5FV4A

Pig liver esterase 5 (ple5)
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
530
structure length
530
Chain Sequence
SPPVVDTAQGRVLGKYVSLEGLAQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCCQDPVAGQMTSDLFTNRKERLIPEFSEDCLYLNIYTPADLTKRGRLPVMVWIHGGGLVVGGASTYDGLALAAHENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQENIANFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVAFTAGLVRKDMKAAAKQIAVLAGCKTTTSAVFVHCLRQKSEDELLDLTLKMKFFALDLHGDPRESHPFLTTVVDGVLLPKMPEEILAEKDFNTVPYIVGINKQEFGWLLPTMMGFPLSEGKLDQKTATSLLWKSYPIANIPEELTPVATDKYLGGTDDPVKKKDLFLDLMGDVVFGVPSVTVARQHRDAGAPTYMYEFQYRPSFSSDKKPKTVIGDHGDEIFSVFGAPFLRGDAPEEEVSLSKTVMKFWANFARSGNPNGEGLPHWPMYDQEEGYLQIGVNTQAAKRLKGEEVAFWNDLLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pig Liver Esterase 5
rcsb
source organism Sus scrofa
molecule tags Hydrolase
molecule keywords CARBOXYLIC ESTER HYDROLASE
total genus 172
structure length 530
sequence length 530
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2016-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fv4A00
3AZQA 2WG0A 1FSSA 2EDCA 2WFZA 2ROQA 2OGSA 4DGQA 1A8UA 4MXDA 2Y6VA 3V1MA 5JZBA 3Q8WA 1E8MA 3W9BA 1YB6A 2G5TA 4Y2TA 2I03A 3NOXA 1TKRA 1T4MA 1QE3A 5HF6A 1UWCA 4LYEA 4UFPA 4WCVA 2HA2A 3C87A 4YK7A 3I2KA 4H77A 1ORWA 1EB9A 4BZWA 5ISMA 5ALXA 1U65A 4UBNA 5JAOA 4PNZA 4HTAA 4B81A 4CG2A 3BDIA 1YASA 1ZIYA 1H2YA 4Y2JA 1YA4A 2B61A 2WHRA 1SCQA 3SX4A 1YS2X 4RE6A 3R3XA 4EY6A 3O9VA 2ONCA 2FX5A 5JD5A 4FOLA 1G66A 3A2NA 4EHBA 4QDUA 3SWWA 1CUEA 3GBSA 3NUZA 2WG1A 3UUFA 1HKHA 1NU8A 2QTBA 5KWJA 4Y2PA 4MWSA 1K8QA 4AO6A 1TIBA 2BGRA 4Q3KA 1XZKA 3H2JA 4OB8A 1Q0ZA 5K5EA 1UZAA 4DTCA 4DMHA 4EA6A 3I28A 1WPRA 3WIOA 3TJMA 4EZIA 1HL7A 3F98A 1GT6A 1ACJA 3WL6A 5AH0A 4W63A 1QO7A 4I3FA 4FKBA 1W52X 4QE3A 1W1IA 4G9GA 5IVHA 2XB6A 1VLQA 4FLEA 4EB0A 5AJHA 4G5XA 5DYWA 4UBJA 4ROTA 3WMRA 1EVEA 2ECFA 5IKXA 3VKFA 4HS9A 1YB7A 4BCDA 4HXEB 1F0NA 2VAVA 1OCEA 4BRSA 2QVBA 2WJ3A 3G0IA 3FSGA 5AKHA 4G8DA 1SC9A 3G0DA 1TCBA 3AUKA 1CUYA 2PSFA 2ZSIA 3AIMA 3AILA 5ALYA 4MYSA 2HRQA 4F60A 3PFCA 5KBYA 2RONA 4L0CA 1ORVA 1XRNA 3DL4A 4NMWA 3WK7A 1GPLA 4XJVA 2X76A 4PF1A 1VZ2A 1GPNA 3I2IA 2E3JA 5AHXA 2XMDA 5SYMA 4GLBA 4E46A 3R3YA 5KREA 3WKAA 3HEAA 5EHXA 3A2MA 3DD5A 3HI4A 5CRIA 2ZJ6A 3BF8A 2VTVA 3FCYA 4BE9A 3KWJA 3VISA 5AOCA 3WL5A 5FXMA 2HDWA 3C8DA 2I78A 3ED1A 4K6GA 2IIVA 3G9XA 5AICA 3D2BA 2OGTA 3FLAA 2H9YA 2Z8XA 5HQ3B 3X3HA 3R41A 3VVLA 1F8UA 1ACLA 4D9JA 3G0CA 4DLNA 2BFNA 5AIAA 5JD4A 3GUUA 4J0HA 4BVJA 1CIJA 3CXUA 2YYSA 4J0JA 1BE0A 3WKBA 4AZ3A 3ANSA 1YS1X 1JU3A 3H2GA 2Z8ZA 4J0GA 4QDTA 4AB1A 1XQVA 4B9AA 5HF5A 5AM3A 3DLTA 1FFEA 4ETWA 4QLOA 2VAXA 4Y9SA 4N5HX 4ITVA 1XKLA 5ALJA 3DOIA 1IUOA 4ZV7A 3H1AA 3IUNA 1DWPA 5K3EA 5LZ7A 3BJRA 3D3NA 5C8XA 5DTIA 3WK4A 5EHQA 4H7DA 3FVRA 1XZJA 5JZ9A 3H04A 4N8DA 2Z3ZA 2C5FA 5HF8A 3EIOA 1UOOA 5T4BA 5AM4A 3FYUB 5HFAA 1QFSA 1TK3A 2BCEA 2D5LA 4F21A 5CT9A 3BL8A 4EY4A 3H2KA 1XZBA 3ZV7A 4KAAA 4B84A 3DQZA 5HQ3A 2W6CX 2QS9A 5EI5A 1SFRA 1KEZA 4KE8A 2DQYA 2JGFA 2CUTA 2QT9A 4XX1A 3LCRA 2WHPB 3H1BA 3L1HA 4BATA 1UK7A 2WFMA 3PDCA 2FUKA 3FYTA 1CUJA 2HU8A 1A8QA 5JASA 4RNCA 4I19A 3NGMA 5DWDA 1DU4A 1UK9A 1BEEA 1LBTA 5AI6A 1GKKA 5K3DA 1XRPA 4C88A 4PQEA 4L3WA 5EIHA 1CUZA 4O08A 2XUAA 1CQWA 1DQZA 4WY8A 1Q83A 3WYDA 4B82A 1IZ8A 2QR5A 2Y2UA 2ZSHA 5AKXA 3LS2A 2WIGA 1AZWA 4DSZA 3I2FA 2OQIA 1ZOIA 1TRHA 1CUUA 1W4LA 4K5QA 5AI9A 4Q82A 3WWOA 2H7CA 2QRUA 5HFNA 3IDAA 1DINA 1XFDA 3IULA 3ANTA 3IA2A 1QIMA 4PV7A 3KSRA 3O95A 5CT4A 1J1IA 5E4TA 1A7UA 4G8CA 5J3JA 3I1IA 1W76A 5AKYA 2RGUA 5AI0A 4HVTA 4BDSA 3DYIA 4P93A 5DNVA 5ALNA 2CMFA 3A6ZA 2VF2A 1MJ5A 2XUPA 1YCDA 2JBWA 4LXGA 2K2QB 3ICVA 2XUHA 4IHAA 4Y2RA 5JAUA 3WA7A 4UBLA 4N5IX 3DL7A 2RHTA 2QMQA 4JNCA 5E4JA 1QTIA 1QOZA 5AIBA 4GDMA 1VE6A 5ALTA 4AN1A 3FSGD 3GROA 4Q1VA 1UOPA 1XQXA 4UFOA 4ZGBA 3I1YA 5C8ZA 1I6WA 3ESAA 1ZJ5A 3PE6A 3QH4A 3R3WA 3C8HA 3OTQA 5ALUA 4RE5A 4FLFA 3HLKA 1ZICA 2NW6A 3BE8A 3M82A 1E3QA 2HA4A 1XZEA 4ZREA 4A5SA 4UPDA 4Z49A 2P8SA 3GA7A 2Y6UA 5LIPA 2C0QA 4AMZA 3T4UA 1XZGA 2RAUA 3ZLUA 1JFRA 3WI7A 3SK0A 5DJ5A 1XZIA 5HK9A 3IUMA 5FP0A 1R9MA 5LP1A 2OAEA 4WJLA 2XQJA 4CFSA 1ZI8A 2HIHA 1C7IA 1L7QA 1K6EA 1CUDA 5D7BA 2ACEA 4X3CA 4YPVA 4Y2YA 5AI4A 1F6WA 5BWCA 2ORYA 1E5TA 4BP8A 2QZPA 1FFCA 3AZPA 1A88A 4FMPA 3FVTA 3K9BA 1CUSA 1EHYA 3R3UA 5AKJA 3BWXA 3KDAA 4C4XA 2PSJA 3MUNA 4FNGA 4AQDA 3VDXA 3DCNA 1BROA 1YAHA 1GZ7A 4X6XA 3DEAA 2JIDA 1QJ4A 1JMYA 2PU5A 1XRMA 3JWEA 5IVKA 4A23A 4BB0A 2HA6A 5A7GA 1ODTC 1QLWA 3LIPA 4X7BA 5I9IA 4DMCA 2VJCA 5FDFA 2RHWA 4DYHA 1H2XA 4UBKA 1ZGCA 4DNFA 2GBFA 4BRZA 1QIKA 2HFKA 1JI3A 1XRQA 4CIBA 3O4GA 3YASA 3OG9A 1DWOA 3IVMA 3WWEA 2Z5GA 2QUBA 1MX1A 1BEZA 1LBSA 3V1LA 1J06A 1LPMA 2J3QA 4KJXA 2PPLA 5LLSA 3IUQA 1MX9A 2I3ZA 2YXPX 5FKJA 2JGLA 3EQ8A 2WIJA 1CUHA 5EHZA 4KE9A 4CG1A 1JKMA 4E11A 2WILA 5DNWA 4H7FA 4H7KA 4B0PA 3VXKA 4CCYB 1HQDA 2V98A 5C8VA 3E1GA 4JYPA 1AX9A 1XLWA 4UHFA 1N5RA 1SCKA 5AKIA 3FLEA 3WK8A 4W9RA 1AC5A 1CUAA 2VT6A 1CUVA 4IO0A 1OXMA 3STXA 5JADA 1XZFA 1M33A 2VQ6A 1VOTA 1UKCA 4PO3X 1YR2A 5AOAA 1QGED 1QTRA 4OCZA 4QZVA 4H7EA 5EHNA 3BF7A 3O4IA 3OURA 1AMNA 2X5XA 4TPKA 4J3JA 4JEIA 4HRXA 4BTLA 