTA 2G67A 4PQEA 4DV3B 2GF2A 3ICEA 1J24A 2ODTX 2WKRA 3GLUA 3SHFA 1JSLA 2VNIA 2WLTA 2TECE 3DC7A 3GELA 1SRRA 1GAJA 3LTNC 3H7IA 2FPGB 2R00A 3FKSA 2PKWA 2BHLA 1P9OA 1Z2CA 2NAFA 4M4SA 1XEFA 4BPRA 1SUAA 1ECGA 4ZCLA 1IQPA 1VKJA 4CF4A 1OYVA 3D5EA 4Y6RA 4D5GA 4GKJB 5CAEA 2FX3A 4QYMA 3AQIA 4UOZA 2ASEA 3ORYA 4ZDJA 1EXWA 1UC4B 4EFKA 2Z6QA 4FS3A 3KSDO 4YP7A 2I91A 1JG1A 2Q49A 2QVYX 2F59A 3L6DA 3OZSA 2GHQA 4FR5A 4W1PA 3WGUA 2IZ0A 3G5AA 3LL4A 4EQ6A 1OWMA 4WZZA 1KZ4A 4PIPA 4JMPA 4HGNA 4UTNA 4QBIA 3AEQA 4NYIQ 5E4JA 1N32B 3N6RA 4QPNA 1ISPA 4MDYA 2UUPA 3OMWA 1M34B 1OLOA 3IUPA 1T8UA 2VAMA 3IELA 3DAPA 3MEQA 1YZTA 4FQ7A 1MX3A 3I73A 4TXLA 3WGQA 3ZGYA 3REQA 4BXOB 4TTRA 4BBJA 1ZINA 3DDZX 2DBVO 4GL4A 4N6OA 5JZVA 3B6EA 4TS9A 4UAJA 5KJFA 2ZRMA 4XM1A 1E5XA 1JMVA 3RT1A 4YCCA 1IBCA 3HR4A 2ZIUB 4WI1A 3RRMA 5CDGA 3HKCB 1ECFA 4LQCA 3H2BA 2JLWA 1I24A 4IZHA 3BX1A 1W4RA 1S9HA 3OQVA 1QM5A 3BXEA 1DC7A 1DUSA 2UUBB 1GV0A 3H9UA 1X8LA 4Z1OA 3IE1A 4G85A 2AR0A 2D00A 2XTZA 4D74A 3SYTA 4BQQA 1TJNA 1S3IA 3BULA 1QFMA 4RD6A 2AFHE 2X8WA 3C3MA 4IQ4A 5AKHA 3WS7A 3CIFA 1EYZA 2XB8A 4BIIA 1R8YA 3N8KA 1LDBA 5AXAA 1L4EA 3TKYA 3WNQA 4BO5A 2O8NA 2R9VA 1HE4A 3JAWB 1JSZA 4KGXA 4PHHA 3TX2A 4N6NA 1RRGA 2ZRKA 4KR6A 4DUPA 2GSWA 1NVGA 3LYLA 4W5NA 4WN9A 4YP6A 1RJEA 1VI6A 3TQFA 1E3WA 5IN4A 1X3LA 3ABSB 3GJRA 3N74A 2WPDA 5TGZA 1E4EA 2AWOA 2KMLA 2P6MA 3STXA 3VQTA 5L6LB 5E9WA 3C41J 1XVIA 3QXJA 1Y6QA 1S4QA 1ULHA 4X41A 3ZNNA 3VV2A 2C4KA 4QUDA 5BQOA 3H1EA 2JGIA 2OV6A 4PHTA 4KR2A 1D6SA 4L3VA 4ND4A 3R77A 4RTQA 1ZJ5A 3AFHA 4GO1A 3TGLA 1M6EX 4PNHA 4CFSA 3GRPA 3RS3A 3ZYCA 3FUUA 1Q11A 2QRVB 4F8EA 3ND8A 3WIEA 1Y1RA 1B73A 4OHFA 3TKLA 4ZKEA 2ZJOA 1QZXA 1EWVA 3L1JA 5C4GB 1EFVB 1SOMA 2FN7A 5EKXA 4C01A 5I7HA 1X1CA 4ILKA 