1D5WA

Phosphorylated fixj receiver domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
122
Chain Sequence
MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
publication title Conformational changes induced by phosphorylation of the FixJ receiver domain.
pubmed doi rcsb
source organism Sinorhizobium meliloti
total genus 38
structure length 122
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d5wA00
1BDIA 1DC7A 1FSPA 4IMIB 1DG9A 1VLZA 1W9HA 3LFTA 1DJMA 2QVCA 3TD9A 3CTPA 3BRSA 2JBAB 4OBBA 3DGEC 4ML3A 1I3CA 5KQMA 2FVYA 4MS1A 2QZJA 4Z9BA 4YP9A 4ETNA 4RXTA 1QP0A 3LUKA 2R25B 4D6YA 5FBHA 2AYXA 4XASA 3RVMA 2CHFA 2FMFA 3LKBA 1GLGA 1A0OA 3A0UA 3IP9A 3O2SB 5IC5A 4EVSA 5KQLA 1QP4A 2DRIA 3OLXA 2PJUA 3TX6A 2PMCA 3O75A 3SG0A 3EQ2A 4RY8A 2L2QA 3H1GA 2PL9A 4MYRA 3DGFC 4MPTA 4WZZA 1D5WA 2PL1A 4KQ9A 4MR9A 4M88A 4YRZA 1L5ZA 3GRCA 4NQRA 3FFTA 2O20A 3MIZA 1Z26A 4EVQA 4H3KB 2QXYA 1W25A 1YK1A 4RKQA 5EWMA 4EUKA 3FDFA 2P9HA 3GBPA 3QLUC 2HPHA 4MR8B 3L49A 2N9UA 1EWTA 3FFXA 1URPA 3FFWA 4G0QA 4WUTA 3T8YA 3MF4A 4L85A 4LE0A 1YVUA 3BBLA 2PKXA 3QEMA 1RZRD 1DBWA 1TLFA 4DQDA 3NNNA 5FWYB 4MR9B 1OXBB 4XFKA 4HNQA 5C5EA 3HXMA 3Q15C 3IP6A 2HSGA 4ZYLA 1Z2EA 3HS3A 4ETMA 1SRRA 1WETA 1VKRA 2RGYA 1JF8A 4D74A 1P8AA 3C97A 1PUXA 3DLHA 1QNLA 5JNWA 4S04A 2FMKA 3N53A 1K68A 3KJXA 4N76A 4HNRA 4ZMSA 2E4ZA 4Z4FA 2PUBA 1DRJA 3RVOA 1ZVVA 2FEPA 3O1IC 5KWSA 1USKA 3BILA 3H6GA 2FEWB 4GPAA 4MLDA 3D8UA 3KG2A 1NXWA 3EQZA 3M6MD 1U2PA 2PUDA 2LP4Y 4FE4A 4W5TA 1ZDMA 3NNDA 4N0PA 5IUJC 4PZ0A 4RK4A 4NV3A 4F11A 1SXHA 3EULA 7ABPA 3GBVA 1M2FA 3B2NA 4D6XA 2MSLA 2L18A 1KGSA 5JS1A 1PEAA 3DLBA 2FLWA 3KHTA 2GBPA 2P4UA 3HEBA 1NY5A 2IOYA 2PAFA 4Y9TA 4YGXB 5TE9A 1JX6A 1ZN2A 5T7BA 2WJWA 1A04A 4RK1A 2FN8A 5CNKA 3EAFA 1DBPA 1MAVA 1J56A 4EY3A 1QO0A 2M98A 3K9CA 4YLEA 1APBA 4KNYA 4ZMRA 6CHYA 5FBKA 2OQRA 4HYEA 2FQWA 5IX8A 1MVOA 3OM0A 2NT3A 1YTUA 1DRKA 3F7NA 1NXXA 2FEKA 3H5LA 4GNRA 4IF4A 4MRMB 3O21A 4DADA 1EFAA 1D2AA 3OO1A 5EWJB 5T3YA 4RK7A 3T6KA 3UKJA 4EYQA 1KMIY 3KLOA 2MYPA 4KQCA 3LKVA 3MMNA 2A9QA 5TPZD 5HQJA 1D1QA 3OQNA 5FWXB 2ZAYA 1JL3A 2MYNA 1M5UA 3KKEA 1BDHA 1E2BA 2GX6A 1ZESA 1ZH4A 2L19A 2R48A 3CU5A 1LJLA 4HNSA 1ISRA 1FFWA 3OM1A 2NZUG 2JVIA 3E61A 4G0OA 4Z4HA 3CG4A 1JWLA 4WXMA 3H5OA 5IEBA 3T38A 4YCSA 3O1JC 4NCAA 4Z4IA 3HVRA 2FW0A 3HCWA 4PE5B 3M9WA 3URMA 5IUNC 5C5CA 1BAPA 2MSWA 1TJYA 4KK4A 5DKFA 2JB9A 1IIBA 2MYUA 3LTEA 4MQEB 4RS3A 4RXUA 1K66A 1R8JA 3A0RB 4W5NA 2QSJA 2JVJA 4O1HA 2MYTA 4QYMA 2X7XA 3H5VA 3P9YA 4ETIA 4TLLB 3NBMA 2GWRA 2IPMA 3K4HA 3QX9A 1GCGA 3L6UA 1EAYA 4KV7A 2F8TA 2LBPA 3NHMA 3CNBA 1DBQA 3KYJB 1ISSA 4N47A 3IDOA 3OQOA 1FFGA 3S99A 4MS1B 3GYBA 3R0JA 2CWDA 4F12A 1JDPA 3OLVA 3I09A 2M1ZA 4PICA 5E3JA 1BDJA 3SQNA 1VPWA 1EHCA 1VRVA 4RY0A 3EDCA 3RVQA 4E7PA 1EWKA 2QVGA 1SXIA 3CG0A 4MR7A 1TVMA 3GV0A 4RDCA 2XDYA 3HV2A 1NATA 4PYRA 4LX8A 3DBIA 5KC9A 1NXSA 1QQBA 4G0YA 4MAAA 4IRXA 2RDMA 4XAQA 3JVDA 1DCFA 1PHRA 1PNTA 4QYWA 3F6CA 1EWVA 3RVSA 3H5IA 3JTEA 1ABFA 2PE5A 3HK2A 3M9XA 1U0SY 4Z4GA 3HO1A 5BR1A 5TQ2A 5F64A 4Q6WA 3FMVA 4YV7A 5IBQA 2ID9A 2E4XA 3IP7A 1ZHHA 3G85A 3QX8A 4LE2A 1NXTA 3HDGA 3OMWA 4MQFA 2CD7A 3A3KA 5KQGA 3CZ5A 4IMJB 3KS9A 1Z18A 4RSMA 3RVPA 1QO0D 5EWMB 1JYEA 4Z4EA 1E6KA 2HQOA 3JS5A 4G86A 4G97A 3RVKA 3UUGA 2ID7A 1CHNA 2YHAA 4Z4CA 3MM4A 3KSMA 1P2FA 1TM2A 1USIA 4PEVA 5JNTA 5JNUA 3EJWA 4Z0NA 4Q6BA 1JDNA 4YO7A 3QEMB 3TO5A 3O1HB 4JB2A 4LE1A 5BRAA 1B00A 1GUBA 3HJFA 1XWWA 4W5OA 3SNKA 1ZGZA 4OLAA 2KYRA 2CHEA 2Q5CA 3HM9A 4N41A 4RWEA 4WWHA 2LUOA 5GOTA 5BQ3A 4NICA 1USGA 3SAJA 5GQSA 3I42A 3RVJA 1Z15A 4YR7A 1JHZA 2FMIA 4OTZA 4MQFB 4WXEA 1QP7A 3QLTA 4KZKA 3TMYA 5IULC 3RVRA 4LZLA 2FTKE 5TQ0A 1YS6A 4CBVA 4ZJPA 2IDMA 1ZGGA 2HQRA 3H5TA 2GI4A 2E4VA 2WRZA 1Z16A 1XHEA 4IILA 1H9CA 3GL9A 3O74A 3N0XA 4MGEA 1Z2DA 6ABPA 1KRWA 2WWVD 3LUGA 3KYIB 2PUCA 4O5AA 3OMXA 1F51E 5B3JA 5CNIA 3ROTA 3C3WA 4N0QA 3QLVA 5TQJA 2RJOA 2A9OA 4YWHA 1QQAA 1DCKA 5DCLA 3I45A 5HSGA 1L5YA 4H60A 2NZVG 5CHYA 5HKOA 3FGZA 2JBAA 4JOQA 4MS4A 1LK0A 1SXGA 2RJNA 5CNMA 1XHFA 2A9PA 1E6LA 2TMYA 2AYZA 1RXEA 1A2OA 3T95A 1CYEA 5TQ0B 1AB6A 5EWLA 3RVNA 3UK0A 1QKKA 4TMYA 4TLMB 3ROFA 1PNRA 5DLEA 2VUIB 4JAVC 3N6VA 3GT7A 3LUJA 3N0RA 4KK3A 2VYCA 4RK0A 4LRQA 1MB3A 4UHJA 2IKSA 2IPAB 3DZDA 3LUCA 3N0WA 5PNTA 5KC8A 1JFTA 3KLNA 3N8IA 1Z13A 1FFSA 1JFVA 1RNLA 2YHBA 3JPYA 4JASB 5JNSA 2W42A 4F3TA 2H0AA 3CS3A 4EGSA 4OATA 3GA5A 3OO0A 2I6FA 4MLCA 3H5WA 4XLTA 4NCBA 1D1PA 1U04A 4RZSA 1JBEA 4Z99A 1DCMA 3CZCA 2FN9A 2QR3A 4JB0A 1YMVA 1ZAYA 2BGGA 3VNBA 1RPJA 4KVFA 2E4UA 4MS4B 4QICA 1LBIA 4RK5A 1TMYA 2VUHB 1NXPA 1M2EA 3BRQA 1LJUA 4F06A 3Q9SA 5EWLB 2JRLA 2WJAA 3EGCA 3H6HA 2PLNA 1NXOA 1JFSA 2PUAA 1PEYA 3BREA 4JA2A 4KFCA 3TB6A 1MIHA 4EVRA 3IP5A 4MR8A 1U8TA 3Q7SA 2FLKA 3CKMA 2JK1A 1KRXA 3O2QB 1ZY2A 3RH0A 4OG2A 2JCGA 3ILHA 4W5QA 1YIOA 1Z12A 1HEYA 2R4QA 5JNVA 4S05A 2A9RA 4O1IA 3QK7A 1LBHA 1ZITA 2WB4A 5TPZA 3OLZA 3OLWA 4TN5A 4FB4A 2B4AA 4RV5A 5FWYA 5KQPA 1CEYA 1E6MA 2FQXA 2PUEA 4F8JA 3CRNA 4JP1A 5TPWA 1GCAA 2LIVA 4L4UA 1YS7A 2FMHA 5IEJA 3N75A 2OENG 5HM6A 1YK0A 3LUHA 3RVLA 2WMYA 