2Q7OE

Structure of human purine nucleoside phosphorylase in complex with l-immucillin-h
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
284
structure length
284
Chain Sequence
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title L-Enantiomers of transition state analogue inhibitors bound to human purine nucleoside phosphorylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 284
sequence length 284
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q7oE00
1Y1SA 4OJTA 4TYMA 4U2KA 4FFSA 5C80A 2ISCA 1NW4A 4NY1A 1U1DA 4QEZA 2OECA 4QASA 4JWTA 1ODKA 3OZBA 2HSWA 5EUBA 4OGKA 4I2VA 1K9SA 1Y6RA 1YBFA 3PHCA 4BMYA 4WKPA 3E0QA 1RSZA 1V45E 3OCCA 1PR2A 4D98A 4WKBA 4WKCA 4F3KA 1ULBA 2QPLA 3FB1A 4IP0A 3E9RA 4OGLA 4LDNA 3LA8A 1PF7E 3BGSA 4TXLA 4R2WA 1T8WA 5F73A 1Y1TA 5B7QA 3DF9A 1U1FA 1TD1A 3PNPA 2AI3A 1PR0A 3OOHA 3KUKA 1JDUA 3F8WA 1PR1A 5CCDA 4JP5A 1Z5PA 4BN0A 4JOSA 4BMXA 3QPBA 3KHSA 4H1TA 1YQUA 4RJ2A 1K3FA 4L6IA 1JE0A 1VMKA 1RXUA 2I8AA 4P54A 1JDZA 4G8JA 4G41A 4PNPA 2HWUA 1PR4A 3UAXA 1A9QA 3BL6A 5F7ZA 4WKNA 1PR5A 1Z34A 1VHJA 4R2XA 5F78A 1WTAA 1K27A 4L5YA 2PGAA 4QFBA 4TXJA 5ETJA 4K6OA 4DAEA 1YRYE 1JPVA 1ZL2A 1XE3A 2XRFA 1LVUA 3UAVA 2HRDA 3T94A 4TXHA 1A69A 3EUFA 3LBAA 3NBQA 1C3XA 3INYA 3LGSA 1OV6A 4D9HA 4LNAA 4DARA 2AI1A 4NS1A 1RXSA 1ECPA 4OF4A 3PNSA 1ODLA 1PW7A 1RCTE 3O4VA 1ULAA 3OZCA 4R31A 2A0WA 3E9ZA 1TGVA 4L5AA 4EB8A 4DAOA 4YO8A 4TS3A 1YR3A 4TTAA 1U1GA 5B7GA 2I4TA 1SD1A 4D8VA 1SJ9A 1YQQA 1Y1QA 1QE5A 4M3NA 1JDVA 1V41E 3BSFA 1CB0A 1JE1A 4MCHA 1Z36A 5F77A 3KVYA 1PK9A 1TCUA 3P0FA 1Y6QA 2GUWA 5DK6A 3P0EA 3FWPA 1FXUA 4L0MA 5CYGA 3DDOA 1A9RA 3OF3A 1A9PA 1A9TA 4NSNA 1OU4A 1OTYA 3UT6A 5IU6A 1T8RA 4WKOA 2RJ3A 1T8YA 2QDKA 4QATA 3PHBE 2IQ5A 1TCVA 1JP7A 1V48A 4DABA 1ODIA 4UC0A 1Z35A 4OEHA 3KU4A 3UAZA 1Z38A 1RT9A 3OOEA 3EMVA 2Q7OE 3KVVA 3NM5A 3NM4A 1PWYE 1JYSA 3ENZA 1PKEA 3GGSA 1RFGE 4X24A 1Y1RA 1PBNA 1Q1GA 1A9SA 5KB3A 3UAYA 4DA7A 5IFKA 1V4NA 4OY3A 4DANA 3UAWA 2OC4A 3IEXA 4E1VA 1I80A 2ON6A 5F7XA 1NC1A 3FOWA 2H8GA 1OUMA 2QTTA 3OZDA 3GB9A 2OC9A 5CYFA 4QAQA 4MARA 5K1ZA 1ZOSA 1OTXA 1T8SA 4GMHA 4QARA 2P4SA 1RXCA 4M7WA 5FAKA 5CXQA 4GKAA 5F7OA 3D1VA 5F76A 3K8QA 3FNQA 1PR6A 5CXSA 1JDTA 1LX7A 1SQ6A 4EARA 1B8NA 4YMLA 3EUEA 1SD2A 1VFNA 3MMSA 2A0YA 3IOMA 5JPCA 5F7JA 4MCIA 3C74A 1LV8A 2BSXA 2HN9A 1RR6A 1NC3A 1CG6A 1U1EA 3FAZA 1M73E 4LZWA 1RXYA 2AC7A 3KVRA 1A9OA 1OVGA 3FUCA 2OXFA 1N3IA 3OZEA 3O6VA 2AI2A 3NM6B 4PR3A 4G89A 3DP9A 1G2OA 4F2PA 1TGYA 4GLFA 5CCEA 1T0UA 3DPSA 1Z39A 2A0XA 4YNBA 4KN5A 1Z37A 1V2HE 4TTJA 4LKRA 4YJKA 5I3CA 4TS9A 1V3QE 5B7NA 4DA0A 4LNHA 3MB8A 5B7PA 4F3CA 1JDSA 1ODJA 3TL6A 4DA6A 1PK7A 4D8XA 4TTIA 5EFOA 4F2WA 4ECEA 4DA8A 4M1EA 2B94A 1RYZA 1Z33A 4D8YA 2QSUA 3DJFA 4GLJA 3ODGA 1B8OA 1Z5NA 2QTGA 4L5CA 4BMZA 3U40A 3BJEA 3EEIA 1U1CA 2A8YA 3SCZA 3OPVA 4TXMA 3K8OE 4F1WA 4TXNA 3ONVA 1Z5OA 5EPUA 1VHWA
chains in the Genus database with same CATH superfamily
2QJTA 2VJLA 3QVTA 2CBXA 1VIAA 3TQCA 1ADGA 3UHPA 3UMCA 1FMTA 3I34X 1LU9A 2OFXA 3W04A 4J03A 4EY8A 4IRMA 3G0BA 1QVRA 2P5SA 3DHEA 2WICA 1LBHA 2P6PA 3PNYA 3PUZA 4MO9A 4TYMA 5H9VA 3SVZA 4BO3A 2XXAB 2VCEA 4U7PB 4MR8A 3BMNB 5AT1A 5U4XA 3FR8A 3SNKA 4ZI3A 3RF6A 2NV2B 3SQLA 3LTEA 1F8XA 4NY1A 4RVHA 4UAGA 2G07A 1BCSA 1PNVA 2J7PD 1C7FA 3GFQA 4OQNA 3RT7A 3OPYA 4QASA 1ZN7A 4RTKA 3LBIA 3NC0C 3KJXA 2JGNA 1X0XA 1DIOB 1QNFA 1W46A 2GCOA 1JZQA 1OILA 1QH8B 2HQSA 2Y1KA 1Q44A 3AEQA 3F98A 3GGOA 2DWCA 3PHCA 5EMNA 5KCMA 3C43A 3UBMA 1ZPDA 4BNMA 2PK3A 4GX5A 3ESQA 3I5XA 1T6NA 1CUWA 5FI5A 3A3OA 2WY2D 1G2QA 1AY0A 1Z0FA 1BQ4A 4HFNA 3A28A 1V45E 1Y98A 3F8SA 3WK9A 1PR2A 2ZYVX 1SBHA 1QH1B 2BGNA 3FPGA 3JSAA 3KPYA 4ZEXA 3D6MA 4GP6A 1TAQA 2HU7A 3U56A 2XNDA 1FVOA 2BGIA 2QPLA 2YHIB 4KQCA 1XVUA 2J45A 3L04A 1G60A 3BWXA 5PGMA 4R2LA 3CLRD 3FUXA 4IDQA 3RFXA 3LS2A 4JP1A 1MTZA 2BJWA 3H9QA 3RE1A 3ZDAA 1C9JA 1AN9A 2ZBQA 4V0KA 1EKXA 3FYHA 1VMAA 1EDBA 2RGWA 1TRHA 1VSTA 4PZAA 1EBUA 4LAFA 1Q0PA 1TM5E 1AA9A 3LU1A 1VLLA 3ZR4B 2Z98A 4M9SA 4ZTZB 2R47A 1L7VC 3BE5A 1YDGA 2IH4A 4BLUA 3ETGA 1S3GA 4QYWA 2FP3A 2IIPA 3GVIA 5FOQA 2XNDD 2VAPA 2WM3A 4G5SA 3F8WA 4RH3A 3F3MA 2V65A 3ANLA 3JQGA 3O0TA 3QE3A 4LV5B 3ZVKA 4ZVKA 4B83A 1KZ9A 3B2QA 4QPDA 1SUEA 4RGVA 3BZWA 1G21A 4FONA 4MYDA 5DHTA 3S2IA 1EVIA 3HVRA 1TT7A 1A76A 1BAPA 1CQXA 1FP4A 1U8FO 3MQFA 4JI0B 3EZ6A 1P0PA 1HE5A 3C3BA 5LLTA 1KO4A 1YZHA 3MTJA 1WB9A 3IEVA 2WUFA 2PKCA 1RJ9B 3H4TA 4WKGA 2WQZA 3B38A 5AK5A 4ND6A 2R8PA 3PXAA 1IHXA 4OXIA 3ID6C 2GBLC 1TUIA 4L4YA 3BRCA 3CG0A 4D46A 2WFAA 3CUYA 2I3ZA 4ZALA 2VZ0A 4EKDA 1PUXA 2VR1A 2ZJ8A 2A59A 4ZT2A 2MR5A 5ELLA 1KXJA 2XLCA 3FDZB 3Q8XB 2ADOA 4NCKA 2JJ2D 1GSIA 3N2NA 5F2KA 4E5UA 5DCUA 1FLAA 1G5PA 4D82A 3CSDA 4AB1A 3WJ2A 4V0LA 5F78A 3Q85A 3DYVA 1NAIA 4FNMA 3GJSA 1TMGE 2AZ4A 1ZESA 2I34A 4TXJA 1N34B 1E1RA 1IHPA 3IKLA 2NUTA 4YQFA 3JXEA 3SKYA 3VYSB 1DG9A 1PZMA 4UDOA 3GRCA 2VVTA 3G0HA 2B8TA 1V96A 1UOPA 1LQTA 5T6BA 3DBLB 1IONA 3THYB 2AOUA 1RPNA 1S2DA 4YAKA 3MMZA 2DPYA 3H83A 4TKVA 5L9AA 2AQIA 4ZYTA 1NX9A 3EFEA 1GQOA 5FUWA 5J2TA 5E4JA 1HOTA 4YJ3F 3T9CA 5JYDA 2X6QA 3HKEB 3TLAA 