5FV4A

Pig liver esterase 5 (ple5)
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
530
structure length
530
Chain Sequence
b'SPPVVDTAQGRVLGKYVSLEGLAQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCCQDPVAGQMTSDLFTNRKERLIPEFSEDCLYLNIYTPADLTKRGRLPVMVWIHGGGLVVGGASTYDGLALAAHENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQENIANFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVAFTAGLVRKDMKAAAKQIAVLAGCKTTTSAVFVHCLRQKSEDELLDLTLKMKFFALDLHGDPRESHPFLTTVVDGVLLPKMPEEILAEKDFNTVPYIVGINKQEFGWLLPTMMGFPLSEGKLDQKTATSLLWKSYPIANIPEELTPVATDKYLGGTDDPVKKKDLFLDLMGDVVFGVPSVTVARQHRDAGAPTYMYEFQYRPSFSSDKKPKTVIGDHGDEIFSVFGAPFLRGDAPEEEVSLSKTVMKFWANFARSGNPNGEGLPHWPMYDQEEGYLQIGVNTQAAKRLKGEEVAFWNDLLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOXYLIC ESTER HYDROLASE
publication title Pig Liver Esterase 5
rcsb
source organism Sus scrofa
molecule tags Hydrolase
total genus 172
structure length 530
sequence length 530
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2016-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fv4A00
5FPPA 2XUQA 3R3WA 3A6ZA 5K3FA 3O4IA 4KRYA 5CT6A 4BE9A 2WUFA 2JGLA 3B5EA 6YASA 3IURA 3I2FA 3VKFA 4HTAA 4X94A 4PSDA 1MNAA 4JYPA 4AXBA 4KE8A 4ZV9A 4U2FA 1JU4A 3O95A 1VZ3A 4LIPD 3ICVA 3KD2A 3QZUA 1U65A 3BWXA 2W6CX 1L7QA 2YH2A 2CUTA 3S8YA 4FHZA 1XRPA 5AKZA 5ALXA 5HF6A 4E46A 4C6HA 4GWLA 2HU7A 4BVJA 3GBSA 4B83A 7YASA 3PE6A 2QVBA 3H0CA 2ZYHA 5HFNA 5F4ZA 5D3ZA 2RHTA 4GXNA 2I3DA 4Y2TA 5AK5A 5C8VA 4RE6A 4FMPA 5CT5A 5SYNA 4CFSA 4KAJA 1ISPA 3R3YA 3VJMA 4H7JA 1AC5A 3IUNA 4O08A 4RNCA 4TVKA 3TGLA 3BL8A 5K3FB 2XB6A 4LHEA 4QLOA 1CPYA 1N5MA 4KAFA 1B41A 1XZLA 1JJBA 1DWOA 2WQZA 5K5EA 2WTNA 3FVRA 3CN7A 3PI6A 4UHCA 3WJ1A 2XMGA 2OQIA 3ANSA 1SCIA 3UMJA 5JZSA 1N8SA 1XZJA 5ALOA 3STVA 4OCZA 3DLTA 2XUOA 2HA4A 4F60A 1DT5A 1QTRA 3AIKA 3V1NA 1UOPA 2WFZA 1E89A 3WK9A 2ONCA 4DMFA 1SOMA 1JJFA 3G7NA 5ALGA 2OXEA 4ARAA 4AQDA 4QWWA 5ALPA 3ICWA 1CUUA 1YAJA 2HA0A 5EGNA 4IQ4A 1EK1A 2AJCA 3G9UA 4UBMA 1BE0A 5K3CA 4B9AA 2QR5A 1TRHA 5AP9A 3HRHA 3G0BA 1UT6A 3RM3A 1LBTA 3I2GA 3QH4A 1DQZA 1JFRA 4H77A 4AZ0A 5AKYA 1YCDA 4AMZA 2PSHA 3HABA 2J4FA 4ARBA 3H2IA 4Y2VA 1ACJA 1YS2X 3DL4A 5C8ZA 5AKKA 4Q3OA 4OU5A 5JD6A 3QMWA 1BCRA 1XQWA 3G9XA 3FLAA 2WIJA 1WCYA 5C81A 1H23A 1KU6A 4OD0A 1NU6A 1EXWA 1QONA 1DQYA 3M3DA 5AKLA 3I2HA 1ZGCA 5KWJA 1LPOA 4Y9SA 3D3NA 1R1DA 5LYYA 4PQEA 2WUGA 3RARA 5A2GA 3I6ZA 5FDFA 2HU8A 1CUBA 4C4YA 3HYSA 3BJMA 2EDCA 1ODTC 4N5HX 4JNCA 1XZBA 1CIJA 2QXUA 2C7BA 5LIPA 1XKLA 3WK7A 5LZ8A 1VZ2A 2I78A 1BEEA 3WK8A 1BU8A 2Z8ZA 1P0QA 3VJLA 1CUAA 1ACLA 5CT4A 4FFVA 3U0VA 2GBFA 3SK0A 3EF3A 3WKDA 1G4HA 3WYNA 5HQ3A 3WWDA 2EDAA 3OOSA 4B7ZA 4X7BA 2XI4A 5DYWA 1GKLA 1TIBA 2GZRA 4DLNA 1C7IA 1XLVA 5FOQA 5CRIA 1BCSA 3I6MA 4QDXA 4LXHA 2WG2A 1P0IA 3JYHA 4X6YA 1ZI9A 3BDVA 4UPDA 5AO9A 4DSAA 3H17A 4H7HA 2YASA 1UFOA 1IVYA 2H7YA 4OB6A 3LLCA 4Q1VA 5CURA 4AX4A 4GECA 4DMKA 4UFOA 4LYDA 1FJ2A 4AN0A 2JGEA 1TAHA 1E8MA 4JH0A 4W1PA 1J1IA 2WJ6A 3DKRA 5HF5A 3I2IA 2BUAA 4LYEA 2H7CA 1DWQA 3I1YA 1XZAA 3ZPXA 1YB7A 1CRLA 2D0DA 4FKBA 2JGKA 3C8HA 4WY8A 1QO9A 1UXOA 3L1HA 3MGAA 2B61A 5JAOA 4OB8A 4KRXA 4X91A 3PUHA 3Q8WA 4K5QA 1WB4A 2QTBA 2BGRA 3A70A 5JANA 1D07A 4MWSA 3CCCA 3O4GA 5I9IA 1XZKA 3NGMA 1WPXA 1RP1A 5HQ3B 5ALZA 3R3UA 4DIUA 4WFKA 4G9GA 1WHSA 2OQVA 4XVCA 1BRTA 3V1MA 3JWEA 3M83A 5I8PA 4WDRA 1FSSA 1WOMA 1ODSA 1ORWA 4UHHA 5K3DA 3BF7A 4QDOA 3S2ZA 4NMWA 2HU5A 5A7FA 2Y6UA 5CMLA 5HK8A 3ZLTA 1H22A 4FBLA 3WJ2A 2GBGA 3STXA 4H7IA 3C6YA 3LIPA 1GZ7A 1N1MA 2GYUA 4X71A 3GA7A 3AFIA 2E3JA 4H7DA 3FYTA 5AOAA 3WWEA 3WWOA 1MX9A 4OUKX 3W05A 1Z68A 1TKRA 2LIPA 1TCAA 3C45A 1W1IA 1E3QA 2JGJA 3ZLVA 5IKXA 4OSEA 4QE3A 2OCLA 5E4TA 4QDUA 1AUOA 1MAHA 4MYSA 1VE7A 2HA7A 2RONA 3EBLA 1AZWA 1QIHA 4UBJA 1ZIXA 4J0DA 3VVLA 4PSUA 2QMQA 4F5ZA 3WWPA 3WL8A 5LLSA 3HXKA 2HA3A 3W2TA 1JMYA 1HDEA 2X5XA 5SYMA 1MX5A 2XUAA 3HSSA 3DL7A 4HVTA 4K2AA 2WTMA 3K6KA 3DDUA 4X6UA 2IX9A 1UKAA 3VDXA 3IVMA 1KU0A 1UK7A 1EB9A 2FX5A 2OCKA 1VKHA 2XUHA 1H2XA 3KOOA 1YA8A 1J06A 1CUXA 3K2IA 2XMRA 5AI0A 5LKRA 5LZ9A 5E4YA 3WK6A 3IUJA 5CH5A 2VT6A 4AMYA 3EIOA 2ORYA 4UHDA 4CI9A 4UHEA 3DKKA 4DYHA 1X2EA 4UUQA 4UHBA 3WL7A 4CG1A 4GI1A 5AI5A 2Y6VA 5E2IA 4MYDA 3WZLA 1CUWA 1CUYA 5A7GA 4X3CA 4DTCA 1ZGBA 3H19A 1FFCA 2ACKA 1ZICA 1CVLA 2HRRA 4PF1A 1XQVA 3AILA 4X90A 4BC0A 2OLEA 3LS2A 1TK3A 2VATA 1XRMA 4ZV7A 3FCYA 4M0MA 1EK2A 1GT6A 4OYLA 2Z5GA 4BTVA 5A7HA 4L9AA 2WSLA 4X85A 2C5GA 3T52A 2Q0XA 3FSGA 3FLBA 4ROTA 1RWQA 3AZOA 4J0KA 2H1IA 2QJWA 2YXPX 4IO0A 3I2JA 5KBYA 1XZIA 1IZ7A 1ORVA 3IB3A 3K9BA 1FFEA 3MUNA 4U2CA 2BJHA 4G8DA 5AJHA 2P8SA 4KYVA 1T2NA 2GYWA 3H04A 1VOTA 4G4IA 4WJLA 4FWBA 3G8YA 4EUSA 5JASA 1SCKA 1TCCA 4OPMA 4PW0A 4BDSA 5LZ4A 2XQJA 4MEAA 1XLWA 3ZWQA 1ZD3A 4EA6A 3BE8A 5JAHA 1HLGA 2WLSA 2Y1KA 4B6GA 5JALA 4FOLA 1QIJA 4M0EA 2XE4A 2WIDA 1QOZA 1CEXA 3HC7A 5DTIA 1R3DA 5LP1A 4FNGA 2DQZA 3C70A 3DYVA 2VAVA 1I6WA 4BP9A 3LP5A 3HI4A 4CIBA 5FP0A 4Y2RA 1Q83A 5JAUA 3V48A 2FJPA 5HZGA 2OAEA 4QLAA 3O4JA 3EQ9A 1LPPA 3PFCA 4BC1A 3F97A 4QWMA 1QIFA 5AI6A 2WFLA 1S8OA 4AO7A 4B81A 3WKCA 5AOCA 5ALYA 1AX9A 3H1BA 2JGIA 4UBIA 5T4BA 4J0CA 4B9EA 2CMFA 2XQKA 3GZJA 4BCBA 2AXEA 