3H18A 2HFJA 3QMWA 1R4ZA 1LLFA 3FOBA 1THGA 1E8NA 2DCMA 4E15A 2AJBA 1AKNA 4C4ZA 2WIDA 1O6FA 1LPBB 5CXUA 4AN0A 3BIWA 3QBJA 1DX4A 1QIDA 2XE4A 5ALIA 3H19A 4J0KA 4PW0A 4P08A 4X94A 3QM1A 1F0PA 3C5VA 1OILA 1EVQA 4QNNA 2CB9A 4NVRA 5JAPA 1X70A 5FUMA 3FYUA 2ZYRA 2O2GA 5I8PA 3I2HA 2XUGA 2XQFA 1D07A 2YASA 3IBTA 4OB7A 3A2LA 4X92A 4WDQA 1XZDA 2ZYSA 1W75A 1ZD2P 4CG3A 1H2ZA 4MQMA 5LZ8A 5LZ5A 1ZI9A 3G02A 1UXOA 5AI5A 3KOOA 2WSLA 3M3DA 3D4LA 3VJKA 4BZZA 3KWFA 4QLAA 2DHDA 1CVLA 3D0KA 5C7YA 3T52A 2PL5A 4KE7A 2AJLI 2XUOA 1XZHA 5HKAA 3DDUA 3FNBA 4G8BA 1MPXA 1Y7IA 5ALLA 4B83A 2C7BA 3B12A 4IH9A 1MAHA 2XUIA 3WKCA 4DMFA 1FFDA 1QO9A 5I7UA 4GEGA 1BN6A 1EI9A 3QMMA 4H7JA 1IUNA 3Q0TA 4P9NA 4NS4A 2WJ6A 4DNPA 1IVYA 2PVSA 4OPMA 2JEZA 4WY5A 4ZV9A 2GBIA 1J07A 2XUDA 1QIGA 4CCWA 4BAZA 5FRDA 4X91A 5FOQA 3R3VA 3W9UA 4B7ZA 4B6GA 1U4NA 2XUFA 1EH5A 1DQYA 3LIIA 1R3DA 2Z3WA 3O0DA 2WTNA 2QKYA 1EX9A 1FFBA 2I3DA 2DQZA 3VJMA 2XUKA 4K2AA 3WL8A 1XZCA 2R11A 2XLCA 3A70A 2GYVA 4PSCA 4E14A 2HU7A 3GZJA 4MYDA 3WWPA 1MU0A 3ILSA 2JEYA 3AZOA 2XMCA 3FCXA 1XQWA 4G4GA 4UHBA 3BXPA 5JAHA 1CUCA 1PJAA 2HA7A 5FPPA 1TQHA 1BRTA 1XZAA 4GXNA 4C89A 4Q3LA 3D59A 3DS8A 5T4HA 2EDAA 2WQZA 2CBGA 4X95A 3MVEA 3LLCA 5H3HA 1IMJA 3P2MA 2AJ8A 5AM5A 2H7XA 3OM8A 4U2FA 1EXWA 3L1IA 3C45A 5BV7A 2WM2A 1XROA 5JYCA 2X8BA 3WJ2A 2VJBA 3IIIA 1CUIA 3HXKA 4UBIA 2B20A 5A71A 5FLKA 5ALGA 5A7FA 3AINA 3RM3A 4Q05A 2HHAA 4IH1A 2WJ4A 3WLAA 2WFLA 2O7RA 4HRYA 4WDRA 5EFZA 2PM8A 2QJRA 3G0GA 3C6YA 5LZ9A 4FHZA 5AM0A 2G5PA 3R40A 3VJLA 3WIBA 4RPCA 4Q34A 5SYNA 2HA3A 2XMBA 1SOMA 2DHEA 3ZPXA 1JT2A 5CMLA 3H0CA 2VA9A 5JZSA 3H2IA 5C81A 1C7JA 4M0FA 4BC1A 5FV4A 3STTA 4B0OA 3WQHA 1QIIA 5ALDA 4B9EA 4Y2UA 4KE6A 2AJCA 1L7RA 2B4KA 1MTZA 3V1KA 1VKHA 1EK1A 4LXIA 2GZRA 3C43A 1EINA 1GGVA 4EY8A 3DKRA 4U2BA 4BAUA 7YASA 2VJDA 1H22A 4M0EA 4BP9A 5JATA 4BVLA 5JARA 5K3CA 3MGAA 2BUBA 3FBWA 3FYUC 1AURA 2WU4A 1CR6A 2HADA 1WHSA 1CUGA 4UBMA 4BAGA 5CTAA 4YASA 2JGIA 4J0IA 1AGYA 5ALSA 1UFOA 4I4CA 2C58A 2QUAA 1UK6A 2VJAA 4ARAA 1C4XA 1WPXA 4X6UA 4ARBA 4OUKX 1ZD3A 5ALEA 2QOEA 3STVA 2CJPA 3D5EA 1CLEA 1LPNA 1K4YA 5AK5A 3WWDA 4OYLA 1P0MA 4H18A 3I2JA 5CT6A 1LPSA 4QWWA 4MWTA 2FJ0A 3G9UA 1CEXA 5AK3A 2ACKA 2OCLA 3C6ZA 1EA5A 1KU6A 2WHPA 4QA9A 6YASA 2PUJA 1USWA 1AQLA 2DHCA 1DT3A 3ESDA 2V9ZA 4A16A 1EDEA 4DMKA 3UMJA 3JYHA 4QWMA 3BIXA 2GYUA 2CKMA 3DOHA 2Y2VA 2JGKA 3FAKA 4XWGA 1KU0A 2WFLB 4EY7A 4Y2XA 3W05A 1K5PA 1ODSA 5EIAA 4LIPD 4AX4A 1WCYA 1ZI6A 3QZUA 5AK4A 1XZMA 4JUIA 5DNUA 4J7AA 4X00A 2J3DA 4S0XA 5HZGA 3EQ9A 3RLIA 4GW3A 2ZJFA 5LKAA 1P0IA 3W2TA 2XUQA 5AKEA 3WJ1A 3EBLA 4IH4A 5CH5A 1JJIA 2BUAA 2DR0A 3I6YA 1B6GA 5CXXA 3RKSA 3HZOA 2EEPA 2OPHA 1TCCA 3O4JA 2J4CA 1CQZA 4FBLA 1IUPA 2ZYIA 4KAFA 4Q3OA 2BAGA 3H2HA 1RWQA 5JALA 1G4HA 5ALMA 1UOQA 4INZA 4L9AA 3C5WP 1W6RA 4UHEA 5K3FA 3ZI7A 3WK6A 3LP5A 1E8DA 4Y2QA 3UUEA 1MAAA 2O2HA 1HLGA 3JW8A 3VVMA 4PSDA 1JMKC 1UKAA 4B80A 3DYVA 5DYYA 4P92A 5EGNA 3AIOA 4OU4A 4YX9A 4HZGA 2RIPA 4AZ0A 4QDOA 2WIKA 4H0CA 3U0VA 2HA0A 3HSSA 3F97A 1QONA 2IX9A 3IUJA 5E4YA 5IVDA 2YH2A 1N1MA 2XI4A 1Q0RA 1MNQA 2C4HA 2ZYHA 4Y2VA 4GHWA 4G1FA 1WHTA 2WUEA 2PKYX 3CN9A 5JANA 4J0CA 2BJHA 4HAIA 4KR0A 4KACA 2IITA 1H23A 1T2NA 2JGEA 1DTEA 4C87A 3OPMA 1WB4A 3B5EA 3GELA 4OB6A 5BWBA 4X71A 4X6YA 4RGYA 4X85A 4DNQA 1VXOA 1R88A 4BBZA 4OSEA 5FPQA 4L72A 2VSQA 1EB8A 2DFPA 1RP1A 5BOVA 1QIEA 3PI6A 1XKTA 2RI6A 5ALPA 5ALOA 5DTJA 4N8EA 1JJFA 4KAJA 5CH3A 1UKBA 1ETHA 2PSDA 3WK5A 3S2ZA 5D3KA 4IQ4A 5LKRA 3SC2A 2XDWA 4BCCA 3AJAA 4FWBA 2HA5A 2OCKA 1CUWA 4LXHA 3WZLA 4BC0A 2OCIA 3KXPA 3QMVA 2WTMA 4FFVA 1BS9A 1YAJA 1GQRA 2OCGA 4KRYA 4U2DA 2Y1KA 1QIJA 3F67A 1B41A 4G4IA 1GPKA 5CBKA 4GECA 3F9CA 1VA4A 4ZRDA 4G4JA 5KWIA 2OGZA 3IB3A 2WUFA 1EDBA 4OU5A 2PUHA 1TCAA 4TGLA 3STYA 3WL7A 1X2EA 1DX6A 1R9NA 1ZD5A 3N2ZB 2W22A 4HXFB 3PF9A 3AIKA 2PSEA 1LZLA 1N8SA 5E2IA 1A8SA 3CN7A 4LHEA 3TRDA 1JJBA 4KEAA 4AO7A 1ZJ4A 4ZI5A 2GZSA 1GXSA 2PU7A 3R3ZA 1RYYA 5A7HA 5ALQA 1NU6A 4FNMA 2OLEA 2ES4A 2D0DA 5CT8A 2GYWA 2CZQA 3K6KA 1LPPA 3QPAA 5CURA 1GQSA 2HRRA 5LYYA 1VJ5A 2G63A 2H1IA 4DIUA 3HJUA 3DKKA 4GBGA 4JYMA 2XUJA 5ALVA 1R50A 5AKZA 2J4FA 5K3BA 1VA5A 2VEOA 3F8SA 1BCRA 3BDVA 4WFIA 1SCIA 1ZIXA 1XLUA 3L1JA 2AJDA 4UBOA 5ALKA 5AOBA 5AKLA 3D7RA 4QDZA 3G8YA 1WOMA 5D3ZA 3B3QA 3FWHA 4BCBA 2OQVA 4AO8A 1XRLA 2WU3A 4FBMA 1MT3A 3KD2A 3NWOA 4Y7DA 4FDMA 1PFQA 4HXGA 1MNAA 2XQIA 1BU8A 3QYJA 3G7NA 1LGYA 3ESBA 3ZWQA 3ICWA 2QXUA 2FJPA 1TAHA 1P0QA 3EF3A 3OC0A 4UHDA 5F4ZA 4CIAA 2XMZA 3QPCA 1CUFA 4KYVA 4XVCA 3D2CA 4DSAA 4X90A 3M81A 4K6HA 1Q84A 1QZ3A 5AM2A 2H7YA 3U1TA 2PX6A 3F96A 1WB6A 1Y7HA 3O4HA 5AKGA 4F5ZA 5A6VA 3PUHA 4JH0A 2XMGA 5T4EA 1IZ7A 2Q0XA 2LIPA 2ZVDA 4UUQA 1U2EA 3STUA 1E66A 3BJMA 1LPOA 4H35A 5IVIA 2WUDA 2QJWA 2B9VA 1HBJA 5ALZA 4LYDA 2WHQA 3I6MA 4MQLA 1CFJA 1JU4A 4X97A 4J03A 3D2AA 3I2GA 2WKWA 1G42A 3I6ZA 1VXRA 3WKDA 4EBBA 4ZWNA 5AK6A 1K63A 5JD6A 3M83A 1XQYA 1ODCA 2XMQA 4J0DA 2UZ0A 5CH8A 5ALFA 3CCCA 4GWLA 2O7VA 1ZD4A 3WK9A 3HACA 5HF9A 4OD0A 4U2GA 4XIIA 5ALRA 2C5GA 1VZ3A 3QVMA 1ZGBA 2C0PA 2AXEA 5HCUA 1THTA 3OOSA 5JIBA 2HL6A 4FLMA 1CUBA 1E89A 3PF8A 2ZJ7A 1Y37A 2XQGA 4ZXFA 3STWA 3PICA 1EK2A 1GKLA 4W1RA 5K3AA 3W06A 2GBGA 4H7HA 1HDEA 