4JGGA

Crystal structure of tesa
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
180
structure length
180
Chain Sequence
b'QTLLVVGDSISAALGLDTSQGWVALLQKRLADEGYDYRVVNASISGDTSAGGLARLPALLAEEKPALVVIELGGNDGLRGMAPAQLQQNLASMAQKARAEGAKVLLLGIQLPPNYGPRYIEAFSRVYGAVAAQEKTALVPFFLEGVGGVQGMMQADGIHPALAAQPRLLENVWPTLKPLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase TesA
molecule tags Hydrolase
source organism Pseudomonas aeruginosa
publication title Structural and Functional Characterisation of TesA - A Novel Lysophospholipase A from Pseudomonas aeruginosa.
pubmed doi rcsb
total genus 60
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4jggA00
3DCIA 4IYJA 2WABA 1U8UA 4K7JA 1J00A 4K9SA 3HP4A 3SKVA 1FXWF 2VPTA 2O14A 1DEXA 4RW0A 3W7VA 1JRLA 1ESDA 1ESCA 5B5SA 4K3UA 2HSJA 3KVNA 4H08A 1BWPA 4Q9AA 3RJTA 4I8IA 4JJ6A 3DC7A 4HF7A 1DEOA 4TX1A 3PT5A 5A4AA 3P94A 1BWQA 3DT8A 3DT6A 4JGGA 3SLRA 4JJ4A 1IVNA 2WAAA 4NRDA 1K7CA 5CD9A 3U37A 4XVHA 1Z8HA 2Q0QA 4JHLA 1PP4A 4LHSA 3BZWA 1WABA 4OAPA 2W9XA 3MILA 4PPYA 5HOEA 1ES9A 1BWRA 4S1PA 4K40A 4HYQA 1ESEA 2Q0SA 5BN1A 4JKOA 1YZFA 1V2GA 1VYHA 2APJA 1FXWA 1VJGA 4OAOA 3DT9A 4M8KA 3C1UA 4DEVA 5JD3A 1ZMBA 4Q7QA 2WAOA 4RSHA
chains in the Genus database with same CATH superfamily
4KLAA 3HKBB 4YAEA 1H4QA 3KWFA 2WABA 4JB8A 4QTXA 1BYUA 1WF6A 3LK6A 1QGUA 4HFRA 4MKGA 3HVUA 4B81A 1NOJA 1G3IA 4NABA 3CEAA 2BMEA 2DQZA 3F6YA 4RVNA 3F9RA 2QY9A 2CBGA 2QIOA 1SIUA 2GQ0A 1W30A 2XB8A 3DEFA 1OAAA 3R9KA 2GGSA 3THRA 4IG4A 3KEFA 2R8YA 16PKA 1M74A 2G67A 1EQ2A 1ODJA 1ZVJA 1ESDA 3RLIA 2QTRA 3A9UA 3V00A 4A0FA 2V74B 5DYTA 1OFUA 3GD7A 2FEXA 3Q3VA 4D45A 1N5JA 2F8MA 2QY6A 3GJRA 3WLNA 3BWXA 4INAA 3WMFA 1Z8FA 1XFDA 2H1OA 4A6XA 1YZYA 1VSVA 1PR4A 4N48A 2P40A 4GVXA 5I47A 1LA2A 4N41A 2BRUC 4AF6A 1JVSA 1TT5A 3OX1A 2JBAB 1CY7A 1MX5A 1JFFA 4NOJA 2XQKA 5HVNA 2PT7A 1MPXA 4GGMX 4PC6A 3DXXA 5C37A 1Y7PA 1CRQA 1NTOA 1WTAA 1G55A 1U4OA 1VYTA 2MYTA 3H86A 3U1VA 3D0RA 3WA6A 1LV8A 4IOJA 1WUIS 4MVJD 5C5IA 4HDNA 3UHAA 1JZTA 2Q5JA 2BF4A 4ZPJA 2D2VA 4UTZA 2XIQA 5JYBA 1GCAA 1J0DA 1PHPA 3N87A 3DEAA 4AZ3B 4ZC8A 1KPIA 2ZB2A 2C95A 3MS4A 1GV1A 3BQMB 5LA6B 1U7WA 3BMQB 1A96A 1RIIA 1IY0A 1R64A 3DDWA 3LUDA 4YUVA 3VJLA 1LDMA 2IYSA 2Q3EA 3O9ZA 2HPHA 4JL8A 3WYBA 3O8NA 1QCCA 4I8DA 1ZGJA 2ZITA 1O94C 3DWEX 3IVAA 2O2SA 2XQIA 5JZMA 1S2IA 4KDEA 2QRJA 3EXHC 4MYRA 4GMXA 1F8YA 5CIQA 4RM2A 5FTLA 1PD0A 2IX9A 3OY2A 3QWAA 3JAKB 4L0MA 4NK5A 4GI3A 1EM8B 4WKCA 5H59A 5C34B 2GCPA 4QOEA 1NC3A 4D3YA 3RRXA 2PJRA 3L1KA 3GNSA 1JQDA 3T3DA 1J9GA 4CV3A 2DWUA 1KKMA 2X5OA 5LJIA 3WLAA 2PNFA 2X5NA 3Q6NA 4UHBA 1DIOB 4CL0A 2JJ1D 2HADA 4KQJA 8MHTA 2WFLB 4HC4A 3H9CA 4BUZA 3LRTA 3TWOA 1GA1A 4YONB 1SG6A 3SLKA 3PUVA 4KNWA 4FYJA 4LXQA 1CUFA 1GRRA 4Q9DA 3V80A 4IFIA 3DAOA 4RA6A 4UU1A 4JGBA 1JW9B 2QL7A 2ZS9A 3GAZA 3T7AA 3T3IA 1XDWA 2WJPA 4QU9A 3VH3A 4POOA 4RSHA 3E2MA 3C7KA 4ARZB 4S2UA 1PX2A 1B76A 2BFFB 2J5QA 5CBPB 1XDZA 4OBWA 4A2WA 1Z4OA 1NU8A 4MKHA 5CYGA 2AUMA 1Q84A 1GAWA 4HDAA 1YC2A 4XB2A 2RG7A 2C83A 4KE7A 5JCJD 3DOCA 1PLJA 2X2FA 2I8AA 2HN9A 3EIUA 2XRZA 4DPLA 3EH1A 1F3LA 1GQRA 1QVRA 1S8FA 3K1YA 2MR6A 1X38A 3GEGA 4FR0A 1H1LB 3DKRA 4S35A 2OZLB 4DUGD 3SMQA 2VJQA 4IUBS 1KJNA 3Q85A 4N9WA 4OHOA 1OCEA 4GSYA 4OK5A 5KNBA 4LJKA 4I4NA 3REQA 4I3FA 3AR7A 1RQPA 2R87A 2J45A 4LV8B 1YJ5A 4CU2A 2FZ4A 1WG8A 4BVLA 4D0LB 2P3QA 2YW2A 4LF5B 3DZBA 3QKRA 3S1LA 2W90A 2PUAA 1TNDA 1G21E 5AI6A 1J49A 2R86A 4Q4HA 4B34A 1CZRA 3A8TA 3C7CB 2HHAA 4RE5A 1SG0A 3Q6MA 3IH5A 4KK3A 2Q3JA 1NN0A 1M1NB 1N0WA 1YC5A 1WR8A 4NAHA 4PYIA 1KHTA 3TE7A 4CCYA 1ZRNA 3DDNA 3EZYA 3OHSX 3WOHA 1T6YA 3VR6H 2DFDA 4YAFA 3WBJA 2Z3WA 1WV0A 4FLEA 1K6JA 3D0QA 4KQHA 2KE5A 1A04A 3FCYA 5KWEA 1HSOA 1ESMA 2SCUA 5T5QA 4BP9A 2B99A 1H3FA 4XVUA 3P94A 4YP1A 4B0PA 2E2WA 3DPSA 4WGGA 3GFSA 3IQGX 5JNLA 4QDZA 1QVVA 3G79A 4FUQA 5KQLA 2XZTA 1R0CA 2DPMA 3P4UA 1LC0A 2MJLA 5GP1A 4D4HA 5C7LO 3RU9A 3EE6A 5ARCA 5H3CA 1OGYA 3QELA 3HJNA 3ZIAD 3ZQJA 1UC4B 4MP3A 1E1MA 4D92A 4EGQA 4TMZA 1R0BA 3L6EA 3HP7A 4B31A 2H06A 4ES6A 3HRKA 3MUFA 1J0BA 2R11A 1JIJA 2QUAA 3HB5X 1YS7A 1HZJA 3KAKA 1U7XA 2PSDA 1T8PA 4Q37A 5AI5A 2H1VA 2ZG6A 4C0QC 4FYHA 4GYKA 1E1YA 1DAKA 4MWSA 2EZ4A 5FYDA 1A9XA 2GZHA 3OOEA 1KXZA 1Z2AA 1RQLA 3L7NA 1WOMA 4ZCPA 1R12A 2J09A 3VPFA 3NBAA 3HO6A 3PQ8A 3AQ4A 5E4FA 3T5DA 4BGIA 2HWUA 1LEHA 1Z37A 4ZZ3A 2EWWA 4XIYA 4D9NA 1I51A 3PCTA 3I53A 4GICA 2C0PA 1RXSA 4LWQA 3GLIA 3WQSB 1K8ZB 4Y2TA 1CB0A 2R1TB 1XWWA 3AUXA 4CMJA 1KTIA 1UQRA 3FYUA 4A1OA 3RB8A 3JRWA 2BDUA 4G0XA 5L3SA 3UICA 3HUEA 4AIIA 2JC3A 1CZLA 2VJBA 4E5PA 1A8PA 4RHEA 3GA7A 3HVRA 1E8MA 2XNHA 4JV5B 2ZZMA 2BGWA 2PFSA 1XA3A 4NCIA 5NLLA 1C2TA 4H4DA 3CS3A 1WXEA 2PS1A 4MUAA 4UU8A 4V3CA 1P45A 3RRYA 3VDMA 3PKJA 4KMRA 3VKUA 2RHMA 4D6XA 3QHPA 1IE3A 3FNHA 2E9SA 3QVUA 3AI2A 1RAFA 2JGMA 3LM8A 4KGDA 5JARA 3DMPA 3E18A 3J7AC 2ZSFA 1D4AA 2PRYA 1A72A 2X3UA 2YNMA 3PBKA 4XTRA 5BV8A 3L6CA 3RYFA 1KY5A 1A8UA 3BN3A 4NU5A 3A9WA 3KP1A 1J8DA 2P9GA 3UFXB 2D1QA 2NQTA 1GPDG 3TLMA 1OXTA 2OCIA 3N6RA 1AKRA 5HMLA 3GI1A 2PSEA 1NVFA 3LY9A 2RKOA 1U1FA 1IHPA 2GERA 3EFEA 4RQTA 5F3WB 1L7QA 1UQTA 5CB0A 