3CFYA 4RK6A 3SM9A 4LDAA 5ED4A 3O2JA 4XARA 3JPWA 1NTRA 4MS3A 2LPMA 1DZ3A 4WT7A 3LUDA 3Q7TA 1DP4A 3IPAA 5B3JC 3QLVC 3F73A 4ZPJA 3ILYA 4P98A 4KMRA 2FXIA 2ZWMA 5CNJA 2IYNA 4OLBA 4EYKA 4MR7B 9ABPA 5D2CA 5IUKC 5ABPA 2QV0A 1Z25A 3C3KA 1ABEA 1M5TA 2PUFA 4KPYA 3H75A 3MA0A 1OXKB 2E4WA 3QELA 1C4WA 3HZHA 3F6PA 2IPLA 3OQMA 1QPZA 1AB5A 1S8NA 3QEKA 2E4YA 3KTOA 5TPWB 1Z17A 5BRJA 2FKAA 3I5AA 3LUAA 3SY8A 4G0XA 4W5RA 2V0NA 5TQ2B 2QU7A 2R47A 4B09A 3EODA 4LDZA 1BVHA 3OLYA 1GUDA 4Z9AA 2J48A 4N03A 5I4CA 4MS3B 3H1FA 1D4ZA 3VNAA 3GWGA 3HDVA 1U2QA 3Q7RA 3HUUA 1FQWA 3HSYA 1F4VA 2NT4A 8ABPA 2PUGA 4MRMA 4KRFA 3Q41A 3D02A 3RQIA 4IGAA 3E3MA 4FE7A 4Q7EA 5EWJA 2H3HA 3LMKA 1RZRA 3QELB 2VK2A 1ZH2A 3LUFA 3QLUA 4RU1A 5DGCA 1P6UA 3CHYA 3NHZA 1JH9A 4YS6A 5DTEA 5JS2A 4G0ZA 5FWXA 1T34A 4XXHA 3LOPA 1MB0A 2FSPA 2HJ9A 5JNRA 1RXIA 2JVKA 2QW1A 3A10A 1C0EA 3G1WA 3MQ4A 3HUTA 4RKRA 3CLKA 4EYOA 4RXMA 3IPCA 1QMPA 2GKGA 3W9SA 4E7OA 2FQYA 3KCNA 4G0PA 1P6QA 4UHKA 1SD5A 2F8SA 4RY9A 2L17A 2IPNA 4KREA 1UDRA 2MSKA 4G0MA 5KI6A 1Y1LA 4DN6A 2HQBA 1BA2A 4MQEA 3C3MA 1NXVA 2B1JA 1JYFA 3C6QA 3JVIA 4P1ZA 3MYYA 3NNSA 4EYGA 1YMUA 4H3HB 4QPJC 1JLKA 2WY2D 3JY6A 3H1EA 1DC8A 2NUBA
chains in the Genus database with same CATH superfamily
2DJ5A 3Q40A 3F6SA 4WKCA 3ZGVA 3FF4A 1SPXA 3UMFA 1RDFA 3HZRA 1CS0B 3JAWB 3ZCXA 2FOXA 3UGQA 1MT0A 5KTPA 2MR5A 3ODGA 3OESA 3OSZA 4UBIA 1ZJZA 3SR3A 1NMSA 3CTPA 1WLYA 3WYDA 4R51A 4O2AA 2PNJA 5AKXA 4FHCA 4X44A 4AJ4A 3T1TA 2WI8A 3M34A 2AFRA 1DWPA 4PN7A 3U4QB 5JLJA 3GFBA 1ZYUA 4ZYVA 5K4HA 4WERA 2H16A 2FQQA 1GAXA 3GRAA 4C2TA 3A6PC 5TMPA 2WSBA 4HUJA 3BF7A 3ORFA 1UFRA 4JLJA 1MHPA 3L46A 4H59A 2O2SA 1QYXA 1O77A 2DRIA 2COUA 5ALKA 2ERCA 2FRDC 3SC3A 2PTHA 2VHCA 2NVUB 1BX0A 3RUIA 4A91A 1W5SA 3K53A 1BJRE 3EQ2A 2JLBA 1E0JA 3NCHA 5BUCA 5FA6A 1A96A 1R3DA 1OIXA 2HMUA 4KQ9A 2IHJA 3O90A 3TFWA 3RJZA 1I30A 3LLUA 5CX4A 4BO2A 3DLIA 4B4KA 4B87A 3RRNA 3NIWA 1DKOA 4G3XA 5AESA 4I46A 4LW8A 1SEVA 2P2LA 1H8HA 1H2YA 1GR0A 1UKCA 3MIZA 4KE7A 4TL9A 5CVCA 3TQHA 3TNJA 3E70C 3ZN2A 4D8WA 4N6OA 2A78A 4LFBB 2DQ4A 2I6TA 3IVAA 4I4TA 1QAOA 3C0KA 1A4XA 3OJLA 1B76A 3HSSA 4DUGD 4D99A 3W7AA 4WUTA 4ZDJA 1URPA 1KI6B 2AMLA 2BR5A 4JI6B 4DJDC 5ICMA 1A72A 5AW7A 2HDHA 1JT2A 1KETA 1N6LA 2HRRA 3BBLA 3V4OA 4B6RA 3QEMA 4X20A 3WLEA 4B3HA 4EKNB 1L7QA 2CHQA 2FMXA 2GBIA 1ZA2A 5CURA 2ZQ5A 4MWEA 4XFKA 2YUIA 2NPOA 1P77A 4EATA 1E5QA 3II6X 2HWKA 3WA7A 1X0VA 2WIFA 3AJ8A 2WD7B 5DK4A 5EHIA 5BYBA 5JY6A 1ECPA 2WK1A 3KLMX 3QITA 4C0WA 1IOWA 3N58A 5IANA 1U63A 3ACCA 4YJ3F 5B2ZA 1BH6A 3AFHA 3ZV5A 3BN3A 3L40A 1KMHA 4WK2B 3LHIA 2JGLA 5KS2A 5JFOA 5F9FA 3AP1A 5LQJA 2BRUA 1UKAA 1KQOA 3ZI7A 1T25A 3VPHA 2GZ1A 4BKRA 1G41A 4JBHA 4OCZA 2Y1WA 3ENQA 2YHIB 3K2IA 3BRCA 3MWGA 4HLDA 4R5MA 2ODAA 1SQ5A 1LNQA 2JDIA 2P30A 3CZRA 3P4XA 4YJHA 3ZWXA 1UBOS 1SCNE 3M6MD 2GLUA 3GOHA 1E3JA 4Q4AB 1PFWA 4ZO7A 1E1RD 4GI2A 5H81A 4N0PA 1IQ0A 1DEKA 4YP6A 5BT8A 1POWA 4GQAA 1BKYA 3OOEA 1WX1A 3JQPA 1U31A 5E6SB 1RQXA 4IMPA 4OO3A 4G5GA 1SK9A 2FR1A 1BEEA 1W59A 2UYOA 2OBYA 3IC5A 5GVRA 3ZIUA 2JLZA 3ZWDA 3DLBA 4Q7LA 4L4ZA 2P4UA 3EVAA 5AKZA 1E7QA 1RTTA 5EIHA 4N5MA 1Z9BA 3WNBA 1W0JD 2QORA 2HGSA 4Z3KA 5F23A 3COJA 1OLSB 1S8FA 3A9WA 3I76A 3CXUA 1FFXA 4BBPA 1SKYE 1F60A 3E53A 4YRJA 4JWTA 5DYYA 3UFXA 3PNLA 3BAZA 4ND2A 3LCRA 1QV6A 5KJEA 2ZBUA 1N0UA 2FVXA 3P20A 2CWWA 1GSAA 2ORYA 4X0EA 1XEWY 4M8NE 4B43A 2IP2A 4IKEA 4BNMA 4R1MA 4JL6A 4OBEA 4EPTA 4X6LA 1UL1X 4LYGA 5F1KA 4P53A 2P9FA 4QG3A 2R8PA 1SM4A 3NC4A 5B7PA 5JFGA 1WB9A 4KQCA 3U1BA 4OOFA 3TAHA 3F5DA 4YRIA 2CLSA 1VZ3A 4RKEA 1KI2A 4D96A 3AF0A 3QPBA 2O2YA 3EQ7A 2ANCA 3MT7A 5ALMA 2G40A 2ZUCA 1AU9A 3EG9B 5DRYA 1RHMA 5EI5A 3RT7A 1KGDA 2WWRA 4RYLA 1XZGA 3S68A 3OIYA 1XKTA 2VEDA 4DSUA 1LJLA 2AE1A 3H83A 1M6EX 3OX1A 5H3LA 2DP4E 3EDMA 2RKWA 3W8RA 4CFSA 4R2MA 4OSEA 3U3ZA 2G17A 3Q2OA 4D8UA 1P80A 4I8IA 2HHHB 1UIMA 4RH3A 3I2JA 1GXSA 1QE5A 1SUBA 2V54A 2Q21A 4B73A 2Z58A 2DSNA 5EGSA 5C5CA 2ZIXA 2E7ZA 1T4DA 3MTAA 1GAQA 4TLAA 3WGLA 1YMQA 4INAA 4MQEB 3JQEA 4QYIB 4ZAFA 2B1IA 5C8YF 5IC6A 4AO6A 1SWWA 1WMAA 3BHMA 2GGSA 1QGAA 1Y4ZA 1A4UA 3QUTA 4ZI2A 2ZOSA 1YB4A 4TS1A 4HUQA 5L4LA 1IUKA 1TD9A 2BRUC 3VYWA 3K4HA 2AB0A 2CC2A 1CJKC 1FNCA 2LCIA 3M4YA 4IINA 1GIAA 1M8JA 2QRPA 3SJ7A 1E1QA 4EDFA 5G0WA 1EXVA 2LBPA 1BHJA 1XVVA 5TF0A 4EZIA 5LMUB 3BMQA 4FE3A 1FFGA 4Q4JB 2HZ7A 3T34A 3ET5A 4R1OA 3KT0A 2WAOA 3HY4A 4FFNA 4E4TA 3D4OA 4CYMA 4FLFA 4I55F 3EPJA 4MIKA 3REFA 2BH9A 4AZWA 1V4NA 1JIKA 4ZO9A 2ZU6A 2FCRA 4Y9SA 1KYVA 1NBEA 1WKBA 1ZCJA 2VHEA 4RKWA 4CM4A 3W34A 1WPGA 1TVMA 4YTEA 1WP4A 4PYRA 1P5RA 1T6NA 3DBIA 3PC7A 4AZVA 4C21A 1ONNA 1NXSA 3C48A 2YWFA 3QFFA 5ER6A 2ZUEA 5JYBA 4WLFA 3TDNA 3JVDA 5KWIA 2CY0A 3F9CA 3GGCA 3U7QB 3BMCA 2MINB 2C4MA 1QZZA 1XAHA 4IX1A 3HBLA 3ZHUA 1M2HA 9LDTA 2OZPA 2QRNA 1MABA 2HL6A 3HI4A 2FFJA 4HDNB 2TSYB 4FC7A 3B1YA 3MWEA 4I3HA 3T3PB 4AG5A 5A0TA 1OT5A 2YZNA 4FW8A 2A14A 4NYJQ 4B32A 4CDMA 1KI7A 1VPDA 3ED5A 2DKOA 4IP0A 4MUFA 3OEHA 3GFGA 3NZEA 4S1PA 4BQPA 4ISCA 1VE6A 1Q44A 1WQ3A 4UHHA 4HH1A 3JALA 4NCJA 2Y1EA 4Q1AA 2WSSA 4S1TA 3WBFA 4EI7A 1E6KA 4RQBA 4RVCA 1HE2A 