4N8EA 5AIAA 3G0CA 1XRQA 3FNBA 5CXXA 3HLKA 1O6FA 4K6HA 2AJDA 2IITA 3KSRA 4H0CA 3X3HA 4PSCA 1ZOIA 1W76A 2QXTA 4MQLA 4Y2QA 3E0XA 4AN1A 1IMJA 2XQGA 2CZQA 4QNNA 2V98A 4UBOA 3W04A 5JYCA 1YS1X 1W6RA 1VXOA 4GBGA 5J3JA 3WL5A 3DQZA 1VLQA 3R3ZA 5HCUA 1F6WA 3TEJA 3QM1A 4G9EA 4N8DA 2EEPA 1QIDA 3R41A 4V2IA 1DTEA 3D2AA 5DYTA 1AQLA 3BF8A 4FLMA 2WIGA 2DHEA 2Y2VA 2JEZA 4RGYA 5DNVA 2C4HA 2C0PA 4U2EA 2VJDA 4IH9A 4UFPA 4B84A 4UFNA 1MJ5A 2CKMA 4JUIA 3STUA 3N2ZB 4GHWA 4C4ZA 1HBJA 4BB0A 3RLIA 1OILA 4G4GA 4XWGA 3WLAA 3O9VA 5LZ5A 3WMRA 4JYMA 2RI6A 1AGYA 4BZZA 3TRDA 2G5TA 4BCDA 1G5FA 2WFLB 4BCCA 3PF9A 4DM7A 5CH8A 5FV4A 3F9CA 5T4FA 1T4MA 2PSDA 3QPAA 4I19A 4F21A 2QS9A 1DINA 3QMVA 2HFJA 1UZAA 3C43A 3VISA 1CUDA 2PSJA 1H2ZA 2PM8A 4U2BA 1DU4A 2IIVA 3ESAA 5IVHA 4HRYA 3WA6A 5JARA 1LPMA 4HXFB 4DNFA 2XDWA 4Y2YA 3BXPA 3UUEA 4J0IA 1WB6A 4LXGA 4NZZA 2O2HA 4MJ3A 2J3QA 4YASA 4C4XA 3AJAA 2ES4A 3SWWA 1QIIA 4D9JA 1BROA 4ZRDA 1JKMA 4J0JA 1GXSA 4WY5A 1U8EA 2JGMA 5C7YA 1IUOA 3A2NA 2XUJA 2XUDA 3D0KA 5AICA 2WIFA 5E4JA 4IHAA 5HK9A 1R88A 2VJCA 4BATA 1MAAA 2J3DA 4Q82A 4K6GA 5CBKA 1ZIYA 2WIKA 1R4ZA 3IDAA 4W1RA 1DWPA 1NU8A 2VT7A 4U2DA 3C5VA 4ZXFA 5ALUA 4ZI5A 3QYJA 5IVKA 1EA5A 5H3HA 2WILA 2W22A 3ZV7A 4FNMA 1KEZA 4B85A 5FLKA 3W9UA 1IZ8A 1R9MA 4BRSA 2HFKA 2HHAA 2ZYIA 2DQYA 1CUZA 2DSNA 2BGNA 5DTJA 4H7FA 4NVRA 2HDWA 3IIIA 3NOXA 1VJ5A 2H9YA 4EBBA 5ALLA 3EQ8A 2O7VA 5JIBA 5ALKA 2WM2A 1X2BA 1CUIA 4EHBA 3AUKA 2HIHA 2HA5A 4BP8A 2Z3WA 4AB1A 2VQ6A 1LPNA 4JEIA 1MT3A 5ALMA 1HQDA 1ZD2P 4HZGA 4CCWA 4QA9A 1GGVA 1XFDA 1BS9A 4H35A 4Q3KA 2DHCA 4W1QA 4X97A 4PO3X 5BOVA 4GDMA 5AH0A 3VXKA 1LBSA 1E5TA 5DWDA 3PF8A 1FFDA 2PUJA 3D7RA 3EQ7A 2HM7A 5EHZA 1B6GA 2QZPA 3DD5A 1E66A 3DCNA 3R3XA 5LZ2A 2JBWA 4C88A 3CCBA 3WA7A 1P0PA 1QIMA 4MEBA 4K6KA 5EHQA 3DOHA 3D59A 1CFJA 4U2GA 1QIGA 5ALQA 3FAKA 2XLCA 1WB5A 5ESRA 2OGZA 1Y7IA 3QPCA 2VJAA 3OPMA 4Y2XA 3GELA 3IULA 4XX1A 1C7JA 1EVQA 5DJ5A 4ZGBA 1ODCA 2CBGA 4Y2JA 1VXRA 2UZ0A 5AK3A 2BUCA 2DR0A 5HKBA 1EDBA 2PSFA 2VAXA 4PNZA 4EB0A 4W9RA 4BAZA 1AMNA 5FPQA 4J3JA 3W06A 1K8QA 1WM1A 4X95A 2BCEA 4I4CA 4DNPA 1W52X 4X93A 3FYUC 3QBJA 1XRRA 3BDIA 1LZKA 2DHDA 1M33A 2GBCA 1DX6A 1LPSA 4MXDA 1SCQA 1XZDA 1YR2A 2PL5A 5D7BA 2PVSA 3H2KA 5EI5A 4A23A 4WFJA 4KE6A 4CCYA 2Z3ZA 5AM2A 4RE5A 3D2CA 5ALRA 4BAUA 5JD5A 3D5EA 2HRQA 5K3AA 4BAGA 3O0DA 3H2GA 4BRZA 2XMDA 5HF9A 2RIPA 1GPNA 2PX6A 3Q0TA 3DS8A 3OM8A 3C6BA 5CW2A 2O2GA 4Z49A 4Y2UA 4QEKA 1LPBB 3A2LA 5T4HA 1MTZA 5JZBA 4J0HA 2B4KA 4RPCA 5ALDA 4Y7DA 3F98A 5LKAA 4N5IX 2WG1A 3G9ZA 4C89A 2XMBA 4AZ3A 3WIOA 3WKBA 4B0OA 3CXUA 4DMHA 4Q05A 5FKJA 3R40A 2QM0A 2ZYSA 1TQHA 3LCRA 3GFFA 4BVKA 1K5PA 1ZI6A 3BIXA 2ZVDA 5FXMA 3L1JA 4BDTA 1CUEA 2G63A 2XUGA 4CG2A 4J03A 3C87A 3I1IA 1Y7HA 3FBWA 5CT9A 3G9TA 5JADA 2BAGA 2QUBA 4S0XA 4GEGA 4KAAA 4KE9A 5AK4A 5AM4A 3ED1A 3R0VA 3E3AA 1Q0ZA 3DEAA 5AKEA 2GBIA 5AIBA 1W75A 1MU0A 4BTLA 1E8NA 1LLFA 5K3BA 3VJKA 2AJBA 1DX4A 2B9VA 2JIDA 3O4HA 2PSEA 1BN6A 3ESDA 1AKNA 1QO7A 1K4YA 2VF2A 2WG0A 2ZSIA 5AM0A 4CCYB 4FFWA 3V1LA 1Y37A 4IH1A 4L3WA 1F8UA 1YB6A 4G8BA 5AKJA 1YSCA 3F67A 4E14A 3V1KA 4EY8A 3V9AA 1BEZA 1R9NA 5EIHA 3WZMA 1UOOA 5C8XA 1YAHA 5JD4A 4HAIA 1G42A 4WFIA 2PU7A 3WKAA 3WK5A 2BUBA 5ALHA 5A71A 5AM3A 2OCIA 2O2IA 1QLWA 2VEOA 2NW6A 2QRUA 4UBKA 4BZWA 1L7RA 2XUPA 3N0TA 2PKYX 2ZYRA 2ROQA 1EI9A 1CUJA 2VJBA 3STYA 2XMSA 3H18A 1XRLA 2Z8XA 3B12A 2HA2A 3ZLUA 2DCMA 3C5WP 5ALJA 5FUMA 3DOIA 4YX9A 1NX9A 5AM1A 4LKOA 2I3ZA 1LPAB 4KE7A 2D5LA 2XMQA 1MN6A 1ZD5A 1XROA 1H2YA 4DNOA 3FCXA 5A6VA 2WHRA 3RK4A 4DGQA 3E4DA 1K63A 1GKKA 1OXMA 2OG1A 4HRXA 2WU4A 3E1GA 1THTA 1CUCA 5AKGA 4HS9A 3M82A 4E15A 3YASA 2XT0A 3DNMA 4EY6A 1XZMA 4EY7A 5K3EA 1P0MA 3FVTA 2ZJ7A 1CR6A 1O6GA 3FOBA 1UK9A 3JW8A 1VA4A 5ALFA 1N5RA 5FRDA 2RAUA 1A88A 1MO2A 1TCBA 2XMCA 4BYMA 2HADA 2VA9A 1WPRA 4F0JA 3FYUA 2RHWA 4GW3A 4OU4A 1JMKC 4P08A 4J7AA 1YA4A 1HKHA 3WK4A 4FLEA 2QOEA 1HL7A 4WDQA 1LZLA 2BKLA 1GQSA 2ECFA 1W4LA 1A8UA 1MX1A 2H7XA 4UBNA 5ALNA 3STWA 3H2JA 4WCVA 1XLUA 1UOQA 5AKXA 1WHTA 1A8SA 5ALEA 3U1TA 3AZPA 2WJ3A 3CN9A 3M81A 2VSQA 3SX4A 4E11A 2OPHA 1SFRA 3T4UA 5HKAA 2PUHA 3H2HA 1UK8A 5ALWA 5CTAA 2WUEA 3AZQA 4QDTA 2DFPA 3OG9A 3BIWA 5HF8A 3C6ZA 1JT2A 3QITA 1XZFA 4EY5A 2J4CA 3WL6A 3OTQA 2WFMA 3I28A 2G5PA 5DNWA 2GZSA 4OYYA 1EINA 2XMZA 3A2MA 2JGFA 2XUFA 5AKHA 2QJRA 3PFBA 1XZHA 3G0DA 4H7KA 5EIEA 4L72A 3G0IA 2R8BA 2WU3A 2O7RA 2CEKA 3FSGD 3NWOA 2XQFA 4L0CA 1JI3A 2FJ0A 5DNUA 4M0FA 1PFQA 1QIEA 3P2MA 1HPLA 4BBZA 4IH4A 3F96A 3FYUB 1ZJ5A 1UKBA 3PDCA 3F8SA 2OCGA 4OB7A 5EHNA 1YASA 1CUHA 1CLEA 3VVMA 4X92A 4MWTA 2K2QB 4XIIA 1CUFA 5YASA 1K6EA 1XQXA 3GROA 1EVEA 1EHYA 4BVLA 1CUSA 3ANTA 4HXGA 1UK6A 5T4EA 5DYYA 2WHQA 1J07A 4B82A 3WYDA 3AIOA 2YYSA 4Q3LA 4Y2SA 4AO6A 1PV1A 4GLBA 3IA2A 4X00A 1OCEA 1QE3A 4ETWA 4YK7A 1THGA 5JATA 3AINA 1ZD4A 1ETHA 1MNQA 2C5FA 4X6XA 2G4LA 5D3KA 3QPDA 4FLFA 4AO8A 1EDDA 3AIMA 1BN7A 3HJUA 4QDZA 3DYIA 4C01A 1RYYA 2ZSHA 4DMCA 3ILSA 1Q84A 1CQZA 1J2EA 3MUOA 4NS4A 4TGLA 3ESCA 5A62A 3IUMA 1EX9A 1UWCA 4UBLA 2FUKA 3DJYA 2GYVA 3D2BA 5BV7A 2AJ8A 4H18A 2ZJ6A 1FFAA 2Y2UA 1GPKA 3LIIA 1XZEA 5ISMA 4Y2PA 2BFNA 4YPVA 1QZ3A 3HACA 1U4NA 1XZCA 4HXEB 1GQRA 2VTVA 1JJIA 4EZIA 5BWCA 5JZ9A 1LNSA 