2AW3A 4U2GA 4C3VA 4JUAA 2ZIWB 4F8YA 2HCRA 1H9AA 5B37A 5L3QA 1JNXX 1ESEA 4TXHA 5JE8A 3KWMA 1QK3A 1VIYA 1HNWB 2VLIA 1Y7LA 3CZ5A 3EUFA 3WBJA 4FFVA 3HP7A 3LBAA 1AD2A 1UXOA 1PQ4A 2Q46A 1PQPA 3L1VA 1T5BA 4JJFA 3Q3JB 2GZMA 2XADA 4ZO4A 1W5TA 5E8JA 3Q72A 1AGXA 2A9RA 1GITA 4OXYA 1IMJA 1X86B 4GHWA 3BMQB 1D5WA 1NW5A 2PRZA 2XHEA 4WFQA 4JX8A 4XWTA 5JD3A 2ZRCA 1RC1A 1YS9A 3MIIA 1FFXA 1SBTA 4BV3A 3RFCA 1RPZA 1IVYA 5CX1A 3KETA 1P5HA 2FR8C 1YK0A 3OE7A 4Y9SA 1VRCA 3U4CA 2HW8A 1I3NA 5COQA 1WQ4A 4OMDA 3TN7A 2GPNA 2FNAA 2JGDB 4XOUA 3ZGNA 4C4TA 4OBWA 4EKYA 2G1KA 4HATA 3TNFA 4R8SA 1QF7A 5EQJB 5A4MS 1NUSA 1A9YA 3ZNPA 3M0EA 4NJOA 5LCXA 2O4CA 1AXGA 4MA0A 5CLHA 3K0CC 3S2FA 4UFOA 1Z5GA 3WXBA 4DJDC 1ACJA 3AQ4A 5FWXB 2G5PA 5I5EA 3PX3A 1B0AA 1Q22A 1LPMA 3HH8A 1E2QA 1PWXA 5I7AA 5J5CA 3UJ3X 4EPVA 4QTYA 5JSQA 4CXMA 3QI2A 2ZU6A 4NABA 3VGJA 2IY9A 2PTHA 2VNHA 4D8VA 2C3UA 4FMBB 1XJWA 3K32A 3MG9A 3OE7D 5FR2A 4GL2A 2NSYA 3PHHA 1Q7EA 4Y2VA 2PVSA 4HB3A 5FL3A 3TR0A 4C7OB 4K2HA 3S1SA 1HC7A 1XQVA 4ES6A 1WMBA 4C4PA 1J2JA 3C7AA 3U9LA 2EJUA 3WL8A 1EWQA 5FPYA 1FVXA 1VLVA 1WM1A 3HCOA 3PQEA 2MSLA 4R6XA 4CEHB 2G1JA 2M1ZA 4B47A 4BZXA 4WAUA 3ZTYA 4E51A 1CB7A 3DLIA 2RE8A 1SC4A 1VHDA 3KUDA 1B6TA 4IFTA 1JLLA 4J9UE 4O4JB 3RARA 3HR7A 4UHDA 1M6NA 3CLSD 3HI4A 1RM0A 2ATEA 2BI8A 3I3OA 1ZBQA 2EGHA 1KMIY 1H8HA 3ETNA 4BFWA 2FWJA 1XCBA 3GOQA 3TG8A 4HFJA 5CIQA 3IEMA 4Q1BA 2J3JA 2G5GX 3CWZA 3KLOA 3HBNA 1K3UB 4MV4A 4B3HA 2R4TA 2IOFK 1Z6AA 3QVSA 3RRXA 4COKA 2MOKA 2XYGA 4D80A 1E9EA 1WU8A 2QL7A 4E88A 5K0GA 2DTDA 4RMJA 2EKDA 5CMLA 1ZU5A 1RJDA 1SVKA 4KPFC 9ATCA 1N1DA 2RHOA 2WJZB 2YR0A 3IP3A 3N2YA 2NU6B 1F1BA 4G23A 3LCVB 5H83A 1W4LA 3L6BA 3UNXA 1LDMA 1DV2A 2GAOA 3EXG1 1WHTA 1U4SA 3O8DA 5FDFA 1FJXA 2Q1TA 3IPLA 3R41A 3I92A 3AEUB 4RA9B 1GRNA 3EIOA 4REOA 1JKJB 2ZKIA 5AKEA 5IXSA 1G8GA 4ZGGA 2AF3C 1PHPA 1VCNA 3A9SA 5CA0B 4W5RA 1CJMA 5ICFA 3V4OA 1WABA 1OV4A 4RTLA 4FX5A 4TZTA 3R9KA 3RNLA 3HN7A 1CKEA 4QG7A 3LK6A 4XJTA 4KR2A 5SZKB 2Q6OA 2Z5FA 3M6LA 4GYJA 3RJMA 1YAHA 1M1YA 5EAIA 2FK8A 2XYVA 3QVWA 3RRFA 4MR7B 2R7MA 3A6JA 1XYGA 3H5WA 4JMLA 4YT4A 5IVKA 3OURA 2BGTA 1ZH8A 3AKZA 1GR0A 1GRQA 3O7WA 3OESA 3ML1A 4LZNA 1F8FA 1N9KA 2GJ8A 3BM5A 4DEXA 4OSOA 3P9QA 1U0JA 3STXA 5BXYA 5C8YB 3ZWAA 2CDAA 2FLVA 2Q2NA 4EYQA 4ZCTA 1LEHA 2V7PA 1CSEE 2R00C 1IHUA 4FYIA 1MJHA 4JBNA 1CX9B 4D41A 2Z6UA 1M76A 4LZOA 3E9EA 3GI1A 1NRIA 1ZD3A 2MINA 2O2IA 2G5CA 4JIMA 4NBTA 1JR6A 1QFYA 3MGCA 4CTMA 4ZMSA 4L74A 1TRKA 2FTKE 4PQYA 2XQKA 3H3JA 3DZFA 3PXEA 1L4LA 3KV3O 3Q3GE 1HLPA 1CHNA 1NTRA 2JBAB 2OILA 1IRXA 4LEIA 1DUSA 1SC3A 4BJ6A 2QVZX 2REQB 3UHJA 4DXAA 1HMPA 3CH5A 1SXJE 3UKDA 1RE1A 4YCBA 5DOVA 4Z4CA 1OZFA 4TT8A 5JD5A 1F8GA 1S9HA 2JW5A 2Q0QA 2XTNA 5JANA 1LJ8A 5HUQA 2UZIR 1LPAB 4JSTA 2ACWA 5ECWA 3LXUX 5B2FA 1WCV1 4LY9A 2O8DA 4CT4B 1JQKA 1Y6ZA 1EE2A 2IE8A 1Z7YA 4R68A 2ZJ0A 1DT3A 2O7VA 1T9GR 5JCOC 3BTUA 2CJWA 2I78A 2R3SA 5JAUA 2IHTA 3P0IA 2OV6A 4KGVA 1M8JA 1P31A 1ZC4A 2H52A 1MX1A 2WILA 4IRXA 4C7MA 5A7HA 2CCGA 3ZLTA 2PFKA 4QBIA 3UFXB 2G36A 4DNQA 1BEEA 4G5GA 3QEKA 3RRBA 1WSAA 4DLKA 1TK2A 4JH0A 4E30A 2QW1A 3C85A 3IPCA 4Q02A 2ADMA 3RAFC 4PAQA 3K70D 5T67A 1V8DA 1YAJA 4A2PA 3C5CA 4QDKA 3DD1A 2UYOA 5CXQA 3TEMA 2PSDA 3QMMA 3FRIA 4R1NA 2KPOA 5F7OA 3ZWWA 4MUJA 3QYPA 1EK6A 1XMJA 2ZTSA 4WZAE 3VUEA 4UHCA 4GLBA 1JZTA 4RQBA 3GLFE 2C4TA 3OX4A 3WYGA 4AUKA 1T0HB 4FHGA 1NNLA 3WADA 3EGDA 1B74A 1TJ4A 2AKYA 4RGQA 3RIXA 1F8UA 5MFZA 2PA3A 4RW0A 1D6JA 1EI9A 3KKOA 4YJ2A 5DK4A 4UAUA 3PJRA 2BGGA 2P40A 3IVXA 4TV8A 4ZC1A 2RGEA 1E77A 1H0SA 1MC8A 2D0DA 2ORWA 4C43A 4Q3LA 3FPFA 1SU6A 2OHGA 2VZEA 4ZVVA 4CF5A 2GF9A 3KP1A 4CMCA 4BQSA 4RGYA 2VBGA 1L1RA 2QJOA 3FAZA 1Q0RA 4OUKX 2OQRA 1GCUA 4PR0A 4B48A 2OCBA 3UKJA 3W6PA 3VYWA 2GA9A 2H57A 4K87A 3CJTA 2NPOA 2RGGA 4K6CA 3X0DA 5DP1A 4ZAWA 2QKYA 4LRUA 3LWNA 1R16A 3MWLA 5CT9A 4MKHA 3NXSA 1I51A 2P9JA 4M89A 1X7GA 2GGSA 4DUZB 2R96A 3JALB 4YAGA 2KHZA 3OIUA 1P2SA 4Q3EA 1S01A 2ZRGA 5DHFA 2A5YB 3FTNA 3HLKA 3OZEA 2QR2A 1BE6A 3BE6A 4LXQA 2BMJA 1EXMA 1YL7A 1NMYA 2FEPA 3LUFA 2FPXA 4LECA 4R2MA 4EJ6A 3ZE9A 2NZ2A 3GH3A 3JVDA 3NFYA 3H3XA 3UIEA 2WJAA 3ZZUA 4DQ0A 4LGCA 2OBBA 1G2OA 4Y9DA 4IWXA 1XVVA 5J1TB 3U3OA 2X3YA 1ZC3A 4Q9AA 5FNVA 4MQ5A 1Q20A 1NT4A 1Z22A 1NVMB 5FLKA 4TKLA 1PT7A 4KAAA 4TKUB 4DN6A 4YRRA 1VCMA 2CLFB 4FHFA 2XRMA 1CR0A 2GAAA 3WWPA 1ZCAA 4EM6A 2ZTUA 2ZRAA 5JY1A 2A9JA 1FA9A 1US8A 4GOLD 1XZEA 2JFGA 1SKQA 3B51X 2PANA 2WWYA 3SM9A 2XE4A 2YWCA 3O90A 2O2GA 4DCVA 1VC2A 1QOZA 3B5IA 4J4HA 4JVSB 1IXZA 4MVXA 4OHZA 1W93A 1EP3B 2VHTA 1E79A 4LQDA 5KS2A 5GP1A 1I24A 1HG0A 3OA0A 2VTKA 3MEQA 3ELUA 1JT9A 4K2AA 4LY3A 2CVQA 5EZQA 4K9PA 1KO7A 1XF1A 2BFPA 3IESA 1WPGA 1HDEA 3JR7A 3KJHA 3HUEA 4KRXA 4ALNA 5DGCA 2SNIE 3C3AA 1IBRA 1UDRA 2EQAA 4JB2A 4LISA 1VA4A 3LLUA 3UVEA 3ZNQA 5JNUA 4WBSA 2IV3A 4K0KB 3AXSA 3SIRA 4RTQA 5EIAA 4A1FA 4YRDA 1ZS9A 1M5TA 1TVKB 1UH5A 3BSWA 1Y3CE 3VBEA 5LYJF 4MVJF 2I76A 3OEYA 1IN1A 5LZ7A 2I1LA 2N1BA 1T0PA 2YYAA 1FTSA 3OHSX 1RWMA 2QIPA 1KDRA 5J58A 1N57A 2F1JA 1RACA 4K5QA 4E15A 1I9CA 1BGXT 3FGNA 3MZ0A 4GKJB 2VEOA 4KRYA 1I5OA 3IE0A 3OT4A 4LBVA 2W71A 