1VLQA

Crystal structure of acetyl xylan esterase (tm0077) from thermotoga maritima at 2.10 a resolution
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
322
structure length
322
Chain Sequence
AFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyl xylan esterase
publication title Functional and structural characterization of a thermostable acetyl esterase from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 122
structure length 322
sequence length 322
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vlqA00
3OPMA 4DNQA 5DYTA 2RONA 1QO7A 5AIBA 3AIKA 5KREA 1JFRA 2XB6A 3RARA 1PFQA 1QIMA 5JIBA 1MT3A 1W1IA 1GPLA 5HKAA 4E46A 2P8SA 1ZGBA 5FUMA 1Q84A 1VXRA 5EFZA 5K3EA 4F5ZA 1DT5A 3O0DA 4RGYA 4W1PA 1AUOA 2WJ6A 1DT3A 1FFEA 3E3AA 4UBMA 5KWJA 3BDVA 5ALZA 1TRHA 1C4XA 4MXDA 2WSLA 1UK6A 5ALQA 4EB0A 3IULA 1CUJA 3ED1A 2OGTA 1QFSA 1QO9A 5ALIA 2JGFA 3E0XA 4C6HA 5A62A 3WJ2A 1G5FA 2Y1KA 4LXIA 3ZLTA 4G8CA 4QWWA 3GFFA 4G4JA 3UUFA 2FJPA 1IVYA 3C70A 3IURA 3M82A 4PSCA 4L3WA 2ZJFA 5IKXA 3WKEA 4UBJA 4C4XA 1ZJ4A 2XUIA 5HCUA 4A16A 1CUBA 5AK3A 1DQZA 2Z3ZA 2ZYSA 1CUGA 5C8XA 1HQDA 1QIKA 4Q05A 4UHHA 4J3JA 1XQXA 1U4NA 5ALMA 1VA5A 1ZD3A 3DQZA 4FBMA 2C5GA 3VISA 1R9NA 4Q82A 1CRLA 1ZIXA 1YA8A 4TGLA 3IUMA 3V1MA 2WU3A 5AKHA 1SCKA 2AJLI 5EHQA 3WLAA 5AKXA 4BCBA 1WHSA 1P0MA 4KAFA 1N1MA 4U2FA 3ESCA 4P08A 3WJ1A 2CUTA 4HXGA 2X76A 5JASA 4X95A 3AZOA 1XFDA 1MAHA 3RK4A 3R3WA 4BDTA 4AZ0A 3WWCA 3I6MA 2PSEA 5ALOA 1GPNA 2CMFA 1XZIA 1H2WA 5EGNA 3WKBA 1QIHA 1O6FA 1MX1A 2OG1A 1ETHA 5HF5A 5AI5A 1N5RA 4JNCA 1LZLA 2QXUA 5AIAA 3M81A 2HA5A 4INZA 2PL5A 3O95A 1EDDA 3GZJA 4G1FA 3MGAA 2OQIA 2XUAA 5CBKA 1GQRA 2Q0XA 4UHEA 4Q1VA 4FBLA 2VJBA 4HXEB 1YSCA 4ZV7A 4Y9SA 1B6GA 3LS2A 5AOAA 2VA9A 5DNWA 3C87A 3WK8A 2BFNA 2WJ4A 2HHAA 3ICWA 2HRQA 4F60A 1FJ2A 4BE9A 1ACLA 4H7HA 3M3DA 2R8BA 2GYWA 4A5SA 4MYDA 4I4CA 4JUIA 4OB8A 4B9EA 4FKBA 4DIUA 3CCBA 3I2JA 1FFCA 4PO3X 4FMPA 1QIFA 1CEXA 4QLOA 3BIWA 1VOTA 3UMJA 3LIPA 3O4JA 5BV7A 1DX4A 3PUIA 2JEYA 2OCKA 4UFNA 2JGLA 4L0CA 2YH2A 2Z3WA 3ESBA 4A23A 2G4LA 2XUJA 4J0KA 5ALXA 2VAXA 3KXPA 1K63A 4Y2RA 2DHEA 1VJ5A 4G8DA 3FCXA 1VXOA 2WFZA 4OU4A 4H7JA 5ALHA 2XMCA 2OGZA 3A2MA 3Q0TA 4NMWA 3WL7A 3WK6A 2QKYA 1BEZA 4QDZA 1VA4A 2OCGA 1C7JA 2B9VA 3AINA 4E15A 1YB7A 2C4HA 4WY8A 4GBGA 4B84A 1F8UA 3W05A 5AK4A 2PM8A 5IVHA 5LP1A 1XLVA 1ZD2P 4WCVA 1T2NA 2HU7A 4B82A 4BB0A 3C8HA 1GPKA 3ZPXA 2XMBA 2HM7A 4KRYA 3K6KA 4NZZA 1CUEA 1XZGA 1Z68A 4Q3OA 3B3QA 5FLKA 4H18A 4HAIA 4ZV9A 2ACKA 4LYEA 5DNVA 2XMDA 5AI6A 5K3DA 3EQ8A 4CG3A 2WUGA 1RP1A 1YB6A 1XKLA 1QIIA 3H1BA 4AO6A 1EB9A 2VJAA 5EHZA 1IZ7A 3D2CA 4JYPA 4U2EA 2O2IA 2PUHA 2FX5A 1TAHA 2UZ0A 3H2JA 1QIJA 4B85A 1WPXA 4ZI5A 5J3JA 1AKNA 3PICA 2WKWA 4PSDA 5FDFA 5KBYA 2JBWA 1UZAA 4H7DA 4IQ4A 4EY5A 3DOHA 4J0GA 4EY7A 1BE0A 2PSDA 1XZCA 4DGQA 1JI3A 4BAGA 3NGMA 3H19A 4X94A 5EHNA 1UK9A 4OB6A 4FHZA 1VLQA 1CUVA 3G0GA 4EHBA 1ZICA 5JD4A 4WFKA 2PU7A 2BCEA 2CEKA 4G9GA 3DL4A 2XI4A 4HTAA 2DQZA 3UUEA 1NU6A 1VKHA 3FLBA 1E66A 1F6WA 2OQVA 3PI6A 3C6ZA 2WFMA 3B12A 2RHTA 1UFOA 1CUSA 3FYUA 2D0DA 4BRSA 3C6BA 5JATA 1I6WA 5A7HA 1E8NA 4WDQA 1GGVA 4RE5A 1EINA 3D5EA 2AJ8A 1LBTA 1BRTA 2JGMA 1QTRA 1CVLA 4W1RA 2VQ6A 3G0CA 2QZPA 4CCWA 5CH8A 5JZ9A 3SWWA 5LLSA 1MO2A 2HL6A 3VKFA 2G63A 3G9TA 4FLMA 2XQGA 2IX9A 2ZSHA 3Q8WA 1LBSA 1S8OA 5A2GA 3BDIA 3H2IA 2OAEA 1XLWA 3KOOA 1YR2A 4FWBA 5I9IA 4IO0A 1K5PA 5HFNA 5ALWA 5D7BA 4GI1A 4AMZA 1CUDA 1Y7IA 5CW2A 3QBJA 3FYTA 1F0NA 5JANA 2XUDA 4MJ3A 3L1JA 5DJ5A 3F98A 3AJAA 4GLBA 3D59A 5BWBA 5EIEA 3VVMA 4XWGA 3VDXA 4QDXA 5AKYA 5AKZA 4DMFA 1L7QA 3ZLUA 4X71A 1F0PA 4BP9A 5T4EA 4BYMA 2B4KA 1ZGCA 1H2XA 2OCLA 2V9ZA 2Y6VA 2J3QA 3O9MA 3WK5A 1LZKA 3JWEA 1ZIYA 3D0KA 1SOMA 5T4BA 3FBWA 4UPDA 4BVLA 3AIMA 3CXUA 2GBFA 4H7EA 4HVTA 2XMSA 2D5LA 2Z8ZA 4OYYA 3IUJA 5AKEA 3OC0A 2ZJ6A 3STWA 4EA6A 3KWFA 1XZLA 3OURA 3G9ZA 3GBSA 1R4ZA 1K4YA 4GW3A 5ALYA 4K5QA 3R3XA 4UUQA 1VZ2A 5AI9A 4LXGA 4DMHA 3RM3A 1QIDA 3HABA 1XRRA 2DSNA 4EY8A 5LZ4A 4DNOA 1AMNA 4AQDA 3BL8A 3C8DA 4W1SA 2QJWA 1CQZA 3WL5A 1PJAA 3I1IA 3BIXA 4BDSA 4ZXFA 2HADA 1EDEA 4GHWA 4X6XA 3QPDA 5HF6A 5YASA 5AM4A 2OAGA 1CFJA 2XE4A 3GELA 2DFPA 1TIBA 4RE6A 4QDOA 2W22A 3WK4A 1W76A 4AN1A 4P92A 3VJMA 1TKRA 1H22A 3STUA 1AX9A 4NVRA 4C4YA 1XLUA 4ZGBA 2GYUA 4FLEA 1D07A 1J2EA 4LHEA 3WIBA 2H9YA 2HU8A 1MNAA 5C7YA 4C88A 1HBJA 1WCYA 4KEAA 2PUJA 3MVEA 5DTIA 2WFLB 1VE7A 4B80A 1CV2A 5ALVA 4KAJA 3WZLA 2YASA 3DKRA 1LGYA 4Q3LA 2JEZA 3D7RA 2LIPA 1UOOA 4AO7A 4GEGA 3A2NA 2VJCA 3H17A 5AK5A 4UHCA 3FCYA 3DKKA 1ORWA 1JKMA 4H35A 1QTIA 1Q0RA 2OGSA 3L1IA 4IHAA 2ACEA 3HI4A 1UT6A 4U2CA 1Q83A 1SC9A 4I3FA 1R50A 2PVSA 2Z5GA 3FYUC 3WIOA 2OCIA 4GECA 5E4YA 4U2DA 2XLCA 4XIIA 5ALSA 2XMQA 2VT6A 1H2YA 1EH5A 1YS1X 3T4UA 1XRLA 4BTVA 1DU4A 4UHDA 4OCZA 2WM2A 1YCDA 4DSAA 3WI7A 4WFJA 2VF2A 4BTLA 4MQLA 3DCNA 4ROTA 5AM2A 3EQ9A 3G02A 1KU6A 3AZPA 1SCIA 3EBLA 5E2IA 3TEJA 3H04A 5BWCA 4X90A 1U65A 3BF8A 5T4FA 2G5TA 2PPLA 5HQ3B 1J07A 3WZMA 4MWSA 4DSZA 5AM5A 4DNPA 1GXSA 4UBIA 5JALA 4QZVA 3OG9A 3EQ7A 2PSFA 3WK9A 5DLPA 3BWXA 5K3AA 2RI6A 4Y2SA 3STXA 5HK8A 5ALDA 1A88A 1DTEA 1ZJ5A 