5AHXA 4KJXA 3OC0A 4UHFA 3IBTA 2RGUA 3QMMA 1E8DA 2R11A 3WIBA 4C87A 1CV2A 1QFSA 3WI7A 4A5SA 1QIKA 2HA6A 1IUNA 3O9MA 4B0PA 5JAPA 3BJRA 4INZA 2XLBA 5IH7A 3IUQA 4A16A 4W63A 4Q34A 5AM5A 3FLEA 3WWCA 1GPLA 5CH3A 3B3QA 1QGED 1XQYA 2WUDA 4FBMA 3ZI7A 1A7UA 1R50A 3PICA 4P9NA 5ALIA 5ALSA 5HFAA 4CG3A 3PUIA 4LXIA 1VE6A 1EB8A 1CUGA 1XRNA 4G4JA 2C0QA 3HZOA 1EDEA 3C6XA 1DT3A 4FTWA 3STTA 2AJLI 5AI9A 5AK6A 5EFZA 5AKIA 5CXUA 5I7UA 4B80A 3I6YA 3SC2A 2QT9A 3FWHA 1PJAA 5DLPA 2WHPA 4G1FA 1UKCA 4G5XA 5IVIA 4ZREA 3H1AA 4H7EA 3GUUA 5AI4A 1FFBA 4I3FA 4DSZA 4KACA 1C4XA 1SC9A 1H2WA 3KDAA 1XZGA 3KWJA 2ACEA 5EHXA 1CUVA 2OGTA 4ZWNA 3QVMA 1EH5A 3W9BA 3HEAA 4FDMA 2XUIA 1U2EA 2CB9A 5KWIA 4KR0A 3I2KA 2V97A 4EY4A 3D4LA 2B20A 1X70A 5BWBA 4DNQA 1CQWA 5ALTA 3RKSA 5EIAA 2QKYA 5LZ7A 2PBLA 4P93A 2JEYA 2WJ4A 4G8CA 4TPKA 2ZJFA 4N8SA 1ZI8A 3NUZA 5AI8A 1L7AA 4BE4A 1IUPA 1QTIA 2OAGA 3L1IA 3KXPA 3MVEA 4CIAA 2X76A 1VA5A 3OURA 2PU5A 3WKEA 4ITVA 3KWFA 2OGSA 2PPLA 1JU3A 1F0NA 5AOBA 3C8DA 3ESBA 4QZVA 1USWA 3WQHA 2V9ZA 1LGYA 4MQMA 4KEAA 1Q0RA 1QJ4A 1XKTA 2XUKA 3UUFA 1AURA 2HL6A 2V96A 2WKWA 4J0GA 3G0GA 3TJMA 2WHPB 2JF0A 4PV7A 3G02A 5KREA 2XQIA 5IVDA 5D6OA 5ALVA 1ZJ4A 4P92A 4W1SA 1A8QA 2X8BA 2I03A 1F0PA 4XJVA 2QUAA 2CJPA 1G66A 3R3VA 5CT8A 1QFMA 1MPXA 2C58A
chains in the Genus database with same CATH superfamily
4ZRNA 1MF7A 3Q9SA 5AW0A 4GI3A 5KYUB 3VV3A 1KKUA 4NFSA 3AVVA 1D2MA 1E3TA 1M2VA 1PS8A 4H1TA 4L1KA 3DL2A 1E9SA 5CT6A 1K6XA 1WBJB 2JGLA 3B5EA 1YRBA 3NLLA 4M22A 1EDOA 3K09A 5H9WA 4Q39A 3HJTA 3JU3A 3IURA 1KZ1A 2G70A 2RARA 1DC4A 4X94A 1PSZA 2JPDA 2JIQA 1HNWB 2XWSA 5J47A 2PUDA 4Q19A 5G0TA 1W48A 1WXGA 3VHXB 3QKIA 2ZPUA 4AXBA 2VYVD 3HUDA 3HDHA 4D4JA 1MIOB 1VHQA 4TLAA 4ZV9A 4R40A 2J48A 3RIEA 4A0RA 4OGWA 4AKTA 2XCTB 5GADl 4JHXA 5JSHA 2QL7A 3ZUPA 3GLIB 3IEMA 1YK0A 4JT2A 2QTMA 4GWKA 1G8JA 2G09A 4ND6A 3HKBA 3PA6A 3WL4A 2RGXA 5KJEA 4B73A 2B1QA 5LBIA 4D0NA 1SVUA 1WVMA 3ZDDA 1GTL1 3ICVA 4ZYVA 1DC8A 1VL5A 3L6DA 2V7XA 4GAEA 4WJKB 2J7PD 1MENA 3H2SA 4KGVA 4YP9A 2B21A 1U65A 2PE5A 2Y77A 2I4NA 1YTUA 3A11A 3N2LA 1MIHA 3CMMA 1ZNWA 2XMPA 1JDBC 2O2SA 2FMHA 1XTKA 3JD1A 3LKBA 5F52A 1EP2B 2JC3A 5H82A 1ZH0A 1JTFA 3WLJA 2CUTA 3ME5A 4IYJA 3SYLA 5B3LA 2CLIB 4WJZA 2AZDA 1Y6RA 2VP2A 3IQGX 1L6IA 4N65A 1K7SN 1U7HA 2XXJA 5I01A 3AONB 3HWSA 4XCQA 4GWLA 1TFRA 2AN4A 3BULA 3K1AA 4C5CA 3MIIA 1XHEA 2JIMA 3UZUA 1DBSA 4BZPA 2VJYA 3PE6A 1TX4B 1PO7A 1Z26A 3CSUA 2IKSA 3QUAA 3QVLA 3TEMA 2ZYHA 3TLJA 1RACA 3G2PA 1QS0B 4QTYA 4FSDA 3FVVA 4XIGS 1CHDA 3K9LA 3KLNA 3ON5A 1MA3A 5F4ZA 3IT3A 3N8DA 3UOGA 4NBLA 3DE2X 3EARA 3IPLA 4UXJA 2OHFA 1U9YA 2GILA 2Y0EA 1YULA 4R31A 2QQ0A 3QG5A 3A28A 4RE6A 3L18A 4MEJA 3UW3A 4YP0A 1BMTA 4OXRA 4B7CA 4BNKA 2OP0A 5CT5A 1GDTA 2Q0QA 5CPFA 1JKIA 3RTBA 4CFSA 4JASB 2I54A 2J4DA 2VXCA 3E3LA 3AF5A 4QYWA 4BFVA 2HJRA 3QVGA 2J87A 3WLTA 3FTFA 2AUTA 5B3JA 4H7JA 5T57A 1DCMA 2G08A 4MQ6A 3VJMA 2KHZA 1H3NA 3S1AA 1JEYA 4NMHA 2FGKA 2VHJA 2ZIXB 4JB0A 4O08A 4UNSA 5DLQC 2QP4A 2VHWA 3JAKA 4G1MB 2PLNA 5DM70 2JJYA 1ABBA 4K9LA 4MGKR 5K3FB 1XL1A 1TNDA 2DFLA 5DW3A 4URXR 4JYAB 2GTIA 3EPHA 4H16A 4RHXA 4ABTA 1L6RA 4LHEA 3FM9A 4QLOA 3HO8A 3A3OA 1HSZA 3OHMA 5FJJA 1Z29A 5CYFA 1PZGA 3E27A 3PE4A 4K86A 4K9PA 2WY2D 1EVIA 2IODA 5BVHA 1G1MA 3N07A 4TXLA 1EK6A 1MORA 4DV1B 3DOJA 4YWHA 2ZWPA 4YNBA 1T34A 2H7VA 2R6FA 1JDJA 4I5EA 3EXHC 4WNCA 4GU5A 5DKFA 3FVRA 1XT6A 4EB6B 3KHKA 5C4IA 3IL2A 1NQVA 1VDMA 2D8MA 5TQ2A 4JP3A 1TQ6A 3HZZA 3KKLA 1VFPA 3I34X 1W0KD 2XE6A 4IEFB 4KO3S 3WJ1A 3KSBC 1XALA 4HMPA 4OEHA 3HVRA 2PUEA 4AN4A 3EQ6A 4ND5A 2OC9A 4RFLA 4Z3OA 4L78A 2QLNA 3ZG6A 1MQSA 4JR0A 2JKZA 1XZJA 3CIOA 4FQ8A 4NHEA 4Q1AA 2INGX 1ULZA 2Y1WA 3EG5A 1JWBB 2IYOA 1JDNA 1W5AA 5EWLB 3STVA 4GOKA 1EBBA 2OUKA 4IFIA 4BNXA 3Q8MA 3EMKA 3MLAA 1OZGA 3KAKA 3AM5A 4KXNA 1BWSA 2WTEA 3AG6A 3LGSA 3IAM1 4CEHA 5DZSA 1QTRA 1TA0A 1NXVA 4FYWA 4UNQA 3MPOA 4PC2A 4Y9TA 5F5LA 4BB6A 1CIVA 1T91A 3GEIA 3KJHA 3GGOA 1JTVA 1E89A 3O4VA 2ONCA 4KLCA 1W2HA 4HTFB 4UZFA 3TNFA 3OE5A 3JYOA 1AKUA 1RQPA 3KJZA 3Q15C 5ALGA 5IUJC 4EOGA 5BP7A 1PWXA 2I9PA 1Q95A 4KQEA 4QWWA 3ZWKA 1DUVG 4Z9XA 3CZMA 1CUUA 2VHXA 3ZWVA 1CX9B 4DWWA 4U0JA 4WN9A 3WQRA 1XC7A 4IIVA 2DWCA 5KJFA 4TVOA 1K6MA 4DQLA 3NTQA 3KAPA 2BVNA 1XJQA 1G59A 5AWFC 4UBMA 2QNRA 1F9EA 3IBYA 3QHQA 1OX5A 2A30A 5HJ5A 3OQPA 3NM4A 5J2TA 5F3WB 2QR5A 2XY4A 4EA8A 1C1HA 5DHUA 1Q92A 3VH1A 3BGWA 5EWJA 1O4VA 2EWVA 3GFBA 4EA7A 4F4IA 1JA0A 1QC5B 1UT6A 2XBMA 1LBTA 1WXHA 3RFCA 2VRBA 3W5SA 1Y9AA 2OEPA 2GTPA 1C1YA 4E6PA 1QX4A 1Z75A 1IM2A 3IP3A 2B6HA 4P35A 1DQZA 4F7WA 1JFRA 2GPTA 4H77A 4U6NA 4AZ0A 1XK6A 1DXHA 4O4IB 4N76A 2EAUA 1QHYA 4X3OA 3ZD6A 1QQ6A 4U7HA 4IX9A 1HE4A 1YCDA 2XH8A 3KKNA 5T67A 3HHPA 4RYDA 2ZIFA 4AMZA 5AW2A 4QUHA 4Z8YA 2PSHA 4NZ9A 4XPIA 5FNVB 1LH0A 3HABA 2Y4NA 3AEXA 4H4EA 2GRAA 4I8IA 4OJMX 1SG0A 4RZSA 1CSEE 4XLZA 3OPVA 3V8BA 3VR5H 1FS6A 4PYOA 1ACJA 1NF2A 1Q0HA 4G24A 5LC1A 2B99A 4YCMA 1N6LA 2AG5A 2EOAA 4HNAA 2GNPA 1BCRA 2V1XA 1BMFA 4F46A 2J3MA 1E7MA 1Y81A 1Z7WA 3E23A 1QHFA 3EFHA 5CLJA 5C81A 2H57A 3ERCA 4J1QA 1R4AA 4V0QA 1UJCA 1ECJA 2IHTA 4NCHA 3M5DA 5KB3A 1ZP6A 1PZMA 1GT91 5A0FA 2QJFA 2VRCA 4O5OA 3A9WA 4QEDA 3M3DA 1JQKA 3PRJA 5EC8A 4DDWA 1H8ED 