1Z13A 1U3CA 2EKQA 3I01M 4I9GA 4IHJF 4JKYA 5GJCA 1D6SA 1X87A 1ORWA 1Z5WA 2KLHA 3N2ZB 2QRVA 2YY7A 1CR2A 2Q3LA 1LUAA 1UBOS 2J9FB 4U7HA 3BSSA 4ED9A 3AB7A 1ULZA 1SHLA 4DHWA 2J9ZB 3UMBA 1QQ7A 2JB9A 4BV9A 3T9BA 3OPNA 1BRMA 1VL2A 4LF4B 5IKEA 1FMCA 1LV7A 1LQUA 1NVKA 3IRVA 3PJFA 4CM5A 3ZKAA 3JATA 2IUUA 4AO6A 4FD3A 1ECCA 1RRGA 2D54A 4P08A 4DKXA 1XLTA 3COZA 3V34A 2O1SA 3PVSA 3GPDG 1JJ7A 5ISMA 3IAAA 1HSOA 3KDPA 3K4HA 3GLVA 1ZSVA 4OJTA 1IJKA 4DCNA 4HGZA 4E09A 1JBQA 2BGLA 4UBLA 1ZKDA 4WW0A 1LWOA 4P3YA 4C5CA 4MR9A 4U2KA 2AKAB 3DZBA 5BQOA 3RSLA 2O59A 3LQRA 2FMFA 3OEWA 5F5XA 1MABA 3C48A 1XBTA 4JL8A 1O96B 2D8MA 1NLFA 3AR6A 3Q12A 1V4VA 5EJ4A 3BXXA 4GMKA 3T3MB 2XGOA 4OMCA 3KXDA 4U6QA 2C54A 4JWTA 3DZJA 1MVLA 2H4JA 2RH8A 3OLZA 3ZIUA 3KX2A 4AN4A 1J33A 1Z4OA 2DH6A 1YFZA 4DG5A 1KJNA 4GXNA 3NHMA 1H3FA 1JT2A 1PR9A 2Q3EA 4HJRA 5DP2A 4JGGA 4KIUA 3QJ5A 3LDHA 4HDRB 4IOMA 3ADOA 3NDPA 2PGXA 3A31A 2DXIA 1DE0A 4HSGA 2K87A 2VQDA 3L0PA 1MF7A 2GHRA 2QVLA 2VHJA 1JXMA 4EO4A 4LFCB 1PKXA 1NXPA 2AG8A 4MWSA 1LLQA 2JLCA 4Q9JA 1EUCB 2JD1A 4O3MA 3RQSA 4I9HA 2JGLA 4LRQA 4CV0A 4QG3A 4WKBA 1WXDA 4QQNA 2BL4A 3HJGA 1LBQA 4DYVA 4NZ9A 1W9HA 1UUFA 3MYYA 3SEQA 1U2QA 4O2BA 3W5SA 1U7UA 3RYHB 2BFDB 1KL7A 1EB9A 2QQ0A 1A9ZA 1YJQA 4XB1A 3C5VA 3D3KA 1IQRA 1H94A 2XB4A 4DILA 1SXPA 3RFFA 1KZHA 2D8AA 3HCDA 2XTMA 1AF4A 3FMIA 3LBFA 3JYNA 5DBOA 4K81B 3F6YA 5G1OA 4EABA 5TQ0B 4F71A 2BHNA 3JYPA 4YP7A 4FWTA 4H0FA 4RJJA 1Y48E 2EFYA 4W8OA 1UDWA 2ISQA 1HGXA 2D13A 2PSHA 2Z1DA 3TIGA 3R0ZA 3EEOA 5CLIA 1CQJB 5LUBA 3MRXA 5KUTA 1EWTA 2AZMA 2BHSA 1TD1A 4GDMA 4B82A 2DVMA 1UPXA 2PX0A 5K01A 1WD7A 4HXEB 3G82C 1KOGA 2IYXA 3D8RA 5C3MA 2AOTB 3P71T 4HDMB 4RZIA 2NP6A 3HVUA 3K1AB 5I7OA 1YFLA 2NZYA 3L8MA 1ID1A 1TZMA 4UU0A 2P2LA 2WKRA 3ROKA 2VT2A 1S2LA 5A6SB 4CUKA 4I4LA 2FW1A 4WASA 2YIVX 5HZHA 3EULA 1J25A 2O2JA 1R64A 4LGVA 2GH1A 1D4OA 4G4JA 1GTG1 2OBYA 1D0IA 3U3ZA 4LPSA 2GLUA 1D2HA 3H84A 1S7CA 3LOUA 4KYVA 3H75A 4FFDA 3OE4A 5FH9A 1SK8A 3K35A 4WGGA 4D6XA 5HW0A 3P27A 3MLAA 1G7RA 3X1ZA 1V26A 2O6HA 3BFKA 2V5UA 2J30A 4JDPA 4MIEA 4O2AF 1J39A 4BMCA 4DUGD 1T3TA 1GRRA 4K9KA 5FF9A 4MW0A 5B57C 2P2YA 2YN4A 3OF5A 3LHKA 3QIAA 4YACA 4RANA 4C7XA 1HXHA 1BROA 1SRQA 4GU5A 4HH3C 4F85A 2R1TA 5DPMA 1J2TA 3NVDA 4NBLA 2C58A 1E1QA 3EXHB 2PX8A 2X9VA 2IHKA 3FVWA 4EYGA 5BR7A 1L3CA 1HZZC 3T0IA 1R5BA 1GSAA 3V8VA 2WJWA 1TFRA 4RSHA 1RHKA 4MVWA 2V7QA 3THXB 1NQWA 4TL9A 2F3TA 5FBVB 1JPVA 2NV0A 2FW0A 2CD9A 3MMPA 1H6AA 1XHEA 2H65A 1BH6A 1J9EA 2BFEB 1OREA 4UNRA 5FPPA 4XRRA 4XUCA 1EZ4A 4B3TB 1TF7A 2KW5A 3ANSA 2P8SA 3AV0B 4H6PA 4QRIA 5JWOA 5JY6A 4CG2A 5B1HA 4F2HA 3SYTA 3UTCA 5LXTF 1DZ3A 5IC4A 1BYIA 1NA5A 1H9CA 4WOJA 2FPRA 2BR4A 1BWPA 3T5MA 1E1QD 4JEMA 4F21A 4JLWA 1I3KA 1KSJA 3NANA 1OX5A 1RMQA 2XAAA 4G97A 2HPAA 1JSRA 5GONF 1ISFA 2PZLA 4IX9A 3NASA 2V7QD 1CBUA 1E7YA 3TLJA 1MNQA 1YL5A 4GZ5A 4RM2A 5I9BA 2JFQA 4LJLA 4BWFB 2DBRA 3TLEA 1P81A 2V5AA 3QHPA 1MA3A 4JVMA 4JLBA 5E95A 2VDJA 1G16A 2A0KA 4Y2HA 4G5FA 4HEHA 4MGKR 5BSFA 2D1YA 1LPNA 4PLZA 2GYUA 3FZYA 1P39A 2EEPA 2H1IA 3UK1A 3UFBA 1CR4A 1DWUA 3CX7A 2R0QC 2G63A 1UFQA 5F1PA 4HB0A 4DCUA 3RCBA 2A1UB 4LYYA 1YJBA 4NK4A 4Q3CA 1RCTE 2E4UA 1ULAA 2ZJ7A 3ESYA 2OLJA 4LPKA 4YREA 3TTTA 3CF6R 3KHUA 3G2HA 3W2IA 3RFTA 5J4VA 1QZXA 3R5JA 4I5GA 3UYLA 4IZOA 4JGBA 1R4NA 1H4VB 3DFUA 1RTTA 5IDVA 3ZHSA 1P7ZA 4W82A 3VPDA 2WW8A 4M8NE 3ZE0B 2V6IA 3JASB 2MDTA 4F2DA 4N65A 1V37A 4GZ6A 2QRPA 3DUFB 5JR3A 4D79A 3THOA 2RCYA 3IGFA 1WAMA 3U7RA 1CB0A 2EZTA 1BMDA 1DCKA 1I8TA 1TO1E 2J5QA 2O57A 2EW8A 3KZCA 3OO0A 2IT1A 3G88A 2WIGA 2LZ0A 1M8FA 2J32A 2KS6A 2VJMA 1J06A 3O47A 3PPYA 4NBSA 4O4IF 5KVQA 2JRCA 1R9MA 1VM6A 1CNEA 2MSDB 3B1YA 3OD5A 1IIBA 3QG1A 4G86A 2GEDA 2IL1A 2PLFA 3JAKB 4CUZA 1P73A 2EIXA 2B4RO 3F2VA 3P4YA 2P27A 1XUOA 4QGBA 5HVNA 5DX0A 1M34A 1NPYA 5IUJC 3I0NA 4LFAB 4UU8A 2X7JA 4MDYA 1Q7GA 1TIBA 1K6EA 5L95A 2AW5A 4NC9A 2NU9A 1FXUA 1D1PA 2AOVA 5FXMA 3T1TA 4ABYA 3WLKX 4MB6A 1DQSA 2OCXA 1UBNA 1FDUA 1K98A 2YFYA 3ENQA 1TZJA 3IALA 3R5KA 1ZITA 2YIJA 1M6YA 4U39A 5EHNA 2Z56A 3ZDEA 4Y6GB 5H3LA 1KTIA 4Q7QA 1L4KA 3ONEA 3QP9A 4H3HB 3E3LA 4JVLA 4RZUA 4B3IA 1W2GA 4B2IA 5ICEA 1WP9A 4IPTA 1J24A 2QT0A 4FJ2A 4J90A 5A2GA 3UJ8A 3WLPA 2EX0A 1JAXA 4CLRA 1P2UA 2ODWA 4D8WA 1XXLA 1Y3IA 2FJPA 1EWYA 2IITA 1VMEA 3NHKA 3HJBA 3JVUA 1W44A 4U9HS 3ZKWB 5INTA 3KOMA 4I4CA 1NG1A 5BUSA 3F8TA 4ZI2A 3KJFA 1DQNA 1THZA 5AVKA 1IPFA 3DBOB 1DKLA 2CXXA 2CW5A 2O50A 3IXQA 1DZIA 2DU8A 2EZ4A 4GPAA 5EZYB 2L42A 1J00A 4QUBA 1E9RA 1NQVA 1N3LA 1V48A 1QR2A 3RVKA 1LWNA 4B6QA 3NUGA 4RY8A 5C8DA 4PSVA 1CEYA 1M3SA 4QVGA 1JQEA 1JTEA 3A6ZA 3KB2A 5CP8A 1PFGA 5K2MA 1U9IA 2AJDA 3WOVA 5LPNA 1GA6A 4INZA 1KDTA 1Z38A 1RT9A 1ZGHA 2NN3C 4MQFB 5KQSA 2VF8A 2OGTA 3F6EX 2GZDA 1Y9DA 1DPGA 2XCTB 4OX9B 1L5HB 1E4YA 3NUQA 3NETA 3WS7A 4QJ5A 3RR2A 4LOKA 1JEYA 5JO9A 2NIPA 2E21A 1MMFB 3ZWOA 2R7KA 4FKZA 1IY0A 5AM0A 4M53A 5KPDA 1II9A 1VBKA 4KE6A 4E33A 4GM4A 4UJ5A 3AVVA 8MHTA 2BTQB 1QRSA 4BNVA 4HRAA 4BBJA 3A9WA 4BO2A 1QO7A 2GCGA 4QZVA 5D3MA 1CQWA 1X7WA 5EHQA 3MJEA 5CG1A 2BGMA 3IEUA 3UW1A 5JALA 1OJ7A 1Z17A 5LBTA 4B17A 1XTKA 3T7RA 2EATA 