1VLQA

Crystal structure of acetyl xylan esterase (tm0077) from thermotoga maritima at 2.10 a resolution
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
322
structure length
322
Chain Sequence
AFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords acetyl xylan esterase
publication title Functional and structural characterization of a thermostable acetyl esterase from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 122
structure length 322
sequence length 322
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vlqA00
5E4TA 3VDXA 4EY7A 1MNQA 3HC7A 2Y6VA 1YA8A 3DJYA 4J7AA 1AQLA 3AZOA 5AP9A 5JALA 4TGLA 4UHEA 1FFBA 5HKBA 1LPAB 2WIKA 2C58A 4G4JA 5HZGA 4ZV7A 5K3EA 5JIBA 1CQWA 1O6FA 3ESAA 3IUQA 4DSZA 3W05A 4UBKA 4N8DA 5IVDA 1YAJA 3JW8A 4ZI5A 3I1YA 1F6WA 1FJ2A 3IDAA 2Y6UA 4L0CA 3U0VA 4EZIA 3C6ZA 2XQGA 3M3DA 1P0MA 3WL7A 5FXMA 1MX1A 3AILA 3QMVA 1G66A 4ZREA 2QR5A 3GZJA 1OXMA 5AKHA 4KEAA 2AJCA 3A2NA 1EI9A 1B41A 4ARBA 2O7VA 1FFCA 3UUEA 4AO8A 4JYPA 2R11A 1Z68A 2QZPA 1JT2A 2VTVA 3PFBA 1TRHA 1ACLA 5AHXA 2XDWA 4BC0A 4QLAA 2HADA 1A7UA 3VJMA 5AO9A 2RONA 1ETHA 1ODCA 3BXPA 4MQMA 4BB0A 3SWWA 4X93A 4KAJA 3HACA 2PU7A 1LPBB 3NGMA 2VT7A 5AOCA 3WK5A 1LBTA 2DHDA 4B0PA 4UBJA 3H1AA 3ICVA 3O9VA 4Y2VA 4UFOA 4PNZA 1ZGBA 4GECA 3DOHA 1W4LA 4KE9A 3FLBA 3PI6A 2JGEA 2XUQA 1LNSA 1XQXA 1HL7A 5IVKA 4H7JA 3KOOA 4YPVA 4X71A 2RHTA 3GUUA 4IQ4A 2G5TA 2HA2A 2QMQA 4EHBA 3PUIA 5JZSA 5ALGA 3I6MA 5JZ9A 3IA2A 1VXOA 4AN0A 4FDMA 1H2ZA 2XUIA 2WFLB 4AXBA 1EDEA 2BCEA 3LCRA 5AIAA 5EI5A 1U2EA 1K8QA 4H7FA 2QUAA 5EFZA 4AQDA 5EHZA 3R3YA 2GYWA 2WJ6A 2WQZA 2BJHA 4LXIA 4DLNA 3BF7A 5SYNA 3WK4A 3NWOA 1AURA 4WY5A 4X3CA 1EDDA 2QVBA 4K2AA 1O6GA 3WZLA 3C5WP 1DQYA 2OQIA 4C87A 4UFNA 1X70A 2VEOA 1LLFA 2FJ0A 1CPYA 1GQSA 4B81A 3WK6A 4LHEA 2QM0A 1JJIA 1ZD2P 3G0CA 5D7BA 1C7JA 2OG1A 1QIMA 2WTNA 2FX5A 4PO3X 1CVLA 4IO0A 3HXKA 2O2GA 1XLVA 5JASA 4E14A 3STYA 5CTAA 1UT6A 3EF3A 4B83A 5CT9A 2IIVA 2HFJA 4H35A 2K2QB 3G02A 4MEAA 4QDTA 3WWCA 5AOAA 4FHZA 1DWOA 4FFVA 5HF9A 1YSCA 1CUWA 4OB7A 2WJ3A 3DOIA 3MUNA 5LZ7A 4C4ZA 5AI8A 5CXUA 2PPLA 4L3WA 2GZSA 3BL8A 3R3WA 5DTIA 3EQ7A 3B12A 1CQZA 4G1FA 3ZLTA 4B80A 3WKAA 2WUEA 4HAIA 4UUQA 2XMBA 3FBWA 4EY6A 1VLQA 2JGIA 5HQ3A 1G4HA 4M0EA 4CCYA 5AOBA 1MAHA 3H2GA 3PFCA 3SC2A 1MTZA 2XMDA 1A8SA 4IH9A 3D4LA 3DYIA 4BVKA 2GZRA 1IVYA 3ESBA 1GKKA 2H7CA 3IURA 4ROTA 1VZ3A 1HQDA 4B0OA 3DNMA 3O4GA 3FOBA 1E89A 3KSRA 2QRUA 3HSSA 1UOOA 4LYDA 2WIGA 2X5XA 2QS9A 3N2ZB 3QPAA 1P0QA 4S0XA 3G9XA 4UHBA 1XRPA 1E5TA 3B5EA 3PE6A 3AZPA 4H77A 4QWMA 1DU4A 2WHPA 2XMSA 1DT5A 4CCWA 2OLEA 1JMKC 5LP1A 5A6VA 4QDOA 5JAHA 1USWA 4DTCA 4AX4A 2VF2A 1P0PA 3ED1A 4BBZA 4X6XA 4OB6A 3N0TA 4L9AA 3OPMA 4GLBA 3LIIA 2WFZA 3QYJA 4GI1A 2AXEA 5D3ZA 5C81A 2QXTA 2WIFA 1FFDA 4MWSA 3C5VA 2WLSA 4BAGA 1Q84A 4P92A 5AM4A 4OU4A 2VQ6A 3KDAA 4AMYA 3WL5A 1VJ5A 5DNWA 1TCCA 4Y2YA 1L7QA 1ZJ5A 2ZJ7A 5EHXA 5FDFA 2XUOA 5IVIA 4U2GA 4XVCA 1CUCA 4MEBA 4FBMA 2AJLI 5HK8A 1JU3A 3SX4A 3ANTA 4EY5A 4EBBA 5AM3A 5AK3A 4X00A 1QO9A 2JGLA 5DLPA 1TK3A 1D07A 5C8XA 4RE6A 1XLWA 2VAVA 5LYYA 3KWFA 3QPDA 3BIXA 3QBJA 1TIBA 1WCYA 2OAEA 4QDZA 4LXHA 4DGQA 1ODSA 2H7XA 3JYHA 3M82A 1MNAA 1AGYA 2XMQA 1CIJA 5ALZA 3C87A 1BS9A 1DT3A 2VJAA 3F9CA 4LIPD 3GELA 1W6RA 3CCCA 3DD5A 3E4DA 2B61A 3MUOA 2HU7A 5ALIA 4X94A 4CIBA 3EIOA 2HA3A 5AI6A 4AZ3A 2Z3ZA 2BUCA 4W1PA 4X85A 4JYMA 2WG2A 2QT9A 4QWWA 3AIOA 4FBLA 2OGZA 3HEAA 3I2HA 2PSJA 1UK8A 4GXNA 4A23A 2GBCA 3PF9A 2XE4A 1N1MA 4UBIA 3FAKA 2XUJA 2C5GA 1ZI9A 3HLKA 4Y2RA 2P8SA 3H18A 3D0KA 5JD4A 2YASA 4NS4A 5KBYA 4O08A 2I3DA 1MN6A 1QIFA 2CJPA 2XUKA 4J03A 5AKIA 1DWQA 1R4ZA 5AICA 5JD6A 4CG3A 4U2FA 5AKJA 3D3NA 1EB8A 3WWDA 2OPHA 3H1BA 4H7IA 1N5RA 2ECFA 3WWOA 5DYTA 4B7ZA 2JGKA 3LS2A 4M0FA 1WPRA 3G9ZA 4RGYA 4P08A 4AO6A 3L1IA 3O4IA 1X2EA 1K63A 1AUOA 1JMYA 3C6BA 4UBMA 4MYDA 4ZXFA 2WUFA 4PQEA 4MQLA 4W9RA 3R41A 1IMJA 1GKLA 5FUMA 5K3FA 1CUJA 4FLMA 1NU8A 1F0PA 3H04A 4BTVA 3R3ZA 1WHTA 3T4UA 2PKYX 4DMHA 3WZMA 5FRDA 3D59A 2XUFA 4U2DA 1YAHA 2CUTA 1MJ5A 1E8MA 3C8DA 2PSDA 4PSCA 2V9ZA 3V1LA 5ALWA 1YR2A 5AM0A 3H17A 4DNQA 1GPLA 2HHAA 1AKNA 4K5QA 3STUA 3WKCA 3STTA 1VZ2A 4WCVA 5AK4A 3V9AA 1T2NA 3E3AA 1IZ8A 3MVEA 5KREA 1GZ7A 2XQIA 5LKRA 1T4MA 1XZDA 4OYLA 1SCKA 1GPNA 4B85A 5ALDA 3C8HA 3O95A 1VOTA 4Q3KA 1ZD4A 2OXEA 1YB7A 5HFAA 2ORYA 1TAHA 4FLFA 4BAZA 4DM7A 4B9EA 5A71A 3IUJA 2J3QA 1YS2X 2HA4A 1H23A 1E8DA 4DSAA 2VATA 4X97A 3FYTA 1ORWA 1CUBA 5ISMA 1NU6A 4Z49A 4BDSA 4BCCA 4WFIA 2X76A 3D2CA 3FWHA 2XLCA 4GDMA 3WYNA 1TCAA 3F67A 4X92A 2AJDA 5K3CA 1QTRA 3G0GA 2G63A 1L7AA 3VXKA 5LIPA 4H7DA 4OSEA 4N8EA 3BJMA 1XLUA 1JI3A 3PDCA 3U1TA 1XFDA 4J3JA 1CUIA 4UHDA 2PUJA 4F21A 1CUHA 1QO7A 5CH5A 4QDUA 5C8ZA 2QKYA 4GWLA 4EY8A 3CN9A 3FYUC 1WM1A 4UFPA 5ALVA 2ZJ6A 5K5EA 1CV2A 5H3HA 4G8CA 1GT6A 3STWA 1XZGA 4N5HX 5YASA 5C7YA 3BDVA 2WUDA 2B9VA 4W1RA 2VA9A 3ESDA 2QTBA 3AUKA 5FOQA 2WG0A 2DSNA 3GFFA 2DR0A 1WB4A 1XRLA 2VAXA 3VISA 1PV1A 5CH3A 1CUSA 3O4HA 4FFWA 5T4BA 2HA0A 5D3KA 3M83A 4Q82A 4Y7DA 1Q0ZA 3PF8A 1LGYA 1P0IA 4LYEA 3DCNA 5K3DA 1UOQA 2BUAA 3LLCA 3F98A 2HU8A 5AKLA 2WJ4A 2ZYSA 4G8BA 5AI9A 