1XDSA 1FSFA 1XEWX 5FUQA 2UXCB 1Y7IA 3AI3A 2ZRDA 4LK3A 4UTOA 3B6IA 1D2EA 3UMMA 5B3AA 2LDBA 2E6KA 2FGJA 4JLBA 1UK9A 1KO4A 2GPYA 2Z8ZA 1WY7A 3GH1A 3R0JA 4OYYA 3SCZA 4UCXA 4KR7A 2NTEA 2BGNA 3IXMA 4Q1DA 1BX0A 3AUJB 3HP7A 1DS6A 3CNLA 4C4TA 3IRVA 5I7EA 1OC2A 2PSDA 2QE7A 3HZZA 1R9GA 1X8XA 1QHFA 3GOHA 4F1JA 1XALA 5EUBA 1Y1PA 4KDCA 1RXVA 2YJ5A 5EGSA 1P5FA 2Z6VA 1MB0A 1P5JA 4ISBA 4R7GA 3SQOA 2ZR9A 3VO8A 1AKYA 4P92A 4OUDA 5KQMA 2XQJA 3MXOA 4TKVA 3F5QA 1ZG3A 2OBFA 1N2BA 4O6VA 2PVCA 4M87A 4PYOA 3WB9A 4YRRA 5KVAA 1Q84A 4DGSA 5EHNA 4WDRA 3T7AA 3L9XA 5IC4A 2FY8A 3K8YA 2J30A 1W1IA 2VCEA 2VZEA 1K9SA 3D3WA 1YAJA 1M1NB 2ATEA 1GNLA 5TVGA 4YCMA 4ZOLB 5K9ZA 4A9AA 3UN1A 2I6GA 3I34X 3R6LA 1NIJA 4K1XA 4KK4A 2QJWA 4B3XA 5A7GA 5TS2A 5CLIA 5DCLA 4LYHA 3HJAA 3TAUA 4RULA 2C0CA 1U2DC 3G1TA 3EOZA 1RRPA 3E53A 1PW7A 3CX8A 3P96A 4KQFA 4MYCA 1JVNA 2MHCA 2IP2A 3QQPA 1Q7BA 3TZHA 3VR5A 4BP1A 8GPBA 1XFDA 2I4RA 3X2EA 4PCVA 2ZUEA 2ZS9A 5L45A 2FW0A 1D2AA 4ZODA 2FP3A 3ESCA 3JVDA 4OHMA 3SHQA 3I83A 5ALLA 3T52A 2WILA 4B80A 4X20A 3RTEA 4HNVA 2Z6UA 1VMAA 1ZCBA 3EZGA 1E96A 2C9ZA 3MRTA 4OHOA 5EKDA 3RTCA 2JEZA 2JEYA 1F60A 2JGJA 4Q5IA 4R40A 4Q1EA 5DP2A 1G98A 1ZESA 3F6PA 4F4JA 4UBJA 2O3TA 3C85A 4JLWA 4NJMA 3ADKA 2G5CA 3DZDA 2W2TA 3T1OA 3CX3A 1HMYA 5FWYB 5LMCA 2AKAB 1S2IA 1JKMA 1P0PA 2XE4A 1N9GA 3VR3D 1PR4A 3H3XA 3W79A 4PNPA 5AUNB 2V3WA 3FFAA 3SC2A 4AB1A 4CDRA 2I2AA 3P0JA 3PWKA 1MX5A 4FYXA 1I7QB 1QBKC 1A95A 3EGOA 2C07A 3BSWA 3G3EA 3L1VA 3MCTA 1KE1A 2PR2A 4C2AA 4Y6QA 1E3QA 1DBWA 1QOQB 1XJQA 3KG2A 5BR4A 1WA5A 2W8BB 2X5NA 4IQFA 5FUWA 1X8KA 5BNZA 1T5DX 4KZPA 3NNDA 2XCTB 1JR3D 1RAFA 3I2JA 4FLMA 4HNHA 4UVDA 3O3NB 3DP9A 3TBFA 4KYVA 3PPXA 4FNAA 3RYCB 3R4VA 4MMYB 5CDFE 5BOVA 2QL7A 3CN7A 2D1RA 