4JGGA

Crystal structure of tesa
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
180
structure length
180
Chain Sequence
QTLLVVGDSISAALGLDTSQGWVALLQKRLADEGYDYRVVNASISGDTSAGGLARLPALLAEEKPALVVIELGGNDGLRGMAPAQLQQNLASMAQKARAEGAKVLLLGIQLPPNYGPRYIEAFSRVYGAVAAQEKTALVPFFLEGVGGVQGMMQADGIHPALAAQPRLLENVWPTLKPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase TesA
publication title Structural and Functional Characterisation of TesA - A Novel Lysophospholipase A from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 60
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4jggA00
5BN1A 4TX1A 1BWPA 3W7VA 2VPTA 4H08A 2WAAA 4HYQA 2HSJA 2O14A 4M8KA 1PP4A 3DC7A 4Q9AA 5A4AA 1YZFA 4K9SA 1U8UA 3DT9A 1ES9A 1FXWF 1ESCA 1DEOA 4IYJA 3DT8A 2WABA 2Q0SA 2APJA 4S1PA 4K7JA 5B5SA 4LHSA 1ESEA 4K3UA 4JKOA 2W9XA 3BZWA 4JJ4A 4OAPA 4DEVA 4Q7QA 4JHLA 1V2GA 1BWQA 4NRDA 1ESDA 3P94A 5JD3A 4I8IA 4JJ6A 4K40A 5HOEA 4RW0A 1J00A 1K7CA 3KVNA 3MILA 2Q0QA 1VJGA 1JRLA 4PPYA 3DT6A 3PT5A 4HF7A 1BWRA 1Z8HA 1DEXA 3U37A 1IVNA 4JGGA 3SLRA 4OAOA 3HP4A 3C1UA 3DCIA 3SKVA 1FXWA 4RSHA 5CD9A 4XVHA 1WABA 3RJTA 2WAOA 1VYHA 1ZMBA
chains in the Genus database with same CATH superfamily
4IL5A 4GP9A 4OQ4A 4QQKA 3R76A 2C54A 4IMJB 3V80A 4E2YA 3F6PA 1I14A 4Q9JA 3QG5A 4ZVOA 5J4YA 2J5QA 2JGMA 2NW6A 2RHGB 4NATA 2XLBA 1T5LA 2G9NA 1E8MA 2FRDA 5HXAA 2J9XB 1KS9A 1YT5A 2WAAA 4HNTA 2BR3A 5JR3A 4X3PA 2GYYA 3FVRA 5KNDH 1IBLB 3TFWA 4ZOLF 1EFPB 2W6IA 2XMZA 1EK5A 1G2IA 1B93A 2HAEA 3LUKA 1QUEA 3S2SA 1FRVA 2JAXA 4KXVA 2XZTA 5A04A 1IXYA 3K9QO 2JGDB 3HCOA 1SPBS 2CDNA 3I62A 2Q50A 1W36C 3DONA 5CH5A 1JPNA 2RB5A 3B2EA 4C0KA 5A7GA 4HB3A 4HUJA 3AVOA 3LQYA 2A84A 3WDSA 2ZSHA 3FRIA 1OXTA 1BJRE 2QVXX 3QFCA 3INNA 1C3JA 4TROA 2COEA 1N7HA 1M73E 3AESA 4JA2A 3PVCA 1KQOA 3JWJA 5EMMA 2O7SA 4Z2AA 4BU1A 4L4RA 4MUFA 2J0EA 1IDOA 2P2CA 4LGMA 4PRYA 2ZJ6A 4O4HA 5CK5A 4YROA 4CGYA 2HHLA 2XAUA 4MWOA 3OKAA 1KDYA 2APJA 3I8XA 1XP5A 4INAA 4P38A 1USIA 1BDMA 4GRDA 2OWDA 3FPGA 3QBEA 2DECA 4OYYA 1H6BA 3D7LA 4JSYA 2H59A 5CU7A 4P0PB 2QX8A 2OUIA 1R0YA 1Z4IA 1E1YA 2VK2A 2A5LA 2YC2C 5HCIA 2J8ZA 1Q19A 5CBPB 2OD9A 4IIYA 1ARZA 4LKRA 1FNCA 3F8TA 4TSKA 4KDRA 3UAWA 5AUOB 1MAWA 1T6BY 4KOEC 4F11A 3RGGA 5LL6P 2SCUA 4UCWA 5HW0A 4ZWNA 3L9XA 5EVCA 4CTJA 4MYHA 5CLIA 3CKYA 2XGOA 2G17A 1ENPA 3BIFA 5AVOA 3ZZ0A 4BQPA 2VT7A 2IEIA 1Z8FA 1Q3KA 3NBAA 4POAA 3CC8A 2RAUA 4FE4A 4FSXA 1EVEA 1UDRA 3WJ2A 1SBTA 1NE7A 2J85A 5JD3A 3ODGA 2C99A 1EGVB 5BWLA 2R6FA 3L06A 3EASA 3FPBA 4AJNA 4OSEA 4E5KA 5CYGA 2BTQA 2VDUE 1O08A 1ZOPA 1E1CA 5EINA 3KIPA 1EQUA 1XU9A 1F9AA 1GTJ1 1XEWY 3L7CA 4JQCA 4KBFA 1LVUA 3U9LA 4A8JB 5BT9A 2ONJA 1EBFA 1N5LA 2FQWA 3DOFA 3OM0A 3OZVA 1JHYA 2R8BA 4LJYA 4CMKA 2WP8J 3UT5A 4JB3A 2YRFA 4Y7DA 3WLQA 4ZYUA 1T4BA 2FSIA 1XMQB 2O2HA 1E0KA 2QM3A 3II6X 3TZCA 2P5SA 1B74A 4UHHA 2BKXA 1IIBA 4U4AA 3MNFA 3FOZA 2BEUA 3DFIA 4PHFA 1VL8A 3GXOA 1FB5A 4YQEA 2HTEA 2Q5EA 4HDMB 3DQZA 4CEIA 3PSAA 2V7XA 3EIWA 3H1BA 1D09A 1HSZA 3R4CA 4EI2A 4HQ0A 5BPFA 1ULTA 2ZJ1A 1FX1A 3STTA 3U4CA 2P2DA 1UBMS 2ENUA 1BCSB 2QI9F 4IFIA 5C52B 2QPOA 2VDLB 3D8RA 4DSOA 1WD7A 3T7RA 4A6XA 5J5VA 3VR5D 4Y2XA 1XZPA 3EXEA 3RU9A 1FU4A 2X3FA 4NKRA 4HADA 2FW7A 3PFWO 5A4JA 1KY3A 4D79A 5TV2A 3LUJA 1DIGA 3P27A 1JXAA 4MVJP 4J1TA 1TIKA 4PAMA 1LI7A 3N2EA 4YASA 1TAGA 4DT1A 2O8CA 3LXXA 3GLTA 2EZUA 4GOJA 2C96A 3DNMA 4HXEB 4RY0A 2ZWPA 4UAVA 1E58A 4JBYA 5EGSA 1COZA 4WZAE 1FYFA 1LLQA 3C3MA 2HIAA 2I4LA 2GZAA 4YTEA 4HB2A 4Z54A 2KSQA 2YXPX 3KZOA 1XCMA 1VIDA 2XNDA 3QHQA 4ZREA 4ZCQA 3AETA 3IEXA 2IIQA 4I50A 4Y2VA 4AJ2A 5I3ZA 2HSJA 4C14A 4KE7A 5LOVF 2AMYA 3H1GA 5DOVA 3SNHA 3A2MA 1F6BA 1FYEA 2JI9A 4GLLA 4JGBA 1XVIA 4TTAA 1Y3FE 5NULA 2NO5A 4CLEA 3I0ZA 3QX8A 2QA5A 1BVRA 3QYPA 2C42A 4MW0A 3WRVA 1G20B 1IZ0A 1ODCA 2VQ3A 3OF5A 4I4TB 4UZSA 3QBJA 4X92A 1HY3A 3AM3A 1XDUA 4DOMA 5B7QA 4I1PA 1HQDA 5SZKB 4Q21A 4J6FA 2XCQA 4BWVA 2QG9A 1CZKA 2E85A 2Z43A 3ZE0B 1DEOA 1F4VA 3EFOA 5K0JA 4GGPA 3IB3A 3F8WA 1RQRA 3FCEA 1KZGB 2QN7A 1RAEA 3L0CA 1A7KA 4IEFB 1M7GA 5AK0A 4B3RB 1SCIA 4CV3A 3EYWA 3FPEA 1L4HA 2B1IA 3HCBA 2QRNA 4PXAA 1JVNA 3PC8C 1UZAA 1CUGA 1RXSA 3BH6A 4H15A 4J0EA 4OXKA 3PJFA 4TMTA 2I80A 1FFXB 5K3FB 2ILTA 3PTAA 4EKNB 4QWMA 5HBRA 3ZK9A 3I23A 4BP3A 5IT4A 2GCOA 3G6WA 4I4CA 3SXJA 1C29B 4MWDA 5AOAA 1M6YA 5A6VA 2JLUA 1DDOA 2PPVA 1NT2A 3PFKA 1FDOA 4MIKA 5GWXA 2FPOA 4BKPA 2J7KA 5A4MS 3RVQA 5CLFA 4N48A 3RYFA 4C2AA 2OAQ1 1B23P 1WP9A 1M5UA 2FOIA 1B76A 2VDNB 3KR9A 1JLRA 1SOUA 2B4AA 2NT4A 4FCCA 2D3WA 2Y1KA 4IX1A 5L3QA 2XV1A 3FWYA 1DRKA 2M32A 4P0TA 4INPA 2WFMA 1DAHA 1FTSA 3AU9A 4ND8A 2VTBB 1TU4A 4RFVA 3AMVA 5JLAA 3HR4A 3JQ6A 3STYA 2VQFB 1B1AA 2D2XA 3TSAA 1GDDA 4YV7A 3AERB 3KHKA 4MUIA 3CT4A 4M1KA 3CUUA 1SH7A 1YS1X 1F7VA 2ZROA 2XYGA 4JOQA 1DQYA 3IUBA 3V2IA 1U0BB 2XNJA 2QRUA 4URZR 3KKNA 3GG9A 1RQ7A 3AM4A 3EG9B 2Q21A 3MN1A 4HQOA 5BOVA 8AT1A 3HB1A 2OZEA 3STVA 4F9EA 2IHVA 1UMBA 1FUKA 1A9QA 3F4BA 4EMBA 1H2YA 1XTBA 3CNNA 4A26A 4L7VA 1YS7A 5T4BA 3C1UA 4R0NA 4EG4A 2VHUA 3K6RA 2B4QA 5BQ5A 5CLQA 3RFXA 2GM9A 1PEKE 3SXUB 1FFBA 4JEMA 2ECFA 4DV4B 4L0DA 2RHBA 3CRRA 3TJRA 3WQSB 