3IBTA 1PFUA 2BSXA 4F3TA 2OPBA 1E3TA 3MERA 1PGPA 1FC0A 2XVZA 1G41A 1QG6A 2P3SA 4F3CA 1GUDA 3VO1A 5EEGA 2J4CA 4IL5A 4C0JA 1M1UA 3AV0B 4OBXA 2G09A 3OJOA 1NXPA 2O3RA 5FF9A 3V9PA 2NP7A 5E4JA 4RSMA 1Q1BA 1YDFA 5JLAA 2PTHA 4DBLE 1M1ZA 2DH5A 1K0FA 3RPEA 1X3LA 3KJNA 3K31A 1DAPA 1SULA 2ZRIA 3M6XA 1GNRA 3GWZA 4O59O 3KS9A 3RUCA 4B32A 4CEJA 2F00A 4LS3A 1I7DA 3EGDA 4JJ6A 1C8LA 1GPMA 3FR7A 2W6CX 1N0UA 4QJ3A 2FSSA 3INTA 5F51A 1U65A 5EMNA 1GL9B 2QM8A 2FETA 5ALVA 4UE2A 4BKRA 2MMCA 1A5SB 5TQ0B 4YCNA 4ZJZA 2VWGA 4BGUA 2Q2WA 2BHLA 3PEFA 3VTAA 1MAUA 4MPRA 4NENA 4C04A 1VI6A 1ZX1A 3NIFB 1THGA 3OLXA 3W6PA 5ITZA 1TA4A 3V34A 1O1YA 3DL0A 3WLQA 4RXMA 4XDZA 1L7VC 5D87A 3UV7A 4JENA 1NW6A 3O6VA 2DOKA 3PC8A 3KKZA 2VNHA 5DTRA 1P5RA 1XRQA 3RIHA 4BWFB 5BR4A 3ZG6A 4PG7A 5ARDA 1G5QA 1NNLA 1V4BA 4G8DA 3FLBA 2WA1A 3MBKA 4HY3A 4RFLA 4A36A 1JN0A 1DTEA 4BVJA 3FG9A 4CF3A 3HJGA 3IMCA 3ABZA 5A5GA 3IUBA 2X0JA 2D7DA 2VUIB 3ESXA 1QHEA 1MD9A 1VCMA 1YK0A 3O47A 4YHHB 3WIUA 3NRBA 3P2JA 4XIIA 4AJHA 1XZHA 4C4TA 2HF2A 1ZAKA 5IWAB 4PW0A 1IVSA 2K6GA 3VR5A 1EGVB 2PQ0A 3TX2A 2DHQA 3N0VA 1NBHA 1T3ZA 2A9KA 4IOMA 1B8UA 4KYVA 4YAIA 3WDKA 5IDQA 1D6MA 2P1ZA 2HLNA 1F4LA 3G8DA 3IBGA 2ZR0A 4NHOA 3RI3A 3SQNA 3IEIA 4J0QA 1AMNA 2KJQA 5HR5A 1A4XA 2QD2A 3F6RA 1WSAA 4FILA 3LWDA 1KVSA 2P68A 3HLKA 1YVUA 2GO7A 1HDOA 2FPGB 2G1UA 1WZNA 1JXOA 3T1QA 5K3CA 1KBOA 2HPAA 1BX3A 1VIVA 2LE0A 3CCFA 4I55A 3EN0A 5DLPA 5AW8A 1Y7TA 3TZKA 5G0SA 4DIMA 3HA3A 1C1XA 4Z9FA 4DIUA 2G1AA 2W8ZA 4LDQA 4KXNA 2WFAA 3PPWA 3I1FA 3AU8A 2XUJA 1U8XX 2X7XA 2D3WA 4YIHA 1G2OA 2GCNA 3K5PA 3EQ9A 4ECAA 3AKCA 5CPBA 4DJ5X 3AUYA 1J56A 1XMSA 1QLJA 2PKYX 1U99A 4KN8A 4YT4A 1F0NA 3WLOA 1SRRA 5BN3A 4E2WA 5JD4A 2W6JA 3PUYA 5AW9A 4UZSA 5IARA 4C0HA 1EWTA 3TGWA 4YLYA 3JY6A 1WD5A 2WHYA 5K8JB 2EJWA 3HEAA 4IIGA 3T5GA 2ZI4A 5K03A 3JVDA 1AURA 1Q2UA 3FYUB 4LUCA 2TRSB 2ZTHA 1GKIA 1S3GA 3L6UA 4EQZA 4K9SA 4DIFA 5C51B 5SYMA 4RK0A 1USGA 1T0IA 3OJLA 4L08A 3O3MB 3F6CA 5B2FA 1OTYA 3SR3A 2VH2A 3JD4A 5CU7A 3TZQA 1RRMA 4U2BA 5A6VA 5JY1A 3Q15C 2XE6A 1NU6A 2BFBB 4BNMA 2R62A 1RADA 1A69A 3LBIA 4HB2A 2F4VB 3HGQA 2O2JA 1WX1A 5HUQA 3LZ6A 4P31A 4TKVB 5AKJA 5B7NA 3CX8A 1XTQA 2BDEA 2XTJA 2I65A 2ZJ3A 3DOHA 3E23A 3LC7O 1Z4IA 2Q6IA 1CDEA 4L27A 1M6WA 3MN1A 3KT8A 1K06A 4JYCA 3QBVA 3WB2A 3PNBA 1N9GB 2PUEA 1XPUA 2GZ2A 1N2XA 1CY2A 4MK4A 2PBRA 4TX1A 4CTJA 5BV1A 2FUG6 1CD5A 1M7GA 4MUNA 1BVYF 5JROA 3G5AA 2HQBA 4MWEA 1KZ7B 2NN3C 4JA2A 4RGQA 3R5KA 5IVIA 4YRBA 1UFVA 3UVEA 4L5AA 2FY8A 2ILVA 4JUFA 3PIDA 3ZWNA 5FUQA 3AR8A 3UA4A 3EQ8A 4H27A 1PK8A 4JI4B 1UBJS 1QRRA 3N6XA 4AS3A 2V3VA 3L0YA 3PDHA 4OQLA 1MRZA 2WZQA 1C7JA 2GTHA 5TQ2A 4YPOA 2OK8A 5TJHA 2JFFA 3NKLA 4CQNA 1L1FA 2VC2B 1Z8HA 2VWHA 4GX5A 5G40A 3TVYA 1IXZA 1NL3A 4JT8A 3EEOA 5FORA 3PSAA 4E5YA 4G5SA 4Q7MB 4XM0A 5G02A 2YR0A 2AH5A 3JQBC 1B0PA 2ACWA 4BVAA 3X1KA 1MAWA 3Q8WA 5DHSA 3H2YA 2QJWA 2V7TA 2JGIA 3CEPB 1I6LA 3R5TA 3TDNA 4ZIRB 5KOHA 5DNYB 2PH5A 2JIRA 4AY5A 4FYPA 3U3OA 4Y9UA 4GDFA 1QQTA 1WW8A 5IDWA 1XAHA 4IQGA 4TYWA 4E4TA 3W3AH 5JR3A 3IOMA 4NSNA 1U4SA 5DWQA 3HM9A 4JVSB 1NVKA 4LBVA 4ER7A 5I7OA 1I4OA 2B8EA 2JAWA 1XDSA 3TKYA 2WB2A 3CW2A 1Q3TA 2FB9A 4LK3A 3BFKA 2BBTA 2D59A 2HU5A 4JOSA 3LLUA 4QO8A 1A27A 2J3IA 1Q21A 5JXWA 2JBAA 1UPBA 5JRZA 5B1DA 3HXOA 3C1UA 2VP2A 3DPIA 5GZ3A 3DZDA 3KXLA 1TMOA 3W6NA 4QYSA 1DT3A 3M3DA 3ELWA 2XODA 1XPRA 2A1UB 2X5KO 2IHUA 2ZPTX 3WAJA 2ZWOA 3SC2A 2NUTB 2QT9A 3Q3HA 5TS3A 3EDOA 1E0JA 3QG1A 4Q1DA 4RPJA 1N4DA 2HDHA 3CCCA 3DEHA 2QNBA 5HE8A 4YQFA 3RVSA 2FOLA 1QRDA 2GRUA 4X1YA 3DZKA 1MHPA 2Z4RA 2IGBA 3FPKA 4LRXA 3EZ2A 3FWZA 2D7CA 3NAZA 2IUYA 4F4CA 3A70A 1KA9H 1ST3A 1ONOA 7AT1A 5L4SA 1U81A 1X7GA 1QDUA 1TO1E 3AB7A 2PDAA 4Y18A 2VDNB 3L0DA 5BMOA 4CLOB 3O4JA 3CLSD 2FZWA 3AILA 3GPBA 3Q40A 2UUAB 1P39A 2PR2A 3A1EA 1TQ2A 4JLDA 3NM5A 3HMKA 3VU9B 1N6LA 4ILEA 1T8TA 3UHOA 4NEGA 1N5OX 2ZU6A 1YD7A 3KTAB 3VO8A 1JEJA 1NSFA 2A33A 1K3FA 2OKGA 4MI3A 1IK4A 1OXSC 4BNIA 4QUEA 4QHTA 4A23A 3B36A 1GTG1 3DNFA 3IAUA 1YZQA 3GFFA 3WV4A 4CQLB 4QYWA 5K5EA 1JIQA 2P1RA 3ZCXA 2DFPA 3FROA 1KQNA 1FBTA 1BOFA 1UEXC 4D8TA 5BOSA 3FTEA 2H7CA 5ALSA 2FE1A 3C3CA 1V1RA 5EERA 5JH7F 1GKLA 1OAKA 5IHPA 3GN1A 3QI7A 1SHTX 4IJVA 2WJIA 4F9TA 2PZBA 3VKHA 1PFYA 1V4VA 4G07A 2WVHA 1GN9A 3LX4A 4KXWA 5K0FA 1QPZA 2LKDA 2QTAA 4YRAA 2DHCA 3CTMA 2DWPA 3B1XA 3GRYA 3NR2A 4L57A 1WMAA 4WOBA 4ZO4A 5TJ9A 5C32A 3ONVA 3PDUA 5E8JA 5H02A 3VAAA 4A0GA 1MW9X 1ZY2A 2IEZA 1RLJA 2R2GA 1IZYA 4J7UA 4PO1A 3Q2IA 3V4ZA 4YECA 3KQQA 5I7WA 3OFND 1GDDA 2G25A 2O1XA 4PFQA 1KOGA 3FB1A 5FOUA 1VLHA 1AXGA 3H9UA 3TQRA 3ZQ6A 2G71A 4I7EA 3G2PA 2OBYA 2H4XA 4OHZA 2XCOA 3AL0C 2CLMB 2UDPA 3HZOA 2NSJA 3MBOA 4KQ1A 4AURA 3CNOA 3CF4G 4MUMA 3WY9A 4ZZ2A 3RHSA 4BNTA 4NV1A 2GFIA 3ONFA 4B4DA 1ZL0A 3WLKX 4NMMA 1SCDA 3N0XA 2QUZA 5DHTA 3GJTA 4BLRA 1QVAA 3BHNA 2JGLA 5EWMA 4YV7A 3O95A 4JGIA 4ZGWA 4CBVA 5FNVF 5EE1A 5IVHA 2FSIA 1OZ0A 1C7QA 1I30A 2RGXA 4UAUA 5DVZA 1CR6A 4R1MA 5C7OO 1PTJC 3U4QB 1XTSA 2ORYA 1F20A 1IBLB 1Z28A 1ABEA 1AKVA 3ZY2A 5IJZA 1CKEA 3FZEA 3LGSA 1BXZA 1F2UB 2J32A 2X8WA 4QELA 2IV3A 4AY2A 2JFNA 4HBGA 2C7QA 1N6KA 5I7SA 2OPHA 4UOQA 3ZWQA 1TFUA 