1W6UA 1Y4UA 3IEKA 3O73A 4MVJA 3UJ9A 5A3JA 3IVAA 4B3GA 2A9VA 2OGUA 4H16A 5IUKC 3ZIAA 1FPQA 2FWPA 3TZEA 1L7XA 2GEDA 2JVIA 3OSZA 1QK3A 1QGUB 3M4ZA 3NOVA 4Y1FA 4FHEA 1ILWA 4GBGA 1ZGCA 2ZQZA 1HE2A 4YONB 1SMKA 1NLZA 2XYRA 3MHPA 1BFDA 4JYZA 5ESDA 4O4HA 3CVUA 2N47A 2RB5A 1IIBA 3DLBA 4O08A 2CWWA 3QUTA 1IZ9A 2BPOA 2D59A 3OFNA 2OSBA 3CLVA 1CZLA 1Z0IA 4GMDA 5KNCD 2C5AA 4DN6A 3WAKA 5B7PA 3A11A 3LQRA 2LKCA 4BZWA 2JBAA 4CNQA 4WUVA 4RF4A 2B4KA 3QNWA 2QNIA 3M3DA 6ADHA 4UHBA 3NAGA 4XQEA 5IFLA 4KGVA 2GCOA 4JJFA 2V74B 4EA9A 1BXRB 1J0XO 1QLWA 1BXGB 3IVXA 4MUGA 2A57A 5K4AA 5IHXA 4YJ2A 2ZIXB 2O5EA 3HKCA 4IV8A 1AKWA 4QYTA 1NBIA 4H6XA 4CV2A 1Y1KE 3UG6A 4DRZA 1I2AA 3IUBA 2CVFA 3FDJA 3K1TA 4BNJA 2J5KA 1H94A 5HR5A 1KP3A 1SU4A 4R84A 5A04A 3PI6A 5C35A 4ARAA 1JLLA 1WETA 1E9EA 4CZ2A 1SC6A 421PA 1PHRA 4R9NA 3RYFB 3ZCVA 4A0GA 5A4IS 3FUVA 2KW5A 2NVWA 3RKRA 3LO5A 1GSAA 2H4YA 3COWA 1C9KA 2G76A 6GPBA 2GPNA 1JPUA 1Y6RA 2P77A 1T24A 4EUKA 2X8LA 3B70A 1EUQA 2WINI 1P7YA 3DV0A 3J81A 3E48A 3QE0A 4DAEA 5ILGA 4L16A 3AM5A 4DMHA 1C30B 1E1QA 4HYTA 5C37A 1AMUA 3I1FA 4M9UA 4KH0A 4PZ0A 4BBPA 2CBXA 4FDTA 5CH5A 4CVNA 2AOUB 4FFSA 2Y9MB 3HUFA 4ZYWA 5M2QA 2WZCA 4X95A 3CE6A 3RJMA 1T6YA 1JDVA 3HB5X 3FMPB 4GF5A 4KMSA 5TX7A 4ALMA 1KHTA 2AYZA 1RYNA 3U0BA 4L4UA 1ZA2A 2RHGB 4HXEB 1SVUA 1UP6A 2FH5B 3EXFB 2OYCA 1YI8A 3FRIA 4BKOA 5HQ3B 1SURA 1QG6A 1BIFA 1TM2A 3HN6A 1IZ7A 1NBHA 1VRVA 3PXUA 2D8MA 3LSYA 1EDDA 4JT2A 1EFVA 1M74A 4KE7A 4L2IA 5SICE 2O8FB 4OFZA 2C4MA 1MN6A 1REQA 1MC1A 2OZEA 5BW8A 3DE6X 1IOVA 3ZWXA 1U9ZA 3OZEA 1PK7A 3MSCA 4F0JA 3P0EA 4CCWA 3T7SA 2HIHA 4TWRA 4XYGA 3G0BA 2YKGA 4S1WA 2O1SA 3PG5A 1HBJA 2GN4A 3KL4A 2JJQA 2XV1A 5JRZA 1V1JA 3R5JA 4KDFA 3P2OA 4HDKB 4C0LA 1KQFA 4IDPA 4UE6A 1TTTA 