3UUGA 1BE8A 1T9BA 4YH1A 1X94A 3CSUA 3OD5A 4FFOA 5LQNA 4GAEA 5BWOA 1FYWA 1X7GA 2DSTA 5TS3A 1USIA 3RW9A 5HX7A 3SLRA 1PK9A 3X1ZA 4EKYA 5HG0A 1KTIA 1IE3A 2F4NA 3GUZA 4KIUA 5EP1A 1U2GA 1CQJA 4ZJYA 4MV3A 1UMBA 1DNPA 1E5XA 2V45A 2QUZA 2G0TA 3K8YA 4L9WA 3CB2A 3STYA 3HBJA 5BQXA 1JEYB 4R84A 1IXZA 1U8UA 4BNYA 3THXA 3ACDA 4PWZA 3ZBTA 2H2DA 4MPTA 1ZNQO 1USGA 3WIVA 3S8MA 5DIZA 1D4FA 3QVVA 2L69A 1MA3A 2PKEA 4CLRB 4LHXA 1U0NA 4EW1A 3I8OA 1QXSA 3NORA 4LZLA 1A8SA 1PTKA 2X3UA 1HQCA 3RSZA 4A8PA 1NASA 3BH0A 4GMKA 1KJYA 3MGCA 4DCVA 4L6IA 3PFCA 4PQYA 3CSDA 4BXOA 3ELDA 4A82A 3VPSA 3SBOA 1JDJA 4FXOA 3VZPA 1QAMA 1Z5OA 3Q10A 1BROA 4KB5A 1P8JA 1RJ9A 4IDBA 3W4JA 4Q9LA 4D4MA 5BMVB 2IYOA 2R8XA 5G0SA 3D6AA 5KKNB 4C87A 2HV9A 5A6SA 4K0KB 5IXJA 1UJBA 1GTMA 4RH1A 2VDUE 2Q7DA 1P17A 1QLJA 1V0JA 3FGZA 3LK6A 4I3FA 1QIKA 2JBAA 3OH8A 3B1XA 3PKJA 2P0EA 4MS4A 2ZJFA 2FMUA 1SXGA 3FZQA 3HXKA 4YT5A 1ONSA 5EKTA 4BY9E 4W7SA 3B51X 1A2OA 1YS1X 3WLRA 5TDHA 1U8ZA 2WM2A 3ZC3A 5AW6A 4X62B 3BIXA 4JX9A 3V1LA 2I7XA 2FSVA 4UEJA 5AJUA 4XFDA 2JGIA 2WE7A 2C3MA 2Q1SA 2HIHA 2V4UA 1XELA 3GT0A 5KX5F 3TLBA 4UNIA 4BLWA 5AI9A 3HXQA 4DJFC 3EQ9A 1O8BA 2EWWA 3D3JA 1G16A 3AW9A 3KOXA 2X0KA 2BFFB 4XDYA 1GDHA 2B37A 4LXHA 2OXIA 3K72B 3H5WA 3M1YA 4TQGA 1U04A 1JBEA 3PC8A 5K7SA 1PVOA 5KTKA 1JDZA 3Q85A 4F97A 4BVHA 3EK2A 3OZXA 4CQLB 1RPJA 1DEOA 1ZK1A 1WMFA 2E4UA 5E4FA 4FDLA 1GGNA 2RIRA 3NM4A 1RAEA 4TKUB 2C29D 1JTVA 1QH1B 3EZNA 4MAMA 2HPAA 4KQ2A 4F06A 3FOCA 1WUKS 3JQBA 3ETHA 4EG0A 4HKTA 4ZDIA 2ZREA 2JGDB 1VBMA 1VCHA 2VDVE 3H6HA 2BMFA 2PGDA 5CU7A 4AJIA 5IYZA 4GKJB 5CB4A 1U2GC 3IE0A 4NX2A 5DNCA 2BN4A 4MR8A 4F2HA 5HJ5A 1VJTA 3W3AA 4WOJA 1V8BA 1ZNYA 2R7AA 1ZWLA 1UKEA 2Y3IA 3KWLA 4JYBA 4HL6A 4D98A 3HCBA 4DIOA 4B3JA 1OPRA 4DARA 4OGKA 1G1MA 3IAAA 3SM3A 3S8YA 1N6IA 4JBLA 4W5QA 3GAFA 4S05A 2AZTA 3TTWA 1IBCA 5D5PA 1JH8A 1KBOA 2I4LA 2O5VA 3FR7A 2XTZA 3JQ7B 3LQYA 2RK4A 2P77A 1AZWA 3N2IA 3K8ZA 2G25A 1TCVA 3BL6A 3HHEA 2PYDA 3FA2A 3MS4A 4KWTA 4BE7B 4BFVA 2BDUA 3T7AA 4C6RA 1RCUA 3IOMA 4FHEA 3CRNA 4RFVA 1EINA 1HTWA 3IT3A 4MIOA 1DINA 2AA3A 3BDIA 1DAOA 3A9TA 3Q0TA 5KVCA 3KL2A 4IDPA 1GHTA 3TQCA 1BXRB 3QXHA 1NHGA 2CVQA 3H5NA 2VA9A 4AMGA 4AS1A 1QGDA 2RGNA 3LBFA 4GNKA 4PGMA 5T3UA 4UBNA 1GGMA 5EXDA 2IHUA 5EJ4A 1WHSB 5FA8A 2EFEB 2XDAA 3HJAA 2KJQA 4MVJM 3K05A 1FRNA 4UNRA 4GPZA 3T3DA 5WRFA 4NBVA 2W2KA 3PBKA 4NOJA 3MWYW 4HAIA 2D8MA 2VCEA 3ZGOA 3NDBB 1KYYA 2V7VA 3G5UA 3C3KA 4LJ6A 4LCBA 3RFUA 2CNWD 2A0XA 2K2WA 3O31A 4MP8A 1SIWA 4ZVNA 1W2HA 2INGX 4Z3OA 1OYOA 1JFFA 1JKMA 1YXMA 1HEUA 2EERA 1V7QA 3NBXX 3QEKA 1VMKA 3KKPA 3OZVA 4MWSA 2FSVC 4EUNA 4G5FA 4R83A 4Y8VA 2BHRA 3V1TC 1QOPB 5EAIA 4WZ6A 2YVAA 2PJZA 1V4VA 4BKMA 4EG6A 1MX3A 1JALA 2OE2A 4Y9DA 3DV0B 4MVWA 1Z6YA 1XN4A 1P9WA 3CZ9A 3L0PA 1HURA 3IUBA 2RHGB 1NBHA 4OMDA 5IJXA 3OZCA 2VJMA 2C5LA 4BNDA 5U4XA 3M6XA 5K3DA 1V5WA 2JEOA 4XUDA 2P91A 3AQIA 4TKZA 3TBKA 3PC8C 1NUHA 1O87A 5FA5A 1TJNA 3MRTA 1PG2A 3P32A 3SEAA 2KQUA 2JD1A 3D02A 3G7NA 2PMWB 3L7YA 1SRQA 3X1KA 1U90A 2ZJ1A 4OYLA 1LLDA 4RZUA 1F2DA 1YBMA 4QOSA 1ZH2A 3VHXA 4KQXA 4M0MA 5F3RA 1C1DA 4DCJA 1HDIA 3JQBC 4ZVMA 3SHQA 4DMLA 3BFPA 1Q3KA 1MCZA 3R3HA 2QQGA 2BGIA 1MB0A 4TKVA 2CHUA 1U2DA 1E2UA 3R3ZA 4RMNA 1SIOA 2ONJA 2ONCA 2DHCA 2P9GA 2QRVA 3NHFA 4QXMA 2CV2A 2WIDA 1XMIA 3I12A 1E1QD 3PNKA 3A26A 1AUOA 3ZQUA 3A1VA 5I7RA 4C4PA 2UUBB 1V6SA 2BL4A 2JLAA 1A9RA 1H1DA 1ML3A 3CEMA 1NV9A 4B4OA 4TZ0A 4HQNA 1P6QA 3VSBA 3A06A 1N2OA 1ZN8A 2APJA 4BFLA 4B5KA 5KTNA 1GAEO 4KQMA 4U7JA 1Z2NX 5BV2P 1UPBA 3UZUA 3FHTA 1YBHA 4FS3A 2ZU0C 4O02B 2B1JA 1BZYA 1P5ZB 3SHWA 1IBKB 3MYYA 1IJBA 1N8NA 1T3GA 1T4CB 3CUEF 1L1FA 4IXMA 2A7XA 4RHXA 3RVDA 1VB3A 1FXWF 1UBEA 3EZ6A 1OLOA 2OQIA 1DJPA 5E8JA 5JW6A 2RGNC 3SJUA 1UWKA 3ESAA 4M76B 4F7DA 3BMOB 3NDPA 2W2OA 5LQUA 4P5PA 2C7QA 3HKBB 3ERCA 2BJHA 2Z1MA 3KV1A 4MW2A 1YR7A 3WWOA 1JR3E 2EG5A 3BRSA 4ZEMA 1Y4DE 2CGEA 1I3CA 2FVYA 2R9VA 4LTMA 3UUFA 5FBLB 4AD8A 3A9RA 4Z9BA 2WDPA 5FFNA 1EWQA 5IG2A 3KVYA 4EKDA 4S2UA 3NCTA 2ZLBA 3CCBA 3AVTA 3MW8A 4IH9A 2JJ2D 4EB3A 5KOJA 2SCUA 3O94A 1OCEA 4HT3B 1PS9A 4TWBA 3CH4B 1KDPA 2JEZA 3O8LA 4KN9S 4ZYZA 2GAAA 5CCEA 4OQFA 5HEKA 1CY2A 3NASA 1WG8A 1VHTA 5JR3A 1XEWX 1WL8A 1FTGA 3OC0A 1XTJA 4FXPA 4WBNA 2CF5A 1CV2A 3CUSA 4PNEA 5JADA 3V4RA 2P11A 2E6UX 2YOFA 4CF4A 1E3EA 4P3NA 4PG6A 4ZQGA 4B44A 2YL2A 4OKIA 2C5BA 1X1TA 3B6ZA 2ZS9A 1JPNA 2NU7A 3EPLA 5A9SA 4RHCA 1NVXQ 4YP7A 1XMOB 2QBYA 4C1BA 4KQJA 3GELA 1ADGA 3ZBPA 1U5BB 3ZV6A 4B6JA 1ORRA 3WAKA 1Q16A 1Z63A 1C4XA 1NAHA 1X8KA 2B1RA 3D0QA 3I30X 4OK6A 1V8PA 3KPWA 2FPGA 2O5CA 3OOJA 4JQZA 4LJ4A 4S0ZA 1K6MA 1LZKA 1O96B 1U80A 1HLPA 3LVQE 4EB6A 3FFWA 1U2DC 1R6DA 2FWJA 3HN2A 2C77A 3VKGA 5KYUA 3TTTA 3HVIA 4OPMA 5DCWA 2ZWPA 3W5HA 3AWDA 3MOSA 4QYTA 3PXEA 2CMKA 4RFSA 1ZXBA 3TQQA 5E3HA 1OC2A 4HVAA 1NNEA 5C5EA 3TMKA 3IIMA 2HSGA 3KZOA 4W1SA 3KT3A 1Y3AA 2ETVA 5L3SB 5CA1B 2O14A 5J5CA 5J1TB 4DA4A 2HTFA 2QQ0A 1E6UA 1FNBA 1SVWA 1B15A 3DZJA 4RF5A 4UU0A 5D5QA 3T61A 1U99A 4PZYA 4GSLA 3TS1A 3JYHA 5JECA 2X5XA 1VLLA 1Z6GA 1RZ3A 1JLMA 2H11A 3C1AA 2H0RA 2Q50A 3HO8A 1L3BA 2EATA 4ITVA 2ZJ0A 2FP3A 4KI0A 