1CR2A 1G8AA 4DEVA 5EUMA 5C4IA 4AM8A 4Q1VA 4FZ3A 4BNUA 4HWKA 4X6UA 4EI7A 3WYNA 2AYXA 2OCPA 4B5KA 1ACJA 2CLKB 4EB3A 1ECPA 4DLYA 3GLTA 4XLTA 2OCGA 1I7NA 2PX2A 1E60A 1C0PA 1R0KA 4NOMA 3QF4B 4PVCA 2F59A 2DFNA 2DAPA 1ZWKA 4N5MA 3L1JA 5C8ZA 1CUVA 2JH9A 1DV1A 3HO8A 2JGDA 3IP9A 3LDFA 1COWA 3C39A 3OZCA 3JX9A 4OY3A 1KYIA 3BJMA 3C6MA 4IHKA 1H94A 2CDRA 3EZFA 4FW8A 2XNDD 1FLAA 1QE3A 1TT7A 1QV7A 1OOEA 1Q0RA 3TTVA 4WINA 3RFCA 3NJ4A 3ODPA 1ZRSA 4DSAA 4EG4A 1OXXK 5GINE 3PXCX 2VPZA 4TZTA 4EJ6A 5D6OA 3FLEA 4XPIB 3HCOA 1KEEB 4JLBA 3UT0A 5FNVB 6GPBA 4EUSA 1YZUA 4H6PA 2PM8A 4F5DA 4QOJA 1EUDB 3C8MA 5D7NA 2R8RA 2HHCA 2I7TA 5JPIA 4ARUA 3ZHTA 3ESCA 4BP8A 4C7JA 5BSVA 4IIUA 4OP3A 3D2AA 2XSZD 1BWSA 1CP3A 1WMBA 3DAYA 4N0QA 1DFIA 4BQFA 5F7XA 3Q1KA 3D31A 2GK6A 3E48A 1XP8A 1SQ0A 2J87A 4G1BA 3LT0A 4IIEA 1V25A 3UGTA 3L7YA 3TQTA 5TQVA 1E0DA 1YDHA 1RWVA 4J0IA 4GMDA 1X7WB 4C4SA 4YR7A 3H9BA 2PUGA 4D4KA 1KIFA 2QVYX 2WJYA 3INGA 3IB6A 3IS3A 1MTZA 4PAQA 2PO5A 4ER6A 1APBA 4K6KA 3GHYA 3M1IA 3RVLA 1WAMA 1AB6A 3VSDA 5AI9A 3O1HB 3ETDA 2IY7A 2XMGA 3KJGA 4WZAA 5BSWA 3DT6A 3VH1A 1FTSA 5JS7A 3U4HA 2JCSA 1SN7A 4JXKA 1W34A 4IDAA 1SUCA 4GE3A 2O3SA 3ZGXA 1NQ5A 1PRYA 1VI2A 4UHCA 1QG4A 4LZAA 1N8KA 2CE7A 3HWSA 4DL9A 3EEBA 4IQFA 2AD5A 2FFBA 1P7PA 2ZYGA 3UUFA 2V7VA 5DX0A 1PJ3A 3J80A 1OZGA 1RQXA 2P69A 3B5JA 1LNSA 2EX0A 2O8NA 3AERB 3ER8A 4C87A 1ZUHA 2Y93A 2RBEA 3NAGA 4LYYA 4ZAGA 1MX1A 3THYB 2JAXA 3R0QA 1EVYA 4EVSA 3P0FA 3G2QA 2ZR9A 4X8LA 4B3RB 3PCRB 1CK4A 4KR2A 5D1NA 2ODAA 5EJGA 2CXPA 1RM3A 4I1PA 1BXRB 3GRKA 1OVGA 1U8ZA 3PQCA 3I6IA 5HOQA 1S2GA 4QASA 4BOYA 3VHXB 4GZ5A 3ANXA 3WDLA 3GY0A 1FYDA 1TZ2A 4EZBA 3SI7A 2ZQYA 1MU0A 1L5GB 4RIFA 3TQFA 3KU4A 4P98A 1NGSA 3W77A 4ZMBA 4GZLA 4BY9E 5DYGA 3SFTA 3WRYC 1U2GA 3D3QA 2YN0A 1Z7GA 5FAKA 1QTQA 4L9WA 4QD3A 1DLIA 4QUDA 3ZDQA 2XCRB 4HKTA 3ZDCA 3D8RA 3IXMA 3T5PA 2J5RA 1K4MA 2Z56A 4F2WA 1K5GA 1AZWA 1KTVA 4MEBA 2H11A 1PWEA 2QM7A 3PF8A 4MO2A 2Q8NA 1W0CA 4MROA 1T1RA 1D0SA 2YH2A 1KYQA 3ANLA 5J9FA 1Q7TA 1L4LA 4JYBA 2OFPA 3HCNA 1Q7GA 3EXG1 4DHWA 4LSZA 1QYWA 1UAYA 4FYMA 1AN0A 2ADOA 4M1WA 4XWOA 4ZVLA 1HLPA 2F8LA 4KAFA 4XYMA 4YMLA 2P2SA 1PJAA 3NHJA 1W2GA 1AHIA 3T4PA 1EK1A 4RLQA 2O2HA 1V11B 2VT3A 3M7IA 1VJTA 3M5CA 1IEWA 3OP1A 1KSJA 4QT0A 721PA 2A9VA 1J0AA 4AKSA 1WPRA 3BD7A 1K8QA 5CT9A 4PS0A 1EESA 1PZMA 4RTOA 2JFWA 2FHSA 3SK0A 2J6IA 1E63A 1VI5A 4LXTA 2PT9A 3O1IC 1P2TA 2IYYA 3TFWA 3RLFA 1G8PA 1DNPA 5DYWA 5BWBA 4C7XA 1LVGA 2DX7A 3AF3A 1RU3A 3OJEA 1LLCA 4RY2A 5A5VA 4YGYA 4EL5A 1ZVMA 3LLMA 1GQYA 5T3UA 1WW2A 3MCUA 5C7YA 3X1MA 2ZRJA 1JP7A 1E4EB 2JW5A 4RYLA 1W5SA 1X9GA 4FFRA 3KR1A 2A0WA 4NFHA 5D5HA 4ANFA 2R97A 5J5AA 1P72A 5KTNA 1Q5PA 2XNKA 2Q4OA 4HPWA 4XDHA 1ZWLA 3K09A 3KJXA 5I4BA 4KCGA 2PLAA 2Y0EA 4MI1A 4G63A 1K5HA 2CL6X 5TMPA 4CDNA 1L9XA 3TI7A 1PS9A 1EFCA 2FXVA 4FS8A 4CEHA 1H2AS 3TECE 1RXIA 2QG9A 1I14A 1K5PA 2ARKA 2AFIE 2QV7A 2VJDA 3I04M 4KV7A 4R8KA 4RF3A 4DQVA 1OH8A 1EWVA 2XKKA 3PNLA 4B80A 4MA0A 4LKOA 3ILYA 4FGJA 4O2BA 5LB4A 4DUYB 1IOWA 5C1OA 3TXAA 3SN6A 4XCXA 5FWAA 1I3CA 3FTDA 4XUGB 1FVXA 2PZMA 4JVNA 5L4NA 1NASA 1Q7CA 1N2IA 4XM1A 3CNQS 1QP4A 4L8LA 1BMDA 3EARA 2X1LA 3S2IA 2FRXA 1NLUA 5EHNA 5AVTA 2Q5QA 2CUZA 3D6TB 2IYRA 3C5EA 1H5NA 4OSOA 2CF5A 4BAGA 1R9MA 5A9RA 3DBIA 3RUDA 2WTBA 3T61A 3N5CA 2VDJA 2V7EA 2IU6A 3ZVLA 3L8EA 4QU8A 1SXJA 4LF9B 2XGGA 2C29D 2PD6A 5AIBA 1DOAA 1J90A 1EZ1A 1VP9A 2W2OA 3CB2A 3OZVA 4J7CA 3U60B 1QH8A 1XAIA 4EK9A 2REOA 4BAZA 3L7OA 1R0YA 2F3TA 3JQAD 3STXA 5K01A 1JG4A 3QVSA 5DW0A 2W2KA 3K9NA 3MCVA 3PRKE 3ZGOA 1NUAA 4Y8VA 1BDIA 3RIEA 2BP7B 5LVAA 3OJFA 1ZXBA 4XOUA 2EG5A 2RC5A 2GN4A 3HCFA 4Y6QA 1G38A 2A67A 2R66A 1U0SY 2X58A 4FZ5A 2Y2UA 5DHAA 4AJKA 3ESBA 4YMHA 1QKIA 1QS0A 1E89A 1EEXB 5ALDA 4MR9B 2VZ8A 2OXTA 1T8YA 4KJZA 4TSKA 5B58T 2H08A 3LC1O 3UKDA 4KQ6A 4Q48A 4ME6A 3ZI4A 1Z2NX 5E1MA 1EFRA 1XTKA 5DM60 2G70A 4MW0A 3W78A 4BVEA 3NOXA 4MUGA 2MCFA 1ZISA 5F9MA 3QP9A 2KQUA 4XFKA 4O5OA 1JIXA 5JVDF 3IPCA 4I1YA 3TW6A 2JFYA 3ESZA 5A3JA 5IANA 3DQZA 4R1UA 3QLTA 4EHAA 4W6ZA 5K0JA 1PJQA 4FYIA 3TG2A 1U63A 3L79A 1P9OA 4UXHA 3SIWA 5FOSA 3O4RA 1HE5A 4DDTA 2H4JA 2OUIA 2VYCA 5MHTA 3M6LA 4RXUA 4Q05A 2ZSEA 4MP8A 4P7KA 5A4KA 4HGPA 1HYGA 2ECPA 3G88A 1JFTA 2IVFA 3RRJA 3VDQA 2PJUA 1Z0KA 1ZJJA 1SUIA 1XF9A 2P41A 2R8BA 2GXQA 3MNFA 4XX1A 3CBQA 3ZHBA 1Z83A 2AVDA 1UMBB 2HIMA 4DYDA 2VQFB 1Z29A 1PR0A 1A88A 4CI9A 4MAMA 2F1JA 2HCRA 3ABOB 3OOSA 3REFA 2XD4A 5JS8A 1EK0A 5EP1A 2GAOA 2ZXUA 4LVUA 4UNQA 2IYQA 5IKEA 2R8EA 1UJ4A 1SCKA 2BGJA 2CF6A 3IT3A 1YCGA 4ZHSA 4Q15A 3EDMA 3LTNC 3I58A 4GOJA 4P93A 2BT4A 2JIBA 2YWXA 2H18A 3BORA 1A9YA 1H9BA 1YS6A 1VA4A 1Z6TA 3N05A 5BQFA 1BD3A 2ENWA 5CMLA 1XO1A 2BPOA 2Q9UA 5EXDA 4R6XA 2WWWA 5G4KA 4UOZA 4RIEA 1XC7A 3RAGA 4KVFA 5BNWA 1R3DA 3KZOA 2R8OA 4HEJA 3PD1A 3M4XA 3P0HA 2XQGA 4YUAA 5A1JA 2DBRA 4CLHA 1XDDA 4U7GA 1ZI9A 4QEKA 5HJEA 3RFFA 4QIHA 4KOAA 1C4KA 1WKBA 4TYQA 1W59A 2NU6B 1L1RA 4AG3A 2VUUA 1KQ3A 4TKMA 3OE5A 3ZDZB 2PXAA 4PCUA 1PVOA 4FBLA 4HDKB 1H6CA 1KI6B 2OBFA 5ALRA 5ALWA 3T1YB 5CLJA 3RADC 1YJBA 2LD4A 1CZOA 2YS7A 5LCXA 3KJEA 1SQFA 2O59A 1BVHA 4DNXA 1YCFA 2I62A 2Z6VA 1SHKA 3CBGA 