5KOYA 2KX7A 2GH1A 3FG9A 5DHUA 3TKLA 2SKCA 4IWYA 2Y1GA 1E18A 3HH8A 2ZRGA 4FFLA 4D8VA 1RZ3A 1G7RA 2WDPA 3CHYA 4CIDA 1CRQA 2H4XA 1DINA 5FUYA 3R6LA 3ZCPA 1W9HA 1TAQA 3SQMA 1FP7A 3H9QA 2GMWA 4PG6A 2IJGX 2NYUA 3O26A 2WMDA 4UHCA 3FNFA 3AF4A 1RACA 5LJIA 3U4IA 1L4LA 2OVBA 2CFCA 1UMCB 1U94A 2P9GA 2RARA 5JNVA 3WJ7A 2N42A 4I6EA 2W37A 4PSVA 3KVYA 3A4VA 4V1CB 1S89A 5DI3B 1UQUA 1RJ9A 1I0ZA 3V7FA 1XFAA 3BMNA 4B82A 5FP0A 2B61A 3VPAA 3WI7A 5CA1A 1JR3E 3NJ8A 4O5OA 1FXWF 2QY9A 1DZIA 2GZ1A 4Q4JB 3SYRA 2IP4A 1A8HA 2CZGA 3AIMA 2P9JA 1E1LA 2R6ZA 3GUZA 3ZCRA 1LZLA 4F04A 6REQA 1ZIYA 1MJHA 1OI2A 2Q49A 5BT8A 1OIWA 3EPHA 2G9RA 3ZQKA 2IPNA 4NYMQ 3LOPA 1MKYA 1D1QA 4MKHA 2XWJI 4IDCA 2I62A 1RMQA 3NAZA 1A5AB 2HHCA 3UAYA 4EA7A 4Y9SA 1E69A 2H8GA 3D8SA 3UKJA 1KERA 2GXQA 2FPKA 3CR3C 4MW2A 4F9TA 1ZIXA 5I5EA 4BN0A 5JWRA 3GGCA 3DDHA 4DMHA 1JEJA 2OCGA 2V59A 1UOEA 2P6UA 4KX3A 3PPWA 4Z1MA 1SEVA 5JS2A 2VEOA 3FTCA 4Z7NB 3RS9A 2HW8A 3GHYA 2B5WA 2IXDA 3ON5A 5KYNA 5DM70 1H6AA 2WUDA 3L6BA 4XDGA 4ZRNA 5EXEA 3QHPA 3U3XA 2BSXA 1H94A 1ODKA 2WHEA 3A9VA 3FTQA 4CQMD 3T5MA 1BHSA 2OXEA 1VG1A 2M6SA 2DUMA 3AJEA 2QLFA 5EC8A 2CL6X 4M0PA 4N0QA 4M60A 3LT1A 5HKOA 3GT3A 1ZJ4A 5JJCA 7MHTA 3DXYA 4GGMX 4FFBB 1UC8A 2V3WA 4P34A 4HAXA 2BFDB 4U0KA 2F1JA 1GGHA 2EKZA 3GBSA 5LP6A 3H2GA 3NIFB 3KU1A 1QGUB 3RAFC 1AQ6A 2OHFA 3C16C 3DW3X 5CLLA 2AYYA 1QANA 5K8TA 3BGIA 3BE4A 4BKMA 2WY2D 1SBIA 3QPWA 3JQBA 5DB4A 1X3SA 3M9WA 5IN5A 5BQPA 1EXWA 2RJNA 2FZKA 1FLDA 4IH4A 4HF7A 5E0OA 1IU9A 2QSZA 3Q2IA 2BAGA 2BISA 3W5BA 4NYJR 1Z56C 3F78A 4UFOA 1STOA 4CMBA 5BVGB 4KQHA 1WUIS 2F3SA 2H5JA 2FTKE 2YICA 4FHCA 3RAEC 4Z53A 2XKJE 3CLSD 3LBAA 1P3DA 3SJBA 4PHCA 2EJTA 2VT6A 1G0NA 1LQUA 2BR4A 2I22A 3Q7QA 1B7GO 1NUTA 3JZFA 3OZGA 3MCWA 2DPHA 4EGSA 1X94A 3EVAA 3ZGNA 3N2GA 2LD4A 2ZG6A 4TQUS 1KI8A 3MWJA 4E5SA 4E08A 1TM2A 3D6TB 5GADl 1SD2A 3DR3A 1Y80A 1B4DA 1X8LA 3DLCA 2VYFA 1FTYA 4ZTBA 4OPMA 1Z4QA 4RXUA 5T5QA 3AR7A 3FLMA 3S3TA 4L4SA 3ZOKA 5LZ4A 2HCFA 1A77A 4G0YA 5BY2A 4PLFA 1WO8A 1Z4KA 1ZL2A 2R5NA 5G0VA 5KNCH 3JWGA 4ZD6A 4MIEA 1NJ6A 4INZA 3LLUA 3QMMA 3NUGA 2MMCA 3GLIB 1S2OA 3HLTA 4TYMA 3RFTA 2P79A 3C7TA 4MHOA 1RJGA 1ZH8A 4O4LA 1RBYA 1G2OA 3W79A 2D5IA 2DHQA 2GPSA 3P0HA 1M2GA 4B8ZA 3ED5A 4OUDA 4KE6A 4KZKA 1ORHA 2EEZA 2BT4A 1WX1A 3ADPA 4EYKA 1QIMA 4NU8X 2QXYA 3BMXA 3IEUA 3K0EA 4NPHA 3WL7A 1V5WA 1M5RA 2XNKA 3I53A 4CM5A 3KQUA 1E59A 4RHTA 2ZM5A 1ONOA 3HZHA 1X7XA 4LHVA 4XWTA 5CFPA 3FVWA 1RWPA 4KACA 3AF3A 2D2VA 3PG5A 1GPNA 4XYMA 4OXXA 4Y9UA 1GKLA 3PD7A 2TMKA 5EJFA 4LSGA 5GONF 5ICGA 3NHWA 3BXOA 3STHA 3LC1O 3AJDA 5HS6A 2FX3A 3QVOA 4F5EA 4RTJA 3PRKE 2D7DA 4MPTA 1J39A 4I3FA 1OC4A 2FZWA 4G9GA 1AXGA 1ZKMA 3SKXA 3DL0A 3EIHA 3Q98A 1CIPA 3LDFA 1JBKA 1FMJA 1MEEA 1JUDA 4BVKA 2HA6A 2HXYA 3HJUA 3B85A 4U3JB 2NU8A 4Z4IA 5GPBA 1A71A 2DR0A 4A8JC 4EYQA 3DGEC 4D1YA 3IQWA 1N75A 1O95C 3K4QA 1JKJA 3AUXA 2IHKA 3AI3A 4AMVA 1Y9AA 4REOA 1THTA 4A27A 4E7PA 1VHLA 3K31A 2NX2A 3OZBA 4K9QA 4ZVLA 4H1VA 3ZPXA 4B9AA 5IXJA 3NGLA 1Y82A 3FDXA 4BTEA 4MZDA 3V4LA 3U7FB 3EUEA 4Y0AA 1CG6A 4ZPXA 2GD6A 1A5ZA 1PYGA 5LQCA 3CVYA 4BLVA 2JK1A 4TXMA 1UBEA 1J42A 2PKQP 2ZI9A 3PR3A 4KPUA 1D6MA 4N03A 4XVRA 3V8NA 2R47A 1VDMA 3HNPA 1XF1A 2GCPA 3RYTC 4AN0A 1GQOA 1CR6A 4EX6A 4UDNA 3O8RA 3DL4A 3OIVA 4BYGA 2AJBA 3NH6A 1JL3A 3LF1A 1ACJA 2PIAA 3ICOA 3OETA 4P7KA 4EHBA 2R65A 1M1YB 3ACDA 2CK3A 3HSSA 3ILVA 4RANA 2I7XA 3M1IA 3M9XA 1ZVQA 3LDUA 4BKQA 3HVRA 3FUTA 1F8UA 1I6WA 3B2QA 4RIIA 3EIEA 2QSUA 3VO2A 2BUCA 4TTRA 2XQKA 4IWNA 4UBOA 4EKIA 1PF7E 4FDUA 5TMDA 2DE0X 1BXRA 1LEHA 2P8JA 1FZQA 3C39A 2ZT5A 5EP2A 5FOWA 5JUWA 2XITA 4PLVA 1KH1A 2CE7A 4NBSA 5G4KB 4KOAA 1JFLA 4CM1A 2G76A 2Y27A 3P71T 1KMHB 5DWVA 5K0EA 3DDZX 4FXOA 2IPLA 2XB4A 4XQCA 3BDVA 1RWVA 3PFFA 3FZGA 1P18A 4HCJA 4CZ2A 5F5NA 2BP7A 3B6ZA 3RT7A 4MV3A 3KJXA 3WLNA 2OBBA 1YKSA 3WDLA 1IY8A 3ROKA 1Q3TA 1TEZA 2VSNA 4HXGA 3DG9A 4ARCA 3H6HA 3QLTA 1ISFA 4KLCA 4E07A 1ADJA 3BSSA 3KAPA 1DUSA 2AEEA 2H16A 3B3GA 3AJAA 3RG2A 3BD9A 3E3OA 2OKCA 3HWSA 5JSZA 2HSDA 4MAAA 4D5GA 4IX9A 3ASVA 4EYGA 2GTPA 2P3SA 5T8KA 1S8NA 3K0CA 3UM9A 5FX2A 3RU2A 2F8TA 2CLEB 5C81A 4ZCTA 2Q4OA 4FNOA 5CRIA 4M1OA 5JWOA 4JYAB 1LJLA 3QOWA 3PNKA 3H4VA 2HEGA 2WM8A 4HFRA 2OFOA 4FEYA 1ZBQA 3EE6A 3V4VB 5KHOC 1U0GA 2DLCX 2YWBA 2VAXA 3C1OA 2J48A 2I2BA 5CM8B 3OMXA 2WD9A 3IRVA 4FEEA 4LDJA 1H0RA 4KJZA 1ZXBA 4HDSB 1U81A 4UARA 4RU1A 2NUTA 1ZI6A 2W98A 4BGIA 3CVVA 2F55A 4ZO4A 3LW8A 3PNYA 4FOPA 4NCNA 3PIDA 4CMCA 3BT7A 1OZFA 2INGX 3OZDA 1IHUA 5T41A 1RAAA 2AFHA 4ARIA 3SF8B 1BYUA 2WJVA 1YAJA 5CFLA 4S12A 1Q11A 1WTAA 3KQMA 2R86A 3PC7A 3ZH2A 5EMNA 3FDZB 1JSLA 2A58A 2H4HA 1ZK1A 1RXIA 3B6EA 4KQ1A 4DWWA 1Q2XA 2NU9A 3P32A 3GVIA 3HA2A 2PYDA 3ZDBA 3D5EA 5BPHA 4G63A 4Z6KA 4AUNA 5BUZA 1O54A 2HDOA 2OHXA 4KAJA 1VQ1A 5TGDA 3TTSA 4DDUA 4ZV4A 4Q7JB 2BJWA 4P5PA 2JCYA 5AJYA 5BSMA 1IOWA 4N3NA 3EHDA 4YRFA 3CF2A 2RHHA 4ZCPA 1QJ4A 2VZLA 1N6OA 2HJWA 2R6JA 3C1TA 1VMEA 4JFAA 3GL9A 4UW9A 1KVSA 3LVQE 3FCYA 3BULA 2IHJA 4WT7A 1S8FA 5TT0A 3H0KA 4YO8A 3PF9A 1KSGA 3LZCA 5HRAA 2R2GA 2DM6A 3DF9A 5E4FA 2HIHA 1M2VB 3R8XA 1O6GA 3QITA 5JANA 5KX5B 2IS2A 1ZIPA 2O48X 5EXDA 