2Y6UA 5AICA 2VTVA 4C87A 4BZWA 1AURA 2WU4A 5LZ5A 3H1AA 1HKHA 3LIIA 2OPHA 1AGYA 4G5XA 3IA2A 3V48A 4G8BA 3CCCA 3FNBA 1ORVA 4BVJA 3TRDA 1A8QA 1LPAB 3QYJA 4FTWA 2HA4A 3G9XA 3I1YA 1YAJA 2X5XA 4EUSA 4LKOA 4AX4A 5AKGA 2O7RA 1TCCA 5ALNA 1UK7A 1FFDA 3JW8A 4J0JA 2HU5A 1EDBA 3JYHA 4OYLA 2I78A 4N8DA 4K6HA 3ZLVA 2PKYX 2Y2VA 1XRMA 5K5EA 3MUNA 1ZD5A 2GZRA 2RIPA 4QNNA 1WB5A 3HC7A 1NX9A 2QUBA 5CT9A 1XRQA 5DYWA 4Y7DA 1BCSA 1GKKA 4Y2UA 4BCDA 2AJCA 5CT4A 2GBCA 3EIOA 3R3YA 4E14A 2XQKA 3R3UA 2BGNA 3PF8A 1ACJA 4BE4A 1EHYA 1Q0ZA 5EIHA 4EY4A 5DNUA 1QLWA 2H1IA 3TGLA 4PQEA 1JJBA 4S0XA 2XMZA 5AKLA 5CXXA 2HA2A 2XMRA 1JU4A 4Q3KA 4X00A 3QPCA 3I2FA 2IITA 2WG0A 1MTZA 1XQVA 4J0CA 1BEEA 4B0OA 2WUEA 2JGJA 4H77A 2QMQA 4EY6A 4N8SA 3E4DA 4X97A 4B6GA 5AM3A 4Q34A 3X3HA 3HZOA 1W75A 1X70A 4J7AA 1BU8A 4F0JA 1ZOIA 4UHFA 1THGA 2ZVDA 1W6RA 3HJUA 1AQLA 3QZUA 4EZIA 7YASA 1XRNA 2J4CA 3B5EA 3G8YA 5LYYA 3IIIA 1AZWA 4BBZA 2X8BA 4QLAA 3N0TA 4MEAA 3W9BA 1MX5A 3H2KA 3DNMA 3F9CA 1XQYA 2WG1A 4KE6A 2WLSA 3O9VA 2XQJA 2XUQA 2CBGA 4FNGA 3VVLA 5JAPA 3WYNA 3HSSA 5ALTA 2WILA 4I19A 4W1QA 1BS9A 3GUUA 3FSGA 3C6YA 3DLTA 3N2ZB 5T4HA 2HA6A 5JZSA 3DL7A 3I2HA 1QZ3A 3WWEA 3QM1A 5HF8A 5AKJA 2AJDA 1X2EA 1XZHA 3H18A 4MWTA 2WHPB 5ALFA 3WKAA 1Y7HA 1XZKA 2WJ3A 4EBBA 1SCQA 1GQSA 2XQIA 5AM1A 2QR5A 4BAZA 3O4IA 4PW0A 2BGRA 5HKBA 3A6ZA 3G7NA 2WUFA 5FKJA 4ARAA 4PF1A 5ALKA 1BCRA 5F4ZA 1QONA 1QIEA 1BN7A 5A7GA 4CG1A 1B41A 1UOQA 2ZJ7A 5ALRA 5LZ7A 2ORYA 4KJXA 3H0CA 2ONCA 1G42A 5IVKA 1Y37A 5ALPA 2DHDA 2WHPA 2XUKA 4BVKA 1HLGA 4OPMA 3STVA 2I3DA 2QUAA 2QXTA 3WYDA 1XZEA 1EXWA 1CLEA 4H0CA 1CUUA 1XZFA 4FNMA 5AKKA 5CT5A 2VSQA 4Y2XA 2QTBA 1E89A 1A8UA 2JGIA 5EIAA 2DHCA 3FLEA 3O4HA 3PFCA 1GT6A 5AH0A 2FUKA 3C43A 1MU0A 5AI8A 3U0VA 4KR0A 1P0PA 4CG2A 4LYDA 4UBLA 1IMJA 1XQWA 4G4IA 1WHTA 3IB3A 4M0EA 1EK1A 3E1GA 1WPRA 2GYVA 2WIDA 5ALUA 2XT0A 4TPKA 3G0DA 4DMCA 1K8QA 4W9RA 3S2ZA 2VJDA 2C5FA 3C5WP 5C8ZA 2QT9A 1N5MA 2WTNA 3QITA 2YYSA 4Y2YA 1E8MA 1FSSA 5AO9A 2ES4A 4KE8A 2QOEA 4X3CA 3QMWA 4BP8A 1CUAA 1EVQA 3NWOA 2DQYA 4DMKA 5I8PA 5JAHA 4YPVA 3FOBA 5LZ8A 1LPSA 4HRYA 1EX9A 4Y2JA 4DM7A 3I6ZA 4BATA 4Y2QA 1XKTA 5FPPA 3CN7A 3HXKA 4X85A 4H7IA 1YS2X 4QA9A 1H23A 1WB4A 5A7FA 3H2GA 4FLFA 2ZYIA 3DYIA 3T52A 1IZ8A 1MPXA 1IUOA 4B0PA 4C89A 2VEOA 4L9AA 1CR6A 2H7XA 5D3KA 1KU0A 3V9AA 1DX6A 4ZREA 5D6OA 4XVCA 1ZI8A 4KACA 5AP9A 3W04A 3K2IA 2GZSA 3QVMA 4AXBA 4XX1A 5AKIA 1YAHA 3IDAA 4BAUA 4HXFB 4IH4A 1JMYA 3DS8A 1ODSA 3DJYA 1CUZA 1QGED 1W52X 2G5PA 3CN9A 4QDUA 2GBIA 5E4JA 3HYSA 1QE3A 4P9NA 1DWOA 3BJMA 3D2BA 2XUPA 2JGEA 4J0IA 5FXMA 3F8SA 1EA5A 5CRIA 2Z8XA 3ESAA 2HIHA 3YASA 4KE9A 3STYA 2V96A 4RPCA 4CIAA 4W63A 2RHWA 3V1KA 1LNSA 4TVKA 2XLBA 1ODCA 5JAOA 3W9UA 3WWDA 5AM0A 3C45A 5CT8A 3F67A 5SYNA 2HA0A 3STTA 3MUOA 2YXPX 1YA4A 5DYYA 4X7BA 1QJ4A 5CURA 4KYVA 4FDMA 2QVBA 4KAAA 1J1IA 3IUQA 3VXKA 2ECFA 1CUFA 4QEKA 3BF7A 4QE3A 1CUCA 4C4ZA 4P93A 3H2HA 1QOZA 2DCMA 1XZMA 4UBOA 3QPAA 5AI4A 3WA6A 1XRPA 2PSHA 1K6EA 3D3NA 3DDUA 4C01A 2QRUA 5FPQA 3R3ZA 3I2IA 1W4LA 2WFLA 3AIOA 2B20A 4YX9A 2IIVA 1HL7A 4PNZA 2HDWA 4BCCA 1CIJA 5AHXA 1P0QA 3FAKA 1MJ5A 4N8EA 1TQHA 4FFWA 1MX9A 1KEZA 2PX6A 4OB7A 1RYYA 2VATA 2R11A 4U2GA 1QIGA 5CXUA 3G9UA 4JEIA 1P0IA 4F21A 2W6CX 3QH4A 3I2KA 5JZBA 1CQWA 4AN0A 1N8SA 2Y2UA 2JGKA 2WHRA 3D2AA 2E3JA 3M83A 4MYSA 5DTJA 2HRRA 4O08A 2I03A 1FFBA 2EDCA 5BOVA 3LP5A 1R1DA 1JJFA 4OSEA 1VZ3A 4Z49A 1NU8A 4PSUA 2ZSIA 5E4TA 1OCEA 1ZI9A 1CPYA 4J03A 3WKCA 4X6UA 3NUZA 1O6GA 5LKAA 1M33A 1MN6A 4BRZA 1CUHA 4PV7A 1LPNA 4H7FA 3DD5A 2H7CA 3ZI7A 1U8EA 3RLIA 1LPMA 3P2MA 3QMVA 5JD6A 5HQ3A 3U1TA 4QDTA 3WK7A 1LLFA 5LIPA 3S8YA 3W2TA 5ALLA 2WUDA 4X6YA 5IH7A 2AXEA 4MEBA 1R9MA 4K6GA 3FWHA 3NOXA 5JARA 1QFMA 2WHQA 5ALEA 4N5IX 2HFKA 3PF9A 3WL6A 4AMYA 2QM0A 2C7BA 3SX4A 4OD0A 1EB8A 4K2AA 5HF9A 2RAUA 5HFAA 2WIFA 5KWIA 5CT6A 2C0PA 3DEAA 3I6YA 2VT7A 2J4FA 4CI9A 4ETWA 2O7VA 3IBTA 4NS4A 6YASA 4ITVA 3PUHA 2FJ0A 4B83A 3O4GA 4BC1A 1XROA 2V98A 1GKLA 1L7RA 3L1HA 2JIDA 4RNCA 5LKRA 3LLCA 3ESDA 3BJRA 1OXMA 2HA3A 2I3ZA 3R41A 2XUFA 1E8DA 5FV4A 2WIKA 3HEAA 2CKMA 1TCBA 1DWQA 2PSJA 4M0MA 4Y2VA 1X2BA 2CB9A 3F97A 4IH1A 4IH9A 3R0VA 5AK6A 5H3HA 5IVDA 3ZV7A 1A8SA 1OILA 1T4MA 2WQZA 4B81A 2QS9A 5FP0A 3V1LA 1UKCA 1H2ZA 4LXHA 2OLEA 1YASA 3OOSA 2XUOA 5LZ2A 4J0HA 2WIGA 3WWOA 2CJPA 3A70A 4LIPD 5ALJA 4WDRA 3WWPA 1PV1A 3FVTA 3DOIA 3R40A 3KD2A 5JAUA 3GA7A 1TK3A 2PU5A 2BUCA 5EHXA 2PBLA 3DYVA 3HLKA 3R3VA 3VJKA 2DR0A 1EK2A 1FFAA 1MNQA 2VAVA 4CCYB 5AJHA 4MQMA 1U2EA 4WY5A 5ESRA 2O2GA 3F96A 2H7YA 2OXEA 4HZGA 1ZD4A 4BC0A 1HDEA 4K6KA 3SC2A 4ZRDA 1CUYA 4WJLA 1BROA 1GZ7A 3SK0A 2V97A 4M0FA 1DWPA 5DWDA 1JU3A 4DYHA 3C5VA 1JMKC 2WTMA 1LPPA 4AO8A 5JADA 4V2IA 1R3DA 1AC5A 2JF0A 4FFVA 3WMRA 4UFOA 4B7ZA 4CCYA 1XZAA 1A7UA 3WL8A 5EI5A 1XZJA 2ROQA 1WM1A 2ZYRA 4GDMA 1CUWA 1IUPA 1XZDA 2J3DA 4N5HX 3EF3A 3WKDA 1UWCA 3FYUB 3KDAA 3FLAA 3QMMA 3PFBA 5AI0A 4UBNA 2BUAA 3D4LA 3G0BA 1E5TA 2XDWA 4DLNA 5A6VA 2ZYHA 4U2BA 1J06A 1L7AA 3FVRA 1WB6A 1THTA 5JD5A 3ICVA 4YK7A 3OM8A 5AOCA 4DTCA 4KE7A 3AILA 4X93A 2RGUA 3I2GA 4E11A 5K3FB 2BAGA 5CTAA 2HFJA 4B9AA 4D9JA 5HZGA 2EEPA 