4BMZA 2YWCA 5K7SA 5L53A 1BN6A 1R6AA 5EIBD 1HTBA 4J1QA 1UK9A 1IHOA 2R44A 3C6YA 1P0QA 1U8TA 3NWPA 3O4GA 5DLDA 2FJ0A 1TMGE 3W79A 1KNXA 2HEGA 1U7DA 1XKQA 4MMYB 4I50B 3DWGA 5AR1A 4OQEA 4C76A 3MTGA 4ZTUB 4HDRB 3BGIA 1M2FA 4DDKA 2VI5A 3B1ZA 1Q1NA 2Q3BA 2BLLA 4EMSA 4W5JA 2ZIXA 2QGZA 3B6JA 2HDOA 4MKZA 4V02A 2FGKA 3WZ2A 4DE5A 4EYOA 1VG9B 1J2EA 2JKZA 3KEMA 5CK4A 9ABPA 3BM5A 3EQ2A 5KTKA 2PPLA 4Z8XA 1BJTA 2CVHA 2WIDA 3CNHA 4DLSA 2R8XA 2FP3A 1B4DA 1UZLA 2AX3A 1AVTA 1ZD3A 2YVUA 3L4JA 3TR6A 1Y3CE 2E4VA 3FPLA 4I1IA 4LF6B 2J85A 2VRCA 1UMCA 2JJQA 1OILA 1XLTA 3AEZA 1L4KA 3LBFA 3H8WA 4RKEA 3WIVA 3SEZA 4TTAA 1HTTA 2Q4RA 3T5TA 5BW4A 2ZRLA 3D3WA 4F06A 3H7IA 1MNQA 1W4ZA 4XLZA 4MWTA 2H1WA 3IPXA 4NE2A 2I9PA 4QUGA 3A1NA 1IRIA 3VUEA 2VA9A 3WLJA 4AQ7A 1E1NA 2W2MA 1B16A 3BQNB 3IOYA 4Q1BA 3HCEA 2EZTA 1CUWA 2EG9A 3N8GA 2XHEA 1VRCA 4RDXA 5BUQA 2VSNA 2LVBA 3T12A 5JJKA 3GVCA 3AG5A 4GRIA 1T1EA 2W98A 5EVCA 5FFMA 1DC8A 3A6PC 3AB3A 7ABPA 2WOOA 3BDAA 3ZWWA 5EFZA 3HWWA 4U8GA 1GV0A 1TM5E 4Y2VA 3RVMA 1TCVA 1CQWA 1NDQA 1XZCA 2A6PA 2XYPA 3VX4A 4ENTA 4ARVA 2YFYA 3FF4A 3IMEA 4RCYA 4P33A 5JI3E 1SOWA 1TL7C 2JDID 1V71A 4PQRA 3LO8A 4MVXA 1N2CE 1E2UA 1UCFA 4HGNA 5DNVA 2J9GA 4CG1A 3N2KB 1O6ZA 2XZPA 3R6GA 1MJFA 2IYXA 3FSGA 3GRFA 5AI0A 4ZO9A 3VHXA 5B58C 1D5CA 4S04A 2OXRA 3KPVA 3REQB 4Q4AB 4OGKA 2PT5A 1OH7A 4BB5A 1Q16A 3NLLA 1XRRA 3KYJB 2PKEA 1EUZA 1L1QA 1UPXA 5CR9A 1YOVA 3SAJA 3U7QB 3WBKA 4R5HA 2F43A 1N3IA 3UJAA 1ORDA 3THYA 3CZ5A 1ZSYA 2Q5HA 3JZIA 1XUOA 2QRUA 1QAQA 3CG0A 3H2HA 1T1IA 3V4RA 4DFDA 3ZUPA 2NU9A 3FNGA 4UD2A 1DELA 5CNJA 2ZI3A 1J25A 4KDCA 4JC5A 1PT6A 1NHGA 1Y8RA 2HJWA 4DLTA 1ZNZA 3FOCA 4MR7B 2IWRA 3ZXUB 4C7KA 3RIXA 4DCVA 3B12A 1VB3A 3T8YA 5B7PA 1USUA 3PG5A 4PQYA 2IRWA 4TL8A 2Z6UA 3I4FA 3RTDA 3A27A 2ISSD 1U5CA 1EIWA 3EWIA 2J08A 4B9EA 1N7HA 3A4NA 4N3NA 4MVJF 3AF4A 1HYHA 6LDHA 1L7AA 1YZ3A 3H6KA 1DJMA 1KO8A 3D3JA 2WFLA 3V8PA 2F9MA 4Y9RA 4GBED 2Q07A 4Q00A 3L40A 1YOBA 2AMFA 2HKIA 2OBXA 2Z2JA 3S28A 4EPVA 5JZOA 2XVAA 4XRGA 1JBQA 1NT2A 3JAKA 1TW2A 3QUBA 4V1CB 2DEUA 4R9SA 1SGWA 3CVVA 3FI0A 1AOXA 1Z06A 4GBGA 4F4FA 4GD3Q 2AV6A 2WM9B 3PTLA 3V4SA 3DMRA 1CJSA 3H3FA 4OLFA 3SEAA 4TRRA 5DB4A 2PUCA 5C8DA 1L5YA 1YJXA 2YICA 5DEIA 4GPEA 4FB4A 4FDUA 4I5EA 4WD3A 4BX8A 1DXHA 1SU6A 3UN1A 1QVZA 4F91B 5ENZA 4F93B 3W2GA 2Y3IA 4TTSA 4WEOA 4YCMA 5ALXA 4BQOA 3BCRA 3BJRA 3FXAA 2GPYA 2XOKD 2QMEA 1MB9A 3DG9A 2OBNA 3LL4A 4I4TB 2XRMA 4M3NA 3VC3A 2XXBA 3JQ7B 1FFGA 2IHZA 3NHBA 5BRNA 2XZLA 4B44A 1P7VA 4BGEA 1FPMA 5DI3A 3ZCPA 2VAVA 2OV4A 4V24A 4Z4FA 5ELXA 1Q3KA 4E5VA 5D2CA 4S1TA 1C1DA 5FTJA 1BRTA 3EZ6A 5FUVA 3I4LA 4C7OB 1JFFB 1ND5A 2CNDA 3IBSA 3KRTA 5L4LA 2C2HA 2WKQA 2HT6A 3LYUA 4TLDA 3PC6A 3H5LA 2I1QA 2DGDA 5JAUA 2NZ8A 2HMUA 1XMXA 2WPNA 3KR0A 5C8XA 4FJ1A 5CLLA 3I2FA 2PD3A 3CJQA 5KAMA 3SF8A 2AT1A 2R47A 4UCXA 1BYIA 3U62A 3WLSA 3IAEA 4NMHA 4YRDA 5TV2A 4G4GA 1MB3A 4O4LB 3TRDA 3P20A 1ORHA 2BEWB 3D7NA 3CWCA 1E7QA 1ODSA 2ETVA 3CXUA 1J7JA 1GJRA 3FUXA 2NAPA 4JB2A 2J5XA 3A3NA 3OPQA 4B83A 4YJFB 3IOBA 3GLFB 4I8IA 4QYMA 1NR5A 1WXIA 5J4HA 1FDIA 5BN5B 4UC0A 1M1YA 1E79D 1M1YB 2BFAA 3G5UA 1J0CA 2DCUA 3EYWA 3GZ4A 4LHYA 2ZRGA 1Z73A 1R6XA 4OA5A 2RB5A 3DS8A 4PNPA 5GOZA 5K8VA 1YIOA 1E4VA 1T6BY 1DRVA 1XNGA 3KEOA 2H2GA 1Z39A 4J4HA 4QQKA 4D57A 2H1RA 2FSUA 5DM0A 4F9GA 1DEKA 3OEHA 1S1MA 1WU8A 1JKIA 1WNFA 4GMFA 2XWSA 5HKOA 1NYTA 3WRXA 2JGRA 2CVPA 1LI5A 3TCXB 5C31A 1NVMB 5FL3A 2VTVA 5F2OA 3K5WA 3SX0A 4D43A 3QKSA 1N57A 3F5MA 3LOPA 3STUA 5E6SA 3WJ2A 1KDPA 3VPHA 2G82A 3T0IA 4FC6A 2OO5A 4OJNA 3TQOA 4LV5B 4E21A 1RMYA 4BQIA 2WA2A 3SEQA 3AR2A 4D4GA 1WSBA 1XJWA 5AVVA 2A5JA 1P7CA 4Q9NA 5FBHA 1HDGO 4X20B 3WFZA 3MRTA 4Y0AA 3K09C 5THXA 3JATB 1R0WA 3LUFA 3LX8A 1EDDA 2ZYDA 4DRYA 5EWJA 5IJXA 1FUIA 4NK4A 2QZPA 2FPMA 3HSKA 2EIXA 4WOPA 5H3LA 1PL0A 4CQLA 4EI9A 3L7KA 2GCIA 4Z3DA 3BWYA 1FSZA 1BAPA 1VLMA 4ISCA 4X93A 5AKLA 3I30X 1W96A 4B7UA 2HRQA 1CUSA 2EZUA 1WDTA 4FGKA 2NUPB 2XLCA 1F0PA 3VYUB 1EGMB 2ZUFA 2C7RA 5JPDA 1U98A 3SM9A 3ID6C 1AQ6A 1W94A 3E9NA 1KC1A 2REQB 1R15A 3OZIA 1CU1A 3AUJB 2BL4A 3P9XA 5CVJA 1LPAB 2IIQA 3U9LA 1E3IA 3PRYA 2REXB 2FSFA 2FWRA 2KI5A 1L1EA 3L1UA 3LT1A 3H2JA 4G09A 4CMIB 4NATA 2XB6A 3GARA 3L84A 4MUEA 3KXIA 4RH3A 2H0AA 1CR0A 1BA3A 3QM1A 4B0OA 3DE3X 3VKVA 1KRHA 2YJGA 4OBBA 4XX0B 8ADHA 4TWZA 4MQEB 5AVOA 4ZN6A 4KMMA 1TTTA 3C41J 3FFTA 1ZICA 5JWOA 2JASA 1FQJA 3LDHA 5G0VA 1ZM4A 1FOEB 3UJ9A 1NW9B 2C2MA 5JIBA 3EWAA 4BNWA 4YDQA 4RS4A 2VRWA 2GAJA 3EOAI 3GDWA 3LRXA 5BSEA 1LLUA 5CG1A 4E09A 1FQOA 3KWLA 2WUDA 1HMPA 4L4ZA 1Y8RB 3CU5A 4MV4A 5GM1A 3HJAA 2PSFA 3MJSA 5EOVA 4BB9A 5BWOA 5LPNA 2QX9A 1HDYA 3K0SA 1ZI8A 2VXCA 3EMDA 3DGEC 4CQJA 4PY2A 2XA2A 4MR8B 4ZI7B 1NN1A 3AVTA 3K70B 3R7WA 4B2PA 3UWKA 4D0RA 4DMKA 5F23A 1B15A 4NONA 3TSOA 3HKEB 2HPZA 1DKNA 4P5DA 5F2EA 2VJNA 1QH1A 3OC6A 4JMLA 4UTRA 5I7HA 1EVEA 1HDEA 1JAIA 4FN5A 4ZVTA 1U0JA 2CN1A 5KQMA 3SHQA 4P80A 4F85A 4L15A 1DG3A 3FVRA 2PL1A 3GLGA 5I8WA 2Q6VA 3DC7A 4MPDA 1VHTA 3OD5A 5KSWB 2BEJA 1W8DA 1VL2A 2JANA 3KTFA 4P4TA 4U9IS 3WL5A 2DQ4A 2WM2A 3E7WA 4GVLA 1E1CA 1GITA 2DERA 1CQIA 1J99A 3GRAA 2V03A 4ZQHA 1GZVA 2N47A 4H1VA 1YR2A 