2EW2A 5M29A 3KO8A 2APJA 5AKLA 3SGLA 4YDQA 4INPA 1KVRA 3DYBA 1NP3A 4FOSA 1JG1A 2C3YA 2RBEA 3OPQA 1SBZA 4HAOA 1E1KA 3GJ8A 3UCXA 1K4KA 3KJEA 4HDQB 1Q0QA 1IXYA 1OR8A 2IH4A 1HE5A 4NYJR 1W2WB 4REQA 4CKXA 2WUGA 3KLPX 1VG1A 2XAUA 3L6EA 4C0QC 1ISHA 1Q22A 5CLLA 4F11A 2GPJA 1QHIA 2KYRA 4LSMA 2TMDA 2VDUE 2YS6A 4FUTA 3TAUA 4NP6A 4B6JA 1QANA 2NACA 3S2FA 1QCCA 4GO1A 5BSEA 2R48A 1CIJA 4CTOA 5EYPA 2JAWA 4LWZA 1O77A 1NDHA 5B2FA 2V6IA 2QXUA 3U40A 4W7HA 3IRUA 2IGBA 4NLLA 1YS4A 3FTQA 2X3UA 3PDUA 1GQQA 1G20A 5HCIA 4MKGA 5HMMA 2EYQA 3TIFA 3ZU3A 3PXXA 4RY9A 3ZGOA 1FW8A 2D06A 3WK7A 2DQSA 3JQ8A 3MCTA 3QK7A 4RHCA 5E6SA 3PJFA 4Q01A 1EE1A 5LZ8A 3LXRA 1NXOA 1ZGGA 4OHVA 4LZOA 3ZIAD 1D4OA 1FSZA 3GNLA 3AHHA 1Y34E 1A76A 3A4YA 4DUZB 1J0XO 3EZGA 4R9RA 4IG9A 1PUXA 2W2TA 4OYRA 3W6ZA 2YXNA 2Z8ZA 4B33A 3WMEA 1P0QA 3VJLA 3ZU4A 2R8XA 5F7ZA 1HYEA 2QRNA 3TIXB 2RH5A 3IH5A 1N6PA 4MQEB 4Q4HA 3GRZA 2NU6A 1L5LA 1IONA 1T9KA 2A0UA 3U0VA 1JHXA 2GBFA 2HUPA 2D2FA 4MVJH 3RVDA 3SK0A 2Q3JA 1G4HA 3RKUA 4ZT5A 1US8B 1RYHA 3L0OA 5EOVA 2VUHB 5HQ3A 4J1TC 1L7OA 4W7SA 1ZGZA 5B55A 3ZWWA 3M1IA 4LDJA 2E1PA 2ZKLA 4DT1A 4GX0A 1PRYA 3ABZA 3IP5A 3N6RA 3AB7A 3HM2A 2C03A 2R2AA 1H2AS 3DKIA 4C4RA 3JVIA 3WYEA 1GKLA 3ZQJA 1L8OA 3BDAA 4NV0A 5JY1A 3OLVA 2WTBA 5IRCD 3LQ1A 4ZCIA 1I1HA 3PVZA 1FUUA 1NUPA 5DPMA 1C7IA 2VDWB 1J2JA 1E7RA 5EKTA 1Y1RA 2XYQA 4DBVO 2C83A 5CRIA 4LJ5A 3RHSA 2PKRA 3H05A 3I6MA 4UJ5A 5F2OA 3LLUA 3D6UA 3UWSA 5TEWA 2ZSDA 4YMWA 4IJ6A 5EP4A 5CA1B 3HCPA 1D6MA 1THMA 2Z6AA 3LVBA 2CMHA 2BDEA 3NORA 2WUWE 5LBTA 4BEVA 4I50F 5F64A 3AVTA 2ZJ3A 3PPVA 2AYZA 2X0JA 3NT2A 4DSAA 3PE3A 5KUTA 3SJ7A 1IJKA 5AJXA 1N6HA 3DCJA 2Z0MA 1KJJA 3H17A 4YRQA 2OA0A 5KVAA 3O8QB 1B4DA 2XCUA 2D3WA 3COZA 4ZYWA 4H7HA 1UBMS 2XNDD 1AHHA 2NSDA 4LRWA 2GCEA 3OQ6A 4UDOA 4WUVA 5SY9A 3WLQA 4EB8A 2I2FA 3HCWA 3W7VA 4Q1VA 1IBLB 2AR9A 3GGJA 3GEPA 4DN6A 4MAMA 3MMSA 5HG0A 1VPTA 3MTQA 3N74A 4LYDA 4A6EA 1A04A 2EBWA 3AJEA 2GXUA 4QM6A 5IWAB 1S6YA 3HYLA 4EUKA 3E7XA 1AMOA 4JVNA 4W1PA 1PR1A 5E8JA 2IWRA 3WHIA 1P7WA 3VYUB 1VLZA 4AXXA 2J59A 3L0SA 4I5FA 4O1IA 5L7TA 4HD8A 2CT8A 3DKRA 1A5TA 1T0JB 1P9LA 3BYZA 1O0BA 1KZGB 1UBHS 2XT6A 2H9AA 1XZAA 3HO6A 4YFYA 5AHOA 2JNWA 1YB7A 4MUKA 4QBFA 4BFTA 4X63A 1E5VA 5HR5A 5H0IA 1E2QA 1EPUA 1E99A 1X8XA 1ESZA 3Q8KA 5DHAA 1RI3A 2Y27A 4JLKA 4PYIA 3L1HA 5SICE 2JRCA 3LDAA 4YIHA 5F7XA 3D8SA 4KWCA 1R8SA 3MGAA 4FNOA 5JAOA 5D1HA 1NVKA 2QRGA 1DO2A 1U8UA 2J45A 1EKXA 1SU6A 1Y1KE 3QU7A 4KMOA 4R81A 3V8NA 4X66B 4G0WA 4CT5A 3P9SA 2AWOA 5GMOA 4TUYF 1WSAA 1A96A 3UB2A 3VHQA 3DEIA 5FEMA 2ECPA 3PLAE 3WOHA 1ADYA 2PKCA 4G5OA 4TL8A 5IU6A 3OZ7A 3PQ6A 2IZ1A 4IGFA 3H2ZA 1SC1A 1YZ3A 5I9IA 2VP6A 3REGA 3DE1X 1MZPA 4YPFA 1EGAA 1OWMA 3R3UA 4FJ1A 4DIUA 2IYYA 1FDIA 2IP2A 3B2NA 4A1FA 3FUVA 1E7QA 1K6IA 3NIDB 4G9GA 4MWBA 4R9VA 4HWRA 4WFKA 4EF4A 4WNAB 1QTQA 1RM0A 3K0FA 5JOQA 3L7CA 1E6LA 4QOJA 2OQVA 1QV7A 3BFKA 1NW3A 3RC1A 3U2QA 2JCVA 1UIMA 4BFSA 2GKSA 4H3VA 4B8YA 4RVDA 1QH1B 2B78A 2X2FA 4XWAA 4PNHA 4WDRA 3QWIA 5CFRA 3B6KA 4AM8A 4HJXA 3T1HB 1WOMA 3COPA 1GYPA 2D1FA 2XF2A 4F9TA 4DV3B 1ORWA 1V47A 4FGJA 4DWOA 1S8FA 3VZSA 4IFTA 3MS7A 4PGFA 3S2ZA 2Z04A 4DA8A 1IBCA 2HU5A 5HK8A 1O95D 1DDOA 1BMQA 1H22A 1LC0A 4M4SA 1QG4A 3B78A 3MGGA 1RJ9B 2PX5A 3ICPA 4PXYA 3LIPA 2XW6A 1GZ7A 4DCCA 1P7CA 2CXUA 2J7PA 3UWMA 1WIWA 2Y1GA 3KZNA 2P69A 2E3JA 4DDMA 2DJ5A 2V5UA 2I4LA 4N5NA 3WLNA 1JI0A 4FC6A 4YFVA 2W6JA 3HWX1 3TKAA 2X77A 4DIFA 2AK3A 1NW8A 1XB2A 4V0ME 3A4IA 2BRUC 1A27A 2N9UA 3JQPA 2YNMA 3OKPA 1IQPA 3CBGA 2AZTA 2QW1A 1CE8A 3OICA 4D46A 4RESA 4CETA 3MW8A 4IDEA 5I3ZA 1P7ZA 2I71A 1J1ZA 5JSQA 1XRJA 4YP1A 1EFPB 1KZYC 4XJSA 2QRLA 4LCBA 2P4EA 4RDCA 1NLUA 2ORED 2VJLA 4NS1A 4I50B 3ZDRA 2OCLA 4RVOA 5E4TA 1L5HA 5BN5B 1DEAA 1G5RA 1H2RS 3PGLA 3D6AA 1WXWA 3SC3A 1PTJC 1P7VA 4NZNA 3FSEA 4KU4A 3N7TA 5D01A 1PFKA 1NY6A 4MYSA 1FTSA 4YY3B 3OOJA 4P32A 5FTMA 3L8DA 4OVKA 1X7WB 2LBPA 4G0QA 2GN9A 1UEIA 3KCNA 4US0R 4UBJA 4Y7CA 2OHVA 4CQMD 1YKSA 2M6SA 4G85A 2EZ9A 4TKUB 3TCXB 2WABA 4GL2A 3A1CA 4EG7A 5IKPA 3THSA 1R8XA 3GO4A 3WL8A 4YC7A 4R41A 3C14C 3IDQA 1YL7A 2GO7A 2LP4Y 2C99A 4R0MA 2ASVA 5B7NA 5BUSA 3RVJA 3U3XA 2WJGA 3L7IA 4PWYA 3DL0A 4YCCA 4P54A 3TRIA 3JYPA 3FFXA 4DTIA 3DL7A 3AR6A 3CQ9A 3H86A 5EUCA 3ZZTA 4D9CA 4UMDA 4HWTA 2W2VA 2IDZA 2WTMA 1VCOA 1OYVA 3DDUA 4X6UA 3GRCA 3ESRA 1CZKA 1OGJA 1UAGA 2B83A 2DU8A 3U4DA 1UKAA 1JDSA 4C6TA 3VDXA 1T36A 2PLAA 1MIOA 1IVSA 1UK7A 1YBAA 2V4MA 3PFWO 1CIPA 2FX5A 4NE2A 4PRZA 1OJ7A 2IPLA 3PRKE 2C7OA 4W6QA 4JXJA 4A8JA 3ZWOA 3AEQB 5DGIA 5JJ5A 4PZEA 5L53A 4NC9A 1VKHA 1BKSB 2D74A 5D6NA 1ID1A 1W0KA 4K9RA 4PSVA 3SOPA 4CIWA 2UUPA 4R1PA 4ML3A 1CUXA 4I4TB 3RVKA 1QYDA 4IINA 4NF2A 1XMXA 4O63O 3E82A 4TTJA 2A0WA 2OLKA 2VDLB 4PPYA 4DQXA 1KJZA 2CEAA 3BREA 1KNXA 1SU8A 3KEMA 1VGRA 3KSUA 3NAQA 3W5HA 5FWXB 1VIVA 4MKIA 3IQXA 4YCBA 5THXA 1RFLA 2EIXA 2C3MA 2OGWA 2VT6A 2RGNC 4FOOA 3I92A 4HF7A 4P58A 5DNEA 2PH3A 3ZV6A 3EIOA 3LBFA 3NGXA 3ZVNA 1IQ0A 1Y1LA 2JAUA 3JZMA 2AI3A 3SMQA 5JXJA 5JTTA 4WECA 1FSPA 4NQZA 4UHDA 1GY8A 3C5CA 4I1SA 2A14A 1T3HA 4UE2A 2YWGA 5ES4B 2YR0A 2PY6A 3DKKA 4DYDA 4BQPA 4FZ3A 1P1IA 3AEZA 4DLVA 4CKEB 2W9XA 4MUGA 4B6PA 3LKZA 1O95C 4F5YA 5IMBA 3RYIB 2WHXA 3D4NA 