4UHHA 5YASA 1UK8A 1MO2A 2XQKA 1BN7A 5DLPA 3AFIA 4M0MA 4EUSA 5K3FB 4KRXA 2XT0A 3HRHA 5ALHA 2OG1A 4DM7A 1ISPA 1QFMA 4Y2SA 1WM1A 3R0VA 4G9EA 3RK4A 2WIFA 2XMSA 4TVKA 1QIFA 1NX9A 4BVKA 1CPYA 4X93A 3DJYA 1L7AA 4FFWA 4V2IA 5CW2A 2QM0A 3C70A 4NZZA 5AP9A 5HK8A 1N5MA 4BTVA 4B85A 3QITA 3CCBA 3IURA 5T4FA 4AMYA 1LNSA 3E0XA 3H17A 3MUOA 3ESCA 3RARA 3WKEA 1FJ2A 2QXTA 4WFKA 3C6XA 4QEKA 3ZLVA 4FTWA 1U8EA 4CCYA 2BGNA 4LKOA 2GBCA 3HYSA 1CRLA 4WFJA 5LZ4A 4BE4A 1VE7A 2BKLA 3N0TA 4MEAA 4PSUA 5AI8A 1XZLA 2V97A 2WG2A 4GI1A 1AUOA 3WZMA 4MEBA 2OXEA 1LPAB 3TGLA 3PUIA 4BYMA 3DNMA 4K6KA 5HKBA 1H2WA 4C01A 5DYTA 1PV1A 2JF0A 4UFNA 2HM7A 5IH7A 1DWQA 2JGMA 4F0JA 5D6OA 2BUCA 4W1PA 3GFFA 3HABA 3G9TA 5AKKA 1CUXA 2CEKA 4QDXA 3V48A 3W04A 2V96A 5EIEA 3WYNA 4BDTA 1XLVA 3FLBA 1UT6A 1EDDA 2PBLA 1DT5A 4W1QA 3QPDA 3ZLTA 1MN6A 5A2GA 3G0BA 3E4DA 2WUGA 3PFBA 5ESRA 3O9MA 3V1NA 2OAGA 1XRRA 4OYYA 2R8BA 3E3AA 1R1DA 1FFAA 1G5FA 1LZKA 2G4LA 5AO9A 3S8YA 1HPLA 3WA6A 1YSCA 1CV2A 2XLBA 4UHCA 1O6GA 4C4YA 4AXBA 2XMRA 3C6BA 5CT5A 4C6HA 3G9ZA 3TEJA 2VT7A 2O2IA 3EQ7A 5LZ2A 4EY5A 5ALWA 1BCSA 2VATA 3K2IA 4U2CA 1QIHA 5A62A 1Z68A 4CI9A 4H7IA 1MX5A 2PSHA 5AM1A 2DSNA 1J2EA 4DNOA 2HU5A 4W1SA 1P0PA 1X2BA 4N8SA 2WLSA 3HC7A 4U2EA 4MJ3A 3V9AA 3WWCA 2JGJA 1YA8A 1S8OA 1WB5A
chains in the Genus database with same CATH superfamily
1BNCA 2XWSA 3PIIA 3AG6A 1SCBA 3T4PA 3AKDA 1A9TA 2B4QA 1ZKMA 2XCIA 2E6KA 4Q3NA 4YNBA 4DKJA 1JDNA 5JDIA 1EFCA 3L77A 1RZVA 3K5WA 4X63A 3UUGA 3WY9A 4DGQA 1TEVA 4RY9A 2WWXA 4FPXA 1J49A 4KKVA 3ZDEA 5JZBA 3Q8WA 4RZHA 3FY4A 5DT9A 3A6HA 3OJFA 3PNSA 3ONNA 5BMVF 1N57A 3B5IA 3SQXA 3R6WA 4D0SA 1PW5A 3WTCA 1P4SA 2HSDA 3I61A 1TKRA 1YWGO 1ZEJA 1T4MA 5BV2P 1QE3A 2F9LA 3PNQA 1ZWLA 1SHJA 1TK2A 4B74A 1OH8A 4LYEA 3EFOA 4CFZA 1R6BX 3GA0A 3OEED 4G0PA 4WCVA 4ENVA 4L0DA 4G4SO 4N7BA 4OY3A 3VV2A 3BWEA 4AUNA 5EJ7A 2EAUA 3R76A 2FEAA 3FCEA 1GV1A 1CZLA 1U9IA 5B37A 4RU1A 3S8MA 3O1HB 2V7BA 4I9HA 2ZRFA 3BB1A 3AW8A 3I2KA 4MITA 1ORWA 4ND8A 1CQIB 5MGBA 5C35A 3FYCA 1KY3A 4BZWA 5JI2E 4RJIA 2GAFA 5I47A 2WM3A 4HTAA 3W2GA 4LK3A 1T4BA 3WIBA 3BDIA 1G8HA 4P4UA 1A2QA 3LLUA 3CF6R 2WA1A 3U4DA 1N6NA 3VNVA 2FPUA 1GY8A 2GCOA 1CE8B 1I2AA 3HFJA 1EJ2A 1WIWA 2E4YA 3PL1A 4OGGA 3AVUA 1QPGA 1V37A 1SXPA 1NQWA 1G1AA 3R3XA 2PK3A 3TTYA 1C4KA 1VG1A 5LD2C 1ZL2A 4KQ2A 2ZRGA 5T41A 2YZKA 4FOLA 3NHLA 1NJSA 1N7IA 4GOND 4MIYA 3SP1A 1AGNA 3OZEA 5TGTA 8MHTA 4CLXA 1NBIA 4NARA 4P3PA 4TMYA 4CIXA 4D96A 5I4KA 1WSBA 1CUEA 1PWYE 2ERXA 3AFNA 3EVFA 3BEDA 3HYLA 3NUZA 2Q6VA 5FLEX 1F9AA 3UUFA 4TRNA 2XSZD 5BPFA 1E63A 3RSOA 2WMOB 5HA5A 3TW0A 1O9HA 1RBMA 3BH6A 5B4TA 4RULA 2OM2A 1QFZA 2BEVB 3VPBA 1C9YA 1T1JA 4NECA 5I7AA 3ROFA 4A0GA 4RM3A 3EEOA 2TMKA 3CZ5A 2V58A 3OVMA 4HGNA 4L51A 3REQA 1JTVA 4TSKA 2YXBA 1B0PA 4D9FA 1TIBA 2G7ZA 3P52A 4E5PA 1NI3A 4DZZA 4WK2B 2BKVA 1F38A 5FA5A 4HYEA 2ZSFA 4IX9A 5IT9A 1XLTA 4LV8B 4ZRNA 4OB8A 3CVWA 2YZNA 2Z4TA 4ZT2A 1XPOA 1Z2AA 1P7VA 1V3UA 3P2KA 4HFMA 3R7BA 3RUPA 3T3HA 4UCWA 3II6X 3OCUA 4F8EA 3OOHA 3D6VA 3P0JA 4BZQA 2B78A 2CKDA 3WLTA 4KFTA 1WPRA 1R0CA 2ONZA 3WIOA 3X43A 1D0SA 3UM9A 4YRRA 2G25A 1CRQA 4IJ6A 4K9RA 1M8JA 2KW5A 2X2PA 2AW3A 5F4BA 3W8NA 1HL7A 4FHDA 4JI2B 1ENPA 2WTEA 3F98A 3KFLA 1ACJA 4TXMA 1FXWA 1M8GA 2ZCUA 3MJRA 2A30A 4KXMA 4MVJH 4W63A 1M0EA 1NWHA 1HL3A 3A1TA 5T67A 3SHQA 4OHPA 4Y9RA 1NVDA 3QG5A 4JB2A 4KWCA 1EYZA 2MWMA 4J29A 1N6OA 1Q0PA 2CNBA 3ASUA 4WMLA 1WQ3A 4G9GA 1V5IA 5IYZA 2ECQA 3R0JA 4IRMA 3GYGA 3LUHA 1QNFA 1XPJA 1Z26A 2GCEA 2FFQA 2O20A 4ML3A 5AJHA 4UBJA 1M2KA 2ZFUA 3OEHD 3T94A 1EVEA 2BEVA 2ECFA 3WMRA 2GA8A 5ICSA 2Y71A 3GA5A 4FFBA 4HS9A 4MLPA 4Q9HA 3GG2A 5DVZA 3MMPA 3VRHA 4BFYA 4YV1A 5KS2A 5C8XA 4MRNA 3OPNA 3SBXA 3U3RA 5BURA 1Q3KA 3B2NA 3N2NA 3N6RA 4I5DA 1JXMA 4ZHQA 4HI0E 1BDIA 3IEVA 1OCEA 3R9WA 1RWNA 4G3XA 1C7QA 2LV8A 4N7JA 1OX4A 3E27A 2QVBA 2RGCA 1ZNYA 3B1KA 2WD7B 2W2VA 3G0IA 3KS9A 1UBCA 5AKHA 4H16A 1G3QA 1X7WB 3VDQA 2VRBA 3QMPA 5JVDB 5AW8A 1BWPA 3DZGA 4X41A 1TCBA 5EOVA 3SXUB 1AA6A 3BXGA 1XD9A 2WJHA 1NUHA 1IDOA 1QWSA 1WCIB 3IHKA 5JYBA 1V6CA 1DJNA 1XQ1A 4TYQA 2ERCA 4PWZA 2JAUA 2XIJA 3HJGA 1NI4A 3IUEA 4LWQA 5ALYA 2ZIFA 4MV9A 3PYMA 4XQEA 2YFHA 1X7WA 2QN9A 3TSOA 3RKUA 4DQ0A 3IMFA 1V8PA 1DPFA 2XNJA 1LTKA 1PTKA 4NMHA 2O7QA 3A3OA 4ZOEA 4Q4HA 1NY6A 3QX3A 2CC2A 3FPBA 4CNBA 2RHCA 4KTTE 4CIDA 3A04A 3DLIA 5LBIA 1IWBB 2YN2A 5CFRA 3UB2A 3HVRA 3ZY4A 3RV4A 3IEKA 1V8BA 1HDZA 1HZJA 1TYAE 3DCIA 3N2IA 2YYZA 1H05A 1UJ4A 4OH1A 4UVEA 3WK7A 4W5OA 1WG8A 1VZ2A 2HMVA 4PF1A 3ZD8A 4UU0A 3D4BA 3ZVLA 3BCUA 4QGHA 3IAAA 3NRCA 4FFBB 2QTVA 2VBFA 3JARB 1RQGA 1KI8A 4TUYA 4CW7A 5SYMA 2JHCA 2C2XA 3A25A 1WKCA 5DDIP 3UYKA 4RZ2A 2AS0A 4LYHA 1EWYA 1RRKA 3DE1X 3AQ4A 3ILVA 3N2GA 4RKYA 3WKAA 2B9EA 1FMJA 3PEWA 4LWOA 1ZSYA 1WZNA 3N86A 4LE2A 3UBMA 4D25A 2CHFA 3SIPA 1U2GC 1VMKA 1XD2B 3QV2A 5BSEA 3S27A 4WLFA 4A8HA 4OQZA 4ESOA 3G23A 2CXTA 3CKLA 5A2QA 3AKEA 1IZYA 5JI3E 2EHJA 3H3XA 4TWRA 2VTVA 1U1CA 1EFLA 4B7AA 2YICA 4B6QA 1B4DA 3KL2A 2C2BA 3FTCA 2CXXA 3GJRA 1KDVA 3V7YA 3ET4A 5JOQA 3FMGA 4IQFA 3WL5A 3DHWC 1JTEA 3IEPA 4C0AC 4AKGA 4JT9A 5TQ0B 4F06A 2ZUWA 3PXEA 3RS3A 1N2CE 1PZHA 1QAQA 2WLTA 3D3JA 3L43A 4JLUA 4YP5A 1I7SB 2H4HA 2IYXA 2I33A 1NLMA 4DB2A 