2WIKA 4W9NC 2V1XA 3VRHA 1BU8A 3R6LA 5EIHA 1K8XB 2L0XA 1IFXA 3TSWA 4NYMQ 2W11A 5EZYA 2Q4EA 3UWMA 2AKYA 2K2WA 2P62A 3DE1X 3EA4A 3KKKA 2W22A 3QXHA 5CDGA 4S05A 1ODKA 1N32B 3GWGA 3GGPA 5HQ3B 3FVQA 1SA0B 4NZPA 1FL9A 2WT4A 2OCDA 2VAXA 3A06A 1TAGA 2PKXA 5LN1A 1E3MA 4RDCA 1K3TA 1TQ8A 1KFCB 3C4QA 4YCAA 4DIKA 1U7ZA 4ZTZB 1AQLA 3KQYA 1D4ZA 2Q4DA 4KFTA 4AJLA 5DOZA 2AXPA 2ZYVX 1E0AA 4C0BA 1A5AB 3QOXA 1T36A 3BK2A 4NDAA 3RSGA 1OX6A 5DNWA 5FI3A 1A8QA 1Y81A 3SJAA 2C7OA 2WYIA 2F48A 1VBNA 4M22A 4UM7A 2R60A 2K7FA 1CEQA 2GZ3A 5IFKA 2HTEA 5D5QA 3G82C 2V4ZA 1K97A 4PIPA 1JR3E 2JVIA 4J7AA 4KACA 3MC1A 4LY3A 4W5OA 5BUSA 1Z6AA 1CHDA 2QUIA 5TVGA 4RF4A 1VJDA 3STYA 3CUVA 2X6RA 2H63A 2YJ4A 1ZKDA 4BMDA 1HDIA 1ZH8A 2QV0A 1PDVA 2V5UA 2GYVA 1BH2A 2ZIXB 2BFBA 3DSRA 1CJVC 1Z4PX 3WISA 4KO4S 1ST2A 2AMLA 1FSSA 2B20A 1A5TA 3DE4X 1GU0A 3W4JA 2IEIA 3IKTA 1KIMA 1GG9A 1UDAA 3VNBA 1QGYA 4PZZA 5CB4A 5J58A 1O0CA 3MZ0A 1ORIA 1PJSA 1ZZGA 5HQJA 4X1KB 3RVNA 2X5JO 1JEAA 1RWMA 3FLAA 5KB3A 3V8QA 4XD2A 2IUSA 3T3EA 2P6RA 3GJYA 1I5EA 4MRAA 3VBCA 3ZBPA 3K72B 3K9FC 2B1RA 2AWOA 2B1GA 2BMDA 3W6ZA 3UMMA 3FMVA 2H1SA 3OQPA 5B2ZA 4MS3B 1E7YA 3QEOA 1KKLA 2VP6A 3DBLB 3DLPX 3EIQA 3EGXA 4FFMA 4J90A 3S27A 1AKNA 1BMTA 2G07A 1KI6A 3C3KA 5ALQA 5JJCA 4O2LA 4UNRA 4RWZA 1JLLA 1H2RS 1CG6A 4ZWNA 2EKDA 4BFUA 1NUHA 1KETA 3B38A 3QNUA 4Z53A 4UEWA 2WK1A 3R5FA 3VYWA 4KXQA 3ZK9A 4CR6A 3CZMA 5ABPA 2O8EA 3MELA 3CVJA 2G72A 2HA4A 3IV7A 4I1SA 3T7RA 4A5SA 4BO4A 3I72A 3AFMA 1YI1A 4YCJA 1JSLA 1Y33E 2J3EA 1X6VA 2QAJA 3KOXA 2W2PA 4J4BA 4S2EA 4B3CA 5REQB 1ISRA 4DCCA 3I92A 4KI0A 1I7QB 1I0ZA 2HSJA 3WXMA 1SXJC 1NVTA 4X90A 4J2TA 1XN4A 4CW7A 4D9BA 5ED4A 4I55B 4LRTB 1RWXA 4U39A 4RV9A 1KZ4A 1M5UA 1I3MA 2BI8A 2WJWA 3S1AB 1BSVA 3LGAA 3M0EA 3QXXA 3S2EA 2QTVB 2IODA 4MNTA 3GW8A 1HO3A 2M32A 4XGQA 1XTZA 1EXWA 1F51E 1N2OA 1MCZA 1ZRHA 2OP0A 4GQAA 4LOLA 5ILOA 3QW4B 3B13B 5CCDA 2JB9A 3DNMA 1U5BB 1T8RA 4XCQA 5C1PA 4NI5A 1EDEA 5ETJA 3B6MA 4LZNA 5G1PA 4BFYA 3PCXA 4QE3A 4CL8A 2J9YB 2VPIA 1EVQA 4HJXA 4KX5A 1C41A 2JK0A 5F1KA 1M6VA 3ILXA 4OQ4A 4EHBA 1X2BA 1TJNA 2DY1A 3U61B 4H6WA 2OORC 3A28A 2GR9A 1NKVA 3D3KA 1YHYA 2V5AA 5KYWA 3H87A 1FY2A 5K3EA 2ZZNA 1KKUA 4RA9A 4BO2A 4P7FA 3E1GA 3E61A 3ZK7A 3U3RA 2QVCA 4I66A 4E1VA 1EFVB 2X1VA 4JLJA 3VYTB 4DEXA 3NTRA 4EKGA 2OCKA 2BD0A 3ST7A 4PSKA 1Q0PA 3SHTA 2DKFA 2P77A 4XWGA 2EWMA 1OX4A 3JQQA 1I36A 1PO7A 4JBYA 1K63A 1ZN9A 2O6HA 4LDPA 4R0VA 3W04A 4BNDB 3V8NA 1Q15A 3AIIA 1I2AA 13PKA 2P9TA 1U2EA 1UBRS 1KO7A 2I3DA 3AKEA 4NYIR 5ALEA 1LZKA 4JVMA 4AWAA 1MJHA 3VZPA 1X39A 3GJ5A 2WIAA 1M6EX 2E6UX 1H65A 1QFZA 1SXJE 2PKCA 4JZYA 4WUVA 2F1OA 1O58A 3A7EA 3HRHA 4FD2A 3T7EA 2OGUA 4CFYA 1XVUA 1IRXA 4MLCA 3GQBB 5C0OE 2G6BA 5KSZA 3NETA 2L42A 3WSTA 4FSXA 4JX9A 4GNKA 4MDHA 4OV6B 4EUNA 4QYIB 4WVFA 5I4KA 3Q0IA 3AUAA 2W2KB 4OREX 1D9XA 1EHYA 5EKTA 4ZK2A 3SVTA 4AN0A 4GKVA 2XCSB 2WNSA 2ZJ8A 2WY2D 3W5UA 4CM9A 5I7FA 3E8XA 4FGLA 4HXFB 1NQVA 1XA0A 3GA0A 4X9XA 5LD2C 5KDDA 4FUTA 4G1MB 2JGFA 4JBWA 2V1UA 3NALA 1IWBB 1UBMS 2OC4A 2CMFA 2O8VA 5EKXA 4CUJA 1O0SA 2AXEA 2B7CA 2VF8A 3CONA 3RHZA 2UXCB 2VVTA 3VVCA 3MQFA 3VKGA 2RHGB 1KAQA 2AG0A 5AK3A 4NPCA 1OFIA 3TJMA 3C1TA 1YI8A 2JZOA 3IE0A 5MFPA 2AFIA 3BWVA 4LOIA 2XB9A 4IXWA 5DXAA 3RSLA 1DGQA 3D6UA 1J00A 1X1QA 3BIJA 2GK3A 4LCJA 1WCIA 1VM6A 5F33A 2EJTA 4ZV4A 3LPLA 5JS6A 1GGVA 5ALTA 3WBFA 2ZJ6A 1KH1A 3BSFA 3T3NA 3EPRA 1UEIA 3Q7IA 2K4MA 1X2EA 3ZQ4A 2Q3CA 3Q7QA 1WS6A 1ZGHA 3P9NA 4PZPA 1RRVA 4JEUA 2C4MA 2HIHA 2LXNA 5B6PA 3PGXA 1Z6YA 3A3OA 4F6CA 2X0KA 3OOHA 4MJ7A 2Q0HA 1UP7A 1JIIA 4I3GA 4B6GA 3N5KA 4NDNE 4N5LA 3WGKA 4CMKA 5L3SB 2ZZKA 4I9UA 1IPEA 3M5PA 2PANA 4F2HA 2BI4A 5AW5A 3I6QA 1TU3A 3QVKA 2JD2A 2GN8A 4CV0A 1JYSA 3GRRA 3TW4A 3K92A 2FCRA 1L4FA 1OVMA 2PEZA 2W2LA 4OQQA 4WXMA 3PF9A 2QZZA 5IVDA 1BKSB 2BKVA 2XWPA 3R0ZA 2C59A 2JCXA 1FFXB 3DFFA 3L46A 3L8FA 2HSWA 4Y6PA 3AFOA 3R3JA 4QU0A 2Z57A 2IPMA 1GKYA 3ADKA 1UC5B 4L51A 4LVNA 3T99A 3JWHA 4XWYA 1GPUA 4LQ4A 3NZEA 1ZZEA 4G01B 3TD9A 1Z07A 2G3YA 4WQMA 5IBCA 2GM4A 1FU4A 3BE5A 5I48A 5L3QA 4WKPA 4OIMA 2X2OA 1QR2A 1KEZA 5I9SA 1J2RA 4MQ5A 4AKEA 5FULA 3PUXA 2EAUA 4LFAB 3QPAA 5KMGA 4P7GA 1YZLA 2F1RA 1ZBDA 3PT9A 2J3HA 1H2WA 3IURA 3MJEA 4TPKA 4WK6A 1SPXA 4QBIA 3UXMA 3WADA 3P2YA 3R4VA 1QFJA 1YNSA 2J48A 5AVWA 1AO0A 2X9LA 3L7LA 3MTIA 5DLQC 3S29A 3FX2A 4KBYA 2A9RA 4X3CA 4QDTA 2FZVA 1DBQA 1XMQB 3G2JA 5JNSA 3DTVB 1HEIA 1VTKA 3PR2B 4GOXA 1MDFA 4PEVA 5DM2A 1VGVA 1VG8A 2FPLA 2ZTUA 3BFJA 4ID3A 4M54A 4WHMA 4WGFA 1J33A 3R3UA 3LCMA 3QH4A 3P9PA 2YOFA 2WM8A 4I5IA 4MJ3A 2D1FA 4O2BF 5CTAA 2G76A 3TLAA 1PUXA 3UO8B 4DDWA 2IY8A 3FCCA 4FQ8A 4RLFA 3VNRA 1Z47A 1NVBA 2Q5FA 4KQCA 3ZDDA 1HURA 1CJMA 1RPNA 1EFDN 2JL1A 3FGZA 4UUOA 4MZDA 4CMCA 3W2TA 2A7XA 1B3BA 3C8ZA 2CLHB 2W71A 1E1DA 2JFBA 3N2GA 2VZ0A 4EYSA 3NGLA 2VDVE 4QPNA 3KYCA 4Z0PA 2DU8A 4DUPA 4RVDA 3E8SA 4RX1A 2ZAIA 1L7EA 2VF4X 5F73A 3BSSA 3RHTA 2ACKA 4LK2A 1EUQA 3OETA 1FNCA 3DH0A 3K9QO 1I2CA 2PKQO 1Y4ZA 4KQXA 4F5YA 2CVZA 3MUNA 4WDQA 1I01A 3T7SA 3P7MA 3TLYA 4X84A 1E2IA 5TGZA 2NSHA 2AI2A 2O3QA 3GJXC 2X0DA 3TRIA 3VR4A 4BN5A 1QJ4A 4RMNA 1AK2A 2C58A 2QLFA 3MPUA 1KO1A 2COEA 