5FV4A

Pig liver esterase 5 (ple5)
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
530
structure length
530
Chain Sequence
SPPVVDTAQGRVLGKYVSLEGLAQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCCQDPVAGQMTSDLFTNRKERLIPEFSEDCLYLNIYTPADLTKRGRLPVMVWIHGGGLVVGGASTYDGLALAAHENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQENIANFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVAFTAGLVRKDMKAAAKQIAVLAGCKTTTSAVFVHCLRQKSEDELLDLTLKMKFFALDLHGDPRESHPFLTTVVDGVLLPKMPEEILAEKDFNTVPYIVGINKQEFGWLLPTMMGFPLSEGKLDQKTATSLLWKSYPIANIPEELTPVATDKYLGGTDDPVKKKDLFLDLMGDVVFGVPSVTVARQHRDAGAPTYMYEFQYRPSFSSDKKPKTVIGDHGDEIFSVFGAPFLRGDAPEEEVSLSKTVMKFWANFARSGNPNGEGLPHWPMYDQEEGYLQIGVNTQAAKRLKGEEVAFWNDLLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOXYLIC ESTER HYDROLASE
publication title Pig Liver Esterase 5
rcsb
source organism Sus scrofa
molecule tags Hydrolase
total genus 172
structure length 530
sequence length 530
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2016-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fv4A00
1E3QA 1MNQA 1BEZA 1BU8A 4J0HA 4PNZA 1Q84A 3F8SA 5BWBA 1JU3A 3WIBA 1GPNA 4UBIA 3ZWQA 5ALWA 1QIGA 4H18A 5ALKA 2XMSA 4C6HA 4H7IA 3VISA 2VTVA 5IKXA 3AJAA 4G4JA 2XUKA 2BUBA 1XRQA 5CT6A 1ETHA 4HRYA 1YA8A 3G0BA 4KJXA 5ALTA 4OB7A 1GQRA 2NW6A 1A8QA 4FKBA 3F98A 4E11A 3TJMA 1C7JA 3H1AA 1H2WA 1IUOA 1R88A 3FCYA 4TPKA 2LIPA 2BAGA 1WB4A 2C7BA 1JKMA 1N5RA 4PF1A 1LZLA 2WSLA 4D9JA 5C7YA 5EIAA 2WJ3A 4BTLA 3I2KA 1XZCA 5LKRA 1WHTA 2H7CA 4FMPA 1W76A 1GKLA 5LIPA 5CT5A 4GDMA 3DDUA 1VLQA 2ACEA 4HXGA 3LIPA 2WFMA 4AB1A 4WFKA 3PF9A 5AK6A 3PF8A 4B83A 3BJMA 5JAUA 1ZD4A 4RE6A 3ANTA 3MGAA 2WHPB 4BAZA 2XUPA 3VVMA 4UFNA 2WKWA 5JAHA 4EBBA 3R3XA 2H1IA 3WJ2A 1EK2A 4DIUA 5CXUA 4B0PA 3W05A 5AIAA 4CFSA 1EB9A 4X85A 1VA4A 2EDCA 3C8DA 1WOMA 5DNUA 1AKNA 2QR5A 3I2FA 4AMZA 1R9MA 2GBCA 3V48A 2WFLA 1AZWA 2IIVA 1UOOA 2OCIA 1JT2A 2B9VA 5HKBA 4X00A 1LPBB 1F8UA 2XUQA 1MX1A 1FSSA 2AXEA 4P08A 4EHBA 1CUCA 3L1JA 3STWA 3PUHA 4Q3LA 3W9UA 3BWXA 2CB9A 2Z3ZA 1PV1A 4FFVA 1JMKC 2C4HA 4X71A 1CUYA 3ED1A 3O9MA 1QIJA 2K2QB 2Z5GA 3AUKA 4ITVA 1DX4A 3BDVA 4KACA 1FFCA 5K3FA 5LZ7A 3MUNA 3R3UA 3DL4A 2XUHA 5SYNA 4B82A 2WG1A 5ALGA 5AO9A 2XLCA 1XZGA 4C89A 4H35A 4KYVA 1QIKA 1EDEA 4ZV9A 1YS2X 4JEIA 2GBFA 1G4HA 2AJBA 2O2IA 1HLGA 1AC5A 4C87A 2WIKA 2VAVA 4M0FA 1LPOA 1CV2A 3FOBA 2RAUA 2XUFA 5CRIA 3O4HA 5EHXA 1TK3A 1LPMA 2HL6A 1FFEA 4RPCA 1TCCA 5ALOA 1DX6A 4YASA 1MO2A 1UFOA 5JYCA 5K3AA 1T4MA 3C8HA 1W75A 2ZYSA 3WK5A 4OU5A 1E8DA 3JWEA 3ESAA 4OB6A 1FFAA 4W1RA 1L7AA 1AX9A 2I03A 1SCQA 1KU6A 1BROA 5LZ5A 4UUQA 4C88A 4FOLA 1XQWA 1L7RA 4JNCA 5DYTA 2PVSA 1QIDA 5KWIA 1YB6A 4AO7A 3H1BA 3G9XA 3G9UA 4BTVA 4UHFA 2I3ZA 4W1QA 1GPLA 3WWPA 1P0PA 2V96A 3AZOA 4IH1A 4I4CA 4BVKA 3H04A 3KWJA 3WKDA 3LS2A 5AM5A 4QWWA 1EDBA 2EEPA 1QOZA 2XQKA 3DKKA 3C6YA 1ODCA 4OSEA 3LP5A 2GYWA 2B20A 4IHAA 4N5IX 3O4IA 1E66A 2WU3A 2I78A 1A88A 1XZBA 2RI6A 4G9EA 3I6ZA 2FJPA 2PUHA 5FRDA 1JJFA 2CBGA 5HQ3A 1ZOIA 4FNMA 5D3KA 1MAHA 1JFRA 4B81A 4QDXA 3SWWA 1LBSA 2ZYIA 3AZPA 2ZSHA 4OPMA 1XZJA 1N5MA 3ILSA 1HPLA 4ETWA 1MX9A 4WDRA 2DQZA 3BDIA 2AJDA 1CQWA 4FLFA 4L72A 3MVEA 2XMQA 3LIIA 2VAXA 4DNFA 2X5XA 1XZFA 5AKLA 3R3VA 1OILA 4X6YA 4BE9A 2QZPA 3D3NA 1LPNA 3WWDA 2XUAA 3IUNA 3EF3A 5FP0A 5K3CA 4Y2TA 2BJHA 5AKHA 1MPXA 2JBWA 5CH5A 5AKEA 1BEEA 2XMDA 2PUJA 1XLVA 1X2EA 2Z3WA 2JGKA 5I8PA 2XMBA 1DQZA 3F96A 1D07A 2XUGA 3ICVA 3W2TA 1YASA 2Y2VA 3OURA 3K2IA 5JATA 3T4UA 3PI6A 5JADA 2WJ6A 3C6BA 4J3JA 1QGED 4FBMA 4KAFA 2OAGA 2ZSIA 1HL7A 3C6XA 3FYUA 1XRMA 1L7QA 1G42A 5D7BA 4X94A 4PQEA 4JUIA 3I2GA 4G4IA 2ZYHA 4X7BA 1AMNA 5E4YA 4X91A 1WB5A 4Q3KA 4LHEA 5AH0A 4DMCA 3C45A 5E4JA 3PICA 1TKRA 3G9ZA 5LYYA 1VXRA 5SYMA 5E4TA 3F67A 4NMWA 1DINA 2QVBA 3O0DA 4QA9A 3STTA 2WIGA 4FHZA 5A7HA 5HKAA 5T4HA 2HA2A 2XT0A 1E8MA 4X97A 2WUEA 4IO0A 4N8DA 4G9GA 4U2DA 3WL5A 4CG2A 1VA5A 2JEZA 1QE3A 3WA6A 3W06A 3E4DA 4J03A 3IB3A 4HAIA 1BN6A 4AX4A 2RHWA 3EBLA 1VXOA 1TIBA 2R8BA 4BP8A 4NZZA 1MAAA 2HFJA 3ZLTA 3UMJA 2RHTA 5JZ9A 5FLKA 2WU4A 1R3DA 2ROQA 5JANA 3V9AA 3HJUA 4QDTA 1WM1A 1QIMA 4H0CA 4UBOA 1EXWA 3IVMA 4GHWA 3O95A 3UUEA 1W52X 2QOEA 4K6HA 5AIBA 1XRLA 4Y2YA 3C43A 3AILA 2AJ8A 4ZREA 4X3CA 4CG1A 1KU0A 4Y2JA 3DOHA 4J0GA 3RKSA 4WFIA 1WPRA 4J0DA 2OGSA 3WYNA 1IZ7A 2JF0A 1K8QA 4H7JA 4PV7A 3I2HA 1K5PA 2XUJA 1N8SA 3I6YA 5H3HA 1H2XA 4CCYA 3ESCA 4Y2PA 3WK7A 4O08A 2WIDA 2X8BA 1Q83A 3STXA 4F21A 1VOTA 5AKYA 1R4ZA 4DSAA 2ZJFA 2VQ6A 4DYHA 5CW2A 5CT4A 3WL8A 2OQVA 3ZPXA 1AUOA 1DWOA 3TGLA 5EIEA 1CIJA 4DMKA 7YASA 3H2GA 4UHEA 4DLNA 1OXMA 2CMFA 1P0QA 1HBJA 3N0TA 1LPSA 5FUMA 4EB0A 1ZI9A 1BE0A 1MN6A 2HU5A 1EB8A 3ZI7A 2PL5A 2XLBA 5ALJA 3QMMA 3NGMA 5AKIA 5LZ9A 1ZJ5A 2GYVA 4BCBA 3WWOA 3I6MA 4MEBA 3IUQA 4U2BA 3HI4A 1THGA 2D5LA 4BYMA 3D59A 2VATA 5K3BA 1CPYA 3HSSA 2JGFA 1Q0RA 2C5FA 5JARA 2EDAA 4ROTA 4BAGA 1ACLA 3DCNA 5ALVA 3QZUA 2HHAA 4G5XA 5FXMA 3V1MA 3B3QA 3HABA 3QPCA 3H19A 5ALSA 3WMRA 4JH0A 4ZWNA 5ALZA 1U65A 4GW3A 4H7DA 3DL7A 5FPQA 1CUFA 1ZD3A 2D0DA 3WL7A 3R3YA 4F60A 1XZLA 2FJ0A 3S8YA 2V97A 2W22A 1QIEA 3KXPA 1UK8A 5JIBA 1QFSA 1DT5A 2QJRA 4H77A 4BB0A 1CUDA 4H7KA 1RWQA 6YASA 4A16A 3H2JA 1U8EA 