1YA4A 3WKBA 5ALYA 3WK8A 3LIPA 2XLBA 5HFNA 5CH8A 2HA7A 1L7RA 2PM8A 1FFAA 1BEZA 2PU5A 4H7EA 1JFRA 2HL6A 1THGA 4BVLA 1UKAA 1EB9A 3Q8WA 5LZ9A 5A62A 1GPKA 1G42A 2GBFA 3KXPA 5I9IA 3RK4A 4F60A 2WILA 4X7BA 3I2IA 2HFKA 4PSDA 4CCYB 3W9UA 3FYUB 1E8NA 1WB5A 1KEZA 5DNVA 3V1KA 5ALLA 1LZLA 3RKSA 5ALQA 2WSLA 2HM7A 1DX4A 3FLEA 2WFLA 1VXRA 5CBKA 2BGRA 2ZYIA 3DQZA 3WL6A 1HLGA 4B6GA 1BE0A 1EVEA 2HDWA 1XQYA 5ALSA 3BDIA 3G0BA 4BC1A 4C4XA 3QMMA 2PSHA 4HRXA 2LIPA 2EDAA 3G9UA 4KRXA 1XRQA 4BZWA 1ORVA 4BVJA 2AJBA 1MU0A 4J0KA 5AM1A 3DL7A 1SOMA 3BF8A 5AKKA 4ZWNA 4X90A 1XZKA 1XZLA 3YASA 4BRZA 3L1HA 1CUAA 2E3JA 5HCUA 4ETWA 3B3QA 1QJ4A 2WFMA 3FSGA 4WFJA 3ZLVA 4AO7A 5AI5A 1UFOA 2FJPA 1VA4A 1XZBA 4K6GA 1ZI6A 3P2MA 3FCYA 1CRLA 4ZRDA 4INZA 2HU5A 5CT5A 5ALMA 3R3UA 4GHWA 4WDRA 3ZLUA 5EIHA 3BJRA 1QIGA 3QH4A 1R1DA 5HK9A 3ZV7A 5A7FA 1YB6A 1HKHA 4QZVA 3S8YA 1J2EA 3A6ZA 2YH2A 2BAGA 2NW6A 2EEPA 3AFIA 3ZI7A 4OPMA 5DWDA 4FLEA 4QNNA 1N5MA 3E1GA 4H7KA 2D0DA 1VE7A 2C0PA 5D6OA 4U2EA 4C88A 1A8UA 2CBGA 3KWJA 5ESRA 5HKAA 1ZIXA 1CUEA 3FCXA 2FUKA 1AX9A 4HXEB 2CKMA 1R9NA 3I6YA 2IX9A 3R3VA 2V98A 1CUUA 3IVMA 1CEXA 3OURA 3H2IA 3PICA 3S2ZA 2D5LA 2VJBA 1Y7HA 5KWJA 4G9EA 4W1QA 2QJRA 4KE6A 4WJLA 1XRRA 3VVLA 4Y2UA 1K4YA 3WIOA 5JD5A 1F0NA 3WK9A 3G9TA 4G4GA 1ZICA 5BV7A 4QDXA 1MO2A 2JEZA 3CCBA 3QZUA 4E11A 1G5FA 5AKZA 5JANA 3V48A 4DNPA 2H1IA 3C6YA 4I19A 3CN7A 5JZBA 1ZGCA 3JWEA 3STVA 2OQVA 1EVQA 3DYVA 3KD2A 5JAOA 1Q83A 1WPXA 2RI6A 1EK2A 5DTJA 5CT6A 1RWQA 5T4HA 5CMLA 4AMZA 4C6HA 5EIEA 5BOVA 4XX1A 3WLAA 3R0VA 1EX9A 1S8OA 1DTEA 2Z3WA 4H18A 5ALHA 4P9NA 3I2KA 3H19A 4EA6A 2XMGA 2I78A 2YXPX 4K6HA 1J06A 4CI9A 1CUVA 3LP5A 3WMRA 1HDEA 3IB3A 1CLEA 4G5XA 3W9BA 3FSGD 4LXGA 4D9JA 2VSQA 3HYSA 5JADA 3TEJA 1LZKA 3DKRA 3WL8A 4MWTA 2ROQA 5T4EA 5E4JA 1DINA 1Q0RA 5ALNA 2BGNA 3OOSA 1H22A 1HPLA 3WI7A 1R9MA 4HRYA 5I7UA 2JGMA 4DMKA 1SC9A 1WHSA 2X8BA 1XQVA 3FVRA 4HXFB 5JAPA 1XZAA 2C5FA 1IUNA 1KU6A 3G8YA 5AM5A 3K9BA 5LZ2A 1EH5A 4BATA 5AI0A 4HS9A 3A70A 2XT0A 2ZVDA 2HRRA 5ALPA 4B9AA 3G0IA 3DEAA 3DDUA 2Q0XA 2WHRA 5DJ5A 5A7HA 4C4YA 4X6UA 1LPOA 4J0JA 5EHNA 3IULA 4MJ3A 3ICWA 1KU0A 4TVKA 4DIUA 5LZ8A 4WY8A 3W04A 3FVTA 3D2AA 4HZGA 4X95A 1X2BA 2GYVA 2JGJA 2WIDA 1RP1A 1J1IA 2O2IA 1XKLA 2XUAA 3WA6A 5F4ZA 3DLTA 2W6CX 3HJUA 2Z8XA 1JJFA 1UKBA 4ITVA 2PBLA 4G4IA 5I8PA 2O7RA 4BZZA 3VVMA 2XQJA 1Y7IA 1XROA 4FKBA 3VJLA 4UBLA 2VJDA 3D2BA 5ALEA 3ILSA 3TGLA 1QLWA 1H2YA 5AKGA 3BWXA 4RNCA 2B20A 4P93A 1TCBA 3DL4A 5AM2A 5FV4A 1ZIYA 4QE3A 2BFNA 4KR0A 4FWBA 4WFKA 3A2LA 1R50A 2XUHA 4J0GA 4YASA 1A88A 4CG2A 1WOMA 5SYMA 5CXXA 5K3BA 2WU3A 4ZGBA 3GROA 3PUHA 1HBJA 1LPMA 3HZOA 1WB6A 1CUZA 2ACEA 3WYDA 4J0IA 4XIIA 5AI4A 2I03A 3EQ8A 4J0HA 5T4FA 3O0DA 3IIIA 4N8SA 1UK6A 1UOPA 1R88A 5CT4A 5CT8A 5IH7A 2JBWA 1K5PA 2HIHA 5CURA 4QEKA 4I4CA 1EK1A 4WDQA 3WK7A 4UPDA 3G0DA 1EA5A 2ZSHA 5IKXA 2QUBA 2PX6A 2CEKA 5JAUA 2W22A 2ACKA 4EB0A 1A8QA 4FMPA 1ZOIA 3R40A 4DYHA 3ZPXA 2PSFA 3ANSA 1YCDA 1PFQA 4BCBA 3SK0A 4K6KA 1UKCA 5LZ5A 1U65A 1Y37A 3A2MA 4H0CA 1QIHA 4UHHA 5ALFA 1C4XA 4PV7A 2Z8ZA 1XQWA 2R8BA 1C7IA 3TJMA 5A2GA 5HF8A 4E15A 1W75A 1XKTA 1ACJA 4IH4A 1CUYA 3O4JA 1OCEA 4FNMA 2C0QA 1MT3A 4UHCA 2XQFA 2JEYA 2J4CA 3F8SA 1IUPA 1QIDA 4PSUA 3FNBA 1GGVA 2XUPA 4CIAA 3C70A 4BE4A 4GBGA 2DQYA 3EBLA 4G9GA 1ODTC 4QLOA 4BRSA 3I6ZA 4OD0A 5EGNA 2XQKA 5A7GA 1ZI8A 3OTQA 2PUHA 4HXGA 5HF6A 3IBTA 3I2JA 2OGTA 5AK5A 1TKRA 1JJBA 1AMNA 1EINA 1XZMA 4KRYA 1XRMA 3GA7A 4F5ZA 4IH1A 1FFEA 2ZYRA 3W2TA 5AKEA 4A5SA 1QGED 5IVHA 4Y2XA 2J4FA 2EDCA 3NUZA 3NOXA 4J0DA 4A16A 2UZ0A 3WJ1A 5AKXA 3K2IA 4KE7A 2C7BA 1OILA 1RYYA 4TPKA 2H7YA 3RLIA 1VE6A 4I3FA 2RAUA 3TRDA 3H2KA 2HA6A 3HI4A 2XB6A 3F97A 3AJAA 3O9MA 1IZ7A 1XZFA 5AJHA 3QVMA 5HQ3B 5AKYA 1QIIA 1LPSA 4L72A 1QOZA 4YK7A 3H2JA 1M33A 4DNFA 3WJ2A 3V1MA 1SFRA 4UHFA 2DCMA 3AZQA 2RIPA 4Q1VA 4UBOA 2OCIA 2CB9A 5CRIA 2WHPB 3EQ9A 1GQRA 4XWGA 3R3XA 4MYSA 2WUGA 5DYWA 2IITA 1BN6A 4CFSA 1U4NA 2WU4A 3T52A 1CUGA 1XZEA 3I2GA 4Y9SA 5HF5A 4BE9A 1FSSA 1K6EA 3VJKA 3WKEA 5DNUA 2WG1A 2V97A 3BE8A 2JIDA 5EHQA 2Y2VA 5JARA 1BRTA 4U2CA 5AIBA 2ZSIA 4B84A 3OC0A 3RARA 1VA5A 4BDTA 4C01A 4UBNA 1W76A 1THTA 3M81A 5FPQA 2C4HA 2ONCA 2GBIA 2Z5GA 4GEGA 4LKOA 1YASA 4KJXA 4J0CA 1EXWA 2QOEA 1CUFA 4U2BA 1JU4A 3AIKA 3FLAA 1CR6A 3FYUA 1ZJ4A 4OYYA 5LZ4A 1DWPA 1SCIA 3D7RA 4PW0A 4DMFA 4Q34A 1R3DA 1E66A 2G4LA 1PJAA 2VJCA 4KE8A 1LPPA 1W1IA 3V1NA 1UWCA 1E3QA 2OCGA 1NX9A 4GW3A 1QZ3A 2Y2UA 3QITA 4BTLA 1QFSA 5ALKA 2CZQA 4FOLA 3I1IA 4Y2JA 3AIMA 1J07A 2XMZA 3Q0TA 2AJ8A 4N5IX 4X91A 2XMCA 2XMRA 4EY4A 4BCDA 2J3DA 4AZ0A 4H7HA 4Y2SA 4BP8A 2DHEA 4F0JA 2WTMA 2OCLA 3G7NA 2ZJFA 1EHYA 1UXOA 4NZZA 3D5EA 1SCQA 2BUBA 5ALUA 4OUKX 1BEEA 3QPCA 4HVTA 3MGAA 4M0MA 1DQZA 1BCRA 3C43A 4HTAA 3L1JA 4BYMA 2OAGA 2WKWA 5FP0A 4QA9A 1QTIA 5E2IA 3WWEA 7YASA 1F8UA 3WIBA 2PL5A 1BCSA 3K6KA 1LBSA 2VT6A 2QJWA 2DFPA 3H0CA 1U8EA 1YS1X 5FPPA 2PSEA 3UUFA 1I6WA 4RPCA 3GBSA 4KAFA 2WIJA 3IUNA 2JGFA 5KWIA 3DKKA 4AB1A 1XZIA 5C8VA 3WA7A 3IUMA 3QM1A 4W1SA 1XZHA 3H2HA 4Q3OA 1MAAA 1H2WA 5LKAA 4Y2PA 5AH0A 3VKFA 3AINA 5JATA 1GXSA 5BWCA 3BIWA 5ALJA 4EUSA 1QFMA 5ALXA 4OCZA 