1X9IA 1Z5WA 3IULA 4XOUA 3V97A 3VGJA 4P3OA 3BILA 3KSDO 4BZXA 1ZMBA 2HCBA 4Z2AA 3K9FC 1Z8DA 2HU7A 4D4LA 1BA3A 1MJGA 2RGXA 4RS4A 1ZR2A 1LQUA 4JVLA 5H4GA 1HE8B 2AMVA 4FWIB 3N2GA 4CKXA 4IL5A 1YONA 3VKFA 1IWPB 4FFBA 4ZAZA 4NMLA 1MJNA 2ECKA 1Y5LA 1HG0A 1PGJA 2I7VA 4HQOA 4R68A 3IX7A 2PN1A 2ACVA 2BELA 3WRYA 2PZMA 2PD4A 2WUVA 4GI1A 4F9GA 4EJ2A 3FH0A 3T94A 1V4BA 3FJ1A 3F3SA 3KK0A 3BA1A 3FNRA 3I37X 1Y8RB 2AVDA 4DWOA 3W6ZA 2H2HA 4YT4A 1JLSA 3S1LA 1H2AS 2R751 2WF9A 5JAZA 3QVMA 1EMDA 2NO1A 5ECYA 2Z8YM 4L73A 5JUWA 1C14A 3PHIA 2J5XA 1SCKA 4QBTA 3RC9A 1XQ6A 3EAFA 2QD2A 5DXAA 4YX9A 4UEOA 5TMDA 1W5TA 4YRSA 2CHVA 1M6VA 1G59A 3Q4GA 5FBKA 2FUNB 2F3QA 3DKIA 1DX9A 3DWIA 4JIMA 3H5RA 2ONKA 4JUBA 4M0FA 1ZINA 4MVXA 1AN9A 1NYRA 2VJKA 5GADl 3DDNA 3W3AD 4OHWA 5EE3A 1YDEA 3AF4A 4PSCA 5B1IA 3PR1A 3WIBA 3EWAA 5LZ9A 2GR9A 2HM7A 1XA0A 4QGHA 1KWKA 1RYFA 1UM9B 4LOKA 2VJBA 1GUYA 4NEQA 4V0KA 2A9QA 1OF1A 2VYQA 3QPDA 4HN4B 5F78A 1CRLA 4F60A 5CYGA 2B34A 1TYEB 3W3AH 3GROA 1JMVA 3KQMA 1GQOA 2VBIA 4NRDA 4DCTA 2NU8A 1IHDA 2PTGA 4CNBA 1J8MF 5ER9A 1GUAA 1H4QA 4CIVA 4C2BA 1XZNA 3NWEA 5B7NA 5LYJF 2D4AA 5F7ZA 4FNOA 4ENSA 1TCUA 4EFKA 4PGGA 2P9YA 3AI2A 1DL5A 1VG0B 3GFRA 1CUFA 3PHCA 3D6TB 2PS1A 1KSJA 4PX2A 4NCNA 4WXMA 1JQJC 4X1OA 4GW3A 5CX1B 4BQFA 3BM5A 4M83A 4ESOA 5K03A 3D7MA 4KH1A 2IU4A 4AECA 1XZFA 3M6LA 1K8RA 1DAMA 3S2YA 4JELA 1I8TA 1HXHA 2HK7A 3UW3A 4IHJA 4C6SA 2WB2A 2HBYA 1WUIS 5EE0A 3L0DA 4RTJA 4RIEA 1XEXA 4EF6A 4P0QB 3WIOA 3TE7A 3TDKA 2OBNA 2HPZA 2K5UA 5KMGA 3S5JA 5EJ8A 2ACWA 3R77A 1KY3A 3VU9A 1B4DA 3T3IA 1GCGA 4R1SA 1K5DA 2WTEA 2BM1A 4NULA 2REXB 2ORED 4KV7A 5EIWA 1E7YA 3W9BA 3WYNA 3GJ8A 1NWCA 1OJ7A 2NZJA 3GGPA 3M81A 3I2FA 1CQIB 2HA5A 2NUPB 4FMBB 1FMJA 2ILTA 1KJJA 4E33A 2BP7A 2WSMA 1ZOOA 3A58B 1T6ZA 2O0KA 2OD9A 4Z8XA 4I1SA 4DWWA 5BSKA 2IYLD 3WRYC 4PICA 2P90A 1NKTA 3O84A 2OILA 4ME6A 4LF5B 3RVQA 3D7NA 4F6RB 4MUKA 1E1YA 4K0RA 3IOCA 5KQSA 1J9EA 1XZJA 2VQ6A 1ES9A 2HUNA 3HR8A 5DYWA 2A2ZA 1DAFA 5IARA 1ZPDA 3AILA 1KZHA 2J6HA 1UAAA 2F4VB 3CT6A 2E21A 2QTZA 2O5RA 2QTNA 1PHRA 1V5IA 3A6JA 1RQGA 3KUDA 3OCZA 3ORRA 4NNPA 1L9XA 5J9FA 4D3SA 2ZJAA 3CWQA 3JTEA 2AFHE 4GYYA 3PE4A 2Q1TA 4WXHA 1B3BA 2B21A 2F43A 2O19A 1JVNA 1T5LA 3EZFA 3RTDA 4WN3A 4C4SA 1C1XA 5GZ1A 3UMYA 4Q3EA 3C7CB 3R3YA 2I33A 1AK9A 4LNAA 2GNOA 5EIOA 4MQFA 4HWOA 1VYTA 4Y2HA 2WWIA 5KQGA 5L4SA 5BUZA 2PO7A 3G9XA 1ZMRA 5TF4A 1TJPB 5JEEA 1L4KA 2EKBA 1J5PA 4O0MA 2BMEA 3DZ8A 4Q16A 5DHAA 3RPEA 1FTNA 1T1GA 1CHNA 3HACA 4MQMA 1WULS 2GM9A 2PFSA 1KMMA 2GHRA 4QPNA 1KYZA 2OFPA 1E3WB 3PGVA 4RMGA 3W5AA 3CH6A 4X94A 3UJ3X 2VT3A 1FP4B 1AQNA 2ODPA 1AA6A 1N2CB 2FPLA 2QTHA 1PJ3A 3GYGA 1WPQA 2ZCVA 1LNZA 2JLRA 3K1TA 1DC4A 4OXIA 5THKA 4G8CA 1NL3A 1SZDA 1FTSA 1LNSA 1HQKA 1T6BY 1UXIA 4I81A 4MRRA 4PS0A 4NICA 4RD3A 2W5UA 4BAGA 2I3DA 1MAWA 2IHTA 2VRBA 4OXNA 4AIIA 4KKXB 2GEUA 3SEFA 1WXHA 2DGDA 1SD2A 2JC3A 3I53A 3LHKA 4LMBA 4KZKA 2XUOA 4WLVA 3HFJA 5DI9A 5AXDA 3T7JA 4BVEA 1O57A 2VF5X 3NG1A 3IUQA 1GGJA 2BBSA 3KSUA 5FAKA 1SZJG 3IBTA 3MSCA 5DDIP 4AYWA 1H66A 2X15A 1J2RA 3DS8A 2RMKA 4WAUA 3RSQA 3V4FA 1PR9A 3WHKA 1EVEA 4LAFA 2W6JA 1JSLA 1W2WB 2PX6A 3Q3IA 4ZHQA 4MROA 3PXGA 2C04A 3Q9UA 4BDSA 1BMTA 1M1YB 4NLLA 1NF8A 3FKQA 3RSFA 1F51E 3HCDA 4QREA 5DLDA 3V00A 1OXVA 5DRTA 5ALUA 1CEQA 5EIFA 1PX0A 5B7QA 3R6GA 1YJ5A 2VYND 4IQFA 5BR4A 3G7UA 4BNFA 3TSOA 1QHGA 2VHVA 4NV0A 4IIHA 2NO4A 2WAXA 2YCBA 2VJQA 4JOQA 3AVYA 1NP3A 3CIFA 2X2FA 2ZZKA 3QFHA 4IFIA 1NW7A 2VN8A 3B12A 4CG0A 3TGWA 5IH7A 5KNCD 1DKRA 2IUEA 3HP7A 5IK2D 4EG1A 4NF2A 4NYMQ 4YMGA 5CDFA 4B4WA 1ZD3A 2OXCA 5HUHA 1E2KA 4FFDA 2XI4A 3GDFA 1YV9A 3B8HA 3USZA 1WSDA 1MB3A 2F59A 5JC1A 2HXSA 2H4JA 4JLNA 3WK6A 3GEBA 4DPMA 2IC5A 3KLNA 3T7EA 1JKJB 4JASB 5G41A 2PZLA 4BB9A 4UAJA 3H1BA 2RHMA 5A4DA 5D84A 3UJ9A 5K8UA 3ZCRA 2HU5A 3FDZA 5ALOA 4RHUA 1FYVA 2V9CA 4M9XA 1ISHA 3CVUA 4IQGA 3A31A 3FUVA 3Q0IA 2QPAA 4YCCA 2OV8A 2CCJA 4TMTA 4WOCA 4DR4B 2RBGA 4UM5A 3SS7X 4CN8A 3GPCA 3D1JA 4C7MA 1WV0A 2CUTA 2ZRPA 4ZVLA 4BV3A 3K32A 4FNGA 3GNTA 3F7TA 3LSTA 4J0JA 4F9FA 3D43A 4RHFA 3R0XA 2FETA 2A4MA 1U8YA 2I2FA 1G4UR 3F97A 4A92A 3PIIA 1XD2A 4CUJA 1L7EA 2FZVA 4WY8A 5EJ7A 4JI0B 1NXOA 4CR7A 2QTTA 2I29A 3CPSA 3LPLA 2NAFA 1L5RA 2XT0A 3WLAA 1HOXA 5CW1A 4P7FA 5FUBA 4YAEA 4DPLA 4RHYA 5AD1A 2VRWA 1U3UA 2QRQA 2VPQA 3PUKA 2Z04A 1ZX1A 4EYSA 1JQ3A 4PX5A 2P67A 3WRXA 2YFQA 4NCHA 3ML1A 4TTIA 2A9RA 2AOUB 4O1IA 3QPWA 1CQXA 4PC7A 1B8NA 3OCUA 3N2NA 4B1FA 2DPGA 2WM3A 1UP4A 4DQ0A 2F2TA 3IRUA 2ATIA 3O4RA 3ZHOA 4Z49A 3UAYA 5BW8A 2GAJA 3PQEA 3PPVA 1KVSA 3LFHA 1OU4A 3NGMA 2VNSA 1LLFA 4F04A 4M0KA 3DXZA 2IBTA 2AOTB 1P81A 2ZYRA 1JXQA 2XBUA 1YK0A 1HZZA 1PD0A 4B47A 3ASYA 3ZWWA 1DIHA 1C4KA 1JB1A 5DSXA 4HAXA 4CMIA 4DT1B 4G89A 4R1QA 3VO9A 5BN3A 4KXQA 1J21A 3GLGB 1D5CA 2UZ4A 3IQDB 2X0IA 4OHVA 4KCGA 1DP4A 3SICE 3VZRA 1EVKA 3OT1A 1GCUA 1B16A 2PFKA 4TXHA 2VTVA 5ERGB 1YFLA 3TRFA 3MSXA 1S2OA 3GOQA 2AX3A 4PO8A 3TLKA 2JFBA 1R64A 3UHFA 4M6WA 9ABPA 3F3KA 4YMUA 1DEXA 4ENWA 4FUTA 3WLNA 1ABEA 4PPGA 1T0BA 4Y18A 3ITEA 1GA6A 1HGXA 3FYSA 5C53B 1X1BA 3JRNA 3NAZA 3NQ41 4RZIA 3U9TA 4CF5A 2I5PO 2IF0A 