2YH2A 4FBLA 1A8SA 2WIFA 3YASA 1IZ8A 2OCGA 5BV7A 3EQ9A 5CTAA 4GWLA 3KD2A 1QTIA 1CQZA 2V98A 3GROA 1R1DA 4FWBA 4X95A 1GKKA 3WZLA 1YB7A 3WLAA 3R41A 3BIWA 5AI0A 4ZRDA 5FOQA 3GELA 4MQLA 1CUXA 2OGTA 3G8YA 2PSFA 5ALUA 2PKYX 4WJLA 3DYVA 4UBNA 2QUAA 1XZKA 3HXKA 3WZMA 3DLTA 5LZ8A 4AMYA 5HFAA 1S8OA 4OYLA 1EVEA 1Y7HA 1EINA 4V2IA 1JI3A 1YAHA 4B85A 1UK9A 3M81A 1UOQA 3FYUC 1AGYA 3R3WA 4C4YA 4Q05A 1YA4A 3NUZA 3G0DA 4FFWA 1GPKA 5DNVA 5CMLA 3M82A 4HVTA 5DTIA 3QMVA 2QXUA 2QJWA 1EA5A 4X93A 2H9YA 5IVKA 3DQZA 4UHHA 4U2GA 5HQ3B 2C0QA 1CUIA 3BF8A 5LP1A 4EY7A 2Y6VA 2Y6UA 2E3JA 1YS1X 3D2CA 5T4EA 3OG9A 3LLCA 4OYYA 2VEOA 1ZIYA 5HFNA 3G0IA 4Q3OA 3R0VA 1J06A 4CIAA 3A70A 2OG1A 4QWMA 1CRLA 5AI5A 2J3QA 2BGNA 5I9IA 1SOMA 3C5VA 5DYYA 5IVIA 1NU8A 5ALMA 4P92A 1RP1A 4H7EA 2WG2A 5AJHA 2DSNA 1F6WA 3Q8WA 2XMGA 1DWPA 4EY8A 4Y9SA 1LNSA 1CUHA 4DGQA 1DTEA 4B84A 1XZHA 4PSDA 1DQYA 5HK8A 4X90A 5KREA 4G8DA 2XUIA 2UZ0A 3L1IA 1ISPA 4MXDA 4BAUA 2VJDA 2WTNA 3N2ZB 4ARAA 2AJCA 3STYA 2O7RA 4Y2QA 2O2GA 2OGZA 2OAEA 3V1LA 2VT6A 4L0CA 5T4BA 5JD4A 4KE6A 4N5HX 2QKYA 5ALEA 5AM0A 2HA3A 2WILA 2QMQA 5C8XA 5AKXA 3VDXA 5J3JA 4UHCA 1QO7A 4BZWA 2XUOA 1U4NA 5I7UA 3EQ7A 2RONA 1THTA 2I3DA 1IMJA 1XLUA 1SFRA 4CG3A 4QZVA 4KAJA 2FX5A 3D7RA 1XKTA 3BXPA 4XWGA 3BJRA 5CT8A 3CXUA 3G02A 4DNPA 5ALHA 1J07A 4LIPD 3JW8A 2QTBA 2HM7A 2OCKA 2G5PA 3HLKA 1CUJA 5HF8A 3TEJA 4Q1VA 3FLBA 4UFOA 4UHDA 2WHRA 2HFKA 2XQIA 2J3DA 4K2AA 3FAKA 3C70A 3SK0A 3EIOA 2XMRA 3WK6A 4AXBA 4W9RA 3I2JA 3JYHA 5EHQA 3SX4A 3BL8A 1UOPA 1GXSA 2G5TA 4UHBA 4E14A 5DNWA 4LXGA 4F5ZA 1TCBA 1CUUA 1XLWA 2WHQA 3IA2A 2ONCA 1UKCA 2HADA 3CN7A 2ZJ7A 4OU4A 1QTRA 1MX5A 1CEXA 3VJKA 4BVLA 4AQDA 4DMFA 2PPLA 1IUPA 3STVA 4GECA 3FCXA 4LXIA 1B41A 1UK7A 1XRNA 2BUAA 1E89A 4KR0A 2JGIA 3O9VA 5AKKA 4BDTA 4INZA 1P0MA 5AOAA 3QPDA 4GXNA 2ES4A 2B4KA 5CXXA 2BFNA 2YXPX 1XRPA 2BCEA 2PSJA 3TRDA 3X3HA 3F9CA 5T4FA 3FWHA 4N8EA 4MJ3A 2J4CA 5AOBA 4KE7A 5DTJA 3QPAA 2GBIA 5IVDA 4BRSA 1EX9A 1W6RA 1ODSA 4BCCA 4W63A 3AIOA 4U2FA 3WKAA 1JU4A 1WPXA 3I1YA 3E3AA 1XKLA 4CCYB 5AI6A 1XZAA 1ZD5A 3BE8A 4Y2RA 1K63A 1ZJ4A 3IULA 3U0VA 3CCBA 5HF9A 5AI4A 3KWFA 4U2CA 1FFDA 5ALYA 1J2EA 3IUJA 1IVYA 1UT6A 1CUWA 3K6KA 3DNMA 3HACA 4Y2XA 4KRXA 5BWCA 4J0JA 3CCCA 2WUDA 1N1MA 3KSRA 3WWEA 4KRYA 1Y7IA 2Z8ZA 1SCIA 3HZOA 1VKHA 5CH8A 3ICWA 4PSUA 1NX9A 2P8SA 3NOXA 4NVRA 4B9AA 3RARA 1LPAB 4M0EA 2QM0A 3I28A 4QLOA 5EHNA 3NWOA 4DM7A 4MYDA 1VZ3A 4PO3X 3EQ8A 3VKFA 3IIIA 1EHYA 5DLPA 3WWCA 5ALNA 2G4LA 4YK7A 5DWDA 5HF5A 1GQSA 1H22A 4DMHA 1G5FA 3M83A 5DJ5A 1ZGCA 4J7AA 1ORWA 4EZIA 3WKEA 4MEAA 4PSCA 5AICA 1EH5A 2GYUA 1XRRA 4MQMA 4RGYA 1JJIA 4Y2SA 1XFDA 1ODTC 1UKBA 4Z49A 1ZIXA 4XJVA 5AHXA 1XZMA 5AM3A 3I1IA 1C4XA 4GLBA 4XX1A 4L3WA 3W9BA 2ECFA 1F0PA 2CJPA 4ZI5A 2IITA 4WY5A 2GZSA 3FVRA 3FBWA 1GT6A 2JGLA 2XUDA 4B0OA 3D2AA 3H17A 5EIHA 4UBLA 4X6UA 2RGUA 4OCZA 3C5WP 4ARBA 5A6VA 2PSEA 3HYSA 3ZLUA 1E5TA 2ZJ6A 4HS9A 5F4ZA 3FLEA 3R3ZA 2YYSA 4UBKA 4C01A 1AQLA 1PJAA 2CEKA 3ANSA 3Q0TA 2VJAA 4DTCA 2PU7A 1SC9A 1CUBA 5C8VA 2XMCA 4Y7DA 2WQZA 2HDWA 3WQHA 3QMWA 5FDFA 5A62A 3WYDA 3U1TA 2Q0XA 1O6FA 1X2BA 2QRUA 2WFLB 2WIJA 5EFZA 1BRTA 1H23A 1CVLA 3VJMA 1ACJA 2V9ZA 3AZQA 5AM4A 3E0XA 4B9EA 5AOCA 1CLEA 3K9BA 2OQIA 4ZXFA 2HU7A 1TCAA 1XZIA 1ZI6A 5JASA 3OPMA 3AINA 1HDEA 4ZGBA 2DR0A 2XQGA 5YASA 3H2KA 5JD5A 4H7HA 2H7XA 4FLEA 1XQXA 1K6EA 3STUA 5K3FB 1WHSA 4GBGA 2WJ4A 4BC0A 2C5GA 2HRQA 1BCRA 4K6KA 3PFCA 1YR2A 4HXEB 3WJ1A 2WTMA 5D6OA 5K5EA 1H2ZA 4FDMA 1JMYA 3P2MA 3DYIA 3C87A 4MWTA 4BRZA 2DHEA 3E1GA 4KE8A 1EDDA 2GBGA 1MNAA 3ESBA 2BGRA 1XZDA 4IQ4A 5A2GA 1QLWA 2HIHA 2W6CX 3RLIA 1UXOA 2WUFA 3A2MA 4B7ZA 3VVLA 1TAHA 5LZ4A 1E8NA 5A71A 1YSCA 2XDWA 4Q82A 1MTZA 2H7YA 4TGLA 3PFBA 4IH9A 1CR6A 4M0MA 4QLAA 4QEKA 1HQDA 4KAAA 2YASA 4J0IA 4UPDA 4BDSA 5EI5A 3GA7A 5AKGA 1BN7A 3RK4A 1BCSA 4BCDA 3B5EA 5HCUA 5FPPA 4HTAA 3ZLVA 5HF6A 2DFPA 1FFBA 4K6GA 4GI1A 3ESDA 3OOSA 2AJLI 3LCRA 1QIHA 2ORYA 4J0CA 2OCLA 3DOIA 3FSGA 5C8ZA 2O2HA 1CUEA 2DQYA 1CFJA 4AZ0A 4CIBA 1LBTA 5A7FA 1XQYA 4J0KA 1QFMA 2JGEA 1TQHA 5AKJA 4B6GA 4DNQA 4EY6A 1WB6A 3G0CA 1YAJA 4CCWA 2WG0A 4FNGA 5LLSA 2JIDA 3WI7A 5C81A 3G0GA 5AP9A 3QBJA 2BKLA 4C4ZA 4FLMA 3FYTA 3AIMA 2WHPA 4N8SA 4L9AA 4C4XA 3O4JA 3S2ZA 5ALDA 1G66A 3KOOA 3QH4A 3R40A 3QITA 1UK6A 2WLSA 2XQFA 3WK9A 1C7IA 1AURA 2C0PA 2C58A 3HEAA 4QNNA 4HXFB 2XQJA 5BOVA 5AKZA 4BC1A 5E2IA 4MWSA 1OCEA 1ORVA 2OXEA 1VZ2A 5ALLA 2WUGA 4TVKA 5IVHA 4OD0A 3M3DA 2RIPA 3BF7A 2J4FA 5AK4A 1GGVA 3PE6A 2Y2UA 2PM8A 3B12A 4ZV7A 4A5SA 3HC7A 5IH7A 2CZQA 3GUUA 3UUFA 4RE5A 1EK1A 1MU0A 2R11A 3FVTA 4Y2UA 2PBLA 1HKHA 2PX6A 4AN0A 1VE6A 5ALRA 4QDZA 3WK8A 4CI9A 5CBKA 4AO6A 2Y1KA 3H2HA 5CURA 4H7FA 2HA4A 1CUGA 4Q34A 3VJLA 1BS9A 1YCDA 2QS9A 4G1FA 1IUNA 2HA6A 3G7NA 1F0NA 1CUZA 1QZ3A 2VF2A 3WIOA 1MJ5A 3D2BA 4WDQA 4LKOA 3C6ZA 4E15A 4S0XA 3FLAA 3DEAA 1DU4A 2VSQA 2CKMA 3DS8A 3QVMA 4YX9A 2JEYA 1XZEA 5JALA 1A8UA 2OPHA 1R9NA 3FYUB 5LZ2A 4JYMA 2X76A 4LXHA 5JZSA 4DNOA 2CUTA 2BUCA 4HZGA 5A7GA 1RYYA 5KBYA 3BIXA 4MYSA 3PDCA 4QE3A 2O7VA 3IURA 1TRHA 1T2NA 3RM3A 4YPVA 5AK5A 2VA9A 2DCMA 2XI4A 1I6WA 3GZJA 1Q0ZA 1KEZA 4RNCA 2QXTA 3T52A 3QYJA 1DWQA 1NU6A 4BVJA 2DHCA 3WL6A 5JAOA 1QJ4A 3V1KA 2VJCA 3H2IA 4G8BA 