2YICA 3M4XA 3ZLTA 3ZTYA 1T8TA 2XKJE 4I5GA 5KJ6A 4US1R 3WAJA 3GD7A 3HU2A 3LQFA 4YAWA 1C4XA 4IKEA 3UTCA 1D1PA 3C3WA 5BWBA 2CMHA 4NEQA 5BUQA 3HDQA 4PO1A 3LDUA 3ROEA 2I7VA 5ALSA 3QM1A 2RSLA 2CV0A 4H7JA 1XN4A 1F6WA 7ADHA 1F8YA 1QP8A 1GG9A 1NKTA 2C1ZA 2HF9A 2II6A 4NNPA 1SCUB 2X3FA 3DZKA 1DDGA 3T3EA 3L79A 4HDSA 4IOLA 1D0VA 1W44A 1ADBA 2FG7C 4JGIA 3ZHCA 4DEYA 5IJXA 4X60A 1CUEA 4POOA 4CQJA 3BWBA 4WK4B 2AN3A 2ZI5A 4UTPA 2CNWA 3L1HA 3CUVA 3TECE 4IY1A 4OYLA 3OC0A 3P9PA 5ENZA 2IHKA 1BD3A 3PNYA 3PF9A 4YREA 5F4ZA 2B0CA 4RIEA 3SZOA 1ZNQO 2X3UA 3R0VA 4LTMA 3I1YA 1ZI6A 1E3TA 4WCFB 3MWEB 4KOAA 3MQ2A 3IEVA 3TG8A 3ZG6A 4ZTUB 3G17A 3K0AA 4CF3A 3V33A 2G36A 1THTA 2B21A 4HL6A 4L0QA 4EG0A 2QXYA 2FEKA 4GUDA 4Y1RA 2M1XA 3V8PA 2CW5A 2UZ0A 3H6KA 4FFBA 4MGYR 2GH1A 2JLBA 1ZNYA 1EA7A 4ZARA 3WJAA 1NJGA 3MAJA 1KZGB 4M9QA 2DUNA 5AQEA 1CE8B 1SULA 3ETGA 2N9UA 1NR7A 1XCJA 2HIMA 2D54A 2RIRA 1GCOA 4HVTA 4R16A 4TMFA 2YMMA 5DE3A 1A1VA 4K28A 1WXEA 4G5GA 4DC0A 1Q1NA 3IAUA 3DWIA 2YQ5A 3RT9A 1INLA 3PL5A 3EWIA 1JKFA 2X86A 1EA5A 1FRZA 1K88A 1R5OA 2PEZA 2W48A 4ZCIA 3BK7A 1ZVVA 2WU1A 1ND6A 3FF4A 5L6MB 3T7JA 1B0ZA 1QG2A 2OY0A 3K0FA 4WY5A 5CVDA 3U9LA 4BN4A 1X1SA 4LEIA 1YR6A 2G28A 3H9EO 4RHFA 1XZNA 3OQBA 3UPDA 2AZXA 3T5GA 3KKPA 1JNYA 2NM0A 5EUCA 1ZM2A 3N8HA 4HJRA 1PVVA 2HYDA 4G0XA 3OZVA 3ODPA 1W85B 1SCQA 1QIKA 1E0DA 1MJFA 2XQFA 4GMXA 4P3NA 4V39A 3KZOA 4E13A 2WHXA 3VNBA 1J4AA 4OD0A 4AJ4A 2ZPTX 3D6MA 4M1SA 4TGLA 3D6HA 3Q8XB 2QN7A 4DIFA 5KTTA 1JSXA 2VSXA 3BCUA 5BW4A 1Q83A 1XWFA 3ZDXB 4C3VA 1GSIA 4UHKA 2WJHA 1Y7HA 4JVMA 5KHOC 4HATA 2BISA 1IWBB 3G02A 4UNIA 3R8XA 1I6KA 2PMKA 1ST2A 3AHHA 3ICCA 5DTIA 3SZLA 2NX2A 1JYFA 3VFDA 4DDMA 1YDGA 4HH1A 3JQDA 1VJ0A 3EVFA 4MWGA 5TMBA 1DLJA 4LKOA 1PNVA 