2FV8A 4EFNA 2WKWA 3N0RA 3SNHA 4B6OA 5LMNB 3NHJA 3NMUF 4OFBA 1Y37A 1IXRC 2RONA 5AO9A 3E23A 3I6IA 5KB3A 1OKKA 2OORA 4UPDA 3T12A 4E21A 3RYFA 1P6UA 2G7ZA 2VSYA 2C4KA 3IEIA 4EY4A 5IFKA 1O95C 1I36A 2Q5QA 3E7PA 2NZXA 4JCCA 3PGLA 4R1UA 2EL7A 3HY3A 3KQTA 3ZG6A 1WMFA 4MRMB 4YI5A 1XCJA 4P4NA 2L18A 4YQZA 3TPZA 4ENVA 3M6FA 1KARA 1PDOA 3H8WA 2X2PA 2ZIFA 3IEXA 5TMDA 5FUVA 3TJMA 3WLAA 4BJ1A 5LQKA 2ZREA 5ED0A 4E5DA 2JI8A 1EGVB 1LSOA 3A4YA 2X9NA 2WHPA 3K1TA 4YFVA 1WCWA 2DM6A 4QX6A 5IHXA 1R4MB 1OGYA 1WR8A 4URUR 5AESA 3TNLA 3WKEA 2ATVA 5F7XA 2CXRA 2IHVA 1KJJA 1OI7A 4B7UA 3RSGA 2GXAA 2DHDA 3M1YA 1STOA 4BVAA 4Z4EA 4NL4H 4R83A 3T4PA 5BPHA 1K7YA 1L4FA 3WKCA 1ZCFA 5T8KA 1WNFA 5K1ZA 4MRSA 5KNBA 3KPWA 3GLQA 4KI7A 1E18A 3DKVA 2WF5A 5KOJB 4L2IB 4DRZA 3QEBZ 3Q3IA 2H0AA 3D2LA 3UATA 1UIMA 5DW3A 1UBJS 1M7GA 4DREA 3SJ7A 3WLMA 2EG5A 4A0FA 1RHMA 3IA2A 3LW8A 3RC7A 2W6PA 1RXCA 3HADA 3M5DA 3IKMB 1DUIA 3H1EA 4GW3A 4E7PA 4BPRA 3WWOA 4IGKA 1KY5A 1W59A 2PS0A 3D1VA 5F76A 3AY0A 4ARIA 2DOKA 4PFJA 2DGDA 3S2ZA 3IQXA 4OM7A 5THXA 1LX7A 2W2KA 3Q0IA 4PG5A 2A84A 3HJRA 1QIGA 1EK0A 4GS5A 4D4LA 1OSNA 4M1KA 1U2ZA 1UFRA 4LC0A 1GTZA 4GPTA 3FNHA 3KJZA 3TOXA 3IOMA 4C0KA 1IVSA 1GT91 5EVJA 4RTOA 3M33A 1R50A 2ZJ3A 4HS4A 3ZY2A 2H4YA 3ABQB 1X14A 1XP5A 4GD3Q 1DBSA 2PX3A 4LW8A 1JIQA 3LP6A 4WK6A 3B1FA 1NC3A 3TI9A 1N36B 3CG4A 4QSHA 1YJ5A 1BDHA 3U1BA 4D43A 2DSTA 3FUWA 4BNLA 1JX6A 4ND4A 1A72A 1Q3KA 1CJSA 4JLSA 1XNJA 4BO9A 4E08A 5ALEA 1OVMA 3ABSB 2XD9A 3R6WA 4EJSC 4CFZA 3KBBA 4EQ6B 2Q3BA 3PU6A 3B2EA 4ARZA 4DSZA 5LDHA 1WUHS 2OXFA 2QRUA 3FZQA 3SJUA 3T38A 4OH7A 1CVIA 4G84A 3TQTA 3M1AA 4L08A 3EEQA 3TKLA 4B7ZA 1J8QA 5FO0A 2YVAA 4N39A 1LKZA 5T64A 1O0SA 1UT8A 4OB6A 1VRVA 2DFLA 2AB0A 4UNNA 4UCWA 3TZCA 3VPFA 1LBEA 3VO8A 4F7DA 4RMGA 4AKTA 4F8EA 3N7UA 4HNRA 1MRZA 1KO1A 1EBBA 1ZNWA 1QCCA 4TV9A 2OBFA 1KORA 1LI7A 4NYMQ 4BO6A 3DZDA 4L22A 5IP5A 3QXJA 3AHFA 4NOKA 2QBYA 1KOJA 2JCGA 2NAPA 3GFRA 4DR4B 1HDXA 3M6IA 5FBLB 3SHQA 5JEEA 1FDTA 5EIBC 3C5HA 4TQUS 3UQZA 5EGNA 1TZKA 2W6IA 2VNJA 3EXFB 3C41J 2P2NA 3D8HA 3L3BA 4QKQA 3ZHZA 2W8BB 2IYRA 3NAZA 4JEUA 4C3ZA 3LUJA 3C3CA 3V4LA 5B7PA 1B8VA 4J7CA 2FF5A 3AEZA 3AUFA 3HVIA 4IEIA 5D5HA 5M5BA 2CSXA 2OFOA 3QE4A 3GJ8A 3CWCA 2QQEA 4QGFA 1NBAA 3BEDA 5CBPA 3AO0B 4KNWA 2R7AA 2QX7A 1UBLS 2R7NA 3IP8A 4MEAA 4PV7A 3CZ9A 3ZE7A 5IANA 5KHOC 3O8RA 5K0CA 3GLHB 1N2IA 2UVPB 3BS4A 4MMZB 3U2QA 2Q4EA 1OX4A 3E84A 3KSAC 1R0XA 2O14A 3W79A 4D9IA 2NTJA 2W6ID 1NW8A 1AZLA 1L6IA 1YOVA 4FYPA 4M1EA 1XJ0A 1IJEA 4DA8A 4ER6A 4WH0A 5A62A 1P9WA 2WWTA 4LWOA 3U3DA 4TT3D 5I7UA 3TFQA 4FOPA 3Q3VA 3IAXA 4YRQA 4QL3A 1NNI1 1O03A 1U0RA 2A9QA 2XZDA 2MSNA 3DWFA 3NJ4A 4M0CA 2HBQA 4XVUA 2PUFA 4Q05A 1JKIA 1EFVB 1XLUA 3A6FA 4ZOLB 4FX2A 2XAUA 1VB3A 4OKIA 3ODPA 5FI1B 3SDBA 4IH4A 2BMFA 3A9TA 4M22A 4GT1A 4PC2A 3TOVA 4NU8X 4BNDB 2ZCVA 1SUSA 2TRSB 4DMFA 3TLCA 4LRSB 3VU9B 1YR6A 3ZXYA 4AJLA 2GARA 2ZT6A 4JZKA 1QIHA 1PJRA 3REOA 3V7YA 3W1EA 4XYLA 3VPXA 5B4TA 1NDHA 3ZY4A 3N7AA 3BGDA 3K5HA 3W5VA 4EUNA 2WWGA 4OQPA 1A04A 3ND8A 5JMOA 1QYVA 2OK7A 2JFPA 2WWHA 4UREA 4BJ3A 2YYZA 3I05A 1QR6A 2CDBA 4M87A 2ODEA 1GIAA 2AL7A 2JK1A 1RMTA 2YZ7A 5DU2A 3BFPA 1DLJA 1E0JA 3KJQA 1QZZA 3QWBA 4YASA 2C8KA 2EKBA 2IZ6A 3E22B 1OHHA 1GGMA 1S0UA 2HF9A 2HQRA 2PUTA 2V59A 2QYSA 3M6MD 4KN9S 4X41A 1IZYA 3NYWA 4AJ2A 1NW4A 1Y63A 2DQSA 3LY5A 4BS9A 2DHEA 1X1TA 1B6GA 1RYYA 4HYYA 4KLAA 2FEXA 3ZDCA 4F4HA 4G0MA 4UCFA 1F0YA 5AW2A 4GI5A 1SKUA 2ZZNA 2ZWPA 5ALUA 4ZEMA 3EODA 5E4FA 2BHTA 3K09C 4AF8A 4IXDA 3PUYA 2EFCB 2RJNA 5E9WA 1DVRA 1YF3A 2XB2A 1F06A 2Q2OA 3FRJA 4WBNF 1YSCA 1RLOA 4FFMA 4HNVA 2ENWA 3MGBA 1Z82A 2C1ZA 2QQGA 1OHHD 1ZUNB 2X76A 3H9JA 2YIDA 1GPKA 3L02A 1YRQA 3Q40A 4Z8YA 1FDIA 1B00A 1B76A 4C01A 1ST2A 5KYXA 5AKIA 4N0QA 1PSWA 5DX8A 2FHPA 2ICAA 1S8OA 4RKEA 1DC6A 4A03A 2M98A 2X0IA 2YC2C 4JLDA 1T1IA 2ZSBA 3HACA 1EWRA 3OPQA 1QYRA 3R6DA 2IUYA 4UBKA 2OD2A 2X4IA 4LDNA 5EXSA 3FIJA 1N2ZA 1FFBA 2DR3A 1N2HA 2HOQA 2GXQA 2I2BA 2V9CA 4GOXA 4FVTA 3R9IA 3J81A 1EHCA 4LK2A 1JJFA 2OZLB 3K0FA 4JHXA 4C4SA 2I2CA 2NAFA 4BKMA 1KBZA 1JPJA 1XG5A 4RD2A 4MJ7A 4YCSA 4FGSA 2XUJA 2UZAA 1CQIB 4CKWA 2CNWA 2VPTA 3A8TA 3DGFC 4C3UA 1NJFA 1LLUA 1Z2AA 1L7PA 4ZCSA 1NLUA 3ZH2A 4LTDA 1T13A 4X1KA 2YMQA 4H35A 4J6EA 3URKA 5CD9A 3TLGA 3LPAA 4Y9TA 3VFDA 4EGFA 3TOZA 3WTCA 2VHYA 3AFNA 2EFDB 3JSXA 4PPQA 2ZK7A 4IICA 5TMBA 1TT5B 4D81A 5NULA 3U62A 2AS0A 1KS2A 3MWDB 1OBCA 2B0JA 1X38A 4ZQBA 3PHGA 5A5DA 4L4XA 1NQOA 2YIMA 5C35A 3HP1A 1O6ZA 3AZQA 3KT8A 2EBWA 1JN0A 4Y3UA 1AZTA 2VAXA 4RJ2A 5I9MA 5JCXA 3FWHA 4C6RA 1YXMA 1JE0A 4NE2A 4LXHA 2Q0SA 3FPJA 3E8SA 2A7QA 1P8AA 1AKEA 1NQ5A 3IFSA 3EB9A 3KTDA 3MWFA 4QQKA 4TN5A 1O4WA 5KX5F 1AQNA 2YJNA 3EFOA 4IIJA 5JZOA 2YQ4A 1P5JA 3P9PA 5LFAA 2C82A 2CB9A 3MPUA 1QHGA 3PWKA 4RK0A 4FS8A 4YI3A 4UW9A 4IRUB 3FPCA 3HABA 3TKAA 3S0JA 2VQFB 4Z53A 2IYEA 4LDAA 1U7WA 2YZGA 5LZ4A 3CJQA 3ICPA 1QGYA 4JJAA 5LQUA 5ETJA 5AUNB 2O3JA 1ULSA 2YVLA 3H11B 5K0JA 5KWSA 4URYR 3A1TA 3T41A 1BFDA 2FQWA 4AQYB 3H8SA 1BMQA 1AJEA 4Q7KA 3PGMA 4EA8A 4MWGA 4BU0A 4A0HA 4IUBS 2YICA 1JB9A 4WESB 4BMOB 1HOXA 2J0EA 3NOQA 5JH7A 1LLFA 