2XCUA 3B2QA 2PVCA 2CVOA 2OHGA 4DYVA 3OKAA 1ZCZA 3AVQA 1DB3A 3MBIA 2O14A 3C45A 4FFOA 3QLJA 1XF1A 1RHKA 2PL3A 2I29A 4QAJA 1EUCB 2XDWA 4FCWA 2VN8A 4QEZA 3DKIA 3D6AA 5ADHA 2C4NA 3BE8A 5HBRA 3VV2A 4REQB 1LBQA 1OLXA 1ZFNA 1CB7A 5AUPB 4RTJA 4JR2A 3DVQX 4K9KA 2ZULA 4E51A 2CDBA 3W4IA 3V4FA 1OV4A 3OLVA 2HK7A 4X66B 4I9GA 1NDUA 2F6RA 2ZE7A 3JVIA 4IZ6A 2BE9A 2ZANA 3UOGA 4RQUA 4ENWA 4CUKA 2YWHA 4Z51A 1OFVA 1P0IA 4ENUA 5P21A 2Q3DA 2FU5C 1X1TA 3PXXA 4YH1A 2OHOA 5GONA 3VPBA 1RLUA 4HSGA 1X7XA 2VDMB 3PU6A 2QW0X 4GOLD 1R4MA 4GE0A 4IDNA 4OOFA 1P81A 1ZGCA 1UJNA 1G6Q1 2B2NA 4UCWA 4MIYA 3DLHA 2NQ2C 4RDIA 3AP2A 1TMKA 2ZJ0A 3E7PA 4CG3A 3HPQA 4QFCA 4AU1A 4YXWA 3EG9A 5BN4B 3W5VA 4KTVE 2AFHA 3U7EB 3IIJA 3I9MA 3PQ4A 4QVIA 3NM6B 2HOQA 3E70C 2J4FA 3P4YA 2ZPAA 4BATA 3T5AA 1FVHA 4PANA 1RI2A 3WKDA 4UQOA 1C3XA 4QOHA 4NOKA 4IIBA 1V16B 1CHNA 3AHDA 4Q4DA 4JDUA 3FTPA 3DFMA 2ZYAA 4RGVA 1EHIA 1ZOPA 3MMPA 4OGLA 2RCNA 4TTTS 1L7DA 2ORIA 1CQJA 4G5XA 3OAAD 3PR3A 4OQPA 4W9MC 1Q11A 3HNRA 5HZMA 2G6TA 5EY5B 3RU2A 5H81A 3UJ8A 1NLYA 3KFXA 4O4IF 1L5RA 4MQLA 5M04A 1SVKA 2JA2A 1JDJA 4NJEA 4OGGA 3WMXA 3C5WP 1OV6A 2OBMA 3L8MA 4R41A 2ZB4A 1YAHA 2OYCA 1H66A 1D04A 2OQRA 4ZYLA 3K1TA 1M66A 4EG7A 3C24A 5AHWA 3KIPA 1RRFA 3O4FA 2Z8XA 4A1FA 2JFQA 4IVQA 1S2OA 3MB8A 4QJ4A 3BE4A 1DAHA 2FPXA 1JLRA 2ZJFA 3OE7A 2QN1A 4WIAA 4ZANA 4D2IA 2OV1A 3MTAA 3RF6A 5AKEA 4XPZA 3K0CC 4EGCB 4KKXB 3TLEA 4AP5A 2AW3A 3C3JA 1RCTE 4ON9A 2DG2A 2F90A 3B1KA 5K20A 3BXZA 1S01A 3SJZA 1J22A 4OFZA 3RAFC 4BE7B 2QYTA 5IT9A 2ZBFA 5JYEA 4RZXA 3I6MA 4V3BA 1TOAA 3FRJA 5FV4A 3GPLA 1PGNA 3OQJA 5C4MA 1R9NA 1UEJA 3NT4A 5BSMA 1GADO 1UBOS 2R6HA 3GZTB 3MUOA 2HCBA 2H3EA 2QE7A 4RESA 1QGOA 3EZ9A 1N8NA 3ZCQA 4U2DA 1K88A 4IEFB 2Q49A 2C82A 5H68A 1GZ5A 1QLWA 1OIXA 2CD7A 1BO6A 3H3XA 3LO5A 3DE2X 3OT1B 2MOKA 3JU3A 2EFHB 2W6JD 3K35A 3K3PA 4MIKA 4Q82A 4TTPA 4DIOA 5CDHA 4MZXA 7MHTA 1PFKA 4LQDA 3HBLA 3O2NA 2XEXA 1TECE 5CNKA 3EMBA 4FS3A 1KMNA 4OMUA 2GA9A 3WKAA 3CLRD 3RVQA 1LD3A 4TQUS 3NFYA 3M4JA 3GRPA 4L8WB 2YYAA 2C3UA 5CVTA 4TV8A 3K0FA 4LBYA 1MQSA 2Q1UA 3H1TA 4GH5A 4QXRA 1TJ3A 3TD6A 3TXXA 3BGWA 1E2GA 1GKUB 3UFBA 3MYRA 3VFDA 1V1RB 3WI7A 1YB7A 4F6LA 2I78A 1Q19A 3WGIA 3BE6A 3OQNA 4GKKB 3NHAA 1IUNA 5AVJA 4BX0A 2BBSA 3K70D 1EK6A 5FJJA 3OEEA 4HUQB 1NFFA 4JBHA 1GUAA 1KQOA 2FW6A 3FCXA 3IMFA 4TQAA 3IAM6 4FWIB 2Z8YA 1NPYA 3UW3A 2A84A 1RZRA 3DT8A 3G89A 4KO1S 4Y6RA 4F4UA 4ESVA 3G2KA 3MOSA 4M0PA 1MJ5A 3I9JA 4U2CA 4CM5A 2J67A 1HY3A 3HU3A 1UBGA 2P65A 1HLDA 2J3MA 1VXRA 3H5OA 2OHVA 3QFSA 3U4AA 3W5CA 1RSZA 3AUFA 1VMDA 3EC2A 5TY0A 3SDBA 3VU0A 1RKVA 3LLVA 4YJHB 4CMEA 2P2LA 1JSXA 1N7IA 4JHLA 5DHUA 3T9EA 4K86A 2A92A 2QENA 4MWOA 3ZE1B 1HC7A 1ZNXA 1G8FA 5DHPA 5F9FA 3REGA 2BZGA 3R8XA 4BMVA 4E7PA 2ISQA 2VBFA 4O2AF 1IBSA 5A4JA 5DN6D 4TS1A 2DFVA 1ZOOA 4JQSA 1TM2A 5H9WA 5AO9A 5E7IA 1CYDA 4EHKA 3C8HA 1UBTS 5SY4A 5LR6A 1ILEA 4FX5A 4BWYA 1C8VB 4TUYA 3TLBA 5DGDA 2GN2A 4KXYA 2R1ZA 4ZAYA 3Q5GA 3JQAB 2PAAA 5LQUA 3FHJA 3DQQA 2BELA 4UCQA 2RSLA 2EW1A 1M83A 1ZA2A 4ARSA 2FMFA 2P9ZA 4LXUA 1D1TA 4XB1A 1PR6A 3COJA 1YJAA 1L5MA 2YWDA 5L8VA 1E7MA 2CC2A 4GAEA 4GPTA 4Z9YA 2C5LA 3SXUA 3V8BA 4MCAA 4EENA 5SICE 1Y37A 3W6UA 3FTCA 1OROA 2WWRA 1TK3A 1DIAA 1SQ5A 4MKFA 4P38A 3U0BA 3ZX4A 3OT4A 1GPWB 2ESRA 2XT0A 3FA2A 4GWKA 5IPFA 3W9SA 2CB0A 2OFXA 1NJ2A 3KZCA 3TO5A 5AJHA 1DRUA 1TTQB 2FLKA 5LLDA 2BFEA 1XNQB 1NNUA 5CK5A 3E1KA 3MRVA 4N5NA 1K8YB 4UTXA 1G9SA 5EJMA 5FUYA 4FB5A 2O8CB 1W4LA 2JGJA 2Z43A 2BFCB 3S70A 2PX3A 1ZSNA 3L0ZA 3ENNA 1II8A 5HBGA 1PGQA 3SHVA 1WRBA 1HZZA 1CUXA 3THOA 4AMUA 1FFYA 2FN4A 3G02A 2BMVA 2HBYA 1CUEA 1HNZB 3EGVA 3EVAA 4MRRA 5EINA 1JXAA 4PYOA 5CB6A 2CXHA 4EAAA 2GPJA 2I03A 2H92A 1T6ZA 3FGPA 1U0FA 2ATVA 3QMWA 4WERA 2XIJA 3HJTA 5M29A 3KQPA 3V2GA 3G9ZA 4C4PA 3ZHYA 2RIPA 1HDRA 2IEDA 3ANMA 2A8YA 4AL4A 2K5UA 4D3XA 1Y8QB 2GN0A 3PVCA 1T3LA 1U8CB 3KOUA 3HCPA 4IX1A 2WJGA 2YIMA 2WEKA 2H5EA 2I2CA 1QYIA 5BNIA 1KEVA 5U1PA 3HEBA 3ZU3A 2QSZA 3SQLA 3GR6A 4ARCA 1Q3HA 2R1VA 4UBNA 3PHIA 1YGYA 2A2ZA 2JI4A 2OUKA 1JXMA 4OFBA 1Z34A 2GHTA 1R16A 1ZCJA 4HEQA 3K0EA 2E5FA 1AKQA 2Y99A 5A5FA 5KTRA 3EFHA 4KR0A 3IDZA 5A0VA 3CF6R 3KTOA 2G04A 3DXFA 3S44A 4G4SO 4JS0A 2XCTB 1N25A 1C29B 2OB1A 4TWBA 1N9GA 2HLHA 2ZGVA 4RFSB 1NUSA 4RE6A 1ENOA 2V0CA 1H2FA 2Z95A 1TJ4A 1JEQB 2C94A 4G86A 3HP1A 5ECYA 1UBEA 3RDPA 5JO9A 1MO2A 5K6AC 4IH1A 4LJLA 4YT2A 1Z38A 1NQWA 2POCA 4EQ6A 4PHFA 4IDHA 3GLGE 1JSZA 3SGLA 1IOZA 1NVDA 1UK6A 2VHJA 2XOEA 2AXNA 1RPJA 2PRIA 3E27A 3QFTA 4QOGA 5EIEA 3VZDA 5FUXA 1MW8X 3DUWA 4FHZA 3TLKA 2QRMA 1S96A 3PRJA 3A58B 5CVEA 2H17A 5DT2A 3UXYA 3WIDA 1SUSA 1YJCA 2A9PA 2HZ7A 2ASEA 2W83A 1NNI1 1S7GA 2YWBA 5CM8B 3TGLA 1ATIA 4KGVA 1K7CA 1YRYE 4WXHA 2JCYA 4QL3A 1OB5A 4Z1MA 3UWOA 1P33A 4AIRA 1SKAA 4IJUA 3I2JA 1E7WA 1RCUA 4IS2A 4MW6A 3CLVA 1PP4A 1SD5A 2JFVA 1I5RA 1MO6A 3G7NA 3N76A 4G65A 2ZAGA 1NR7A 4YJ2B 3SHFA 4E6EA 1W73A 5CEFA 1QB8A 3CRW1 2FX2A 3OM0A 1YUNA 2AN9A 4OYHA 2NU7A 4FLMA 1G3QA 3N28A 2NZYA 1K8RA 1KU6A 3TLZA 1VFNA 4YCLA 3PEUA 2I2XB 2DJIA 5K3FA 3VYVA 3O8QA 4HN9A 3R4CA 2QL9A 4JLWA 5EKDA 1FZQA 3PX2A 2GN9A 1G5IA 3Q8KA 2QMOA 2O8FA 2CWWA 2GTIA 4FIDA 