2GN2A 3L0BA 4TV8B 1E62A 2A9FA 2G83A 5M3BA 3SY8A 2WJYA 2O8FB 2O06A 1EPUA 1OBOA 1UBRS 2AC2A 3I4FA 4S1VA 2QU7A 5KVQA 4TWIA 3LYUA 2YIMA 3AT1A 4EHIA 2CV0A 2H4YA 2ZS8A 3EE6A 2HF7A 5B37A 3UN1A 5ADWA 3DFUA 3LGXA 4M60A 4TQUS 3S2IA 2XXAA 3AR2A 1Q6YA 1S6YA 1QX3A 2EW1A 3ICCA 2H7CA 3T9AA 2FGKA 5HK9A 4LQDA 4BO3A 1EESA 1A88A 2C9BA 4MRMA 4KRFA 3E1GA 1X7XA 1PE0A 1VYUA 3FHOA 2PKRA 4Q7EA 4JDUA 2VTDA 5L8VA 3LMKA 5T41A 4IXNA 3OIGA 1K6EA 5IZ4A 5JISA 1EDEA 3GLTA 2ZWOA 2FW8A 4FC6A 1RM0A 5DGCA 5KNCH 5IW8A 4WK6A 3G68A 4K46A 4URUR 2VXCA 2YIDA 2MDTA 4L28A 2BISA 3KEGA 3MTIA 4KBGA 3MQ4A 3HUTA 4JJ7A 5FOVA 3ZKWB 2F3RA 3RUFA 1Y1PA 2ZSEA 2RKOA 3FUCA 4RLHA 2WJ4A 2JD2A 2WU8A 1HPLA 1CRQA 4A23A 4C7XA 1WVMA 2ZRGA 5ED0A 2WF8A 1W94A 1P4RA 4D3FA 1QFZA 2DBQA 5DOZA 2MJLA 1D9XA 2OUIA 2IPNA 1VPEA 1X86B 2MSKA 3I28A 2BFCB 2Z5FA 1L6IA 3NBKA 4FHDA 1SXQA 5MGNA 5BSUA 2IDKA 1TX4B 3DEZA 4ZHSA 2X77A 4YCAA 1NP6A 5AK5A 3C70A 1HZZC 3USES 3V7WA 4F56A 2JF0A 2YN4A 3MGBA 5DHPA 4QM6A 3ZWKA 1JS1X 3FVWA 3HXLA 3KJHA 5D01A 2O8BA 4KX3A 2LD4A 1A77A 4FLEA 4W1QA 3KZMA 4L27A 3VZBA 1RZUA 3KV3O 3LFTA 2PKQP 2ZJ7A 3TD9A 3LBNA 4O1MA 4G2NA 4D9NA 1FPMA 5JSHA 1ORHA 3ONNA 3MOIA 4JP2A 5IPFA 3DPIA 2RHLA 1HDOA 1XDUA 2VEOA 4I6GA 4X93A 3N2LA 3F2IA 5T4HA 3WFZA 3ZNNA 2V8BA 1J99A 1FVHA 1SBZA 4KH0A 3TAXA 3RC3A 4CLOA 1BD3A 3GUVA 3H2KA 2FSGA 1Y8QB 3QG5A 3QMVA 3TJZA 3SMQA 1BHO1 2F1OA 3C5EA 1FLVA 4P81A 3K6SA 1CSEE 1TZCA 2DT8A 3TIVA 2AYXA 5NLLA 3T1NA 5B58C 3OQJA 3G2HA 3ONVA 2VQDA 1A0OA 1IRIA 1FJGB 3I6IA 3Q6MA 4RA9A 1GZDA 1NUTA 4OQYA 2AN4A 1D6NA 2PJUA 2Z9BA 1XQWA 3ZCVA 5B3LA 3H9EO 4G85A 3X1DA 1S2GA 4FQ7A 2ZI5A 2PL1A 3DOFA 4J0KA 3NYIA 4M88A 3R7FA 1B7GO 4JMLA 1XNHA 1M6HA 4YUZA 3Q3HA 4IXTA 3UBTA 4NQRA 1I2MA 4GM4A 2QM0A 4Q1BA 3WHIA 4KO1S 4YEDA 121PA 3IJ5A 1AM4D 2IXFA 3DYIA 3KKOA 2H2WA 3KOUA 3HCAA 1X15A 3IELA 4HP8A 1J4AA 4H3KB 5K2OA 3OP1A 1TPYA 3FSEA 2QRZA 3FPCA 3OHSX 3WMGA 1C0LA 2Q07A 4M49A 4D6PA 3AJRA 1I7DA 1E4EB 4NECA 2QG4A 1RRMA 3GGDA 4MK4A 4F45A 3AJDA 2BW0A 1KIMA 2ZYVX 3D5TA 1M2NA 2GZAA 2IT1A 3LECA 4OJMX 3KXKA 4CIXA 4MPJA 3AW8A 4ND1A 4BEWA 2HFJA 1HBJA 3DKRA 1SHTX 5IHPA 2QX9A 1G6Q1 3UVEA 2J6CA 1KMQA 3L0SA 2DQYA 5LMZA 1RZRD 4FD2A 5ALFA 4O08A 5E7MA 3OURA 1T8TA 2CSUA 4DKJA 4F5YA 2ZJOA 3HXMA 3OTGA 4JOBA 2Q3BA 3G9QA 3R75A 2ZI4A 4TLDA 1W96A 1H3NA 2FX2A 3P2EA 1DJQA 3HZZA 4PSKA 4S2EA 1XPRA 1UR5A 3BRWA 4H08A 1N3LA 3GQVA 4M9RA 1XMPA 4O4HA 2E0IA 4EW2A 5K3EA 2A5YB 5T6BA 4B85A 1N6HA 3JASB 1RAFA 4LKOA 2OT3B 4BCCA 3D0KA 5A4KA 2G80A 1ICIA 1XXHB 1QHHB 1HYEA 1V1JA 2ZAIA 5AOCA 3RU3A 3WNQA 4NK5A 4P83A 1M7HA 4MLDA 1W75A 2PXAA 3DQZA 2YVUA 1RWVA 1IFXA 1PTJC 3EQZA 2G5GX 1X77A 2WSYB 3SQLA 1T13A 1GNTA 4Q37A 1SNYA 1EBUA 2J46A 4NV3A 4P31A 3EGXB 1RBMA 4IM7A 1C9YA 1V6CA 2EJCA 2Z98A 4KU4A 4MW4A 3CLTC 2QZSA 4QTTB 4XYEA 1QGZA 3AEKB 4B4DA 4ZKDA 2H1RA 2CNKA 5JS1A 4F4DA 4MA0A 4PLYA 3ZU4A 1Q1ZA 2I76A 1LW6E 1R5OA 4G9EA 1A04A 1WCXA 2QAIA 1N2EA 1MGPA 4KUEA 3PK0A 1WXFA 3WG9A 5K6TA 4BPRA 3PKIA 2PSEA 3CIOA 4IHQA 3SE7A 5C1IA 3W05A 1UDXA 1ND5A 5K3FA 4EZEA 1XALA 2QP4A 4BFUA 2QI9F 5LP6F 4ZMRA 4FEGA 1UJCA 2NU9A 3AUSA 3H2IA 5ECWA 4F2WA 2PVSA 4XQGA 1EEXB 3AINA 5KSZA 1QX4A 3W0LB 4FBMA 1VSVA 5EZYF 1KOGA 4LQLA 3JVUA 3L8YA 4F71A 5IASA 5DCYA 4YDRA 2K6GA 1RKUA 1XMXA 4DCNA 3TR6A 1MU0A 2CEKA 1AO0A 2Z2KA 1Z06A 2PRSA 3DV2A 2QHXA 3FETA 4IIYA 1PJ2A 2DPMA 4EAQA 3GJ0A 4J94A 5BQPA 2OAGA 2Q27A 5CFNA 2RONA 4ACAA 4RY2A 4E03A 3AFIA 2L19A 1ZH4A 2P1DA 3NKLA 4BMDA 3VZSA 4HX5A 5D3MA 4KDCA 2XB4A 8ATCA 4DREA 2AFVA 2HB6A 2NZUG 1GFSA 1SMKA 3QMWA 2LR0A 4G0OA 2CZCA 2W2QA 4X91A 4Y30A 1N5LA 1HYHA 2VRCA 3N8KA 4GOKA 3IQHX 2BBTA 2XCOA 3I1JA 1Z4OA 3RYHA 3GFOA 4YJ2A 1E2IA 3FCEA 3B20A 2B4KA 2FW0A 3HCWA 3K6KA 3GLGE 3MJTA 2WJ6A 4FMCF 2GJAA 4L3VA 3SX2A 1G8GA 2QK4A 4DIMA 2GJKA 1EJBA 3GRRA 1F7UA 3EAQA 5LBUA 2EX1A 1DC6A 1YQUA 3VU3A 2I67A 2VP2A 1E79A 4G9BA 1XYVA 3LT4A 4C3ZA 2FP4B 2I6GA 2W4MA 2OHXA 2FEXA 1JECA 3K9QO 3AKCA 3HXPA 5IDXA 1DRVA 4R1NA 1NLMA 4TLLB 3UA3A 2GWRA 2P3OA 3HGMA 1Z39A 1KP2A 3D3WA 3MLAA 2QP3A 5SICE 4J0QA 2D1TA 3UUWA 4DJTA 2WYHA 2VQFB 3ILSA 4IYRA 4MO9A 1KI1A 4IWXA 3GB9A 3RUHA 4EELA 5IJ0B 3V2UA 1VSBA 3VO2A 1X3LA 4O0LA 3DW3X 1FS5A 2DYKA 2JBWA 4FPXA 4MCIA 2JIZA 1FNNA 4BLRA 3N8HA 2I8LA 2P5UA 3Q9LA 4IW3B 3C6YA 1HK7A 3JWJA 4I0WB 1MA0A 3ZJTA 1B8UA 3OEEA 5K09A 4UUNA 1P0IA 3RBVA 2MCFA 4LXGA 1VCIA 3SZRA 3HMQA 4RY0A 3KJZA 1PSDA 2B8EA 3OTIA 4YXFA 4H2DA 2DETA 1NVVR 5B4UA 3PHGA 2H59A 3A4LA 4G4GA 4HAZA 3WP0A 4TYYA 1JE0A 1UXKA 4BIMA 1LPAB 2I2DA 4RPHA 2BTQB 2F7SA 1RJFA 2V6FA 4N5NA 4E2FA 3ZEAA 1NVMB 2VCYA 4FGJA 1U28A 1SKBA 1RWBA 4AY2A 3IQGX 3P45A 1DARA 2D5IA 3VTKA 1HF3A 4UATA 5DYTA 3F78A 4JOSA 4Y2GA 3AMVA 3LWBA 2E4XA 1DQRA 1L3CA 2XTNA 4LYEA 4YPFA 2QMQA 5EOVA 3EN0A 3DWFA 1T9AA 4KR7A 3QWBA 1QVVA 3AP3A 3CY6A 3LKDA 1EQUA 1Y9JA 2I3GA 1FMCA 2YY7A 4N6GA 3HLKA 3CZMA 1XJ5A 1QK4A 4M1ZA 1GPWB 4E4YA 1NT2A 2CJPA 2ENWA 3NHWA 4BIIA 2QIPA 1U4OA 2WKQA 2OCBA 2ADOA 4FONA 4P7GA 4PGFA 5HCNA 5J59A 4UTRA 4ZFNA 2IYWA 1E8DA 3GZTB 4B9AA 1HKHA 3WXMA 4A8JB 1X87A 4DC9A 3A32A 3VQTA 1F0YA 4FS8A 4HZIA 2VPYA 4BQRA 1RE1A 1KAEA 4PAWA 1QH8A 