3S4YA 2IP4A 2EL9A 3NHWA 1J8QA 3IAXA 4O2BF 5EWJB 2JFGA 5FA6A 4Q9NA 3GHYA 2CVZA 4UTVA 5JC1A 4QIHA 1CB7A 2QZJA 4IINA 4C14A 1G3QA 4ZHQA 3HCPA 3HYSA 4QRHA 4X8LA 2CDNA 1H9CA 4RUKA 1FRQA 1M7BA 3NRBA 4NE2A 4X7PA 2WZQA 3KOMA 4A26A 4LGVA 4BVJA 1E94E 2FWMX 1L8QA 3NIFB 3NBXX 5JBNA 1E2NA 1GPJA 4P84A 5HIIA 2CCGA 1HGXA 1AQYA 4B0PA 1Z4JA 1BCSA 1X2EA 1IDOA 1IAQA 2IELA 3GMDA 4XDYA 2PFSA 3KZXA 4KLNA 1TQ6A 3BIWA 3A6DA 4KX3A 4C2BA 5K3OA 3ZCSA 3A4VA 2P3SA 3NANA 4WL0A 1YKFA 1MG5A 3IKTA 4XDGA 1N5IA 5IJ9A 4AG3A 3T41A 1WD5A 1V7ZA 2QIPA 721PA 3X3HA 1QRRA 2ECOA 3FFWA 1W30A 2WG2A 3LY7A 3ZGLA 5K03A 1DZIA 2GHTA 5JVDA 4QUHA 1QGYA 3QK7A 5I7AA 3TEFA 4TN5A 4BDTA 4DMMA 2IEBA 2WABA 3DXYA 5TIIA 2PNJA 4N0QA 5F1YA 1MCZA 3MPOA 1H2RS 1WY5A 1Y3AA 2GZHA 4O0LA 1CKEA 1JQDA 2C4WA 2YFYA 3NZEA 5L7TA 1VG1A 2ZAOA 1TLFA 2OORA 4GPEA 4N03A 2Y99A 4NECA 4DIBA 4MWOA 2OP1A 3LRPA 4FOTA 4MK4A 4RKRA 5DI9A 3ZV3A 1WDKA 3D31A 3G9TA 5GONA 3EC2A 3GA0A 4KQ2A 3T3DA 1H2FA 3O4HA 5BVHA 5CFRA 4XGIA 3UHOA 4OREX 5H9WA 1PEKE 2QPAA 2YW9A 1JQEA 3HDJA 5F76A 4JJAA 1P77A 5F7ZA 4BZZA 1TOAA 3EZ7A 3OX2A 1M0TA 2RGGA 1T2UA 3RVKA 2V4ZA 1NVFA 3MCWA 2XUZA 3VZSA 3G2IA 4BFCA 1N78A 4WXRA 5FORA 3S7ZA 4NBWA 3PNVA 2ZVDA 2HJSA 3PHGA 4MRMA 1YBVA 3SXPA 4NX2A 1QHGA 4MVYA 4UD2A 2IYUA 3NNSA 4MS3B 1KK2A 4BO6A 4L8LA 4E6PA 4EF4A 4CHGA 1J8DA 5BO5A 4DR3B 1Z8FA 4X44A 2WAMA 2EJBA 3ELUA 3EIWA 2RI1A 1CDZA 1XKTA 2GBCA 3EZ2A 4HDKA 4J90A 2GEKA 3ZHYA 4YXWD 1W46A 3VU9B 1IWOA 2YH2A 3LX4A 3KWJA 4HDNB 4WMLA 1QOZA 3SBEA 3PGKA 4DZRA 1QH8B 5EIEA 5IKPA 3NYRA 4GW3A 1CJCA 4WACA 3UAYA 1QH0A 4J16C 3F9CA 3LY8A 2P2DA 3HMKA 3SM9A 1VI5A 1REQB 3UJNA 1DL5A 3JQFC 3LP8A 4JQYA 4M38A 4W6QA 1IONA 1O96B 2JJ8A 1I80A 4YMVA 4QA9A 1PX0A 4ZYVA 1AT1A 3UWSA 2H2IA 2AHRA 