2XUDA 4IHAA 2HA5A 4JEIA 3OM8A 1ZD5A 4Y2QA 2CMFA 3HABA 3WKDA 1BROA 1UZAA 3X3HA 1QONA 2GYUA 4V2IA 1DX6A 1EDBA 4PF1A 4NVRA 4KACA 1QIJA 1H2XA 4Q05A 5LLSA 1QIKA 5ALTA 2G5PA 5CW2A 3WQHA 1XZJA 1CFJA 2Y1KA 1N8SA 4RE5A 4ZV9A 4FNGA 3QMWA 4Y2TA 5JYCA 1MPXA 2O2HA 4MXDA 3WWPA 3ESCA 5AK6A 5K3AA 1JKMA 4AN1A 5FLKA 2ES4A 2JF0A 1ISPA 1TQHA 1AZWA 2ZYHA 4G8DA 4DMCA 4BP9A 1XRNA 2YYSA 2WM2A 4XJVA 4JUIA 5K3FB 4B82A 2DQZA 2V96A 5ALOA 1B6GA 2XI4A 3DS8A 2WHQA 2RGUA 5BWBA 2OCKA 1XZCA 4KYVA 4JH0A 4OU5A 3ZWQA 3STXA 1LPNA 4Q3LA 4ARAA 4NMWA 3RM3A 3OG9A 4YX9A 3HRHA 1VKHA 4DNOA 2BKLA 5ALRA 2PVSA 5E4YA 1UK9A 1BU8A 5FKJA 4FTWA 4C89A 1BN7A 2B4KA 1MX5A 3CXUA 4CG1A 1ZD3A 4BAUA 4W63A 2H9YA 3W06A 2XUGA 5J3JA 3I28A 2OGSA 5EIAA 4E46A 3C45A 2GBGA 1UK7A 1QIEA 3C6XA 1IUOA 3E0XA 1CUDA 1AC5A 1QE3A 1MX9A 2I3ZA 6YASA 1CUXA 5DYYA 3I2FA 4JNCA 2DHCA 3F96A 4X6YA 3UMJA 2HRQA 4KAAA 1W52X 2QXUA 4OB8A 2RHWA
chains in the Genus database with same CATH superfamily
4I46A 2VUTA 5E4TA 2QRGA 3VDXA 3VMMA 4EY7A 1MNQA 2B1IA 2ZEJA 2Y6VA 3F71A 2JLQA 1ZITA 3HC7A 2WYIA 4NU5A 4FOOA 2L0XA 1PKEA 5FNVF 4LRTB 4W5WA 5EIWA 1RQPA 4IEEA 1AN0A 1RW4A 2W6NA 4J7AA 5EMLA 2O8FB 3D3EA 4MUHA 3HDHA 5AP9A 4DA4A 1KE1A 5L53A 1KVSA 3Q40A 4EA7A 2GM3A 3COJA 3AB3A 1FNDA 2IIQA 4Q3BA 3KR9A 2Q7DA 4O5OA 4PHCA 1FMCA 4YHBA 1FFBA 2G9QA 1PZHA 2FZCA 4RIEA 2IV2X 4DG8A 1T15A 4GBED 4K81B 1KWKA 4BZPA 2IP4A 2WIKA 3BMQB 1ESZA 4P33A 4WK2B 4X54A 4G4JA 1LSJA 4HAUA 4L51A 1DBPA 1J8DA 1L5HB 2CCJA 4C0SA 3NHYA 1Z75A 1E9FA 1UMKA 2QYSA 4DHEA 2AXQA 2JIMA 2YICA 2QENA 1VL8A 4WV3A 4DSZA 3WLKX 5TQVA 1IJFA 3IKLA 2P41A 3BXHA 3ND8A 4JDPA 4N8DA 3SXPA 3U17A 3N9IA 3BAFA 2WJAA 4IHJA 3ZX4A 4CKXA 4A8HA 2WD9A 1MA3A 2W98A 2B5WA 2P1ZA 3KR1A 1S2LA 4I0WB 4QHTA 4ZALA 1Z83A 3I6IA 3D54D 3T9DA 1F6WA 1ULUA 2MU1A 3W9YA 4AG5A 3USCS 3IDAA 5PNTA 1C9DB 3VR0A 1J99A 3AR3A 3HN7A 3EA5A 3DEFA 3E3LA 3EGXB 4M99A 4BFTA 4EZIA 4EAQA 5FEUA 4IBOA 4YUWA 3M3DA 4V2UA 1QZTA 1T9KA 4K46A 1KJJA 4O0LA 5LMZA 3B7PA 1XN4A 2EWWA 3FHLA 1MX1A 3R3HA 2J0UA 3AILA 1N7JA 3EXHA 4ZREA 2ATEA 2GWHA 2CXPA 5AKHA 1E1CA 4KEAA 4U7PB 4ERNA 4JUFA 2LDXA 4AG6A 2ZI6A 2AJCA 2GCEA 2AMJA 3C7CB 3A2NA 4C2BA 1UAAA 1HNNA 1EI9A 1FRFS 1B41A 1H93A 1PX0A 2Z43A 3H9QA 3LK6A 4TZ0A 2O7VA 1RHMA 3CO5A 1C7RA 1U0FA 2IEZA 4W5HA 1PLKA 3RSHA 2AD1A 4ZMRA 2C00A 2B21A 3RFFA 3PGXA 3IKTA 3N2YA 3UUEA 4A7PA 3AVUA 4H6VA 1GSAA 1XGKA 3SXUB 2R11A 3OQPA 1XJ5A 4HGOA 1PGNA 2QZPA 4G65A 5JV5A 2WD7B 1CRZA 4E7OA 2W42A 4TUYA 3P2YA 5B3JC 3UY4A 1WB9A 3SQLA 4BC0A 5KU7A 4D96A 1P2TA 2FVXA 2EEZA 4H08A 1PFYA 2A5FA 3D3KA 4P4UA 2X0IA 4QYIA 3VJMA 1ODCA 1RVDA 4QUHA 1W36C 2HNBA 4MQMA 1NVVR 2CLCX 3ZKWA 3FY4A 1DO0A 3B1YA 2ZPUA 3P5BA 4AJPA 1SOUA 2IU3A 5CW1A 3HVJA 5AJWA 2C29D 1Q3KA 5CDUA 4F4IA 4B3CA 4X5OA 5SY9A 1EFHA 1NOIA 2C20A 2RH9B 2AEFA 3FFXA 1I4OA 2O59A 3GPBA 1ORHA 3RSLA 5AOCA 3R3SA 3IT2A 1F51E 2DULA 3IIEA 4HWRA 1TADA 5E0OA 5KYNA 2DHDA 1HQCA 3ADPA 3QVVA 5AHKA 3CZRA 2G1PA 3ICVA 1E3TA 4DDMA 3F8TA 4YT2A 2H9AA 3WADA 3ZHUA 3M4NA 3D6UA 1ZGBA 3JQDA 1FLDA 4JC8A 3B5JA 4K8RB 1FSPA 3W3AA 4C7JA 2ODNA 3K1YA 4KE9A 5JNUA 4Y9UA 4YGXB 2JGEA 3TIFA 3FPJA 3Q12A 1Q1BA 4K05A 2WC1A 4UZFA 1QKIA 4MR9A 4WOBA 2D0IA 4TTIA 3QV2A 1OLUA 1MJNA 3MGBA 3LOPA 4HGZA 4L02A 1TT5A 3AFOA 3GA0A 3K09C 4UXJA 2HRDA 3A9VA 2IDJA 3GUUA 3ZWKA 2BC9A 3FXAA 4CRWB 4EX6A 2ZTUA 5KC9A 4IQ4A 2J0QA 4QGGA 4QGBA 1EFAA 3OBIA 2FOIA 4DXHA 3Q0EA 2YZMA 1QVRA 4YC7A 2E4XA 3TBFA 2RHRA 1GL7A 4UD6A 2IWHA 4WAUA 2J6HA 1SIOA 4R1NA 1IATA 3RFVA 3VDNB 1VSBA 2PGJA 4D0LB 1NJGA 3CEHA 5TS3A 1CJCA 4M9UA 3RUHA 3SM9A 3ZD8A 4Y9TA 4G41A 2H8GA 5JZ9A 3JATA 3BG5A 4MGYR 4RSMA 1U1GA 1LI4A 3C3XA 4FDMA 4I1OA 2IEDA 1WDMA 4WGFA 3TOCA 1MRSA 3VU3A 4ZJPA 4RWZA 1NW8A 1FYWA 2WZCA 3R7NA 3LX6A 2WFLB 3NW9A 4X41A 1SXJE 4ALLA 2HY7A 2A0FA 1O8BA 2BCEA 2WMYA 1DBSA 2G72A 3GPDG 1U6IA 3FUXA 1V4VA 4HDSB 5FNZA 2O8EA 3PDIA 5AIAA 1U2EA 4MKZA 5KTSA 1SUBA 1NVAA 1C3EA 2QUAA 1NXSA 3R1IA 3RBZA 4DR1B 2GYWA 2R8PA 4TQGA 3FCEA 3IRVA 2JAPA 3T0FA 1E92A 1Q1QA 2YOFA 3PGKA 5IABA 1B0PA 1TOAA 1DHRA 1RAFA 2FWBA 3L49A 4I6JA 3ODPA 4US1R 5SYNA 1O89A 4QOEA 4WNIA 5CFRA 4MYRA 3WK4A 1KERA 1XI2A 4I5DA 1LQUA 4WY5A 3TQSA 1EDDA 2RB5A 3RS9A 1YFKA 4WBXC 3O3CA 5DBIA 3GJ4A 1FXWA 4NENB 1DQYA 2VQFB 1YRLA 1QCYA 4N5MA 3BD7A 3CH5A 4BY9E 4C7KA 3JQFA 1RKVA 3F2VA 4RA6A 4XB6B 5BQ3A 2WMNB 1HYGA 2MTBA 2PH5A 3OUUA 4FCTA 4JJIA 4UEJA 1LS1A 1S02A 1GQSA 2NU9B 1MENA 4S2EA 3PENA 2E6UX 4V24A 4XLZA 4YDSA 3AF4A 4LHEA 2C88A 1JJIA 3EB9A 3VSCA 3JZDA 2HV8A 3G0CA 5D7BA 2EX4A 2LP4Y 3A1FA 3AG5A 3O7MA 5ENZA 3EXG2 5ICSA 3HJNA 2CUNA 2JI4A 2GT1A 4X6LA 3TMKA 1KI3A 1C7JA 2OG1A 2Y0DA 4DUGD 1CJTC 4KIWA 2PNJA 2FDRA 3EN0A 3OIVA 4X8MA 1CVLA 1W49A 4ZANA 4A6EA 4IO0A 5BN5A 1YXMA 3L8YA 4ZI7A 4DV0B 2FP4A 3KHUA 3TW8A 1IBKB 1P4SA 4E14A 1N8KA 4MDYA 4X63A 1H0KA 3STYA 3N07A 1AS3A 3R74A 2WJHA 1MUUA 1MAWA 3I9LA 5K1ZA 3Q5GA 3FPFA 4PTYA 1HF3A 2PZMA 3DDNA 3EF3A 5CT9A 2A58A 3RU7A 2GO7A 2VFAA 2IIVA 2NYRA 4H35A 1YR8A 3DLPX 5EOVA 5J5AA 3HQ4O 5FQNA 1Q11A 4MEAA 3SPXA 3TNDA 3QX3A 2G0NA 2P9TA 2QPAA 3WMGA 4Z1OA 4DW8A 1ZRSA 3NHFA 3QU5A 2DQ4A 3E03A 4FILA 4ZICA 3FSJX 2CL0X 