3KOXA 5J5AA 4J0KA 3H83A 3AL3A 3Q2OA 3FOCA 3DC2A 4G1UC 3D2AA 3RBVA 3V4FA 1RC0A 2ISSD 1O7JA 2II6A 3IQFA 5BRJA 2GZSA 3D6JA 1X1QA 1XB2A 4FC7A 3UWDA 1NFRA 4I19A 5HP4A 1Z2CA 3OQBA 4FK8A 2Q3FA 2WHQA 4B47A 1FLAA 3CWCA 5K09A 1FK8A 4CU2A 1QO7A 1VLJA 4COOA 3SU8A 2N1MA 4C43A 3RS5A 2Q3EA 5KMGB 1N8NA 4KAXA 5K05A 3ETCA 1VZ3A 3IP6A 3KKPA 3D3NA 3UFXA 2QHXA 4FU0A 1IATA 2OEPA 3V4PB 2H1HA 1PQPA 2OYCA 1Z35A 1JA0A 1I2MA 2EP5A 3DBHA 4L22A 4XA8A 1DQSA 3PZRA 4FR0A 3VTZA 3AHEA 5I01A 4LRXA 3FYSA 2P6MA 1LDEA 5ERXA 4B81A 1BW9B 1RI5A 4G6ZA 3GA5A 2ISCA 2CHQA 3IMEA 1M2EA 2ZS7A 3MTGA 3KCQA 2WTMA 3FYTA 5REQB 3UHJA 5A03A 3EA5A 3WLSA 1E5DA 3S2UA 5T4FA 2RAPA 1VIVA 3ITEA 1T6NA 4B4VA 2F9MA 1JALA 2F3TA 3M34A 5LXTA 2VPTA 2VYQA 4FI3C 4DIOA 1TC1A 1ZL0A 1VZ2A 4MRAA 1TIBA 4L4XA 1Y8QB 2O1WA 5BVHA 3BPSA 4Y1FA 4LSZA 1OAOA 3SCZA 4G1CA 2J59A 2ZE7A 1NUSA 4U2FA 5KQLA 4XVQA 1R16A 2J32A 4LJ8A 5EKDA 2Q45A 2PTHA 3G8YA 3HR8A 4PGAA 3LGAA 4WFQA 3DDCA 4ZHQF 1BH6A 4MTLA 5KU1A 5GY7A 3TQQA 2X41A 5ALKA 4CYMA 2EWWA 3ETGA 2IZOA 5DNCA 3EPKA 1ECGA 1T0HB 4RWZA 5TPWB 1J97A 1X0XA 3A2LA 3I1FA 3OU2A 1P1RA 3P0EA 3V7WA 5CA0F 2FA9A 2Q2NA 2EU8A 4RZXA 3HN2A 1B0PA 4DJDC 2IOFA 1XZBA 2V7WA 4MEJA 4G89A 4EVIA 3TMAA 4KLAA 4FGJA 4H18A 3HVHA 3FOEC 2ERXA 3G0BA 5B3AA 4B73A 1PX2A 4WW0A 3OOWA 2ZCUA 3D6UA 4S35A 3Q72A 4C3OB 3FJOA 4J2TA 1R4ZA 1UZMA 3TDMA 3LP6A 4CF5A 3RFCA 2PJRA 3DKRA 4V38A 1MOSA 4CKCA 1EJ2A 1XPJA 2QBYA 4YRGA 4LCEA 2YJ4A 1TO2E 1H4TA 2RGNA 4RA9B 4EB6A 5CIYA 3QOXA 3M6IA 4Q1VA 3SX0A 4YJKA 3FGPA 2ZYUX 3JS5A 4XLZA 4JNKA 1F38A 1Q1GA 2HJGA 3DPSA 2G28A 5IT0A 1RKUA 1SOVA 2FUG6 3EGXA 4QRHA 3CEMA 4CEHB 1ZQ1A 2NYRA 4MV5A 3DE6X 2F62A 1YOVB 1Z26A 5DH9A 1UKZA 3JQ7B 1EK1A 1ZI9A 5LZ5A 1RE1A 2ZYRA 5ITZB 3W8DA 3EF3A 4EB8A 5F1PA 1UPFA 1QXSA 1NRJB 3MINB 2X0EA 4WGFA 2B5OA 1POWA 3C3AA 1H9BA 1RT9A 2MSEB 2WV7A 2WFZA 4FN4A 1JRLA 3JQGA 4NP6A 4WX2B 3FAKA 3VDQA 3RSOA 4ZKDA 3L07A 1N8SA 5CLHA 2OHIA 4M86A 4X60A 4FR5A 2WM2A 3KJIA 2P62A 2VTKA 1QPGA 2AOTB 2IEAA 3GCWA 4NABA 3ECCA 2OYRA 3WKDA 5HDBB 4KHPB 1N2CE 2ZJ4A 1X1DA 2XZLA 1Z16A 3LX4A 3I73A 5FULA 1IQPA 2NWQA 1L7XA 3N0TA 2YXDA 3HXKA 5JPCA 1A88A 1KC1A 3WZMA 4HVLA 1QPBA 3B13B 1X38A 2CMGA 2LP4Y 2IPXA 4Z51A 5L3SA 1ZMRA 4GLJA 1WQ3A 3EVCA 1QRRA 4TL8A 3HCAA 3TZBA 1HL7A 2E4WA 3D0QA 2MR6A 4H7JA 5JT1A 1FMTA 1NSYA 1W5FA 3TO5A 2GSDA 2TECE 2AN4A 3ZJ4A 4YXFA 3NRBA 3BF7A 5A2GA 5EIAA 3U3KA 4JP5A 3O0DA 3U26A 3LQ2A 2UZ4A 5CIWA 1IXZA 3A37A 4JMLA 4YLGA 4A92A 4D6PA 4QJ3A 2AK2A 2C3MA 4QAJA 4YAEA 4QPNA 3S2EA 4CDNA 1Z4MA 3TTUA 5CBKA 4Z3OA 1TAHA 2A1UB 3IEKA 5ESDA 3PUYA 2IIBA 3UMVA 1XXHA 3HI4A 2DPXA 2WVJA 3IPRA 4O2AF 1E79D 1PK9A 3ROTA 2WR8A 3W6PA 5J2UF 4WNAA 5MGNA 1WIWA 2H4WA 2AOWA 3IL2A 3LL7A 4CUZA 3VNQA 1N2ZA 1F51E 1U04A 2HT1A 3BXXA 5EUMA 5FI1B 5C8YA 1AKUA 4XUCA 4BCBA 3D43A 1MOQA 4NU5A 1OW3B 2AN5A 1X7DA 3CEPB 3ED1A 4MSUA 5H7XA 2ZSKA 2G1UA 2GWHA 2O07A 3ZBTA 2PA3A 4D9KA 2D0IA 4REMA 3RHFA 4OO3A 5KINB 3KOMA 1UWKA 3HKDB 3A1DA 3T94A 4C7MA 3O1JC 3JPWA 1WF6A 5IT9A 2Q1WA 1NE2A 2Q9CA 1YVUA 1AUOA 2IDMA 2ORVA 4P4SB 1NJSA 2VQEB 2ZTUA 2PHZA 3ZHVA 1I7PA 5TF4A 1MV8A 2Y2UA 1XAIA 3LUFA 3ZH9B 4B80A 1YRQA 4IMRA 3ASUA 3BMOB 4M6WA 1KI2A 4Z9FA 1V26A 3FA2A 3FNEA 2WVAA 2XADA 3WX0A 1N9ZA 3DOIA 1DDIA 1N6IA 1V9CA 1Z0FA 2QLMA 4QYXA 3RSHA 3A6JA 1IJFA 4I1RA 4W6QA 2FFHA 1IQ0A 1GPH1 1K4MA 1SQGA 2RCYA 2SNIE 4YCDA 4F7WA 8MHTA 3ESDA 3T7AA 1VJCA 3SWWA 2HMYB 1I0IA 3BDAA 5LM3A 2L69A 3O1LA 4MQUA 3SMQA 3A04A 2NO4A 1J8MF 1A69A 1GTG1 1MNAA 3MTQA 4HNGA 1TZ2A 1SUEA 3O5AA 4M1TA 3IDSA 1IM5A 2WSSD 2LCFA 2PH7A 1JHVA 3DV0A 1U7TA 2WF9A 3KC2A 3V2GA 4TQ9A 3HXOA 3OQJA 1WY5A 2HUPA 1SCDA 1T0JB 3E3NA 3A1FA 5GJWC 3U7IA 3H2BA 4NPAA 4XGIA 5JYDA 2XWQA 4UTOA 3WL6A 3ROZA 1VSBA 3NBUA 4IHJA 4YQFA 1H1LB 2XUOA 3GLGA 2AZ4A 1CERA 5IYZB 2Y05A 1EFRA 4V0SA 1B6TA 3N2KA 3U4DA 3P97A 1YDMA 3QM1A 4MO2A 4BMYA 2CVHA 2R1TB 4EDHA 4GQAA 1FX0A 1GZSA 5B7PA 2PMFA 3KJHA 3QQPA 4WI1A 3UOWA 1Y8AA 4X93A 3P2YA 2A9QA 2D2EA 3UB4A 3K32A 2NQTA 3KOOA 2H1OA 1NF2A 4BEVA 2OCLA 3EZ6A 3PGA1 4ZK2A 2CW5A 1E2FA 3FSRA 4AKHA 1Z2NX 3HDJA 4UASA 1O4VA 2NSYA 5DN9A 1T2NA 3AP3A 5KVSA 1AHPA 1QMPA 1A1SA 4WFJA 4KTTE 2DAPA 4EHKA 4HAZA 3GPDG 3G5MA 2J0QA 4HV4A 2X7HA 1GKKA 5JD5A 5K2OA 3BH7A 3BMCB 1NN0A 3UK2A 4FS3A 4PLCA 5C46F 1NBAA 4NX2A 2BSAA 3OOYA 3FUVA 3D3KA 1QV7A 4RENA 1E5XA 4B3GA 3NX4A 4N8EA 3H18A 4JC0A 1WZIA 3Q3JB 2QD5A 4AVYA 5ARDA 4ALLA 4E03A 5FLEX 2DTEA 2VPIA 4XIFA 4UFNA 3QVGB 4DHWA 4ALNA 1OFVA 4E12A 3PNLA 3VMMA 1PJBA 4ZHSA 5J63A 1CDZA 3MW8A 3ZDAA 4M55A 4A0SA 4BO7A 4R31A 4AJLA 3ZY3A 2IUEA 2XRFA 3GELA 3LX5A 2D8MA 2RI1A 4JN6B 1CRWG 1ODSA 1U0RA 4NNOA 3TEMA 3WNVA 1OUMA 3ODPA 4KQ6A 1NDHA 3BJIC 4GWLA 1VJ0A 3V7NA 4MA0A 3OZAA 4O5AA 1NVXQ 1V16A 2C78A 1B8NA 2AFRA 1E2MA 1T3SA 5KNBD 1AJEA 1V11A 2E55A 2WG0A 4G0PA 1PZNA 2FPGB 3FLEA 2GN6A 3U3OA 4U7PB 4DQDA 5JZVA 2C7QA 1XD2B 2QMEA 5LJLA 4U5QA 2Z6AA 1PDWA 3QKRB 4MARA 1A82A 3N8NA 1BSVA 2PSSA 3EMVA 3ULKA 3ZDCA 4HAIA 1GQQA 3KWJA 4OI1A 3RTEA 2FPMA 5K8IA 1X1RA 3VR3A 4BNZA 1GQYA 1AD2A 3UHFA 2R6AA 3ZQJA 4E5NA 4YQYA 1XMOB 4RF2A 5J3JA 4QTUB 3ND7A 4J0HA 5IZCC 1P0CA 5C8YF 3O8QB 2HV8A 1YBFA 2Q7OE 3QKTA 