4IKEA 3D7MA 1LNQA 1YZLA 3SR4A 3TIGA 1KK1A 3MWLA 3WL7A 3KBOA 3KT0A 5AI5A 4PC1A 1QHXA 2KBEA 4NDNE 3SJAA 4G4SP 3CRZA 4AJPA 1JDVA 3P0FA 4RJJA 1NBIA 4TTVA 4J1TA 4U4AA 7REQA 1CUWA 4Q00A 2Z5VA 4Q5IA 2ZYAA 2JLRA 3H1EA 3KYJB 3HR7A 1I7PA 1Z37A 1O94D 3KTDA 1L7MA 5A7GA 4ED9A 1P74A 3GIWA 1RKQA 4NJOA 2ZVPX 3QJ5A 5FBVB 1UQUA 4AKGA 4QYIB 1FFCA 2BI7A 4YRSA 4MVJI 4LHSA 2ACKA 2PCLA 2ADFA 3KOUA 2FMTA 1RJGA 5EXXA 4OGFA 4DDHA 2JIPA 1BO6A 4EPXA 2FPOA 3KTOA 3ABRB 5BSGA 5ARBA 1EK0A 1I3CA 4X90A 1QKIA 2UZ3A 3KQMA 1JHYA 4DUYB 1KIMA 1NVGA 2VATA 3ENNA 1CR1A 4I1VA 1KZ6A 3DEHA 2ZIXA 4LZNA 3FCYA 1QRDA 1M76A 3EXG2 1XTVA 4OSPA 3TW8A 3N2GA 3NHSA 3HQ4O 4QSHA 3W5BA 4TMTA 4OUDB 1ZNXA 5H3CA 1CQIB 5DBGA 4HYTA 1YH3A 3M49A 1U02A 2ZI4A 2WSLA 4YRTA 1NL3A 2PX4A 2ID7A 5KJCA 5E1BA 5AXCA 3T52A 3BHIA 2Q0XA 2VDNB 2FZ5A 1NZJA 4CMIB 1RWQA 3K20A 1NJ6A 3MHTA 3TMYA 1ANKA 2RKWA 4ALMA 4OX9B 1IN1A 3RWOA 5AJTA 2F9MA 4ENWA 4D9MA 4G07A 4IQ0A 3RREA 1BSVA 1ZUD1 2CLLB 3IAS1 2WWVD 3ZHTA 1XTRA 1F0KA 3DZHA 2WVJA 4UCQA 4B5LA 3I2JA 4WIAA 1YHYA 2YV5A 4IMRA 2R44A 2P9TA 1QG0A 3PU6A 5L3SB 4O2RA 2JFUA 3JQ7B 2Q2NA 1IZ7A 5L7WA 1ORVA 1RMQA 1RYEA 2UV8A 3L2OB 4ARZA 2HMYB 4WGFA 4NV1A 3MUNA 3VKHA 2OD9A 4U2CA 4DCUA 3R23A 1IH8A 2G0TA 3ZHQA 2YHBA 2DUNA 5F78A 1SC4A 1EWTA 2I62A 3DZBA 1SBIA 2RB5A 5GP1A 3ZK9A 2VYQA 3GLSA 3KM0A 3ADBA 1AKQA 3BQMB 4C4SA 4HP8A 2JKYA 5HTKA 4B3GA 2BM8A 1R8QA 5BR7A 1NT4A 3IBGA 2CVPA 3E22B 1KEWA 1V0JA 4WZZA 4ZEVA 2C98A 4Y1RB 1R37A 1D2RA 2I6XA 1XN1A 1MV5A 1SURA 3VZBA 1ZN2A 5JSFA 4X84A 1CDDA 4FWBA 3BMNA 2OBXA 3GT4A 1ZRHA 2W2KB 4IGAA 5HM8A 1DAPA 4HH4A 4MIYA 2IW3A 1F8YA 3K5PA 4OQQA 5JCOA 4C08A 3FGPA 3C2QA 2DY1A 5GV7A 4LZPA 2NXCA 4F5DA 5LZ4A 3TLYA 5LMNB 2G5CA 3DZ8A 4Q9LA 4JLDA 4AY5A 3BE8A 4BLTA 2Y1KA 1R0XA 2WDZA 3FOCA 3EFOB 1JHAA 1G2IA 4IJQA 1V6CA 4M0EA 4Z9YA 3WFJA 1VL8A 2I7DA 5IHXA 1N0UA 1QOZA 2WD7B 3M6FA 2H63A 3OLQA 3RCBA 3ZIAA 1H3EA 5DTIA 3JQGB 2CLHB 1VGQA 5LP1A 1QDLB 2UVPB 1OAAA 2DX7A 3T7SA 3TTXA 1YCFA 1PJZA 4UU8A 3MTIA 1R5JA 1JEQA 5WRFA 2VJPA 3LF1A 1E2HA 1XDGA 4J9VA 4M1WA 1E4EB 2DFDA 1X8KA 3ASYA 3CMCO 4EH1A 3ESQA 2CYBA 4E5YA 1G3UA 1I6WA 1RJEA 3JZFA 3WIDA 4ZJZA 2BM0A 2CXOA 4LYYA 1JG3A 1ZN8A 3ITDA 2RE8A 3D3JA 1KWGA 3SZ3A 4BECA 1FUIA 4L16A 2QN1A 3HI4A 5EGSA 1ZUIA 3O1LA 4BLOA 2FP4B 4CIBA 1NN0A 3GDFA 1IOZA 2FDRA 5KCMA 3GPIA 3WQSB 1MEOA 1JIXA 1NN3A 3PC2A 2C0CA 1XU9A 5GAJA 3V48A 1QFZA 4B3SB 1E9EA 2ZAGA 5HZGA 4NBWA 4TQUS 1OROA 2AMFA 4FW8A 4N5LA 1KIAA 4L9RA 4G1CA 4RSMA 4XM2A 2PH5A 3W4KA 1LPPA 3E4CA 4BC1A 3F97A 5IM4F 2R2GA 4QWMA 2WU0A 3RSQA 4ZYZA 5BV8A 3R9WA 1QIFA 2WPNA 4LRXA 2ZZNA 2EQBA 1RC0A 4LBVA 5BQXA 4DJDC 4FCCA 3WKCA 1SULA 2ZAMA 4IS2A 5AOCA 4ZKDA 5C52B 3LV8A 3HJRA 4PANA 5HE9A 1SBCA 5A9TA 3F5FA 2BRUA 1FNBA 3R7DA 2ZXFA 3LA8A 3R7WB 5GWXA 1HNZB 1XG5A 4ZIRB 3ZBTA 2GKGA 3GJ4A 5T4BA 3W34A 1RQGA 2VT3A 4OV6B 2HC9A 3EZLA 4BCBA 4M9SA 4XARA 2ZSFA 3CVOA 4KSCA 4R1QA 4N8EA 5COAA 4CNQA 3G0CA 1FP4A 4DJFC 1PZEA 5CXXA 2DPGA 2XNDA 4Q9IA 4GEKA 4NYMR 3PQ4A 4I7EA 2BFOA 1IWOA 4FDTA 1QK5A 5CFQA 4PYQA 2ZM6B 4C7OB 4DWVA 1N2CA 1PEKE 4H0CA 3VYSB 3NVKI 4BWYA 3LQ2A 1C3XA 4L76A 1SQ6A 4PSCA 4QPPA 3BTSA 1W76A 2VZ8A 4MQLA 4YAJA 3UW1A 1A9RA 4AN1A 5JRJA 3PNPA 3TQSA 5F1OA 2ZJ5A 4OI1A 4YS6A 1NNLA 2VK8A 4H08A 3IAHA 3QY9A 3HS3A 4IVPA 1QSGA 1FCJA 1VXOA 1OHHD 1E2JA 1SA0B 1XTUA 2ZUTA 2OPBA 1M6VB 4BO6A 3UMCA 4TWJA 5K03A 3PC8C 1DO8A 3FGZA 4YRRA 3DQZA 5K4HA 4UC0A 3K70B 4IUDS 3R3ZA 4F8EA 3DXYA 3QMPA 1M2FA 1VJ1A 4MGHA 1J8VA 1QGOA 1Y6ZA 1UH5A 3GR6A 3TEJA 2ZXUA 4KNYA 3MCVA 3Q72A 5EFOA 2BGWA 1XAHA 4XDGA 5CHYA 3OSZA 1CDEA 3WICA 1X9HA 4KPGA 2PXAA 4OXQA 9LDTA 3HP4A 1F2TB 1KH2A 4FEEA 3FGOA 4ZEOA 4JD5A 2DHEA 3RODA 3CF4G 3NNNA 2F9FA 4TV8B 2W2XA 5SYAA 5DNVA 4HGOA 1EEHA 1T9ZA 4ER0A 4AKSA 3H6HA 4QKQA 1AS2A 1XMSA 3FB1A 4IH9A 3CZQA 1E2GA 4IDAA 3U4GA 4B84A 4BN4A 3WV4A 2YCLA 4ESEA 1MJ5A 3DBIA 2CKMA 4JUIA 3PPIA 2LVBA 3ZU6A 4RNDB 2CFIA 2C57A 3KQTA 4X8OA 4CM4A 1HBJA 2WF5A 3SN6A 5TLSA 4RTOA 3DSRA 2IYPA 4JB8A 4JVLA 3RLIA 1SKQA 1IZYA 2PH7A 4PLYA 2QGZA 2VPZA 4EK9A 1WF6A 2IEGA 3SP1A 5K1ZA 3TW4A 4XWGA 3NWPA 3WLAA 3TM5A 2PFKA 3WMRA 4EEZA 3TEFA 1JIKA 3SBXA 2VDWA 3GYGA 2VPTA 3ZYCA 4MS4B 2QU7A 3EYWA 2BTQB 3ODPA 4FQ5A 4ER3A 3VGPA 1BYUA 2CBXA 1KIFA 5FAXA 5LNK6 1QXSA 3A6HA 3MMZA 4KPYA 3DOCA 4OFBA 2RGNA 1X14A 4KO4S 4JI6B 5ITZB 2WFLB 4BCCA 4D3XA 3I83A 4G5FA 5KTKA 1KDRA 4Z6KA 1OWOA 4DM7A 1JJ7A 3EAQA 3DONA 2EGUA 3P9YA 4MCHA 5FV4A 4D80A 4K0KB 3SM9A 2E6UX 2MINB 4F96A 3QFSA 1BWRA 1R0RE 2Z2JA 4QUGA 5CDTA 4N5MA 1WNFA 3QPAA 3HBAA 3CBQA 1O95A 4YIKA 5BNFA 1A1VA 1ZG3A 4AJLA 1DINA 3QMVA 4GI7A 4INJA 1NTRA 2HFJA 5F76A 1I0LA 2SCUA 3VISA 4G1UC 2ZYTX 1CUDA 1LDGA 4PVDA 4E5SA 4E7PA 1N33B 4HY3A 1N7HA 1PX0A 4PO8A 5LOVB 3PWKA 1M8PA 2PM8A 4HVCA 3ZW9A 4U2BA 5K2OA 2LV8A 2O0MA 3P19A 1KOGA 2J0UA 3WA6A 4LHWA 5TQ0A 5JARA 2C88A 4WH0A 2I7CA 3DE4X 4CQLA 1YZUA 1VMKA 2XDWA 4DNFA 2HJGA 1YC2A 1UQRA 1DOHA 2VDJA 3KNZA 5FD8A 2R6CA 1GVNB 3RAFC 2BJVA 1EXNA 3MYYA 4FFPA 3MSXA 2ZIGA 4YRAA 4YMGA 3U44A 1VP9A 2O2HA 3DMPA 4JA2A 2P9CA 1FVXA 4KXUA 4YASA 2E4VA 1HEIA 2HF9A 1Y8AA 4JUFA 3T5MA 5K5EA 4UM5A 1GN8A 3MA0A 3SWWA 4IIDA 4KO1S 4CCAA 4UU1A 5HBRA 2JJ8A 4ZRDA 4EY8A 3I4LA 5KAMA 2X0KA 4XGQA 2FSSA 