5AI8A 5ISMA 1LPPA 3H0CA 2JGMA 4I19A 4KEAA 1QONA 5EGNA 2HA7A 2WM2A 2DHDA 1DT3A 1USWA 3IUMA 5HK9A 3FNBA 1LLFA 1UKAA 3DKRA 3IDAA 2WFZA 4B80A 3QM1A 4AO8A 2PSHA 4JYPA 4UFPA 1CUAA 3CN9A 3V1NA 4KE9A 4G4GA 3D0KA 4UBMA 1FJ2A 1B6GA 1J1IA 1H2YA 2PU5A 4LYDA 5AM2A 3ZV7A 1EI9A 4EY5A 2PSDA 4GEGA 1PFQA 5JAPA 4QDOA 5LKAA 5CH3A 1ZI8A 4XVCA 2QUBA 1CUSA 2Z8XA 1Z68A 4BBZA 3KDAA 5FKJA 4IH4A 3DD5A 4F0JA 1P0IA 5JZBA 4WY8A 2ZVDA 1U2EA 1ZD2P 4XIIA 2FUKA 2ACKA 2HRRA 3WA7A 4G8CA 1VJ5A 4EY4A 3AIKA 1K4YA 5ALQA 1XQVA 4HRXA 4A23A 1SCKA 3DJYA 3IBTA 5K3EA 3GFFA 4OB8A 1X70A 2VT7A 4BATA 4X6XA 1R50A 4AN1A 1UWCA 4PW0A 5ESRA 1JJBA 3AFIA 3OM8A 5ALPA 3H18A 4I3FA 4AZ3A 1VE7A 4E46A 3VXKA 3WK4A 4P93A 5JD6A 3HRHA 5AM1A 2QT9A 1Y37A 3G9TA 4QDUA 5ALXA 1LZKA 5DYWA 3WKBA 5K3DA 3GBSA 5KWJA 1WCYA 3WKCA 4UBJA 5EHZA 4W1SA 5ALIA 1A7UA 3OTQA 4DSZA 3L1HA 3SC2A 4WFJA 3O4GA 1LGYA 2JGJA 2OLEA 2IX9A 5AI9A 4OUKX 3A2NA 5CT9A 1QIFA 1CUVA 4NS4A 5D3ZA 1XROA 2G63A 4U2EA 4FTWA 1O6GA 3MUOA 2XE4A 3I2IA 5ALFA 4LYEA 3PUIA 3A6ZA 3F97A 5AK3A 1W1IA 2HA0A 3FSGD 5FV4A 1QIIA 3OC0A 4BE4A 4BP9A 3A2LA 1ZGBA 4EA6A 4Y2VA 4K5QA 4W1PA 2HA5A 1EVQA 2GZRA 4X92A 2HU8A 3D4LA 1M33A 2XB6A 1ZICA 1UZAA 1MT3A 1GZ7A 3W04A 2B61A 5HZGA 4EUSA 4P9NA 3D5EA 2XMZA 2ZYRA 2VJBA 4BZZA 1W4LA 1QO9A 4WCVA
chains in the Genus database with same CATH superfamily
4I5DA 4F6RB 1KPHA 1BU5A 1Y34E 1MMFB 5IVPA 3KXLA 3V8BA 2ZYWX 3JARB 2JGRA 3SVZA 2Q3LA 1PK9A 2F59A 1BU8A 4FCCA 4MINA 4L5IA 4BO4A 1V7CA 1S2DA 4PNZA 1CR0A 3UMSA 2IOYA 5D85A 5IT4A 2R1VB 4W8OA 5BWBA 1SOAA 3U60B 2OOKA 1HMPA 4G86A 4YRRA 1WG8A 3N3BC 1FUIA 2FMHA 5AUNB 4W8GA 2ZXUA 1PD0A 1OA1A 1QX3A 4BIMA 4V0RA 5IC6A 1PUIA 5CIYA 3WBBA 4DMLA 4HWTA 3WYAA 4ARUA 1C81A 1QQAA 1HDRA 4BU0A 2IYVA 3BGDA 2ZIEA 4I2VA 3WLJA 1T2FA 1I9CA 1RW4A 2YZGA 3UN1A 1CQJB 2DWPA 4JLNA 4NDZA 5ALKA 3U3MA 3VR0A 3UBTA 4XQGA 3B2EA 1TZJA 2GPAA 1SVUA 3RUAA 1FTYA 1GRVA 4M3NA 4ZVQA 1GPMA 3CUKA 3VISA 4ZV4A 2RFLA 1R5JA 3ND9A 3F3KA 4N1AA 2HLNA 2G1AA 3U7QA 4ER3A 4RNDB 3AESB 1TJPB 1W19A 3UIEA 1KNXA 2J87A 4FOSA 4YN3A 3TM4A 5L6LB 2NW6A 1N6IA 5GIOE 3K9WA 1A8QA 3VZPA 3LBFA 4BO9A 3TJMA 2Y1CA 3CZQA 4E11A 5BYKA 3H1AA 4PLGA 1JH9A 1QRAA 3NVMB 3MCZA 1MO5A 1V0JA 2EP8A 4C4RA 2H2FA 4RDHA 5CB4A 3HDJA 1RCTE 3S2YA 3TSZA 1FSPA 1WAMA 4N49A 3D6VA 3GIWA 3HN2A 4QOIA 3QKSA 4CM4A 2J9YB 1UBKS 4BHTA 2B6NA 1T9ZA 4QOHA 3U4AA 3C3KA 1GL6A 2Q9BA 2Q4OA 4OQLA 5CVUA 2C2YA 3H2ZA 3TMYA 5CPBA 1ZUNB 4OM7A 5K4AA 3NC4A 5DHPA 1LZLA 4I50F 1V2HE 2CHFA 2FN8A 4O4LB 1N0VC 4BKQA 1L4YA 3QEJA 1E9RA 4BTLA 4EW2A 2CL6X 3UBMA 5BRNA 1R3UA 3O47A 4LG1A 3DBIA 2I4NA 4QQ8A 3REQA 3RSFA 3TW6A 1YR1A 1NL3A 1WHTA 2ZT7A 3A4NA 3BJEA 3D3EA 3QU4A 4PR0A 3TLXA 3VU9A 4F8EA 3A9RA 2F64A 5LIPA 2AG8A 5CT5A 3DDUA 1DJNA 1Z7YA 5EE9A 2OC9A 4HXGA 3ICOA 4OHUA 1C9KA 5CNJA 3SS7X 4CLOA 3LIPA 1RZ3A 1GGEA 2AMVA 5AK6A 3PF9A 1A5ZA 4RZHA 4CUZA 1Y98A 3HN7A 1BE1A 3IX7A 3NYRA 3GMDA 4HDMA 3IP7A 4IMIB 4PAOA 4B83A 5LQUA 4MI9A 2ZB7A 1SVOA 3ANTA 5IC5A 3GLVA 2FPIA 3GLHB 1ADBA 2NYRA 2QRJA 4IX1A 4KYUA 4P35A 3NFYA 4L51A 3CPJB 1P19A 4RQAA 3VR3D 1SU8A 5I7FA 3GGCA 4CDNA 2O8EA 3HUFA 2OSVA 4UFNA 3ISTA 4WZBA 1Y5NA 1NYQA 4DDKA 1TUBB 2A3RA 3QKTA 3TCKA 1PJSA 3CMCO 3VFDA 3GVIA 4F2PA 1PS8A 1PG5A 2H1IA 5BR8B 3AHCA 3HJRA 1PFGA 1YQQA 1TVCA 4YJFA 1UPBA 3BRCA 1QCCA 3H1GA 4DIUA 4FN4A 3LUPA 3H9GA 5CXUA 4XIYA 4RD3A 5IBQA 1WSAA 3FUVA 4ND5A 4WCFC 3BWYA 4JT8A 3KFLA 1GTVA 3KWMA 4DF3A 1JB1A 3W8RA 1U2RA 3I6BA 2YWJA 2VRWA 2X3YA 4FWIB 3JZDA 3G3EA 4F3NA 1E2EA 4GMXA 1S3FA 4ZEXA 2JCYA 1ZSNA 2EKPA 2BRUC 5THXA 3IRUA 2ERXA 1JB9A 1MR3F 3VNUA 1PQPA 2HSEA 1WOMA 3D3WA 3RC1A 3TAUA 1AKNA 4PPQA 3ZNNA 3I2FA 1A9YA 4LJYA 5EMHA 2CJWA 3KB1A 3PC8A 3NM6B 1T9HA 4KI7A 1OIVA 1KEEA 3ENKA 4HEJA 3T6KA 3V46A 1Q14A 2H59A 5F9FA 3PWSA 1EA7A 1R5BA 2GBCA 2J7PD 1VYHA 3FDFA 4V3BA 2WFLA 5PGMA 3OIVA 4ETIA 2QL5A 2I2WA 3PQ5A 3QUSA 3HCFA 1I2ZA 4IV0A 2Y9PB 3H5IA 2E5LB 2PH1A 3GFOA 1NI3A 3TNYA 2MMCA 1P7PA 2HSGA 2C61A 2CHUA 3RW9A 1N6HA 1OSNA 1Y1SA 5IFLA 4U2KA 2IVZA 4XGIA 2QTGA 4D6YA 5IT5A 4IJMA 2I65A 4B09A 3LP8A 3QU2A 4A0GA 2F8LA 3DP9A 1P9WA 1DSSG 2HTEA 2QJOA 2WMOB 3N1UA 3MOSA 1SWWA 3CZPA 5I9BA 1NIJA 3W8NA 4IUDS 5C0OE 3K0EA 1MFPA 4K6CA 3WX0A 4UZSA 1LI5A 4D99A 4UTPA 2GTPA 521PA 2CB9A 4WUTA 1Q1ZA 3A6GA 3QFCA 1MRSA 3DZDA 5AUPB 2AC2A 2OY0A 1JMKC 1RIFA 1ZCFA 3FPFA 2PBZA 2ZVJA 5KHLB 1E1RA 4KUHA 3ZDAA 2ZI4A 4JJIA 4NPHA 3O9MA 4YCAA 4ZI3A 3ZIAD 3UWKA 4D9IA 2K2QB 2WVJA 4MUXA 4DMUB 2BHTA 2VQDA 2JIOA 4X41A 5E1MA 1AXRA 1XVVA 4ZAXA 4E21A 3QWHA 4X8LA 3WR5A 1XJCA 4KZPA 2Q3JA 2VF8A 5K05A 2GAFA 2ZYAA 4EL5A 3BDVA 1O4WA 2A30A 3CLKA 5TQJA 5A02A 4B2PA 1TM1E 2ZRPA 4IGAA 4Q37A 4FONA 4I66A 2P2LA 2SKCA 4FJ1A 4LJLA 1BW9B 5SYNA 5C52B 4NZYA 2XVMA 3HFRA 3HKEB 4D74A 4DY4A 4F97A 3H6KA 5JWRA 5FLXA 4KVAA 4PANA 2QPLA 2XLCA 2IIPA 1FUYB 2DUUA 2ZIUB 3N8IA 3OWOA 4G85A 4UD2A 5C7OO 2R87A 3N0WA 1NRXA 4O2AA 1JWLA 1XLTA 1E6KA 2FFAA 2H9IA 2MSDB 4GP9A 4Q24A 4KYVA 4MMYB 4OAOA 3T7RA 1NGSA 2GCGA 5KNBD 2B2CA 3GLGA 3KNZA 1NQWA 4PS0A 2DY0A 1EDEA 1A97A 4ZV9A 4WZZA 1PJBA 2ESRA 2GBFA 2I9PA 3G5TA 1MX3A 1NMQA 1L7MA 4L4ZA 4ZCRA 4KC0A 5CFLA 5ARDA 2HRBA 1FUKA 3A32A 1HLGA 1K7SN 1UBRS 3MS4A 3TMAA 5JH7B 1OLSA 1X0VA 2HXYA 2WIKA 4QGAA 