4RVSA 2PKXA 3GT7A 1YSCA 5I6DA 3VR3A 1S7GA 2I1LA 3P9RA 1QB8A 5DV9A 5LZ7A 3W2EA 4CLHA 1H8HD 3PJDA 5TEVA 4ZKDA 1TF7A 4C4ZA 4D3FA 1TX4B 5AI8A 1PJBA 2IOFA 3DZFA 5CXUA 3ZWAA 1R6BX 3PCTA 2PPLA 2BM9A 1B15A 1QQ7A 4CMKA 4LXQA 3KQNA 3LPNA 3E9CA 3UJDA 2CDCA 3EASA 3LC1O 1L5VA 5I47A 3NFRA 4RL4A 2AEEA 3VV3A 2O0LA 4IIYA 1CR1A 4KO3S 4JASB 1CQZA 3KWLA 5FUVA 3TUJC 1G0NA 1YBHA 3DOOA 3UYKA 3IP9A 3A6EA 3VHQA 4G1FA 5CM8B 2PRYA 2PX2A 1POWA 3LYHA 5DU2A 2A67A 1DAKA 4B80A 1G5QA 3WRVA 5I01A 1ZHOA 1QYIA 1UP4A 1V1JA 5JMOA 2C8KA 3AM4A 4R8RA 5BN3B 4DKJA 1PZGA 1VLZA 1DO8A 2AGVA 3LX4A 1QZUA 3SHFA 2X5OA 4DQDA 1BO6A 4L6CA 1ZUIA 3EIQA 2XNDD 2PUBA 3AVTA 1N33B 1XPUA 4WK6A 4D5GA 4QJBA 1AB6A 2AR7A 2A86A 5AOBA 1MAHA 1SK8A 1YZVA 3H2GA 3NAQA 3SC2A 3S28A 4NEQA 1A8SA 4YUYA 1C2YA 4IH9A 3D4LA 3UOAB 3E18A 2H0RA 5K8IA 3LPMA 2QYOA 3LAWA 3LOUA 1IVYA 1GQOA 4JCOA 4PM4A 4QOGA 3TL2A 1GKKA 1M1YE 1Y82A 5A9SB 4GX0A 3TLZA 1ZYUA 2O3UA 2OGWA 3FDZA 2QV0A 3RYIB 1IM5A 2HSWA 3A6LA 1JHPA 4EPWA 3OO0A 4IX1A 3EW7A 1J6UA 4TRNA 2ANBA 4B6OA 4OQNA 3HE3A 4RHYA 1UOOA 5AVYA 3DEZA 3TGPA 2WIGA 4H4DA 4CJXA 1OAOA 2QS9A 1NBEA 3EGOA 3QPAA 1M34E 4JLKA 4LFCB 1IOWA 1K75A 3PGLA 3G9XA 4CR6A 4CTNA 2W11A 4UHBA 3A1SA 1C4KA 4QIHA 1E5TA 1QXSA 4TN1A 1D0VA 2OXIA 3SMVA 1OPXA 3K9QO 4CQLB 4RTPA 3DONA 1T10A 1EVLA 1HOTA 1VG1A 2MYTA 4FB5A 2V3CC 2RGCA 4G5YA 2C9BA 2HO4A 3GRAA 1DT5A 1YI0A 1ZH8A 1UJ2A 4D9GA 2XWPA 4LYFA 1J2TA 4RORA 5K6AC 2Q6LA 3PKIA 4JL8A 5B36A 2F8TA 1WW2A 1BDBA 3MJEA 4ZZ3A 5CDTA 3AEZA 1C9KA 1LSSA 2H1OA 3E5RA 2VP6A 3PHLA 2XTMA 2P0AA 3N0XA 3FVWA 5LJLA 2O8DB 2HHJA 2GF9A 3N3BC 4X6XA 2OYCA 3MC1A 4DPLA 3OCVA 1AKRA 4L9AA 2X0NA 2FSSA 2QPOA 2ZRBA 5IJ9B 4M6WA 2JFOA 4DEXA 1RWKA 1P2DA 4BWFB 4G0UA 2JBHA 2YUIA 2VQ3A 3H1PA 3ZUGA 2WFZA 1OZFA 3QYJA 4GI1A 5FBQB 4QEDA 3TAXA 4DTIA 3TLBA 2M2IA 4UNRA 1DCKA 1ZINA 3I9MA 2QZZA 1QDUA 1VE5A 3QY9A 2FW1A 5EHIA 16PKA 4ENVA 1ZMRA 4NJEA 3N59A 3C5VA 5F77A 5L6MB 2JZOA 2ON6A 3B6JA 1FJGB 4BO3A 2NXNA 2N0SA 4NZPA 4Y1GA 2WTXA 2WWRA 2XVAA 1WQ3A 3CVJA 1E9DA 2IP2A 4HFMA 2IXEA 2HWXA 5FUBA 2CFIA 3KDAA 4R2HA 1QSGA 3R2JA 4F1KA 3U61B 3WL5A 5B7NA 1NSYA 1RBYA 2PKEA 3TR0A 2V8BA 1VP9A 4LSMA 3HZRA 5GONF 3WNQA 4UNNA 3AJ8A 1ZAYA 2POCA 5IBRA 3ZKAA 5ADWA 1EXMA 1TTHA 3L7JA 5EE1A 5I7WA 2N1BA 1HTTA 2AQHA 4XPIB 1DTSA 2VC2B 4YROA 5ERGB 1JSRA 1ONNA 4D81A 4OO3A 1JKFA 5JI2E 3U49A 3KAKA 1P6QA 2D2XA 5T57A 4P0QB 4U63A 1BC5A 3R09A 3WRXA 3FRHA 4BO7A 3JWJA 3S4YA 4XWWA 1VIYA 3FPLA 1XSEA 1HI9A 1MB0A 2AJLI 3NHSA 1AGRA 5DISB 4XUEA 5HK8A 3ANTA 4PPNA 1D2MA 2PL3A 3O3OB 4MVJH 1RCUA 5KX5B 3RU3A 2IP1A 2W8BB 4F11A 4P83A 4EY5A 5AM3A 1QJCA 4CIVA 1RWOA 5IKPA 1Y1RA 4URZR 4X00A 3P9CA 5K09A 2E21A 1QO9A 4MKIA 1L5RA 2BGMA 3BXEA 1TK3A 2H2FA 2YWJA 2GPSA 3D4BA 3DAYA 1E2EA 1K8RA 1JDVA 3LCCA 4MPJA 1V3TA 4M9ZA 1YTLA 1Z26A 1RHJA 2HPAA 1KNQA 4EI7A 2BIFA 5FL3A 1Y7TA 3BIXA 3QBJA 5EYPA 1Q3TA 3VYVA 1BD4A 1WCYA 2OAEA 1ODSA 1MQAA 2XHEA 4R9RA 5HM8A 1MNAA 1HT1E 2GHTA 3E23A 1AGYA 3LUPA 3RVKA 3UFXB 4CLOA 1XA3A 5DI3A 5ALZA 2O54A 5DSZA 2IGTA 4O4LB 4C5AA 2OSBA 3DMYA 2O23A 2XJ4A 4E1BA 2BEVB 4KH0A 4NH0A 5JYDA 4ENUA 3NVMB 4AF8A 1ZVMA 4MKFA 3R7SA 2AMVA 4NHEA 3SFVA 1VIMA 2G76A 1H3FA 1Z63A 4LMPA 4FSDA 2VJAA 4UU1A 5BSRA 4Z4CA 2BBSA 2C7QA 5C80A 3RT1A 4KC0A 1RM3A 3VR3D 1JAHA 3L04A 1NONA 2QY6A 1I24A 1JQ3A 4XD2A 3CCCA 4LHVA 4DT1B 5DN6A 5LMUB 2OBLA 1E9CA 5DGCA 4DANA 3GGJA 2GZHA 4EQZA 3O94A 3B1JA 3I04M 1SG0A 2AX4A 4JR1A 5H82A 3K9HA 4Q48A 2SNIE 1AGXA 3MMSA 4N7JA 4JBLA 4QARA 1UBOS 1ABEA 1L7NA 2H1LA 4MRPA 3RC1A 5ALIA 2AVDA 4X94A 3AVPA 3L8HA 3UK7A 4CIBA 4S04A 1IB6A 3GRCA 1WUTA 2R25B 5GAJA 4JBIA 2OBBA 1YVUA 2VTEA 3DEJA 2QP9X 2YX1A 2JHPA 3OP1A 4G5QA 1E32A 2BUCA 4DSOA 1MB9A 5AXAA 4CL3A 4YY3B 1O57A 3GFGA 1P4HA 1ZIDA 3GI1A 2ZE6A 4IQ0A 4MUKA 2ZTHA 4QWWA 5DBGA 3H2SA 3E3OA 3KTOA 4MUAA 2IC5A 1X7XB 2DQSA 1B8VA 2IHJA 4UU7A 2P6RA 1PNOA 3DMPA 2G9UA 1PQWA 2QQFA 1ZR2A 1N2OA 1PFUA 1NUQA 3SSAA 3UMMA 1BH6A 5K05A 3PWKA 5BMVA 3EODA 4GXNA 4LVNA 4YXFA 2GBCA 4D8XA 7MDHA 2VS1A 5TQ0A 1ZKMA 1YQQA 4GX2A 1HDOA 5KDDA 4HNAA 4D5EA 1P1RA 1L9KA 3DF7A 4I9GA 4L6AA 1N3YA 3RO7A 3IAFA 4QUBA 2PVPA 3NBKA 3RW9A 3ENKA 3OJOA 2BHTA 2JAQA 4UVDA 3BSSA 3F6CA 3WNBA 3AYXB 3EH1A 4UU8A 1EFVA 4EZBA 3IBSA 2J45A 3NWEA 4KN5A 1QYRA 3VVBA 4N47A 4IR7A 4MUJA 1ZI9A 1H6DA 1HLPA 1SGWA 1JF8A 2P6OA 2PSSA 3VH1A 3U0BA 2B4AA 3D7NA 2BMAA 2P8SA 1KQPA 1N36B 3I09A 4WKOA 3SKVA 1IM2A 1B0AA 4JJEA 1A97A 3OEYA 2YVAA 5DFAA 4ESEA 3IMFA 1B3BA 2B2XA 2DJIA 3CGWA 4CLEA 4J0EA 3WLMA 3OSUA 3OE1A 1IIBA 2FX2A 3L0BA 3E2IA 4DCCA 1NUPA 2YASA 3Q10A 4NS4A 4BMVA 1SRRA 4O08A 1L7BA 3B82A 1JEQA 4P5PA 1Y1PA 1BSVA 2BKUA 3QJ5A 4MA0A 5FADA 5J1TB 3JR3A 3LBIA 3KFLA 3QVGB 2GESA 1OLSA 4J03A 4L0MA 4CL2A 3PHJA 3SYLA 5JYEA 1EQAA 5DNYB 1EUYA 2LD4A 3IAM1 1I33A 3C8MA 4M1YA 1LDEA 2O3QA 1IULA 1PCXA 1J0EA 4JOQA 1YQXA 3ELUA 4PLPA 4PY2A 4XD7A 1JDUA 5IM5A 4HV4A 1MC5A 2XXAB 3IFSA 1Z45A 2Q2WA 3H3FA 2N46A 5E1MA 5IH3A 1I5RA 2PAFA 1OFVA 3WWDA 4R0VA 5KWVA 1Z5NA 2CVPA 3GFOA 2OPHA 3IR7A 1AKWA 2GNAA 5LQSA 5CDFE 3I3SR 1BFKA 1U5CA 2WB2A 5L7TA 1GCIA 1C9MA 2GD0A 1JPJA 3LHIA 4HWSA 3V2UA 8ABPA 3KQSA 1JTVA 2BFDA 3R6LA 