2QVLA 5CURA 4JEHA 4N3CA 4A0HA 2QM0A 1MLDA 1Q0PA 2R4TA 4C7OA 3SK0A 3F8TA 4BQEA 5B4UA 1YF3A 3LFHA 3H83A 4KITB 2HKIA 1EVEA 3QE9Y 3BIJA 4FMCB 3M6LA 3O38A 1R0CA 5CCDA 2Y66A 4OQYA 1K7XB 1WZCA 2CFTA 3AVYA 5FA5A 2GBLA 1MRNA 5IUNC 1A9XA 3GN2A 4KVFA 2G1PA 3H5IA 1LC0A 4CEJA 4K9MA 2QRZA 1D6NA 5BN3A 3UWOA 5J1SB 2P0YA 2M32A 1OQAA 4WECA 3VR6A 2YN0A 3NGMA 1O08A 4AF6A 3ET5A 3N70A 1DFHA 2Q1XA 1ZN2A 3IQGX 4OQMA 1T8SA 4P5DA 1Z34A 5DWDA 4P5EA 2OCIA 4E22A 3AEUA 1N2CE 1B3BA 5BT9A 1LDMA 2R25B 1L7MA 4E4TA 1F7UA 1P7VA 1NR5A 5EJIA 2PUHA 1UBOS 4ZDIA 3G7SA 3OA0A 4DY4A 1R10A 5GVSA 3NEYA 1Y8QA 8ATCA 4OLFA 1S7GA 2E4YA 3WNDA 3HDHA 1RU3A 1Z6GA 4L5YA 2PU5A 3D9QX 3U44A 3C6BA 3EQ2A 3GJ5A 1P2SA 2PZGA 4HNRA 2OZLA 1AK9A 4KHZA 3FLAA 1VCNA 2VZ8A 2PKQO 3R20A 2DULA 1XTIA 4NZYA 1QHYA 1TDJA 1QGUA 2XAUA 1JQ3A 2R5FA 4FHGA 4FMDF 3KHUA 1FSGA 2W83A 2NUBA 3OJ0A 4UXIA 2IZ1A 3VH2A 4DDHA 5BUZA 1XPOA 4XJXA 2ORIA 1K8XB 4KU4A 3RYIA 3UW3A 2ZG6A 4UPDA 3GCGA 3IUQA 2HA6A 3D2AA 4JOBA 5I5EA 2BFEA 2FZLA 4QGFA 3MM4A 5T7BA 2AOTB 4ZJYA 3WGKA 2Z30A 2C2YA 3A26A 2NUTB 3ABRB 4G1VA 3NBYC 5E3IA 3ZCQA 1VLZA 1G8HA 2EZ8A 1KDOA 1OFUA 2ZUWA 3DJYA 3KJZA 4KV7A 1Z0JA 1YMUA 2K7FA 4V1CA 1FFYA 2R48A 2EATA 1QS0A 3FH0A 5KPDA 2W6NA 3MAGA 3KOYA 3AVUA 5EE5B 1JH9A 1T5TA 3BMNA 4RPLA 1IUNA 4D4JA 3SIPA 1FUUA 3NIWA 1XT6A 2CYCA 4WXYB 2VH2A 4GR9A 4CEIA 3O3MB 1M6VB 1Z4LA 2PTHA 3TZCA 3WRXC 1BAPA 1ISFA 3GRVA 4HRXA 5AYVA 1IK6A 2WE8A 1G8YA 1X92A 2JJMA 4EJ0A 3LUJA 5EFZA 4I55B 1OA0A 3BWEA 2QX6A 4ZICA 1IRIA 2WYUA 2I8CA 3G2JA 4KLCA 2C7GA 3GP3A 4LNHA 4XIIA 5EP2A 5TSDA 3UJ7A 2NWQA 3ABQB 1JIKA 3BSYA 3OOJA 3MQ4A 2RJ3A 1NXTA 2WUWE 4LXYA 4OK3A 4RA9B 3UB4A 4RH1A 5HE9A 4DXHA 2RCYA 1EP9A 2L42A 2P2SA 1FXWF 3E9DA 4FYHA 4R8MA 1R9MA 4E6EA 4DSZA 