1I4DD 3KIPA 1CV2A 1Y1TA 2GR9A 1T9GS 4II7A 4MGZR 3ZY3A 1OI7A 1Z2EA 1E3JA 1JE0A 3MIZA 2BVNA 1QK5A 2RAUA 2JK1A 4DUPA 5ENDA 4JVNA 1E2UA 4FZ3A 4PWYA 3JQ8A 2ZJOA 1RM4A 2I4TA 2X7JA 3EGDB 4Y6QA 2HL6A 4A8JA 2X1MA 1DPGA 1OYVA 4NBSA 2FWIA 5LVAA 5CU7A 4BNXA 2CVQA 2PQ6A 3A31A 4EPXA 4TYMA 1WD5A 2C95A 3I12A 5K3AA 4OI0A 5LQRA 4FGUA 5DHQA 1DI0A 1W75A 3KFXA 4NFLA 1H4SA 4NU0A 3WBJA 4CF7A 2M32A 3PIIA 4GM4A 3N2IA 1JBQA 3NHRA 3JWEA 3ESAA 4K7JA 4W1RA 2JATA 1L7AA 1BA2A 2GOYA 4IIBA 5DYIA 2DJ5A 1PJZA 1DKLA 1FVOA 4W7SA 1DS6A 5AW4A 2GEVA 2HSZA 2P2CA 3NKVA 5HX7A 1VQ1A 3EB9A 4J0EA 4W9NA 2QYTA 4QUGA 4RO0A 5HCIA 3X1WA 1ONNA 1XQWA 3GGOA 1Z9BA 1RBQA 3OZ7A 5JWOA 1P17A 1RVV1 1XO1A 5E3HA 1E3IA 5KOJA 1NVGA 2A2ZA 3GJYA 3GZNA 3O9ZA 1YB6A 1GGHA 1IEQA 1ZM3A 2GBPA 4OFBA 4DR5B 3E35A 2COEA 1AGNA 2JFNA 3ZDXB 3H7AA 2I3ZA 3HP1A 3JYQA 5CA0F 3CGGA 4F5EA 5TMPA 3N7TA 4OEHA 1KNQA 4HAXA 1JKFA 1GXSB 3WWPA 5INTA 1P0PA 1T4CA 4MW6A 2V96A 4EL0A 2MHCA 2JIMA 2DETA 3INYA 4B4OA 1XA3A 3I6IA 3DXXA 3BHJA 3KUDA 3QJYA 2W90A 4FFBA 2HGZA 1KY3A 3H04A 3LKVA 3MWLA 2BFBA 1OWPA 2QRNA 3LS2A 4GC9A 4MUGA 3WKDA 1EG7A 4D25A 2V7PA 3EXFA 2GN6A 2LNDA 1WETA 2O8DB 3VR3A 3KP1A 3PUKA 5A2QA 1E79D 3A4LA 4JLUA 2HR1A 1QOZA 1OT5A 2WV9A 1ODCA 1PSWA 2IEZA 3RI3A 5BSFA 4NG5A 4YO8A 5LYJF 2C3UA 2CXNA 3OOJA 4G0VA 2W83A 4US1R 2OMKA 4YP7A 4C78A 1RXVA 3II6X 1OV4A 4QUIA 2P62A 1YJCA 2ZSUA 3DFIA 4Z3KA 1UJ5A 1WXDA 2JAWA 2O3RA 3O4IA 5JCPA 3H75A 3KVYA 1ZRHA 1T8RA 3EGWA 3PQ4A 1A9SA 1UJCA 1WCWA 2V7VA 2F1OA 4IIJA 2QRZA 3ITDA 1L5GB 2NSJA 3OX4A 3EA0A 1DG9A 3CSSA 5DI9A 1GA1A 1XA0A 2OHOA 3Q2KA 5IDYA 4BKRA 2IS4A 2SECE 1LLUA 1JG1A 2VOEA 1EZ1A 3FVWA 4BX8A 2D2XA 3I6ZA 4A5OA 3H1TA 4TX1A 1UBEA 5ECYA 4HUQB 3CB4A 4QJ4A 1FDTA 4HG2A 1M34A 5EZYF 5JSUA 4WAUA 2QUKA 4A92A 5TPWA 4MVCA 5B4TA 5LQDA 4ZU6X 2P79A 4FNMA 1Z4KA 4X61A 4JBLA 5DH9A 4P32A 1JDUA 1RRKA 1UZLA 2IP4A 3SWWA 1I0LA 4MLZA 3AZPA 3H4IA 4HB3A 1OU4A 1SBTA 2FF7A 3TINA 2C8VA 4WKNA 1TVEA 4ZOAA 5BSTA 2IS6A 4EATA 1JHMA 5B1HA 3PJDA 4C0QC 3EPPA 4IIXA 4YNBA 4BJ6A 5JBIA 3GJ3A 2X0KA 2ZCUA 1N5MA 3A9TA 3PKIA 4BO8A 4EEXA 1HO3A 2HBQA 3MGGA 4WKCA 3UC5A 3EPJA 4WDRA 2H1SA 5FORA 1WXGA 3BDIA 3Q88A 4GU5A 4B4WA 2CEAA 2GLXA 3L06A 1CQWA 3W2EA 2GPWA 5A9TA 1UADA 4L72A 3RC2A 4J16A 4DMMA 2GJ8A 3C7KA 5JCJD 3IEXA 4MQBA 2XNSA 2XMQA 2BR3A 4DNFA 1SKYE 4EA9A 3VHLB 2X5XA 4J2TA 2IBMA 2AZDA 1NM5C 1XZFA 3CG4A 3HBFA 4F8YA 2NSHA 2JI6A 4BRUA 3JQ9C 4X6YA 1TZBA 1JAIA 1D6NA 1GQQA 3N76A 5K6AC 1A8PA 1AK9A 2XUAA 3PVCA 1U1GA 4NR0A 2BLNA 3DMNA 3NM4A 2H54A 5K3CA 2YDYA 3ZIAA 3G2IA 3ET4A 2BJHA 5AKHA 2F9LA 2QVCA 2QW1A 3CNOA 3JQFA 3I73A 1XDUA 1C9EA 4KSCA 1WQ1R 5B55A 1PHPA 2HHJA 1MPXA 1N6PA 2AZ4A 3CUTA 1ISFA 4YDSA 1TPZA 3HR7A 1NWHA 2ADFA 4PSKA 4ZAWA 3MELA 4DCCA 4JLKA 4AZ3B 4ZPXA 2ATEA 2OLJA 3KELA 1TTPB 1S7CA 3ITNA 4AJNA 4D5GA 2LP4Y 3ERCA 3D7NA 1G8AA 3E8MA 1SZDA 1A8IA 1FYDA 4XVQA 3P5BA 2P7IA 1K0UA 1RKVA 2VJLA 3IUEA 4Q4HB 1FQJA 4RMHA 1O9HA 5BSKA 4BMXA 5KNBA 4Y1EA 3LUBA 4WI1A 4CEIA 2ZE5A 3IOEA 5HYVA 4YHHB 3F96A 2QU8A 3COZA 4A0FA 1P6QA 1X7GA 2G36A 1G60A 1DAGA 5FBVB 3ICVA 2ZETA 1J2UA 1YASA 3VX3A 1O94D 1CX9B 4JY7A 1XU9A 1C1DA 2OSBA 2D0OB 3CLVA 1D9ZA 2XCIA 4O1MA 5JATA 4KQEA 4HQ6A 4CEJB 3O75A 4CL2A 1SZJG 5JADA 3DPSA 1N4DA 3E1KA 3EEBA 2DUWA 4BNKA 2BM0A 1US8A 4E33A 4ZZ0A 4Z4FA 5JMOA 1GPDG 5DLYA 3JYOA 3LRTA 4FC6A 2CE2X 5FUXA 1NI4B 4FBMA 4OJYA 4II3A 1USGA 5EWMB 2IU0A 1H2AS 4PYMA 5HSGA 3PTAA 1PJ4A 3EWSA 3KKMA 3SC2B 1JVSA 1TM7E 1VBNA 4B7UA 2VZ8A 2FH5B 1LKZA 2MSLA 2Y4OA 4OLJA 1LLQA 4MQ4A 3FWYA 5FR1A 1JEYB 3GZ4A 3KR9A 4HGYA 2KI5A 2Q4TA 4TS3A 1ORDA 3TK1A 4BNJA 1HF3A 4MS3A 2PFKA 2RC6A 2WJAA 1T1EA 4CIWA 1WDKA 4NOKA 1N32B 3K8QA 5JO0A 1KY5A 3BAZA 3DLPX 2ZYHA 1Y33E 5CJPA 2YQ4A 4RJKA 3AJ9A 1P7WA 2JHFA 3EIXA 3R5XA 4PLHA 1GCUA 3FF1A 4WE3A 3HY6A 3PNKA 4WZ6A 5E4YA 3ZGNA 5ITWA 3KQKA 1VCMA 3U49A 3AGQA 2O8BB 4LV6A 2HN9A 1H1LB 3E5MA 4GMDA 3C45A 1OZ0A 2GM3A 4R3UC 5BN3B 3CMMA 4P1ZA 1V25A 1X6VA 1MHPA 1NMZA 2BEWA 2FG5A 1C4WA 4IRXA 2FPMA 5L7YA 1ZJJA 1SIUA 3LAWA 3F67A 4JYBA 4ESVA 3HJHA 3GLIA 1GAEO 4H2DA 2R6FA 3O0DA 1EEXB 2YXBA 4QA9A 3WGJA 2J48A 1JLRA 3K3PA 2QM7A 1FFWA 1N5JA 1QF9A 1TFRA 4M6WB 4HSEA 3W78A 4LF5B 2A9PA 1NYLA 3KQQA 1BDMA 1WW2A 2NO1A 5HKAA 2JCVA 2WWWA 1W48A 2ZRLA 2BELA 4B17A 4ZO7A 1E8MA 1DJPA 2AFIB 4QTYA 3GAAA 2C96A 3VZCA 1T29A 2A5YB 2Z1MA 1TU0A 2FFRA 2WAOA 3CLTD 3DBHA 1CSEE 3IEIA 3FGOA 1SR8A 3HV2A 3OZCA 4HGPA 1RWNA 4XIGS 1FW6A 2I9KA 4KW7A 4AJOA 2C3PA 3DE6X 4DJ5X 1RI3A 1TMYA 3HO1A 3E4DA 3RU2A 1SAYA 4X66B 5KYKA 4C3OB 3T4XA 4N54A 4IX9A 2GK7A 4OXKA 4UNNA 1T35A 1HNNA 5AJZA 2G1UA 1SXJB 5EUBA 3RS8A 1W6UA 3ZU4A 4DQLA 1AZSC 1ZW6A 3GFRA 3L6CA 4I14A 4UHJA 4M9ZA 4AX4A 1U28A 3LJKA 4BP3A 1UAYA 1RBZA 1EDOA 2ERCA 2B7BA 1BOFA 1I32A 1P2BA 2GN4A 3N2LA 1RLTA 2R7AA 3Q3VA 1XZQA 4YP0A 1ODKA 1RE1A 1HLPA 1NW3A 2JIZD 1FQOA 3QOXA 3B51X 4NZZA 3AOEA 3OWHA 1C2TA 1KFJB 3TUJC 3EPLA 4LX8A 2E55A 3EN0A 1AS3A 1W44A 4KH0A 3U9TA 3JRNA 4NABA 2JZNA 3UHPA 2WU4A 3IPLA 2ROQA 5JANA 3V9AA 4YJ3A 5L40A 5BMVA 5F5LA 4J1TA 2ACWA 3PRJA 4EF6A 1QRSA 3SJCA 3H8SA 1RCFA 2VYQA 4MCJA 5IU6A 2GTHA 1L3CA 2Y3IA 4YUXA 3ZDRA 4H0CA 3W6ZA 1SCAA 3H97A 4GHWA 1E0SA 1E98A 1N9KA 1P1BA 2FMUA 2GETA 3W3AA 2EX4A 3HKBA 