3G13A 3B85A 5AUQA 1WMDA 5F7OA 1E2BA 1FTGA 1VCMA 2K7ZA 3IOBA 5BQOA 2FY8A 5DYTA 1EUZA 4I8IA 3WLNA 3P9SA 7ADHA 3K9LA 4HGYA 2KLBA 1K0FA 3A26A 2XF2A 4C0XA 3KQHA 3ROXA 1OFUX 1SUFA 1WPRA 3G9ZA 4DCUA 4FHFA 1Y34E 2GVZC 1PJ3A 5SV2A 3T5CA 3DZCA 4CF3A 4OM8A 1RJGA 4J1TC 3RRZA 1IONA 2AOWA 2CXUA 1X2EA 3D8RA 5GWXA 4TZ6A 4UC0A 3B60A 2YJTD 2PG3A 3JS5A 4YGYA 3ZWMA 2XGJA 4N6OA 1PDVA 3EG5A 4XAQA 1MAUA 3QK7A 5LQJA 2PZEA 1E7YA 2BSAA 1S2OA 5U1PA 1XU4A 1K8XB 4NYMR 4ZXFA 4DB2A 2WUFA 3VTAA 3P0IA 1PZFA 3UJPA 2VZ9A 4XRGA 2BL4A 3GP3A 4NE2A 2CSUA 3QBVA 4WI1A 3DO6A 5ITZB 3PJEA 2C1EA 5DXAA 5H0IA 1AE1A 1IMJA 1UBFA 2CLKB 2FH5B 4MQFA 3CF4A 2E4WA 2O52A 1HFKA 4XCXA 5FUMA 4NPAA 1MW8X 1CUJA 1OZAA 3PXDA 1JILA 4X3PA 1NU8A 1UDXA 1PHPA 4LN1A 1ZM9A 4FEGA 4KB5A 4NOJA 3A1UA 3GW8A 3PXCX 4UPVA 3TMAA 3J80A 3HO6A 2Y93A 5FRDA 2J87A 1US8B 3A4TA 1QAMA 2XUFA 3CKMA 3ZWDA 5DULA 3L6EA 2HQOA 4U2DA 4MHTA 3L7CA 4ZKEA 3TLCA 1QYXA 5KYKA 3B9BA 4CMAA 1DEHA 1VSQA 2JVKA 2PYIA 4JYZA 1UKVY 1Y1QA 2HK7A 1LEHA 3BD6A 1T3SA 4NRDA 1H3NA 4DAEA 3C8DA 4PSCA 3TD6A 4C20A 1BGXT 3K15A 3RT9A 1YJ8A 4IVQA 5FPYA 3RJ9A 5ALWA 1J9EA 3S2FA 1Z34A 5CB4B 3AL0C 1DKMA 1O95A 1Z4MA 4GZMA 4ZVSA 1HKUA 3UPTA 4JI6B 1RNLA 2I6TA 3C6QA 4G9BA 4ML3A 1MXHA 1MABA 3W8FA 1WR8A 3NQ41 1JAIA 2JLXA 5H3LA 4Y6LA 3RS8A 4HQRA 4P22A 5BWLA 4F4HA 3HCRA 4Q7JB 4CLDA 2XD4A 1TEZA 3T95A 3PR3A 4KSCA 4P0PB 2KLHA 4TUYB 3TQCA 5JNLA 3A4YA 4YH1A 2EZ8A 4QU5A 3ETEA 2IPNA 1T4BA 3GHHA 4B8YA 1T6XA 1VYTA 3MTDA 4LJLA 5LDHA 4QYIB 1LBEA 2WSBA 3I9NA 1G21A 2B83A 5EMKA 2VDNB 4IJ5A 4H27A 3EVNA 1DQPA 3U3DA 3QWFA 3HM9A 1YOBA 2JHFA 5ALDA 3C8HA 1KDPA 3T3EA 3PQ3A 2IUEA 2FV8A 3P0JA 1JDJA 3I6BA 1Z2CA 1ZQ1A 2AN1A 2QRJA 1YB7A 3HYNA 2P35A 3GAZA 4IIJA 5IM4F 1TAHA 1OU4A 1RYZA 3UK6A 5FORA 4FE7A 3H4VA 4UTPA 2VSNA 3G5LA 1EHCA 2WT8A 4ZVNA 1ZK2A 3ET5A 3DHYA 1RM4A 4FYMA 1G2OA 1I3MA 4IWXA 4M9SA 1RMYA 4HGQA 4V1CI 1C1XA 4OL9A 4QBIA 4B6FA 1F3LA 3KJIA 1B00A 3ROTA 4B6EA 4BV9A 1UEIA 4R7GA 5C7OO 1LC0A 1P5ZB 3FOWA 4GGMX 1SM4A 3H5VA 1SR8A 2QR3A 2J7KA 3H97A 2X14A 3UHAA 3WLEA 1CUBA 3D7MA 1OI3A 2I87A 3UJBA 3K70C 3EW9A 5J59A 3AKYA 1TT5B 3JRWA 2AE1A 3JVDA 4ZAFA 3ENWA 3U7EB 4EJSA 4KWHA 5FBWB 3K2QA 3FWZA 5T8KA 1MGPA 4YT4A 5A5VA 2XLCA 1D09A 1V1MA 3F67A 3MT9A 2E5WA 4UUPA 4X92A 3L43A 1U7PA 2VXCA 4Q3EA 5K3CA 3WLTA 3UA4A 3E9YA 2YRFA 4YUAA 2POQX 1ID8A 3BEOA 1HRKA 5IHPA 2QMZA 4L27A 3TGWA 1ADJA 2KS6A 5ABPA 1UAYA 4MULA 1EFLA 5FNVA 3VXKA 3HA2A 4CU2A 2DFLA 3RC8A 2C96A 4N8EA 3U40A 2B1JA 4C6RA 5C3UA 4YYZA 2O8EB 3U37A 3KQLA 1GPYA 3PC7A 3UT5A 2RB4A 3V8QA 3L05A 2RGEA 3PRKE 3CB2A 4D0RA 4QNMA 1QGYA 4D0SA 2ZUBA 1KXJA 1CUIA 3KYDB 3OETA 2A9RA 1R16A 1JB1A 4EVQA 2GUWA 1FYVA 4PC2A 2PUJA 3KIPA 4ZAVA 5HR5A 5JSFA 5DYGA 3DVSX 1CUHA 4LMBA 3QEKA 3M33A 4MUNA 4ZDWA 1G7TA 1GSOA 4IHKA 3LF2A 5CH5A 3ROGA 3UH1A 5C8ZA 3G88A 5LYJF 5KI6A 4EG5A 3Q5DA 4F2PA 2JGDA 3I5MA 1Z5UA 4EY8A 4XD7D 3R3JA 3CN9A 1M2FA 4RA6B 4RPHA 3UGKA 3CR3C 5LA6F 2VDOB 4UFPA 5ALVA 5JXJA 1CV2A 4G8CA 3LA6A 3C3MA 3QOWA 3V7FA 3LC2O 4XJXA 2QK4A 3D3WA 5H16A 4IGFA 3T41A 3IMGA 3KQQA 5C7YA 1N2SA 2HK6A 3RV4A 2WUDA 3G9QA 2X9GA 2P2LA 3X2SA 5AJZA 4QHYA 5LM3A 2IYYA 1YCGA 2I8LA 4JLWA 4P8RA 2ZZKA 1D6MA 1AZTA 2GR9A 3MINB 4RESA 5FOQA 3HCBA 4QAQA 1M6HA 4GG1A 2OD2A 3SSOA 2HRZA 3RQSA 4QOHA 2DT8A 4II2A 3QU2A 4JD5A 1K8YB 1KP9A 4GQAA 3RBXA 3AMVA 2NU6B 3VZDA 2HA0A 4OQEA 3E1SA 5AW1A 4YP5A 2X8LA 2O8BA 4PIMA 1Z6XA 4R6WA 4RJKA 4ZVKA 1A9ZA 4OP3A 1ZSVA 4XUDA 3AVQA 4DLKA 1F20A 1YC2A 1CJMA 1YE5A 2Y27A 4MGKR 1KQGA 3SQMA 2XRZA 3AC0A 1AG9A 2AG0A 3CRMA 3SEFA 1WP4A 1HR0B 2C5AA 3UMFA 4BX2A 3AY3A 4N7BA 1UOQA 5K0FA 3NHMA 2B4TO 3ESZA 1B0UA 3LLCA 2G40A 1FYEA 2HU8A 3C14C 4LCEA 4TTJA 3ZZTA 1Z8HA 3ZDYB 4XWTA 5EPOA 3W1EA 1UKEA 3TUIC 4DBLC 3KEOA 3T9EA 4NBKA 3UUWA 5IAAA 2F43A 1ULZA 2FUCA 3Q1LA 1ZMXA 4C9BA 3DB2A 4JWTA 1W19A 1FW6A 4R83A 1TVCA 5EL0A 2IYAA 2QPTA 1DV2A 2WZDA 4LV5B 5HFNA 4AX8A 1SD2A 4N7RA 3S1SA 3RJMA 1DGQA 1RP7A 2HSJA 4XQ9A 4C7XA 4B31A 3FTNA 3T61A 2OECA 1PT6A 3FMOB 4A82A 4WOCA 4U1RA 4NAHA 1CULC 4V0LA 3EBPA 2BJWA 5JFOA 1NRXA 2NXWA 4LJ4A 4BVLA 3SI7A 2FUEA 4UTVA 2VN8A 3R20A 4P3KA 5LZ9A 3L8ZA 3O8QB 5HIJA 2WU1A 4LJYA 1AHNA 2O4CA 2Y0PA 2H8KA 4P3XA 2ZDQA 3WLJA 1ATIA 1FQWA 3KXPA 5LPNA 4KUHA 3SHWA 1O95D 4HEA6 3RK4A 4ARVA 3J81A 5H81A 5KKAA 4HRAA 3I2IA 2CCKA 3ZWNA 4DDHA 4C2UA 3A9TA 4ZMSA 1PVOA 2VCEA 2PTGA 4I2VA 2QN8A 3EXIB 3HMQA 3SC2B 1NI3A 3KQYA 3PDUA 4GS5A 2IKQA 4F2HA 3RC3A 1A72A 1CQPA 1E8NA 2IFTA 5DNVA 5A0VA 3V1KA 1LRLA 1LDNA 3ICCA 5I4IA 1TGVA 1L1EA 1H2EA 2GXQA 3FDZB 3FWKA 3RKSA 4CEIB 3E7DA 2C99A 4DIOA 2JC3A 4F6CA 2HM7A 1Q22A 3NNNA 1JJAA 1M1UA 4YJ2B 5GGXA 4GMXA 3T35A 1BKYA 4BNJA 1Q15A 2O8DA 3IOMA 3DF9A 3NETA 1V7QA 4JP1A 4LZAA 4EI9A 2EP7A 2BGRA 1HY3A 3T7CA 3WSVA 1U1CA 2FDCA 2FPOA 4B6GA 3BWBA 1SBYA 4L3OA 1AB5A 1KI2A 1R4AA 2HF2A 5ES4B 3LVRE 4E5DA 3ZV3A 1MG0A 3NEJA 3BDIA 3LUBA 3RTDA 3JD4A 4BC1A 4BGDA 3OJCA 5HGXA 4GU5A 1Z62A 4DMLA 1HFEL 3NHPA 5G0WA 1N3IA 1O6ZA 2PNFA 1KDRA 1NVGA 2UYHA 3OECA 5HBGA 5LD2C 1Q50A 3G9UA 1PV2A 2BFCB 2QN7A 3DWFA 3GZ4A 4PYLA 4KRXA 4R16A 3TLEA 4EVIA 4ZV4A 3NNDA 4Q3DA 1W0KD 1VCOA 3D5TA 1W4CA 4EB6A 