5ES4B 3UA3A 1KO8A 4Y6LA 2I4NA 1WEHA 1H0KA 1JAYA 3NHPA 3R44A 3TRKA 1DUIA 2WFLB 4JLMA 5CDSA 4F93B 4KBYA 1Z5WA 1L1FA 4CKWA 3SBOA 1E4OA 2NPOA 3CHYA 3ONDA 1ZK2A 5CFOA 1KYZA 5F5XA 4GZLA 4DBVO 4Z2AA 2ZKIA 1FYVA 4ZVTA 3U4AA 3NBAA 3WIUA 1Z4QA 2AFRA 2KBFA 4ZVKA 3K20A 4HQNA 4P35A 1CUAA 3H13A 1YK1A 2CVQA 3FKQA 2V96A 1U8FO 3B48A 1PP4A 3PTLA 4UOQA 5FKJA 3VR1A 3UMYA 1KGDA 5IT9A 2B8EA 3IOBA 4TXJA 1M2OA 4DANA 1KKUA 5JS7A 4D3DA 2BF7A 4PG5A 3RUHA 5HXAA 3ZJVA 2A1TS 3N7UA 1ODTC 2IEZA 1W48A 3PGXA 4FEAA 2XRZA 4G56A 4B6GA 1P8JA 1V5IA 5JS2A 5I4IA 1EGAA 4Y67A 4RFVA 2XE8A 3WBBA 3WXMA 5A4JA 3GRKA 4D5EA 4LFCB 4UHHA 2GESA 5EZQA 1RRKA 2CXPA 2PUWA 4FIZA 4QBFA 4FUQA 1EUYA 4V3BA 4E11A 1Y6FA 2ZTHA 3MT7A 1HTBA 4Y7CA 3LU1A 2BKVA 1ZMTA 3QEOA 3PC3A 1O4WA 2FGKA 1NUUA 2OBXA 2VJPA 3IT3A 5LSAA 5EXEA 5JVDB 1TUBB 2HXYA 4O2BB 4M1YA 4Z54A 1EUDA 4IEFB 1LW7A 3VVMA 1E2HA 1QPGA 3H5NA 3KT6A 2BGRA 4A5OA 5J4VA 3RIXA 3R3HA 4JUFA 3X0DA 3F90A 4E5DA 1C9YA 4XTRA 1WW3A 4S0XA 5DHRA 1TA4A 4LXTA 3W5JA 1UPUA 1UOQA 2OCBA 2WWTA 1BXKA 3INNA 1U8UA 2VDPB 1Z2EA 4FSDA 5CBPB 4B6RA 1LJUA 3EULA 3HBLA 4BQIA 4X65B 1WBBA 1CEEA 4PZEA 3GF4A 1ICEA 1GSHA 5JSKA 1MJHA 3TFQA 4EFNA 2VSNA 3KQWA 1RMYA 2HNKA 4Y1GA 4RD4A 4C08A 3K0HA 4GX5A 4RK4A 1JDZA 5JYEA 5KVQA 2PUCA 1GN9A 2DHEA 2HN9A 5E3JA 1XMPA 3RFXA 4B3IA 4KRYA 3CZ5A 3JXEA 3SQDA 4HMQA 3T9DA 2G70A 4KO4S 4EHFA 4QEZA 3H04A 2V97A 1JEQA 4KYIB 4P83A 3F1LA 4AP9A 2WU3A 3PNSA 4L08A 2V7UA 3FZEA 5JPIA 3ROGA 3V1MA 1ZQ1A 1WHSB 4J7AA 1TU0A 3OCWA 4JR2A 3GQVA 5ECYA 1ZGZA 1Q7TA 3DXFA 1GP2A 4KN9S 5ALEA 1Q0QA 1OYYA 3ETJA 4FGKA 1IXZA 2J4CA 5DLEA 3WQSB 3RAGA 3S8YA 4UPEA 3VU9A 1KEEA 3CLTD 1T34A 4TKUA 4AROA 2YOHA 4QUKA 4FUTA 5IZ4A 2Z9BA 3HH8A 3L8DA 4NCJA 1U0BB 1VIMA 2JFNA 4YV1A 3AZPA