4P33A 5FFNA 1DBPA 3SF8B 3OIFA 1P2FA 1YU6A 2JI9A 3UICA 2EFYA 3FCEA 4IEEA 2PY6A 3FROA 1F38A 1U2SA 1BDJA 1QNFA 3R74A 3U7QB 3HLTA 4HWGA 2P2GA 3VR4D 4DR6B 2X4DA 4AJ4A 1U0LA 5JCJA 3ORFA 1H1DA 2B8JA 1ESCA 2DPHA 2OFPA 2VK8A 5JDIA 13PKA 3IILA 4JEMA 4L9SA 3TSWA 1B1CA 3LECA 4W8HA 3H99A 4KQ1A 1P81A 1EFVA 2Y76A 4WFIA 4PZ0A 5CB4B 4J0DA 2YIDA 2OGSA 5AVUA 3H6GA 1IZ7A 4J4BA 3V4VB 4EYSA 2YCBA 3BB4A 2PMWB 4OHOA 4O59O 1K8QA 1UKZA 3QKSB 2IZZA 2XYVA 2NO0A 2VTDA 3ET5A 1WD7A 3UENA 1AUQA 4P4TA 1FQKA 4PV7A 4F86A 4NYJR 1K5PA 1K3UB 2E4XA 2O5EA 3ENVA 1NT4A 1V5EA 1WW8A 3CUSA 4CM9D 4UE2A 3U4QA 5EE0A 4FSXA 4NOMA 1H2XA 1IN8A 3T1TA 4OJKA 3ESCA 3WK7A 4KIWA 2KMLA 3W2GA 4EARA 1V3TA 1W49A 3RHTA 2JARA 1S4MA 1JILA 1ITZA 1U7TA 1SC1A 3G6WA 3O2SB 1G8SA 3REOA 5JJLA 3QVXA 3IA7A 1W29A 2HWKA 4WNAA 1Y9ZA 2J85A 4GLFA 2IWRA 2XJ4A 2IYPA 4K88A 2YRWA 2ECQA 4CLOB 1WABA 1YO6A 4G1VA 5HIAA 3CEAA 3JD1A 8LDHA 3DBRA 2R5NA 1T8PA 8AT1A 1R8QA 2Q5CA 1JYFA 1J9ZA 3H3FA 4FX5A 3BMOB 4HDMB 5DBOA 2E6KA 5DNEA 3IEKA 3HXOA 1T34A 1QPGA 4BNDA 2ZKIA 5ULLA 4DYHA 1NSYA 1M2JA 5FO0A 1YFZA 2A33A 4GKAA 4JB2A 1O94A 4ZDJA 2O8EB 2BI7A 2PRIA 2P9EA 4P0TA 4LDNA 3OPVA 1LLCA 2XF2A 4M22A 2V6IA 1KFKB 1B00A 1EE1A 2GLUA 3LC7O 4HFMA 1O87A 5FTWA 4Z4HA 5JS7A 3H2GA 4FE7A 3CVOA 4BJHB 1UFQA 5FX2A 1NN0A 2VJKA 4DCVA 3SFVA 4JLAA 1FJGB 1QVWA 2GZDA 5DGTA 2RKOA 1ND6A 4GOJA 5IXYA 3IPXA 1HBJA 2WP8J 4WIAA 1J0EA 2QMUA 1DWUA 4DZRA 4V2UA 4PFKA 1C80A 1ZI9A 3JQQA 4CKCA 1R0CA 3AY7A 1ZO8A 2HU5A 3BORA 721PA 1NRJB 1HLFA 2DBZA 2IYZA 4G0WA 1Z07A 2BHLA 2PL5A 1D7OA 1N7JA 3GHYA 3VC2A 2EW8A 1BSVA 3WDKA 3A37A 3DVSX 2Y27A 3T1HB 5KVSA 1Y3AA 1XMQB 2R68A 1EE2A 2O0HA 2QTLA 3FN4A 3PXDA 3D3WB 5LZ9A 1Q0UA 2GYVA 2SBTA 1XC7A 1YHNA 3WWOA 4DWWA 1G1MA 3R8CA 5CD9A 1KETA 2P9HA 4MEBA 1ZM4A 3QY0A 1TMKA 2CJWB 3A4MA 4Q7KA 1ZU5A 3HI4A 2V8BA 3E81A 4TMWA 3GR6A 4KR7A 4R1PA 4CU2A 2D5LA 3A06A 1UMDB 1ENOA 4QECA 5CK4A 3VC7A 4BYMA 4DSOA 1PE0A 1V9SA 2GEDA 4LY3A 3L93A 2O2EA 4V0ME 2QQFA 5FBQB 3JVIA 1SUCA 1OXTA 5BOSA 4RTMA 2E4YA 1X77A 3FYSA 1IDOA 3O84A 4CR8A 4Q0MA 4ROTA 3QUTA 4H7PA 3TZKA 2BF4A 1Q2UA 4JX8A 5JSKA 5LD2B 3VR5D 2AKYA 1CJTC 4E7OA 3TD9A 5ALVA 3PI7A 2P67A 2HHAA 1JV2B 5THQA 3F7TA 1ES9A 3OQIA 1LBIA 1Q95A 3HDTA 3UB3A 2GNOA 3DR5A 1EUQA 1ZVQA 4LE1A 3HABA 1UFKA 3N8DA 4OIMA 4RJJA 5BSMA 4ZWNA 3TAHA 2JHCA 3S7ZA 1IDN1 1VMIA 4HEA1 1WNFA 4JQOA 4DOMA 2ZSDA 3HP7A 1GU1A 2WY2D 2QAGA 2Z6AA 3SKXA 1CUFA 2NO5A 2WI8A 1U6IA 4YMVA 2G0NA 3P2EA 3G7UA 1M8KA 2FOXA 4PE5B 4YREA 2D0DA 3UJ6A 4N5LA 1MOZA 1C4OA 1C3LA 2EIXA 4B6QA 4M8NE 2Q07A 3QX9A 2V6BA 3NBFA 1FPQA 3QBDA 1K89A 1XI2A 4MW4A 2W22A 1NXWA 1YDFA 2XTAA 4PG7A 3FOEC 3HUDA 1UK8A 2IU6A 3EAFA 1J0CA 3P32A 4PG6A 1QBKC 2PUTA 5F5NA 4B6JA 2XGJA 3VYSB 2L0XA 3KVOA 1LSUA 2EW2A 1P7YA 4MQFB 1YUBA 3OE5A 3UW3A 5BVGB 2ZSFA 2QU7A 2JIZA 1N34B 2E4UA 4LDZA 2OK8A 4O2AB 3KAKA 1I4OA 3NB0A 2TMDA 1V6AA 4CMGA 2ZRQA 3AERB 3H2JA 3WGTA 5LJLA 3T12A 2VNIA 1JQBA 2F9MA 3B7GA 3CWQA 3HCDA 2H8KA 5EP2A 1IZ8A 5BO5A 2RGBA 5AW0A 3UJ7A 3WOHA 5CTAA 4GWLA 5HQJA 3MEQA 4L4UA 1DFGA 3NHPA 2J1LA 2J07A 4ID9A 2EATA 2H4XA 2ZJ3A 2RHJA 3I04M 3Q1KA 5ADWA 4LSWA 1H6BA 2JRLA 1KO1A 2PWYA 5CDSA 4C4TA 3KHUA 1GRQA 3UNXA 1RLMA 1QE5A 4HAYA 3RRNA 2AR9A 3E9EA 4X95A 5HGJA 3WDMA 4R6XA 4B3XA 2V1UA 3VR4A 2J9FA 3IS3A 3G9QA 5A1JA 2QNRA 4TTIA 1KI7A 2V58A 2YVUA 2W4QA 2Y1XA 2ZIWB 2JFQA 1IH8A 1PHRA 1OAKA 1GCOA 3R6GA 3BIWA 3QEBZ 1GAWA 2O7NA 2Q6OA 5JECA 3DOUA 3EAQA 3V1UA 2CMKA 2QYHA 3Q72A 1QV7A 1IBKB 3NBMA 1ESMA 2PSFA 2BLLA 1MQ8B 3OE7D 1MV5A 2GERA 5ALUA 1OD6A 5EKTA 4GUAA 4WJLA 1LEHA 2NQTA 3COPA 3UB4A 4AS3A 4Z4CA 4B2LA 4QBHA 1R7RA 1XZKA 1KVRA 2IKSA 2P68A 1LWOA 3BE4A 4RVCA 5LZ8A 4AX8A 4GT1A 4LOKA 5J2TA 2ABWA 2AWNA 4OYLA 4FFLA 2ANCA 4L9WA 4L57A 4CM9A 1EX1A 4UUOA 4YV0A 3LQQA 2BDEA 3TZ6A 2G1KA 2IV2X 4KPYA 2Z58A 3AJRA 3NOVA 1OTHA 3TXYA 1GTSA 3ZHOA 4NEGA 1R27A 1BKDR 3SR0A 3U7GA 1EGAA 4URUR 5J4KA 3Q41A 3GMSA 1JI3A 1D1PA 2Z9BA 3QFSA 1RJ9A 1G5IA 1V96A 5GONB 4FCTA 2VDRB 1Z5PA 3AF2A 2VH5R 3P2OA 3T99A 4F72A 4QFMA 1U9CA 3EGVA 3RS0A 1N2EA 1T4CB 1O96A 3F71A 3FYHA 4JHLA 3PL5A 1W5FA 1UOQA 4YCCA 3KV3O 4FFBB 1M0WA 2JW5A 4JUDX 4RHTA 1AKUA 1NFQA 5DEOA 3HCNA 1RWBA 4R0NA 4ARSA 3L7NA 1N2CA 5TVKA 3L4KA 3ICCA 1R0RE 4NARA 2CNNA 2PPVA 4Z99A 1P44A 3EXFB 1SC6A 2YFQA 3O8DA 2RG7A 4HDCA 2HNBA 4K0RA 3S99A 4G0QA 3GJ6A 4TYNA 1J2JA 4X3PA 3AC0A 1ZISA 1GITA 1YOVB 1ZSYA 4PBRA 1KIFA 5JSYA 5DNCA 1DCFA 2DB3A 4F45A 3C3XA 2GO1A 1D2NA 2HHLA 1HM5A 3DO6A 3FZEA 3G0DA 3NI2A 1ZZEA 4IDHA 1QQTA 1RHUA 1Z4OA 1FC0A 1WKCA 1XWIA 2IPNA 4PZDA 3RAGA 2XVAA 5DNVA 4EYOA 1I4EB 1T9GR 5CMLA 5BY2A 1ILEA 4EIWA 3M82A 5A9SA 5DTIA 5IN5A 2JJYA 2YXNA 1GAQA 3IP1A 4O4IA 1ORTA 2G25A 1JHXA 3LCJA 4MLDA 4AM8A 2PTHA 2QXUA 3D8SA 4Q9DA 4M1EA 2OV1A 3RHZA 2GJSA 1U9JA 4MZXA 1SBYA 3KQYA 4X93A 1S8AA 3L8GA 4NLLA 5DBHX 2FUEA 3EXEB 4FEGA 4JNKA 4U2GA 5GJBA 1CUIA 4MPJA 4AMUA 4TMYA 2GDZA 5C3UA 1DHRA 1RQ2A 3HRKA 4TOIA 4V38A 3W2HA 3WIVA 4FZRA 4EVQA 2Y6VA 2AOTB 1N6OA 1OROA 1YR6A 2E18A 2GPJA 2OAQ1 4CW7A 2ZS7A 1V37A 3N05A 2FP3A 1YS1X 2QR2A 4RV4A 1K0FA 1Y42X 3IP8A 4RSHA 2ZRBA 2WMDA 3TLEA 1XTUA 4Z0TA 4BNZA 1B42A 4ERNA 1ZIYA 2G7MC 3QVGA 5HFNA 6LDHA 1XUOA 2O2DA 3JZMA 5JXGA 5KYUA 2XRFA 3L0IB 2QQ5A 