5CDYA 2JEOA 4UTNA 3FYDA 4XOIA 1T3ZA 4OUDB 2W42A 1AT1A 3DTVB 2PX6A 2GBIA 2H1CA 5F12A 3Q41A 1OB2A 1FFCA 1E5LA 2YZMA 1KPIA 2UUAB 1FY2A 3ZDQA 1GR1A 3ONDA 1GILA 2JIQA 1JI3A 1NW3A 4FMCF 4GBJA 3VSEA 3QQPA 5CRIA 2I54A 3NBQA 4MYCA 4X5OA 2G1AA 1UEXC 2A35A 3AC0A 3LGSA 3IJRA 2QPOA 1P4RA 1EFHA 1V6AA 3NRBA 4PSCA 1XI2A 4U6SA 3SXPA 3QA9A 3CBGA 2G83A 3X1KA 1AKQA 2VZLA 1Z07A 3AKDA 3G02A 3NHWA 1FBNA 3ADDA 1J20A 221PA 4KEAA 2HAEA 2H29A 4KPUA 1Y1PA 4NVRA 4AZ0A 4CMIB 1YZVA 1QYCA 2YOGA 1BDIA 2P1DA 4RTJA 1KETA 1U7HA 4O4HB 2MYNA 2BM8A 4OF4A 4M36A 4IBOA 4J43A 5A4JA 4C04A 1OMOA 2NU8B 4DIBA 2Z6VA 1ZGAA 5TS3A 3ZN2A 1AZWA 3PEVA 4FM9A 2BYTA 4EO9A 2E5LB 2J85A 1PEYA 3HLTA 4MW2A 4Q1EA 3H86A 3CRRA 4RIEA 1YB4A 4L6AA 1RZUA 1PZEA 5FOUA 3TBFA 1Q7BA 1NVBA 2ZJYA 5EMHA 1GG9A 4P4UA 2B3TA 4JZYA 4LZLA 4CV2A 4D0RA 1OH6A 3NZEA 3P94A 2J3MA 2F1OA 3PB3A 5A9SB 3ROPA 1TIPA 2KM1A 1YR3A 1II8B 4DMLA 1ISSA 2V96A 3DQQA 4WTOA 5F9MA 1W29A 2B5WA 4GYKA 2G3YA 1NIPA 2X0FA 1RAIA 3GFPA 1QKKA 3AVPA 3JQFC 2EQ5A 2HGZA 1P45A 2PYDA 4IIGA 2PGIA 4OIMA 4RYDA 4EKEA 1UMBB 3JU3A 1OYOA 2V54A 1W49A 3QXSA 4OFWA 3VNUA 2WOOA 2C7GA 3W8DA 3WQQA 4UTRA 1NRWA 1EK1A 1W25A 2PPVA 1NUAA 1LJUA 4ZYUA 4Q4HA 1SHTX 1S9DA 1X3SA 2X22A 3K1YA 4NYJR 5JDIA 3U16A 3Q7TA 4LJSA 1RNLA 2PX4A 4PSAA 5L53A 2FH5B 3UICA 2I55A 1SQGA 3NBMA 4L8GA 4D6PA 4E5KA 5ICMA 2HYIC 2BKUA 4IO1A 1J9GA 2QLNA 3LCMA 2B4KA 3P0EA 5JEDA 5ALQA 1Y89A 1ZM7A 3WJ1A 3DCJA 3B89A 1KZ7B 1FTQA 4IQFA 1HFKA 1DC5A 2APJA 2VWGA 4RE6A 1JEQA 1CERA 4FFBB 4OXQA 5ALHA 1IYZA 3VX3A 1MH9A 2RGRA 1LZLA 1GGVA 3DKPA 3MUNA 4D9BA 1IM8A 1A9RA 3U4AA 5LBUA 1A9TA 3G9ZA 1IWBB 1K6MA 4XQGA 3TLYA 3KYJB 2XOKD 3REFA 4Z51A 2VK2A 3MUFA 1NBEA 2JAXA 3E5HA 3U1TA 4E5MA 3B78A 3OWHA 4HWTA 3CB2A 4BNJA 1W88B 2MYUA 2WYVA 3EA4A 4H08A 4HDKA 1KP2A 4XPIB 3C7TA 4N0DA 1U28A 3FOEC 4DYHA 3OEED 3BD7A 4H6WA 2DUUA 1K7FB 4CCYA 2PGLA 1N0IA 2IZ5A 1XD9A 2CLSA 1ORRA 2IYLD 2TMGA 3O9MA 4D9EA 1JFTA 5IJ9A 4H0NA 4C07A 5DYGA 4CNQA 4LX8A 2H54A 3F7OA 4AS3A 4AP9A 2Q3CA 4NV3A 1M2KA 4B43A 3B53X 5T4HA 2E37A 4HGOA 3W8NA 7YASA 1C0LA 3K9LA 3VR0A 3RUHA 1T2DA 2XOXA 1R0LA 2XX3A 3LZDA 3UAZA 1LPSA 2LP4Y 2XCOA 3BD6A 4KTVE 6ADHA 1Z2NX 3C6XA 3D3NA 5CH3A 5EWLB 3UK2A 1D2AA 3LQQA 2WMNB 5EE3A 4ETWA 2CYCA 4W5TA 3DMGA 3VH2A 5CEFA 1VIVA 1J22A 3K92A 2XBUA 3V33A 2LBPA 3IAFA 5IK2A 4W4TA 4YECA 1ZNQO 2AE2A 4B44A 1ETHA 1F17A 2Y6VA 3OZGA 4QOJA 1T5SA 1GCIA 1KAOA 1SUFA 5KDLA 1BMFA 2ASEA 2K6GA 4MMXB 5F64A 3VR3A 5A5FA 4P53A 5KTRA 3O4JA 2K2QB 3SC6A 4CMEC 5EP1A 2HIGA 3F6CA 4ZGWA 5LMUB 1NOJA 5K20A 3ELDA 1K08A 3PF9A 4G6ZA 4BB0A 1JDBC 1PBNA 2BP7B 3N28A 4IIDA 4TUYF 4LBWA 4V0ME 3U17A 1HWYA 3PJDA 3VR5A 4YR9A 5E6UA 3RS3A 3GIWA 3H5AA 4BATA 1YRWA 2CCJA 4I55A 4PBTA 4EYSA 1CZHA 3NH6A 2GHIA 4IDOA 2CL6X 3QBJA 4CLEA 4ZMBA 5CFPA 5IK2D 2I7XA 2A0FA 5D5PA 3FTFA 1JQJC 1OFIA 1WXQA 2YZ2A 4KBFA 4KXUA 1UOQA 1UMCA 1ACMA 1GKIA 3G1UA 2V7BA 4KBGA 4PU0A 3ZI4A 1QUEA 5ABPA 5AVTA 4U2CA 1E62A 1PT8A 3COYA 1V3TA 2DUWA 2WVJA 5G0TA 4Z2YA 3ZU2A 3VR5D 5D3QA 4UU7A 4ZYVA 2ODBA 4K88A 3CT4A 1JGTA 3OTHA 4IF6A 2V3VA 4L9AA 3P0JA 4LSWA 3RRZA 4NXMB 4QNNA 3DVQX 3TGWA 3L1HA 5B1EA 4HQNA 1CR6A 4JQSA 4ZHQB 5IN5A 3NCHA 5E6RA 2D3WA 5E7IA 3L06A 3ZIAD 3S29A 5G4LA 3U3XA 4Z0NA 1H3NA 1KQNA 5TB5A 3WWEA 2AN4A 2GNAA 3VBCA 4UNQA 1P61B 4KZKA 3OECA 1CUGA 3ZIDA 1QGZA 4HHEA 3NBYC 1IAVA 1V3UA 5BNZA 5CDFE 2FRDC 1SUBA 3EA5A 3KXPA 3ZWBA 4FWBA 4U2BA 3M9LA 4RFSA 4ZCQA 4BKUA 2WE7A 3U7JA 5HP4A 2QL9A 3AESA 4J0QA 1CRPA 1FFHA 5I3ZA 5GMOA 5AXDA 5AP9A 3LO5A 1IZ9A 3P2YA 3HXPA 3FNQA 1H2BA 1ZVQA 1VHQA 4JR1A 5CXSA 1UDXA 5EINA 1DXHA 4KV9A 3ILSA 4AQ7A 4HBZA 4H27A 1Q19A 1VFNA 2OOSA 1L5MA 2B0CA 1PJCA 3EDMA 4QYTA 2WB2A 5J2UB 3VM6A 1X7ZA 3MMSA 4WPGA 1BC5A 1ZJ4A 1A77A 3HUTA 2IUSA 1SZJG 4LCBA 2HLDD 2XBLA 2R6AA 4R16A 2KWIA 4B0OA 1NVUQ 1BE8A 4ZRDA 1P18A 5FLYA 3OT1B 2H1OA 2A5FA 4YRTA 3CPJB 4MCJA 1E1KA 1GSHA 5C4IA 1UJ4A 4D9KA 1CFZA 2MR6A 1ZM4A 3ITDA 1IPHA 1G8FA 4KXQA 2BY4A 5ITWA 5JYEA 2FZ4A 3HRIA 2AC7A 5KIAA 3N6XA 4M4SA 3LUKA 3D6JA 5J4KA 4HADA 5AOVA 2J87A 4I5DA 2QZ4A 5C4MA 1UJ5A 3F5FA 1DCTA 2P78A 1KEVA 2Y0DA 3SFVA 2OP1A 3L7LA 4BLPA 5BMVF 1LNSA 1N3IA 1SWWA 2B78A 3U7EB 4QGSA 4MV1A 2Z5LA 4OOEA 3L84A 5ERGB 1GGHA 4XVCA 4W63A 2FOXA 2FPPA 1NJ5A 4K9SA 1GAXA 3HJAA 3ZWNA 1WUYA 5K09A 1NPDA 1EFDN 3WMWA 3LPMA 1M6VB 3AF4A 3VKVA 3FDJA 3O2JA 3DP9A 3OJCA 2ZYWX 5ENZA 4YPOA 3DUWA 1HEYA 1TGYA 4YRIA 1SIWA 3RAGA 2PDAA 4K40A 3I09A 4YRSA 5JFGA 2Q50A 2XTZA 3S8YA 3C6BA 3E3OA 2OO5A 3P2JA 3LH5A 4KRGA 2JLQA 5FI0B 2D2XA 3VHXA 3FD8A 1HT0A 2GBLA 3ZI0A 1ZAYA 4YP1A 1NQUA 2C88A 4Q66C 3PNVA 3E9QA 3RDPA 1MAHA 3AVYA 4PWZA 4QJBA 3R75A 3TQQA 3GV0A 1GUBA 4EX7A 1Z6ZA 2PL5A 2C7RA 5B7NA 1U0HC 1FPMA 2Q4DA 1EHYA 1XJQA 2NO7A 3K3PA 3A3PA 3AUJB 3DOUA 3L8GA 4QEDA 4JLPA 3BF8A 2CUZA 3PVCA 2DQKA 3FHJA 4UFNA 1GQYA 3JTMA 3QUSA 5BSHA 3PI7A 1BE1A 4HMOA 2OG2A 1VMIA 1FOEB 3OCXA 4PLTA 1X80A 4MR8B 4UNPA 1JDSA 4QIHA 5HDBB 1QHEA 1QHFA 2JIPA 2AC4A 1ORHA 1Z4PX 3BXPA 4PPGA 1WLSA 1XXHA 3HR8A 1BCSB 1L1QA 4K1LA 4Q12A 1NMQA 4MAMA 2O2CA 5DRTA 1Z0DA 5L6LB 3EZGA 3M1LA 3OPYB 4X3PA 2P6UA 1S8AA 4KYIB 4IVNA 4BFLA 1BU5A 3A05A 3K71B 