1ZDMA 1M8PA 1BYUA 2VZEA 1W96A 1HE3A 2X3YA 3FUWA 2CNWA 1HDRA 4YUVA 4ZDKA 2ILVA 3K0SA 1NLFA 2XD9A 3FNQA 3LXXA 3OEEA 4LISA 4JI3B 3C3YA 4KYUA 1QFXA 3WB0A 4ND7A 2JASA 1QS0A 3ZDBA 1XF9A 5INTA 4NMMA 2MJLA 3FI9A 4IIDA 4JQZA 1NZFA 4PYOA 2VRBA 2BFWA 3D6AA 4L5CA 2CF6A 4I7EA 5AKKA 5DGXA 5IPFA 1OH6A 2GEKA 4CODB 1OMOA 1P4JA 2GKGA 3AGQA 3MB8A 4U7JA 2CNDA 3VZCA 2O3SA 1W2GA 4KO8A 4DSUA 1IG0A 4PAQA 4F84A 2ETVA 1PVDA 3JSAA 3WHKA 1ZSNA 2E3JA 3ZHYA 4ETWA 1GFZA 1C3OB 1V48A 4NJEB 2CVOA 4JP3A 4LZPA 3ROQA 5BN1A 3KJXA 2VHQA 1RCTE 4RIGA 3AOEC 1HQKA 3BH6A 2PYDA 4JX9A 4ARUA 2OMEA 4CLRA 3AETA 2FRVA 2WFMA 4L5BA 3AKZA 3FSGA 5EXDA 3OA2A 3DHNA 4FZ3A 4AO7A 2X5KO 2F67A 5AI5A 3JWIA 1N25A 2YWRA 3PNQA 4PYKA 1K6XA 2RD2A 3LWBA 5BNWA 5K0JA 1GYQA 3HCOA 2H59A 1E59A 4W5NA 3UCFA 2QP3A 3K5WA 4MWEA 4AY4A 2V3WA 2PUWA 2R60A 5J4LA 2OOSA 2QUHA 1JIJA 2HJSA 4X62B 2SKEA 2WJPA 3Q7RA 5CT5A 4EG8A 4CETA 1XO1A 2JH9A 5B7PA 1BCSB 3R3UA 4MZXA 4OTZA 4RFSA 1H42A 1SUCA 1NXQA 1SURA 3KCQA 4L78A 4CKWA 3RYCB 1QIGA 2X4LA 1GN9A 2Y0EA 3QH4A 4LWZA 4N82A 4GM0A 4OLJA 2CWWA 4XJSA 3H42B 5HK9A 1AQNA 4ZTZB 1V7CA 3EQ2A 3ZV7A 1GLGA 3RUFA 5F73A 5A7FA 4FWIB 1PT9A 3OOEA 3DMTC 3IOEA 4Y6SA 4QZVA 2Q2VA 5KYYA 4D8YA 2OOKA 1D2EA 2HMWA 3WMFA 1NKVA 1TMOA 3I8XA 4RY0A 4YALA 4PYIA 2P2YA 1STOA 2VHWA 3H99A 3AFIA 1UMCA 1QX3A 2GJ8A 5CP8A 3ZI7A 5DGHA 5FA8A 8ADHA 1YS7A 3HKBA 3EPRA 3AFMA 4FGLA 1YH3A 5DWDA 3LT4A 3S2GA 5EEHA 4D9EA 2I4TA 1XEAA 3GXBA 4JVOA 4QNNA 4R2KA 2UVPA 4I4TB 4XH9B 3RYFB 5JDCA 3P0RA 1GWNA 4FIZA 3UMSA 4AS1A 4IVPA 1U8UA 2VP9A 3MJ4A 1I30A 1VE7A 3DE6X 4MTCA 1HNXB 3CR7A 5FBKA 1TU0A 4LWPA 3SZMA 3D8UA 2DFVA 1WE2A 1L7PA 4DXAA 2VP2A 2WY2D 2BTQA 5LFAA 1YK1A 3I5XA 4TKUA 1R3UA 1D8AA 3D8NA 5SY4A 4CLOB 2IS6A 5AW5A 1O0BA 4BV3A 3HBJA 4MR7A 4XTRA 3I62A 1MB2A 2YCLA 1JHZA 1D7OA 1L4GA 3KWJA 2JFNA 2CMDA 2G09A 3TTWA 4WXHA 3LW8A 4BMYA 1GTG1 3QE3A 3IIKA 4WX2B 2FXIA 3HZZA 4ZJUA 1GFWA 2B94A 1A9YA 3TW4A 5HKAA 2O8NA 3JVEA 4MUFA 4BKQA 5GMOA 4OP2A 4P86A 1SA0A 2FUKA 3M9XA 4E7PA 2DFNA 3DNPA 2VP3A 4PS0A 2HMAA 1WXIA 3SVTA 3ZC3A 1R9NA 3EF1A 3QELA 4H31A 2R7MA 4MCJA 5B2FA 4FYYA 1M0SA 3DZKA 1N0WA 1VKOA 3R3VA 3TW6A 1UMDB 2EYUA 5K0GA 2ECOA 3IVMA 1JPNA 4P7KA 4W7HA 5CFOA 2REXB 1YWGO 2VHXA 4NABA 3EPHA 1GU1A 1YNSA 3H2IA 3GBVA 1JJVA 3A9SA 4CUKA 5U4QA 4E5MA 2OESA 5CDYA 2Q1SA 2D5LA 2QVGA 4LSGA 1XU9A 2UKDA 5U4XA 1Y7HA 5KWJA 1LB1B 3GLHA 4Q47A 4G9EA 4UVIA 2IPLA 2PKQP 5IU6A 3G2OA 1XAGA 1JWLA 5LMNB 3KKQA 1TEXA 3MQ4A 3DWIA 3SEZA 4BVBA 2DHQA 2RJOA 1XRRA 1YUNA 3BTVA 4FDTA 5EWJB 5BRJA 3STHA 5KTMA 4HDRB 4ZYWA 1ZCZA 3USES 1OX6A 1RXIA 2JLRA 3ISJA 5JS6A 3FZYA 3KL4A 2AK2A 3BDAA 1AQ6A 3AUFA 2ZTLA 2N75A 3TSWA 4LNUA 5CEJA 3GQBA 3UAGA 2AH5A 2I2CA 2OVBA 2GEFA 1E2DA 2VHCA 3G9TA 3AEQA 5DXJA 4KWCA 1XF1A 5DM0A 5TQ0B 4IF6A 1G19A 3MZ0A 3P0HA 2GSDA 2DAPA 2W00A 2NYUA 2V65A 2YV3A 5H1YA 4YUXA 5THKA 3UTCA 4H16A 1R0ZA 2K7FA 4FNAA 4QDXA 1ONBA 4KUGA 4B1FA 3D02A 4A8JA 2JEZA 5KDLA 4B4KA 4DLXA 4E11A 5JZOA 1OXBB 1OXSC 2ZUUA 4PLWA 2LCIA 3MLAA 4FFBA 5HQTA 5FBRB 1QH9A 3SVLA 1BE8A 4IDBA 3VPCA 1EWYA 2J9FA 4DNPA 1HYHA 3O1LA 2J32A 5HJ2A 1JG7A 4KN9S 3C6YA 4DIEA 1FLAA 3F46A 3QPUA 5DLDA 3OIDA 2A5JA 4EKEA 5M2QA 2GF0A 3CPSA 1PDOA 1JYFA 1UFQA 3JWEA 3TGLA 1IXRC 1EJ2A 2I7XA 1E2UA 2YS7A 3OZVA 5HWSA 2XCIA 1SQ5A 1RWMA 3TNLA 2NGRA 3DYVA 3KD2A 1GSIA 1KO7A 5JAOA 1WOYA 1T24A 3KC2A 5DPMA 2GH1A 3LUAA 4D3DA 1Q83A 2I5PO 1DLJA 1NPDA 3QE4A 4QHSA 4V0SA 4QG7A 1IQ0A 3V4VB 2YV1A 1OT5A 4B34A 4XVUA 5GONA 8GPBA 3VPHA 2CNWD 3FDXA 4YDRA 3NH9A 5EA2A 2ZAOA 3OCCA 5T4HA 3TXXA 3DLCA 3KAJA 2A0UA 4O29A 4KPUA 4AMZA 4MCAA 2QGFA 3P94A 4PZEA 4YVFA 2GILA 4DR5B 4AUMA 3QNUA 2FQXA 4XX1A 2UXCB 3BUSA 3OQMA 3FJOA 9LDTA 1Z2OX 1NOJA 1DTEA 1HC7A 3RNOA 1NP3A 2Z3WA 3EFBA 1UFKA 2H4ZA 1CDZA 3JAMA 4CKEB 4B75A 4QRIA 3DDSA 1GQQA 1JSLA 1Z4IA 4RF4A 3WGLA 2V7TA 4CV2A 1JLRA 2BFDB 2JFWA 4FX2A 4O8CA 2YXPX 4WCDA 1ISSA 4K6HA 3KB8A 3RSQA 1J06A 4ZO4A 3DNFA 3MJSA 2HOQA 3TLGA 2J5KA 2W90A 3LP5A 4M54A 2CJXA 4O0MA 5ARDA 4IDNA 3SY8A 3WMRA 5DLQC 1GQFA 4L75A 1W8IA 1QZXA 4REMA 3T3IA 4S3MA 5KYTA 1EFTA 3R23A 3W9BA 3FSGD 4LXGA 2ZRMA 3MN1A 5FR1A 3CXRA 3HFRA 1ES9A 2FW8A 3RU2A 2PBRA 1T6NA 3SNHA 2PUFA 4PFQA 5JADA 4H9GA 1I4EB 2YY6A 1LZKA 3DKRA 4O2LA 1CRQA 1UFRA 4MWDA 1TXGA 5LUAA 3RVMA 1RRGA 3PFWO 4MWTA 2EFJA 1JBEA 1K66A 2ROQA 3DT8A 1ECPA 3EIXA 1V5IA 3FGPA 4LDRA 3ZHTA 4EMSA 2VCHA 3BRSA 3OM1A 3VQTA 4EL0A 4QGSA 5KOYA 1LTKA 1KIAA 2PAAA 3UWSA 3IB6A 3L77A 4Z4IA 2VJNA 1QOQB 4TL7A 2BGNA 3OOSA 3Q1KA 4YLEA 4DQXA 4IJWA 4IINA 2WW8A 1NRWA 3VPXA 4PLVA 1D2GA 4QODA 2JGMA 1X80A 3ETNA 4TWBA 4POAA 1XMIA 1SC9A 1AH2A 1J9ZA 1WHSA 1X74A 2FEAA 2LVBA 2XHZA 2WWGA 1XQVA 4WWHA 3CVOA 1YBVA 2IE0A 2QAGA 3I30X 3ZHBA 3O2SB 4HXFB 4MI1A 2VF7A 1XZAA 3L01A 4OI1A 2PPVA 1ZN2A 3G8YA 4TV8F 5AM5A 1BJTA 2DWPA 2ZBFA 4ASUD 1EH5A 5AHWA 1SVIA 3GF4A 3VDRA 4AZSA 4BATA 5CA1B 3U1VA 2HWUA 4TYQA 4C0KA 2GXSA 4YMSA 3TG8A 1VLMA 2Z4TA 2VAWA 3L1UA 3WGHA 2VCYA 3WNVA 3E7PA 2RI1A 5GV8A 3A70A 3AHEA 2Y1DA 2HRRA 4EPTA 5BY2A 2RGAA 3DEAA 5BN4B 1CQIA 1IJBA 3AI2A 3JTEA 4M36A 4CE6A 2ZKIA 2X6QA 3SYNA 2PWYA 3DHEA 4ZN6A 3PV0A 5FOWA 2YIVX 4X6UA 1J20A 1BWRA 