5JFTA 4JQOA 1XELA 1QGYA 2EFGA 3EB9A 3GNTA 2WD7B 3SX4A 1F60A 1JW9B 1ZSYA 4C88A 4DKJA 5KYWB 1C7FA 3CNBA 2A9RA 3OIWA 5CM2Z 4Z0PA 1WBJB 3T9EA 5G0UA 2ZIWB 3FBGA 2HRDA 4GVLA 3QVTA 4YA6A 4Q47A 4AZ3A 2NPIA 3H4TA 4YMUA 1OT5A 4JQYA 4ZAWA 3UAXA 1CUCA 2DCUA 2OCIA 1EB8A 3CMCO 3FPSA 1ZUNB 4FHGA 5AJHA 3LA6A 1E1DA 2GAAA 1V8PA 3LOQA 3NUQA 5DN6D 1TYDE 3KHUA 9ATCA 1GAQA 4D57A 3T7KA 3ER8A 1RYZA 4JCOA 4KG7A 1QOZA 2QROA 2I33A 2FPPA 5CVDA 4I4LA 5BSWA 4A91A 3CZ4A 4MVJG 1EUCA 4LZZA 3RFUA 4BNIA 1L3IA 2ZUUA 3E6AA 3SP1A 2VXOA 1ZAYA 3ZDFA 4B6FA 3ZD6A 4GUAA 2J3HA 3MRSA 1XJ0A 2XKAA 4PYRA 5DNVA 1DP4A 3GJ5A 4HAVA 4R6WA 4JXXA 1PWXA 4R98A 4ZVSA 5CTJA 4JEHA 4LVUA 3T99A 2PVSA 2CJWB 1QRTA 2UUOA 4FKZA 2IHNA 2J7PA 4NCXA 1HT2E 3DHVA 1BOOA 3ZVKA 1SKUA 1CQPA 3G2NA 5AK3A 5B1HA 4EFNA 3EEQA 3UN1A 3ZU5A 2FR0A 5GIOE 4XJSA 4DV2B 4CFSA 2E4VA 1LK7A 2CHFA 2Y0PA 121PA 2XT6A 3GJQA 5B53A 4EFDA 4Y6OA 4CKWB 5TMPA 4Y2UA 4PO1A 1U1GA 1D2EA 1WMDA 2QM8A 4OAOA 5BWNA 3ER9A 3R7LA 5IFKA 3RS7A 3T1HB 3K1ZA 3VAZA 2J6IA 1R7RA 2HI0A 2W2XA 4IZOA 5TPZA 3UPTA 2V6FA 3UQZA 1TQ4A 2O1XA 1P29A 5J4HA 3ADOA 4BTLA 4LF6B 1P44A 1QK5A 3EC1A 4IFEA 4L5AA 3HXTA 3IJPA 5ARBA 3V1UA 5CDTA 3G82C 5ER9A 5THXA 3QMPA 1TVKB 2D54A 1NONA 5J47A 4HFJA 3A7EA 2YL2A 2P2ZA 1GGMA 3CO5A 2H4JA 3RC1A 2Y68A 3HGTA 1V25A 3ZD9A 1YQUA 1U2DC 4GNRA 5HGXA 2BGJA 4B48A 4MI6A 3CQ9A 4JI2B 4O4IF 2WWVD 4UZFA 2DCMA 2ZQYA 3QF4A 4GC5A 4FMDB 3MLEA 1QR2A 4KREA 4DC1A 3NTRA 3GGPA 5I4CA 1NUHA 1QZZA 1DUIA 3CSUA 5HM8A 2VA8A 3AEUB 2G0NA 4MRMA 4P3YA 2WMNB 5B3JA 4EJ6A 1N2IA 1RP7A 4L2IB 4EJSB 2DBZA 1R4MA 5DYIA 2VR1A 2BH9A 2YJNA 2IGBA 3IAS6 1J0DA 3Q7RA 4OKNA 4HY3A 3GFSA 1B8UA 3FHCB 4CMIA 1WG8A 1XRLA 1L7QA 2FMHA 1U0LA 2HDHA 2VJDA 2Z5FA 3PIRA 3HYNA 2C5LA 4PZDA 3MLAA 1YGYA 2KB0A 2P4UA 2QAIA 3CRNA 4RK5A 2Q6VA 3N2NA 3PP8A 4MQFB 3IDZA 4OQXA 3QX9A 3L79A 1QCCA 1O3YA 2OZVA 1IOVA 2FJ0A 3R44A 2AOUA 1QWSA 1T4CB 3QBTA 4G25A 4CG1A 4YCNA 3G0IA 3W6NA 1X1CA 4OQEA 2W8BA 3LYHA 4TLDA 4Z49A 2FHSA 1BEEA 2IXBA 1I3CA 5CEFA 5EESA 3HSYA 1T0IA 2OK8A 2EKBA 3JARA 1WXEA 1AGNA 3P0IA 3OEHD 4XM2A 1GUYA 3ZWYA 2GFIA 4L5CA 2O2JA 5D5PA 3U3JA 2UYHA 3CSDA 3FF4A 4IV0A 4P92A 5SYMA 3K0AB 1U1IA 1PNVA 3NO4A 4J1SA 5FOTA 1YQ9A 3S6JA 3HYTA 1OLSA 4J3JA 2C8JA 4PANA 1NULA 4F56A 2D1SA 4Q1FA 1N92A 5CB8A 1IRIA 3GZNA 1NMQA 2ZSUA 3OT1A 5D3QA 4E2ZA 1OZHA 1H2WA 2FEMA 4TYPA 4TS9A 4ENUA 3QU5A 1PR0A 3A27A 5EIWA 3X1YA 3I0NA 4UPVA 4EPWA 2HBZA 3OPXA 3NTOA 1UKVY 3RWMB 3E9MA 5EKUA 1YB1A 1EVJA 1QIDA 2VSYA 3D6MA 4LGVA 3O8BA 3SS7X 1OCEA 5BN3A 3N0XA 4FCTA 2PU5A 3W7AA 4DCSA 1ABFA 3CLUC 2HMVA 2EOAA 3AFGA 4GKJB 4ZEMA 5JQWA 1SCBA 1SIOA 3NWPA 1GNVA 1WCXA 2CXTA 3DTTA 1OLXA 3EVEA 4LTDA 3IBGA 4OU5A 1RLJA 5DLYA 4DWOA 2V1UA 3MGKA 4LBVA 5EXXA 1SCJA 2A7QA 1AE1A 2UZ1B 4OKIA 3V9PA 3ZNPA 5TMEA 5I7FA 1GXSB 4G86A 4WZBA 1Z33A 1QX4A 2XDQA 1I9GA 3WK8A 4L74A 1RM0A 4KE8A 2IXGA 4OTZA 3BFKA 3BWYA 1NQVA 3PD0A 3RC7A 3QXXA 3OEWA 2ZAYA 1OFUX 1R6DA 2GZMA 4YJHB 1VJ1A 5FH9A 3E58A 4CM4A 3F46A 4GXNA 4HS4A 2TMDA 1GZ6A 1ZEMA 3H5AA 2QN8A 1TGYA 2I76A 4UHEA 3B5IA 4ZA2A 4OHYA 4MLCA 3ZJYA 1X7YA 3U2QA 3U40A 3CINA 4CM9D 4DIEA 1R64A 1QFMA 1HEIA 3GLQA 2AE2A 2FRVA 3K4PA 1UZUA 1N4AA 4EZEA 2GAFA 4FYWA 2VP4A 3PC6A 4ZXFA 3S28A 2ZQ5A 3PHHA 3DLHA 2JRLA 1E2PA 2W6JA 2Z8XA 1P61B 1QFYA 4N47A 4QYIB 1WV0A 1K06A 1T0PA 2D1QA 5IBRA 5JVDB 2PO5A 3I8SA 4A5OA 2V9CA 3UXYA 2IYUA 4IY1A 4H2DA 4QUEA 5ALZA 1OFTA 5I9SA 4B3JA 4TQGA 3OE4A 4WVFA 3ZWCA 4M1MA 3T06B 2XE4A 3CM0A 2BBSA 3H5OA 1FS6A 4YT5A 2PZKA 4DJJA 3I39X 1DPGA 4AICA 1OY1A 1OSNA 4LNAA 5GM2A 4KR2A 3F1LA 2WUFA 3IILA 4GEGA 1LLFA 1RNLA 4HEHA 2FJPA 4MDYA 4V0ME 1GL7A 1T2UA 3L7BA 4PGHA 1MC1A 2G8LA 4DLAA 3KQOA 3OQIA 3NIDB 1C30A 4JFRA 4FSDA 2JL1A 4BJHB 3SMVA 4AMBA 5EZYA 2BFFB 4GXRA 1U3WA 1RFLA 3PYMA 3WNBA 2ZSDA 3K09C 5BMVF 4D4MA 2ODAA 1IHOA 1WJGA 1OA0A 5BW5A 1FDWA 2CVFA 1KOJA 3EEFA 1VPEA 3EXHA 3LWNA 2WEKA 2EGUA 2JGRA 2GAIA 4KQEA 2AMVA 2FE4A 3AONB 4MVJA 3BUSA 4R69A 3T3DA 3DZKA 4GI3A 3WGMA 3C7KA 5H80A 3E7WA 3WWEA 2JATA 1JLLB 4W8OA 3RUHA 3WHKA 4OAQA 3H5NA 3N75A 1U0OC 2P4QA 2VXCA 2C7RA 3CJRA 3IAFA 3S8YA 1RJEA 4QGAA 1VSTA 2WF8A 3CXRA 2FJUA 1WNFA 3SIPA 4TTVA 5JD6A 1N9KA 4Z7OB 4BB5A 2JEOA 4UQLA 5LUAA 1WMEA 3O4FA 2CXSA 3PQ6A 1XMSA 4PEVA 1RAFA 4QM7A 4AZTA 3MUNA 1TW2A 3S7ZA 1GZDA 5C37A 3DP7A 4QU9A 1VMAA 5F35A 4FZJA 5D87A 3MA0A 3G13A 4YPOA 4JT4A 1JSCA 1O58A 3B7PA 4P2GA 4TL7A 4ZO6A 3RIHA 3RVNA 3W2GA 1F12A 1GARA 4F8EA 4NS4A 1YDWA 3WB9A 2ZT7A 4EA6A 1SVUA 3AEKA 4ZQGA 3QMVA 3RQIA 5AW5A 2E87A 5CH8A 2J3DA 1PT6A 3C7AA 4MGZR 1DARA 1RBQA 4JBXA 2DSTA 3SJZA 5DX8A 1Z37A 2A92A 3QTBA 3LBFA 4HWTA 3CKLA 4J0DA 5AUPB 2WHXA 3C8HA 3H87A 1Z3CA 1JLMA 3LO8A 2ZS9A 4AQYB 4M46A 2V1XA 1GG2A 5HE8A 1T1IA 2C4MA 3JPYA 5KC8A 2PGDA 3FPKA 5KTOA 4MH0R 2EERA 1G38A 5T57A 1GYQA 2Z9BA 1DQZA 3ANXA 4M8SA 3D1VA 4BO2A 3OQNA 1LVHA 2F1KA 2K6GA 4DCNA 5IVHA 2EKPA 1UEIA 3WYAA 3P9ZA 3KXIA 1E9DA 1Y48E 2ABWA 4TVKA 1HWYA 1GA1A 1Y9DA 1V6AA 5KYXB 1QHYA 5A1TA 4IFTA 3QWIA 3HI6A 1CRPA 1NVMB 1XV5A 3MGBA 1E0AA 1WW2A 1E2BA 4KFRA 1AU9A 2R8PA 3BFPA 2F90A 2X76A 3QLEA 5JE8A 3VHLB 1UPBA 4Q1AA 5CB4F 2FEOA 5I51A 2J09A 3JRNA 3PE4A 