1S0UA 3RLFA 1DBSA 3FPBA 3J81k 1XTKA 2OG1A 2OCAA 2RK6A 1NJSA 4M9UA 2A9QA 5GVRA 5IM5A 2NZUG 4QWMA 3SHVA 3QG1A 1G291 5T6BA 2BGNA 1CJVC 3PYXA 2CF6A 1E6LA 2A4MA 3DV9A 3WMWA 1W0KD 3K5PA 1QRUA 3NYWA 3GDGA 5IVIA 1WXHA 3K94A 4YWJA 1UJ2A 5ALMA 1APBA 3GPLA 3E8SA 5DISB 2FN3A 2LV8A 3B1WA 4LGYA 4Q3NA 4KXNA 1J5PA 1W36D 1G64A 1LS1A 1QC5A 2M6SA 1COWA 2B82A 3B3GA 2P2SA 4KO1S 2QY9A 3UHFA 1QQBA 1LW6E 1G3MA 3CZRA 2PYIA 4ZJUA 1DTEA 3H5VA 4NDAA 1J24A 1HYBA 1NPTO 4Q4LA 4B84A 2R0QC 2CLFB 3WGYA 3DOEA 4ENQA 4XQEA 1UCFA 1JLLA 2P9QA 4O33A 4GX2A 4ZOLA 4CDMA 4ZDKA 4E07A 2V7QD 4OHXA 1NLFA 2QV7A 5I5GA 3SSNA 4F3RA 3EEFA 1ZC4A 3LHSA 4KBFA 3M6IA 5BMOA 2H1FA 1F7VA 2UZ0A 1XNRB 3OTWA 5T5QA 1ISPA 3R9KA 2UXBB 1D1QA 3NHJA 5G0VA 3DL0A 3IAHA 4BAUA 3TD2A 5CCEA 1MABA 3CV3A 2WTNA 1DVRA 1XYVA 2NAFA 4XGKA 4PM4A 1T0PA 2CFTA 3KR0A 4QGFA 4FWTA 5JNLA 3ZY2A 4Y6SA 4ENWA 2OUIA 4E5DA 1WVGA 2NO7A 1EWRA 2O2GA 5GZ1A 5JCZA 1M5TA 4RTKA 5F3WB 1K88A 1C1DB 2ZJ2A 2PUAA 1IG0A 1P5RA 3AEKA 3CJTA 3JALA 1YQ9A 1H2HA 5J1SB 4YHBA 2IQ5A 4MQ6A 5T4BA 4YDQA 5JD4A 4N5HX 4RULA 1GAXA 3EZXA 2R97A 4RQUA 5IDWA 5ALEA 2XEXA 4CMIA 5TIIA 2ATCA 1J99A 3M6AA 2FPPA 4WQMA 3ZDYB 4AJ1A 4DDTA 2DWOA 4LYHA 2HA3A 2D7CA 2ORED 5BYJA 5IM4A 1G8GA 1ABFA 3DMTC 5C8XA 1JEAA 5TRTA 3W3ZB 3TZHA 3AF6A 4M38A 5EJ4A 2JRCA 4JGGA 4UHCA 4BZWA 3TNLA 2P75A 5TV2A 3O4VA 1R8SA 4MS3B 2FR8A 4GI2A 3UMRA 1P8JA 5CG2A 4QZVA 1GU7A 5JVDA 4L3OA 1N77A 5B4VA 1MFZA 3PQ6A 1N33B 4MMXB 4OBBA 3BXPA 4PGMA 4XWGA 1FJXA 3BJRA 3RFXA 1XTIA 1Y3FE 3OE7A 4FR2A 4QTZA 2RHRA 1C3XA 1QWOA 5CT8A 4BGIA 1DG3A 4RLQA 1BJRE 4F6LA 1RTTA 2QXYA 3HB9A 1EWVA 1H2EA 5AQ1A 3VUEA 4DUGD 3O5AA 2JIPA 4LIPD 3CM0A 2BEWB 4RCVA 2ON6A 2F1HA 1NY6A 2XUZA 1M7BA 1Q1AA 2OQRA 3CEPB 4RV9A 4HMQA 3TOZA 4TSKA 2G5PA 1AD2A 1J23A 1NNUA 3K0KA 5E0KB 5EMKA 4KV7A 5K2OA 1R8JA 4MCIA 1E5QA 2X14A 3DZFA 3EMKA 1F3LA 3OLZA 4PC6A 5L95A 3E15A 5TB5A 4E1BA 2W6QA 1N57A 3RTCA 2I2DA 5KO2A 4PWZA 5FI1B 3ONNA 4EABA 3KC2A 1GFWA 5EPUA 4J75A 4QM6A 2PRSA 3G2PA 1BFKA 1JNXX 1G5QA 1Z0DA 4ZHSA 1U2GA 1NW6A 2ZUSA 2VN8A 2DMRA 4MV5A 2JL1A 3SHOA 2ZU6A 3IR6A 4MV7A 1FDWA 1IY9A 2GRJA 2J33A 3GFPA 4FSDA 4IM7A 4K2AA 2RD2A 4I1PA 4UU7A 1KOGA 1NVXQ 2VWGA 2OECA 3NHUA 3FTDA 4EH1A 4PFQA 1FK8A 4DV3B 3R5KA 4TROA 2Q3FA 1NQVA 2NU6B 3K8YA 3SZ3A 4W9RA 2AK2A 3Q7QA 4EG5A 2MJLA 4UVEA 3K2QA 1TA9A 3JYHA 3PEUA 4KLNA 1FVXA 1TD1A 4XZ3A 3ZC3A 1ZGAA 4E14A 1VKZA 3Q8LA 1BJTA 1KO8A 1EUCB 1L7VC 2BTOA 2P3OA 3GFBA 4XJTA 4EZBA 4AECA 4BJ3A 1JA9A 3OKFA 1IBRA 2QX8A 1XLWA 2WHQA 3LMKA 4LRQA 3RJ9A 5FYQA 3O0TA 2KM1A 3W4KA 5DGHA 5BR1A 2ZJ7A 3PPIA 4GR9A 4MW7A 4OU4A 2NQ2C 3ZH9B 3SQWA 1RLJA 1OFTA 1MO4A 3CKLA 4QJ3A 3INTA 4LXXA 1X42A 2ATIA 1Z4LA 3SQDA 4DMFA 3EXIA 3MMXA 3TRHA 2AFVA 3WVNA 3STVA 3M2TA 2PUVA 4IQ0A 2B99A 2QW0X 1IZZA 4FW8A 4WTOA 3OJFA 4LXIA 3HWWA 4CL3A 1ZHHA 4WBNB 1JLSA 2CHVA 3W7AA 4X54A 1BTOA 1J70A 2QN7A 3QBVA 2VP3A 4LZZA 4P54A 3BTVA 3TW4A 1U1FA 1UK7A 4HHEA 2QD2A 2B36A 2PZMA 3I62A 1P1FA 1X7HA 3ME5A 4YMIA 2EJWA 5E1OA 5JEEA 1HG1A 2YZNA 4INZA 5BMVB 3WRYC 4V1CI 4TQ9A 2HI0A 3IAUA 3UJHA 1LDYA 4C04A 4UCXA 3AF4A 3DA8A 5AOAA 3UANA 1XK6A 4GSLA 3ZGXA 2XYPA 1UH5A 3KJFA 5FQNA 2ARKA 3ZWOA 3GCXA 4RTOA 5KJ1A 3HKBB 2DYKA 1XDZA 2YXEA 3M6XA 3R77A 3VKWA 4ER0A 3BXXA 2C2BA 2BEUA 3S2EA 5TARA 4E6EA 4E70A 1ZKMA 1HQCA 3WNBA 2YXPX 4J94A 3EX7C 1IPEA 2FSPA 3RODA 1LTQA 4D9KA 4UW9A 5SZIA 4MDFA 2V74B 1OE0A 5A05A 2DKFA 3OPYI 1NYRA 5HFJA 2GNPA 2IU3A 3X3HA 2ZULA 3AVYA 3NIDB 5A4AA 2IZ7A 4BE7B 3F9CA 3LDAA 3NONA 3FWHA 1UZUA 2C4UA 1PR3A 2J4CA 4MP3A 1W0KA 3QE0A 5DOVA 5AOBA 4QYSA 4AVYA 1IL0A 2R3SA 4Q7MB 4PN3A 5DTJA 1CQPA 5BSHA 1IAVA 5AXCA 2Z6QA 1RM0A 3PB3A 1LNZA 3E2PA 5J40A 3UV6A 4AD8A 4PX5A 4EFNA 1IN4A 1Z5ZA 1QZZA 3OFJA 1ODSA 2C82A 3ZEIA 2Q0SA 2J9ZB 2JFUA 4IDDA 2V45A 3GU3A 3WYGA 2PJZA 2GF9A 4ZI2A 3S81A 3J7TA 4E3ZA 3MCAA 1WPXA 3UMCA 3ZBTA 3OSUA 2AK3A 2N0SA 3E3AA 4JP8A 1VSQA 1FBTA 2ZI9A 3N39C 3FJYA 3OIYA 1GG5A 1J4AA 2AF3C 3H5AA 3ZN2A 1MORA 3EVGA 2WZDA 4MVJE 4WD3A 3IULA 1ZJ4A 5DHRA 1JHQA 2NSLA 3U0VA 2WE8A 1DXOA 4WNAB 1SELA 2XADA 3A0UA 3ZCUA 4FW9A 2GPYA 3ZWPA 3ZYZA 4V0KA 3TRFA 3IQHX 4IHJA 4K81B 2FXVA 1X1QA 4YECA 3IUJA 3DBRB 1UT6A 2AC4A 3UMFA 3FFTA 3K6KA 5DPMA 2IY8A 3LLSA 4EM6A 1JQEA 4U6QA 1C0KA 3GPBA 4KO4S 4BNDB 1XK7A 1QF6A 3KYCA 5CLIA 4EAAA 4QHSA 4TL9A 1I13A 1VM6A 2IUYA 2VJMA 4DJFC 3WWEA 5J4HA 3KQNA 1G8MA 2XSZD 3NTQA 4NQZA 5I9NA 1MC5A 2XITA 2FW7A 5DGDA 3I45A 1E3DA 4ZAZA 1YZKA 4OP1A 1DIAA 1TJ3A 2AX3A 1EP2B 4B79A 1CZKA 3KZVA 1Y7TA 4PQRA 1A1SA 2XKKA 1D1SA 4F93B 3LWDA 1O0CA 1KJ9A 1RAEA 1RM3A 1S3SA 3HZOA 4EF5A 2R4TA 1M8PA 3AV0B 2OD9A 2VDNB 3USCS 2JVIA 1E3TA 3OLYA 4NVRA 4H1TA 2G9NA 2NTYC 3AH8A 2F55A 1UXGA 5LDGA 5KOHB 5AMXA 2Y77A 1LPAB 4M0EA 4MW1A 2KX7A 2SICE 4MR7B 2OV2A 3HQ4O 5U1PA 1LJ8A 4IIEA 5IWCA 4JSRA 1HDGO 2OPBA 5UKDA 4C7OB 3DUFA 3MLAA 1W87A 5JYBA 3DH0A 2I67A 4PO3X 2XCSB 3EQ8A 3BJIC 5JS1A 3QV1A 4BLSA 3C5EA 3DPIA 2Y1WA 4MV4A 3WK4A 3WJAA 1Y9EA 2PS3A 4DPMA 1P91A 5ALNA 3TX2A 1GPUA 4I9NA 5DWDA 5T3UA 4AC9A 1UQUA 2C5LA 3IAS6 2OM2A 5KYYB 4GOKA 4URYR 1IVSA 3U5TA 2VSOA 3IQZA 1G5FA 3DHWC 3EF0A 3K7EA 1WUHS 2FDRA 4PPNA 4AW9A 4YRCA 4IICA 3CRRA 2J0EA 4P6VF 5J5VA 4LXUA 4BQRA 1ZGCA 5FHRA 4J7AA 1GZVA 5BOSB 3P71T 