3L6UA 4J9UE 4J0JA 4KLCA 1L2TA 2XNCA 3KZKA 2CFOA 1DIGA 3PC6A 4ZQIA 3KUCA 2X15A 3QHPA 1P3DA 3BGSA 1U8AA 2AOTA 3ZCVA 4N5LA 3NPMA 3GEBA 3D43A 4DIUA 1PTKA 5L3RA 3V8VA 1MC8A 4NBLA 4HT3B 2BTEA 2YFYA 3NOOA 4TRJA 4BZQA 3H75A 3SM3A 2FPRA 3Q3HA 4WN9B 3M4ZA 1Z12A 4HZGA 1YQTA 1X2BA 2GYVA 1G21B 2JGJA 4E6EA 2WIDA 3EZGA 5K2MA 3U3KA 1JA9A 1WXXA 4TYPA 2FHSA 4RYDA 2R8ZA 3I6QA 3GLQA 4DWOA 1CHDA 1XZ8A 4PBTA 4WLUA 5F4ZA 4PINA 2OM6A 4AJ9A 4BX8A 5IKEA 4EHAA 1UXIA 4IIJB 5CGZA 3O5AA 2RKBA 2VAMA 2KI5A 4G81A 2ERCA 2XBLA 2CW5A 3OVMA 5JYBA 3HG7A 3OUZA 3ZDQA 4N40A 2JG3A 2YV2A 4MGHA 4BNIA 4RHXA 2XQJA 4MW1A 1Y7IA 2P6PA 1P2VA 3OTGA 4FFOA 4G1BA 1Z0SA 4Q7MB 1HZZC 2RAVA 3OIUA 4UNIA 4BV8A 4DF3A 2CLHB 1QTNA 2VDJA 1GG8A 1MXFA 2EX0A 5LDGA 4D2IA 5ALEA 2UV8A 4IRMA 3SMQA 5CA0F 2WAOA 2O1XA 3N2GB 1NAHA 1QLWA 1WV1A 2XOEA 1EUCB 1H2YA 1QUEA 4FEYA 4TRRA 1QFYA 3AHGA 2HD4A 4N0EA 4RADA 1BX0A 5C1OA 3GEPA 4FSHA 4J0QA 1BRMA 3ON5A 3UENA 3V7WA 1NXVA 5C4MA 4OJKA 5JXIA 2HI0A 1GD1O 2B4RO 3DL4A 1P0FA 4DC9A 1ZIYA 4RH3A 4W8HA 4DVJA 4JUBA 4L76A 1NOKA 1KOGA 1O94A 4H4EA 2BFNA 1PYGA 2P67A 3FMFA 1KBOA 1Y6QA 2VF8A 2GBLC 3HUFA 4FWBA 2EKQA 4NX2A 4RYLA 3K6SA 2DWCA 1R50A 2CC2A 2JD0A 3DVAA 1XCBA 3PUWA 4RD6A 1R74A 2CN1A 1A88A 2VSFA 1ZJZA 1XMQB 5A9RA 1X0VA 4LMAA 5SYMA 4AKTA 3QKSA 1YRAA 4QQNA 2XH8A 2PA3A 3VAAA 1U8XX 3IE1A 3CH7A 3BWYA 3GROA 2AN5A 1VHJA 4IV0A 4ZA2A 1NM5C 3HZOA 1OPRA 1JLLA 2R48A 1CUZA 5KS2A 4YRCA 4GZ5A 5FNVB 1X9HA 1S2DA 1KOLA 3O8LA 5JE8A 3OZFA 2ILTA 4XIIA 1JG6A 3AFNA 3QEMB 3DWEX 2QUKA 1EWKA 2VH1A 2B7LA 1P73A 1PW5A 3EQ8A 1UK6A 3BSYA 3OCWA 3U4GA 4N1AA 1FDIA 3PQCA 3CO0S 2VDWA 4OA8A 5LQNA 4IDDA 1K5PA 4IZOA 3NHAA 3PEFA 1J25A 2HIHA 1J2YA 2OV8A 5E1OA 3RJZA 2AC2A 4GOND 1ZM2A 4M1SA 1N0VC 4WDQA 5FFFA 1FC0A 4BNVA 3QVTA 3H7IA 1SOAA 4PANA 4G0PA 2ZRJA 1CC1S 1I1QB 1Y3DE 1T5LA 1O87A 3HFSA 3G5AA 1P2BA 4DV6B 3R5TA 2Z3VA 3G0DA 3T94A 2JGDB 3IERA 2I6GA 4YA6A 2ZUEA 1A95A 3OLYA 5G4KB 1Y8CA 2PX6A 2G0AA 4EFLA 5JAUA 3G2IA 1E5DA 2W22A 1G3IA 3PC2A 4K9NA 2EKDA 2B8NA 3WP0A 4BMZA 3GLFB 1C3JA 2EG9A 1A8QA 2XWQA 1P1FA 3R40A 3AYZB 3T1TA 2R6R1 3ANSA 1DJPA 4K03A 1ECBA 3RIXA 3D3WB 4IQGA 1PFQA 5EJAA 3ME5A 1FFHA 4PU0A 1UBJS 1NVFA 3SK0A 4BBPA 4ZEMA 2PY6A 5TGTA 4K6KA 3TKLA 1GGEA 4ZQEA 4ZQCB 3TLKA 1IY2A 1O4WA 1ZWKA 1VG0B 1Y8QB 5HILA 1E9BA 3GVXA 3ZE2B 1SVUA 5C4GB 3A2MA 5IFLA 4H0CA 1WKCA 1F9AA 2D00A 4GYKA 5KSOA 2GEJA 2M98A 2PGDA 4G89A 1QIHA 3E0QA 5EKSA 5UKDA 5ALFA 1C4XA 2QTAA 4DR2B 4PV7A 2R9VA 2VYFA 4GWGA 5IMBA 1PS0A 3ZBTA 3E27A 3NH6A 4AZWA 1OROA 3PD7A 2R1VB 2FPIA 3DEKA 4HAXA 3MMXA 4EH1A 3A0RB 4IIVA 1O77A 2PO7A 2H1CA 2X8AA 4N3NA 3M1LA 4KYTA 2W2XA 3CLRD 1EFPA 4XFKA 2AI2A 1CUYA 1QGAA 4K6CA 5BRAA 1APBA 2AW5A 3S40A 1UFVA 4L5YA 5DIZA 3UV7A 2OQRA 4AKIA 4NHOA 1OTYA 2Y66A 2FDXA 4ABYA 1PX2A 2QT0A 1D3AA 1PUXA 5KVVA 4LDQA 4UHCA 5I7AA 3CNQS 2XIQA 2XQFA 3AL2A 3KVNA 4G84A 4NMLA 3KLNA 1VJCA 2F43B 2R00C 4B3XA 2QVCA 1G4AE 3GB9A 1A0OA 4YCSA 2XUPA 3CHYA 4CIAA 4I8XA 1E61A 4G67A 4GBGA 1OB5A 5DHUA 1CS0B 1L0BA 1P80A 2PT5A 3KE8A 2EXXA 4G9GA 1ODTC 1H1TA 2EJCA 2PYZA 3NOQA 4WKGA 4MH0R 5KTRA 2EJUA 3EC2A 4OKNA 4OFZA 3AJDA 5DB4A 2ZRNA 4EG3A 3C1AA 5EGNA 1KTVA 1U81A 4K6MA 4S1PA 1KKUA 3KVVA 5A7GA 2J3KA 1Z6TA 3MXTA 1RWBA 3EVDA 3OTQA 1DAHA 4MVYA 4Y9RA 4F5YA 3I2JA 1DX9A 1KKMA 2WLTA 1E2JA 2H29A 2OGTA 1A5BB 1KYYA 4OMUA 1TZKA 1GARA 5CD1A 1AMNA 3EQZA 2K6GA 1EX1A 4KRYA 4NZNA 3HCCA 4JLMA 4YR7A 4UM9B 3AOGA 3U81A 4MQ6A 4MWBA 4CN8A 5IJWA 2C83A 3PE4A 5CCBA 2BPOA 2ZJ2A 3QBEA 2FPUA 3EXG1 1EMDA 3W2TA 4EF6A 5K2OA 3UNXA 4KPYA 4YN3A 4D97A 3K5IA 4LMRA 1QGED 4RM3A 4CM7A 4D9NA 5IVHA 3R0JA 5IAOA 5I48A 3D6MA 5GJBA 3MS4A 3DZBA 1SKUA 1P5FA 3WAJA 4IHQA 2XBMA 3LVBA 3H5TA 1KO5A 5K0LA 1TE2A 3VU1A 2FF5A 1WMFA 1X1DA 2O7SA 4FOPA 4ESVA 2WDZA 2HC9A 4I6EA 2R2AA 2RC5A 3G8CA 3IAEA 4X8LA 1BWSA 4R8KA 5F5LA 3ZVMA 3MF4A 1SUSA 1S0UA 1NLMA 1NYTA 4TV9F 2C7BA 1P6XA 4H3KB 2WWWA 3D8SA 3JQQA 1NUSA 1UC9A 1YDGA 5F3DA 3ROMA 4UHKA 3UJ3X 5CU7A 3ELWA 4F5WA 3ZD6A 3L46A 4WLFA 3KYCB 1JIVA 2AFIA 3WY9A 4R3NA 4MUXA 4DG5A 5FI1B 4PRKA 1KZGB 1B74A 1DOAA 2O57A 2ZT5A 2HMTA 3FD8A 3SLKA 4F7DA 4YFYA 5EEGA 3KZ1E 4FDVA 2H3HA 4YRZA 2P75A 5KZMB 2CLFB 2GX6A 3AJAA 3COWA 3OSZA 4Q19A 3BMNB 1IZ7A 1M8KA 1QQ5A 1SUPA 1KOJA 1LLDA 3WLQA 3CNLA 1WXDA 3NIDB 4TXLA 4DDKA 1BVRA 3LC7O 1GZ6A 2HDHA 4HLUA 5HQJA 4OGGA 1L1RA 2X0KA 3A1TA 3DFUA 4OJTA 1NJ2A 2WA1A 3KSBC 2P2DA 4E6PA 2XXJA 2ZQYA 4LF8B 5AKYA 5IC5A 5G0TA 4AMVA 1QOZA 1GAJA 1O94D 3CZCA 3GPLA 1M2VA 5LYJA 5ED4A 1KZ6A 3DT6A 2SICE 3H2JA 3KPWA 5JJ5A 1M33A 4J2OA 3AL3A 3ASUA 5LA6A 2YZKA 1E3WA 1WX1A 3C1UA 3IKMB 3MA0A 4KLRA 3V1MA 4DV3B 5IVPA 5TMEA 1WD7A 3TCXB 4TMKA 5BSWA 1EM8B 2P1DA 4GWKA 1BYIA 3RI3A 1GNPA 1V11B 3N6XA 2OHVA 4UHFA 1G8JA 2DCMA 4A6PA 2OXCA 3IVCA 2RIPA 2JNWA 3JYPA 1NJ1A 2DKNA 3PYMA 2JD1A 3AETB 3TR5A 1V4BA 4J0FA 1N1DA 2HQSA 1Y3FE 5HSGA 1P44A 3LXUX 3BK1A 1T29A 1I4DD 3A10A 1CDEA 4HYYA 3WO1A 1T8YA 2GK3A 1CF2O 2PQ0A 1EVZA 2II6A 1GGKA 1R0BA 2X8JA 4EGQA 2I66A 1VSTA 3MPOA 4MQEB 3U9LA 4GR5A 3EZNA 3TRIA 2CB9A 2YXBA 4ALMA 1I4WA 1K1EA 5B3JA 2BGWA 2A2ZA 2WHPB 4PZZA 4XWGA 3EIHA 5IKOA 5JQGB 1Q7GA 4LZWA 3EIEA 