2GBGA 1USWA 2WIJA 3RKSA 4AZ3A 2QJRA 1ZI6A 5FRDA 2BUBA 1CUXA 3AFIA 1EI9A 4GWLA 3G0IA 2XUHA 3ZWQA 1C7IA 4KRXA 2C58A 2XMGA 1LPOA 5CH5A 2C0QA 1JJIA 5LZ9A 3HRHA 3W06A 1R88A 5K3FA 2O2HA 3GROA 5K3BA 1EVEA 4X92A 4GXNA 1WOMA 5C8VA 4FOLA 1BN6A 4XJVA 2NW6A 2EDAA 3I28A 4JYMA 3A2LA 2B61A 4JH0A 4Y2PA 5ISMA 3C6XA 3WQHA 1G4HA 4UBKA 3KSRA 3LCRA 3K9BA 3V1NA 5HK9A 5I7UA 1DQYA 1DINA 1UKBA 4DNFA 3WA7A 4UHBA 3ANTA 4L72A 2AJBA 5CMLA 4CFSA 5SYMA 1XZBA 4UFPA 4J0DA 5FOQA 4QWMA 3BE8A 5AOBA 4ZWNA 5D3ZA 1TCAA 1UKAA 4Y2TA 4OUKX 2XQFA 5ALGA 4ARBA 2K2QB 3AUKA 4G9EA 1UXOA 2BKLA 4BZZA 4CIBA 5JYCA 1HPLA 5A71A 3AZQA 5K3CA 3VJLA 3OTQA 1UOPA 3PDCA 1MAAA 1UK8A 3PE6A 5IVIA 3HACA 1SFRA 1ISPA 4G4GA 3IUNA 4HRXA 1RWQA 2WG2A 3TJMA 1JT2A 3FSGD 4OU5A 2CZQA 1E3QA 3ANSA 1G66A 4X91A 3IVMA 1ODTC 1CUIA 4WFIA 1VE6A 4H7KA 1LPBB 4HS9A 3BXPA 2HA7A 5C81A 4AB1A 5CH3A 4YASA 1IUNA 3KWJA 2BJHA 2XUGA 3ILSA
chains in the Genus database with same CATH superfamily
3VI3B 1P39A 1KMQA 4RX1A 1REQB 3OPMA 3UA3A 3ZBPA 4BY9E 2Z2YA 3DVSX 3E3MA 1NVDA 3WNDA 1GG5A 1RWMA 2G9ZA 4ZYLA 4M86A 1RR6A 3C3EA 1TJ5A 1PR1A 2DYKA 3BMCB 2Y77A 2Q7OE 1JFRA 5AIBA 4P7BA 1PFQA 1QIMA 4IHJA 5AVTA 1O5TA 4GBMA 3D6JA 4JR1A 2OLKA 5IJZA 4WJKB 1NY6A 1KDVA 2JCSA 2WHXA 5A4AA 1Z22A 3GLHE 3AESA 1Y4AE 3A8TA 1QWOA 4K86A 2JFNA 4QAJA 3EAQA 2Z58A 4UAJA 3IEUA 4OIMA 5EFZA 5LYJA 4YDQA 3T5MA 4Q19A 4XZ3A 2DT8A 5F1KA 5K3EA 5GADl 5B1SA 2LTAA 2MTBA 3IXLA 4PBSA 1DJNA 4CG0A 1K89A 4YI3A 2QBYA 2I7VA 4IGEA 2WA2A 4Q7EA 4OMCA 5IDYA 4N76A 4MS3B 4LZJA 1WZUA 1AUOA 1EZ4A 1PBTA 2WJ6A 4E5MA 5EJ4A 3PNQA 1DT3A 3JQFA 4MV9A 3WX0A 2Q2QA 3ZXYA 2PZBA 1T5SA 1TU4A 3KPYA 1H2HA 3I5XA 3BDVA 4LJ4A 3ZHZA 3DOOA 3FVVA 1YIAA 5AHKA 5AW9A 3RAFC 4EYSA 3PYMA 2XZLA 1TRHA 4MXDA 1KZ7B 2WSLA 2XF8A 4ZQHA 4O2BF 1VKJA 1Z6AA 2I1WA 5ALQA 5GONB 4KXYA 1WDLA 1K7YA 1CUJA 1KYIA 4GKVA 4MRSA 2I66A 1L4EA 1SUEA 5LDDC 4N1AA 5G1PA 1NHWA 2P4UA 1DTSA 1QFSA 1QRUA 2XYGA 4OHKA 4PO8A 2JGFA 4B2IA 4YUAA 2OP0A 3WY9A 5CGQB 3M6MD 5GOTA 5TV2A 2H06A 5A62A 1T1RA 3TQCA 5C52B 3U37A 2Y1KA 3WAGA 2J6BA 1HOTA 4NL4H 1YZTA 3WFZA 1OT5A 3PPYA 3ZLTA 1JR6A 2QVYX 4L0DA 3QNMA 5DGIA 2EFEB 4AMVA 1VKRA 1XQ6A 5BVHA 4L95C 3VR3D 4R8SA 4G4JA 2E6UX 2WAYA 3ZGOA 1GAXA 3IA7A 4IJUA 3UUFA 3IURA 4U3JB 2JLWA 2QA5A 2UVQA 3U2QA 3BSYA 4XYBA 2A5YB 4W5QA 4BU0A 1CQIB 1P7VA 5FWXA 3VO9A 1R6TA 1T43A 1C2YA 3DHWC 3VAYA 1SD5A 3LV8A 3WKEA 3DD1A 3AWIA 3GEDA 1DV1A 3THOA 4C4XA 1LEHA 3EOAI 2MT9A 1XMJA 1ZJ4A 2XUIA 1XCPA 3PUWA 1CUBA 1B8NA 3PQ5A 2R2AA 4MTLA 5HDBB 5C8XA 1CJKC 3LLUA 2QMYA 3AXTA 1HQDA 4C3VA 4NZPA 3IDOA 3CKYA 4DTIA 5ITVA 5B3AA 5LC1A 1AK1A 1XLTC 3KYCB 1DV2A 5DHAA 4Q05A 4RM3A 4G1EB 4EF6A 4ZMRA 4MRNA 4UOZA 3NHLA 1SWVA 1U4NA 2PLRA 5DCWA 4NXNB 1R4NB 3UPTA 4ALJA 1P73A 3MS7A 2NVOA 3DQZA 4FBMA 2C5GA 3VISA 1MMFB 1WB9A 2D7CA 3HO1A 5DPMA 3S99A 1CRLA 3H1GA 2X6RA 4LHVA 3MGKA 4E09A 4Y9DA 3CF4A 3DF9A 4FE3A 2I3AA 2A5JA 4HFMA 5T57A 4MS1A 3R4CA 5F76A 1FU8A 3WLAA 4EITA 3FYCA 1M72A 4HDMA 3PNOA 2A0YA 1XKQA 3DLAA 5EP1A 2JAXA 1P0MA 3PEEA 4BNYA 1XAHA 3ITNA 2Y1OA 5FBLB 1JH9A 2GK7A 1LNQA 2KLHA 4Q1DA 2O50A 4PRKA 2Q45A 5GM2A 4OJKA 4V24A 1EIZA 5L3RA 2X76A 4ZAWA 4X95A 4ND3A 5FOWA 3G5TA 3IUYA 1L2TA 1G5RA 2BFBA 3QPWA 3LCCA 2B5WA 4S1PA 4WK2B 1IBKB 3I6MA 4I9GA 2XYQA 3S2GA 4C7OA 4Y6RA 4I5EA 2CMFA 3VSEA 5KSOA 3EIEA 4HN9A 3TSCA 4YP5A 2YY7A 1O6FA 4BO0A 5BUZA 1DVRA 2D1RA 3SHVA 5AI5A 2EZUA 1EQUA 1DXHA 1N5RA 1VGRA 2QXUA 4PGAA 1LSSA 4UEQA 2NU8B 3WYFA 2ERYA 5FTLA 3S1AB 2J0SA 4INZA 4TMWA 1C50A 1ZGGA 3B3GA 1Q16A 3NBFA 1OSNA 3O95A 4V02A 2DM6A 2PJZA 5E3JA 2FFAA 4BVHA 5AJTA 2ZU6A 3EGEA 4Q3CA 4G1FA 1U0LA 2OQIA 4EPXA 1ORTA 1WF6A 2Q0XA 4UHEA 4WY2A 3VZBA 3KQYA 2JJ2A 5BXYA 4XWTA 1HE3A 1MA0A 2VJBA 1O94A 2DWPA 3KJNA 2MMCA 2ANCA 1NRIA 3FPEA 4LHYA 5TQJA 1FDUA 4ZV7A 5IUJC 5J23A 1DXOA 1CHDA 5TQ2A 2F2TA 3FBGA 4QYXA 1BXRB 1LW6E 1VE9A 1T2VA 2Z9BA 5AOAA 3DOEA 3TOXA 3IRUA 5DNWA 3VR4D 3WK8A 2B35A 2WJ4A 1I7PA 1XIVA 2ZRFA 4P3KA 3UAWA 2O19A 3ICWA 3IP7A 3RNOA 5IASA 2BGMA 3CH7A 3M8KA 3VTKA 4BE9A 3LT5A 3T3NA 2PJRA 1GZVA 3FX2A 3SSMA 4FXOA 3UJ7A 1TZMA 1CK4A 2NO1A 3VKHA 2XH8A 1WL8A 2YWFA 4A5SA 3GPIA 4MYDA 4YQYA 2VR1A 3TL2A 5I5EA 4Z1MA 4XM1A 2ETVA 1OU0A 4JI8B 5KC8A 1QCCA 4C07A 3PJFA 1S3IA 3I2JA 2R96A 2V54A 3O73A 5E7MA 1MT0A 1OW3B 4F84A 3VH4A 1QGZA 2Y0PA 1QIFA 4CEJB 4RBNA 1FYXA 3ENNA 5JZOA 1L8LA 3WZ2A 1VOTA 4OLJA 4Q4LA 3LIPA 2VBFA 2BJWA 4UXIA 3ZXXA 3PQDA 4OJMX 3TJZA 4CNQA 5F5NA 2EIHA 2OY0A 4X64B 5BSEA 1B23P 3NNNA 3LE8A 3TQQA 3EY4A 4UFNA 4WI1A 5K7SA 4EF4A 4L08A 5HHTA 4OMUA 2BMVA 4ZQGA 2V03A 4F7DA 4B6OA 2Z08A 3F8WA 4EGCB 4U7GA 1XRSB 1B42A 3BHNA 2R7MA 2VDMB 2G4LA 2Z98A 3HU2A 2CLHB 3PEUA 4A23A 6NULA 3U4IA 2YCBA 5DM4A 3TUIC 3NRBA 1NJ8A 1N6IA 1PJSA 1UP4A 3C41J 3TTYA 2QI9F 2VUSA 2BMDA 5FHRA 2CNNA 3KXPA 1K63A 1AHHA 4DB4A 2VSYA 3U7HB 1QZZA 2YNMC 2PUVA 4BVEA 3R9WA 4KR2A 2C92A 1M1NB 3EIUA 3ELWA 4PFJA 4F5DA 4M9UA 3DO8A 4IGKA 1E2DA 2DHEA 4ZI7F 2QLTA 4YV7A 1OX4A 3EXG1 3V7WA 2I76A 4JHLA 1VHTA 4OUDB 5EP2A 3IIKA 1G18A 4POAA 1X1RA 2IP1A 4H3SA 1EGAA 1Q0QA 3G2PA 2J6IA 2QN6A 3PNLA 1JTVA 4JLVA 4LYYA 4ZC1A 1ONSA 4KI0A 1F20A 2J09A 4RA9B 5KO2A 