3CVJA 4L28A 1W52X 4UVIA 5ES3A 3KOYA 2VJOA 2O14A 4ER6A 3G85A 2C77A 1XZGA 4Z99A 1N7IA 4PSDA 3ORYA 3NHKA 4BLPA 2VYCA 4CIWA 1DEKA 1O89A 3S2ZA 4NENB 1FTQA 1EX9A 4E51A 1QHHB 5GTDA 1P6UA 2WFLA 4LBWA 2FXIA 2QRLA 1UL1X 4C01A 1XT6A 1KAEA 2H7XA 4K9NA 4NG4A 1QK4A 4EYEA 3JR3A 1XZLA 2DY0A 4J16A 2IVFA 2P9EA 4D5EA 1V3UA 4YMLA 2GVNA 3DBRB 4X41A 5KDDA 3VBEA 4GPZA 5BN5B 4O2BA 4B31A 4C76A 3K9WA 3C3KA 3IGFA 4FS8A 4NEGA 3RK1A 3UOGA 5BRAA 1N6LA 4OSPA 1JT2A 2J08A 4UNNA 2ID4A 3EVBA 3F6EX 3KXLA 1ZH2A 3QU4A 1LBEA 1L7DA 4BL5A 3BE6A 1M8JA 1P80A 2R7AA 1JNYA 1KEUA 2GDZA 4GM0A 4MS3A 1PUJA 1J0BA 1T5BA 4Y2GA 2GN0A 3N58A 4AWBA 2ZBFA 2MINB 2G70A 4EEKA 1JFSA 1XR3A 1FIUA 4DA7A 4Z4CA 1Z4JA 4YV0A 1DHRA 2LDBA 5AVJA 5FV7A 4RVGA 3IMKA 3HXQA 3I9V1 5DM1A 3QUBA 3W05A 3WRWA 5CXXA 2ZAIA 4ARSA 3KVRA 3N76A 3LOUA 1Y7IA 1XZAA 4Q3EA 3GWZA 3S1AB 1X80A 2DPYA 3VNBA 1XVVA 2QTRA 3TSCA 3KEOA 2ATVA 3JQAB 2W8ZA 3O8OA 2P78A 3IBFA 3TFOA 3L0BA 2LNDA 5KZMB 1MEJA 3QWFA 1FNBA 3TLBA 3NHYA 3NU1A 4X0EA 2H1RA 3IQIX 2HXGA 2ZJ3A 3EEOA 3FFAA 3QXSA 3MRVA 1K7CA 3R9IA 4CIBA 2PGXA 3WMEA 1HO3A 1AQLA 2F9FA 3F47A 4HLQB 4PBTA 4G4SO 3TK1A 1HE2A 4KIFA 2OPHA 1I10A 2HLHA 4L8YA 5K2MA 3A9RA 4ZYYA 3EOAI 5IUJC 1FDTA 3OSZA 1FYVA 1U0TA 2FLWA 1B8PA 4MYCA 1X1BA 3KAJA 1EJ0A 1ML4A 1NOIA 2J9ZB 4KV7A 1K8ZB 5ENVA 3BJEA 3VH3A 1RAHA 1SXJC 4HDKB 2DXIA 1XLTA 4WXYB 3WIVA 1TEHA 1RLUA 4YAJA 3FYCA 3RVOA 1MBZA 4EW3A 4EY3A 1PD0A 3SE0A 3U7HB 4CKBA 1AZTA 5A02A 3ZCUA 4AY5A 1ZRHA 2QLTA 1VKNA 4A0RA 5CD9A 3R5SA 1E92A 2PS0A 2OM6A 4TKUA 2IUFA 3HJHA 3R0XA 2I8LA 4BUZA 4DSAA 2GARA 5BR4A 4ER0A 1YSCA 3HLYA 4CRWB 1N78A 1QOQB 1BHQ1 2V8OA 4KXYA 2EZTA 1Z39A 3O84A 3ROMA 3H42B 3ZCXA 3PFNA 3GQBB 4N5HX 1HFJA 1FSPA 4JDPA 5LIRA 1L7EA 2ZBVA 1JIXA 4HGZA 5TRTA 2P2LA 4P6VF 1RLIA 3SLKA 1IXSB 1EFKA 5J5CA 4Q3AA 5GQSA 2WPDD 3CVOA 4N1AA 3VM6A 4ZJZA 2WB2A 4MK4A 2E21A 3VDXA 1JE0A 1JJAA 1RTTA 1HTBA 2Z98A 2ZIXA 1PQUA 4OHXA 3TG8A 4Q9AA 2O5VA 2X6TA 4FTWA 4BO1A 1XTZA 5GV8A 5DPMA 2ZI6A 5A3SA 1FDSA 1SK8A 4LYGA 4LVNA 5IEJA 4M8IA 5HJEA 5E1OA 5L4SA 1GKIA 3WRYC 1KRXA 1EZ1A 4RELA 2P4SA 3OLQA 3NOXA 3QTTA 4MW9A 3TW8B 3M5DA 2IYVA 2L19A 4OQMA 4B7CA 4JI8B 1AHNA 3MMZA 1C41A 1VECA 2YRXA 4ZIRB 3KHTA 2BONA 3K6KA 1VMIA 4TL9A 4YGYA 4DAEA 3AKCA 1NHWA 1J9EA 3OOSA 5BQOA 1YR6A 2Y4OA 1QYVA 2GHQA 1RYDA 3TGLA 3QEKA 2W4QA 1F17A 1ONPA 4E3WA 3CEHA 2CHEA 3MWLA 2GZ3A 1T5HX 3X1KA 5JS6A 1MIHA 3E9DA 4LE2A 4N7JA 5K3EA 1BD3A 3N7UA 2R4TA 3ELDA 4YDRA 5B12A 4UAUA 3SS9X 3SR3A 3SHFA 4I36A 3HZOA 1P1KA 3LC2O 1KXJA 3DMTC 5G41A 1N0IA 4LBYA 1XAGA 2CMFA 2HTFA 2WT9A 4NBVA 4L78A 3G17A 3VR2D 2ZKIA 1GDHA 3OX2A 4Z9YA 4NU0A 1CB0A 2I29A 4QT4A 1YL5A 4RJ2A 1K2VN 4AJPA 4RIHA 4F12A 3HU3A 1E8NA 4JBGA 1HNZB 3FAZA 2XZDA 1M2NA 3IIIA 4W5WA 5JWHA 1BDIA 3QUTA 1AS3A 1TM7E 3HO8A 3KV1A 4IQGA 1DBWA 5EUQB 3SIXA 3HRHA 4DM7A 2PUGA 1Z7EA 1SOMA 4ACAA 1Z8HA 4AECA 3A05A 4J76A 1TECE 3UENA 4BWGA 4EPRA 4RZ3A 1IUKA 2QUIA 3HO6A 3IURA 3NG1A 1SHLA 2PJZA 3D4NA 4BY9E 5CXQA 5ILOA 2GBGA 1XZEA 3HFRA 2D7JA 1M83A 2Q5QA 5DHSA 5C35A 1BXGB 1R9NA 1Z5WA 2DFVA 2YR0A 2CJXA 2JKZA 3AV3A 3BE5A 3A6ZA 3GJYA 2Q2QA 1HFEL 5CJJA 5FO0A 3AQIA 4AI6A 2VP5A 1UK6A 1QYXA 1TTHA 1U7OA 1FEZA 3GEDA 3GRPA 1U2EA 3MQFA 4MLPA 5E7QA 4KO2S 4F97A 3SVTA 4MWBA 1GPDG 2VK8A 1H2HA 4HBZA 3MOIA 4Q15A 5KHLB 3BICA 2JLWA 1GRCA 3P20A 1Y3AA 3UJ6A 4ZGWA 4S1WA 3K2IA 1OX4A 4BMZA 1ML3A 2G77B 1OYOA 3VSAA 1ZH6A 2D2IA 3ELWA 4X20A 5ERGB 4I14A 5F3WB 1K89A 2ZJ2A 3M33A 3M2TA 1PZEA 2FDRA 1XTKA 1D6JA 3T5BA 1DIOB 3KE8A 5IMSA 3MCZA 3AILA 3TRJA 3WMWA 1Z4PX 2H1SA 2G25A 1GL9B 2I4MA 4O2RA 2QTWB 4UHJA 3UZUA 4IQ4A 5LKRA 2EBHX 1J8FA 1SHZA 4EUHA 3FRHA 3JAWB 4IZ6A 2VOJA 1WCWA 2NQ8A 3E53A 2H2GA 2V6BA 3L0DA 4TXNA 2I2WA 2N47A 3MMPA 1L5NA 2IEBA 2QORA 3OJWA 1REQA 3W2FA 4DCPA 2AHRA 5JQGA 1SA0A 3COWA 2ZUVA 4IJUA 2XGMA 4UDYX 4P93A 3I1JA 1JPUA 3OFND 4HQNA 5EJAA 4EQ6A 4C3ZA 1XJWA 4ND2A 4A3SA 4G9EA 2JDIA 3INYA 1OZAA 1QSGA 2DJIA 3DLTA 3HLKA 5CFNA 1JR3A 2G0AA 5FL7A 3KWMA 1LK5A 1HKHA 4YRNA 4AF7A 1RVDA 2NV0A 3ZDEA 4DV0B 2RGEA 2Y66A 3IP8A 1V47A 4JYCA 5IJZA 4AJEA 2P6OA 3VKHA 5EJ8A 2ZSBA 3G68A 3ZHRA 1YULA 4ABYA 5CH3A 4LYDA 3O83A 4AKTA 2WT8A 2LCQA 2D7CA 4FW9A 5FUMA 5LMNB 5BV1A 1K98A 4HB0A 2GPBA 3O1HB 3RI3A 3N8KA 4L07A 3OIFA 1CYDA 3VKVA 3T5DA 1SC6A 2H0AA 4DLSA 2QX6A 3OE7A 2XB9A 1ZU4A 2NV6A 5B4VA 1JLSA 4DA9A 2G1PA 3BFVA 5CYPA 3WA6A 4L9SA 5UKDA 4RGBA 3ND9A 2PSEA 2D0DA 4YR9A 2V7TA 3G0GA 3E5RA 2C8VA 2O8BB 1NJ8A 1NVEA 4KRGA 3LKZA 5HNKA 3GOQA 4E1BA 5IK2D 1AT1A 5CVVA 3CZAA 3O74A 4GMFA 4DG9A 3AUYA 1TL7C 1TCUA 3WFJA 3ZZTA 4C4ZA 3D5QA 1HR0B 1S02A 1U6IA 4P84A 1C1XA 5KYYB 2BCEA 3E8SA 4L51A 5LZ9A 1RRCA 1ZGCA 4LJ6A 1ECCA 1Y1PA 1YQQA 2E1RA 3GRFA 4K8RB 3GVPA 4Q9IA 5EHGA 4XZ3A 4NFYA 2B7LA 5G3ZA 1OZ0A 4QEZA 3WJ1A 1XQYA 5F1YA 3CPEA 3OTIA 1UAGA 1W0CA 3WSTA 2JD2A 3C3EA 4G1BA 1JTFA 3O47A 4ZOAA 5BV7A 3C74A 2A8YA 4G1EB 3TQSA 1SKYE 1RC8A 5HKBA 1W6UA 5EWJA 3QV1A 5CDSA 1S2GA 1KDVA 1GR0A 1VHTA 4CG2A 2DT5A 2W43A 3FCXA 4DIKA 1U63A 3HJBA 2HOQA 1ISMA 4C4XA 3L3BA 2PLFA 4TKLA 2Z8YA 1L4KA 1F2UA 2I7DA 2VJKA 3QNWA 5FTMA 5K4AA 1YB5A 4BVAA 4BX8A 2I03A 1S7GA 4RDHA 1MD9A 1QORA 1I7SB 3EEYA 3DE7X 