3P0EA 1Y4ZA 1W7AA 4WY5A 4AIIA 4LF5B 3IR5A 2JGMA 3MM4A 3OY7A 2AEMA 2YHSA 4IZ6A 1M75A 4DCMA 1IUOA 4MCJA 4WK6A 1QH9A 4GPD1 4QRHA 3BSYA 1U31A 4EABA 2XUDA 1CF9A 4K26A 2FN9A 2IOQA 4P3YA 4D4KA 4OFZA 1JKFA 1Z34A 4INAA 1SBTA 3CKKA 4Q4JB 4EB3A 3CS3A 4IHAA 3LWDA 4QJ5A 2P91A 5FF9A 1ZK2A 4DA7A 3AI2A 3I5UA 4KQ6A 2CJXA 3PYLA 3VDMA 1VE5A 1LTKA 2J3DA 3CE6A 4Q82A 2OG2A 3S8EA 1QGDA 2ZUFA 3PGVA 2ZKIA 3G2IA 1ZIYA 4JX8A 5JSZB 2QIPA 1THZA 1I14A 4PAWA 3FHJA 3CZ5A 4OQMA 3S2SA 1K0FA 2WAYA 2ZPAA 4GGPA 4YQEA 5C9ZA 1IAQA 4RMGA 3P9NA 1TYEB 3CWQA 4WADA 3SX2A 3EFEA 1XGKA 3C3PA 4NI5A 3T1YB 3ZHUA 1QRUA 1F4VA 2YVUA 3HVKA 3LAWA 3AU9A 1ZNQO 3K7EA 1FYDA 4HDKA 1EX7A 4GVLA 4PLPA 4OTZA 2NVBA 4BNVA 5IVKA 4M53A 2EKQA 2WILA 4F5EA 4ZEMA 3EWSA 4PYNA 4RK0A 1M73E 1F5NA 3I62A 1P39A 5DHPA 3EHEA 3TSOA 4B85A 4OKIA 3CISA 5EKUA 1ML3A 2VA8A 3A37A 4IWXA 3MWJA 3C3YA 2J9XB 4AX8A 4WCFC 5K0FA 5GM2A 3UV3A 2HO4A 4JI8B 3TPCA 2EW1A 3HFGA 4RWZA 5CLHA 3ROFA 4BRSA 4DSTA 4LE1A 4KN9S 2BZ1A 5IXJA 4HQRA 2Y92A 1VKRA 3J81A 2R3SA 3DDSA 3RC2A 2EZ8A 3LF2A 3NX4A 1GPDG 4I81A 1F7VA 2I6FA 2DQYA 3K0AA 4Q47A 4DA9A 3KOMA 4WLVA 3U13A 4HQKA 3D1VA 3QI2A 2Z6QA 1EVZA 3FWYA 4KR6A 4WSOA 3I73A 4IFBA 1OXXK 2QG9A 4NVRA 1AQYA 3B7PA 3PTAA 3TLGA 3BK2A 4TTTS 3GFPA 3W9SA 4EI2A 3KQYA 3F4BA 4GD3Q 1KKLA 4K9QA 3CEJA 1AQIA 5F9MA 1N75A 1C8VB 2XB4A 5TT0A 2J41A 1Q7CA 2WI8A 2RAPA 3SCZA 2CJFA 1KO7A 3CZPA 2GM5A 3AUKA 4FUQA 4WAUA 3QPVA 3TBHA 4DIBA 1J5XA 2A57A 1S2MA 2GMWA 5JBIA 5F3DA 1X3SA 4UDNA 5FORA 3NWEA 3MS2A 1GGNA 1BDBA 4WZ6A 3IDSA 5ALMA 4ENRA 3QVVA 5LB2A 4DW8A 5JFTA 4HZGA 2EP8A 4CIVA 4FR5A 5CEFA 1VMDA 1O94A 4LJ7A 4G01B 5EJ9A 1Z5ZA 1Y6GA 3WXMA 5TF0A 1XFDA 4JHLA 5FBKA 3D8BA 2H92A 4H35A 2P41A 1M1YE 3WDLA 4UQPA 2FZCA 5CIQA 5MN4A 3WL3A 1YCHA 4Q9AA 3JQAD 2RH8A 2O1WA 4GDMA 4IV8A 3GG9A 3ZBUA 4DIKA 2C7VA 1NKTA 5DW0A 5AH0A 4D8TA 1OT5A 1P29A 4OQ4A 1M0WA 3ETGA 4KX3A 1EK5A 3HN2A 2RK6A 4Q1EA 5TB5A 3L1UA 3PDWA 2R1VB 4BPRA 4FC7A 2NZYA 1RI4A 1G21B 3NJ4A 3VXKA 3WB2A 3DLCA 4OLBA 2ODNA 4RUKA 3PF8A 1NVBA 2CE7A 3ABOB 5EP3A 2CVQA 3OQOA 4NBUA 2CV2A 1E2LA 1GGEA 1QR6A 2JATA 1I7NA 3FTPA 4KWEA 5HBGA 1KYIA 4EI7A 2UU9B 3RABA 1EX1A 3R3XA 2QZPA 1ZHFA 3DD5A 3DH0A 3KBBA 4N7BA 2WICA 4PHCA 3ZWXA 5E7IA 4CL8A 2OVFA 3Q11A 3WOVA 2DKOA 4AZWA 3SVLA 4Z2YA 2A9PA 4GVXA 1VL1A 2AKAB 2H4WA 2NZXA 1P0PA 3JRNA 3LUCA 3VR2D 3OD1A 2WKPA 3WS7A 1IN8A 4LZZA 1IEXA 3C5HA 3DOHA 5EHQA 2WWRA 2OV6A 1XTZA 1CFJA 3D59A 4II7A 4CEJA 1K0UA 1LU9A 5CVTA 3U44B 1QQBA 4TUYA 2YC4C 3M1LA 5ALQA 2XLCA 4Q9DA 2WAOA 4O1HA 2V0CA 4K28A 4YUZA 4BO0A 1T1IA 1XTQA 5EIXA 3C3EA 2FLWA 4UOQA 5HJEA 1WB5A 2ZRPA 5KJ6A 3PC8A 1X1DA 3NKFA 1AMUA 4KTVE 2E85A 1A8IA 4BNNA 4JENA 1Y7IA 1MVOA 3QPCA 4YQFA 3T4XA 2HK9A 3L4SO 1SHJA 3QELA 3X2SA 1E1CA 3PGKA 3Q0IA 1C7JA 5AW5A 3ZQKA 4DHWA 1L5OA 3R5XA 5DJ5A 2Q45A 2Q50A 4IXWA 3F2IA 1XEAA 5BYKA 2CMDA 1DIOB 1MD9A 4S1OA 1GCGA 2FLKA 2R7NA 3PENA 3JARA 1ZCAA 1SCJA 4JKYA 3SQXA 1XCPA 3O7MA 1OOEA 4P83A 4Q3CA 1EAMA 2OC4A 4MLDA 4WE3A 3RJZA 3RU3A 3UC5A 5CDFE 5JAZA 1Z5OA 2IOHA 3TTVA 4PNZA 2W2PA 3RYIA 5JSYA 4Q9KA 4ZARA 5KS2A 4W9RA 1PYGA 4BAZA 4WXYB 1G9TA 2I67A 3TR5A 3GEGA 1X19A 1HY3A 1M83A 1Z5NA 3CWZA 3GGGA 4HNSA 1TPYA 2NXEA 3DXFA 2I2WA 1QCZA 3KZCA 4NZYA 3CG0A 1PHPA 3HBFA 3W06A 1K8QA 4R1TA 3RPEA 3O3CA 2OR3A 1XEXB 3QYAA 5J5AA 2PBRA 2BCEA 3RRZA 5HVNA 2BDUA 3UG6A 1E3WB 3L49A 4DNPA 5C4MA 4QYIA 4LOHA 4N41A 1PR6A 3VR3D 2JIBA 4TXHA 2QUHA 2ZS9A 3IUYA 3LM8A 5DO9A 4X93A 2A1TS 2A67A 3RSOA 4EECA 5HZKA 3O82A 2UXCB 3H7AA 3MBOA 3TI9A 1OVMA 3PT5A 1U04A 2R1TA 3AR3A 1LZKA 4EZBA 2YS7A 1SUPA 1XIVA 3KKMA 1OA1A 2BZSA 3AT1A 1JAZA 1W46A 1Z08A 4GMXA 4LY3A 4BP3A 4EKIA 4YMTA 3T5AA 1KDYA 3IE1A 2EWWA 3GBVA 2P9HA 3PG5A 2AQ8A 1EIZA 2NZWA 4XFJA 3FDJA 4NZOA 4EHIA 1Q44A 1SXIA 1C29B 4GC5A 1W47A 1XF1A 4MWOA 5MHTA 1VKJA 2BFCB 2IE8A 1G7TA 1Z4NA 3EXHB 4MXDA 1SCQA 3DV0B 3VSEA 3AKDA 4L07A 2FZ4A 5IT4A 1KQGA 2JFBA 1RWXA 5CDGA 5BO5A 4GPTA 5ADHA 1D2EA 4LGCA 4E09A 2R4UA 2EW8A 4HGPA 2QV0A 5BT9A 5D7BA 3B3JA 1WNTA 1XE3A 3R0IA 4J4HA 1E3IA 4HDMB 4R8KA 3AERB 4YAEA 5EI5A 3WIVA 1U9IA 4KE6A 4Z1OA 1GRCA 2Z3ZA 3W8RA 5AM2A 1XHLA 4MW1A 2X86A 5ALRA 2WJJA 3TSYA 1UXJA 4JI7B 3KZMA 3PYXA 1SKMA 3P5SA 4MWCA 5JD5A 4P22A 1Z0FA 1OBVA 4GMDA 3O0DA 2NO5A 2V6FA 3KQOA 5EMLA 4B46A 2NUTA 2E4AA 2GFHA 2Y0PA 1V4NA 2RIPA 3GFQA 4DA4A 3ZGZA 3N3BC 1FEZA 1RI2A 1Y1QA 4WK0B 1HXHA 4EAAA 2XZTA 1ILEA 4N6NA 3MN1A 2DECA 2G1KA 4RH0A 2O2GA 5EEHA 1Z4LA 4YRDA 4GUDA 1JFTA 2AOTB 4GH5A 1S2OA 3MOGA 1C5KA 4ZO9A 3ZWAA 3WLSA 2ZITA 4QUDA 1CYDA 1Y5IA 4EJMA 2Y4OA 3AL3A 3UXMA 2KWIA 5JZBA 3RIMA 4G0UA 1IPEA 2B4KA 3C3WA 4RPCA 1NUAA 5BVGB 5JVDB 5ALDA 4RVHA 3F98A 1VKNA 1OHHA 4CDNA 3IP7A 1RI5A 2FFQA 4MKXA 1IXRC 1A4RA 2XMBA 4TMKA 1WDMA 3RV4A 3SEQA 4PPGA 3I2YX 3P2KA 2BP7A 4IJMA 1UM8A 2G7ZA 2V0NA 2CHFA 3IELA 4OY3A 5DK6A 3QI7A 4LBWA 4MJ7A 2VTDA 3EFOA 4Q05A 4Q6WA 2QN7A 3EEBA 3E8MA 3NBUA 3R40A 3GZTB 3ZY5A 5HSGA 4N0MA 4IDBA 2WD7A 2AC2A 3L6RA 4KR7A 4ARCA 1T3SA 4INOA 3FYDA 3BIXA 2NQ2C 2YJZA 2V9PA 1C7FA 2UVPA 3BWVA 3IOYA 4HDOB 5F2KA 5FXMA 1FUEA 3WMXA 5B1HA 3NAZA 1EFRD 1K3TA 1XMIA 4NNJA 4CKWA 1YNOA 3BEDA 3RRNA 3RW9A 3H11A 4FYJA 5E6RB 2ZSEA 4KDCA 4PPFA 2DR3A 4R2MA 1E7YA 4YQYA 1PWEA 3DMNA 3O47A 4CG2A 