2ODNA 1SGWA 1E60A 1UBJS 1ESZA 2LW7A 1J90A 3NBKA 3P2EA 4OU4A 4ENTA 3EF1A 3OPYI 1I4DD 2JRCA 4H7JA 4RUKA 5ALHA 2NU6B 3LUJA 3KQLA 2GAIA 1T8TA 3W4KA 5IFLA 1C9YA 4MKXA 3ZY6A 2WVHA 3ORQA 1MHPA 1C7JA 5B36A 5KYTA 1BA3A 5B6JA 3Q7PA 1T0PA 3AINA 2I9PA 4E15A 4GGOA 4B6PA 4CKYA 4KFTA 1ZONA 3NUGA 5ITWA 4B34A 3FNFA 3IE1A 1D1SA 3HYTA 521PA 2FUCA 1QK3A 2CVZA 2LCQA 2JLUA 1JPJA 1J25A 2G17A 4O1MA 3WGJA 3OMXA 5IARA 2PM8A 3KR9A 2D62A 1JLSA 1QGUA 4IMPA 3I1JA 4ND2A 4G0QA 3WBKA 3FUTA 1I80A 2DVMA 4ZIRA 3ZHBA 2QTNA 1VIVA 3OP4A 2IOFA 4PC6A 3V4SA 4BB0A 1NBHA 3C8HA 3ZPXA 1JECA 2CMDA 1F0KA 1RHRA 3AC0A 1SZCA 3FPGA 3OLVA 2GZ2A 5IK2D 3P9KA 4NQRA 1EGHA 4NOMA 2XCIA 2Y99A 2IY8A 2XVYA 3O4VA 1P2SA 1JLLA 4DR1B 1PJ4A 4Q3OA 3ZGXA 1IVSA 1IJKA 1RPJA 2VK8A 4DIEA 4HI0E 1F4LA 5CCDA 1E6UA 3I23A 3SR4A 2FF7A 4L1KA 3X44A 1KAGA 2QJFA 4KXQA 5BR4A 4LZWA 4EA8A 2WE8A 1ZUIA 4HAIA 1PTKA 4TWRA 5I3CA 4QNMA 4RMGA 3VO2A 4F4UA 3HG7A 3Q6MA 4R2KA 5CDTA 1QQTA 3IHTA 4IDNA 5DNVA 2QRMA 1Z0UA 3OUUA 3PKZA 4WNYA 2BJVA 3E70C 1M67A 1R10A 4G8JA 4EPYA 1SUPA 2BI8A 3SE7A 4PX9A 4LDAA 1U3DA 4PZUA 2DPMA 1J0BA 5CDHA 3PUYA 3F5SA 2PUAA 2YJGA 2IW1A 2BGKA 3NHPA 4KWHA 3ZE0B 5A05A 1RHUA 2XKBA 5FL3A 1KEEA 2FSVC 3S55A 4IWXA 1G9TA 3H1BA 2ZXFA 4AO6A 4C0WA 1YL7A 4TMKA 3E82A 5FI1B 3WGMA 2VKTA 3K3PA 1GCAA 1KO5A 4JYPA 4HMQA 3FNIA 4P3NA 4TWIA 4CDGA 5JEEA 2AK3A 1CB7A 5EQTA 4A73A 4PINA 2QMZA 5F3DA 1T5BA 1Z74A 3TD6A 5J3JA 13PKA 2G0NA 5F7JA 1C9DB 3DZBA 3EVCA 2WKWA 1F2TA 3ABRB 3BCRA 3G5MA 5JS7A 4MIOA 3EB9A 3QXHA 5AJVB 3KETA 1NI4A 1FPQA 2BE7A 1FDWA 3NZEA 3SSAA 5FDFA 2XB2A 4YJ3A 5BURA 1AKTA 1NW8A 1BGWA 1N6OA 3I83A 1F17A 1L4LA 3FF4A 4H7DA 1KYYA 5IJ9A 3QF4B 2TSYB 2PEZA 4BKUA 1NUTA 3FN4A 1A9OA 2IDMA 3GGPA 3KYDB 3TDMA 1UKEA 4AKIA 4R1TA 2FW8A 3KXIA 4J0GA 3EVBA 2DXIA 3UMGA 4HGZA 5LP6C 2QX6A 3EDCA 1BIFA 3EQ2A 3SYKA 1JI3A 3DPSA 2DLNA 1NUPA 2PGLA 4ZO8A 1MOQA 4HSEA 4ML3A 3BIFA 1NW4A 1GRCA 2MHCA 3IJRA 4RS4A 3WLIA 3IBFA 1Z47A 1A9RA 1W0KA 1MF7A 2C8KA 3EXG2 3ZX5A 1DLJA 1WY7A 4JUBA 2HIGA 4DMGA 4OB6A 4O4IA 2V8BA 1PUXA 2QRHA 4C2TA 4FHZA 4ZANA 4ETMA 2MSKA 2V65A 1L5RA 1YFZA 3KVVA 1I8TA 5KNCA 3JRXA 4G36A 3IDSA 2WF6A 3G0GA 5I3ZA 1AUQA 1OFUX 1MC4A 4G85A 1D2NA 3IS3A 5ICFA 4TM7A 1ZICA 1BDMA 1YRAA 2YMMA 3G59A 1J0XO 2OXCA 4PQRA 4Q00A 3NVKI 2Z5FA 1P7YA 3M1YA 1IYZA 2QB5A 2ZRBA 4AKSA 5JAMA 4ALMA 1I51A 4B2PA 1JDNA 5P21A 2PRKA 4HAUA 4W7HA 4ZEMA 2RH9B 2UAGA 1XD8A 3EZGA 1Q2UA 3DL4A 5TR9A 4WT7A 5CVUA 5ILQA 1ECGA 4HTAA 3B1ZA 4NBUA 4GMGA 3P9ZA 3SU8A 2IEBA 4Q7MB 1L5YA 2OT3B 5FQNA 3RQIA 4YMLA 1VKHA 4IXMA 1GTZA 4GGMX 1R0BA 1UAYA 1GL6A 1JJ7A 1T24A 1TDJA 1YK1A 2H4XA 2NXJA 2QGFA 3DWIA 4IIDA 4R41A 3EK2A 2E4YA 5DTRA 5JDIC 4H31A 4YUVA 2B30A 1NQWA 3BWYA 3G68A 3R9KA 5JNUA 5A3VA 4OAOA 5A6SB 1XVUA 1I4LD 5AMXA 3O9ZA 2JA2A 2X7JA 3SEAA 1A5BB 4CZ2A 1X13A 3OQPA 1UDWA 1NRWA 1X3LA 2RHCA 3E2PA 2P9BA 3HPQA 1CUSA 4O4HB 4BQQA 4CHTA 5JMWA 3I0NA 2BHSA 3PP8A 3Q7IA 4NF2A 1U0GA 2QXYA 4EZBA 3FWZA 3VH3A 1WQ1R 3OJOA 1E8NA 1W8IA 2ZS7A 1RXEA 3LPAA 3NGXA 2KM1A 4XH9B 4ZEXA 2DSTA 3R5JA 1L5KA 1EINA 3OECA 5F7ZA 2B7BA 1E2IA 3RYIA 2J0UB 1ZO8A 4QGBA 4TLDA 2UUCB 4L8WB 1LLCA 1CVLA 1E9EA 3A6EA 5JSQA 2VQ6A 1N9GB 2QZPA 2CYBA 3GPLA 5KYGA 1VP3A 1FK8A 3CMMA 5CH8A 4PIPA 2CK3D 4RHTA 4Z4HA 4DV5B 5B53A 3SG0A 2CZCA 2QUZA 2A1TS 3P9IA 2XY4A 1QB8A 3NBZC 1WUKS 1GCOA 1XT6A 1JJAA 4JP5A 2DMRA 3NRCA 4QIHA 4Q39A 4FLMA 4RSHA 1PKEA 4TLAA 4XVHA 4PYQA 3N76A 2ZSHA 3DEJA 3K92A 3PCXA 1LBSA 3Q8WA 1S8OA 4NPAA 1F5NA 3PXBA 1GZSA 5E6SB 1LX7A 3AF4A 2ZBEA 3LBHA 4DZRA 1XLWA 2HX1A 3S2YA 3L1UA 3NHUA 4GM0A 4LISA 1BDHA 3AG6A 4B2YA 3KSUA 5C4GB 1R4MB 3NEYA 1L6RA 4QM6A 4CR8A 1K5PA 1HY3A 4O1IA 1M8KA 2WT9A 4F4FA 1IQ0A 2GLXA 5DXAA 5ALWA 3IFSA 3PCTA 4XVUA 5D7BA 4NBNA 4AMZA 4M38A 1U3GA 5AVKA 5B4VA 3FMPB 4PZ9A 2Z4TA 4XQEA 2V0GA 5H16A 4HV4A 4GKBA 3WO0A 1AKRA 3RU2A 2KW5A 3FM9A 1UADA 3LKVA 2ZUFA 3NHMA 3FPKA 1P7CA 4TOIA 3RHSA 4R2MA 4CMJA 3UGKA 4JMLA 5KOHA 1T6ZA 5H02A 1C9NA 1ULAA 2WJZB 3OZUA 3RTCA 2I4MA 2V6IA 2PS3A 1WLYA 1Z2EA 4P38A 1RVV1 2HHCA 2RHJA 2Q2OA 5I7EA 1U7PA 4J1TA 1SHKA 1USKA 3AJAA 4GLBA 3I92A 2Q3CA 4B3SB 2FUNB 3AR9A 1I01A 5FEMA 3VX3A 3E1SA 4ESVA 4EPRA 2G04A 2WKQA 3BIOA 5F35A 4BKMA 1UJCA 3VH2A 1GTL1 4OHPA 2VUTA 4V0KA 3PX2A 4BFTA 3JQAA 1FC0A 3VDXA 2XWQA 1X1QA 1AS2A 4L6AA 2WYWA 4DA4A 5B58T 3ZLUA 4X71A 4IXWA 5ADHA 3R5FA 4MB2A 1X1CA 1PG2A 1Y9ZA 3WSTA 2WB4A 3TEMA 3DCYA 4S35A 4AROA 4UQOA 2WYVA 5I8WA 1COWA 1HUQA 5FPYA 4HOYA 4LOIA 3RSCA 1KH3A 4A8TA 1NUUA 2NPFA 2RSLA 4MARA 2NPOA 2V9ZA 2J3QA 3U4MA 3WB2A 3D0KA 5D00A 3GN1A 3GLVA 1KH2A 1P7WA 2NSDA 4JJAA 1ODJA 2WMYA 4C6TA 2LPMA 1X7XA 2O7SA 3Q0EA 4BGIA 3N6XA 3JAMA 3SEFA 1H3NA 3FCAA 2HQBA 2O8CA 1NVGA 2K6GA 2GBFA 4KXMA 1PWZA 1ONOA 3SZGA 4MP8A 4ARZA 2GPJA 2XMSA 1ANKA 3GV0A 5CXSA 5JI2E 1PK8A 1Y7LA 1OVMA 1KYQA 1E9DA 4HGYA 2IH4A 1W4BA 1V1RA 2NSHA 1WW2A 2D5LA 3EH2A 2QIOA 3BE4A 4R1OA 1I33A 2GN1A 2HNAA 2LWIA 3FNQA 3P9NA 3PTAA 1LJUA 1Z3CA 3TNFA 1Z7YA 5COAA 3RYFB 4RANA 2GM5A 4IILA 4EA6A 4V1CI 1NATA 3CH5A 3KWFA 1TZBA 3MTBA 4NJEA 5EIBD 5BNIA 2FW0A 3ZWYA 1JQJC 1X92A 4JMPA 1H0HA 3Q3JB 3VGJA 1Z6GA 2OKCA 3HMKA 2JANA 2QVGA 4GW3A 5KC9A 