3LU1A 4XRRA 3AEQA 1Z13A 4YRKA 3ESRA 2Z95A 1NNSA 3IXQA 4NDNE 1R88A 3DF7A 4PGGA 3I9LA 3FFBA 3H0CA 3E2PA 4WBNB 3O9VA 1KEWA 2Y93A 1BKDR 4BDSA 2FKNA 1DJMA 2ETXA 2WJGA 3LUGA 5DNYB 3AW9A 3JD0A 1TCVA 4H6PA 1TA9A 1PSZA 1YOBA 2KE5A 2I1QA 3GAMA 1FTNA 2NSLA 3MG9A 3EAFA 1SU7A 4WECA 3QPUA 3VJKA 3HJFA 5TR9A 2Q2OA 4F3TA 2MSCB 3QJGA 4MUMA 1OFUA 1VA5A 3KQNA 1ZJZA 4YDHB 3CLVA 4M0DA 3ZYZA 2ZTVA 2ACWA 4GR4A 4RSMA 3LPAA 3UMRA 1ZJJA 2VATA 2CXQA 4Q7MB 1QO0D 3ORHA 3QVJA 5EIEA 4P80A 4X7PA 2FAXA 1SURA 3FSJX 4G0QA 5ALPA 2F43A 4BZZA 1ORWA 4EUEA 3O3MB 3AL2A 3VC3A 4BX2A 3P9IA 2O23A 3TD2A 4Z3DA 2UUPA 3HBAA 3WSWA 5JJKA 2WIDA 4RS4A 1RC1A 2X19A 2JBAB 4WXEA 1T8UA 4ZRDA 2D13A 2YBDA 4ZI7B 1PVDA 1Z7WA 2G9QA 3JALA 1OIXA 2COKA 4JJ4A 1HE4A 2UZ0A 4TN1A 5DHRA 5FA6A 5LWQA 5KSOA 2E49A 4NCBA 1P62B 1OTYA 2R3SA 3VI4B 3MELA 3FROA 3OC0A 4ID9A 2ZBDA 1XF9A 2WJJA 1MZVA 2XIJA 2K87A 5J1SB 3GLFB 3M6UA 4XSGA 1NI5A 3F2VA 4K9MA 2Q62A 5C4MA 4EPYA 4N3AA 4MQMA 4KGVA 4LSMA 1UBHS 2OA0A 4YJDA 3L7DA 1DPFA 4MS1B 4BV9A 4JLSA 1SQFA 1NUAA 4LXIA 3WA7A 2OGZA 2XIQA 3HUFA 1JR2A 4QTTB 2ZRIA 2XTNA 1ONSA 4BTVA 4TTIA 3T95A 1RRGA 2PWBA 4B3IA 5JCZA 4D4KA 4Z4QA 2G5CA 4Q7EA 5EWMB 4BMPB 1G4HA 2AJLI 3CGWA 2BKUA 1JHOA 4YIHA 1OH8A 1RYEA 4EG1A 4FWTA 2R6HA 4UCQA 1ZCBA 5FNVB 2RGUA 1KDTA 2RD2A 1XDBA 3RYIA 4GWKA 2NAPA 3FTDA 3H04A 4JK3A 4K9KA 3ZWMA 1RWWA 3W8RA 5E9QA 5JJIA 3GLSA 1I7LA 2Q7XA 3VTFA 4HDRA 4B7UA 4M53A 4KP7A 1XJQA 1P5FA 4UVEA 2XNHA 2HWWA 4AJ4A 4B87A 3N07A 4YAUA 4I55B 1EX7A 3RSCA 4WK6A 4UNSA 3RGWS 2YJZA 3M9LA 3K3PA 3QE3A 4L9RA 1ZBDA 2KMLA 4JWKA 4RPKA 4YFVA 3GGJA 5MF6A 1E1QD 2HGZA 4MPPA 4R2HA 3YASA 2VRCD 3OEEA 3P2IA 4NJMA 1ZC3A 3I5MA 4HMQA 4WA7A 1TTTA 3RT9A 4C7OA 1F4PA 5KB3A 3K9FC 1QJCA 5DMXA 4TWAA 4Q19A 2AL7A 3C97A 4D56A 5IU6A 3VJLA 2XWPA 1QAMA 2A9OA 2BM0A 2BFWA 2H2FA 2L18A 3UMGA 4CW7A 1ETHA 1UXHA 7YASA 2OILA 4G9BA 4PM4A 1XPRA 2VP6A 4KGZA 1RHKA 2HPHA 4B4KA 3L0ZA 3M6LA 4OJMX 3H19A 1MU0A 2GRJA 5JFOA 5D7BA 4YCBA 1ADBA 1XA4A 1WUTA 2ZB4A 4UTXA 3V4OA 1J49A 2QU7A 4EKYA 4L0MA 2WNHA 1Z0SA 3SBDA 4D0GA 2AX3A 3WLAA 5B30A 1E2UA 1E5LA 3ZZUA 4FUTA 3TRKA 3H8WA 1II8A 1KQ3A 1LKZA 2GFQA 3C6QA 3GAFA 3PEUA 4XB6B 1GVNB 3TZKA 3K53A 2V7EA 4HVCA 4G0XA 4YJGA 3RRFA 5ED0A 2DFTA 2QE7A 2ZUWA 4JJZA 4Q24A 3MT0A 2O2GA 1OZGA 3HDGA 3P9NA 1JEYB 4QUHA 1BX0A 4M87A 3SZMA 3B6IA 3KKLA 3LWBA 4NNJA 4B2LA 4QRIA 1QIKA 4Q16A 2OAGA 2O0JA 4TSFA 2CXOA 1QIGA 4NOLA 2PSDA 3G7UA 3MOGA 1EP2B 3WNCA 2H8KA 3LO5A 3TPZA 4K7JA 2CV2A 4XVUA 5BSKA 3QZUA 3M49A 4MNTA 4RV4A 4AC9A 2IT1A 4U9UA 3NAQA 2KYRA 1E7RA 2CNWA 2I66A 4U8HA 2GYWA 2YXEA 4K3UA 4K6MA 5AYVA 4DYHA 3PLAE 2P11A 3TW6A 2A0FA 1GDTA 3IAM6 4TMVA 1JXMA 1CUDA 1L9XA 1VYUA 2P9YA 2WYIA 3D3QA 3NDPA 4WXRA 3SD7A 4M76B 3ZU6A 2ZTLA 1U28A 1JHUA 1GRRA 4ZTUB 4Z0NA 5ABPA 2OB1A 3IO5A 1SXHA 2JFPA 2B3DA 1N0VC 2OCAA 4QQRA 8OHMA 1TQ8A 1UJ2A 1WTCA 2Q4EA 1NZFA 2VAPA 1JJ7A 4PG7A 2O4CA 5JARA 3TUZC 1OH5A 5LUBA 1G41A 1YIDA 4ZVKA 1Z12A 4C0QC 2AXNA 2ORIA 2C1XA 3K70D 3L02A 2H1CA 3H9EO 1EVZA 4QNRA 3PCRB 3ZKWA 1TD1A 3GUHA 3LK6A 2QZ4A 4C21A 1HUQA 3UYLA 3IJRA 1XZDA 1ZS9A 1JYFA 4WOKA 1N2GA 5FBLB 2HF9A 3SQDA 4N0PA 2QIPA 5DTJA 5T8KC 3T3GA 3E1SA 3BAZA 3CUTA 4Q37A 3TGWA 4Q3BA 2IELA 4BV3A 2IVZA 3QLUC 3IHKA 3PC4A 1DX9A 4KQGA 4YAGA 3TBKA 4IDPA 4LHEA 3ZHUA 1EGQA 1NY5A 1D5WA 3OLCX 1ZGJA 3I2HA 2CWWA 1F6DA 2HMAA 1OI3A 2JIDA 4DLUA 3ZIDA 3HVKA 3HCWA 3IYLW 3WLTA 2ZFUA 2RBGA 5AOVA 4XJTA 2GK3A 4LV8B 3IIJA 4BUJA 3KE9A 1OMOA 3AUFA 2IEDA 1EVKA 4R54A 5F12A 5JXWA 1DX4A 3ES9A 1UT5A 2UDPA 3G59A 4H7KA 2N9UA 3LCRA 3EWNA 4RNDB 7REQA 1C50A 2WSMA 2AKEA 4HATA 1AQUA 1I0LA 2GOYA 3AJ8A 4TS1A 5KTPA 1ADCA 2WMOB 2GERA 1CY0A 2WSIA 3L4BA 5BURA 2BM9A 3SEQA 5PGMA 2NO9A 4QELA 3WAJA 1JFTA 3M4JA 4D9NA 4LZJA 1N1MA 2RHCA 1DBSA 2HJ9A 1IJKA 2XXJA 4ZEWA 2RFLA 3PRJA 3PFIA 3DDSA 4WSOA 2Y8EA 2GBIA 2GLUA 3GJZA 1SHKA 3GGSA 1PJQA 3ZR4B 3DZJA 2CV1A 4IDGA 2P30A 4DABA 1R8SA 1NW5A 1OXKB 1RXEA 2P9QA 3LY7A 1UKEA 3G8BA 1MH9A 3ADKA 4RS3A 3F5QA 5EQTA 4BNUA 2P6RA 5LZ7A 2X6RA 2DUWA 4BV2A 2FG6C 2QTLA 3SE7A 3UUFA 5TARA 4BC0A 3RB8A 1LRKA 4C2TA 2CCKA 5LYJF 3DEIA 4OGGA 5C2JB 4DXAA 5EE5B 4Y2PA 1P4JA 2AWOA 2VI5A 3I32A 1FQOA 5FOUA 5JU6A 2A9PA 1IY2A 1BFKA 1G3QA 1LA2A 1Q44A 3ND6A 4OB6A 4RK1A 2EC5A 3F4KA 3IT1A 4IYJA 3UJCA 1QPZA 1KZ1A 3LAWA 1I6MA 2H9AA 3LVBA 3TAHA 3JD4A 1OV4A 1N3LA 2YNMA 3AHGA 4HTFB 1EEXB 3B20A 3OQHA 1KBQA 5DRTA 4CI9A 1I2DA 3TTTA 5KTMA 3TQOA 4IUBS 4AO6A 4GZ6A 4RGQA 4AWXA 4AK9A 1VG9B 1QE0A 4KXMA 5T4HA 4BLUA 1NYTA 3RU7A 1UBRS 3H4IA 1JEQA 3FSGA 3EDOA 2CB0A 4KXXA 4XDHA 1T9CA 1MOZA 3ZZMA 5K0FA 2WM9B 3ZW7A 4BVBA 2RBEA 3AUTA 4IF4A 5TQ0B 3CVXA 3GRKA 3LLCA 4HKTA 4KBYA 5LQJA 4FOSA 4CHTA 4F7DA 1EG2A 1NBMA 3PHIA 3TOCA 3ROGA 1ZRNA 4N5MA 4IF6A 3AVQA 4GWGA 1CV2A 4JL6A 3NH9A 5LSAA 3RR2A 4CQNA 4KKVA 4K40A 3AUSA 4YT8A 4U2GA 4UE3S 4BPBA 1P31A 1AKTA 1ZCFA 2WTUA 1NW7A 1U8FO 1RADA 2NSDA 3RSSA 3OBIA 3TI9A 1NXWA 2RDMA 1SHTX 1BXZA 3DXZA 3G8CA 3KUCA 3VGJA 5BSHA 2YKGA 1L4BA 5DM0A 3RK4A 1FP6A 1N5MA 4IV8A 3VOAA 3W8EA 4NBRA 4QD3A 4KO3S 4M7WA 4WCFA 2PZMA 1DMSA 3EZ2A 1XDWA 3UICA 2QRKA 4JVMA 5FF9A 4I5EA 3C6ZA 3DH0A 3QVXA 1XVUA 2IF2A 3S70A 4QOGA 