2WDPA 3DT8A 5GONF 2GHIA 4W5TA 4RHTA 3L5OA 1Q0SA 1Y7HA 5DTMA 4ZRMA 3EZ9A 3G9TA 1M0TA 1WV0A 4J2HA 1GTJ1 5K6TA 3KZXA 4S0XA 1N1DA 1DEKA 1QZUA 5I9SA 3OQHA 3I37X 1SVWA 2QX8A 3M4YA 2H29A 3CPJB 1YOVB 4GBMA 4WCFA 4XTCS 5AK4A 1Z06A 4ENVA 1J0DA 1XSEA 3F78A 4KPFC 3O26A 1DPGA 2OP1A 3C97A 1RMTA 2F1KA 2Y71A 1NI3A 1FMJA 1PNQA 1T2VA 2DFNA 3FPCA 3I1JA 3KDPA 3OPYB 4ZYUA 4LRTB 1OC2A 1U0RA 4XEHA 4ZI7B 2V59A 1YFKA 5A6SB 1P1RA 4JUDX 5EMKA 5AKEA 5A02A 1TTPB 2JCXA 1UDRA 4L5IA 1ZOLA 2YV4A 3EVAA 4EGJA 1V2GA 1YDEA 1J22A 1M8JA 5IJ9A 4C20A 3FCEA 5K3BA 2VVTA 2OZEA 4DLPA 1WTCA 2GERA 3MWKA 3H65A 3O4HA 1B8NA 4JBIA 4YCAA 4I3HA 3VUEA 2PSEA 2IY9A 4NATA 1QO7A 2WG0A 4GSYA 5AM0A 1T0UA 3ZCXA 5C80A 4DC9A 3EASA 3V1LA 1Y37A 4IH1A 2GNOA 4MZXA 2P2CA 4TOIA 4Z1MD 2B7LA 3ID6C 1FTNA 3MF4A 4G8BA 3OE7D 4L5JA 1W1WA 4ZOLF 1L5NA 5EPOA 2IIBA 2XF8A 2O3TA 2R00A 3F67A 4QBHA 4PX5A 3N6VA 3QBEA 3NFRA 1EE9A 2R96A 3OT5A 2FNAA 1LBQA 2ZUBA 2HSZA 3RF7A 3WRXC 1ZINA 3T7EA 4CF3A 4HWPA 4OQFA 4LI3X 1L5WA 2PXHA 2PU7A 2V7EA 2BE9A 4HBZA 1KS9A 3WKAA 2MSNA 3LRPA 4GZ3A 1KH1A 3O83A 2BUBA 5KNDH 5A71A 1Z36A 1M6VA 2IXFA 2IUFA 4XD7D 4KMMA 4DCJA 2VEOA 3G79A 2GVNA 1LFDB 4CRWB 3ZUGA 4E6EA 2UYCA 1WY5A 4UTZA 4AW9A 2RC6A 4IIEA 2XUPA 5HX7A 1MR3F 2FMIA 3IOCA 2ZYRA 3LPDA 4UQOA 3V7FA 4CCSA 2ZYWX 4BRWA 3OTOB 2XIQA 1EI9A 5H02A 5IAJA 3PEWA 3HYRA 4MLCA 5AVUA 3V2GA 2AOVA 2JASA 4CTJA 3RWMB 4TQ9A 2XMSA 3GCGA 1E6UA 2Y76A 5L3RA 4Y6OA 1O5OA 4RK5A 4MVJG 4Z4QA 2L17A 1FNDA 5FOUA 2W6NA 1CYEA 2VK1A 2J0QA 2VS1A 3ZLUA 1AXEA 2IUYA 4KGDA 3C5WP 2H0QA 3DOIA 1T10A 2DUJA 2FZWA 2ZBRA 1X87A 2I3ZA 3LUDA 3DBLA 4IJUA 4YTEA 4ZK2A 1TYDE 1M34B 4UVHA 3TOXA 2I3BA 1KXZA 1XVAA 2D5LA 4KE7A 4BLRA 3MCAA 3S2UA 2XMQA 3D3EA 1MN6A 5KOHB 3FCAA 1Z4MA 4U8GA 1XROA 1WSDA 1Z7BA 2D1RA 3PXCX 4I1YA 1MA0A 1PL8A 2Q6IA 2BFDB 5A6VA 3ILVA 4X54A 3VMFA 3NIBA 4EG8A 3MERA 3N0VA 4DQDA 3D5TA 2L19A 1J0CA 1CLUA 1GTSA 2QDXA 2Y0DA 1SQSA 1XAIA 2RKOA 4HI0E 1OXMA 4PCLA 3RRMA 1W59A 2OG1A 2OK7A 3SC6A 4ZZIA 4FT2A 1K1EA 3EGDA 1SHLA 3E1GA 3NIWA 3O4FA 1EUCB 3GJ5A 2ONYA 5DU2A 2I5PO 3BN3A 2XNCA 3ASZA 5BQPA 2QHXA 3GVIA 3QLVC 1GFWA 3DNMA 3YASA 4RKYA 1JHZA 2F00A 3GOQA 1K3FA 2DWQA 5G3YA 2FQ1A 4EY6A 2J6IA 4UTOA 1XZMA 2LD4A 5EKDA 3ABSB 3Q98A 5JUWA 2MINA 3QWFA 3PUZA 1GUYA 3LX4A 1Y3HA 5GONB 3TZLA 4MHSA 4JR2A 3RS9A 4WLEA 4IIXA 3LU1A 1F2UB 2O0LA 4IYRA 2ZJAA 4NICA 1ZD1A 5LP6C 2O54A 1L8QA 1O6GA 1EM6A 1I13A 4RKFA 4C4AA 2Q8NA 2GK7A 1VA4A 2WOJA 4EENA 1G8AA 2R68A 4O4HB 4OREX 3M89A 5BOSB 4JBYA 2AXPA 5A1JA 5KKNB 1ORDA 1G2OA 5LUBA 2RAUA 4GR5A 4ZFNA 5CVUA 1A88A 5ELMA 3OPNA 5CJPA 4AD8A 4FFSA 5FL7A 1V16B 3IHLA 1UMCA 1OXTA 2HADA 4PX3A 5IM4A 2VA9A 1PGPA 4OM8A 4OP2A 1W44A 4MVJE 2QX6A 1XVUA 2RHWA 1JMKC 2XA1A 1ZD8A 3FMVA 4LBYA 2RHOA 3KE8A 3URMA 5CCBA 1FX0A 1U8TA 4ONEA 5ESWA 3WRVA 2HPHA 3A10A 1OH7A 2AG6A 2C8LA 2EBFX 3B1KA 3WK4A 3AOEC 4JLBA 3ZGNA 1Z3CA 3ES9A 4IOJA 2CY0A 1X1BA 2ONKA 4QGFA 2J3EA 3T7CA 1XZNA 1DLJA 4G25A 1P5ZB 1X7YB 4KLZA 3EODA 2IHBA 3E6AA 1IC6A 4QGHA 3UY4A 2ECFA 3FWPA 2BEUA 3IXMA 5ALNA 3TSCA 2H7XA 2O5CA 3R9XA 5F12A 1KC1A 4WCVA 3ECSA 4XM1A 3THYB 3RQIA 3GDOA 4FZRA 5AKXA 5DHFA 1D0SA 1BZYA 2X2OA 2IPMA 3CLSD 2Q99A 3GLFE 1YR9A 2XTJA 3JQAA 3CN9A 2RC5A 1WXXA 4RVUA 2WD9A 2XWBF 3TTUA 2JEOA 3BXZA 3PGA1 1C80A 2CL6X 2Q4EA 1B23P 4HN9A 3AVXA 3BIJA 4R2KA 2PUHA 2I80A 3IGFA 1Y9JA 2G72A 4BKPA 1ONPA 3ILXA 3LO5A 5ALWA 5BUZA 4MOWA 2CV0A 4RTQA 2E5FA 3EDQA 3LFHA 4BXOA 2EGHA 1S9HA 1SCUA 4JBWA 5CYGA 3R5KA 1G2QA 3VZCA 2Z09A 3WC4A 1RP7A 1CY8A 4E22A 1WA5A 2V7QD 3M70A 3NXSA 4JI2B 4HX5A 1FDWA 5MDHA 1ONOA 1EM8A 2VSXA 2VQDA 1BOFA 3M6LA 3I45A 2O3UA 3C6ZA 3IFSA 3R2JA 2ZLBA 4QC2A 4A8TA 3VR2A 4EY5A 4UTXA 2J4CA 5LFAA 5F35A 1TTTA 3G1WA 3OTQA 2WFMA 1MV8A 4CTMA 5HHTA 3I28A 1E5LA 5I7VA 4OQYA 5DNWA 1KSFX 4FOTA 3P7MA 1VHTA 1ISSA 4KO2S 3RHZA 2XMZA 2BTOA 4RIHA 1GTRA 2AR7A 3H4TA 4OQLA 2QIOA 4URWR 3X2FA 5AKHA 3ZZUA 2Z9BA 1NUUA 4NPHA 3UJ6A 4C5BA 1HDYA 3EXG1 4ER6A 3EDCA 1NLMA 4TLCA 5EIEA 1GGHA 4MWZA 2C2KA 3G0IA 3N1UA 3UT5A 1A2QA 2DFKB 2WU3A 1QVAA 2OFOA 4GSLA 1A72A 1D5WA 2CEKA 2RGAA 5FOSA 3VU8A 5BQ3A 3TUZC 4D9HA 2JS7A 3BK1A 3CRQA 2EP5A 1G3QA 3AC0A 3SKYA 3GNQA 8GPBA 4LVOA 4UTPA 2XQFA 1Z6ZA 2PX0A 1QH8B 3CUEF 1N34B 2CLFB 3WMWA 1PFQA 2IU0A 4D2IA 2OO5C 1HPLA 2Q29A 3DM5A 4URFA 3Q9UA 5AJYA 1WMFA 2MYUA 5FI1B 3TIVA 4F2HA 4EJ6A 1IMOA 3CRNA 1UBFA 1SOWA 3F96A 4Y6LA 1NXWA 2NVUB 4ATNA 2OSBA 4CIYA 5J4HA 1G7SA 3HGQA 4OH7A 2XYPA 5JR3A 2JJ2D 1KYVA 1NFQA 2C5AA 3F5QA 4OB7A 5EHNA 3UMRA 4DMGA 3AUJB 3OX4A 4P33A 2A2ZA 4Z4GA 3I6BA 3GP8A 3CC8A 3M2TA 3G7SA 3E48A 5AW9A 4QHYA 3R0XA 2AL7A 4RXUA 3RT7A 2WE7A 3VR3A 1XQ6A 2IQIA 4RK1A 4E2XA 4YCNA 1C0LA 1N7IA 4Q4AA 4UD6A 5AESA 1UL1X 2K2WA 4ILEA 1HT0A 3KELA 3VJRA 3EC1A 4HXGA 1X0VA 2BCGY 2QN2A 1ABEA 3RVLA 1BDIA 5JZMA 1P9WA 1SKYB 1G60A 1OB5A 3WYDA 3U31A 1TAQA 4M1SA 3AIOA 3GLUA 2FPPA 2V45A 3RGGA 5B4TA 2IZOA 2D0PB 3ETJA 3HKCB 3QX7A 4Z7NB 5HUJA 1H42A 4AP5A 1CQPA 2XVYA 5CCXA 3IA2A 4RS4A 4RTSA 3IBCA 1B93A 1OCEA 1P2SA 2FEKA 3WRYC 4QDJA 2W37A 3L06A 3L0PA 2H2WA 4JOQA 4NEQA 2OYCA 4YK7A 4BUCA 2A5LA 2UZ4A 1THGA 2X8AA 3CLSC 1P44A 2YWRA 2R7KA 2Z5LA 3AINA 1LSUA 4LVNA 3ZN2A 1ZRNA 1A3CA 3WRXA 5A03A 3DZCA 1E92A 1BE1A 1MAUA 1Q7BA 4JFAA 