4M2LA 1H3EA 2HLDA 4HTFB 4YP0A 4OXNA 2AZ4A 4N65A 3CEPB 4LJKA 2QQGA 4DG9A 1VZ2A 2I8LA 3RM3A 3NH6A 4NCXA 1Z4KA 4HS4A 4PCVA 3KP1A 4LK2A 1BA2A 1XRRA 2DFLA 2DSNA 2YVQA 3EXAA 3GRPA 4ZQBA 3ZIDA 1G7SA 4EY8A 2OV6A 3QGMA 3ZDAA 3N8HA 4GP9A 1T4BA 4ZOAA 2BD0A 1AE1A 4X1YA 3WQRA 2ODPA 3Q41A 3T5CA 1AMNA 5DK4A 3BL8A 4RA6A 4DBVO 4TWBA 2G1JA 4W1SA 3PRKE 2QJWA 1CQZA 2EKPA 2D4AA 3WL5A 1DSSG 3RC7A 2HZBA 3I1IA 3SJ7A 3L0SA 2I4OA 1VP9A 2CJWB 3DDHA 2PBRA 5G0WA 4E03A 5MHTA 4BDSA 4YDHB 4N3BA 3SIRA 4ZXFA 4KMSA 2VHCA 3H5AA 4HLUA 3UCXA 3OMLA 4ZPJA 4ZGWA 2ZRMA 4RM2A 4X6XA 4W4TA 3QPDA 5HKOA 1R18A 2CJYA 4C7BA 1T34A 1Z5OA 2AXNA 4C43A 4RGBA 3BRWA 3QXXA 4GLJA 5D51S 1CFJA 3H4MA 3IHKA 5IAJA 1HFWA 2QPOA 4RHYA 3M0EA 3GELA 2DFPA 1SULA 1M6WA 3P2JA 3OIDA 3RWMB 3ZEIA 4AMUA 5I7RA 5KNBD 3K70C 5TS3A 3PXUA 4DSUA 4EYQA 1U9IA 1YIDA 4BFZA 2ZT5A 1W76A 3QFTA 1RC1A 1GEGA 2HIAA 4RZ3A 4AN1A 4P92A 2YHUA 5K3OA 3N59A 1W88A 1CR0A 4BL5A 5HIJA 4KMOA 3SM9A 1D0SA 1OR8A 3O8QA 3CNEA 3VR5H 1I1OA 3L0PA 4R2HA 3GR6A 1AX9A 5GJBA 4NVRA 1XEFA 4CM6A 1IJBA 4DOMA 1PQ4A 3PGVA 5KCZA 4YYEA 2WB2A 1S5PA 3IEMA 2FSPA 4IX9A 5CA1F 4RL6A 1OTHA 2AFIE 4PX3A 4ZALA 5CNKA 1F3LA 4L78A 1SQSA 3NKFA 3SBEA 1IONA 1QGDA 2FG7C 2VZ9A 4OJTA 4DRXA 3COVA 2ZVQX 3CLUC 3ELDA 5IFKA 1REQA 2V9CA 1HBJA 3MVEA 4KEAA 1O89A 2WFLB 1JHVA 2BN4A 4IFEA 1CV2A 2LE0A 5SY9A 2VPYA 3NONA 4CMCA 1ICIA 2IXDA 3BMCA 3AM4A 5FOVA 2BE9A 1LGYA 1MB0A 1T3SA 4QYMA 4Q3LA 4WK6A 2JEZA 1MOZA 1OKKA 4IIVA 4DREA 3R77A 4E33A 1PV4A 2FY8A 3HY3A 2VDKB 3D3QA 4JQCA 4D0LB 4C7JA 4TSRA 1U2SA 1H42A 2OILA 3EYWA 1L5OA 1U28C 3A2NA 1KQFA 2O5EA 4GZ6A 4UHCA 4R2LA 5D3MB 3FOAA 4G9BA 1L7NA 4KDEA 1T8YA 3DKKA 1ORWA 4IIBA 3FY4A 4ZQCB 1ISFA 3EXEB 1Q0RA 3L1IA 5J1SB 5DV9A 3O3OB 1A1VA 3U62A 1XZNA 1OX5A 2B8WA 2ACEA 4UU1A 4ZCLA 1Z6TA 4U2CA 2YWBA 2P9FA 2O0MA 3ICEA 4I6EA 1KIMA 1U7ZA 4BXOB 5JS6A 4MS3A 4OHFA 4QOSA 4IDHA 3SHFA 1U98A 5A4MS 4IUBS 3SS9X 2EU8A 4CYMA 3F5FA 721PA 4NEQA 2ZEJA 1K4MA 4I3FA 1OFUA 2PVSA 2HF7A 3L0CA 1AHIA 2OCYC 2VL7A 1AY0A 3PQFA 1BTOA 2KBEA 1BD3A 3UWDA 4H15A 1VCIA 3GRZA 4LSWA 3L05A 3GEPA 4TM8A 1O77A 1MHTA 1GITA 1R9JA 3D8SA 3H0KA 3TPFA 1JEDA 3DDNA 5GONA 2GTIA 3TB4A 5ALSA 1G19A 3ANNA 3P94A 1QAMA 2Q1TA 4FVTA 2Z2ZA 4IGFA 4OSPA 1S0UA 5CFZA 4AJOA 2IZZA 3HM9A 2D59A 2J0VA 4M55A 2FPMA 1XWFA 2DC1A 4QNRA 4FW8A 4L7QA 3IT0A 4PGFA 5E38A 4HB4A 4FZJA 3V3KA 3WSVA 5BWLA 5JE8A 2HT1A 2IE8A 3H84A 4H6VA 1AHNA 4BTVA 1UQTA 3G85A 1C0IA 3B20A 1WKCA 2KMLA 4ZAYA 4ZK2A 3N2GB 1G8FA 2X40A 3R3HA 4K8RB 1KWKA 2E21A 1XCGB 1JKFA 3OU7A 4GYYA 2C7OA 1HWYA 1YQDA 1GPMA 1S8FA 1IHXA 4G1VA 4CM8A 2Z09A 3T34A 5EMKA 1XL0A 5HJ7A 1VMKA 1YL6A 1TQ6A 1L1QA 4A6XA 4DSAA 1UWVA 4U39A 3VR6H 1IBSA 2R7NA 3DEYX 1ADFA 4F97A 4LS3A 1K1EA 4L07A 4MQLA 5AM2A 4I4TA 1CQIA 3P19A 2ZIXB 3TCKA 2PV7A 4LECA 4UTRA 1OD6A 2A9FA 2Q4OA 5J5AA 4ETNA 2QTVB 3N2LA 1NE7A 2B3DA 4K8OA 5C31A 1V39A 2QAGB 4B3XA 1PFKA 4QOHA 4DCTA 2VHVA 1UJ2A 2G5TA 4IX1A 4HPJB 4F6CA 1RYEA 1NASA 2ZI5A 4UBIA 3DE6X 3QFCA 5EEGA 1IQUA 3I01A 3OG9A 4NPCA 4ZRMA 4G3XA 4OOEA 3DT9A 3PUJA 1TVKB 3U0BA 4GPD1 4FZ5A 2IBMA 4RD6A 1U7DA 2NUTB 1YNSA 1KNQA 1DIGA 1KO4A 3NT2A 1GPDG 3BWXA 4L4SA 4L74A 5G53C 1YR7A 3CURA 4WOCA 3W4JA 4JJIA 3B1XA 4DQKA 1ZISA 3Q7SA 3LQ1A 5CDFE 5HMMA 2LZ0A 5HK8A 2C9DA 2D7JA 2VHJA 1OXUA 2BEUB 4XGKA 4JJEA 2B8JA 3UGTA 4CTKA 3ZHXA 4BWFB 3C7TA 1JVBA 2DKOA 3KZXA 4I1SA 4GPIB 1ATZA 5IUKC 2BC9A 1NVXQ 4C87A 1XHEA 5DMHA 3HKBB 4BMYA 3KEMA 4LVCA 1QRAA 4KMRA 4Q9IA 2GJSA 1G8MA 1UP7A 4XSVA 1SKYB 3K5WA 5BN5B 4WZAB 4KN9S 1UZMA 3H1AA 4RXMA 1O6CA 3O3CA 5TF4A 4H7PA 4R2IA 1HKHA 3LIIA 1E92A 1NF8A 1NMYA 4EKDA 4U7DA 2O05A 1J5EB 1JAXA 4TL8A 4CQMD 1TAGA 3MAGA 2O7NA 2C88A 3H42B 2WJAA 3EGXB 3DW1X 1MD9A 3SJAA 5LBIA 3V48A 2WZDA 1JDBC 3K2QA 3I01M 3FCEA 1ORVA 4HRAA 1LY1A 3RVQA 3WRWA 4HJXA 4BVJA 4GL4A 1VSVA 1J7JA 3S1AA 3VHXB 2G7ZA 4E22A 1A8QA 2Q6OA 4YO7A 1TGYA 2YCLA 2M6RA 4NE2A 5UKDA 3ZE2B 3ZQUA 4J91A 2DUNA 3H2BA 3F7OA 3C2QA 5EZYF 5A3RA 3ZE1B 2E4AA 2POQX 4HNUA 3THWB 2BKEA 1Q5PA 1OWNA 1YAJA 4I55B 4D9NA 1M6YA 5BW5A 1BCSB 1CRQA 3TJRA 5LNK6 2Z6AA 2QLFA 3NDPA 2PX2A 1BXRA 3KQKA 4DYDA 4PWZA 5AKGA 4UNIA 1OE0A 1ORRA 1H69A 1XAJA 3EVZA 4GVLA 5ALNA 2OESA 8ATCA 3RIXA 4UKDA 3JW8A 4C7OB 3I58A 1YJAA 2ADOA 1N3IA 3CF6R 1VPLA 1RIIA 2F3PA 5J2UB 4ZAVA 3I8XA 2EJUA 1LBIA 2BVNA 1FJXA 4MQ5A 4FILA 3ZLVA 3SZOA 3TCXB 2B7LA 4RGQA 2ZS9A 3GHYA 1JV2B 3F4LA 1IEVA 5DSZA 1WUIS 4U7HA 1I2DA 3D6VA 4ENUA 4MV4A 2ZSAA 2IELA 5EKXA 4PC2A 4MUFA 1MJGA 2R4QA 5TJ9A 4FIZA 1ZD5A 6ADHA 1YUNA 2FETA 2HLPA 2RIPA 3MCTA 4CEJA 4M53A 5EPEA 5JNLA 2RGCA 5H5JA 3RE1A 1JEYA 3DFKA 2FQ1A 3VC2A 4DA0A 4DUPA 3FTFA 1VKNA 1JR3A 4D81A 1KOFA 2FQWA 5M34A 4INJA 1K6XA 3FWNA 2FLVA 3LX8A 4Y2UA 3A1EA 3LHIA 1H4SA 3T1OA 1MLDA 2HF8A 1KMCA 1G64A 5CT4A 4GWGA 5D86A 1TVMA 2C2HA 2R85A 3A1VA 3LP6A 4JYBA 4L6CA 5AW5A 5AQEA 4BLRA 4BN0A 5HM8A 3W79A 1L4NA 1U7XA 2X3FA 3R3YA 1Q1BA 2J3KA 3T3OA 4E14A 3B36A 3ET4A 3A04A 3CEMA 4L27A 3WLEA 3W5CA 3RQSA 3G7UA 4C03A 4HX2A 2G82A 3ZXIA 1LX6A 4WCDA 2Q6IA 1AB6A 1TD9A 1E9FA 3DWGA 3P9XA 3V00A 3EVGA 3ZOKA 3K0CC 1YMVA 4PYIA 5JH7F 4LV8B 1M1NA 1OBHA 4B47A 4C1NA 4GKJB 2PRZA 