1QYXA 2I7DA 3KKQA 2Z56A 4EZIA 4IFTA 3ECSA 4ICIA 3DE1X 4PSAA 1UBFA 1WF3A 2P27A 3CVJA 5J4VA 1N5LA 4LWZA 1EVLA 1X7YA 2W2LD 4I9HA 4QT4A 1U6JA 2NUPA 4MV8A 5TJ9A 1ZH8A 4MW9A 3AUAA 1X86B 4MQMA 3SU8A 2PTGA 1TNDA 1J5XA 3CLRD 4RGYA 1DL5A 3LZ6A 1JJIA 3CX3A 3WLTA 4D8WA 1JG4A 4Y2SA 4TRNA 4R9RA 4Z49A 2R8EA 2EGHA 4XJVA 1X38A 4GM1A 5C4MA 3D3JA 1WDWB 5E8RA 2R6R1 1GIAA 4BX9A 3R4CA 1W35A 3UCEA 1PV2A 4GLBA 2OXCA 1B0AA 2XD9A 1NP3A 2QAGB 4OOEA 4QNRA 1L1EA 4TV9A 1YJ5A 2C9DA 4I8XA 1MB9A 3DWGA 4CEHB 3GZTB 4WY5A 2DF8A 2GZSA 2D5BA 2WIAA 2P2ZA 3BQMB 1SCNE 3R20A 4GZ5A 3FBWA 3S68A 4BNTA 1CY8A 4GI7A 4JT2A 3N2KB 4KKXB 1Z74A 2XUDA 2FUNB 3CR7A 4B0OA 1ZL0A 3ZVKA 1WBDA 5EIHA 2RH8A 5ERXA 3SHTA 1J22A 1NQXA 2RB5A 1R66A 3M5CA 1GZ3A 1PBTA 4FZVA 2OO5A 4O0LA 4ARBA 1P2GA 3B6MA 4UUBA 2HLDD 4NCJA 3QEAZ 5LMCA 4HQKA 4JL8A 5K1ZA 5LP6A 4QQFA 3SQMA 4QC2A 4B3MB 1M54A 4IFIA 4PAQA 2FSIA 2D3WA 5DP1A 2ZJ6A 4HS9A 3F7NA 4KXYA 4UBKA 1O7JA 4Y98A 3CLSC 5F4ZA 3X43A 3Q3IA 3ADCA 2VCHA 4C7KA 4JXZA 3E18A 4K05A 1DJOA 2WC1A 2X6RA 1GUYA 4GVLA 4R8LA 5DRTA 3ZE6A 3ANLA 4D0LB 4DTCA 5LQNA 3OF5A 3EEIA 1F51E 4AYTA 3VDQA 1Z2OX 2J0SA 2EQ5A 1SC9A 4FFNA 1IZYA 3TJZA 1QQ7A 3E03A 3UEOA 2AKEA 5HG0A 4EPYA 4WK6A 3MWEA 3KQWA 4J7CA 1OH7A 1VE1A 3KQUA 2B8NA 2HX1A 1TF7A 2WQZA 1Z39A 3TNFA 1W5AA 2HDWA 2LKCA 5I4CA 1UZMA 1SHTX 2QJFA 1FF9A 4HDRA 3QBEA 3T9CA 2VJOA 1O2DA 4RBNA 5E1BA 4C2BA 2B2NA 3DLCA 1SBIA 1T8WA 1Z6TA 2QN8A 2GXQA 1W34A 3NRBA 2X9NA 1XYGA 3IQWA 5K0LA 3RWBA 4EVIA 5CITA 5H02A 3IO3A 5C37A 1PFWA 3WYDA 4XRRA 4C0HA 2IH4A 2J9FB 3QE4A 1O6FA 5K0NA 4EKIA 1SBZA 1CD5A 3RK0A 3E7PA 3P8ZA 4PGGA 4AG5A 2PKQO 3OCXA 4WXEA 5BUCA 1H23A 1F60A 1T8UA 2AYYA 1CVLA 2V5UA 3EXHB 1QB8A 3RYTC 4UVDA 4FT4A 1EESA 2Y67A 3C5HA 3M7IA 4I50A 1ZH2A 1GPWB 1ACJA 1I80A 3S44A 2CN1A 4HLUC 1JFFA 1GZDA 4TS4A 2V9ZA 4XGNA 5J1TB 3VYRB 4I46A 4YPFA 5AJWA 1XVUA 1L1FA 3E0XA 4ZI7F 4YPOA 1NE2A 3TPCA 1RQGA 4Q18A 4MK4A 5GZ6A 1QYWA 1WWKA 4CDRA 5J2TB 4ZXFA 2CFRA 1XV5A 2X3UA 3BIOA 2D8AA 3PKJA 2HU7A 2D3TA 2IL1A 4CKBA 1EFPB 3RSSA 1X8JA 4D41A 2QTWB 3N2YA 4F1KA 3AINA 1BQ4A 1S2OA 1NIPA 2NVUA 2YRXA 2NU9A 1NG1A 1X80A 3SR3A 1ABBA 1XVAA 4ZPJA 2BSQA 2DR0A 4JLDA 5DIZA 4L73A 1F0KA 1RJ9B 3UYKA 3AM1A 2IOFK 2AQ8A 3MXOA 5YASA 4JI5B 3O8OA 4QVIA 4INOA 1OPXA 4TLBA 3H2KA 4TLDA 5JD5A 3ENNA 4GKVA 3A6FA 5SYAA 3WFIA 1O96B 1JWAB 1AHNA 1QH8A 4RKWA 1XP8A 1A9PA 3QVKA 1XQXA 1B14A 1IQ0A 1K6EA 1NDHA 3TQOA 3JSXA 5EJ6A 3FUUA 1N2CB 2Y8EA 2WJ4A 2ZB8A 2JJ2A 2HRQA 2JAXA 5KQGA 3L43A 1DFHA 4C3VA 2C7PA 2O06A 4UZEA 4BMOB 3FHTA 4EGJA 4N5MA 2XSZA 3UOAB 3PEYA 5DWVA 5BQFA 1QHHA 2ZPUA 1DBWA 2ZR0A 5F51A 3GLIB 3BIFA 2Q7DA 3ZBQA 7ADHA 3IV9A 3JQAA 1W85A 1E5VA 3BCHA 5TX7A 4BRZA 3JCZA 3I04A 1GV1A 3T5DA 1U3UA 4XARA 2IX3A 5BNTA 1MTOA 5K8VA 1J5EB 3W9SA 3INNA 4KPGA 3TLZA 2CXHA 3OZDA 3QLJA 4NTZA 3WLEA 4TS1A 5A9SB 10MHA 4Z0HO 1C7EA 1Z17A 2GZHA 4M1SA 1IN6A 1T0UA 3LT5A 4UCQA 2PVPA 4F46A 1DDOA 2EKDA 1ODJA 3MT0A 1GADO 2HO4A 1UXOA 1NMXA 3A2MA 1EX7A 3H7IA 3PDUA 4JP3A 3QKUA 3GN1A 4RGQA 4EI2A 1NMEA 4Z1MD 3IHKA 3ZU2A 4D9EA 3JATA 5HRAA 1OWNA 1LRJA 4J49A 4M9QA 1YSCA 2XDWA 3KU1A 3NNDA 3IAM6 3USZA 1MTZA 1JEDA 1VSUA 2WWXA 1W1UA 1U8YA 3HBJA 2E4AA 3RYIA 2ZZNA 3PFBA 2CDCA 3AM3A 3F8WA 4TMVA 1LF0A 5DHSA 4QLAA 2XNCA 5DSTA 3B1KA 2LCQA 5JZMA 2CFCA 1EPUA 2HGSA 2P9YA 1GA4A 1B8UA 2WD9A 1NUAA 1U99A 2OBMA 4K9NA 3U4IA 3MTAA 4J0IA 2WYUA 4M1KA 2ZVQX 1UXIA 3KYDA 1HORA 3EIQA 3LXUX 4UPDA 3VV2A 1T25A 2DECA 4BDSA 3ZH2A 3SS8A 3VZRA 3V7WA 3Q3HA 1MGPA 3RK4A 5EKDA 3IYLW 5HIMA 1BCSA 4MVJI 1HG0A 1ANKA 4R5HA 1ZJZA 3UA3A 3T0IA 5IMBA 1YZGA 4HDKB 4LMRA 3ZGOA 1TGYA 4IGFA 2XB2A 4B3GA 1PEDA 5F1KA 2XF8A 4P2BA 2VDOB 3UJBA 1KO7A 3B6ZA 4AICA 4RC9A 3KXKA 2AL7A 3OOSA 4FOPA 3GOQA 2X0FA 2PBRA 4J6FA 2ORYA 1WSWA 3BXOA 3Q9UA 2YOGA 3DOIA 4J0CA 4TUYB 1M1NA 1L5OA 1NJ5A 2VAMA 2ZYGA 4L7QA 4LHZA 3UHOA 5IARA 5LFAA 1UXJA 3WB0A 1LI7A 2GQ0A 2E1RA 5ICEA 2GWRA 3AXTA 4AZ0A 16PKA 4S05A 3DBLB 5A7FA 3OOWA 4NBNA 4LY6A 3S2FA 3ZJYA 1KMCA 4G6ZA 1IK4A 4MTLA 5HBGA 3KJEA 2PH3A 3ZWYA 3KHTA 4JR2A 1I7SB 4KV9A 4NP6A 4E08A 4OM8A 3GEDA 4HPJB 1TQHA 5AKJA 2DUNA 1Z4QA 1WB6A 3HGTA 3RS2A 1WO8A 3ANNA 4EY6A 4JZKA 2Q1TA 4CCWA 1YBHA 2CNDA 2PR7A 4ZOLB 1XR3A 4FEAA 1XHFA 3AETA 4FNGA 1SXIA 4RZ3A 5AW5A 1QCZA 2KLBA 4RVGA 3NOQA 4CM8B 1PUXA 5DW0A 2VLBA 1UBNA 5D3QA 2ORIA 1G3RA 3G0GA 3ZLJA 4RY8A 5AP9A 3THSA 2HV9A 4YMGA 3QBJA 4DR7B 4B34A 1XP5A 2C84A 3EASA 3MYRA 2BEJA 2Z4RA 1UBMS 4HAOA 4BEWA 1KQGA 1FFYA 4FT2A 5FWYB 4WLOA 1E69A 1DNPA 4N8SA 1HZZA 3T5PA 1RRCA 4PO1A 4NBTA 2XTNA 4A27A 1CZRA 2YW9A 3FNGA 4Q9HA 5G1OA 3BWDD 2JJMA 3FIUA 4GPEA 4N3CA 5I7VA 1N8NA 3AEKB 3JALB 3O4JA 2NZXA 3NALA 4O4LF 3X2EA 3GT7A 4G5QA 3C98A 4TN1A 1G66A 2IXGA 3KOOA 3KVVA 4L76A 1KQ3A 4CMIB 1JR2A 5KVQA 2XQFA 2NUTA 1MB3A 3HJBA 5LBTA 4TKVA 3NVDA 2C0PA 2UVPB 1DRKA 1MUUA 2WSBA 3IC5A 1N0HA 3PFKA 3DQQA 4S1TA 5EJAA 2YBDA 1DC7A 2RHGB 4P31A 3TZLA 4DKJA 3FWPA 1QGZA 4JUFA 4RA9B 3EW9A 4JLWA 1ZX1A 3BVPA 5IKMA 1AQJA 5IZCA 5T7BA 3GNTA 4F5YA 4BPRA 1DAMA 1AGRA 5CHYA 4YAUA 3NORA 4DV7B 4ZC8A 3TLCA 1PZMA 1WR8A 1Q2XA 3C24A 4MWSA 1SXQA 1VZ2A 1R0YA 2DOKA 4NFHA 5C32A 3D7LA 3I39X 3UJDA 2P6MA 4DA0A 4NNOA 3IHLA 1UBLS 2BI8A 2KHZA 1T2AA 4QAQA 3G6KA 1XU7A 3DQPA 4OD0A 