3W90A 3GPCA 2GCOB 4R3UC 1W4RA 3LUGA 3ZLJA 1PX0A 3AEQB 5KSWB 5K9ZA 1NYRA 3S8MA 4OXKA 1DMSA 1ULTA 1ZMRA 3F0TA 1APBA 3BJRA 2A94A 3HKCA 1TW2A 3I9FA 3DNMA 2OL4A 2B34A 5CM8B 2DFKB 2F4VB 2UDPA 5C1OA 1XZKA 1NSTA 3K6SA 1XTRA 2X42A 4MEBA 3U31A 2P5UA 2B2XA 1FU7A 4NWIA 4F4IA 4FOOA 3WZMA 1G8HA 4M7PA 4M55A 2HTEA 4MV9A 1QO0D 4YIHA 2VBFA 3GLHE 4BPBA 2WNSA 2A8YA 2H0RA 3AR3A 1EZ1A 2CXHA 3EG9A 3EAFA 1N2OA 1U7DA 4I46A 4YQEA 4M98A 5COAA 1A2QA 2HBRA 4QA9A 4A6DA 2ZFUA 3RREA 2Z3ZA 2AMYA 2ZS8A 3C5EA 4YJ3A 3ZWVA 5JD4A 1ISHA 2WWXA 5HM8A 2ZE5A 4Q15A 3RLIA 1YONA 1E5DA 2WM2A 1O1YA 3EVEA 2QX4A 4G5QA 2WVGA 4NOLA 4W9NC 3D5EA 3VPAA 5LQRA 4M76B 5MN6A 5KQPA 1EK5A 1KZ4A 1XFAA 3N70A 4ZT6A 3FNBA 1BKYA 1V95A 5HGXA 2FZKA 3DTNA 2QRMA 4PZ0A 3PC8A 4GXTA 4LXXA 3K0CA 1TEHA 2C0PA 5A06A 2GT1A 1CJUC 5LQDA 3KD3A 4L0DA 1QIIA 2COEA 4L95C 3JQGB 1WCIA 2RHGB 3FLEA 1CUXA 1U81A 2IELA 1VJ5A 3O4FA 2NYRA 2XCQA 4B4WA 4JL5A 3KVNA 3SIWA 4B81A 2ZJOA 1G21B 2GTIA 3AI2A 5JWHA 1NBWB 3R7SA 1N5OX 2VRCA 2J07A 5EN4A 1N33B 1IK4A 2BUCA 1YB7A 1FP4B 1YJXA 5EFZA 3AOGA 3CINA 3ESXA 5D3KA 1NR5A 4AIIA 1G6HA 1XDUA 4AX4A 3VZSA 4Z7OB 1E9SA 1U9JA 4S1TA 3RSQA 5FTJA 5L3VA 4UBJA 3FHTA 1U8TA 2WQ7A 4BNYA 3QMWA 1A96A 2YJZA 1CE8A 2M6RA 2FUG6 3QEMA 2ZPTX 4RL6A 1N6HA 1Q7TA 3E0QA 1KC1A 3BPSA 1QCYA 4Z0TA 2Y1CA 1KMNA 4KLRA 1K6XA 3KSRA 1OFVA 5LP6F 5EXPA 3SI7A 3W2FA 1VE5A 4IP0A 3BHIA 1OGJA 1PT5A 2IPMA 3NUZA 4W1RA 1PSDA 5LBIA 3ZQJA 2ZT8A 5H16A 3P97A 1VLQA 2NVWA 2YDXA 2HCBA 2VXBA 3BGSA 3M6WA 1DADA 4H3VA 4ZQFA 4ZVQA 1WL8A 2XT9A 4I9NA 1DAMA 4TXLA 5IXYA 1VFPA 3PYXA 4R0NA 3WLNA 2BI4A 5FTLA 4PGMA 3N87A 1OZAA 1RLJA 2NUTB 3DF9A 3IP9A 3UOAB 1ENZA 5BQ3A 4G4SO 2AEMA 4M99A 3CVJA 4Z9BA 3WGYA 1WUIS 4EUFA 2HBYA 2RFLA 2AOUB 2OGUA 3AF6A 3PNOA 5K2OA 1EWKA 1NXWA 4TKVB 4B2YA 1DOHA 4OHUA 3D6NB 3ITNA 5LP6C 2LDXA 5KWVA 4ZREA 1SVOA 3KUKA 5FEUA 5J2TB 1XZCA 2YV3A 1JDUA 3OUUA 2UAGA 2WU3A 4P4GA 4TROA 5KTPA 5CDUA 2WQ6A 3I76A 3I04M 2PWYA 3C87A 3KT3A 4EEZA 5TT0A 4F56A 5L3QB 1R6AA 4JP5A 1C4KA 1Z5PA 2PXCA 3F47A 2EYUA 2CF5A 2VTDA 3FYTA 3JTEA 1QGOA 4WVLA 3UO8B 1JR3A 3X3HA 3AUTA 3U4DA 3GARA 2RC5A 1WNTA 4U2FA 3TG2A 1O97C 3TWOA 1XRRA 2YXLA 2QXTA 3EARA 4Q9HA 2WSYB 2V4UA 5LZ8A 1AHIA 4G9GA 4PS1A 3ZE6A 4AN0A 2QLJA 1G3UA 1EB8A 5DN6A 2WTNA 1FFXB 2GJSA 4HQ6A 3HSKA 3LL7A 1GAJA 3ICQB 3NLLA 4MUYA 5CX1B 3CBQA 3WLHA 1CUHA 5AM4A 4LRYA 1Q3HA 4QHYA 3KOUA 4W1SA 3U4GA 4B74A 4QGAA 2QEQA 2VPQA 2J9YB 2INGX 5DHPA 3L01A 1SOMA 1G2PA 1TM3E 1YCGA 1JR3D 3FTDA 1TB4A 4J7AA 4R4JA 1JFVA 2ATCA 3B5EA 4KQIA 3I64A 1YR1A 3K2BA 2H3HA 2W6ZA 2O6LA 4EW2A 4BYMA 3TR6A 1NZFA 2YJ4A 1KP9A 4UMFA 4IQ0A 3V2UA 1Z0KA 5JBNA 5HMLA 5JJ5A 2P4EA 1L5WA 3KKKA 1QFZA 2ZVPX 3KK0A 2DKFA 1SHJA 2X1HA 4NG5A 3OIDA 4O3FA 1PYOA 1NVVR 4WDQA 5C3UA 3VV3A 4PLVA 1UZMA 4C7VA 3B52X 2OBMA 3C39A 4RHXA 1QB7A 5CBKA 2PZJA 3GUVA 1CQPA 2OHHA 2QN9A 3W9SA 1TYAE 1VJCA 4CF3A 3IAS1 1E2UA 2V0NA 3PJGA 3TAUA 4JQOA 2QR5A 1TJ5A 2NG1A 1JLLB 5DM1A 4RADA 2HWYA 2HA3A 1VYHA 3EF1A 4J49A 4NV0A 1I0ZA 5BVHA 4PZLA 2QPAA 2ZUFA 3E8XA 1V16A 2NTVA 3N8DA 5CJJA 4C4YA 3QKUA 1QP8A 4GOND 4AURA 3MHTA 1YL6A 4K9NA 4YUAA 1EFAA 1E99A 3A6LA 4FQ8A 1PO7A 4UMVA 3T1OA 3DLCA 1AQIA 3G49A 3BK7A 1AO0A 2GKOA 3FETA 3HKBA 3LJKA 5CPBA 2JL1A 5A4AA 1PWZA 1Z06A 2I2AA 1A7KA 1TTTA 1KOLA 3K96A 4X7RA 4F96A 2V0GA 3DC2A 1OXUA 1ZQ9A 4RK7A 5DTIA 1HE1C 2PSFA 4ID9A 5BXQC 4AT1A 2PKRA 4QREA 3WYFA 2L69A 2I67A 2JHPA 1PV1A 1TYEB 4ZANA 3QX8A 5HCIA 3GT0A 1A2BA 1GFSA 1VYUA 1WHTB 1Z73A 2B1IA 3TTUA 1VA5A 4KREA 3IOYA 4XZ3A 1YULA 2P9GA 5JMWA 3DE3X 1U1GA 1ATZA 1SXJC 3T3EA 1THTA 3Q1LA 3I9KA 3RKUA 4BN5A 1N8KA 2R44A 3D4OA 1KBQA 3NHBA 1YGPA 1HE8B 4JBGA 5F98A 2GBGA 1Z0ZA 2EXXA 3HXTA 4IJWA 5HUHA 3LYHA 4QUEA 5ILQA 5FBKA 5IABA 4BNWA 1NR1A 5JDCC 1Z36A 4G8CA 4M0EA 1M1YB 1CT9A 1SM4A 5EXDA 4DJ5X 1GA1A 3H8JA 2PSEA 2QZPA 1B8UA 1W5FA 4CLXA 2XA9A 1U80A 2G67A 3FOFC 1EFUA 4Y2SA 2WYUA 1XT6A 3KB6A 3BULA 4QPNA 3EHDA 5EMJA 3NIBA 5IDYA 3G2MA 3PL1A 5EJ5A 3C16C 3G2KA 4RDXA 3GLGE 2ASVA 2PQ2A 2CLLB 3DFZA 4ZEOA 4CIXA 3UWOA 3WIOA 3Q7SA 4AKEA 3CE6A 4HLUC 4IKEA 3GCDA 4LY6A 5A9TA 4F45A 2Q27A 2NO1A 2XQJA 4U0JA 4LHEA 1QU3A 1LTKA 1ZD1A 4RFLA 4AZVA 3K31A 1XR3A 2ZRQA 4O4LF 4R2HA 5F3WB 1YJAA 3EX7C 4MKRA 2QIOA 2JAOA 4IQ4A 1P75A 2YC4C 2MINB 1U8AA 2XE7A 3KT6A 1UBKS 3OKAA 3OKPA 4RL4A 5U1PA 3UT6A 3WAGA 3EPHA 5IU6A 3SQXA 1ZKMA 1T8RA 3F6SA 5ES4B 4IGAA 4YPFA 3W2EA 1QF6A 4DV5B 1Y9EA 1LC0A 3C3EA 4LBYA 2GJ4A 3T0GA 2HA2A 2R2GA 3DPIA 3PP8A 4O29A 1CY2A 4X45A 2FPLA 1II0A 1KERA 1EE1A 1K2VN 3Q6IA 3QW4B 5ALXA 1U2GC 2EFEB 4OQ4A 2B7BA 5DIFA 2B8WA 2RI0A 1FB5A 3K70B 4B3JA 3DE5X 3LUPA 2CEKA 2O8DB 4URZR 2NSHA 5AI6A 3PQ3A 4N6NA 4XYMA 1N32B 2WABA 2D1QA 5EL0A 1QV9A 1N8NA 3L18A 2HI0A 4WBXC 1YCDA 2J3QA 1A5BB 1IWOA 2CJWB 1C7QA 2VO1A 1C4XA 1LK0A 1MX5A 1ODTC 1VCHA 4H17A 4JI6B 4ZGBA 4OPMA 3PGXA 4GOKA 1LF0A 3H99A 5F1OA 1L2TA 1T6XA 4G1VA 4LMPA 4ND3A 4QD3A 1E4EA 1LS6A 1Z0JA 3GRVA 4UM7A 3ILYA 3IL2A 2FW7A 3OFNA 4X7PA 2DULA 1JU4A 2I7VA 2QM0A 2W6MA 2UXCB 3FH0A 4WZ6A 2Q2VA 1GTRA 4RE5A 3CRVA 4X24A 1SXGA 3B2NA 4B6JA 3D5QA 4N9WA 3WGGA 4KXLA 2EFJA 2GETA 4J1SA 3CUUA 5BR8B 3ZU3A 4PLPA 5EJAA 