3MJTA 2IF0A 2H5JA 2QUHA 4KO3S 4OHMA 2R5WA 4NV0A 1MIOB 1HYQA 1S7GA 2H92A 3KU1A 5AKLA 5FTMA 1Q95A 3WMWA 3U1BA 2VQEB 3FFAA 1MJGM 2CEAA 1M3SA 1MV8A 1HEUA 1ZNWA 3AJ9A 1VBMA 2QUJA 3DYBA 3T0FA 2CVOA 4X00A 1E96A 4RA9A 1EVLA 3I2FA 2CXNA 3VPAA 2RKWA 2F3UA 1ZJ6A 3EG5A 3L4SO 4QPJC 2NU6A 3C1OA 3LGAA 4IOMA 2WUEA 3LFTA 3EXHB 1O1YA 2Q6KA 2WMDA 2P30A 3TGWA 1YI0A 5I7FA 1TKBA 4KFSA 4N8SA 4G67A 3HGQA 2J4DA 3E4DA 4DPLA 1AZTA 4W6ZA 4DR4B 3N2NA 1OAOC 3BWDD 3CV3A 1EQAA 4BX9A 4TV8B 4FYWA 1RYHA 3X3HA 2PLNA 4WACA 3NRJA 3N7TA 2C3OA 5LJLA 4YV1A 1X70A 4WHMA 3QEKA 4QELA 1AQYA 2B1IA 3EZ6A 4ZT6A 4AKTA 1XPOA 3VNVA 4JR2A 3WL3A 1E4OA 3ZWWA 3ZK9A 4F0JA 1PZNA 1LSUA 2NZYA 3H8VA 3M5PA 1THGA 3PXEA 2ZSBA 3HJUA 4PQFA 1HQKA 3FBTA 5DYNA 5EXPA 4A2CA 1C3OB 2IOFK 4FQ7A 4TYQA 4N0QA 3BK2A 3CW2A 2VXOA 1KBOA 1PT8A 1T9DA 2X41A 2RGNA 2JCYA 3X2SA 4LXYA 3HL4A 1WPQA 3B5EA 4OI0A 1BE6A 5LYYA 2CNWD 4MKRA 1RI4A 2W8BB 3SMVA 2HJWA 3KZKA 4BGUA 3JQ9A 1EFRD 5GJVC 2WF8A 2BLLA 2Q07A 5KYNA 2JIBA 3HFSA 4FCCA 4I66A 1QSGA 1KSJA 1IU9A 3H2KA 2NMVA 2PH7A 1AF7A 1X1SA 4JXXA 2Q3BA 4UD6A 4QUKA 1M2EA 2OO5A 4MWCA 1PS8A 2WG1A 2VNHA 1DI0A 1DGQA 2G9RA 4CPDA 1R0WA 3V4FA 4DSNA 3B60A 3DO5A 4A2PA 4UHJA 5IUNC 1BX0A 3ZDDA 1F2UB 1DNPA 4G0PA 3T7RA 1FSGA 5C1BA 2P77A 1R8JA 1QR6A 4YCSA 1VMAA 2CF5A 1J9GA 4MDYA 2IV7A 3SZMA 1YOVB 4EFLA 2G1KA 1KVRA 1K68A 2BISA 2HGZA 4HAZA 4RV5A 1MR3F 3SQMA 3IOEA 1SEVA 5B4TA 3L40A 4L5JA 4AF6A 4A36A 3FCCA 3C6YA 3DLTA 1BFDA 4MCHA 1E1RA 2XTMA 1DOHA 2VQ3A 4AWBA 2JFQA 1QK4A 2DHRA 1JVSA 5DGDA 3NTUA 1SOWA 2QRLA 2ZI4A 3HKEB 4MI9A 4P5PA 5AKJA 2GM3A 1QH1B 2AJDA 3IQXA 2AG8A 3O8DA 1XZHA 2IYTA 3T54A 4BWGA 4RTKA 4Q15A 2WHPB 2WNSA 5ALFA 1QXSA 4R3UC 1JMVA 3FROA 3OCVA 3E9MA 3KPWA 4KN5A 2ZSJA 3H2ZA 1LDNA 2UUOA 3HB4X 4R9NA 2ZXUA 1SCQA 3WJAA 2AE1A 3UJ8A 3C14C 2H1LA 2PT6A 1J2RA 4JC0A 3ZH2A 3ROFA 3O4IA 1IOLA 1ZUD1 1T35A 1ZSNA 5C3MA 5CBPB 3SYMA 2WUFA 2VSFA 1N2ZA 3EZXA 3KR2A 1DB3A 1ENYA 2IOHA 3QF4A 2XCUA 4QU8A 2ALJA 2E2WA 1A5ZA 3M9XA 4REQB 4TTIA 5WRFA 3VZRA 3DLHA 4A8JB 3FETA 2QG6A 3NWEA 4DLTA 3A3KA 4GE3A 4ZVLA 5IPFA 1EPUA 2KX7A 2QRVB 1VBKA 5LXTF 3PGA1 3AMVA 3MQ4A 2EBUA 4KQMA 1HURA 3M4XA 1KC1A 1B41A 2Q5CA 4KWTA 3UJNA 3CX3A 1NM5A 5T67A 5ALRA 2ORYA 2F1IA 4KJXA 2UUBB 4DXDA 4WRRA 3TQOA 2C9MA 2H16A 1Z4MA 3VBCA 2HMSA 4B7UA 4DANA 2PZMA 3KV3O 3QEMB 3VSDA 3HBFA 2HLNA 5ALPA 2VK1A 2V4UA 2VDLB 1T26A 1W9HA 3NAQA 4OPMA 3IMEA 3STVA 4C2AA 1PFUA 3A9RA 3AFOA 3OWXA 3SF8B 4QASA 4N5MA 3DNPA 1P3DA 3GDOA 5KWSA 1R5BA 1UFVA 4XQGA 3TR0A 4FC6A 4LWPA 1XU4A 1EXWA 2LDXA 3EJ6A 5IAKA 1FJHA 5EC8A 1Z36A 3L6EA 4R3WA 3T3IA 3NOQA 4H0CA 1Z06A 4H1TA 2BRUC 5SZJA 4ZO7A 1A2KC 2I6QA 1EJ6A 3KEGA 1CUUA 1XEWX 1ZD9A 3EIFA 1NBME 1P8AA 4XQ0A 3ELBA 1I4EB 4MVJA 1XELA 1CE8A 3FB4A 2ZYVX 4A4DA 4Q9AA 1FTNA 4Y2XA 4BX0A 4OHCA 2J9ZB 4LDPA 4MP6A 1T9HA 4XD2A 4GDFA 3WTCA 4E5UA 3AUTA 4QJ3A 3E23A 3SC6A 1ZVMA 2FG6C 3RS0A 3AWDA 3T4PA 5ELMA 4NARA 1T10A 3FLEA 3O4HA 1YZUA 3PFCA 4WLFA 3WBBA 5IDQA 3GDFA 5AH0A 1W30A 1Z0FA 3UMCA 1JP7A 1Q14A 3C43A 4O4HA 4PZDA 4TS1A 2OXTA 1OGYA 2NIPA 3U0VA 2WJJA 3M6IA 4D4KA 1X8KA 4UMFA 1KAOA 3PNVA 2Z57A 4K40A 1P0PA 4C0LA 1VJDA 5LQKA 2JH9A 1TVCA 1VYHA 3I2YX 4MW0A 4UBLA 4XQCA 1I24A 2XB8A 4J0EA 5FOSA 4G4IA 1S4MA 3PGKA 3IJ5A 3K1AB 2MSNA 1UDXA 2TMGA 5KSZA 2J0UA 5F51A 4DSOA 1H1LB 1AKWA 4A10A 3AERB 3HJNA 4M0EA 4JUDX 4ESHA 4J9VA 2FEKA 3GNLA 3CLVA 1U9ZA 3PUKA 3M4NA 4JEHA 3HDVA 5DOVA 4Y6PA 5H83A 3SXPA 4EVSA 3H5NA 4I2VA 4M88A 3S2ZA 1QPGA 2C5FA 2BP7A 2PLWA 3GJRA 4MVJM 4X20B 2QT9A 4U8HA 4A92A 4YJGB 4OK5A 1HL3A 1W48A 2VDQB 4BNKA 1BJRE 4NCJA 4BNGA 1ESMA 4FGKA 4JI4B 3TZCA 1A98A 2E48A 6REQA 3A9VA 4Y2YA 3QU5A 1A82A 2Q0SA 3EUWA 3TNJA 1JWLA 5AO9A 4KE8A 2QOEA 3OIGA 3D7SA 2WIAA 4CEIB 1P18A 1GVNB 3E05A 5E6SA 5ULLA 1ECCA 3FIJA 1GA1A 3RJTA 3ZQ4A 2OB2A 4BP8A 5BNTA 2NGRA 5CG2A 2WWHA 4I1RA 1NGSA 1NYLA 2I2BA 3HCFA 3IR5A 5CM2Z 2AOXA 4ZOQI 2NSLA 2H48A 3Q87B 5FJJA 1P2VA 2YWXA 3GEMA 1YQTA 3SFTA 3RCBA 3HEMA 2FWIA 4DG5A 4BS9A 4EKYA 1EX9A 3PSAA 4YAGA 2ZM5A 1KZGB 3WYGA 2DR2A 4NYIQ 2GAFA 1Q1EA 3KRTA 3QFRA 4TVSA 5BV0A 1EAYA 2A4KA 2BLNA 2YZNA 4R71A 1PTJC 4HDAA 2FG5A 1G9SA 1NYTA 5FPPA 3RYTC 3GFVA 1DC7A 5KEIA 4ZCMA 3L49A 3AHEA 3S5JA 4F8YA 2HWYA 3UXYA 1V5GA 5B7GA 4DAEA 1H23A 3JTMA 2JIZD 1RI3A 1K8RA 2Z1DA 5JXJA 1EG7A 5I9TA 2J59A 3AOEA 2GVDC 3R0XA 4XYMA 1PJ8A 1T1EA 3HVIA 1A3CA 1YDFA 2C4UA 2P9CA 3M4YA 4D25A 3D4NA 3STHA 2COEA 4C0BA 5IT4A 3B7WA 4UAUA 3W8FA 3ZQJA 1QG2A 3RS9A 2VEOA 5K4AA 1CZUA 3TSZA 5SICE 2G28A 4QOEA 1KF0A 2DKFA 3QEAZ 3QW2A 4NBSA 1KU0A 1MDBA 3A06A 3RS7A 5F1OA 2OORC 3LUPA 3I12A 2GB4A 3EGOA 4TSFA 4ZVRA 2XDYA 3OQBA 2ZJ0A 1SHJA 1E79D 4TT3D 1Z07A 3RYCB 4GZLA 3OA0A 2I9KA 3QX3A 4CN8A 3ABIA 3BWEA 2EP8A 2AR0A 5EG5A 2E4ZA 2N1BA 4BQRA 3WV4A 3DBHB 4KACA 4EOGA 3W04A 3KHUA 1JLKA 4Q7LA 3LDHA 4IXDA 4WLUA 2QP3A 4QREA 3R9XB 2GZSA 4XD7D 2QR3A 1T2CA 4MROA 3UIEA 4EG6A 1Z88A 2W2TA 2PBZA 3KDPA 2ZIGA 1DPFA 2JKYA 1SZDA 2H2WA 2BBSA 3KPJA 3O26A 4I1IA 4KTVE 1RP7A 2DWCA 4ZVNA 3ITEA 3KZCA 3H4IA 3BWCA 1E2LA 2VYVA 4NMMA 4H4CA 2MYTA 2C07A 1QVWA 1W4ZA 2CW5A 2Y76A 4S1TA 5BSTA 3RYFA 1ONBA 4AW9A 5GQSA 2QVLA 4S12A 2SNIE 