4UVDA 1W4RA 1MO4A 4QGGA 1Z6ZA 2YOGA 2O50A 3HBNA 1JQLB 1BS1A 1DJLA 3F73A 1QC5A 2XMPA 5COAA 2QN3A 4WUVA 5FHRA 4EUSA 4Q01A 4LK2A 2NUAB 2AFIA 2P67A 4ZU1X 1JJFA 1KETA 3JX9A 4JYBA 4DM3A 1M2FA 1XRQA 1GFSA 4AZ0A 1N2CA 2OP0A 3O2SB 2NZWA 1F8YA 5JAHA 2NPFA 4BVJA 2O8DB 3E4DA 3KP1A 4A36A 4AJOA 1WVGA 4C0AC 1CDDA 1ZH4A 1UR5A 1L7AA 2A5GA 1W75A 1Z08A 3TOVA 2PAFA 2Q5IA 5D84A 2A3RA 3E23A 4K9RA 1B1CA 2DUJA 3IS3A 1YRBA 4R5MA 3S8EA 2AVNA 1YRHA 1FYXA 4O33A 3W3AD 1OU4A 2P40A 3UMYA 2JJ2D 4CWAA 4L3OA 1QFSA 4B3TB 2YQ5A 4ZAYA 1FBTA 1E98A 2H6EA 1ZD1A 4TMFA 4V2IA 4PX5A 3EWAA 4X97A 3T61A 4DV1B 3HBMA 4ONEA 2ODPA 1HLPA 3TD9A 4YP1A 1UJ4A 3V2UA 5CNIA 3AVVA 3TIVA 4JKIA 5I48A 3ZVRA 1NX6A 1ND6A 3PNPA 2I34A 1QQAA 4CL0A 1KI6A 4HOYA 3N53A 1CZRA 4YHHB 3HRKA 2RIRA 3AC0A 3B51X 3T9FA 2QEQA 1GPAA 2FN7A 3K9HA 5DGXA 3L8ZA 5K3CA 3KEGA 4H31A 1NM5C 2V55B 1XD9A 1KHHA 2GN9A 4S1OA 3T9BA 4GL2A 2Q29A 2Q0SA 3CW9A 2XBUA 3M6MD 1WLYA 1CLEA 1WDWB 1QVRA 2IYPA 3CLKA 1P5JA 2B5VA 1M7BA 4WFKA 2CMKA 5IWCA 4AY6A 1J20A 1QGED 3OEYA 3Q0EA 3PQ2A 4ISBA 2HLDD 4MVYA 4RMGA 3B48A 3HKCB 1WZNA 3WV5A 1BWSA 3PKIA 4XRGA 3VC2A 3TF5A 1T8RA 1N7GA 3GFQA 4P3PA 4JYMA 2X4LA 4OX9B 4I8XA 4TLCA 4Y6GB 5DEIA 1RD4A 5E9AA 3BL6A 4IGKA 1D2GA 2JCGA 5DE3A 1GR1A 3UK7A 1QRSA 3LLMA 4TXHA 2XQFA 4TZ0A 1DTEA 2C4WA 3U17A 5JDIA 4EI7A 4UM9D 3ZQ6A 5JAIA 4Q66C 3EXIA 4RTPA 5ICSA 3PC8A 4P54A 4WINA 1ESNA 5D85A 3L8FA 5T6MA 3C1AA 3OLVA 2KBFA 3C98A 3GZTB 4PN7A 4YHBA 3HY4A 5KQSA 3VZQA 3AB3A 5BRNA 3A6EA 2UXBB 1M7HA 3ESCA 4LJAA 4CCYB 5HG0A 1T4DA 1V1MB 3DPIA 1KJWA 3ETHA 3I92A 4LSWA 4L5YA 4W82A 3T3NA 4JT8A 2FMIA 2GAOA 3EDQA 1XDDA 4F6RB 3COJA 1RLMA 2XF8A 3OCCA 1UADA 3LHSA 4MLDA 4UNIA 4Y2SA 1A4IA 3MILA 4PBRA 1PBTA 5ELLA 5KKAA 4G26A 2Q6OA 4CEJB 1SUFA 3JU3A 1K7SN 1E6MA 3PPYA 2WBLC 1RYNA 2XUZA 3F97A 1NF8A 4RC9A 5HCNA 3ZDYB 2QENA 3DVAA 1BH2A 3KV3O 2GLXA 1S96A 4YP0A 2P9ZA 3TXYA 3WGYA 2QZSA 1PJLA 1GA4A 4LCBA 5JRDS 4D9CA 2JAWA 2J0SA 2X40A 3DEKA 1CJBA 3WWPA 1DAIA 4K0RA 1NRXA 5AJTA 5BUCA 4IJKA 1ULZA 2Y6UA 4U1RA 3V8VA 1NZJA 4BP9A 1NZDA 2AYXA 1N2JA 1A97A 3C43A 3O95A 3Q8WA 1CEYA 2RHTA 1ZN7A 2NU7B 5DXJA 1M33A 1ZX1A 1JHPA 1SXJE 3KTOA 3LP5A 3SSAA 5JNTA 2XE6A 5K3SA 3W6OA 3PICA 5HRUA 3RIXA 5CDUA 1RQNA 1J8YF 1GGEA 1TZMA 4H7HA 4D3YA 1ZXXA 3O8CA 5AJUA 5K3BA 2MIIA 3WGNA 2EATA 2I78A 5ALYA 3A6PC 5U1PA 1B6RA 4PZUA 3ZTYA 4HDCA 2QVBA 2OSVA 1L5ZA 3LY5A 4EVRA 2ORED 1C1DA 1I1NA 1XZJA 5CGZA 2WJZB 3OFVA 5H70A 3TUJC 3B3FA 5JAOA 2HJHA 1E2KA 1U3TA 3W90A 4ARUA 2FX2A 1DQPA 3UC5A 1Z06A 4AUEA 3ICWA 4XE5A 3U4AA 3EC7A 2EP7A 1YQWA 4KFCA 1BHO1 1GUBA 3F6YA 4MI3A 1NI3A 1ZFNA 1WE2A 1CE8A 3HYSA 1UJCA 3DTVB 4D8YA 4FD3A 3L8CA 3ENQA 2PBZA 1DRUA 1I1QB 2WW8A 4C0WA 2NXNA 3ZE7A 3V55A 1NQOA 5KTTA 4BKRA 3QPVA 1GAEO 1AK2A 1NSTA 2G4VA 4QUJA 5FCDA 1EK0A 3WGJA 2C4KA 4G41A 3B12A 1IVYA 1NYRA 1VBMA 3BSYA 3FHOA 3E2MA 4M3NA 2SKDA 2Q8QA 2R9VA 2IZ7A 1N77A 3HGQA 2BCGY 1G5QA 4YEDA 3VYSB 5KCZA 5EJGA 1GTRA 4QARA 4EL0A 4TT3A 4PPGA 3GDHA 2QJRA 3I5UA 5ALFA 2ZUBA 3U3MA 1BMQA 2OZKA 2YHBA 3N7AA 2FVYA 2OLJA 1DC4A 4JP1A 2C4VA 2A78A 2VHCA 4B6OA 3NPMA 4XIJA 3VOSA 2IQ5A 5HGJA 4J75A 2BHNA 3G9ZA 2WP0A 4MWTA 3KHSA 3W9BA 1MAVA 3A26A 1TM5E 3FWKA 1E1RA 2EZ8A 4OKSA 4EL5A 4QATA 1QBGA 2FFJA 1B15A 4R3NA 2RGGA 5C8ZA 1Z2DA 4H1HA 4JJGA 4Y1RA 2PLNA 4CXMA 2D3TA 1DO0A 5C9ZA 3VR5H 2PKQO 1EVLA 3FSEA 4R8VA 3TL3A 3UMCA 4GH5A 5BWCA 5AKKA 1YJ5A 2ZXEA 4DMRA 1VKHA 3UMJA 4QJIA 1V4BA 3VR4A 1R8QA 2G09A 3QVUA 2PCJA 1LTHR 1QWOA 2CYBA 1U31A 3ANSA 3AHCA 3HDQA 3OM9A 3LWZA 3GGGA 4KIJA 2Z3WA 3EVNA 5FTWA 2QUHA 1WHTB 1FRFS 3DZDA 3FYUB 3NBMA 1PJTA 4LG1A 3T7EA 4EF5A 1GLGA 2ACKA 2B2XA 1GL3A 1LVGA 3NHJA 1Z2AA 5F2KA 1ZQ9A 3VU9B 1AQJA 1D1PA 3RYCA 4M0UA 1JWLA 4G0VA 3FPCA 1EP3B 1FRNA 3RO7A 1UIMA 1MAHA 2QNRA 3KOWA 2H4FA 4ARZA 5FFFA 3O7MA 4CTNA 4IWXA 3IBSA 4TKZA 4MVJI 4Q18A 2VPXA 1XSEA 3IDOA 1H22A 3ZBUA 1N3IA 4G56A 1PZGA 4E3ZA 2A0WA 1F2TB 2EZ4A 3TVYA 4YYEA 1BRTA 1T35A 3WTCA 3I2FA 3G2PA 4RETA 5LVAA 4LRQA 3CRVA 5DN6A 4W5RA 3B3AA 3CKMA 2B4YA 3WWZA 1X14A 2PSHA 4XD7A 1RE0A 3NKLA 3GU3A 5JZSA 1G60A 4KNVA 1KL7A 3OZIA 4IZIA 5F9MA 2O1EA 1LC0A 1Y1QA 4IXDA 1JA1A 1GQ2A 1U9JA 3WLRA 1FP4B 4JELA 1SRQA 1KE2A 1FF9A 3HKEA 5HUQA 1M76A 4LKOA 2VAWA 4BE7B 5IAAA 1ZMBA 2WTNA 3CF6R 4HH0A 3WVNA 4WK0B 1PGNA 2VNSA 3ZWKA 4RYDA 4AKEA 4QDKA 4F46A 4W9MC 3FZEA 3VFDA 3NBQA 4R1LA 4YAKA 4HGPA 1JKFA 1IEVA 3EEIA 3U80A 4BQEA 4EGQA 2LCIA 2FEWB 1Z36A 3Q9SA 1QP7A 1O5TA 3OPYB 4CMEA 1OWOA 3EN0A 9LDTA 3PNQA 3T7TA 1W7AA 3AYXB 1J9GA 4WL0A 1XO1A 4F5DA 9MHTA 4I2NA 5FR1A 3DWGA 4I9HA 4GYWA 1MO2A 2Q0XA 4AO8A 4TUYB 2O8FB 1EFAA 4IEIA 2OL4A 1YRYE 1CR2A 3SNKA 2JHPA 1Z63A 1OGIA 1VLHA 5B2ZA 4HNAB 4X1YA 3MK31 3PX3A 1WMAA 3LMKA 4AT1A 4D8UA 1I7NA 4P7BA 4GZ3A 4B4DA 2PM8A 1NVVR 5G1NA 2YIJA 1XCGB 4FW8A 2PZEA 2QSJA 5JROA 3AVTA 3DT8A 3U6BA 4BBPA 2RIPA 2FWBA 4YV2A 3DHNA 2Z2ZA 3IQGX 3HBLA 4V3BA 5BR8B 4MP3A 3W5IA 2P8SA 5B6PA 3FKJA 5IAGA 3RWBA 1Z75A 2NIPA 4GICA 4NE2A 4RZSA 3D64A 1LU9A 2WU3A 1UANA 3ANNA 2V45A 3F3SA 1FFAA 1G0OA 3LGSA 2XOEA 3MWEB 1NUQA 4WEOA 5F2OA 3FW1A 3KYDA 5J2TA 1DUVG 3OQ6A 3KXDA 2X0KA 2W4IA 4DEVA 4Z1OA 4FFMA 3RRMA 4EBFA 2C61A 