2IIVA 3G9XA 3G7UA 4K9NA 1RWKA 2WHEA 2WV9A 3D2BA 2F9MA 4TTPA 5FWAA 5KYYA 5LWQA 1NMZA 1CZKA 1YQ9A 2VF4X 2Z8XA 3DDWA 3H4MA 3M6IA 1X6VA 2CXUA 2Q1TA 5JR3A 3CB2A 1YDWA 3UEOA 5FIUA 5F98A 1D7AA 3IV9A 3RYTC 3D1JA 2GDZA 1HK7A 2L18A 3ZWPA 4YR7A 2PUEA 2HCBA 1Z4IA 3GUYA 1UC9A 3SF8B 4C7JA 4E5VA 5H4GA 1KYTA 4B79A 2VZ9A 3CONA 1DQNA 2A0YA 4PPYA 2FFAA 2EU8A 5CLJA 3GUUA 3P32A 3ZUGA 1M5UA 2XDQA 1IIBA 1OT5A 4R2LA 1MH9A 1CIJA 1O5TA 2R8OA 4WLEA 3ZNOA 4G1MB 2AOTA 2YYSA 5J2UF 5H3CA 1I6KA 4MO2A 1U2RA 1C50A 1WCWA 1C1DA 2DFNA 3F0TA 3JQBA 1BE0A 4HO1X 4XQGA 1N2JA 4IJWA 3T5MA 2Q7DA 1P9WA 1AU9A 2VCYA 3D43A 3GJ8A 3L1UA 1BWRA 3S44A 1KOGA 2CLLB 1L4BA 2UYYA 2QX8A 2W37A 2AJTA 2FWRA 2ISCA 3QX9A 1Y5NA 4MIEA 3ZD9A 5DXFA 2Z8ZA 2G77B 1NY5A 4FOSA 4ZOLB 3DUFB 3WGYA 4BQFA 2CEAA 2FG5A 1IAVA 5ES4B 1S8NA 5KU1A 1I4OA 3OQVA 1KWKA 2J3KA 5EZ5A 3BHNA 4W5RA 4DE5A 3RADC 3D0RA 5AM3A 4UUOA 4AY2A 4GR9A 3IRUA 4R8MA 3ND6A 1FUYB 3T5CA 1L8AA 4GMFA 3WIUA 2PDAA 4JITA 2VQ3A 1N7JA 1OW3B 3FPCA 3ZDAA 4LZOA 2QM3A 1N9GB 4ND3A 2V4MA 1JHQA 1FMCA 2HBYA 3MXOA 3V2HA 3SLRA 3M5CA 4S1PA 1NF3A 4POOA 1Z0SA 1OTXA 3DOIA 4JJZA 3OCWA 3HJBA 4R8LA 1FDRA 1L7MA 3BXZA 1H2EA 3IT1A 2UUAB 1CCWA 3H1AA 5JSHA 3IUNA 3DEZA 4BHTA 4Y30A 3PB3A 4ZEMA 3BJRA 1Z45A 3OO0A 1MJHA 1VM6A 3KJXA 3EVZA 1T3TA 2J9XB 4PCUA 3WK4A 4EECA 1KEWA 1OLSA 4LY0A 3QE9Y 3TECE 2ADOA 4H7DA 3CZRA 3QY9A 3IR6A 4WNIA 1E3DA 4TTSA 4GZMA 4BZPA 5BXQC 1GRVA 1ZIOA 6ADHA 1U2DA 5HBRA 3O8LA 3UNXA 3RF7A 4ESHA 1O1YA 2A7QA 3EE6A 4K3VA 1L9KA 1RAEA 2F67A 3QVGB 4KSCA 5HF8A 1KDRA 4HB2A 4RWEA 2XB2A 4M1SA 4P80A 4YUVA 3TB6A 2OQRA 1IH8A 5T4BA 4TXHA 5AM4A 2PUBA 4D8XA 3UT5A 1KSHA 3AESB 4WNAB 1QFSA 4A8JA 4IIYA 1BMDA 4AULA 2IUEA 4GSKA 1DUVG 1ZG3A 1TK3A 1W0KD 3EK2A 3JQCA 3FH0A 4K26A 5D5QA 5BR7A 2BCEA 3PCXA 1HFKA 2D5LA 5BSTA 4NIMA 1X8KA 5CT9A 4F21A 3BTVA 4EY4A 4QYIA 3CEAA 5HHTA 4EO7A 4MP8A 5FHQA 3FOEC 3H2KA 5H80A 4D56A 1O87A 3HWRA 4IKPA 2A5LA 2GZ3A 3I76A 1DUSA 4ZANA 4JUAA 1FQKA 1PEYA 2F3QA 2E4XA 3DQZA 3Q98A 1X7GA 4CEIB 2QR3A 3PCRB 1DKRA 1PS0A 1Y63A 1OLOA 3PKIA 2QX6A 1FLNA 4EYEA 2HCJB 1XVTA 4C0SA 3AR4A 4LC0A 3DO6A 3OZVA 3ZDZB 3AJEA 4NYIR 3P0FA 3WBKA 4XB2A 3DMNA 1KAOA 2WWYA 1SELA 4KPGA 4R1PA 4B6OA 3CNQS 2J9GA 1I0LA 4HD8A 3UMBA 5TT1A 5DYNA 4ZJUA 5IWAB 4II2A 1CNMA 2H9IA 2RC5A 3THRA 3N2EA 3AK4A 3LFHA 2Y1WA 3BN3A 3W8RA 5HSGA 2AZTA 2CUTA 4OHCA 1JKIA 1N5KA 4ALKA 3NXKA 1WPGA 2SBTA 5JH7F 1BW9A 2WHPB 2IDJA 2ZAOA 1BEUB 2O2YA 3DMFA 4CUZA 1RLTA 2JDIA 1VJCA 3L1HA 3ZHCA 4BATA 3L4KA 4DLYA 3PDCA 1E6WA 2Q9AA 5AW9A 2VDJA 1J0XO 1T0BA 2Q46A 1VB5A 2R47A 3G5MA 4LFCB 3B9QA 3EUAA 3GXBA 1NXXA 2XWPA 5JASA 3QUBA 3JYQA 2PGOA 1KK1A 3QSGA 4LVOA 4RNCA 5JE8A 5B4VA 9ATCA 1JE0A 2AHRA 5G0UA 3DVRX 2PRKA 2QSZA 3MQ4A 4L5BA 4AS3A 5AI6A 1E20A 5J4KA 3QF4A 4QFDA 4N3NA 3RS9A 5AOVA 5CPBA 1EXMA 1XRPA 3M8KA 1ZAYA 4PLWA 4C78A 4PQEA 3DAGA 3GEGA 3WGUA 2D74A 2NVUB 5DT2A 5AD1A 4Q4HB 4Z86A 5JDCC 5HDQA 4BKPA 5G1OA 4KQFA 2WTUA 1CQWA 1DQZA 1UXJA 2XB8A 5BT9A 4UNSA 2DERA 13PKA 3MFQA 3NKLA 5FBWB 5GV7A 4D0RA 1P45A 4BZXA 5LJLA 3CUSA 1F2VA 1Y4SA 4BQRA 2EJVA 2XKAA 3GAZA 3TB4A 3QXHA 2Y2UA 1BKDR 4B09A 1SJ9A 2ZSHA 3M0EA 1CZOA 5IZ4A 2Q0QA 2J6IA 2IPOA 3PUZA 1PFVA 4QEZA 3W5VA 3MAAC 4AZSA 5JTUA 2AG0A 3FFAA 4WCFA 3ZKWB 2OD9A 4YV0A 1Z5ZA 3HKBB 5ILOA 4INAA 3RVOA 3K8YA 3ZTWA 1GDHA 5IJ0B 1GNVA 3H1EA 2H8KA 3OJLA 1SVUA 3UFXB 4I2VA 5I9MA 3D54D 1DIHA 1KC3A 1C3OA 1P0CA 1TRHA 1ZN7A 1QCZA 1CUUA 1ZOIA 3OJCA 4G23A 4LZWA 4C06A 2AG8A 2H59A 5EERA 3EVAA 4JGBA 5AVYA 4J4HA 1T6ZA 2UZ1B 2XSZA 4EQZA 2PHZA 1CZUA 2Z2IA 4IHJB 3GOHA 3WWOA 1BKYA 2AMVA 2H7CA 2X8LA 1Y81A 2FSIA 4RTJA 2PRSA 2J3IA 2EWWA 2ZT7A 1DO0A 1LS1A 3FUCA 5DWQA 1DINA 4N76A 2BE7A 1IPEA 1GITA 2HK9A 3AV3A 5TLSA 2GERA 3NPMA 1ISGA 3QPVA 3HQ4O 2NUPA 3KLNA 4UUPA 3GAMA 2ZROA 4ZK6A 4PTYA 4YRTA 3K0CA 3IULA 3KLOA 2ORED 5REQA 1GZVA 1K66A 1OYVA 2BI8A 3IA2A 3NUGA 3OPXA 3VH2A 1QIMA 4LF6B 4OLFA 4J2HA 4GL4A 5MFZA 1V8FA 3IAM6 2FMHA 3O95A 4J91A 4FFDA 3MOSA 4O63O 2YFYA 2GN8A 5AJWA 5E4TA 1JIXA 1BG6A 4GOJA 4M0DA 3BZUA 4M9ZA 2GGSA 1A9YA 2Q3MA 5F5NA 1ZJWA 4MV5A 4CLHA 4HN2A 5F2EA 1ECJA 1YK1A 3U40A 4ER6A 2XY4A 3E7PA 1WA5A 2ZP1A 2GN0A 3K70B 1K8YB 1RWOA 2RH4A 3BGWA 3KZ1E 3HJRA 1JF8A 4G36A 4P93A 3UWSA 5JHHB 1FVOA 2OO3A 5DNVA 4NFLA 1DEOA 4JV5B 4QGAA 3A6ZA 3DR5A 1KJIA 4KIWA 2XTJA 3CSUA 1NDUA 4N0DA 5E1OA 4E33A 1BU5A 5CLFA 1NNEA 1NJ8A 4FCVA 1PTJA 3EODA 3K0KA 5DCWA 4AJHA 5KTMA 3ICVA 2XUHA 3MAGA 4Y2RA 2LBPA 5IDYA 2Q4EA 3A05A 4K9KA 2B98A 1WQ1R 3IQWA 3WA7A 4UBLA 2W4QA 3JQGA 4IG9A 2QSJA 3W5AA 3LVFO 1P73A 3B6JA 4O2BB 5DHUA 2O1XA 3BL5A 3MRXA 3W8DA 5AHKA 5FJJA 3RRMA 4E03A 4NONA 4YRSA 6CHYA 3IQGX 4OHZA 1V7QA 1DIOB 1ORTA 1XMIA 1FVFA 1S3IA 2NUPB 2VQSA 4EHAA 3RB8A 2BEUB 4MULA 5L4LA 2QQFA 2VDQB 5E1BA 5FL7D 2ZDHA 1VE6A 3D6HA 4F4JA 3RSHA 2ESRA 1G8FA 1RSZA 4FQ5A 1ETUA 2VK2A 5LXTB 5GZ1A 4Q1VA 4RTRA 1UC4B 3HVHA 1R0SA 2E85A 4CIYA 1U5CA 3GRUA 2YOGA 2COKA 3MYYA 4KXWA 4UFOA 5C1IA 3TK1A 4B73A 4ZGBA 2R0QC 4OM7A 1WJGA 5H81A 3KTAA 1ONOA 1Z16A 4IP0A 1I6WA 1HDGO 4NS4A 4B17A 4OAPA 4C29A 1UWVA 1ZJ5A 2O1SA 1Y9EA 2B1IA 5T57A 3TLGB 5DLYA 4QVIA 2BP7B 3PR3A 5TX7A 2R3SA 1XCMA 3HKBA 3K9LA 2WAXA 5EWJA 5AFSA 1GCGA 1PIWA 2FHSA 4KC0A 3I12A 1HE1C 2OLKA 3CR8A 