5KCZA 2EKLA 4CV3A 5KQMA 2WAXA 3J80A 3JQ9C 2YCLA 5K3BA 2NXJA 2ESRA 2WZCA 5K3DA 2B9VA 4CYMA 5L4SA 3NOXA 2WI8A 1V8BA 3EGDB 4Y1RA 4BASA 4XE5A 4BCCA 3OP4A 3NC1C 2Q6LA 1EJ0A 3QY9A 3U81A 2O3TA 2ZBDA 3ELBA 3I3SR 3OFND 1PLJA 1OFGA 2YVKA 4YJ2B 1Y5IA 3ENWA 4TV8B 2B36A 2BEKA 4HN2A 5EHGA 5AVXA 3PEUA 1UBRS 4MDEA 1FUEA 1WZ2A 1E3MA 5LYJA 1IM2A 2XDQA 1X1AA 4MVJA 3WKAA 3SFTA 4TYQA 3BIFA 3G8BA 5F21A 1SXHA 1IXSB 3TW8A 2JAPA 2A7XA 1QUFA 3LC0A 4OGWA 1RZRD 4N3NA 5JNTA 1JEDA 1GG5A 3GU3A 3OLYA 4DJJA 4JJ7A 4DPMA 3W5CA 1XD8A 1U8ZA 1XVAA 3ABIA 3DAYA 4WUTA 4IHJA 1V7CA 1BKSB 5FBRB 2IXDA 3TTYA 1I6WA 3HMKA 5CEEA 4H4EA 3T4EA 4EVQA 2AN1A 3HNPA 5H4HA 5JBIA 1HYEA 3NHSA 1QX4A 4B31A 4G0VA 1ONSA 3RU7A 3WO1A 1YJCA 2WTBA 1O2DA 4MVJD 3HWWA 5I45A 4PSKA 5L45A 3KIPA 1JRLA 3OJLA 2WINI 1P9RA 4YN3A 3RVNA 3HXOA 5LQCA 3X43A 1U65A 5FNVB 1WHSA 2VDUE 4IJ6A 2EU8A 3WRYA 3GVHA 4BEVA 4X71A 1SCDA 3VC2A 4XUEA 1JQAA 3ORRA 2QVCA 5K0BA 4JI8B 1GZ7A 1P7PA 1RYNA 3H9EO 1D7OA 1RC0A 2X0RA 2WVAA 2Y0EA 2UV8A 4DCCA 4IQ8A 1TAUA 2JNWA 4E14A 4EW1A 1FSZA 1GNTA 2DHQA 2PKWA 2DKNA 2O06A 1US8B 1RQGA 5EIHA 3L77A 5IAOA 2IX3A 3IX7A 2HMSA 2G8LA 2YJGA 3FYUC 2G9NA 5CAEA 1UJMA 4IJKA 4P5PA 3PTAA 3EXEA 3FWKA 4BVJA 3A70A 3UK7A 3WGIA 3GEMA 4OI4A 3CKLA 5CT4A 1YBMA 3TVTA 8ADHA 2Z4SA 4K28A 3R76A 1I4EB 1GWNA 3L9XA 2WJJA 2ZS7A 2FMIA 3C8MA 4JYMA 1L7RA 4PE5B 2P5TB 4DGSA 4NBRA 3RM3A 3FROA 1J8MF 2WUVA 1VJRA 5F1KA 3GDGA 1YE3A 1PT9A 4EL5A 1N1EA 3K30A 4BOYA 2VK4A 1J0EA 4BEJA 3IIEA 4OFXA 3RI3A 1G63A 3SWWA 3LK7A 2JVJA 1ZA1A 4GKBA 1P7WA 1ZHOA 1Z0UA 2CE7A 1KO8A 4RHTA 2C9YA 3ZHRA 1DXQA 2E18A 1PFVA 1E69A 1ECJA 3HGQA 3JZMA 1A7JA 4JAVC 2QSJA 4KE7A 4C08A 4M1YA 1KVTA 2CHEA 2QNBA 3A7DA 3DTYA 4KC0A 5CD1A 3SS7X 2JLYA 1ZK2A 3RJZA 2BKLA 4AROA 3GDHA 1X8XA 4R7ZA 4P58A 1J9ZA 5D84A 3AL3A 1YTLA 2HMTA 2NGRA 3LFTA 4OLFA 3FKQA 1MPXA 2IXAA 3PGKA 5DW0A 5F35A 5BURA 1CUJA 2WFLA 1HO3A 2DX7A 3GRYA 3BD9A 2OO7A 2QRVB 3A1EA 1SC6A 1UC8A 4NLLA 4PG7A 1KI6A 4ALIA 3C6MA 4HX2A 1IOLA 3R0IA 2QD1A 3L41A 4GR9A 4QXRA 5JRDS 4U7DA 3GFSA 2J6IA 2J9GA 5E9QA 1FVFA 4E22A 2OUIA 1WMSA 3UPDA 2VUHB 4CM4A 3FMFA 3B9PA 4AS1A 1Q1NA 3JATB 2OCAA 4MKXA 4BMNA 2Y76A 2GSWA 2BBSA 5EJ7A 1IN7A 1WLYA 3F5QA 4DA0A 2XEXA 1VKJA 4Z3OA 4XCXA 3CLVA 3BRWD 4JIGA 3PEYA 1QV7A 5LIRA 4QOSA 2ERCA 4WLNA 3OMLA 2OXTA 3CZAA 1ONOA 4MR9B 3T7EA 5C2JB 2CL0X 3TZ6A 4F3CA 3W2TA 4TLMB 2I99A 2V7GA 4V2UA 3GQBA 2QTBA 1MABB 4QPCA 2X13A 4WACA 3WFZA 1J0AA 2G6BA 1NWCA 3QVLA 4DA6A 1BEUB 2NVOA 4QBFA 4P8RA 4MWOA 4CN9A 3SVLA 1R7RA 4XSVA 1DAHA 4EWLA 2N3ZA 4EGQA 1BCRA 3WSTA 1ZN2A 1DAIA 2GM3A 2Z9BA 4P4TA 1AHNA 1JJBA 4O2AA 4P81A 4Q1CA 3VR1A 5FUQA 1W96A 3LCRA 1NQXA 4N3GA 1XGKA 3ITEA 3HJTA 4LXTA 3F73A 2WMDA 4JOQA 1T5HX 3T7IA 1M2VA 2YJ6A 2RK3A 3E4DA 2GD0A 4PSUA 4YMWA 3DBHA 1VI6A 3H87A 3T7SA 3N2KA 3VR6A 4H7EA 3WYBA 3ZY6A 3ZNOA 3SKXA 3FPHA 2IS6A 3AINA 1Y33E 5EJGA 2F17A 3IB6A 3ZJ5A 4O2BB 4QQRA 3OPVA 6ABPA 3L1UA 1K8YB 1D0SA 1P29A 1QKIA 3IOBA 4RVGA 2Y8EA 4XYGA 1RS0A 4HWKA 1W30A 2HK9A 2ZRDA 1X7YA 1QYDA 4K46A 1EGAA 3MILA 3NP9A 4DR2B 1HRKA 1CD5A 5DN9A 5IZCC 4OREX 2FK7A 4D4HA 4QJIA 4AF6A 4YRGA 5LXTA 5AJVB 1ZCJA 1Y1SA 2N9UA 3VU0A 1YJ8A 2FY8A 3U7QA 4MKIA 3TUIC 9ABPA 3AHHA 3VR6D 2Q21A 1PIWA 1CYEA 5GONA 2VSOA 5L7YA 2KYRA 4WV3A 3VYTB 3B36A 1GP2A 1DO0A 4OJQA 1EFTA 2NNWB 4URFA 5HTOA 2F2TA 2VT7A 3RHZA 1VXOA 2X7XA 5DLQC 1X42A 1XEWY 4PTZA 3S99A 3UJCA 1IMOA 5JZSA 1BA2A 4W5OA 4FYVA 3H9UA 3M5PA 5KHLB 1V2GA 3KYBA 4YWJA 3KZXA 1OBFO 3W5JA 4GG1A 2X9LA 4TMXA 1NVDA 3LOQA 1G8SA 1N2CA 1GV0A 4KB5A 4YUVA 3MRTA 1F60A 3S68A 5TGDA 1UKEA 3RSOA 3IB3A 1M54A 2RIRA 3OLQA 3V4ZA 2Y9MB 1NNUA 2QDXA 2OQIA 2E5FA 5B1SA 2BCEA 4Q82A 3E3NA 1XPUA 1E2DA 2ZYGA 3CHYA 3THYA 3OCVA 1LSJA 3TRFA 1SHUX 3DO8A 3VNBA 1YH3A 5KWJA 1ZI6A 2BKEA 3W9UA 3UJ9A 5EHIA 1G21E 2R8OA 3LFHA 4IUYA 1ULBA 1C7RA 1V8PA 4JSYA 5HJ2A 5BT9A 1R5NA 1Y3BE 3E9RA 4R1LA 4XQCA 1V5FA 4COOA 4Y1GA 1F4LA 3A1DA 4CL8A 2QGZA 4CRWB 1SUAA 2R1TB 4DV0B 1X9GA 1ZBDA 4H7DA 4ML3A 1FLDA 3KO8A 1R6UA 1CY0A 1P5FA 2DBZA 4GLOA 1HDYA 1KI8A 3ZCXA 4A91A 3JD1A 3AM1A 1WKVA 3N07A 3H2ZA 4BTLA 2HIAA 5TEWA 1Q11A 1EINA 2W37A 3TXYA 2HQ1A 4DIFA 4TRRA 4AM8A 4X6LA 5B53A 3S6JA 4BNUA 1C1DA 2FJ0A 5AJTA 5D6OA 1T5DX 3L79A 3MTAA 1FDWA 2AF4C 4PRKA 3KOXA 1PR1A 4ALLA 4MYTA 2ILTA 1SQ0A 5ILOA 2FQQA 1DRWA 2VHEA 4QOHA 1IB0A 4GE3A 5HTKA 4DXDA 2DPXA 2O0KA 2O0JA 2WTEA 1RPAA 3FSEA 1AMUA 1Y6FA 4A16A 4GI1A 4XQ0A 3PDWA 2IHUA 1WZCA 3HDHA 1RCUA 4M1ZA 2C2ZA 1W1IA 1VE1A 4HTFA 5HF6A 4IQGA 1C3OA 3RRNA 1XEAA 2ZBVA 1LXCA 3DD5A 1WXWA 3IOEA 4G67A 3U6KA 1JDZA 4P1ZA 3EYAA 4U00A 4P4SA 2VT6A 3PG5A 1MAUA 4RHEA 2NZVG 4S04A 4CUJA 5C5DA 1CQZA 1T10A 1ZUD1 1Y6GA 1PJ2A 1Q1AA 1U11A 2QX6A 2P7IA 3M5CA 1JYEA 4V02A 1T9KA 3MGGA 3UXEA 4P3NA 4MLZA 1WW3A 1PR4A 5FPSA 5JG7A 1LBSA 2ZE6A 3U4MA 5EEGA 2ONYA 1IN5A 3KQSA 1NFQA 2CFCA 4P3OA 3VR4H 1XC7A 3L8HA 3OCUA 4QFBA 4G5HA 5YASA 2GMWA 4HWOA 4K6OA 1XOIA 1R4NB 4CCAA 4DAEA 3FVTA 1RWNA 3TQFA 3CH7A 1Z15A 2QX9A 4KVFA 1KAEA 5JU6A 2WKPA 3JQAA 3LW7A 4DJAA 4X8LA 3KOZA 4JA0A 4OQEA 1Q0QA 2HTFA 3D3JA 3OZVA 4QTUB 5THQA 3L93A 4RJKA 1KTVA 3HY4A 2RAUA 2QTLA 1KHHA 4A8JA 5ESXA 