3CE9A 1CY1A 3DEYX 1YZHA 4CUJA 5IRCD 3IP3A 4FSHA 5DCWA 3PQ7A 5C5IA 2JFXA 1XRMA 1ZYUA 3KZVA 4UE6A 4ZDIA 1SELA 2JGKA 3MGCA 3H9CA 3KO8A 3JW8A 3HHEA 4GLBA 4JEUA 1QDEA 2VCYA 3QJYA 5H02A 4ZI5A 3G0CA 3VVLA 1ULUA 3KBBA 1DO2A 5JBNA 1KY5A 4BQOA 3EQ9A 4O02B 4CLOA 4BYMA 16PKA 1MPXA 2ZJ7A 3IEPA 4R71A 2CYAA 3D3EA 5JH7A 1HURA 2B98A 3R6WA 2E6UX 4PNPA 2R7LA 1MXFA 3AEZA 3L6EA 4MP8A 4Z3KA 5B3JC 1W0JD 3N74A 4KO4S 1LBHA 1NVBA 1FVFA 1FPMA 3HB9A 3OX1A 2IE8A 5LLDA 5B55A 1C2YA 3M4XA 3TZEA 4HNUA 2UUCB 1AH2A 2YZ2A 3ACBA 4NG5A 3A31A 3INGA 3VYVA 4P8RA 2GVZC 4UEKA 4X8OA 4U2DA 4DLYA 5CLJA 3DOUA 5JMTA 1W5AA 4G0UA 5K4HA 3BCHA 1MB9A 5LP1A 1EUDA 1XTIA 2PMCA 3C6MA 4PX9A 2JI8A 4MUNA 2AFVA 2H18A 1PLKA 1MC4A 3VVMA 5B4UA 3R24A 1PJCA 3KFXA 4C20A 2F3PA 2BN4A 1XJ5A 1OFGA 4TQAA 4Y7CA 3DBVO 1YTUA 1Y33E 1KF0A 2RC5A 1RQ2A 2YX1A 3F4LA 2YFYA 5F78A 5HUHA 4K03A 3HRIA 1S3SA 3EJWA 1NGSA 1RMTA 3HV2A 3LCMA 3OSUA 4HS9A 5K8LA 4B6JA 3RLIA 4D4IA 3A1EA 3ORRA 5GINE 1MIOB 5HQJA 2QG6A 6NULA 4PLHA 2G9ZA 2AD5A 3HY6A 1TRHA 3KNZA 1HETA 4FI3F 2DUUA 4GVPA 4KAAA 4C6RA 3PENA 5I7UA 1V8ZA 3KUXA 3TFQA 1OROA 2ZAMA 2XVXA 3NTLA 2GA8A 3GNQA 3GFRA 3SOPA 4JAVC 4M7RA 1YDGA 3LUPA 1M1XB 1ZCJA 1LFAA 2O05A 1A96A 5KTNA 4NWIA 2C2GA 4F8JA 2EQ5A 2VNIA 2OGWA 1RPZA 3KYBA 2G67A 4F6CA 4G5HA 4C7JA 5JDCA 5K4GA 2R1ZA 4MDFA 2PX2A 1ZD4A 3LL4A 2BBTA 2OYSA 2WLTA 3C5WP 1BJKA 2BZSA 2D74A 4PYMA 1EFPA 2W2NA 1Z29A 5AVUA 3UJ7A 2F00A 4E22A 4F2GA 1QCZA 2HV9A 2FG7C 2X0JA 2JGDA 3EMKA 4KXQA 4KN6A 4WBNF 4KI0A 4Y2RA 2QD1A 4WN3A 4Y98A 3FLAA 3WSVA 5FORA 1M34E 4R81A 5B36A 5FPHA 4GDFA 1R27A 2F9LA 4D6YA 2M1ZA 4K2HA 1AUQA 2Y2VA 4QASA 5JG7A 1WBDA 1YQXA 4GX5A 1P2SA 3L1HA 4O2LA 2C00A 2HBRA 3MOSA 2HA2A 3FZYA 3ZWVA 4DLZA 2ZUEA 4QHSA 4AS1A 7GPBA 3RPEA 4JI7B 3MD0A 3ICCA 5DWQA 5FHQA 1VCNA 3W4KA 1OKKD 5JNRA 1J2UA 2NT3A 1NLMA 3ZV3A 4XYEA 1QGZA 1IHXA 4EIWA 1VI6A 1Y81A 3QVMA 5HSGA 1Q15A 1RS0A 4FMCF 5CBPA 1R0KA 5DXAA 1WZCA 3TZLA 3E5NA 4QA9A 1QH1B 2HBQA 3AIKA 3IV7A 1FSFA 3OESA 3H9UA 4AW9A 5T7BA 1RR6A 2YHUA 4QUDA 1CF2O 1OTHA 1VIMA 3P94A 1G7SA 4BB0A 4DR7B 1KEVA 3D3WB 1JB9A 3C4JA 3MM4A 1P7CA 3Q5DA 4HGRA 4JVLA 3SZ3A 3ZHTA 4O29A 4Y0NA 5LDHA 4UTZA 1H1DA 2I1VB 1AK1A 4ML3A 3BEOA 3PR1A 2IW3A 1N2HA 1N6HA 5AXDA 3BWBA 4PAQA 4ZT4A 1EWKA 2DQKA 2XI4A 1D4FA 2IY8A 2XOKD 2RCNA 1KTVA 1K86A 4LX0A 1U2QA 1AF7A 1IN8A 2YWFA 1KA9H 4Y1EA 1QF7A 1QQTA 4A8JA 3GNLA 1O95A 2YQZA 2YFHA 4PO9A 4QFMA 1C7RA 5DHTA 3W7BA 1YQDA 1ZK2A 1NXVA 1R9MA 3WLFA 4J7XA 2NO1A 4DBLE 4ANFA 4AROA 5AW2A 3G2KA 4ZO9A 3NLLA 3DZ8A 4G85A 3ZHQA 2EJBA 4RD1A 5H9WA 4ND8B 4FJ1A 4DC9A 4D3ZA 1K4KA 3AR8A 2V96A 3P2OA 3JWIA 5BW8A 4HDMA 4DIFA 2C9CA 2JARA 3PQCA 1TM4E 2ACVA 3IQHX 4J2HA 1BCSA 4N3BA 4F38A 5F98A 2YHSA 1E2QA 1L1RA 1ZZGA 2KW5A 3JZMA 3ZI7A 3OOHA 2D62A 2PBRA 3UA3A 2G82A 3DD5A 4UZEA 5IULC 1CPYA 1M0WA 2DWQA 2OXCA 2V6IA 1QE5A 1OT3A 4LJKA 3GLHB 1P5ZB 3H16A 2VHJA 2PUEA 3G1WA 1SOAA 2VBFA 3COYA 5FL3A 5LBUA 3UIEA 1R6AA 3VO9A 2P5TB 4X6XA 1CUSA 2EG9A 5CDGA 1B8OA 3RUFA 5INTA 2QX4A 1SHUX 1HEYA 3A9UA 4B3MB 1SWWA 4JS0A 4JLPA 4ZOBA 3W4IA 1KWKA 4PIPA 4JU9A 1VE9A 2L17A 3NHZA 2HGSA 1RYHA 4XTCS 5A3QA 4GYKA 3UT6A 3KETA 4MUKA 1P4GA 1CFJA 4LZAA 5LB4A 3LTEA 1BRMA 1EA5A 1U0HC 2ODQA 2Z2YA 3IH5A 4UPEA 3VPSA 2POCA 3MB5A 1GLNA 3OX3A 4B7ZA 1XTVA 4PPFA 2LGJA 4UATA 2PL5A 1JEAA 3D54D 4QDTA 3MPUA 3KL4A 4TSRA 3D4BA 5BUQA 2C4NA 4I4TA 4MUGA 4GMXA 5AVVA 4UNRA 4GSKA 2WQ7A 4EARA 3KL2A 4OGFA 2VCHA 4F4DA 2I2AA 2VJMB 1P8JA 3IX7A 2WWRA 4Q12A 4XVCA 5K0TA 3H1EA 4D0SA 5IM4A 3AVUA 2W11A 2Y4NA 4XGQA 1UXGA 1R74A 2CSXA 4JB8A 2GCIA 2PFGA 1EP9A 4O4JB 3SYLA 2B7BA 3PFCA 4IOJA 3HMKA 4Q3DA 1XLUA 3Q4GA 1XVLA 4G0ZA 3TX6A 4CM3A 5K8JB 5LQAA 4TRNA 1XN4A 2PK3A 2ZYDA 4TMWA 1DKRA 4X91A 3T7CA 3UJBA 1QNFA 1SVSA 2DFDA 1V7PC 5K3FA 1FFXA 2B20A 2XW6A 3FYUC 2G07A 3M5PA 4FGZA 5CX4A 1ZGGA 5HE9A 4PX3A 2PSFA 1EZZA 2B2CA 2UYOA 1YFZA 1BHJA 3ZGVA 4I2VA 2JA2A 5DV9A 1U0FA 4MYUA 2VAVA 4C4OA 1SZCA 4O8CA 1TMOA 3MBKA 3LPLA 5ADVA 2WA2A 3E9RA 2OK7A 1U3UA 2CKMA 3EXAA 4E46A 1E1KA 5I8ZA 3DMRA 4OIMA 2YWXA 4G1MB 1RKVA 1VJRA 1QB7A 5E38A 1O5IA 4ED9A 5IDQA 2H9YA 4C08A 3GLRA 5CT8A 2OTCA 3TCNA 4D9BA 1I2AA 4RD3A 5FB3A 1U99A 3WGQA 1J7JA 2M9MA 2Z56A 1OFHA 3TJMA 4ZOLB 2VTBA 5EJMA 3RC3A 1Z3IX 2XKKA 5TEVA 1RM4A 2FI1A 4GMGA 5TGZA 1H3EA 3CBGA 3A14A 5A6SB 4M1SA 4J16C 3NWEA 2B4TO 4K6CA 5DZSA 1VRVA 3UJDA 3AERA 3R3VA 5F5XA 4PYLA 1EDOA 4Q3LA 4RJKA 1P7ZA 1LSOA 3VX4A 2G4LA 4NH0A 5EMJA 2I3AA 1PL7A 4LE1A 4NYIQ 4Q9HA 4LOAA 2LIPA 1LDBA 2AXEA 3H1AA 2ZUTA 5LP6B 1QU3A 4DR1B 5T67A 3QY0A 5FWYB 5BSTA 1NXSA 1PYDA 3EG9A 5J23A 1USVA 3FI0A 1BG6A 2E48A 4ZQIA 3ST7A 4I7EA 2X8LA 1S1MA 1JQ5A 4F8YA 2NTNA 4S24A 3TNYA 4N5NA 2JIPA 3WDMA 4S05A 2IZZA 1R4NB 1XNHA 1VKZA 1NURA 5AO9A 1EEHA 3RV3A 2EF0A 4GS5A 4DNPA 1KH3A 4HAOA 5LN1A 2WZDA 2GO7A 1V6CA 4WXHA 4J3FA 1FL9A 3SXUA 4BB6A 1VPTA 2NSJA 4KIGA 4JBIA 1BFDA 4N12A 1Y8ZA 1EGHA 1V41E 1ZSNA 1W93A 2AFHE 1FFGA 3LS2A 4O6VA 3VNVA 3NEJA 4ZAFA 5A06A 4JY7A 3NETA 4U9HS 5DSXA 4B6SA 1EFVB 1SMKA 2Y76A 2ZRCA 3HVIA 4JH0A 4ZAZA 5LD2B 3F71A 1ID1A 4WCVA 4P0QB 1MPTA 1NIJA 4N0MA 1KRHA 2J3JA 3IQXA 1BMDA 1YVPA 2LKDA 1LDGA 1W4ZA 2JIQA 2ZR9A