5KJ1A 3K0EA 1F17A 3K09C 4INPA 1OMOA 2RK4A 2GARA 2R60A 4UUBA 1R6VA 2OBMA 5UKDA 1RM0A 5F2OA 2XUZA 1KOJA 5FWYB 2WU8A 3FPJA 3HHEA 4CLOA 4C05A 3DTYA 3BDAA 3B85A 2I7CA 3RNOA 2NW6A 3E82A 5A0TA 4JEUA 4ARVA 4JC0A 2RI0A 4K9MA 1E3QA 1UQTA 4HNSA 4ZREA 1II0A 4J9VA 4Z49A 2IWRA 3KQLA 1MB9A 3L0CA 4L1KA 1IY0A 3IHTA 5ESDA 3ZXYA 2C7VA 4I3GA 4KDRA 1J33A 2HNBA 3D6UA 1MVNA 4KKXB 3IOBA 3R9IA 3T4UA 3VPGA 3ZLUA 1JFRA 1QK3A 1P3Y1 1MAWA 1KIAA 3I04A 1WMDA 4PZ9A 3AI3A 3WI7A 4MLCA 3U16A 3K4QA 1UBRS 1ZGJA 5BNIA 3LPMA 4EF4A 3SQNA 2QRNA 4LMPA 2WAOA 3ZLBA 2I3BA 1R9MA 2VBIA 3KOWA 4TMTA 4LPSA 4WKCA 3ROMA 4BU0A 1P61B 2QL5A 2ZBFA 4CFSA 1ORRA 1YUNA 4TTTS 3L8MA 4ID9A 4M6WB 1S2LA 3I6QA 3KWLA 3PU6A 3FWYA 3HVUA 4J94A 2D8AA 5FL7A 2IIPA 5GGYA 4YDQA 3JQDA 2JHGA 4WN9B 2CFIA 3ZBPA 2VJOA 3UWDA 4U7TB 4CKEB 4XGIA 3M4XA 4Y2YA 2L19A 4EUNA 3KOUA 5HRAA 5AI4A 5A03A 4E7PA 2K7ZA 5BWCA 3K31A 1NN3A 1D2EA 1E4OA 1C8VB 1K06A 5TGZA 5BQOA 3DAPA 5JSZA 3ZHRA 4CEHB 1FFCA 2UXDB 1XV5A 3QLJA 3OE4A 3MC1A 3LDHA 2PD4A 1EX6A 3HBFA 3NIWA 3K9BA 4KYTA 3K9NA 5K3OA 1BWQA 5A02A 2W6JA 2WF9A 1VJ1A 2RG1A 3A37A 1L5KA 1G63A 3K2EA 5G41A 4OHOA 2PSJA 3FMPB 3ROTA 3MUNA 5EC8A 3PJRA 3E81A 2I67A 1D6SA 2RAFA 3LCVB 4FNGA 4GQIA 4IIUA 4ZVVA 3NBZC 1QX3A 1SA0A 4ALMA 5TC4A 2QRQA 4BMOB 2H6EA 1NBOA 3ASVA 1SPBS 3AW9A 3T9EA 1KFCB 4JYCA 4OJMX 4BMDA 4CF5A 2C2ZA 2HXYA 3LW7A 2EARA 3CX3A 2VHZA 4P53A 2XJ9A 1T25A 1XRMA 4K7JA 1KHTA 1Q12A 5B7NA 4UEKA 1A1VA 1UJBA 4DLTA 4PIVA 1BDMA 1MEOA 1TEXA 1IHUA 3OQ6A 4O8ZA 1FTWA 1M2OA 2AOXA 1ZBDA 2JFHA 4ZCLA 3IFSA 3LIPA 4HQLA 4EELA 1XGKA 4P4SA 5LBUA 1DEHA 4BUJA 3DOOA 1TQ8A 2ZUFA 1VPDA 3L6DA 3M34A 4Q7JB 3OHPA 4BFLA 1TT7A 3I34X 2J0QA 4W99A 2PUTA 4CMAA 2HEIA 2WB4A 4X3OA 4BP1A 3PXBA 2VJCA 4BKOA 4WQMA 2WR8A 2R86A 2RHWA 4IDQA 3HMKA 1RYNA 1IMOA 4YP9A 2DWUA 6Q21A 3QSYA 2Z6QA 1H2XA 2NYVA 2BFFA 3ABSB 3D6TB 1ZGCA 3EDYA 4OFWA 4DNFA 1DRKA 2VXCA 1UBOS 3PC2A 2H9AA 2NQTA 3GG9A 1Z4KA 4RIGA 2AMJA 5ABPA 2SCUB 3VKWA 2A84A 3HM2A 1F3LA 1G17A 4M0LA 4RV9A 4BRZA 1V1JA 1NJGA 1E94E 4YDRA 1F0YA 1BE1A 2H63A 4F9FA 5AJYA 2ZDQA 1L7DA 4Q03A 3DLPX 5E3IA 1AKMA 2G09A 3F90A 2W70A 2QUJA 2F1IA 4MQ6A 4BNNA 3A3KA 2GFQA 2P2CA 2W6ID 4GM1A 1G6KA 4Z7NB 2V6JA 4Z54A 4IMJB 4JLKA 5ES3A 3NEJA 2ZWIA 1HRKA 1JQJC 2QRHA 1H0SA 3BE6A 3I9KA 1FS6A 4LZJA 2IJGX 1GFIA 4KJXA 4P31A 1DIBA 4L07A 2WA2A 2Q5HA 1MORA 2ZT5A 1CD5A 3ZTYA 5KSWB 1G21B 2VQFB 2XNKA 1P4JA 1SB9A 2DYKA 3IUQA 3Q15C 5FKJA 2V7TA 3RS8A 2IIBA 3GP3A 1TTPB 2ZS9A 3F4BA 3ZQ6A 3CVOA 4D9MA 4R8KA 2J5XA 1QC5B 4HR7A 2JGLA 3EQ8A 2TMGA 2FNAA 3HV0A 4OTZA 2OV4A 4V2UA 1CUHA 1CQXA 1JQDA 1T9ZA 3UCXA 3B8HA 3ZXIA 4ZIRA 1ISFA 2IEGA 1LVUA 2B5VA 1QORA 2E1PA 4PZPA 5DM70 2C5HA 2I3AA 3VXKA 1U1FA 1X13A 1X7XA 5LCXA 5DPMA 1L5NA 3SF8A 3H6HA 3G1UA 3I8OA 3V4FA 2HW8A 3QBVA 2QV0A 4LYFA 4MRAA 4CKYA 2R1TB 1LRKA 1WXIA 4C2AA 4R83A 3GBPA 4JLWA 4UJ3A 3H05A 3K32A 3F74A 1YQUA 5AKIA 2J7KA 1ML4A 5CVJA 3X1DA 4TYPA 2I4NA 4D4JA 1OXVA 2CFTA 4FYMA 2PKRA 3FLEA 1Y6GA 4HJXA 2WMNB 3AEYA 4P86A 2KM1A 4UNQA 2Q7OE 1EFVB 4FWIB 3KEGA 4EO4A 5K6RA 4DIKA 2GRAA 4W9RA 2E4WA 4I1OA 2IEDA 1AC5A 3DOCA 3KBBA 3KOMA 3L8ZA 3FAZA 3QW4B 4ZEWA 2ILTA 1RIIA 2PXAA 2VT6A 2OUKA 2ATIA 2QTZA 4GQBA 2PZFA 4E5SA 3GAAA 4IO0A 3MEQA 1OX6A 1TJYA 2FG7C 4N54A 1N2XA 1F7UA 1D1QA 3MPOA 1M33A 1KMQA 4HEQA 4R2WA 1SQ0A 2REQA 3RIEA 1JAXA 1N0VC 4FFOA 4BV2A 1TXGA 3WHLA 2D5IA 4NOMA 5F52A 5FCDA 4CYMA 4DABA 1R8YA 5A9RA 3TSCA 1ZH8A 4KO3S 5FO0A 1W4CA 1V43A 3SCZA 2AG5A 5HE9A 4EG8A 2ODTX 3KE9A 5TNXA 3LQ1A 4Q9LA 1XNRB 2X1HA 1ZGHA 5FYQA 3I5XA 3H7IA 3D8SA 4H7EA 3L1KA 3BF7A 4K87A 2VQEB 4LJLA 3TPFA 1AMNA 3Q4GA 1WLSA 2X5XA 1KMHA 1N75A 1T5DX 4JEIA 1P18A 2DLCX 4ZFNA 2AA3A 5C5EA 5TS3A 3H18A 1T1EA 1YS9A 2RBGA 3DGEC 2HFJA 3P9ZA 5GM1A 1LLFA 1OZAA 3PD0A 5HGXA 3U26A 1TCUA 3QOYA 4LVCA 4LJKA 4UW9A 1ZUD1 1FYXA 3EPPA 3UJHA 3OZGA 4YJ2B 4G37A 1NBWB 2XGGA 3K2BA 2DCMA 5ECGC 4M1WA 1BC5A 3GVCA 5CDHA 3O2QB 2ZRMA 4RPGA 1O6FA 4P2GA 2NSHA 3AXTA 1OH5A 1FB5A 5CXUA 2PXCA 4HDQB 2AZ4A 4K46A 1CHNA 2B99A 3UGTA 1DX4A 1TVKA 2WWTA 1AKUA 1SGWA 4N39A 3V1UA 1EJ0A 3WQSB 2IBMA 1FE8A 5IUNC 1V9CA 1YBVA 3H19A 3HUUA 3UOAB 4PW0A 1HR0B 1YI8A 5JNTA 4F85A 4P08A 4NCNA 5F33A 3LKBA 4C6RA 1IONA 4TN5A 5AUPB 5DBEX 1OILA 2LCIA 1P31A 1G21A 2RGYA 1RYEA 4PS0A 1OV6A 3UW3A 4BNUA 5B58C 4BGEA 3O3NB 4LRSB 5E7QA 5JAPA 3UWMA 3CWQA 1VRWA 3WBJA 1FZTA 5FUMA 2D5BA 2IS1A 4IGKA 1KYZA 1F4LA 2A67A 2O2GA 3HVKA 3OZAA 2WNIA 5JSKA 5C1OA 4Q4CA 1XK6A 1RC0A 3I2HA 3V46A 1GPH1 4ACBA 1TA0A 1CS4C 1RWPA 5FUWA 2XQFA 3OZFA 4IZIA 4MI9A 1QCCA 4CMHA 2JBAB 2YASA 3IBTA 4I4IA 4B43A 3BFXA 4MQ4A 4KZPA 5WRFA 2Q3BA 2FW1A 2H1LA 3A2LA 4HG2A 4FFNA 4FFLA 4M6WA 3KQWA 3PEEA 2VA8A 2AR0A 4HQ0A 1O95C 1UUFA 4UXIA 2YVUA 2Y0PA 4LQCA 4DSTA 1H2ZA 1JR3D 1TZBA 2RGGA 4EFLA 4EO9A 2FN4A 3FKQA 4BBAA 1AQNA 3M6MD 4R98A 3IA7A 4FBGA 1I3KA 5E9JA 4AKSA 4EG6A 5KYUB 3HXMA 3KOOA 1ADBA 5LD2B 1KZYC 1MAUA 3B6EA 2QYOA 4OHKA 4C0KA 4EMBA 2XRFA 3A9WA 5BOSA 5AW6A 1IEQA 4M22A 2VDMB 3VU0A 5EP4A 4Y9UA 4FB5A 4BZZA 3BM5A 5AK0A 4QASA 5J23A 1LI5A 1RKQA 3MWKA 2HPAA 5IG2A 2QTAA 1XE3A 2QTFA 4UASA 1PO7A 2DHDA 5FUBA 5AJXA 1G4AE 2NOAA 2V3WA 4H7PA 5C7YA 1C1XA 3WHPA 3LBFA 3N07A 2P91A 4ER5A 1R0XA 1W0JA 2PT7A 3T52A 2EQBA 2RJOA 