1H8EA 4FN4A 2YHAA 4RHCA 2I76A 3P52A 5E0KB 2GESA 4QGBA 3ZY6A 4B17A 4XJTA 5LKAA 4B82A 1QZZA 2YFKA 3F6SA 3L49A 3L6BA 2C2ZA 3RYHA 1V96A 2B2XA 2FFJA 3DA8A 4R9VA 3G6WA 5AKKA 1F6DA 4H0FA 2ZUWA 5L40A 2OSBA 2YX1A 1HGXA 4LRYA 3LT5A 1VPDA 5HF8A 3M34A 1PFGA 1I32A 5TEWA 1ZUWA 1DEAA 2HC9A 2RG1A 4B3SB 3D43A 1P9NA 1XV5A 2XNSA 4IXDA 3QVOA 1UPFA 4W9RA 3FTQA 5JG7A 2YNMD 2NUAA 3SZ3A 2RGNC 4FW9A 2P3LA 2EFEB 2BEVA 4BBAA 5KHOC 3CN9A 1PIWA 4GC5A 4O08A 4Q3AA 4B7CA 2SHKA 5LZ4A 3QNWA 4R9UC 4RETA 3OTQA 5IP5A 1GPAA 5LQAA 1RI5A 4QHSA 3A6ZA 4GPBA 1ZK1A 3OCXA 1H9CA 5EPEA 3EPPA 1GYQA 4NH4A 1ENPA 1T0BA 2NO6A 3OQMA 2JH8A 1E2QA 3PQDA 1TLTA 2IGTA 2WQZA 4DY4A 3IFSA 2DWCA 2M98A 5IN4A 1I3LA 3FNBA 3IALA 2GJ4A 3SE7A 2BRUA 4M1QA 4HVLA 1Y1PA 3AB8A 2CFCA 3I1YA 1VCIA 1Z35A 2P7IA 1QHFA 3IEUA 1D7AA 1E20A 3A6JA 3Q2OA 3QTTA 2H52A 3EIEA 4LJAA 5F76A 1Y6GA 2QM0A 1X14A 2IH4A 3HUFA 2QYHA 1G2QA 4RGYA 2H00A 5KYVA 2E5WA 3LHSA 2C77A 3KKEA 3COSA 3GD5A 1GQSA 1AKYA 2ZM5A 1U6JA 2QZ9A 3F3MA 5NULA 1Z6QA 2OLJA 5BNTA 3C6BA 3PGMA 4ARAA 4RK1A 2EKQA 3DKKA 3KVNA 2NXNA 2ZRCA 3GP5A 4MXDA 3K1AA 2V0GA 1Q44A 2DPLA 1NXOA 3MINA 3NHPA 3RYCB 2GBIA 3QLEA 2WJ6A 4YFYA 1NIPA 2VQ3A 2RARA 4HPJB 4RPKA 5FT9A 5HFAA 3TMYA 4CLDA 3C5CA 3PYXA 5KVCA 1X0XA 1XVLA 2EBUA 1KAOA 3ELDA 3FKSA 4GPD1 4CV1A 4F7DA 5C5CA 2E5LB 2VT6A 1OLOA 3IIMA 3KUKA 3MWEB 5IABA 3KUDA 1GM5A 1F12A 3RC1A 3B8EA 3FGOA 2CBXA 3CN7A 2XKBA 5FTWA 2Q8PA 3TNJA 2HL6A 1XU4A 3TRJA 3EDQA 1QU2A 2H31A 3WNBA 2ZBDA 4P3NA 3ZXSA 5KSOA 1JQLB 3EVCA 4R0NA 3KAPA 3MGAA 3OCZA 1U1GA 2AOTA 3T0GA 2QPTA 2H2WA 4ZAFA 4QOSA 3V1MA 1LCIA 1KY3A 3SLGA 3L02A 4EWLA 4IOLA 4DM7A 1XZNA 2AJDA 3GLSA 1E6CA 1TUBB 1Z5WA 1VZ3A 3E7XA 1TUGA 1KMHA 4B8YA 3IIIA 1WV1A 2HK6A 5A02A 3H16A 5F64A 4X5OA 3SD7A 1TEVA 5G1NA 2QORA 3KHUA 4JSRA 3K0CA 4TYYA 3EA5A 1KWGA 3PQ7A 1E1QA 1CS0B 3LTEA 4HZUA 2PRZA 3QPDA 3SYLA 3TW8B 5T7BA 3X44A 4BP3A 4IGIA 4Z8YA 4MWGA 3MJRA 4I4CA 5IYZA 3Q7SA 3LSTA 3QPWA 4I4TF 4ZPXA 4ECEA 3OBIA 4F21A 1MA0A 2AUNA 2HMYB 2JLCA 4ND7A 1CDOA 2ATEA 1P8AA 3IQXA 1GZHB 3EUFA 3QX8A 5BSHA 1UC8A 3I5UA 2CVFA 1O8BA 3HYCA 5JI2E 2WUFA 3HABA 5TE9A 1N5LA 1MXFA 4J75A 4JUAA 4O6VA 3HYLA 1Y1TA 4OMDA 4R8LA 3S55A 1RLIA 1M2WA 1PD1A 3NEJA 1T25A 4KFRA 2B6NA 4BQNA 1T3HA 4N6GA 3GGGA 4HMOA 5TMBA 1RLOA 4HH4A 4XDYA 5MGBA 2BGRA 2X0NA 1E1RD 3JWPA 4ZCMA 1UJBA 2Y1WA 4MEJA 4XQ0A 2GUGA 4EB6A 5C7IO 3C3WA 2EZ9A 3O0TA 1PV2A 4WFJA 1W0JA 4WZ6A 4UPVA 3ZVNA 3DZFA 1C1HA 3EC7A 4ALIA 2CUNA 1U3CA 4DAOA 1E9CA 1DTWB 3KSMA 4CDGA 3JVVA 1H2HA 2AL7A 2E18A 4JC0A 1I1HA 1PX0A 4D3ZA 2DR0A 2QPLA 4YRFA 3U81A 3PNOA 3WWYA 3WLFA 1V8BA 3BK1A 2V6GA 1UPCA 1IMOA 4ZRMA 3ZU5A 5CA0F 4C3OB 5T8KA 3GEHA 4ZOCA 4DLAA 4NJOA 4LSGA 1FJXA 3EY9A 1OE0A 2ET6A 1ZU4A 3DZGA 3G9XA 3LMKA 2NO5A 3NGXA 5BW5A 4ZYVA 3HXPA 2LPMA 3PPXA 4V0KA 4F71A 4IUYA 5CXQA 4CKCB 5KYTA 4QXOA 3ILHA 3FSEA 4I4LA 5L9AA 5HA5A 1KEPA 2VEOA 1YJQA 2BY4A 3HKDA 3UUEA 1DEXA 4HZGA 4XD7A 3EGOA 3FAZA 1EGAA 3K0AB 1UL1X 1BW9A 5IAAA 1EGHA 2Q27A 5KNDH 4NOLA 4ZT3A 4D4LA 1F9AA 1JJAA 2BAGA 2YV3A 4NF2A 1L7XA 1PLLA 2EHJA 3VDRA 3BTOA 4XIJA 3RFUA 3NBKA 3PVZA 5F2NA 2HRZA 4YRTA 2FTKE 3KYDA 1BJRE 4ITUA 4W5HA 1K2VN 4YAGA 2ZT7A 2B21A 3FBTA 4C1BA 3LFUA 2RH4A 1QK5A 4AROA 3FI9A 3DYBA 3QKUA 4EFMA 4LX0A 3IT0A 3ND5A 3QA3E 2PMKA 2G06A 2C2KA 4D9HA 4P82A 1RM5A 1J42A 4UZEA 4N82A 2AN3A 4AS2A 4OXNA 4R2IA 1A7UA 3IXLA 4Z3KA 5EJ9A 1XQ6A 1DG1G 1PG2A 3O84A 4QFMA 2HFJA 4EO7A 4ZV9A 2WIJA 1UUFA 2OXFA 1YRLA 3HB1A 4KN5A 4MRMA 5LMCA 4KHPB 4C5CA 2FCAA 1HNNA 2ZP1A 4GUAA 2GT1A 3ZWMA 3USZA 3AHFA 3GMIA 4J0EA 4XWAA 4H1UA 1A1SA 4Q4HB 3W2HA 3ML1A 3ERCA 3BT7A 4M4SA 4U0KA 1U9CA 3HBMA 3MJTA 1LRJA 3FPCA 5K0SA 3AETA 2C9BA 4PNHA 1VCNA 4WNYA 3SPXA 3ACCA 4BNNA 1CIVA 4IDBA 2P9BA 4TL6A 5ECWA 4DCJA 1AZSC 1D0VA 3ZBQA 4LC9A 5JALA 2I4TA 3A3YA 3LECA 3QBDA 1DUIA 4OCZA 2NSLA 4QSMA 1WWKA 1CBUA 4HP8A 1O96B 2O07A 1IMJA 1AKEA 1KYXA 1RKUA 1V9CA 1Z4NA 2A88A 2DECA 1TYDE 2IUTA 3A6KA 3SDZA 3CVWA 1SC4A 1X9IA 4GQIA 4QEDA 4AS1A 1G20A 1NVEA 1OSNA 4R1OA 1G42A 5KYUA 2O3JA 1ISHA 2SICE 4OB6A 1QP7A 1H3NA 2IYLD 4AD8A 4EJ2A 2IYVA 3AM4A 3JD3A 4D9EA 3UV6A 4YAWA 3SDSA 5FPHA 1MENA 2AQ8A 2O6LA 4AJ1A 5IJ0B 4AZSA 2G5PA 5LBTA 4R40A 5TR9A 2YIDA 4D6YA 1V9LA 1XNJA 4EUHA 3QIAA 4HNQA 2DUJA 1U28C 3LVQE 4RZ3A 4TLEA 2ZKIA 5HCUA 2LUOA 1LTKA 4D8YA 3KCQA 1K6MA 4DAEA 4PSUA 2CK3A 2V8BA 4U2KA 1X3SA 2Z1DA 3D7LA 4UD6A 4ACAA 4C4ZA 1J2UA 2ZS7A 3JARB 2DR3A 3B82A 4EFLA 1E18A 5EIWA 2G9VA 2A0KA 4WCFA 3UT6A 4EA7A 3OTOB 5AJTA 5LZ5A 2O7QA 1O77A 3I42A 4CNQA 1GN8A 3FMFA 1GGHA 1RI3A 4KHZA 4YJKA 4GXTA 4RF2A 3RG2A 5KU1A 3UMRA 4DB2A 4LZOA 2XX3A 4P8RA 4KH0A 5FWYB 1PGJA 5E9AA 2PH7A 2FK8A 4E13A 2E4XA 3GJ4A 1C30A 4DV5B 1X1CA 1C3OA 1PS8A 2RHBA 1RXWA 2GCGA 2KBFA 4CIYA 4DMUB 3ZBUA 2CLSA 2ERCA 1VKNA 3OF3A 4Q7KA 2QTNA 4US0R 3E84A 4PHGA 1QZUA 1JWBB 3TLGA 4AN1A 3EVFA 4ESHA 2JI9A 2W8BB 5AJZA 4MW7A 1TF2A 4F5ZA 5BXQC 1P7YA 1EVLA 5SV2A 4MMZB 2QTMA 4R2XA 1YTUA 2PFGA 2D06A 4CGZA 4V0RA 2GFQA 2NACA 2GKSA 4P3PA 3VR5H 1Z75A 3BD8A 5ALMA 4EATA 4XRRA 4PAMA 4Q9HA 2IOFA 4IPTA 3KYBA 2QNRA 1HBJA 3RV3A 3RT7A 1FTQA 3HB4X 3QSYA 1A2OA 1TUBA 4GM1A 2Q1SA 3RNLA 5K8CA 4IV0A 1TI7A 2VQSA 