5BRAA 3GLIB 2QL7A 3GQBB 2P78A 2PKRA 4NK4A 3MT8A 3HCBA 5I7VA 4DLXA 4AX8A 3DJYA 2JFBA 3A14A 4IGIA 1TEVA 2G5PA 3MLAA 4G1BA 1MCZA 3CN9A 4F2DA 4HTFA 4QDUA 1FYWA 2FWNA 3WYCA 5E4JA 3AVTA 1L9KA 3NHJA 3ONFA 4AJIA 1YFJA 3I8OA 2JGEA 4D9GA 4D96A 5FQOA 1Y6QA 4J0IA 1ENZA 2J07A 4PR3A 4Q4AB 2XVXA 2X7HA 4CF6A 1FRNA 4LGCA 4RVSA 4MIEA 4D3YA 2ZZKA 2JI9A 3W7VA 1RHQA 2FFJA 4KE9A 1U5BB 1LA2A 3STYA 4LTDA 2V96A 3OEHD 4FYMA 3WYAA 4ZOLF 2LR0A 3EXFA 2FQXA 4OKIA 4W63A 5FEUA 4LC9A 1LNSA 2PANA 1TUGA 1ZCBA 4MW7A 2XW6A 4TVKA 3ZWCA 2DGDA 4F86A 3ZG6A 2IXFA 4CM9D 1FYVA 2B2XA 4PXAA 3E7PA 2SCUB 2FHSA 3OT1B 3W9UA 2O2YA 2C2GA 4OATA 5ARDA 3TBFA 4CL8A 5JCPA 4LSMA 1I2ZA 1PL8A 1W5FA 2FN7A 4GM1A 2ZIWB 5CT8A 5B3LA 2M6SA 1L4KA 4NMHA 4BJ6A 2J46A 2P9JA 3F67A 1DOAA 1IG0A 3LUAA 3U7JA 3KVOA 1YJQA 2WNIA 3PRYA 4UM8B 2RHBA 1S7CA 2VRWA 2ZTUA 3CX7A 2I67A 5FLEX 4LRYA 4QGFA 1U2DC 2REOA 1KXJA 1J1IA 4YJ2F 1EK6A 3IUQA 5DHFA 4OHYA 4UMDA 4BLTA 1AXRA 4JC4A 4LG1A 2HPHA 1M34B 1XXHB 3KEQA 4HDOB 4I5IA 5B2EA 4P3YA 1NN5A 2KWIA 4C4ZA 1RBQA 3MLBA 3C3XA 3QX8A 2XECA 1XZMA 5A03A 2DETA 1GJRA 4OFZA 2CLIB 1PYOA 1O6BA 3KXLA 3OWOA 2J3JA 5KDLA 4CKBB 3WA6A 4ZZ2A 4EZEA 3NVAA 5IJ0B 4E2YA 3QYPA 4O8ZA 1XTUA 1EVJA 4NOJA 1DAMA 1O3YA 4BMZA 2PSHA 1SB9A 4E12A 1M5UA 5EHIA 5G40A 4EMUA 2EXXA 4RD4A 3OY2A 5AUNB 4F6RB 3BRCA 5K8UA 1XL1A 3C48A 3QBVA 2PR7A 2QRUA 1XTZA 5FPQA 1V48A 4TMVA 3CRVA 1U4OA 1KPGA 3BMQB 4BQSA 5AVQA 5A4IS 2HGSA 1CWUA 1BGXT 1YACA 2CLFB 1RQ7A 4W99A 1NR7A 4M4SA 2WFLA 2SECE 2YUIA 3MOGA 3PPVA 1O96A 2GZDA 3F47A 5CFOA 5L4LA 3DBRA 2FRXA 5E3IA 1N0UA 2AZDA 3DM5A 2FSVA 5JY1A 1WKBA 2IIVA 3SIPA 1F8FA 1EAMA 4G89A 2VRBA 4S3MA 2HCTA 3MRXA 1DCFA 2ZYAA 1NRJB 1PWHA 1J2TA 1W4AA 3C4JA 2WWIA 2Q8PA 4G26A 5CR9A 1OI2A 1EGVB 4EG0A 3TINA 5C37A 2IHUA 4EECA 2R87A 5JVDB 4RQUA 2QZ4A 3C8UA 5D3MA 3UV3A 1MUUA 2HNKA 4KPUB 3WFIA 1KEZA 2PX6A 2XSZA 3MSXA 1FIUA 1HSOA 2CYAA 1NV9A 5HILA 3HS3A 1W94A 1ZC3A 1C7RA 3EXEA 3GU3A 2D2EA 2NM0A 3L7OA 4DR2B 3EMBA 3OVMA 3ZI4A 4M8IA 2BZSA 3SOZA 1ZUWA 3PYXA 1XF1A 1QIGA 1WBJB 3G2QA 4NZNA 1O5OA 1H85A 2QN8A 2FR1A 4QYSA 3FLMA 3HL0A 3P20A 4BXOA 2RH5A 4JGBA 3BZWA 5LQUA 1QCDA 4IXNA 3P2IA 4X6LA 3OKAA 3GZNB 5EJ9A 5DSXA 3KQNA 2II6A 1DEOA 4GQIA 3TN7A 4BBJA 1QFJA 2GRAA 2XAAA 1ORHA 2WHRA 2FPXA 4AZ0B 2DUUA 1UODA 3ZZMA 3KQVA 2JFVA 4HNRA 2VAMA 4RDXA 2R1UA 3QFFA 2H29A 3FRHA 3R5TA 4GUAA 4LY0A 1R9GA 4IIYA 3SY8A 4C0XA 4MYSA 3FWPA 3AHGA 2CF6A 1JHZA 1LNZA 2DJIA 3GMSA 3KOYA 4MPPA 5E1OA 5ICEA 4ESEA 1R6UA 3T5PA 4JOBA 2W2KB 2ZR9A 3JRNA 3K9QO 2I7DA 3INNA 3LP5A 4CIDA 4DWVA 4IZOA 1JQKA 2V74B 4TKUB 3EODA 1M6HA 2CSUA 3D81A 1GV1A 1U2GC 3CUSA 3V2GA 5JQWA 3MUEA 2UZ4A 4KNVA 1V9LA 1R0LA 3K0EA 1Q3KA 2PD3A 3GXOA 3F7TA 3RK1A 2XF2A 4BX2A 1Z0JA 2C9ZA 3KSAC 3PENA 1I4TD 1EVZA 3JQGB 1CY7A 3R6DA 3A26A 1P44A 4X6UA 1M7BA 3NUZA 3NJRA 1K6MA 3T5GA 3WGVA 2QTWB 1V7CA 1VIYA 3BK7A 4BVFA 2XKAA 4JBIA 1IHYA 2CY0A 1M33A 1TFUA 3JY6A 5T64A 4YXWD 4ZEVA 5BYAA 3N8GA 4QLBA 1EFAA 2ZIXA 4QFDA 2C9CA 3DBLB 1KARA 1ZCFA 3OJCA 1NJFA 4PV7A 4BFSA 1I3CA 4NCKA 4ZAZA 4BMDA 3RT7A 3MJEA 2JGNA 5DYGA 3CRNA 1QX3A 1J8FA 1RRKA 2QAGA 1VI2A 2O8BB 3C24A 2J5BA 1RWOA 4QRHA 1TYEB 4OOFA 1DQSA 2YS6A 3P2MA 4O4JB 5FV7A 3SXUB 1Q15A 3U1TA 6AT1A 3CKMA 4RHXA 2FK8A 5IZCA 2GK4A 4G2NA 1OH7A 1NONA 3AW8A 1JA1A 2DRIA 4IOLA 5LIPA 3BB1A 4RJKA 4Y2HA 3VV3A 4CV0A 2OAQ1 2P9QA 4TMFA 3VOBA 5BSHA 3ZHQA 5LPNA 1TVKA 1GFIA 2NADA 4YRZA 3A7EA 1JNXX 1H6AA 5ALLA 4DN6A 2WUDA 3PVSA 2NUTA 3E84A 4X6YA 1UC4B 1V3QE 3KOWA 1SUAA 4G0ZA 3JAWB 2L18A 5JQGF 4R3NA 4BO6A 1K27A 3S6JA 2AXEA 1R9MA 1VLMA 3SI7A 4ND8A 4X65B 3FPLA 2BEUA 4RDHA 4KQXA 2OPBA 3MRVA 4LMPA 1JE0A 1QFMA 5IC6A 5JS8A 3C3YA 3AP2A 4JGIA 2YICA 5ALEA 4TMTA 2ZI9A 4N5IX 3BJZA 1TD1A 3TS1A 3PF9A 5FWYB 4QDKA 1O95C 3SX4A 1L4HA 4MEJA 5F33A 4IV5A 3HKBA 3GB9A 4K1XA 4FDLA 5EYPB 2JH8A 4XCVA 3ZU6A 4OQLA 3ZHUA 2RAUA 2Q6VA 3QIAA 1TEXA 4ER3A 5BN5A 4WZAA 5HFAA 1C7QA 3LQFA 1QG0A 2WIFA 4BQOA 3A6PC 3IELA 2PVPA 3ZWNA 2BT4A 3LHKA 1P5HA 2WSIA 1QBGA 2A0XA 1HC7A 4IWNA 1AQIA 4JI6B 3RFTA 4PWYA 2W9XA 5KWIA 1HV8A 2PUFA 3BG5A 1QMPA 2QVCA 4Q1EA 3PBKA 3EGXA 2XRFA 2R4TA 4Y30A 3MLEA 1RT9A 1VCOA 3RGWS 3VPXA 4G0WA 2J4FA 4E2XA 1YQGA 4Q3DA 3A1UA 4FHFA 4EI2A 3BS4A 1DX9A 1Y1PA 4YB8A 4UM5A 2YV4A 3VHXA 3IBTA 3WOVA 4RY8A 5K1ZA 4CI9A 3WAJA 1Z0ZA 9ATCA 1LWNA 1U1IA 3DULA 3OFNA 4ALNA 2QM7A 2MMGA 1HMYA 3FUWA 4LN1A 3WGTA 4QJBA 5B2FA 2H1WA 4LWZA 1LVUA 4M1QA 3BGIA 1PQYA 3TDNA 2VP3A 4DCMA 4ERNA 4UM7A 3LX5A 1DHRA 1P6UA 2CXTA 1QUFA 5B2ZA 221PA 2VBGA 5BR1A 5BNFA 4PAMA 3DWFA 4ENPA 5LKRA 3V8BA 1WQ4A 3ESDA 2FP4B 1JIQA 2HA3A 2WNHA 3MFYA 3R41A 4DDMA 3TUJC 5JNRA 5JCJD 3GPDG 1XEXB 3VTZA 4IIFA 4IRMA 2GXQA 2OECA 2QMOA 3ABSB 4OGWA 4WK4B 5D1NA 3RIEA 3HEAA 5J2UA 1LTHR 2C61A 2YY6A 4ZZIA 2ZB4A 1BYUA 3EZ9A 1UBNA 2DU8A 4WVFA 1FP1D 2PSJA 3BULA 1EWYA 3KQHA 3D5TA 2EKBA 3EEFA 3AVXA 3PJEA 3CBGA 3RVBA 2C59A 3L93A 5JYDA 5TY0A 3CU5A 3VU9B 2C3YA 3Q3GE 4HWKA 4U7PB 3ICOA 2HQOA 3EC2A 2CB9A 1L5NA 5J59A 3BAFA 3PQEA 3BCHA 4R69A 4QATA 1JLHA 3A1FA 2JLAA 3EVAA 5JWHA 4AJJA 1KDTA 1NT4A 3R0VA 4RAOA 1U1DA 1U5AA 5PGMA 4DKXA 3QHPA 4J1SA 3EEYA 2I34A 5IVDA 4BFVA 4FYPA 3ZV7A 