3ZCPA 5HUQA 2PL5A 5KOJA 2OCPA 4EOGA 1Z2NX 3HB9A 2HWWA 5KDDA 1T1IA 3B6IA 4G0ZA 2XUOA 3LT2A 1SC1A 1OAOA 3HA2A 4YO8A 1XZHA 3FNBA 2ZYAA 3VR3A 5JH7A 2X9VA 3M1LA 5BWMA 5FWNA 1JIIA 1NGSA 1ULAA 1XTTA 2C8JA 2VPZA 2ZIEA 4Q3DA 4D6XA 4B83A 3B12A 1PL0A 2H4ZA 1QAMA 1PYGA 1WOYA 4GGPA 1KK2A 1N6KA 1FFDA 1QO9A 4PLYA 5I7UA 5KNBH 3AERB 4NYJQ 3SBOA 3FUVA 3MWLA 3SJBA 1UMDA 3UKOA 3W77A 2IIQA 1VMIA 5B1IA 5JCOA 4HUJA 1RZRA 1C41A 1DUIA 3Q0TA 3L7AA 4NENB 1EQUA 1L1RA 1AK9A 2Z2YA 2M98A 2K5UA 2MYNA 1MCZA 2WJ6A 3FPKA 1B73A 3R3JA 2FSVC 2ZB2A 4F72A 4MUFA 2PY6A 2YHSA 4IGEA 1ULZA 2G88A 2PKEA 3G8BA 3KPUA 4WEQA 1V1RB 4WY5A 1DL5A 1WULS 1Z36A 4I1YA 1M1YE 2GBIA 4Q3CA 3RUCA 1GU0A 2B8JA 1IM2A 5CNKA 5FX2A 2OC4A 3JX9A 3RVJA 4BAZA 1OA0A 1VBMA 2GEUA 1BE6A 1OX4B 5F7ZA 1DEAA 1NOJA 3L06A 3ABIA 3R7FA 1NUTA 1U3GA 2B7BA 1M74A 2RGWA 1LVHA 2MMCA 4U63A 2Y66A 4ZT7A 2XUFA 4EUKA 1PJLA 3Q8XB 1CQJB 1EH5A 1N5JA 3H86A 1DCKA 5ITZB 1DQYA 3LCMA 4TMZA 4UE2A 4S2EA 1GFSA 4Q4JA 5HJ5A 1QP8A 1ZINA 4DV2B 1Z39A 3NGXA 4Z1MD 3VR2D 2CLDX 1I2CA 2BRUA 4B8ZA 3A2KA 3U5TA 1GD1O 5JJ5A 1YJXA 2WJWA 5DTQA 3TR0A 4EI8A 1JWBB 3O0DA 2ZUVA 3NIBA 4WKBA 2ZYVX 1MIOB 2H2GA 3IC5A 4UM5A 3MLAA 2I4RA 4P6VF 4RL6A 4UZSA 3VJMA 4XLLA 5EJ2A 3EMBA 2V7GA 2XUKA 1JNYA 1POXA 4K2AA 2WSMA 3N75A 4IWYA 3VBEA 4KLRA 1KEKA 1XZCA 2PZKA 1CP2A 4J4TA 1XZNA 2N46A 3HO8A 2YRXA 3D6AA 1MV5A 4HN4B 1N0WA 1DX9A 2WICA 2PZBA 4EQ6A 2C7RA 2FSPA 3GZJA 2WSIA 1PR1A 5F1YA 5I3ZA 4RTSA 1U1EA 4OHFA 1WXHA 2JEYA 2IU3A 3AEUB 4YMHA 2C4MA 2A58A 3AZOA 3NASA 3ZY6A 2VYFA 1XQWA 3IVXA 4R1NA 2GPBA 4E2FA 3GHYA 1A3CA 1YRYE 4BVEA 3WDMA 4UHBA 2FDXA 1WKVA 2ISQA 4GKKB 2PD6A 4PCLA 4NF2A 4ZAZA 1DCFA 3ZTTA 1Z0JA 2MDTA 3EUFA 2HA7A 5FPPA 2B7CA 5J4HA 2DFTA 1OAAA 5DI9A 5BUSA 2FW6A 4QUBA 3D59A 3DS8A 5T4HA 2GBLC 3OLCX 4F91B 4Z9AA 7ADHA 4XA8A 3LLCA 3QUTA 4DM3A 3AFGA 1TLLA 2C5EA 2JGDB 4ZAGA 2CFRA 2RBEA 5H3HA 5EIXA 1IMJA 2ASEA 3T4XA 1NBMD 3Q2IA 1R6TA 3DKPA 4GSLA 3UAGA 3PQ8A 2HYIC 2VJLA 2YBEA 4LVNA 5JY6A 2H16A 3VYVA 5BSVA 3OM8A 4Z0PA 3L1IA 4O4JF 4Z9XA 2BELA 2GEVA 1SUFA 2GH1A 3SQLA 4C6TA 3ELDA 3NT2A 3QQPA 1YR9A 2CVPA 4LQLA 4M1TA 5I7WA 5AUOB 1QHIA 2JEOA 3F1LA 3BKWA 1RAHA 2OXTA 4FMBB 4HJRA 5B5SA 1E79D 3AINA 4Q05A 5J5CA 2IA5A 2GCOB 3A31A 2HHAA 1Y3AA 2VAPA 2WFLA 2QE6A 1XL1A 1HM5A 1SVNA 1ESDA 3MA0A 3OE1A 1AZSC 4NDAA 3NZEA 1MB4A 1IU9A 1RVDA 2Q5LA 2VN8A 3GC6A 3GVPA 4DJEC 5MN4A 4DJJA 4YMVA 3P9IA 3RHZA 1G8JA 5E6UB 3QTLA 3THSA 4EP1A 4FHZA 1Y8CA 3CGGA 4XUEA 3RU9A 3VA7A 4BWYA 2G5PA 4HMQA 4AMUA 2CLKB 4LYYA 4D80A 1OYOA 1NM5A 2W71A 1SG0A 2JRCA 3UJPA 4RPCA 1XWIA 4Q34A 1Z0DA 4JBYA 1T8WA 4Q5IA 1FQJA 2WSSD 4LDQA 4JI5B 3N7TA 2ODNA 3O38A 4L5YA 3ZCVA 4NYMQ 1SOMA 2FG6C 3L7NA 5KOJB 1QS0A 1JT2A 5CFQA 5FNVF 7GPBA 3H0CA 1S02A 3A6JA 1G9TA 5LC1A 2R9VA 1VIAA 2X42A 3B89A 3LLVA 1QPZA 1X86B 4M0FA 1B1CA 3MWEA 3STTA 2AF4C 1FYEA 4WKOA 5ALDA 1GSIA 3PEFA 4KGDA 1ZA1A 2COEA 4Y2UA 1OR8A 4DCMA 2JGNA 2AJCA 1L7RA 2IYOA 2H65A 4PZCA 1XKXA 2OWEA 2P5TB 2VLIA 2WM9B 2J85A 4NNOA 3ZU5A 4ZYXA 5HIMA 1WUJS 1MTZA 1XALA 1VKHA 4ER7A 4L8FA 1MJGA 5LOVA 1HNNA 3GDHA 4M7PA 4R1SA 1OBOA 2BKAA 3DV0B 3Q41A 4TL7A 4UMEA 2DFVA 3L8EA 4ZCRA 5GJVC 2PMWB 1G5IA 3NHSA 4YGYA 3AB3A 3QENA 5J2TB 3OBBA 2ZCVA 2KS6A 3O2SB 2WJGA 4LNUB 3DKRA 5AVKA 1KRXA 3F73A 1V7PC 3JQ7B 3KUUA 3QKSB 3QEMB 2Q6TA 4REMA 4U2BA 3SM9A 3VUEA 4BAUA 4E5YA 4ECEA 4YRBA 7YASA 4HZUB 2FPGA 3P4UA 1W30A 4BP9A 3G5UA 4LOLA 3W3ZB 2KB0A 4A1OA 2FPGB 3UF0A 3JPWA 4P4LA 3WRYA 4BVLA 2W2LD 2O59A 5H83A 2OHOA 5DHPA 3JSAA 2CJFA 3KD3A 2BUBA 1OFHA 1K5GA 3FGNA 3GJ5A 1QH1B 1WHSA 3FWNA 3F3SA 1OV4A 4KPUB 4UBMA 2BFBA 3NHRA 3FFBA 1KXJA 3H16A 1Z37A 2UU9B 5IKEA 3AFMA 2ZJ5A 4YASA 5FPKA 4JYZA 3LUAA 2GLXA 1Z7BA 3AHIA 3ZJYA 4NMXB 2V5VA 2R7KA 2KPOA 3MMNA 5ALSA 2Z8YA 3DHNA 1PL6A 2C5SA 2FPMA 2ZQYA 3MOIA 4FX5A 4XM2A 1RKVA 2INGX 4E3ZA 1EFRA 5CVTA 4DIUA 5HNKA 1AKWA 4RV5A 1RJGA 3FUUA 2M6RA 2ZSEA 4Y1GA 1I3CA 3O3CA 4K6OA 4HQ6A 4LZPA 5HJ2A 1WPXA 3MRSA 4WK6A 1E3WA 4FKZA 4X6UA 4BASA 2I71A 5LB2A 5IHXA 3KQYA 2QOEA 3KPVA 2CJPA 4OA8A 5ENVA 2HNAA 3FKSA 1FYDA 1QLJA 1UANA 1UZLA 2B0JA 2MSCB 3ME5A 4UARA 4L2IA 1UAAA 1FSGA 2B6HA 1XUOA 1CLEA 3LBIA 2XXAA 4O4IA 1MG5A 1OIXA 5AK5A 1SKAA 1TZMA 4HDKB 1V9LA 3ZLJA 1GAEO 4QECA 1K7YA 4ZICA 2C7OA 3AHGA 2BKUA 4P35A 3W8FA 3PHGA 1ZCFA 4FXOA 3U7JA 2FJ0A 3G9UA 2VDUE 2HHJA 1UDBA 2RJ3A 1QV6A 3DBOB 4QM7A 4LF4B 4PZEA 3EZXA 5IDXA 2ZUBA 4KVZA 3GLFE 4X66B 2YHUA 2WHPA 4CU2A 2BGTA 1E7RA 1RXSA 2UAGA 3DE0X 3ZJUA 2ZS8A 3F6RA 1BXGA 4FCWA 3USES 2DLDA 1UDCA 3IP9A 1P2GA 3GIWA 1DT3A 3QIVA 4EJ6A 2DGDA 3S99A 3MS7A 4EDHA 1CIPA 2C2GA 4A2WA 5JNSA 4M1MA 4KREA 5DW3A 2O3TA 3JAWB 4GD3Q 2IXGA 5DOZA 4FFRA 1RI1A 3MMSA 3M49A 4DMKA 4CBVA 5HIIA 3UMJA 3MK31 2JB9A 2JAPA 3QVTA 5K05A 3L6BA 5ED4A 4B3CA 3DV9A 3MN1A 3JYHA 4RZIA 2JATA 3C7DB 4NV1A 4QWMA 2FEMA 1JBKA 2YWCA 4L08A 4XFDA 3JZFA 2CKMA 5IF9A 4KQXA 1BGVA 1OAKA 3EFBA 4EJ0A 4F8YA 2Y2VA 5EVCA 3A3YA 4KUGA 4JP1A 3AJRA 3UC9A 5GP1A 3TPZA 4F5YA 4XWGA 5IDQA 1GNSA 1CRZA 1P33A 3PUJA 2HR1A 1MEJA 3KG2A 5TMBA 3K53A 1J9ZA 2V03A 2D2EA 1M6NA 2AOTB 2PGDA 3FNHA 1PK9A 3WGQA 3W05A 5JLJA 1K5PA 5EQJB 1PLLA 4KR3A 4Z6KA 3W5BA 2CMDA 3ONEA 1ODSA 4MCJA 4WERA 5EIAA 3SEAA 5M04A 3MT0A 4YJHA 3TL3A 5C2JB 4CM5A 