2RH9B 3UAWA 2Y1DA 3MTBA 4RCZA 3TTUA 3CJRA 5C8VA 1ZK4A 5DNAA 2P4QA 1QE5A 1IN7A 2BHNA 3QLVC 5JE8A 3UMCA 1CTQA 3RYIB 3LF1A 1Q57A 2YIJA 4KIJA 2WWYA 1F38A 1MFPA 3LSYA 5DBGA 2A57A 5DDIP 1FZTA 1EI9A 3M9WA 2WMNB 3JWIA 1ZMOA 4EAQA 5EHGA 4QNMA 2PGXA 2I99A 1U4NA 1XZGA 4R2JA 1J4AA 5HNKA 4EYEA 4TQ9A 4KSYA 1P77A 3R6WA 4ZOEA 3JALB 4JI5B 3H1AA 2QXYA 5DWDA 5H9VA 1EVKA 1P5HA 2VJPA 4LHWA 1E3EA 3NOQA 2NTVA 4LJ6A 5AKHA 2WU1A 2XGJA 1KMCA 4M76B 1JHQA 3R5XA 3X1ZA 4C3UA 3GO4A 3ROMA 4V0QA 1P18A 2PGNA 4DJEC 5K8TA 4PG6A 3PXDA 4A26A 4BBPA 5B64A 3I9KA 1VPWA 5IZCC 1XZ8A 3FUWA 4WCDA 4MCHA 5K0GA 4G5QA 2Q9CA 3RS0A 4BV3A 3P2EA 4G8CA 4IWYA 3ZZNA 2WIBA 4EOGA 1T9HA 2H2AA 2X22A 3B3QA 2QTTA 3HKBA 1PK9A 1MG0A 1QUEA 2OQIA 2ZJ1A 3NH6A 2HA3A 4QAQA 1V2HE 1Q14A 3O8OB 1IPFA 4AP6A 4QPDA 3OMWA 4L4RA 1G16A 4NE7A 4D25A 4TLBA 1VG1A 4IZHA 1MR3F 3DTNA 3GX1A 1CZHA 1R5BA 4ND5A 4OHKA 5CIWA 2I2BA 4DKXA 2WWXA 1H1TA 5CITA 5B3JC 1T0JB 2CUKA 5IBRA 4Z4GA 2Y8EA 3U9TA 4B6EA 1IXYA 1CNMA 2EGHA 4TXHA 2FWBA 4GFDA 4ZD6A 3PIRA 1Z5VA 3MT0A 4HS4A 2ZCUA 3T1OA 1YR8A 5DHQA 1Q1QA 5KIAA 4OH7A 1QX4A 2I4LA 2I7XA 1ZGGA 2FPPA 2JAQA 3KVYA 4OIFA 1EWYA 5B1IA 3BB4A 3WK7A 3NVKI 1Z0JA 2RIRA 3IJPA 1MABA 3L8CA 3BG5A 3OTGA 2ZR8A 3GEPA 4N0PA 1JX6A 4WY2A 1AQNA 4FI3C 2IIVA 5TMEA 1YMQA 1GL7A 5F4BA 4L8FA 2A5YB 4FOTA 4AP9A 2AUTA 4QGHA 3MHPA 3R41A 5FLKA 4LGCA 3JASB 2IHVA 2CJPA 3BL8A 1TIPA 4UDOA 1S2LA 2VT7A 3H11B 1J8YF 5HEKA 2CW5A 2I4OA 2JFGA 2MYNA 4EY8A 2R48A 2XI4A 3KEGA 3OZTA 1TKAA 3MEQA 3C8UA 1Q1ZA 2J07A 2EVWX 2JEZA 3L0PA 2UZ4A 2B0JA 4NCKA 3KOOA 2IITA 3OCCA 1Y1KE 4KDFA 2DPXA 4IMPA 2MDTA 4ZAXA 2GTPA 3RJZA 3U19A 1G64A 1Y82A 2YY7A 1PNTA 1UKYA 4A6EA 1SBCA 1E69A 5LLTA 1SCJA 2NTNA 5AJVB 3P5BA 1UIRA 4QBHA 1GSIA 3EZLA 1T4CB 3W5HA 4GECA 2BTQA 1SZPA 3BIXA 2VJLA 1W49A 2I87A 1EEHA 3AR3A 2GBCA 3HDJA 3R7BA 2BGGA 1BHO1 4K3UA 1RD4A 1E6LA 3JV7A 3VC2A 4G23A 2A4KA 2B98A 1HT2E 1OGIA 1ARZA 1SBHA 1SCNE 2BR4A 2WKWA 3W5BA 2UXDB 2H0QA 4A8JA 3C70A 4LJ7A 3GUHA 1IQUA 1L6IA 1WCWA 3BAZA 3P0RA 2P9QA 4W6QA 1YONA 4MKXA 1ACLA 1RFLA 4MS1B 3TZEA 1B8NA 1GAXA 3NT2A 1Q1GA 1RPAA 4HDMB 1IG3A 4JBNA 3H5WA 1S89A 3KFLA 4PZLA 4WZAE 1YH3A 3BMOB 3BD6A 3E22A 3EXHB 3BA1A 1FNBA 2GBGA 5EIBC 4RFVA 4Q9LA 3PXEA 4O2AB 1FRNA 3EWSA 1NW5A 4XYLA 4Z0NA 4CI0B 3EFOB 4W9NA 3CH7A 4DA9A 2PX8A 2BHSA 1E5VA 1AB5A 3P96A 4HRAA 4MGKR 2JJ2D 4EA8A 5C5DA 2IP4A 3BCSA 3R9WA 1G63A 3GMSA 3WYDA 4YT5A 4JI2B 1H2BA 5EQJB 2VBCA 1K3UB 2DVMA 4XEUA 1JGTA 3OEHD 1ZL2A 2JGAA 3LOQA 3UHFA 3WGNA 5BPHA 1PNRA 5AK0A 5C8YA 2O3UA 4MVJI 4YO7A 3K71B 3EPJA 2BW0A 1GEEA 4Y6SA 3BS4A 5FBLB 4I1VA 4B3JA 3RREA 1W1UA 4ZVKA 1M2KA 4R71A 3G2MA 4W8OA 2WP8J 3AEYA 1JDBC 3UPTA 2CNWA 2GBLA 2NPOA 2Q1TA 3AEUA 1ZC4A 3TBFA 1TYZA 2QTHA 2LW7A 1EX6A 2EF1A 5FQNA 2GB4A 4OU5A 3NTQA 1Q1EA 3AGPA 1XEWX 3PEWA 3HFGA 1KK0A 1WL8A 1X15A 3IDQA 4K40A 1D2HA 1V41E 1Z0DA 2FP4A 4G8BA 4CV2A 2JAUA 4S0ZA 2XH8A 5BRJA 4B3BA 4YQZA 1DIBA 2MSKA 2NXEA 3WXBA 4EHDA 3MWLA 5L7WA 4G0WA 3AU9A 1ZUNA 4UM9D 1XP5A 5IFLA 3B51X 1AGRA 1W9HA 2FW7A 1C3VA 4ND1A 5EXXA 3QUSA 1FFHA 1S8OA 2R7LA 2QUJA 3MWKA 3IXQA 3LWNA 1CEEA 1N2HA 3JTEA 3SZUA 1CUCA 5LMNB 3N7AA 4CFSA 2CXRA 3HA7A 4CKWA 4ZICA 1NMZA 3Q98A 2ZIUB 1RJ9A 2WF7A 1SUBA 3L6OO 4LJ4A 5A06A 4TROA 1EA7A 5MFZA 4JU9A 2W2NA 1H6DA 3I6BA 3DZJA 3F7TA 3WJAA 1P2SA 2QI9C 2WJAA 3VJKA 1ZYUA 4HDOB 3JCZA 5E7MA 3SYRA 1P9LA 3B89A 3IUSA 1NATA 5FD8A 2ZTMA 1QK4A 1NV8A 3N2YA 2NWQA 1LF5A 3SOPA 5H3HA 1XDBA 1DO8A 2XCIA 3DCIA 1LDBA 3NGMA 4IYJA 2R96A 1V45E 2NM0A 1U7TA 1Y1QA 5TLSA 221PA 4NG5A 4PYQA 1E3WA 2DFLA 5FOXA 3B20A 1ONSA 4CQMB 3DF9A 2Q1YA 5BY2A 4MYHA 2G28A 7REQA 2LIPA 1SUPA 1CY6A 2B37A 2PA0A 2PT6A 1QOPB 4I8XA 1JRLA 4EPXA 1BVRA 2R7MA 4YYZA 3ZGZA 1GY8A 3KR2A 4EMTA 1NP7A 3RBZA 4B3DA 4QWWA 4LC1A 1YUMA 2HWYA 2R6R1 1G20E 3GK3A 4QUKA 4U3JB 1TVEA 3QW2A 4X61A 5CA0A 3TPFA 4E22A 2GH1A 4EB0A 5JAOA 1QSGA 5JCOA 2E48A 3M4NA 2WVJA 1P4GA 3M89A 4QPJC 2IC5A 3TG8A 4WN9A 5L3VA 2XMBA 3C1AA 1QORA 1FXSA 3UIEA 10MHA 3CZPA 5K3SA 1PEAA 2FQXA 3UPUA 2FMTA 4P0QB 5JNVA 1XLWA 4HGRA 3CJTA 2NNLD 3DVAA 1QP0A 3T3GA 3W90A 3X2SA 2BH9A 4M9UA 1U2QA 4CLEA 4MLDA 3HKCA 2XUGA 5E0OA 4DR6B 1BDMA 1BIFA 4LE1A 4DMLA 1MKYA 1QHHB 3D02A 5THQA 5EUBA 1UKEA 4RCVA 1F2TA 2H9YA 3CSSA 3DBRB 5D3ZA 1UK7A 2EFYA 3OQIA 3ZY5A 5A5EA 2X9NA 4O4HF 1BXGB 3FCUB 4LGYA 1G4AE 1EFPA 2EV9A 4P9NA 5FPKA 3A26A 2GEVA 3OD1A 1JBEA 2B61A 2WHPA 621PA 3CINA 3A7DA 4PYRA 3WMRA 1H69A 1SUDA 1I4TD 1XBTA 5JANA 1OI4A 3LQ4A 4UEJA 2F9LA 1JDSA 4LSWA 2BI7A 1LI4A 5JT1A 4CLRB 2YMMA 1WABA 2WKRA 4O0LA 1GZ4A 4YCDA 4WL0A 5FL7A 1EG2A 1OWMA 2C97A 4FOLA 5FRDA 3CUKA 3QZUA 1ZIYA 4ZVQA 1Z2OX 1GYRA 4EFDA 4II3A 1V3TA 3T7JA 3L05A 3ZVKA 1CUZA 1LK0A 1P1BA 4ER5A 5K8LA 1NN3A 2CJFA 3HGTA 3W8RA 3X1DA 1E2LA 4R84A 3OIUA 4RY9A 4KREA 1RP1A 4A73A 1JB9A 2FPKA 5K2MA 5JWHA 1N2SA 2C5EA 3GLQA 3H04A 4BAUA 1B2RA 5A4IS 5G41A 4BMYA 1DKMA 1ZJYA 3ISVA 4KMSA 5BQ5A 4EPTA 2VHTA 2INGX 4IGAA 4KPFC 4ALMA 4HWRA 4B3TB 2ES4A 1L9KA 4LJ8A 2XUFA 3DDZX 4R05A 5LL6P 5CGZA 1KFBB 3AR9A 1TKCA 4S3MA 2D4AA 1KVTA 4HRXA 3ZZTA 5KX5B 2FW8A 5KS2A 1ZIPA 5IAJA 3OPNA 1ZEMA 3CR8A 3QX9A 4DC1A 1RJGA 1T10A 3K9HA 4MX8A 1P4RA 4CHGA