4Q3LA 3I62A 1ISIA 3MMZA 4REOA 4KZPA 1ZGZA 4RD6A 4LRXA 4NU0A 1AK1A 4OHKA 1UDBA 2CDCA 4HDOB 4ZV9A 1BKDR 5GOTA 4EF5A 4X65B 1OKKD 2B4YA 2LKCA 4FZJA 5T67A 5AUOB 1YE8A 3KEQA 4KN8A 4ZP1A 3EUFA 3HLTA 3LP8A 4FMDB 5JASA 3EVEA 3G13A 2A30A 2P5SA 4LJKA 5JRJA 3NH6A 2V6MA 1Y8AA 4BGDA 2BH2A 1ZGGA 2G9ZA 4OVKA 5TB5A 1L7XA 4GMHA 3PQCA 3CLTD 1Y3HA 3HEAA 2BF4A 1WZIA 2E4VA 2VYVA 2WRZA 4L5YA 3H0KA 4MKFA 4Q3OA 4KE6A 5D3QA 4WBSA 1IU9A 1QVWA 1YRBA 2FR8A 1FXUA 2TMGA 1V96A 2FUG1 2JKVA 2UZ0A 3HYTA 4MGEA 4P32A 4CMCA 5I8WA 3BCHA 4IMRA 2IEAA 1Z68A 4QBKA 1A50B 1FMLA 4LMRA 3RRBA 4BMXA 5KTSA 3GD5A 2DULA 5DI3A 2DR2A 1VYHA 3LIPA 3LIIA 1GFWA 4KXVA 1M0TA 2VUSA 3DEFA 5FTWA 3RK4A 1NDUA 1P3Y1 2PKQO 4WDQA 1Z0ZA 4XM1A 3T0GA 4P2GA 1TM1E 4PYIA 3GH3A 1IPEA 5JD6A 3N7TA 2WE8A 4H1HA 4DLLA 2F17A 4KNVA 2NV6A 3MRSA 2QMHA 1QQ7A 2WUDA 2TMYA 3AJAA 3N5KA 1H0HA 4W8HA 5EIEA 1AG9A 3EVZA 8OHMA 1BQ4A 1CP2A 2OVBA 1G19A 2GZRA 3DVAB 4XVQA 3FIUA 5DMHA 1C3XA 3PE6A 5ELLA 5BXYA 4TL8A 1ZMTA 2UZ1A 2CJFA 2PT9A 3LBHA 3RROA 3TL6A 3UQZA 2J4DA 5EQJB 4R0NA 2RGCA 2JG3A 1F3OA 1U28C 1PVVA 1VMEA 3KTAB 2LTAA 1VGQA 3UK6A 3UYKA 1SUAA 1U1IA 3LC0A 1XLTA 2WT4A 4CTOA 4I1PA 2WLTA 1XZPA 221PA 3LVBA 3PLRA 4K6CA 3S28A 5DX1A 5BNIA 3ADDA 3P9CA 3JX9A 2PAAA 2Y1XA 4Y2JA 3OO0A 2I6FA 3ZXXA 4RPLA 5HKBA 1CR6A 1RIFA 1YZYA 2YV2A 5IDWA 1KAMA 1H22A 3DO6A 3F5FA 2YBDA 3CZCA 5JSZA 4AJ9A 3LDFA 3DO8A 4FW9A 1A2BA 3TJMA 3FDIA 4MUNA 1GV0A 2JRCA 5IM4F 3I2YX 5DIFA 4W99A 3HE3A 2W0SA 3WJAA 3P19A 4XGKA 5E1OA 3JZAA 4P4UA 3DBLA 3L7JA 1AXRA 4UU7A 1T2EA 3DC7A 4LMPA 1Y33E 4RELA 1UPCA 4O2BA 2J85A 2ZDGA 1KO1A 1QF9A 2Z9CA 4E13A 1DQYA 1ULZA 3MG9A 1H93A 1M6NA 4ZD6A 3R74A 4C7JA 2OO5C 1H9AA 2AK3A 4MKHA 3VPDA 3TW0A 2C4UA 2QN8A 2Q3EA 1D1TA 5EP2A 3SHFA 5CVTA 4WE3A 3ZE9A 3ZXYA 4E2XA 1CUDA 1YIOA 3UBMA 4CCYB 1ZGCA 5IWCA 4I3GA 4YQZA 2WB4A 2P7IA 2QD4A 1UFKA 1W5FA 3PNPA 3PUYA 4BLQA 4B8ZA 4FB4A 1S3SA 4RV5A 3P0IA 2DFNA 3D31A 4Q9AA 2IA5A 3BF8A 1B1CA 2SKEA 3GLIB 1QG4A 3TGLA 3E3NA 3S2EA 4L4UA 2DY0A 1IMOA 2FMHA 1E3SA 2OENG 2AZXA 1QHNA 2PMEA 2BKUA 4YASA 5IVKA 1UODA 1S4QA 2E2WA 2FR8C 4L8YA 4WADA 1SHUX 1LSOA 1VKJA 2TYSB 1FLDA 3ZV7A 4QXAA 2Q3CA 3RC7A 2GLXA 1NM5A 2W6IA 4J76A 3V8QA 1E1LA 1S3GA 3A4TA 5CEJA 1CS4C 1N9KA 3IUMA 5A02A 1K89A 1M8PA 1TQDA 3G59A 1R0KA 1Z07A 3PHLA 5ITSA 2HGZA 3SYMA 1VLMA 1GL9B 3RAEC 3DC2A 5AQ1A 1ZM4A 4GE0A 3CW9A 4JXXA 2BFEB 2CLLB 1OFUA 1WHTA 4ARBA 1PAUA 4LOJA 1T1SA 4KPYA 1I7NA 2PRYA 5TEVA 1C4WA 3M3HA 4QXPA 5F73A 1F2TB 3GPDG 3KR2A 4G5RA 2GZ2A 3C1UA 3UMJA 3WLKX 1AB5A 3UK0A 1LQ2A 1S89A 1VP9A 2ZRBA 3D54D 5DBFA 2Y1FA 3HH8A 2Q4TA 5TRTA 3I5AA 4B0OA 2VATA 3ON5A 2I4MA 4G0XA 4GX0A 4L5JA 3W5SA 4AO8A 4YV0A 5JANA 3GN1A 3L8HA 5FAXA 2R47A 3VSAA 5BR7A 4IDNA 1WEHA 2IZ6A 1E6EA 3V3TA 4JQCA 1L4GA 4MUEA 2ISSD 4J29A 2QU8A 4U9UA 4K87A 4EKEA 4CM3A 3JW8A 3EPRA 4FYMA 5TLSA 1W9MA 2AQKA 1U2QA 4IJVA 3BCUA 4F46A 1FQWA 4L57A 1H6CA 4KXLA 2QN7A 3RUPA 3ZS8A 3ROZA 1NUQA 2AG0A 1RWNA 2W8ZA 2EV9A 4JSRA 1Y1SA 2YZ7A 3RM3A 1JUDA 4NCXA 4UUPA 1E9DA 4HHEA 1BD4A 1R4NA 1YD7A 2O57A 5CK4A 2OXTA 1XZBA 1ZONA 4FZVA 2R8ZA 1U0OC 1GKYA 1U1EA 3E8MA 3KLPX 3ORHA 1CWUA 1OOEA 2DT5A 2E82A 1E79D 1X1RA 5REQA 4EO9A 5ITZA 4YMVA 3L0OA 4CMAA 4Z7NB 2F3PA 1EG7A 2N75A 3K31A 1C2TA 1P1JA 2H85A 2QUIA 2ZAMA 4HVLA 4ZYWA 5B53A 1FMFA 2QW1A 1XLVA 4NSNA 3ONWA 1MVNA 1EIZA 3C39A 2WNIA 3P9XA 4QQKA 2FPSA 3PWZA 3ETGA 2XRMA 4FDVA 4XQCA 1YF3A 1IMJA 4CKEB 3GBSA 1Q12A 4AMYA 1GPUA 4ZOQI 2J9FA 5IAGA 1HFEL 3EXG1 2EGGA 3HDQA 2HYIC 4R7GA 1BXGA 4NWIA 1CF4A 1SD5A 4PR3A 1M74A 2Q4RA 1U8FO 2JIZD 3IQEA 2ZJYA 3IDFA 3FFBA 4DV6B 1JEQA 3GH1A 4EBBA 3OEED 5KSYA 2EJBA 5DHRA 3P0HA 2AG6A 3MXOA 4PEVA 3JVIA 3A2LA 3WLHA 3NNSA 4LMAA 4RD1A 1FSGA 4IO0A 3HCCA 3ADPA 3DCNA 4MVCA 4TWAA 3RCBA 2NZYA 2Z08A 3A6LA 4G4IA 1BDIA 1L4YA 2HMSA 5TT0A 3ETEA 3K0AB 2H7VA 1VKNA 3PEWA 1NM5C 3T9DA 1E1MA 1M34B 4YALA 2VAMA 1PJCA 2XYVA 4Y1RB 2OCPA 3UHPA 1RP7A 3RB8A 1Q21A 4CL2A 1Q2UA 5IYZF 3TVYA 1CR1A 5GONA 3U1VA 1PLJA 5CB4F 3JCZA 4HS9A 3RT9A 1H4SA 1NMEA 1ZVMA 3CN7A 5CM2Z 3WC4A 5FPPA 3JWHA 1J0AA 4RPJA 3R9KA 4D9FA 3I6ZA 1SHJA 2VNJA 3QXJA 2C57A 3KP1A 3WLMA 1Z4IA 4BLSA 1T4BA 2GXAA 2CZQA 2HEIA 4GGMX 1IOZA 1RRKA 2FZKA 4I4LA 5I45A 5IZCC 4H6WA 1JJVA 2QY6A 3THYA 2FMFA 3O8OB 2K87A 4PPFA 5AVKA 4K3UA 4XJXA 5DGTA 1P7WA 1ZCFA 3KZKA 4R3WA 2EARA 3LGSA 3WYCA 4V39A 1Y5MA 3D3NA 1YS9A 1K0UA 2B7CA 2YN2A 3OY2A 4K05A 1CULC 4OBXA 3HO6A 3WGJA 2VP5A 2QYSA 4Y6QA 4PBRA 3UGTA 4DBZA 3P5BA 2I03A 3WJ7A 2Z6AA 1N0HA 1GKUB 1Z34A 3E5NA 4WASA 4LFCB 4OMFG 1DO2A 4YRZA 4ZANA 2V4MA 2FSSA 2IHKA 4HVTA 4TYQA 3ULKA 4ARZA 2VPXA 2D2EA 1A1VA 1YRQA 3AVQA 4MVJA 1ADBA 2O20A 4HLUA 4GL2A 4UU1A 4DRXB 2D1RA 1UT6A 5F51A 4QNMA 3FNBA 1Z47A 3RJ5A 4YAGA 4WCFB 3Q9NA 4RKQA 1ZIYA 4NXMB 3L4SO 1HLFA 2P9HA 3D3KA 2HIAA 2R5WA 3KALA 3J7AC 4EFDA 5M34A 5LZ7A 5AQEA 3G2JA 2Z6UA 1ZUWA 3CURA 5FUXA 1OPXA 3I39X 3E2MA 5B3AA 4RTPA 1N6KA 3KR0A 5J4HA 5JTUA 4G0QA 2VYVD 3DL7A 1VPLA 2OBFA 4BJ5A 5M7EA 3IT2A 2IF2A 5ARCA 4LE0A 3PWKA 1HOTA 3OQ6A 4HMQA 4WZBE 1GPKA 3JQFA 5T64A 5F7OA 3DYBA 1DAEA 1QHXA 2REBA 4Q3DA 4PLHA 4B3GA 1KO5A 1T5SA 3RWBA 2FWBA 2LW7A 3DT6A 