1JQBA 1F2TB 1TM4E 2WQ7A 3B48A 2IPMA 4E09A 4YQZA 4X5OA 3B53X 5JCJD 1ZI6A 3BG5A 5GPBA 2D0IA 3M4YA 1G41A 4JUIA 4Y0VA 3BULA 4FS3A 4A8JB 4B3IA 1SU6A 2AV6A 1J6UA 3FJYA 3WWYA 1DZ3A 1RBYA 3ECSA 4S0XA 1ZUIA 4EDFA 1X3LA 5BYJA 3KC2A 1MVLA 3S3TA 5DO9A 5DGDA 3TTVA 3EQ9A 1T2AA 4KVFA 4GW3A 1KQGA 2DWCA 4URVR 3GJ6A 1DC3A 3IPLA 5CG2A 1U0BB 3T61A 5KCZA 1A9XB 5CFZA 4GLJA 1RNLA 3B36A 1AK1A 1JJIA 1IE3A 4V0NA 2B2CA 1B8VA 2BUAA 2XQVA 4NHOA 1KSJA 3AH8A 4Q93A 3JV7A 1CY1A 4FIZA 3P4YA 3RRBA 1I6LA 3PC4A 4WESA 5B3AA 2A0WA 3V34A 1NJFA 2XXBA 1NNLA 1SUBA 3IPYA 1BXGB 4L8WB 4V0SA 2ZYIA 2AR9A 2X77A 3UV7A 3OE5A 4KAFA 1E9AA 3TDMA 3JYLA 3I3SR 3TLYA 2N42A 4M8IA 3AI1A 4NESA 1WW2A 3H9JA 4WOCA 3S1AA 4YIKA 3P96A 4QQFA 1Y3HA 3CLSD 4NQRA 1G4HA 2Q29A 4ZO4A 3WXBA 4BOYA 6REQA 4TTVA 1EJBA 3DFZA 1U8TA 1J2UA 4LHWA 1VCIA 2QTVB 3JARA 3L0PA 4L15A 4INZA 1T4CA 3LD9A 4QGBA 5JUWA 2NVBA 4B75A 1LDEA 2R8YA 4Z3KA 3CCFA 4LOKA 4PS1A 2CUZA 4UE3S 1N1DA 2XEDA 1W96A 5K3FA 1QKIA 1N4DA 2AI3A 1GCIA 2YYYA 3A4IA 2QG9A 2PBZA 3WADA 1TU4A 3F9IA 4DDHA 1SD2A 1KP3A 3A1UA 3LP5A 4TWBA 2ZBQA 1E7YA 1O9BA 4I9UA 1B6TA 1V3VA 2O8CA 1XDSA 2JLSA 2N75A 1JEOA 2QMHA 3U81A 4JC8A 5J40A 3T9BA 4C0WA 3WGTA 4HSGA 2NAPA 1TK9A 4LBVA 3VVMA 2I1LA 4MJLA 5C3UA 3VVCA 1DC5A 1RVV1 5ARBA 3DYVA 2B83A 4P92A 1JNXX 4QOIA 3CG0A 3NTUA 3VDRA 1KHHA 2JLAA 4BMNA 3TMAA 4TXJA 4L27A 4OU4A 1S89A 1T3HA 2RIPA 2YY6A 4NABA 3LFTA 4RIIA 3T9FA 4AZ0A 1P7ZA 1JYEA 2IOFK 3LSTA 5AXBA 5U1PA 1L5GB 5ICMA 4G0VA 3MWYW 2WIKA 2BGGA 3BMCA 3ZHSA 5C37A 3RRZA 2MU1A 4UNRA 1IM8A 4II7A 2HA0A 2FXIA 3INRA 1JN0A 4FZRA 4PHFA 1KH2A 3TZBA 3EZ7A 3KQOA 4K81B 2LE0A 3WFJA 1GG9A 1Q0UA 1QONA 2M6SA 2OHVA 1MC4A 3KAPA 3PGMA 4L8LA 4UM7A 4UUNA 2IX9A 4IIVA 4RABA 2YH2A 4EEXA 1AF7A 2PWAA 2XI4A 1QSGA 1GZ3A 1Q0RA 2NQ8A 4QOJA 3ESQA 1B2RA 1PFKA 2JCYA 3LP8A 4LYGA 4BO4A 1HQCA 4V0OA 4CKEA 3QF7A 1T5TA 2NIPA 2X5NA 1QR6A 3EULA 4HAIA 3HLYA 4HWSA 2R6CA 5EEGA 3ZWXA 4J76A 4PRYA 5HMLA 5GIPE 4D3YA 4OI0A 3K35A 3FI9A 2PX0A 4KFCA 3SOPA 1H23A 2WMDA 3QLUC 1T2NA 4CQMA 3TI7A 4X65B 3QJ5A 1CSEE 1RBZA 2ZI9A 3GELA 4OB6A 3SS7X 2Q4RA 5LP6C 3TBHA 4QG7A 4NOKA 1WKBA 1FXSA 3AM3A 3OH8A 2HO4A 5EXPA 2J08A 3GFQA 4OQMA 3NDRA 4R5MA 3VYRB 1HNXB 1M5RA 1JA0A 4ETNA 1NR5A 3QEJA 4Q9NA 4ND1A 3AY0A 4RSHA 5IPFA 2C54A 1YZFA 2ARKA 4XIJA 3TCKA 1RZ3A 1NC3A 2CZCA 2X6QA 3I72A 5JMTA 4DCNA 4KMSA 2YC4C 3OZRA 2GVNA 2UUPA 1IJKA 2PH1A 4EVIA 4CVNA 1Y9ZA 2VR1A 2D06A 1HX7A 5JQGA 1Y1TA 2DFPA 3OEEA 4RJLA 4IS2A 1YJBA 2X4LA 5JS7A 1CRPA 3PHIA 4F4FA 3PCTA 1PJ8A 3WYAA 4DR7B 1FFYA 3EXFA 3OIYA 3EBOA 1CB7A 3BTOA 4UEOA 4DA4A 3PJEA 3LBAA 1P44A 2WZCA 1LVGA 2OCDA 3PPXA 3QVUA 1KGSA 2N1MA 3ETGA 3ISJA 4KB5A 1QHSA 2QYHA 3F5FA 2C9BA 1KIFA 2AOUB 2C4UA 2C98A 2H5IA 4PVCA 4UDYX 1Z83A 3FPAA 5CH3A 4PRKA 3DZKA 3L5KA 3DT6A 3K0SA 1UKBA 1ETHA 1RLOA 1ZK4A 1RDFA 5I51A 1E2HA 2OESA 5D3KA 1D9ZA 4QUIA 4CKZA 4IQ4A 1DBVO 5K1ZA 3OT4A 3WC4A 1V3TA 3FLMA 1GGFA 3ZHZA 1RI5A 3C5EA 2IYAA 2YINC 2C29D 3NCHA 4PSAA 1M66A 2Z56A 5JG7A 3I3OA 3V4SA 4A3SA 4J2TA 4BC0A 1S3GA 1ZJYA 1LDNA 4FFVA 3RVMA 4BGUA 3ZJTA 4PFQA 4QDKA 1C8KA 1HTWA 4JFAA 1KZ6A 1TX4B 3GV0A 4BNFA 4UPEA 2OCGA 4DFDA 1BHSA 5JYDA 1W581 1WEKA 5LLTA 2QA5A 2UZAA 3M3HA 1URPA 4OXIA 3E05A 4DR5B 2A5GA 2DUJA 1UZNA 1TA9A 4G9BA 4Q4DA 3JR3A 5B3JA 4AJLA 3ZHUA 4YXWD 1OI2A 4CCAA 4E30A 3E9ZA 4NC9A 5AVXA 1YCFA 3F9CA 5LBTA 1BD4A 4K88A 4INJA 1PR0A 1UJCA 1Q7TA 1AUXA 2REQB 2VNHA 2YOFA 4AMBA 4B46A 4F3RA 1Y1KE 5KWIA 2VDNB 3IB3A 4WIAA 4E4TA 2WUFA 1J2YA 3KAQA 1GTG1 4MW2A 2DB3A 1EDBA 4WLVA 1FTGA 1TCAA 5AJVB 1SQSA 5D7NA 3PQ3A 4ZKEA 3ZCXA 1XA0A 5DCLA 3STYA 3V4ZA 4CGYA 1SBTA 3DO8A 2YFKA 4NEGA 2EWMA 1HLPA 1EUZA 3SQMA 4F2DA 5KVAA 1Q17A 1DX6A 1Z4NA 2HBZA 4KRFA 1LTHR 3AHEA 4ZJYA 1R9NA 1YZTA 3N2ZB 1UT8A 2GOYA 4X6LA 3UT6A 4FS8A 3EPHA 3GH3A 4MQFA 4HHEA 1L6RA 2HUNA 4N48A 2OZEA 2QDKA 1NJ1A 4RUKA 1JYSA 1PS9A 3LE8A 5LU9A 4H4CA 4U7DA 1NTOA 5KKNB 3NHJA 1FTNA 2AKAB 2ZOSA 4IDFA 1Q0TA 3RQSA 4G89A 3UO8B 1QOPB 1X8LA 5DN6A 4PCAA 4GWGA 4KLNA 3DP9A 3QNWA 4D42A 1Z6GA 1ITZA 2R2GA 3DE2X 1IRIA 1CJTC 3G2QA 4U9UA 3OX4A 3U4CA 2RFLA 5A7HA 2AIRA 1J2JA 2NZUG 3RD5A 2F6RA 2OHJA 1CIVA 3WRXA 4L9WA 2GETA 5D85A 3UJ3X 1NDHA 3GRAA 2YS7A 1YKSA 4HNRA 3UICA 4KIUA 3C4VA 4FKMA 3PNMA 1XEFA 1LPPA 5ITWA 3E8XA 4D0LB 1IBKB 1LFDB 2Z6VA 3QPAA 3QKUA 5CURA 3HV2A 4QREA 1GQSA 1OYWA 5JPDA 5LYYA 1MLDA 1O54A 3FNQA 3Q7SA 2QQ0A 1N2GA 3EQ6A 3N05A 1WW8A 4FIDA 4GXRA 2EZ9A 2OCBA 3OETA 3OC6A 2QUHA 4O02B 4TQGA 2R8ZA 2YMPA 4GBGA 4AJNA 2HF7A 4KQGA 3RSCA 4C0QC 4DQXA 3TKYA 5HQTA 3VMMA 5K6TA 3NBQA 1JEEA 1P2TA 4E3WA 4KAXA 1GGNA 2I7DA 2BFEA 1O8BA 4M9SA 3SE0A 3TPCA 7AT1A 4P4TA 3TQIA 4FUTA 5C80A 2FMUA 2VK1A 1TC1A 3DEHA 4P0TA 3ZWMA 1Z13A 3RTCA 1DAOA 2SNIE 3HR7A 1Y4ZA 4FDLA 5KX5F 4MGEA 2ZBPA 4HAUA 3S2UA 5B3KA 1QQTA 1Q1QA 1XDDA 1UDAA 1ZRMA 2RC6A 3B82A 2LIVA 1P4RA 3CSDA 4WFIA 4UUMA 2AUMA 2Q1SA 2ZTSA 2PLWA 5IH3A 3VTKA 4EJSB 3ZXSA 3QE2A 5ALKA 1BMQA 4QXQA 4CN9A 2IZZA 5IAGA 5GQSA 1N3LA 1PJBA 3H11A 3KNZA 2QP4A 3EAQA 5KTYA 4E1BA 2O0JA 2WPNA 4ZAYA 1XBTA 5FYDA 1E3TA 2W11A 2X41A 3LWNA 3PSAA 2AN3A 1LJLA 1PHPA 3DWEX 1DRWA 4M7OA 4F7DA 2V4UA 1OT3A 4AO8A 1M1NA 4TV9F 2GX6A 2Z08A 1XRLA 4YMGA 2CMGA 3A3NA 5IX8A 3AB8A 2DTXA 5EAIA 2CL6X 3I9JA 