2NSHA 3ANMA 4XX0B 1D04A 2W2OA 4CKCA 4QOSA 3NHLA 3ZY3A 4K81B 4AJKA 1GAEO 1MRZA 1ZW6A 4YT8A 1N5LA 4F4JA 4CLHA 4YDHB 5JPIA 5CYOA 2BM1A 3HXLA 3MK31 3ONNA 4NABA 4WBNB 3O8BA 3U60B 2ZIVB 3SQDA 3TXAA 1KQNA 3QPDA 4LX0A 3PUKA 2AN9A 3GEBA 3HJGA 1JQ3A 4NAUA 4NH0A 5KYGA 2Q3CA 1YDFA 3NTRA 5DTEA 1JSRA 1PE0A 3ROTA 4YMLA 3EOBI 1QRRA 3MUEA 3TG2A 1HK7A 4IAOA 4ND8A 4K9NA 5GJBA 4KQIA 5I5EA 1Q21A 3NYIA 3W2FA 3EA0A 3LXMA 1ZXBA 2PZJA 2OFFA 4C01A 2VDMB 3C1UA 3IHTA 1YJAA 3LT2A 2GRUA 1IB6A 1DAKA 4OHKA 2OZKA 2A5YB 2EF1A 2VT2A 4UM8B 2F48A 2O1EA 4LCJA 1ATIA 5C4GB 2VG8A 2R6AA 1O6ZA 3PQFA 4DILA 1RHRA 1WUHS 3EVBA 4FWIB 1M2EA 2JKVA 4EPYA 1KI1A 2FF7A 3CNQS 3E9RA 1RZRA 4MWDA 2HK7A 2ZT5A 3SD7A 4DR4B 5DCUA 4ZHQF 2F3PA 2YYYA 1A95A 2Q9CA 3DJYA 5BSFA 3BD8A 5AVTA 2PRIA 4CEIB 3F6RA 4MVWA 2Q1UA 2YMLA 3UPDA 4DVJA 1P9RA 2IU3A 1U99A 1VL6A 1P2VA 4JQSA 4BMCA 1D0VA 5BV7A 4R6WA 3U48A 3ZIDA 4A6XA 4WA7A 2QRZA 4F06A 1VRCA 1VSQA 1UPTA 3MAJA 1E3WA 2OKGA 1Z83A 4IIUA 2AFHB 3LIIA 4X20A 4F6RA 1C7EA 1KYZA 3N59A 1P75A 4IXMA 4XSGA 5KOJB 4BVGA 2R6ZA 3BBPA 1EFRA 1V37A 4RZHA 1V41E 4JVSB 1CRZA 3WFZA 1N3YA 5DF1A 3T95A 1EWRA 3AR2A 1MEEA 1U0NA 3QIVA 5IBRA 3BMOA 2O8NA 3PUWA 5JLAA 1N78A 4G56A 4OBBA 1R2QA 1GZ6A 1IZ0A 2ZJ2A 4PU0A 3NIGB 4B76A 2WF9A 1BX3A 5JZ9A 3VSDA 3ND7A 3LOUA 4LZAA 1JECA 5AHXA 4HLUA 3VZDA 1DTWA 3OC0A 3D8NA 3KFVA 2FHSA 3VSCA 3IBTA 3WBJA 4JC4A 2WKRA 4H3HB 1SBQA 1RVDA 4IRMA 1ZD9A 1AGNA 2FXIA 3VR6H 4WK2B 4YJHB 1KBOA 3WIBA 2VO1A 5FBQB 5LP6A 4RA9A 1E2FA 3ST7A 1D9XA 2QQGA 4YAWA 3T61A 3ZXIA 5JH7B 5KOIA 1UBRS 2XKAA 5C5IA 3L7KA 5CW1A 1YJ5A 1JHVA 4A5SA 4IFEA 4HDMA 3CRW1 3G2QA 4ZVLA 3RS5A 1FJXA 4BV2A 1E0SA 1IUNA 5EJ7A 1A5SB 4B0PA 4J7UA 1DQNA 1YVUA 2XOEA 2PKQO 3V8PA 3BJRA 2CLSA 2JIOA 3QBVA 1GSHA 1YKFA 2DH5A 4L6CA 1ZIDA 4E5PA 2A86A 3IUQA 2QTGA 1QUEA 2XBLA 2IPXA 3B5IA 3GDWA 2X9VA 2IYZA 4D0RA 5FYQA 4DJJA 2JGNA 3WGKA 4E7OA 4MRPA 3L46A 3AETB 5EIAA 3OE7A 5KNLA 5CD9A 1YDHA 1BW9B 3AOEA 1SAYA 1VIDA 1V1MB 1Q6ZA 2R7LA 5H70A 3MOIA 4M60A 2VSFA 1ADCA 3ZE7A 1R0ZA 4IV0A 3KSZO 3SYNA 2B8TA 1OW3B 4XWOA 3PC7A 1UBJS 5K3SA 1A7UA 3PQEA 4YJKA 3PICA 4D82A 1Q20A 2EFEB 2FMKA 1L7DA 3C7TA 5ALSA 3EEIA 1RRVA 2V58A 3QPUA 5H9VA 1KE2A 2DJIA 1GPAA 2GAOA 3PDJA 4Y3UA 3RVSA 4AWAA 4CG3A 2ZT6A 2BJWA 4Q12A 2IL1A 3KWLA 1RS0A 2G1AA 2WP8J 3CRMA 1Z5VA 2FXVA 3DBHB 1CNEA 2IW1A 4S1WA 3RYHA 5JS7A 3VA7A 2Y99A 4ZAVA 5T64A 2IXGA 1XRNA 3PFGA 4TTRA 2HJHA 3W6OA 3G89A 1E94E 3HSYA 3P20A 2EQAA 4Y6GB 3V00A 4BO1A 3FCCA 4PLWA 3VZPA 1GEEA 1EDEA 1ECGA 2WZBA 4YBZA 3T35A 3PS9A 3W2HA 2XRZA 3ZYZA 1RRGA 1NJ1A 2WTXA 2F8SA 3PJDA 4P4GA 5EJ4A 1FYVA 5EVJA 5BORA 2QAIA 4KBYA 4RETA 2NU8A 3OA2A 3VBCA 1ZM3A 1X1SA 4B4OA 1L3CA 3R3JA 1GKIA 4HCJA 3SHQA 5CXUA 4LYJA 3W1WA 2PT5A 2UZ1A 5ED0A 3ADKA 1R4NB 4L27A 2HRBA 5KQGA 2W43A 4KAXA 1OAKA 1H1LA 1LBIA 2YXEA 3FWHA 3JATB 3ASUA 3JYQA 1ZESA 2P5SA 3B6EA 4ESHA 3EEOA 2X6QA 4LECA 1U2QA 4M9RA 4G1FA 4V0MA 5EE3A 2CCKA 2UAGA 3P96A 3I12A 4G5GA 2O2ZA 2XCLA 3AO0B 3OI7A 5JCXA 2CLDX 2GPAA 5CX1A 4BLWA 1Q6YA 4B2IA 4MQBA 1QFXA 4K9DA 4BMNA 5AI4A 5BXQC 1I2BA 3FKJA 1PQ4A 4I3FA 1L5ZA 1T13A 3KPYA 3H5IA 4DSZA 1C4XA 3TB4A 3O3MB 5LB4A 4KZKA 1H2WA 1H8HA 1CR4A 4FDVA 5EXTA 2EX4A 2Z1DA 3KWJA 4E5UA 4QHTA 5DN6D 1F2DA 1NUQA 2OGTA 4ZWNA 1IE3A 2Q49A 3U3JA 1G7CA 3MMXA 2QT0A 4TMYA 1JG6A 4E33A 2ZUWA 2J32A 4FDMA 1YRWA 3OOEA 2L2QA 4RSHA 2PRSA 1H94A 4UUPA 3UXYA 1GG5A 2O5RA 1M1YB 4YT4A 5FLXA 2ACVA 2CL7X 1JRLA 4HYQA 4UEQA 4KR0A 3KCQA 5FFFA 3H9CA 1G17A 2HIAA 1RE0A 1G8YA 4GRAA 3K1JA 1P1FA 5A05A 4ENQA 4ZI3A 5IDWA 2F1RA 3QEMB 3ENWA 1M8FA 3THOA 3WP1B 1N0VC 1LWNA 3T7JA 1G3MA 1KI9A 1Y9DA 1K86A 1JALA 5LDHA 3RKSA 4FGZA 1XEWX 2WYHA 5EE0A 4W8OA 4MCIA 3GWZA 3NHPA 3KR0A 1PS0A 1ZNZA 4JSTA 1DJPA 1FLDA 2X42A 1HEYA 1XCJA 2X7JA 3E9NA 3LFUA 3MINA 4G41A 1BXRB 1MQAA 1Z5GA 1G6OA 2J3JA 2ZJFA 4D9FA 4GYYA 2YCBA 4O4JF 1KTIA 2R9VA 2QUIA 3REQB 2Z56A 1F3OA 1REQB 1ZWKA 3F9IA 4H9GA 1L7AA 2FU5C 5H5JA 3L9XA 4HEQA 1PSDA 5B6IA 5IX8A 5JAIA 4J07A 1BYIA 1K6JA 2GB4A 3LBNA 1QTIA 4CLDA 1NNEA 2SKDA 1FTYA 3L1IA 2VEDA 1ZFNA 1UZUA 3EIQA 3MVEA 3QKUA 4LJKA 4ROSA 4MVXA 2ZAOA 1VA5A 3OJLA 4CWAA 3JWGA 3FYCA 4ITVA 1JR2A 4RTKA 3B7WA 1ZC4A 3GRRA 1I2CA 1JQEA 4OL9A 1FFYA 4I6EA 2GWRA 3MT9A 3TQHA 5JYDA 2F62A 4KOAA 1UXGA 2HGZA 3WRYA 1NVVR 1PJ8A 2XNKA 4GPBA 4S05A 3LSTA 1P60A 2AH5A 3VAYA 1LC3A 4OATA 2ATVA 2DWOA 3NNSA 1ELOA 4MQMA 2JHAA 1ORIA 4G5RA 3MD9A 4RY2A 5KOHA 3V2HA 3ND9A 5EZSA 3ETEA 1QQAA 1HT2E 2D2VA 1QJ4A 1XKTA 4JSRA 4M0PA 4MUIA 4NBRA 5EIFA 4YONB 1E1YA 1X38A 1AURA 3A32A 2WSMA 2HL6A 1ZH4A 3DOEA 2FEXA 3INNA 2HSJA 4J0GA 3ZI0A 3JX9A 1J25A 1WXEA 4CDGA 1OTXA 4OHXA 1BFDA 1TAGA 2D54A 2DPXA 2H31A 2JZOA 5JI3E 1HE2A 2FWNA 3UAZA 1PJRA 1OI7A 4IDCA 4DRXB 2H1CA 3DWFA 3G02A 2ICAA 5A4MS 1VB3A 1LQTA 2HEGA 4K9SA 2E21A 3LY5A 4HFMA 2BHTA 5E9QA 2V7QA 1C1DB 5FOTA 2QRJA 1V3VA 4YDSA 1SNYA 1QVVA 2R79A 1TI7A 2ZYDA 1ZJ4A 4P92A 5CVEA 1R0YA 2BGKA 5DGTA 5H7XA 3D5QA 4AIRA 3L0YA 3FJOA 1A8QA 6REQA 1HGXA 1KDZA 5LQDA 2YFKA 1OI3A 1I0IA 4RHEA 3PD1A 1NASA 3CZRA 4IM7A 5GONA 1L5QA 3FFBA 4BU0A 3RUDA 4LVUA 1P6QA 1F2UA 2HWKA 4OXIA 3TOVA 4OHWA 3UK1A 5FPPA 4XYMA 5BW4A 1Z25A 3R3WA 3UCEA 5TGTA 1EBFA 2ZB8A 3A6ZA 1KYWA 2FTKE 3FUWA 3U7HB 3HMQA 3HGTA