5IS2A 3MT9A 4X8LA 5ALLA 3IP6A 1T8PA 3TEMA 4C3UA 2AFIB 3ABOB 1C30B 1KDOA 2Y27A 2RAPA 4XYLA 1R6AA 2H9YA 3DBHA 4BVGA 2ZDQA 1CJBA 1FYDA 2Y1DA 3TEJA 3DUFA 3ORYA 3R5FA 6NULA 3NOXA 2BM9A 2A67A 3KJQA 1PJZA 3DB2A 1AKQA 3IJEB 2ODQA 4DV0B 5I9TA 1GEEA 2ODBA 1EE9A 1S2IA 4KIWA 1BX3A 1MQ8B 2WHXA 4GRIA 3LLMA 5M5BA 1KQGA 2FEPA 1KHTA 1YDMA 1UF9A 5JXHA 2HJRA 2XZPA 5LLDA 1O0BA 5J2UF 2Z2XA 821PA 5DX0A 5B1SA 1E20A 2WHQA 3EFEA 3FYUB 1UC4B 5B1DA 2VS1A 1OH5A 2HD4A 2WJPA 3IP3A 1I2ZA 2CLCX 1FVFA 2H4WA 4D0SA 2P2ZA 4DMCA 2ZR9A 3ROMA 2FWNA 3WKCA 1DV1A 4M55A 4AJKA 4D2IA 2DWPA 3FYCA 1GRVA 5BVGA 3M33A 3PQ8A 4OHUA 5BOSA 2MSLA 1O0CA 1RZVA 3AL2A 5T4EA 2RE8A 3OAAA 3JWEA 5AKIA 3RFXA 4N12A 4YGXB 4JMPA 1NY5A 2JGAA 3QU9A 1ZN2A 2H92A 3I9LA 3DFKA 5F2EA 1BGVA 1XQXA 1XC7A 1YH3A 2ATCA 5ALZA 1UBUS 2ZI6A 5K3SA 5DNYB 5JZ9A 1UBKS 2QTMA 2COEA 1SQGA 5DW0A 4BJ3A 3E9NA 1DQSA 2GNPA 2VJPA 2C94A 4ARAA 4YLEA 2J5RA 1APBA 2GXSA 2A5FA 3ICWA 2AWNA 2C7VA 4Z0HO 3PE3A 3H16A 4MWZA 5HKKD 1ZSVA 4KE9A 3VH2A 1GNVA 4YJGB 3TZ6A 2H1WA 2YNMA 3L93A 4FEAA 3P4UA 1AHHA 3F5MA 1AMNA 2FF7A 1D2AA 2W6CX 4LWZA 1JHAA 4BGVA 1DAGA 2VYFA 1L5FA 3LDGA 2B2XA 4K9SA 5KTRA 2EQBA 3KLOA 4ZCPA 4HLUC 4C6TB 3KELA 2DERA 1R0SA 3FW1A 1QVRA 1MRNA 1NVBA 4ZVQA 1GQ2A 1WDWB 3HR7A 3L04A 4BLUA 1XVLA 1R27A 4TMFA 1JL3A 2OB2A 2PZJA 4H77A 5H68A 4E94A 4KJXA 1VL2A 1R10A 2NXEA 1VG8A 3C1TA 3UJCA 4JEUA 4OF4A 2DFTA 3GLIE 4NOKA 1NYTA 4AS3A 4AVYA 4DCMA 1C7RA 2DOKA 1VL0A 4NBSA 3ZBUA 4FZ5A 1QV7A 5FPKA 3EIFA 3E9DA 1MO3A 4FDMA 3QU4A 4LRUA 5DHTA 4UARA 3E3LA 1P4SA 3JQFC 5AJTA 3ZU6A 1IL0A 3HJCA 5GVSA 1PLLA 1G17A 1GNSA 3BE8A 3K1JA 5DTJA 3HVRA 2W6ID 1IXKA 4RGBA 4P34A 4E22A 1YGPA 4DG8A 1MG0A 1WTCA 4RS3A 5CB6A 5G1OA 4EO7A 1K66A 4TUYA 1VHDA 3R5SA 1MX1A 3KFVA 4BV8A 4MUXA 3IBYA 3MLEA 4N8EA 3B7GA 5FTJA 1CJVC 1JDUA 2XMSA 1JI3A 2CVZA 3F67A 4TTSA 2CCGA 4N3AA 1MQSA 5FEUA 5JC8A 2E6KA 4ZVSA 4RGVA 1ZZGA 5I4IA 5JZOA 1UEJA 2XE7A 4H27A 2NSHA 2D0PB 2ZTHA 3FNFA 2IPOA 1KZYC 2ECFA 4O2AB 4EYEA 1QWOA 1O9GA 3DO5A 1VI2A 2X58A 4ID3A 1SG9A 1HE1C 4YRPA 5DVZA 1OV4A 4B74A 1I2DA 4QJ4A 3BJRA 2ZIGA 4EA6A 4HK4A 1P9RA 2XY4A 4O4JF 3OFJA 2XBLA 4UFOA 4YMHA 5C5IA 2ECOA 1KC3A 1A9OA 1V11A 1TU3A 1VCNA 3I52A 3MJVA 3DLAA 4GGPA 4L0QA 4Q9HA 5EKUA 1FTYA 5JMPA 4Z86A 5AW5A 3TN7A 3CNEA 2HWXA 4LVUA 2O2CA 3ZQ6A 4G1VA 4RWZA 3F46A 5F1YA 2XMQA 1NVGA 3F6CA 3NHAA 4HFMA 2WJZB 3H5IA 5CVUA 2MSCB 3CMCO 3NOOA 4XWYA 4E1BA 4B3XA 2C92A 4AF6A 4F91B 5I7SA 5LMNB 3EZ2A 2GUWA 1CEXA 3DOUA 3SZOA 1G8YA 5AVVA 2YNMC 1GKKA 4ND8A 2UAGA 1E1DA 1TVEA 1IB6A 3CO0S 4EFLA 4AAYA 2AYYA 4BCBA 5JAOA 3ROXA 4HDAA 1Z18A 3H05A 3SC4A 1QO0D 3A8TA 4I4TB 1YOBA 3O0TA 1XWIA 1JYEA 4N8SA 4A0SA 4U0JA 1YT5A 3EHEA 3WOHA 4AF7A 4DCPA 1HLGA 1ZO8A 3AR6A 4PSAA 5GJBA 5K3CA 1FU7A 1N9ZA 1RM4A 3IJRA 3WWEA 3GCXA 4KHZA 1KH1A 1KXJA 3LRTA 4MX8A 4N7RA 3USCS 3U60B 1POXA 1YI0A 3IUPA 1I4TD 3BB4A 3NT5A 3W2GA 4OMUA 1T3LA 2VT2A 3N8GA 3L43A 4KV9A 3QEMB 2C8VA 4OA5A 2B7LA 4MGHA 4X20B 4UOEA 2H5EA 3QPCA 4MA4A 1G0NA 2Z8YA 2RI1A 3NDIA 4QGGA 4CEJA 5A0VA 2QQFA 2XDQB 2PGLA 2CHEA 2BLNA 1Z38A 2LRHA 3RABA 2OESA 1XRMA 4J9VA 4Z5XA 2LNDA 3BGWA 3SAJA 2EHDA 4CJXA 1Z15A 3TZKA 3DZBA 4P3PA 3WGZA 4ND3A 2UYCA 2QRJA 1C29B 1QFMA 1KMHB 1SVUA 3TMYA 3M2TA 3BZBA 4N48A 1QGYA 2X0NA 4HGNA 4WN9A 4CBVA 1M2GA 1SOVA 5HF8A 4FGZA 1WDTA 2CFCA 1ZMXA 3PEYA 8MHTA 1H5UA 2GI4A 5K9ZA 4WZAA 2RB5A 4A0GA 3OX4A 5FT9A 1U7ZA 2R6JA 4Y98A 5EXEA 1GZHB 4M0LA 1CR2A 2C00A 5G1PA 1KRWA 5A6VA 1GT91 1YFKA 3OICA 4LZOA 1A9ZA 1WNFA 4OGGA 2D6FA 1TUBA 1GUFA 2POCA 4TLEA 2KMLA 3UJHA 2HSDA 5E6UB 5TMBA 1NPYA 4W5HA 2DPLA 2GCOB 5EKXA 1NQVA 3GO4A 2ZJBA 2YV1A 4UE3S 2AJTA 2Q7XA 3ZI0A 4YHHB 1LK0A 4JFAA 1PJRA 1HYQA 1TRKA 1QPGA 1XRJA 2FFAA 1QHEA 1RXEA 3HPQA 4IDCA 1FFXB 2DR3A 5FNVA 3CGGA 3LC2O 4YNBA 4LGYA 3UFXB 3SJZA 1N2GA 3BSWA 3QHPA 4MVJD 3AERA 3KD2A 1PNQA 5GM1A 1NG9A 4LF7B 1K27A 2XAAA 4URZR 5A7FA 7ADHA 2VHTA 4XWKA 1KS9A 1WCIA 3N2KA 1A95A 3A3OA 1G8MA 7GPBA 1GUZA 4NMHA 4TYMA 3MD0A 3HKCB 4PHCA 4JCCA 4Q00A 3R41A 2AGVA 4K40A 3V1MA 4L95C 4MVJH 3KWMA 1KYIA 4HMPA 4YROA 4JJZA 4Q03A 1PFKA 4MYDA 1DV2A 3OJOA 1V5EA 1V35A 1J6UA 3PZRA 4EZBA 2JIMA 1RYZA 2PGOA 5AVUA 4AICA 4Q1CA 4B17A 2IH2A 4DE5A 1P4HA 2IJGX 5CXUA 1RQ7A 3A37A 2Q99A 5DM0A 3VJKA 4RK5A 4OH1A 2X1MA 5FPSA 5LJIA 3SIWA 2IS6A 2O8EB 3QOXA 5BVHA 3NBFA 2AFIE 3G1TA 4NU5A 3Q9SA 1GG2A 2H18A 2HA7A 1BQ3A 3U2QA 5CG1A 2WJAA 2YJGA 4G41A 1ADCA 5AI4A 2M6KA 3ZGYA 1W36C 2W6ZA 2X4IA 2GN0A 3UJNA 4L5AA 4D82A 1DG3A 1JB9A 2JIPA 2XTMA 3D8HA 2OTCA 4N82A 1GXSB 3IP5A 2IFTA 3QKSA 2P3SA 4IV5A 4O4LB 4ABTA 3G2LA 2M2IA 4OGFA 1J1IA 4IJ6A 4HPJB 3KVVA 1OZGA 1MD9A 1U2RA 3SDSA 3C6XA 4F2PA 4GZMA 4UPVA 3TKLA 2R4QA 1GCOA 3AUKA 3K6RA 4II2A 3FR8A 3VPFA 4QA9A 4D8VA 4Q66C 5EJMA 2QRMA 3FTFA 1IQUA 3OLWA 1LFDB 3QH4A 2O2IA 3D6JA 1R6VA 3LWZA 2EGHA 3AIMA 3OOSA 1T36A 4EECA 4YDQA 1R5NA 2PKCA 1ZFNA 5FWYA 4RIGA 3FB4A 2XQGA 4IIUA 4UUBA 3MWLA 4BFXA 3C3PA 3RIXA 1BW9A 3K0BA 1JTEA 3N5CA 5SY9A 3VR3A 1TZJA 3NBYC 3LUHA 3BMQB 2W2TA 3OAAD 5L7WA 1XZIA 5B6JA 1JSRA 1I5EA 4PNHA 2OD2A 4UDXX 3ZVRA 4CHGA 2RHHA 3R6LA 1L4HA 1GNLA 4E14A 4MS3A 2ZVJA 4CIWA 1BGXT 