1EX7A 5EMKA 4CMGA 4F4IA 3JU3A 5EMJA 3A6DA 3REOA 3MRTA 4CRWB 3QTTA 1IK4A 5JQGF 1MNAA 2WVJA 2XQIA 3DE5X 4TTAA 1A77A 3QYJA 4IJ5A 2ABWA 4LV5B 1LGYA 2D7CA 4OYRA 2ZSDA 2QTHA 4US0R 3B3FA 2CW5A 3Q3HA 3EGWA 5FAXA 3R7LA 7MDHA 4NAHA 4XFJA 2PZEA 4ZVNA 3C48A 2W93A 2TYSB 4WD3A 5EZYA 3BCHA 2CY0A 4JP8A 4MVJD 5P8WA 2Y0EA 1EBFA 5DXJA 2V7QA 5HFJA 3SC4A 5KQRA 1OGIA 2F3PA 1TAHA 1FFSA 2EYQA 3EVGA 3H8VA 2JAWA 3X44A 1ECGA 1P0QA 3EF3A 4YIHA 4RTOA 3M6WA 1L3IA 3EFHA 2QORA 4CIAA 1GPJA 2IODA 3LDFA 3AU9A 5DNEA 5TIIA 1MH1A 2P2DA 4MIOA 4I50A 1GNPA 3GFOA 1SVWA 3VOSA 4BO0A 2BLLA 4UKDA 1M34A 4QVKA 1P9RA 1YK0A 2I9PA 5CA0F 3A4TA 2WV7A 3D2CA 3V2GA 1GNTA 3A6EA 4DCCA 2ZANA 4Q1AA 4R84A 4A2CA 3L0BA 1ZNZA 1NVAA 2H7YA 2PS1A 4FC6A 1JAIA 3ZQ4A 4HRVA 1J99A 2AZDA 1G20A 1VKOA 4F5ZA 5CVVA 2J4DA 1TMKA 4PSVA 1E64A 1PG5A 3RYIB 5IAOA 4XRGA 2QUIA 1E96A 5TGDA 2BFDB 1U6KA 1T36A 2ZVDA 1G5TA 2I34A 4UUQA 3WGMA 3KSBC 2XNDD 1GO2A 1BQ4A 3QOFA 1LK0A 1SWWA 3KYDB 3WR5A 3TL6A 3LX5A 5EXXA 5B7PA 1EP1B 4XGRA 3VC1A 1RTTA 4WKPA 4P2BA 1SU8A 2QJWA 5DMXA 5BR4A 4LNHA 3R9KA 1O7JA 2A78A 4MR8B 2ZK7A 5C34B 4DDVA 3QELB 1U28C 4ZMBA 5K0JA 3IJRA 2PZ8A 1ODKA 2Q1UA 3DZDA 4G2TA 4Q9JA 1FU7A 4KGVA 1GNRA 1CFJA 3EOZA 2XCUA 4MW0A 1RYDA 4N47A 2Y8EA 3IP5A 4OAOA 1DTWB 1NIPA 2CJWB 2WJAA 5JDIC 1EVZA 1O6ZA 3GYBA 3TVDA 3ZK8A 5CDTA 2ZPUA 1UODA 2ZR7A 1ADFA 4Q4AB 2QF7A 1DXYA 1NMEA 2ZBEA 1G42A 4NQZA 2P4EA 2RG7A 4J1TC 1QG2A 4OM8A 4ZJPA 1GU7A 1ISHA 1Q7GA 1XQYA 1AHNA 3TINA 4ZQBA 3EZLA 3C2QA 2BCJQ 3UPTA 4A91A 2H5LA 1IXSB 2XOXA 3HDQA 4M99A 1KVSA 1EVKA 3VSEA 3UBTA 4J0DA 2I6GA 1GSAA 2G9RA 3KX2A 4PGAA 5DV9A 3VR4D 5MN5A 4P54A 4LS3A 1SC3A 2O7VA 4MS1B 2EIXA 4KN8A 1YHZA 3WK9A 8AT1A 4NCIA 1T36B 1IM5A 1MG0A 4URFA 4B4WA 2AEFA 3TTXA 5ILQA 5C1DA 4H1HA 3M4NA 3QWFA 4QJBA 5E9QA 2X15A 2C5GA 4EAQA 2G07A 5HJ7A 3RT9A 1L3CA 2P9CA 1L1EA 2XGOA 3LT1A 3QVMA 4R3UC 4E6PA 3NDBB 4IO1A 4N5MA 3VPCA 4YAGA 2QROA 3H9GA 3JWJA 3PPVA 4RA6A 1THTA 3M6XA 3QRWA 4EGSA 1GTRA 1PGOA 4P32A 4J7XA 5JIBA 2HL6A 5TR9A 1CUBA 3PWZA 1E89A 3MM4A 4HB3A 4HNHA 4BN4A 2B2NA 5GTDA 4AKIA 3AJ9A 4EGFA 3STWA 1T5SA 4NBKA 4A0FA 2ZCJA 1GKLA 2HMWA 3DEKA 4QJ5A 2R1ZA 4L5CA 4XUCA 1AOXA 4N4AA 1KYXA 3MCWA 4MWEA 2GN1A 4L85A 2PJDA 3O2NA 2BKEA 1HOXA 1UXHA 1YZ3A 3E9RA 4MV3A 4PPNA 4R6XA 4UHHA 2HYDA 3ZN2A 1JQLB 3L02A 2ZBDA 5IDVA 3CH6A 1QQAA 1ZOPA 2PT9A 2VSYA 1MO2A 4FFMA 3AVPA 5DLPA 1Q50A 1U3FA 3FFXA 5DM0A 5IC5A 4KRXA 1M2VB 2XT0A 3X2EA 4A82A 4DYDA 4ZDKA 3SE7A 2R6GA 4JXJA 4AG3A 3DP7A 1CF4A 5ALHA 2OG1A 4ENWA 3I5AA 1PWEA 1JFLA 4DM7A 2XR1A 5TQ0A 5BV0A 5KWVA 3L4BA 5IVHA 2XJ4A 2ONJA 5KMGB 1DKPA 3R6TA 3S70A 1VBNA 3NG1A 2IWHA 1KORA 2FCRA 2QLLA 4XW2A 3UENA 1QB7A 1JLMA 1PFWA 4BNMA 3ENKA 3TYXA 2E9SA 4BVKA 1CPYA 3Q3VA 1DCMA 3KEMA 4CQMB 3ES9A 3UA4A 2MYTA 2OC9A 1FFHA 2O1EA 2FRXA 3AUUA 3NAMA 1PF7E 2C9ZA 4FHGA 2AQKA 2OD7A 2OL4A 5J5VA 2D4AA 4R81A 1DBRA 4FJ2A 4OBEA 4A10A 5I7EA 3NOOA 3SYRA 2EX4A 2SICE 3FN4A 3UMYA 4L6CA 4MVJA 1IQRA 4GP6A 5CITA 5HZMA 4KX3A 2JCBA 4OL0A 1VQ1A 1FL9A 2JLRA 4MQUA 1LXCA 1E9SA 1YI0A 4IIGA 4BWGA 1JG7A 3SZ3A 3ETLA 1VGVA 2GCIA 3NC0C 2XNCA 3E7XA 4PYQA 5F23A 2E5LB 4I3HA 3MUOA 4O2AF 3UANA 3RARA 1FJ2A 5IJ9A 2QXTA 1U9CA 1UQUA 4HBGA 3TRHA 5CBPB 4YB8A 2UYQA 3C6XA 4JLDA 3OLZA 3HSKA 4FFPA 4DXAA 1PNVA 1Q19A 4KN5A 3U7HB 4OXKA 1BSVA 1OXTA 3DULA 4JENA 4QO7A 2ZI5A 3OM1A 5I9NA 4CCYA 1N4AA 3BCSA 2P6PA 1J0AA 3VI4B 3U60B 4GS5A 1XCJA 3PYXA 4UTZA 2D4HA 2VHTA 2YWEA 1JLHA 1UP4A 3GEMA 3DMYA 3GLIA 1UAGA 2Z9BA 3KHTA 2BSXA 1E2UA 1K0UA 1FX0B 1Q20A 3C3DA 4G0QA 1JA9A 2QPTA 3TZHA 1VHTA 1JFFA 4AAYA 5KX5B 3N0TA 3TZ6A 1USIA 4BMYA 4GMKA 4PSUA 4FT4A 5AI8A 3L6RA 4F6LA 4DLUA 2HGSA 1HXHA 1U3WA 3INNA 1MAVA 1NV9A 5L6LB 4AX8A 1AUOA 3PNVA 3CJTA 4KFRA 1N2OA 3N8IA 2HWKA 4LBZA 4KI0A 2EQAA 1YD7A 4IFEA 2OPHA 4ENSA 4GICA 1TC2A 4XM0A 1LPAB 3ICCA 1EKXA 1IG3A 1VECA 2IHNA 3NNNA 4PYMA 3TGLA 4J1QA 2IH2A 5SZHB 5DU2A 4K6KA 3GT7A 2RSLA 3K1TA 4Z1OA 5LQUA 1H2WA 1I1OA 4NCJA 5DYTA 3K0FB 3WNBA 4HNTA 3L5OA 1IN8A 4UMFA 2EATA 3W7AA 2A9FA 2V9PA 2AXQA 5FI0B 4DMUB 3PX7A 1GZ5A 3EWNA 1J23A 5LUBA 2JGMA 2WINI 4RKWA 3UKDA 3LY5A 1ULHA 2J45A 4IICA 4LMAA 4RFSA 2O8BB 5CVCA 3HABA 4CQMD 2ONYA 1CUXA 4M36A 5AKKA 3AUSA 3OKFA 5JQGB 3V48A 2EHDA 4C0HA 3DFMA 1YNOA 1P75A 1D2NA 3R9XA 4XSGA 4X8HA 5J1TB 1NXSA 2YIMA 3KYJB 3WYNA 3ZDYB 5EP1A 1L4KA 3KHUA 2LWIA 3QGMA 2POCA 4BDTA 1DC7A 3QUQA 3QV1A 3OQJA 1AY0A 3ZWWA 1KAHA 5P21A 1EDDA 1NA5A 1QDLB 2WYHA 4HNUA 4X1KB 2GLUA 4DRYA 1R74A 2NO4A 2V1XA 4K0KB 4PIMA 4LJ8A 4IHQA 1WUKS 3K71B 3E4DA 1Z6XA 2O0HA 3EA5A 1QANA 4Q1EA 4PBSA 1X9GA 3AI7A 4F97A 5KTPA 2WUGA 5EE3A 4DG5A 1TZJA 3DE4X 4C3VA 1QOQB 3M33A 3PR1A 3ISVA 4OSPA 2LDBA 3ITKA 3AQIA 4X24A 3T5AA 2R7MA 2CE2X 3HEBA 5ECYA 3RTEA 4UMVA 1XWWA 1ZOSA 4MDHA 2P5YA 1DQSA 1G6HA 1T6BY 2XNSA 4CMKA 4I08A 4GBMA 4LXTA 4I0WB 1UM8A 2FHPA 4QNRA 1OGJA 4MI3A 4UHCA 3C8ZA 2HSJA 2VTEA 3B20A 5IUKC 2X9GA 5EIBD 3WNZA 5IMBA 4ZT6A 2WUVA 3QEAZ 2PLAA 2W2NA 4AZ3B 4C6HA 4OQDA 4ZT5A 5CJJA 4WCDA 2QLBA 1YU6A 3PEYA 1R8QA 5LQRA 3WLSA 1X92A 5TSDA 2XZOA 1E2GA 3LAWA 5TY0A 1K68A 1I0IA 1DMSA 4R6WA 4QPCA 1Q1AA 2VATA 2QP3A 1OOEA 3K2IA 4LYJA 1L1QA 3ZZ1A 2DPYA 3JAMA 1LV8A 1DOZA 2CSXA 4UULA 5FHRA 1M54A 1ODLA 2AXPA 2CCJA 1AZLA 1P7PA