1DXYA 1MC4A 2VJMB 3FMGA 2CZGA 3EAGA 3DT8A 1R1DA 2EBFX 1A1VA 1X6VA 4R7TA 1BQEA 3EMDA 4Y0VA 5C34B 4O6VA 1EG7A 5DXAA 2OFPA 4CL2A 1M34B 2ZYSA 2Q9UA 1W87A 3GG9A 3IVRA 3Q2IA 1XU9A 4L28A 4QU9A 5LUAA 1KMCA 1ESCA 1TF2A 1EFCA 3JQAD 2NU9B 4Y2JA 1YVPA 2ZI5A 1GN9A 1X92A 1QHSA 1RU3A 4NMWA 4ZZIA 1X13A 3D8BA 1D1QA 2B82A 5DI3A 5AOAA 2FKAA 1O95D 3M6AA 3PBKA 4YAWA 3F4LA 1GTL1 1TA0A 2ZRNA 3V4VB 2FXIA 4IDBA 2VL7A 4JB3A 3WK6A 1V7ZA 2QVYX 4CLRB 2W70A 1DP4A 2QV0A 4U2DA 4NU0A 2WJ6A 5AI4A 5DXFA 5AXCA 1DBVO 1Q15A 1NI4A 2QOEA 3T8YA 4D3SA 2SHKA 3YASA 3ORYA 4GQAA 4BQFA 1WUKS 4S1PA 3PENA 3HBAA 1JTVA 2A3RA 1XQ1A 4YV0A 1EUZA 1LD3A 4F11A 2A9VA 4D74A 3IUMA 3MERA 1DBQA 4GGOA 4TKMA 2C5AA 2BZGA 4IDDA 4R2JA 1N5LA 3CURA 3QUTA 1E0AA 2LW7A 4UQOA 1DXOA 2B5OA 3QKTA 2J6BA 2GEJA 1PDVA 2EZ9A 3TQSA 3MVEA 5ALKA 1UC4B 3DFIA 3BWEA 2M6LA 2D2IA 3WV4A 5ICCA 1JE1A 5LD2C 2BCGY 5A1JA 4QTTB 1NRJB 1CUFA 3LPLA 1AS0A 5JRZA 1JEYB 1FK8A 1MX9A 2Q4TA 1JG3A 1LW6E 2YXPX 1FTNA 2I22A 3IQZA 3P0FA 1ONPA 1DIRA 5E6SB 5DK6A 2I7DA 1WEKA 2LXNA 3IS3A 3EZ7A 3GUUA 2IXTA 1WXEA 2CCKA 2RK6A 4FN4A 3R0QA 4TTPA 2YW9A 4X91A 4R1SA 2D7JA 4RDIA 1JVSA 4IIHA 1E3LA 2B1RA 1GUZA 1X7WB 2P41A 5D3MB 1Z26A 2BM0A 3OQVA 3U13A 5JNSA 3FHCB 4QT4A 4RCZA 4YRPA 4I6JA 1C81A 4P0PB 2F00A 4GYWA 5AM3A 4ZVUA 1R6VA 4OHMA 4FN5A 3CEJA 3LHSA 4A1OA 2GBFA 3NYQA 2VHZA 4ZCLA 3RYFB 1K8QA 1SB8A 1JH8A 2FEKA 4QUHA 4WLFA 3SE0A 4DIEA 1C3LA 3QVJA 5K8CA 2C9DA 1B26A 3GLRA 2WKSA 1L9XA 1QOQB 2IIBA 2QU7A 3JWPA 2F43A 4J1TC 4J0GA 2BFBA 2VP0A 1NAHA 2FI1A 3RUFA 4RWEA 3UWKA 2B1QA 3M4JA 1TM7E 2WHPB 1XL1A 3A25A 4LYDA 4RVSA 4ZVOA 5HCNA 4BFSA 4EZIA 4HQOA 2FN9A 3WIUA 2NQTA 3Q11A 4UVGA 3R7WA 2Y4NA 3Q0EA 1EFLA 5IT9A 2C8VA 5BN4A 1T15A 2HRBA 1NX6A 1Z63A 1PZFA 2A57A 2P7HA 2YUTA 1ND5A 1A0OA 3KVVA 3NEPX 1XAJA 3DZ8A 4NV1A 3QU2A 5AJYA 4CCSA 4EQZA 3NTLA 1E63A 4KIJA 1IPEA 3SD7A 3GGSA 1IL0A 5EIBD 2JFZA 1PGNA 4CODB 4KWHA 2B4AA 1F9AA 4IXNA 1R0KA 3VNSA 4BIMA 2UYGA 5CCBA 1PTJC 1KSHA 3GJ0A 3M2PA 4B6PA 3RAEC 3EASA 3WGUA 1C9EA 4PX3A 4RHCA 1ZHHA 3IJEB 4RZSA 5FHQA 2AT1A 2JHGA 2XYHA 3MFQA 1ZMTA 2AEFA 4KO4S 4QHSA 4WERA 4YRZA 1C4OA 4DJTA 4N48A 4IHKA 4KN8A 1JPUA 1Q1GA 2Q0HA 1C0EA 2W2KB 2XZLA 4V24A 5A3JA 3RHFA 4BE9A 5EJ2A 1Q0ZA 2WIFA 2JA2A 4N5LA 1TEXA 4TZKA 5B1DA 1JLSA 3FCEA 5LQJA 3R8FA 1QHIA 1U7PA 2VFAA 3MJRA 3Q7IA 1PJAA 2Y71A 2EJTA 3L6EA 3KOWA 3QUCA 1R12A 3MRSA 1M66A 4OVKA 3WB1A 5AKGA 2PWPA 2PN1A 3P4UA 3MOIA 5I4IA 4LCEA 1P2BA 1VIMA 2IVZA 1A27A 1HM5A 3AR7A 5LQSA 2ZXEA 1I4LD 3SS9X 2V6JA 1SG6A 3TFOA 3VKGA 4HSEA 4OY3A 1CDZA 3AZPA 2O7NA 1JEAA 5GVSA 5AD1A 3WGVA 1A95A 3WL6A 1DTSA 3NPMA 4OB7A 4E46A 2QG6A 1OAOA 3RC8A 4ZI5A 4HZIA 2AC2A 8GPBA 1RWBA 2W22A 4C22A 3Q9LA 2NV6A 2W2VA 4H6VA 2PMDA 3TGPA 1KRWA 2JD2A 1T9DA 1YBAA 4ARZB 2I3GA 1UCFA 2OCDA 3O2NA 4QAJA 3M82A 1R00A 1W6UA 2QPTA 4L4SA 1NVEA 5FHRA 4B84A 5FLXA 2L17A 3CM0A 3IR5A 2HYDA 2P9YA 1EJBA 2QTZA 1E2LA 1O6GA 1W0JD 2X1LA 4PCUA 1XZBA 1FTWA 4NZZA 4PHHA 3TLXA 1AUQA 2ETVA 2Z2IA 2EC5A 3DMTC 4O2LA 3ZWQA 4G09A 4E1AA 2W83A 2WM9B 4F1KA 1R3DA 4KWIA 3K09A 2PUWA 2QJFA 5IEBA 1QIKA 2VXCA 2QROA 4BFTA 3R9XA 4GKAA 4TV9B 1YD7A 2PMFA 2W98A 4FHZA 3AJ9A 4QDUA 3RS9A 4Z2AA 5J4LA 2QBYB 2MYPA 1H6BA 1KEKA 1J7JA 1J97A 1GZ3A 2CV0A 1WUTA 3D3EA 2OYSA 1RQLA 3OWXA 4BVHA 3EPKA 1QMPA 4G07A 1AG9A 3VX4A 2FA9A 1OFUX 2O3RA 1BYUA 4OQDA 4CPDA 5BSTA 2VNKA 3L4EA 1M6WA 1RE0A 1HH4A 2J08A 1TYBE 1C4WA 2R9VA 4Y2GA 5EQTA 5BWBA 4QVIA 3W77A 2HDNB 1NYLA 3WJ7A 3ZCQA 2G04A 4Y2PA 3F3YA 4CU2A 3UG6A 1YIDA 1XNHA 1LV8A 4NZOA 1MJGA 3AONB 3IQHX 4GAEA 2NVBA 2C9MA 2V4MA 3PNBA 2HBZA 4HRYA 4XLTA 4EHIA 5CBPB 4WBNA 3ZWPA 5IVPA 2HRCA 2P4QA 1TO2E 4B6SA 1M73E 2YV4A 3A14A 3MK31 4LRXA 4Q47A 1VQ1A 3ZJVA 1OX4B 1SH7A 5JFTA 2CXOA 2OSVA 3EZ9A 1QP4A 1QVZA 2GHTA 5K51A 3LIIA 1YOVB 4YHBA 1RYDA 1YVEI 3RSFA 1BRTA 1GL3A 3EEFA 4MVJI 3VSCA 4C2AA 1XL0A 4O1HA 1C7EA 2Y6UA 4M8LA 5KYWA 1F2TA 1MIHA 3BCUA 4DSOA 1UEIA 1RTKA 1R8SA 5FA6A 3K9FC 4BO0A 1YB2A 3DVAA 1JW9B 1JIXA 1Z5VA 3KTAA 4YV7A 4AJIA 1VG9B 3KBOA 3M1IA 2CHUA 3HZZA 2E7ZA 1AXRA 2C29D 3P9KA 5BNIA 3H42B 2XBMA 1KZGB 1J07A 2JKYA 2BJHA 4EEXA 4F2PA 2B3DA 1A98A 4LQLA 1ICEA 2V8BA 1WMEA 3AW8A 4IILA 1W2HA 1NLZA 3DMNA 4PANA 5JO0A 1S02A 4GEKA 3AKYA 2O52A 4YDRA 2E4AA 1Z37A 4BGEA 1L7BA 3LC1O 3NP7A 5TT1A 1PE0A 3IKJA 3FCUB 5G0WA 2QTRA 3DAOA 2PR7A 3WGJA 4Z7JA 3P9CA 4W9RA 2F1KA 4H3KB 1E1NA 1G8PA 3SSNA 1RBYA 2JLWA 3IEPA 4HS9A 1ML4A 4B73A 4RTRA 1L8AA 1WX1A 5I7WA 4LFBB 2IDZA 5FP0A 1NJSA 2C96A 3HA2A 1BS2A 2QD2A 1IXKA 1L4HA 3MJHA 1F8YA 3MB8A 4FFOA 4LNHA 5G4KA 1EVLA 3C3JA 2NO5A 3H65A 5E2AA 3S2GA 1SVLA 3HCEA 4X64B 2QLTA 2R5FA 4QU5A 1DQRA 1RI5A 4QUJA 3PD1A 3P0RA 2QD5A 3TL6A 2HRZA 2QZSA 3D6UA 1EVJA 2OAP1 2KQUA 4TM7A 3GW8A 3HFGA 5KX5A 3IR7A 4KACA 3RYHA 2EEZA 1VGQA 2PBRA 3O3CA 1D2MA 3BXZA 3G2NA 3OCWA 4F2WA 3U0BA 3BB1A 4B8ZA 3AHIA 4OOFA 2FPUA 3T5PA 1D6MA 1XWIA 2MHCA 3GEGA 3QLEA 1UDAA 4UHJA 4B2PA 1IQUA 2QNRA 2CBGA 3GL9A 3HHEA 4KVZA 4W9MC 1KFCB 2CUNA 1K9VF 2QAGA 3BGVA 3DJFA 3ZBTA 3X2FA 1UWVA 2F6RA 2HHJA 1W73A 5HMMA 4JP2A 1VDMA 1BWRA 4HQLA 3WL3A 3ADCA 2WP0A 3R23A 4PZ9A 2BZ0A 2AXQA 3CW9A 4UEQA 2PMCA 4TWZA 5KYXB