2B9EA 3M3DA 1PCXA 3EVAA 3V3TA 4BB5A 1OBFO 4DE5A 5IT9A 2VHEA 1OZFA 1GGVA 1RXUA 1BGWA 3PE6A 4A03A 4R98A 3TTYA 2RHBA 2GXSA 3B12A 2CL7X 4W9MC 4C5CA 5CLJA 5EQJB 2CDRA 4A5SA 3GMIA 3I3OA 1ZKDA 1KI9A 3PV0A 5TQ0A 4M1TA 1IULA 3ORYA 5H1YA 3GUUA 1EK1A 2HXSA 4ZVNA 1MU0A 3IKJA 3LU1A 3NWJA 3DMYA 1FSZA 3U09A 4BU1A 2YJTD 1FTNA 4FPXA 4WBSA 1MVLA 3ZGVA 4BLPA 5HKOA 4U5QA 1T2CA 2PBLA 1RYHA 1AUPA 1I1HA 4RSGA 2VG8A 1FSFA 5J5CA 4CMHA 5HXAA 4W4TA 2XGGA 3EUEA 3JD2A 3ELUA 5ALRA 3SZMA 5K99A 2E9SA 1UT8A 5ABPA 2QD4A 4FGSA 1NZFA 3ZK8A 2YMMA 5DM2A 2FE4A 4CYMA 5TR9A 1KKLA 4Q34A 4LRWA 4EVSA 1RHMA 3VJLA 1FX1A 4EGCB 3V4RA 1KDPA 3CC8A 2FPGA 2IXEA 5DHAA 5HA5A 1C3VA 3U3ZA 3K1JA 4CV0A 1TAUA 1GZ4A 2VK2A 5BR7A 2JA2A 2YFKA 4UEWA 3WMXA 1O97C 3T38A 2J45A 4D81A 1Z6YA 4KQJA 1CUZA 1QZ3A 1T4DA 2VF2A 5EZYA 3WIOA 2GM4A 4XX0A 4OP2A 3AVOA 2RK4A 1CNMA 1KQFA 5M29A 1A2BA 1MB4A 3EXIB 2XZOA 2IS2A 3EA5A 1BVUA 5HM8A 2KYRA 3F6EX 4D45A 2PWAA 5L9AA 4S0XA 3FLAA 3DEAA 1YC5A 3DS8A 5KKNB 2HUPA 1P75A 3GUHA 3MUEA 4GYKA 1RPAA 4FYYA 5CP8A 3PFGA 2JEYA 1H0KA 2J3EA 3D3QA 4RAQA 4YX9A 1FTWA 1HE8B 1OYYA 1O95C 2E21A 2QUJA 4JB8A 1C9DB 2ZLBA 5CVVA 2QRVA 3FYUB 4JYMA 4PNEA 3OLXA 4PIMA 5F21A 2O8FA 1KJIA 2G67A 4OHZA 2CKDA 2JKVA 2W2NA 3S8MA 2B4RO 2GA8A 4LXHA 1QH9A 5SZHB 3N6VA 3B5JA 3DWIA 3FDZA 4DNOA 5B2FA 3AFHA 3K35A 4PEVA 3DDNA 2CHQA 4HZGA 1ZBQA 4HDSA 3LVBA 4CE6A 5BV0A 3IXQA 3NBXX 4X1KA 2HTFA 2FFBA 4CM1A 1E2GA 2G1PA 1YMVA 4D4IA 5CYGA 2BEUB 1F2VA 1N6NA 1EP1B 2NO9A 1HE2A 2XBLA 1EK6A 4L2IA 4YDRA 4D9BA 3WNVA 4EBFA 1X9HA 2Q1WA 1O54A 2JI7A 1P1RA 1K5GA 1T2NA 1YI0A 2KW5A 2VWPA 3M4JA 1EWKA 4M49A 5AK5A 2VA9A 4ZQFA 4GXQA 2XGMA 3OIWA 1VBMA 4CIVA 4QJ5A 3G89A 1XL1A 1ZOLA 2J4DA 3LPLA 5ICSA 1CY2A 2WJVA 4HEQA 3DTVA 1SRQA 4GYWA 3D6UA 3R0XA 3VM6A 1N5IA 3T52A 4G56A 2WWGA 3LPAA 3QYJA 1SY7A 2HCTA 1C9NA 3WNCA 3SPXA 1DWQA 2BGIA 1HFJA 1Z5VA 1NU6A 3LT4A 1OGIA 4RPKA 2V6MA 1XBTA 3LW8A 2OZPA 3CVUA 5T41A 3UUGA 2Q99A 3LDGA 1ZU4A 2JFWA 4XLLA 4LRSB 1U0JA 3R5SA 5ISMA 1W36B 3IT2A 5KYNA 2F8SA 2QX4A 2Q2WA 2R8XA 2WMNB 5KOYA 4NG4A 1A9OA 1LPPA 2R00A 4LW8A 1FTQA 5JXHA 1RKXA 2NPFA 3RIYA 3ER9A 2QRQA 3BGOS 1KDZA 1A95A 1P4GA 3KAJA 3RWOA 2JGMA 4U6SA 4KLAA 1JDPA 5FCDA 3ZR4B 4YRMA 5A9RA 1II8A 4F96A 1ZJWA 3NETA 2F1KA 2Y0BA 2HA7A 1M76A 2WM2A 1OYWA 1IE3A 1GPH1 1NLUA 1C4KA 3OC6A 4UVIA 3ZU6A 2J6HA 1KOJA 4MRAA 4JOCA 2AMYA 4FX2A 4UPEA 4EDFA 1HX7A 4IHJB 4EFMA 1IPFA 2F8TA 2FUCA 3NKLA 5G02A 3EWAA 1FP2A 1T10A 4HBGA 5JZVA 3LZCA 4X1OA 3QG5A 4B80A 4N39A 4M86A 1U94A 1D03A 2GNAA 2R79A 4OYRA 3X2SA 4CCAA 2C3MA 4M54A 4XDYA 1R15A 4IL5A 4URHA 5IK2A 3GAFA 4EEZA 4F1JA 4B6EA 2PSHA 4JYPA 4UPVA 5KDOA 1JPVA 5GINE 3FIJA 2AFHA 2F67A 1FNBA 1P5FA 4P4GA 1PEAA 2RI0A 3ASYA 4BNFA 2Q5JA 3T7DA 1OREA 2XX3A 1FJ2A 1SXPA 1BH6A 2F1JA 1XVLA 4HNSA 3GJ8A 4Q6WA 4RK7A 1QVZA 1GQFA 3UGQA 3EUFA 4UTRA 5AUOB 1RWVA 1NI5A 4IXDA 1EBUA 2EZUA 3OM1A 5B7NA 3HU5A 3HNOA 5K03A 4LYDA 4XFKA 3RFUA 1YE3A 2WM8A 3P27A 2IHBA 2A4KA 3GY0A 1ZOSA 2CHGA 2WE7A 5SY9A 2FETA 2IRWA 1QG6A 1J2RA 3ZV7A 2PSDA 3IMKA 3DV2A 3AB7A 1LV7A 4KITB 1BDHA 4UDXX 1JHDA 2VH2A 4R1LA 2MSEB 1DCMA 4L95C 3L6DA 3DUFB 1GT91 4HZIA 1E9CA 5CH3A 1BHJA 3PQDA 2ZRKA 1C5KA 4JJKA 5B3JC 4DG5A 2YWEA 3PUYA 4RV5A 1SB9A 3FVQA 3IKLA 4R6WA 2Z8XA 1Z68A 4A6DA 2BH9A 3WGIA 3THYB 5LDHA 3TN7A 3A6DA 4N01A 1J7JA 3JWJA 2QAIA 1L6RA 2GPSA 3N58A 5FKJA 3ZDDA 3VR6H 4BQNA 2Q5EA 3THWA 4FDTA 1P0IA 4JP2A 4LWPA 5A0FA 1EFRD 3E2MA 3M9XA 2C04A 1Q74A 1U2EA 2H18A 2NZ2A 3U7JA 1XAHA 3N2GA 4XIIA 2ACKA 3NAMA 2HRRA 1S6YA 3K16A 1RM5A 4C30A 3MT8A 3O92A 2I55A 4EY4A 4GPZA 3KAQA 4QARA 1BGXT 1JXOA 2H63A 4J91A 3BMNA 4RMNA 4B44A 4CLRA 5G1PA 1H3FA 2BDTA 3IBTA 3PZRA 4ITUA 4B5LA 1Y7PA 2AN9A 4QGBA 4DEYA 1OFIA 4OB8A 3WGZA 4BUJA 4A8PA 2NAPA 2P6NA 3DXYA 1D2HA 1K68A 4HOYA 4DL9A 4GVXA 1OH8A 3KLOA 4Y1RA 3OEHD 3I32A 2INGX 3IHTA 1ZGZA 4TV9B 3G1TA 1YS4A 4UOQA 4PW0A 1AK1A 3INRA 1G6KA 3H13A 5AW3A 5B58T 1A4RA 1P74A 3F4LA 4QOFA 3R7WA 5JLJA 2YNMD 2JGNA 3GLUA 4OBWA 1CDOA 4B3HA 2O4CA 3RFFA 3RIEA 2VFAA 1DO8A 1M5RA 2XGSA 3K9NA 3GUCA 1E58A 4EMSA 1WP9A 3PEWA 4ND3A 3W5CA 5BXQC 4XXHA 2QAJA 3B36A 3HRHA 4HWOA 2A86A 2BBTA 2VC2B 5LP6B 1K2WA 3LO8A 3GDHA 1TZ2A 3ZOZA 3ZY4A 1YGYA 4EDHA 4PRYA 1BVHA 1USIA 1EJ0A 5AJTA 3S1LA 1G20A 1WUYA 1W4BA 1OLUB 2XW6A 4GP6A 4N3AA 3SR4A 4OGKA 4EHAA 1VYTA 5IJWA 3WSVA 1D04A 2DCUA 3NAZA 5ALXA 4EO4A 3LPMA 2IZ1A 1LZKA 3A1DA 4KODA 1Z5WA 3PHBE 3WKBA 3QX3A 1NVMB 2PT9A 1M6VA 5K3DA 4CKWA 3I76A 1CJBA 7ABPA 3MWEB 4YDHB 1OBOA 4RXTA 1WCYA 5G0WA 4BVGA 4AY2A 4ZYTA 3K1AB 4US2R 1J39A 1L4GA 4MA4A 4XWKA 2DWUA 5BSUA 4ZMBA 3U7FB 3VPHA 1XNGA 2H31A 1KORA 2DY1A 2NU7A 3ES9A 5G41A 1DJLA 2F62A 5A6SA 5H83A 5ALIA 2F3TA 3EVTA 1ZIPA 4FGKA 3GAZA 3QVTA 1G17A 4OQXA 3RIHA 2XKBA 3V4ZA 2B35A 3OQ1A 3ABOB 1C0IA 3R5TA 3ZE8A 3BSFA 2ZQ5A 3ML1A 3I9KA 4D3DA 4DBZA 3PSHA 4WERA 1D2EA 1U3WA 4QQKA 1FZQA 1HR0B 1J6UA 3RNOA 2JANA 4WESB 3H0KA 4BFSA 2PV7A 3PGVA 5AI9A 4RF3A 4DTIA 3LFTA 3GFTA 1ONBA 2X13A 2O2CA 4FCWA 4YI3A 4DBVO 5KTTA 2O1XA 4KAXA 2H17A 5C53B 1X9GA 2QMHA 5EG5A 1XROA 3O1HB 4YH1A 1YH3A 2Q2QA 3V33A 4CEHA 1JFFB 1NVKA 2H5EA 1O6GA 3KKNA 1IONA 1T24A 4IW3B 2N75A 1OGJA 1VYVA 3MUOA 4CHGA 3RTGA 4NCIA 3KRTA 5JLAA 2PLNA 4PZPA 2CLHB 3B9BA