2CLOB 2WUGA 5DYWA 4ZVVA 5IBPA 4CKWB 5EJ5A 2HMSA 1E0JA 1G8MA 4B3FX 2WHXA 1G9TA 3ENQA 5TNXA 2OCBA 3RUEA 2OL4A 3O03A 1NDUA 3T5BA 1CUGA 1WXQA 1DFGA 4XGIA 3TLXA 1NVWQ 4CL0A 5DOZA 1VRVA 3S5JA 4A1OA 4PG5A 5DNUA 3UWOA 3JVIA 2W6MA 3N2KA 221PA 4PEVA 4WCFB 1X39A 4Z7JA 2V97A 3ZE9A 1UMCB 3OTWA 1R6AA 1BRTA 1GZ4A 4M0LA 3HXLA 4C14A 4CV0A 1WZUA 3GRZA 5AIBA 2D4AA 5EKUA 2BH9A 1TPZA 3OC0A 2A33A 1TNDA 1VA5A 3ESYA 3FB4A 2YOHA 2UVPB 1W76A 3NBYC 3HBFA 2IEGA 2NM0A 4KX5A 4OYRA 4TVOA 1J8FA 3LCVB 4YAFA 2FR0A 2Z5GA 3JYNA 2W0MA 4GEGA 3IAHA 1JVNA 3EEFA 5K51A 1CUFA 4U2BA 1ZD9A 1YF3A 3A7EA 5KQPA 3AIKA 4ZQFA 5FCDA 3HKEA 1L6RA 2BTQB 4F3CA 4RULA 4O2AB 5HW0A 4FWTA 3R7BA 1ZJ4A 2Q0SA 3WRYC 4TT8A 5LZ4A 1OAAA 2ZWPA 4MR7B 4E94A 1M67A 3K09A 2JLCA 3Q3CA 4IOMA 4CQNA 3UIEA 3D7RA 5L4LA 1RAHA 3L8CA 4E70A 2Y4NA 4DMFA 2IZ1A 2M6RA 1OYWA 2MIIA 3URMA 2YZGA 1R3DA 2VH2A 1R5JA 4CF6A 3UBMA 5I7HA 1SA0B 2J31A 4F72A 2PKCA 2VJCA 2WJJA 4KE8A 1UF9A 3M9WA 1Y1SA 2CFTA 4M9CA 1IHOA 1W1IA 2YDXA 1KJIA 4TT3D 4X1IA 5IDYA 3TZLA 4ADSG 2GXAA 4A2CA 3PK0A 3BILA 4FMDF 2N47A 2ZDHA 4E5KA 3KRTA 3G49A 3LXRA 3QPWA 2GPAA 1MD9A 1YUMA 2CMKA 3A9WA 1JSXA 3JAWB 3W6ZA 5JCPA 1E3QA 2XVMA 3H1GA 5E0KB 3HJCA 2OFWA 3ZTTA 1GNQA 2ZBGA 3CH6A 3KYBA 2HREA 1E60A 2YYYA 1D0SA 3CSSA 3FZNA 2DCUA 3IVGA 3TQHA 4Y0AA 3GLHB 1FTSA 3RE1A 5I51A 2HXSA 4H6WA 3DM9B 1QFSA 1VHLA 4RC9A 5FQOA 3VOBA 1UJ5A 3FM9A 4OHWA 3K1ZA 4WINA 3HEMA 2UUAB 2G8NA 1HNWB 2YW9A 2EP8A 1JR3A 1CY8A 2PH3A 4CT0A 3ZH9B 1GAWA 4R2XA 2AJ8A 3WGUA 4F9FA 3OPXA 5ADVA 4AT1A 1ZIOA 2IYVA 1MJFA 1LLQA 2AT1A 3DPIA 1O97C 2FG5A 1DXHA 4PVDA 3JZAA 3MRXA 3CZ9A 4EY4A 2J3DA 1XOIA 2ID4A 2R751 2I2FA 3S70A 4EA8A 4F6RA 2JATA 3MWKA 1KKLA 1PLLA 2Q9CA 3GNQA 3L4BC 4Q1AA 1X14A 2XE7A 1KZ1A 2DHEA 5JC8A 3G7NA 1EP1B 1I01A 2ZJFA 5CG2A 1EHYA 4LRXA 3CYFA 5C35A 1PEYA 3QVWA 3LPLA 3TAUA 4A8JB 4UEWA 3D5EA 1GCOA 1W7AA 3ROKA 1EWQA 4FFBB 2GETA 4BWYA 5FIUA 2BUBA 1N2CA 4G1VA 4RPKA 1Y6ZA 1W59A 4OUKX 3Q3IA 5IDXA 1U1EA 2ATCA 2BONA 2GRAA 3E4CA 4J3FA 2GTPA 4NFYA 3K2BA 2VA8A 4OHXA 4C4AA 1IM8A 3MSCA 4P4GA 3C43A 1M8JA 4IM7A 4JI5B 1RXWA 3DQPA 3RUDA 4BYMA 3T5AA 3KJGA 3KNZA 3EUFA 3O7WA 4I66A 1EQ2A 2QM8A 1R64A 5CCXA 3H9CA 2GO1A 2R8XA 4WLOA 1H4TA 1F8UA 5CJ2A 3WIBA 5I8WA 4RKWA 1XG5A 1SZCA 2COEA 2F1HA 2L82A 1UKZA 3N2IA 4N6GA 4Q4AB 3K6KA 5LBUA 1W0CA 4AIIA 4E2FA 1TQ4A 3H2YA 4J90A 3CZ5A 4F12A 3OT1A 2ID8A 3LD9A 4O3FA 5CDHA 1Y7PA 3NBXX 3ROEA 1TUGA 4R5MA 3NAGA 3T1HB 3GBSA 4L4YA 2TMGA 4FOSA 3HWSA 2SHKA 3QG5A 2WIJA 4FQ5A 4KAFA 4KW7A 3TOVA 4BP1A 5KJ1A 5KOJA 2O0MA 4LC1A 1Z4OA 2IHTA 2IXFA 2JGFA 1CQXA 4DNXA 1M8GA 5BR8B 3ZJTA 4BXOA 1NI4A 1VL0A 1GN8A 2Z8YA 4PGFA 2PRIA 4J6FA 4BV2A 1IN8A 2E4UA 2CNBA 1F8FA 3Q87B 2HIAA 2P2SA 3PWZA 2ODTX 3IUMA 3QM1A 5ED0A 5B3KA 2JD2A 4XA8A 4Q18A 4W1SA 1XZHA 1QWSA 5E9JA 1QOPB 4H1VA 2HZBA 3FB1A 1A5AB 1OGYA 2I67A 3DBIA 3TBHA 4IILA 1C80A 3NIWA 1VBFA 3K8OE 2QW8A 3QTBA 3R76A 3KKKA 1H2WA 3DC7A 4Y2PA 2NNWB 2UVQA 3FHOA 4CTJA 4DLLA 1YTUA 1UODA 2ECPA 2NSLA 4MVWA 1J33A 1U0LA 4PO8A 2FPGB 5AH0A 2IT1A 1SIUA 3AINA 3WGIA 1GXSA 1JLSA 5I9TA 1C1YA 1OA1A 4B8WA 3VU0A 4W6ZA 1DAPA 1ECLA 4Z0NA 1QFMA 5ALXA 1MC1A 1NG1A 4D79A 3RSGA 4D57A 3OLWA 4JXJA 1UADA 1QPBA 3LPDA 3PUXA 1VLVA 3GLKA 4JEIA 3TRKA 4ZAWA 1ZR4A 3KT0A 1NVBA 2JFHA 3OCYA 2IV3A 2BZSA 1V1RA 1TYCA 1G5TA 1UZAA 5BWNA 1OA0A 3WXMA 4MVJM 2Z6UA 2Q5LA 2YN0A 3TQQA 2D0OB 3COSA 3KELA 4EIWA 1QONA 1TFRA 1ZONA 2GZMA 3TQTA 4V2IA 4OHYA 1O54A 1EVIA 1U31A 2HBZA 4Y98A 1DX6A 4B76A 2IHBA 3G5TA 4CQMA 4UUNA 4XGKA 1E6UA 4ND1A 2QAGB 3M6XA 2BLNA 1A7JA 2FA9A 4PGGA 1DQSA 5LLSA 1Z4NA 3E5NA 2IUTA 1KPHA 5G53C 4BMPB 2L2QA 4QQFA 5IN5A 2Z2IA 5CW2A 4NBWA 3IX7A 2EHJA 4XM1A 1NG9A 4MW0A 2Y1XA 2SECE 1JIUA 1TO6A 3WGNA 1N3BA 1N6HA 2D5AA 4F91B 2BBTA 2PCLA 2Q4DA 1SUEA 2XQVA 2ZSFA 3BOSA 3DEIA 3ETCA 3IV7A 3KVOA 4Y2TA 1JPUA 3NM4A 5JYCA 4JJ6A 3U4QA 1MPXA 2O2HA 5B58T 2JCYA 4C08A 1CQIB 5K3AA 4XQCA 4HX5A 2YYAA 5COBA 1IYZA 2FP3A 1P2UA 3HNPA 2AMLA 1U02A 1E5LA 1GKUB 2J08A 3EDMA 3IESA 3IP8A 3QNWA 1SHJA 4ZAXA 3SD7A 4AN1A 4BQIA 1E2FA 3MOGA 1XR3A 5FWXB 4M1EA 1C9JA 2RH8A 4RY2A 4WKCA 1L4UA 1ZN7A 4ZHQF 2QBYA 1RM5A 1KZYC 2G0TA 3GMIA 4RX1A 4Z9BA 3T5PA 2I29A 2Y1OA 3PGA1 3FTEA 3EOZA 1PTJC 4QPCA 4KWEA 4LJ5A 3CW2A 3LBHA 4INAA 4DMCA 3PEWA 2NAFA 1LTQA 5AVVA 2NVUA 3EVAA 1FX0A 2RCNA 1HNZB 4XJVA 1LWOA 2X19A 5TQJA 1M72A 3PNYA 2I4IA 2O2YA 4ZODA 4JUIA 3UAXA 2JIBA 4BLVA 1LK5A 2ZVJA 5FPHA 2FE1A 1T36A 1KFJB 1PE0A 1ZK3A 3EMVA 1NC3A 3ZVNA 1JDBB 3A4IA 1RZVA 2RIRA 3D6VA 3FPHA 4XGNA 2RGUA 2COKA 4XPZA 5IYZF 1CJSA 3Q3GE 4YRRA 2WSMA 2R85A 5REQA 5BWBA 2D06A 4RAQA 4MV7A 5E6SA 1T2FA 3U39A 4OU5A 3LUHA 1EP3B 4NYIQ 5DX0A 3AV3A 1UXHA 2J5BA 3CLKA 1HE2A 2PTHA 3OMXA 4HI0E 4L2IA 2PLNA 1M2OA 1RRVA 4LRYA 4W9NC 4KQWA 3FDIA 2PX3A 3G5MA 2ZG6A 1FZQA 1PR9A 1JR3D 3PBKA 2G9VA 4RBNA 4AP6A 4L50A 3WMXA 4YX9A 1ST2A 2O2SA 3FDFA 1VLHA 1FQKA 1JIXA 3H84A 3U7QB 3P52A 2D5CA 2PVSA 4NNOA 4XVQA 5E4YA 3TIXB 4B73A 1JECA 4HJRA 1BU8A 4TXHA 2OZLA 2Z5VA 1RAAA 1SULA 3LBYA 2JJ1D 3AGPA 3P7MA 5FKJA 4C78A 3K6SB 4TYWA 1ZGJA 3DVAB 4C89A 3NBUA 5MN6A 3DHVA 4MQ4A 4JELA 1C9NA 1QR6A 3RSCA 3P2IA 2IJGX 4MEJA 1XHFA 4E5SA