4UJ3A 1A8SA 5I9SA 5DLYA 4CMAA 1B4DA 3G6KA 4U7WA 5DBOA 1M8FA 4ZPXA 2OP1A 5DM2A 5HEKA 3T06B 4ZVOA 4KIFA 4Z8YA 2V58A 4JEMA 2WI8A 5GMOA 4BX3A 4FJ2A 5FUWA 1EE1A 2OLEA 3E9YA 1YASA 1J20A 1H5QA 4HLCA 4I1VA 1J8MF 2OYCA 5EPOA 1I2MA 2HDNB 1KI8A 4PQGA 1LFDB 1JHDA 4Q3AA 3UPDA 1E1LA 1FS5A 2Q4EA 5IBCA 5FBHA 1IQPA 3NHBA 3O8CA 5MGBA 1GGEA 2IY7A 5D01A 3O8NA 1MIOA 4ZI7A 3KEOA 5C7IO 3DOIA 2EFYA 2JBAB 4RPLA 1RXUA 2RHDA 2FDRA 4NDZA 1V16B 1H66A 5IN4A 3A4MA 1VIAA 3IP9A 2RHGB 3EULA 1M1XB 4FJ0A 1BYIA 5IX8A 5EHXA 2BGWA 4DL9A 2O3TA 2FFHA 2FN4A 3VYWA 3HRIA 1E94E 3HLKA 5JSUA 1IXYA 5IMSA 2WOOA 3EXHA 3DQPA 4IDAA 3W1VA 4B35A 4DBZA 2FQQA 2VDVE 2B69A 2CFSA 1JQBA 3L8DA 5E8JA 3DTTA 1K66A 2IEYA 3KYJB 3LD9A 1RWBA 4M0CA 4Q93A 3BSFA 3NUQA 1U2EA 5B1DA 4IUYA 3RW9A 1B8UA 5HZKA 1HNXB 2XXAB 4WY5A 1IM5A 4IW3B 1NMSA 4K46A 2JD1A 3EF0A 1P2FA 5ESRA 2O2GA 3AK4A 1OYWA 5LU8A 1D4ZA 3TB6A 1B8OA 1OZFA 1GGFA 1L4YA 2X3YA 1BWRA 4NCNA 2OXEA 1ZD4A 1JZSA 1YMQA 3VC1A 4BC0A 1QVVA 3BXXA 2KJQA 1C3OA 1NYRA 4GYKA 4OQFA 1CUYA 1KMHB 1R0XA 4MCIA 3ZZNA 3ZJVA 3PHCA 1N7HA 4BB6A 4PS1A 2VDUE 1DWPA 1HLFA 5KJCA 2W8BA 3L4JA 2HSEA 1JU3A 1PNTA 3C5VA 1QK5A 2B1QA 2HPAA 3E9ZA 4DYHA 4ZDJA 2QLLA 2Q27A 3B3AA 1YBMA 1LK7A 2BOVA 4PLCA 1D1QA 2CYCA 4HK4A 4M0DA 4UTVA 1AC5A 3TXAA 5A5DA 4H4EA 4BMNA 1C1YA 4KO1S 1J2JA 3S2EA 2YHIB 4RLSA 2PZFA 3QVTA 4KN8A 4JVMA 2R6ZA 1QKIA 5T3YA 2JCXA 1XZJA 2W4MA 3NBAA 5EI5A 4Z3KA 2ROQA 3E7FA 4GI2A 3BSSA 1IN5A 2XEXA 3BWBA 2ZYRA 4NNJA 5BUQA 1YJ5A 3W9YA 1NVFA 4YR9A 3SFZA 3V3TA 2OEPA 3RUEA 3VAZA 1KI7A 4XB6B 2W83A 3H9JA 4P2BA 1YOVA 3Q2KA 4O63O 3AVWA 3N8NA 1XZDA 2TS1A 4LTMA 3ZH9B 2P6OA 4R7ZA 3OJFA 5U1PA 2MDTA 3BD8A 2XDAA 4KW7A 4B75A 3EF3A 4ZTUB 1NQTA 2CDAA 4R8RA 5B7PA 3QRWA 3FYUB 3K96A 3KDAA 2I54A 5CP8A 1V5FA 1VBNA 3RI3A 5C7LO 4AF7A 1YXMA 3PFBA 1QOQB 1Q2XA 2AMJA 4DRYA 4GIBA 2V3CC 4I3HA 3UJAA 1IMOA 1H0SA 2DPYA 2EX4A 3HKEA 4YRFA 4P82A 1E0KA 5TNXA 1QH1A 1PJQA 2CJFA 3VKWA 4ZEWA 1P2GA 2TYSB 3NMUF 1V26A 4UQLA 1B6RA 3MXTA 4MV1A 3RRJA 1RKQA 3Q9LA 1U28A 3D4LA 2Q4RA 1J0AA 2IOYA 2FYTA 1CZKA 1JSZA 1Y7PA 4Y1RB 5JT1A 2IS6A 1D9ZA 1HI9A 3AY0A 3BKWA 3EA0A 3FMFA 1E2EA 4FE7A 4NAUA 1L7AA 2WD8A 3SYRA 5A6VA 3LCMA 4RKRA 4WFQA 3K8YA 5D3QA 2OSVA 3FI9A 3MD9A 1NMQA 3ZVRA 5JD5A 1RLIA 4ETIA 2E4UA 3ZI0A 5LQDA 3KQUA 3OFKA 2IBSA 2LUOA 3VPHA 1CDEA 2XV1A 3C1AA 1P7PA 3F7MA 4S1OA 4MYCA 4F6LA 2P1RA 4C7XA 1RM4A 4MV3A 2IKQA 2B4TO 5E0KB 4AJLA 3KT6A 2QRVA 4GAEA 3OE7A 3RYHB 3SJBA 3I2GA 4E11A 4GUDA 2X9NA 3GFTA 2P68A 1V2HE 4R2WA 3JVEA 5A5FA 1XPRA 5GY7A 4IUDS 3L02A 1UBCA 4GQAA 4D9JA 5HZGA 4GR5A 2FFQA 3J7AC 1USWA 4TN5A 1U0FA 5CXQA 2O8FB 4BMVA 3VNUA 1DG1G 3LO8A 3QEMA 4MAMA 4JI0B 1NC1A 2A5GA 2VDRB 5JBQA 1TXGA 3VYVA 1ZI6A 5KYVA 3H97A 1OH5A 3M3HA 3L79A 2JIPA 4HNGA 3BXOA 1TM5E 3SF8A 1QG6A 3IMFA 5CJ2A 3AFIA 2XXJA 1G98A 1ML3A 1W5BA 3W2GA 5BN1A 1GN8A 4Q3BA 3G0IA 5GVRA 4ZEOA 2GXAA 4MA4A 2XUHA 3KK0A 4YXFA 4NMXB 2NZJA 5DOZA 1GSIA 3RWBA 4N6NA 4MV8A 1NX6A 1WMAA 4TLBA 1AQ6A 2D13A 2JLCA 1PZGA 1OLOA 2XZTA 1Y81A 3ACCA 2J3LA 1B26A 1TEHA 1N1EA 2PN1A 5G3ZA 5H59A 5LQCA 3OQOA 1C80A 2ODQA 2VP2A 1NE2A 2QE7A 2YXBA 4RH3A 2PUTA 4CT5A 1UFQA 1P0FA 4CCAA 1GPBA 4J94A 2D06A 1P1JA 3BD7A 5CAEB 3FZNA 4QTYA 2UVDA 1O6ZA 1LI4A 1SQFA 1HTTA 2YW9A 2ZUSA 3P9QA 1A8HA 3GRKA 2C04A 5K3BA 2C5BA 1CY2A 4LDRA 5BT9A 3DAGA 1JPNA 4GXNA 3MWYW 3AUUA 1B7GO 3VPFA 1OFHA 4DCJA 1ADCA 1E3LA 1PHRA 1Q7CA 1BS1A 1CS0B 1BN6A 1NF9A 4IO1A 2NW6A 5LBUA 2Q5EA 3A1NA 5BVGA 1VCNA 4S1VA 2RJ3A 3WIUA 3CRZA 2I1VB 4JYMA 3KNZA 1DAGA 2NTVA 2WBLC 1YL5A 3GWZA 3E9QA 4L50A 2PO5A 3VVCA 4JBWA 4U5XA 4Y67A 1W7AA 1SCAA 1K06A 2A3NA 1FFHA 4OHOA 5JSZB 5LMZA 4MUGA 4P31A 1WTCA 4D0RA 3CRQA 3K1AA 3MT7A 5EMMA 1YDGA 3PLNA 5B3KA 2BV3A 4IXTA 4X8LA 1G4HA 1U9JA 3FA2A 3GD7A 3PHJA 1QDLB 4YTEA 3AERA 5KX5B 3GYGA 3KSRA 3LCRA 3O91A 1VFPA 1EWKA 5FBVB 1ZR4A 4OQ4A 2ZTMA 3TRHA 2C4VA 2D0PB 3DFUA 3WHLA 4JT2A 4YMVA 3H5IA 4HX9A 4N5NA 3SBXA 1ZWKA 1KK2A 3OAAA 2VS1A 5JNVA 3GLFB 4V03A 1X7YB 3TZKA 5GWXA 4YJGA 1UKBA 4H6PA 4QFBA 4RADA 3V34A 3C3AA 3WA7A 2PGJA 1G17A 1Y3DE 1Z62A 3ANTA 3I61A 2E4VA 2AJBA 3QLUA 3IR7A 3ZV4A 5ED4A 4LF5B 1HE1C 1PR6A 1XZBA 1D3AA 4J0DA 1CVRA 5CUQA 3CVXA 3LYUA 3LPLA 9LDTA 1PO7A 3BE8A 3N8IA 4QWMA 1Q7TA 3JTEA 1R8QA 4A26A 1UL1X 2J30A 1Y1TA 5BW6B 2NXEA 1Z7WA 3AETB 4WJZA 1U9YA 1MRSA 4BZPA 1J21A 5ALGA 4EK9A 3H9QA 4NY1A 4ZO6A 4WXYB 4F3KA 1JTFA 2JFUA 1B93A 3N8DA 4MW6A 4X1OA 2BKLA 2JCVA 2YQZA 1XMXA 1GIAA 4BLPA 4MGHA 1OTYA 1U0NA 4CIBA 1HPLA 4YY3B 5IJWA 1OF1A 2J87A 2VJYA 1E9VA 5A71A 3AZQA 1WS6A 1BW9B 2R8EA 1T29A 4Y9RA 5FBWB 2EFJA 2VI5A 3OTQA 4HH0A 1UOPA 2QHXA 5K3CA 3IP1A 4JL6A 4IIEA 2F48A 1RQ2A 1IH8A 1HMPA 3QE4A 2FMXA 2UVPB 4A0SA 1UEIA 2A8YA 2NAFA 4R16A 3GARA 3L7AA 4IHJF 1NXWA 2ODBA 2W2LD 4TKZA 3IEVA 1NAHA 1FQWA 4Z0HO 3OOJA 1NP6A 2IKSA 1TL7C 3L4EA 1M74A 3V8NA 3G17A 3HCRA 4DUGA 1XQ1A 3MHPA 1K3TA 1Z2CA 4ABTA 1W49A 2XGSA 3BJIC 3G2KA 1JT2A 3BTSA 3FSGD 4I99A 1Y82A 3IKMB 4DQVA 4MUIA 3PL1A 2CZQA 3PFNA 4TLCA 4F5YA 5LYJF 3H83A 3CPJB 2IZ0A 2D5CA 3K9FC 1NMZA 4P86A 4NESA 2D1SA 3IVMA 3PIIA 5CK5A 6Q21A 4BGDA 4UUAA 621PA 3T38A 2VXBA 3I0ZA 3U4AA 1VE6A 5BN4B 1YULA