4HB2A 1GTRA 1W1IA 5CR9A 5AI6A 1B43A 4KSCA 2IWRA 1IULA 2CW5A 3IHKA 4RA6A 4OJQA 4Y9RA 1BJTA 3H0EA 1U0LA 1XQ1A 2YNMD 3RIEA 5ABPA 4OM7A 1E60A 2XGGA 1M5TA 1W5BA 3T06B 2B1GA 3QELA 3N28A 4C4XA 2VDNB 1C3JA 2C9CA 1NR7A 1RXSA 4EHJA 2X4LA 3VR5D 4DZRA 5EQTA 2IQIA 4DILA 3GFVA 2D5AA 3L8FA 5DBOA 3CZAA 1P1IA 2ES4A 5TPWB 4OIFA 4UUOA 1FJXA 2AKYA 1KDTA 3PQ4A 5CPFA 1MABB 1AS0A 3TD2A 4DB2A 1YRAA 3BE4A 3MWEB 4EF4A 3OZIA 1IZYA 4A15A 2XQVA 1GUDA 1YVRA 2ID8A 3DLPX 4NOLA 3VR5H 4FCCA 4OJYA 3K5WA 2BMWA 1AOXA 1G291 3CNHA 2JIQA 1MXFA 5FLEX 2EJWA 3DTYA 4A73A 4ENQA 1HE3A 721PA 2C7RA 4FZ3A 1IG3A 2XB9A 3E48A 3OWOA 1NX6A 3T7TA 3HSYA 4LDPA 4R7ZA 1YBVA 2B36A 2V03A 3K9HA 3UAXA 1OE0A 1HT3A 2X2PA 3QKRB 3HA7A 1U98A 4MJLA 3UICA 4A0HA 2PSFA 4DTIA 1ETHA 1J8VA 1QP8A 2HBRA 2CNDA 3CRVA 3QXXA 4HADA 1U1GA 5H82A 3R8FA 2DLNA 1FSFA 3H2SA 4O4IF 1UMBB 3W79A 1JH9A 2RH8A 4P7JA 4C29A 5MN5A 1GNPA 3EMDA 3PRJA 1JTFA 1Y1QA 3HB4X 3T7IA 3ZVMA 3FOEC 2FSUA 4C0LA 2NLOA 2YC2C 4MYCA 4BKPA 1C0EA 3HCFA 3LA8A 5D6OA 3THXB 5CCBA 3CLKA 2PUWA 3MK31 1HNZB 1I3MA 2VDQB 1LSSA 4RX1A 5EMMA 1QJCA 3A4VA 5AKGA 5DFAA 4XQ0A 4BZWA 4E7OA 1T8RA 4ZAWA 1K88A 1NN0A 4XGNA 4HAWA 4P4SA 1U9IA 2YWJA 3V4VB 3WLJA 2PM8A 4Q4LA 2OZLA 2YBEA 2YVKA 2I2XB 1AZSC 1QBGA 4QULA 5KI6A 4EGQA 3KKLA 3ONEA 4LOLA 5BWMA 4BXOB 1VP3A 5E0OA 2XD4A 1E7MA 1ZIXA 3L41A 3JY6A 2QE6A 3L6OO 1VGVA 4KVZA 1N8TA 3H6KA 1YQXA 3WB0A 1B2RA 3DLTA 2ZB7A 4YP5A 1IYZA 1RJ9B 2QTVA 4KMOA 4PG8A 2R1UA 2OK8A 4E5KA 4FT2A 3L7CA 2XUHA 2VH1A 5F77A 1DG9A 1EX7A 1JHVA 4NDNE 3ELWA 4RE5A 4RPGA 2RC5A 4JVMA 1TW2A 4S1NA 1NC1A 1ZHFA 2FWRA 1P7VA 3CPEA 1WO8A 4N54A 1EDBA 4I2VA 2JBAB 4XB6B 3LW7A 3AY3A 3UAWA 2QZJA 3AHEA 4H16A 4PFSA 3OIUA 3TH5A 2QN2A 4JSTA 1TLTA 3LPCA 1I33A 2VIIA 4R9UC 1G5HA 5JAIA 2QOEA 4HJXA 4WXRA 4N5HX 2WZCA 3LUKA 5DJ5A 5GGXA 3HDHA 1Y37A 3PWTA 2DWCA 4H0CA 4OHMA 2R25B 4IJQA 3ZI4A 1N4AA 4X24A 1TTTA 1G42A 1K3TA 3MJ4A 4BKUA 5KIAA 1E2LA 1OXTA 1OA1A 1M1XB 2JBHA 3VYVA 2VPTA 5ARBA 5AW1A 2BTEA 2WUFA 2VP4A 1ISFA 1GLGA 4DM4A 5ILOA 2W58A 3I34X 4L5BA 4MJ3A 3RBZA 3FUWA 3CJTA 3P0RA 4L9RA 3WWZA 4Z6KA 5G40A 1ZSYA 3COYA 1UMDA 4E09A 2EP8A 3GR6A 3O8QA 1YZUA 1W36D 3E05A 4WLOA 1AK2A 2XKBA 1GTVA 1SHKA 2Y66A 3KOWA 2Q1WA 3C74A 1FDWA 2YIVX 4J6EA 5G1NA 2GJ4A 4PR0A 3TOXA 4A6EA 3TLXA 3RVBA 3D5QA 2PRKA 2GPWA 2MTBA 3HUFA 4WA8A 3HXTA 2ZQZA 1ZD2P 4K8OA 4FMDF 1K6IA 3ZQ4A 2EAUA 1EM6A 2QD1A 3BXGA 1CUYA 2CE7A 4R2WA 1ETUA 4M1TA 3O8RA 3TVTA 3LC7O 4MR8B 1KJ9A 2CF6A 1YQTA 1QFJA 3E23A 4LJRA 3DULA 4IEFB 2PX8A 3H1PA 1M1ZA 5AKHA 3MF4A 3OCXA 5DBGA 1WDLA 2O52A 3E3OA 4M8IA 4ND4A 3FLMA 5HTKA 3SNHA 1GPAA 2I7TA 2ZUFA 2ZZNA 3UTCA 1AHPA 2C2BA 1ZLYA 3O47A 4DQDA 3RSSA 2NO5A 3T5PA 3EGWA 3CX6A 4LC1A 2QYHA 2ZAGA 2NQTA 2RD2A 1DAPA 4FOPA 5ICCA 3SKYA 5I01A 4BO1A 2RG7A 1N75A 1YQQA 3DHEA 5FI3A 2B8WA 4NBLA 4UM8B 2DTDA 5PGMA 1N36B 3QEJA 4D74A 1I3NA 1Y3CE 1KZ7B 2C2YA 2QTRA 3KWFA 3LX6A 3CRQA 2X14A 4S04A 1CZUA 1AKUA 4L5CA 5FV7A 3OFVA 1SVSA 2VXBA 3RWMB 3A27A 4AJPA 3KBBA 1FFAA 3AKDA 4YAIA 4EABA 1H2BA 4OQMA 3Q3VA 4OJKA 1YFJA 2ZVQX 4EJFA 3ZHCA 2REOA 4BQEA 3JQAA 2YHUA 4WOKA 3OT5A 2ORWA 2HCTA 2Z1DA 3DMGA 5DH9A 3E8XA 2AV6A 2RGBA 4GQBA 1QQTA 4K81B 2AZ4A 4BFZA 3KJIA 1VA5A 2GTIA 2IY7A 3LL7A 1BU8A 5L9AA 1DOHA 1J0CA 3LCJA 3VYRB 2L18A 4D6XA 3U4MA 4D97A 4H1TA 1PL7A 1E9EA 2IOYA 3I23A 3MJSA 2E5LB 5T7BA 2COKA 1Z7BA 5D85A 3NU1A 4L8WB 1C0KA 3G9TA 1X7ZA 3AR4A 4AJHA 2BFBA 2G9VA 3L05A 1XO1A 3G5LA 4PQRA 2PSHA 5KSPA 4N7MA 3DDCA 4XE5A 5EE1A 4HLNA 4BNDB 2FDCA 1KY5A 2OQRA 2NQ8A 4XSVA 5IDYA 3CLUC 1T0IA 4WKBA 1QTRA 5C4GB 2B25A 4JBXA 3RFTA 1CRZA 2Q6KA 4JQSA 2IBSA 1JJFA 3MCAA 3QE9Y 3AGQA 2CK3A 1QRRA 5K0FA 2OCKA 5JU6A 1RT9A 2Q46A 4N0EA 3PR2B 2VRNA 1Y1RA 1E3QA 2UUOA 4NBTA 3H3FA 1RWXA 5EE5B 1L1EA 1Q15A 5JMOA 1ECLA 2ZCUA 4O29A 3FWZA 4IF6A 1KFCB 3SZMA 1E2FA 1M1NA 1FL9A 2QRVB 4O6VA 1W85A 5HNKA 2VL7A 3H9BA 3DE7X 4FCTA 4V24A 5EJFA 1UH5A 1ISRA 1LDYA 1S2DA 2BGMA 2ID4A 3JATB 3QVGB 5FWDA 2XMRA 3VR3D 4HWRA 1X38A 3PXBA 2B99A 3MGKA 3VVBA 5ADVA 1YNOA 1KEUA 4M0DA 3T38A 1K8XB 2ACKA 1W4LA 4EM6A 1J1UA 3ZS9A 2O3UA 3PI6A 3B3GA 4HXGA 4D44A 3PFFA 1Q0QA 1TUEA 2FFQA 3W2EA 2QR2A 3T7KA 4AW9A 3NO4A 2ZR0A 2DF8A 4I99A 1JG7A 2XGOA 1DCTA 3MINA 1J2UA 2OM2A 1JZTA 2BPOA 4KTTE 2O2DA 3IO5A 4YRRA 2YZMA 1MRZA 3AUJB 5DSZA 2BSQA 4RSRA 4Y9UA 5C37A 4R40A 4PG4A 4TTPA 2P0YA 4HGRA 4B84A 4KO8A 1ISSA 2F6RA 2OV4A 3IDOA 3C4JA 3OETA 2YYSA 3L3BA 4EUSA 1XFAA 3SZUA 1X1SA 2JAPA 4RLSA 2VT6A 3B6MA 1IVNA 1YU6A 3E7WA 3G0OA 1H69A 3G0DA 2JFNA 3GHHA 3GG2A 2E5FA 3OLVA 1IQRA 4GOMD 4C2AA 4LF9B 2YZGA 2Z1NA 5IKMA 1JLRA 5JSYA 1XQVA 3T4UA 2WVGA 3MAJA 5KOJB 1VPWA 1MC4A 2SCUB 1KSHA 2Q9UA 2BEJA 3EXIB 5BSWA 4EJSA 4KQEA 4K9MA 1WBBA 1TZKA 1V8FA 2O7QA 1HR0B 2QW8A 3A1CA 5A62A 4DDKA 2IEIA 4BZZA 2NO6A 5JT1A 4N0DA 3LV8A 2AUTA 1ZI9A 4HXFB 3L6CA 1OLXB 1ZJ4A 3AEUA 4E5DA 2NX2A 3F4KA 3ORSA 4CV0A 4WBNB 1NQUA 4CKWA 4QYWA 4I5IA 5AK0A 2FK8A 3G1UA 1GGVA 2ZE8A 3DE6X 4HPXB 2B4TO 3AJ9A 4JT4A 4YRCA 1B41A 3D1LA 1NDHA 2GK3A 5DEIA 3TM4A 1OTYA 1R5BA 1YDWA 5C32A 1XNQB 4WACA 4ARIA 2SECE 1TRHA 3R3SA 2NU7B 4GR5A 1WV1A 3VX4A 4F38A 1GZ4A 5JVDF 2QBYB 2DHEA 1Q7GA