1D5WA

Phosphorylated fixj receiver domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
122
Chain Sequence
MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
publication title Conformational changes induced by phosphorylation of the FixJ receiver domain.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Gene regulation
total genus 38
structure length 122
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d5wA00
2HQBA 4MRMB 2FXIA 3OLYA 3TD9A 2CD7A 1ABFA 5HKOA 1K68A 3QX8A 5EWJB 1U04A 5C5CA 1SRRA 3QELA 4G0PA 3W9SA 3JVDA 2NZUG 3H1FA 3ILYA 3S99A 1JYFA 3QEMB 3JS5A 4MR7A 4HNSA 4RXMA 5JNVA 1FSPA 3LUDA 4KQ9A 1QQBA 2QZJA 4IMIB 1NXSA 3H6GA 1RPJA 1XHFA 1YK0A 1Z12A 1ZH2A 3JPYA 1RNLA 1QO0D 3A0UA 2RDMA 4LE2A 5F64A 5IBQA 5BRAA 4S04A 4NCAA 3IP9A 4G0OA 1DRKA 4F06A 3IP7A 4RZSA 2WY2D 7ABPA 1Z16A 4G86A 3T6KA 3O1HB 6ABPA 1NXTA 3GBPA 1ABEA 1LK0A 3F73A 3SG0A 2FKAA 3H5TA 2WJWA 1YS6A 3RVKA 5HSGA 5EWLA 1HEYA 1D4ZA 2WJAA 1ZGZA 1GCAA 2FMIA 3CFYA 4G0QA 4KRFA 5FWXB 2HSGA 1XWWA 1FFSA 1BDHA 3HK2A 1E2BA 1P6UA 3JTEA 1YMVA 4YGXB 3H5IA 3O21A 3HZHA 4EYGA 1DRJA 2PE5A 2IPMA 3CU5A 4PEVA 5JNWA 3OQMA 1QKKA 3GV0A 1PNRA 4MS4A 5KC9A 2NUBA 1USIA 3GT7A 3FMVA 5TQ0B 5HQJA 5JNRA 2JK1A 3LUCA 4MR9A 1JH9A 1EHCA 3OO1A 4KK3A 4Y9TA 4KMRA 4RS3A 4EYQA 4ETNA 2PUGA 2I6FA 3C3MA 5FBHA 2A9OA 4LE0A 3LUHA 2H3HA 4E7PA 4D74A 4XARA 1Z13A 3GWGA 4HNRA 3NHZA 2BGGA 3UUGA 2QW1A 4PYRA 3RVMA 3SAJA 5JNUA 2JB9A 3CZ5A 1QQAA 3JY6A 2JVKA 4EYOA 2P4UA 2A9RA 4MS3A 4N0QA 5FWYA 5DCLA 3TB6A 1FFGA 2PUFA 3JVIA 4MRMA 3Q9SA 5CNMA 5B3JC 1E6KA 4KNYA 5EWJA 3URMA 1NTRA 1JWLA 2IOYA 4Z4EA 3H1GA 3QEMA 3SM9A 2ID9A 2Q5CA 3P9YA 4N47A 2QXYA 2IPLA 3BRQA 1BAPA 5GQSA 3I09A 1NXWA 3E61A 1SXIA 3D02A 2GWRA 3G1WA 1LBHA 2PUCA 1P8AA 4PICA 2E4XA 3H5LA 3M9XA 2WRZA 4TN5A 5DGCA 4Z99A 5FBKA 3HSYA 4IILA 1RXEA 3KS9A 1S8NA 3HO1A 4QYWA 5JS2A 4Z4CA 4RXUA 3UKJA 3N0WA 3K4HA 3Q7TA 4Z4HA 4WXEA 2IYNA 3DGFC 3BRSA 3RVNA 1K66A 1J56A 3CG4A 1ISSA 3OLWA 4OG2A 5CHYA 1ZITA 3SNKA 4RKQA 3KCNA 4H60A 3OMWA 3H5OA 1Z18A 9ABPA 3H5WA 2A9QA 4PE5B 5FWXA 2E4WA 1LJLA 3HCWA 3N0RA 3OLXA 4JOQA 5KC8A 3I5AA 4ZMRA 1U2QA 3N8IA 4RK1A 5IX8A 5TQ0A 3MYYA 2PMCA 3GRCA 2PKXA 3N53A 5TPZD 3Q7SA 4Z9AA 1JHZA 4FE7A 3GL9A 2MSLA 3HS3A 3MIZA 3QLUC 2ZWMA 3Q7RA 2M98A 3C3WA 1M2EA 1JL3A 1Z2EA 3LTEA 3I45A 3RVQA 4EY3A 1ZN2A 2JVIA 1Y1LA 1SD5A 4KREA 3BREA 5CNJA 2MSKA 2RJOA 1XHEA 5JNSA 1VRVA 4W5RA 4KQCA 1U2PA 2VUIB 3FFXA 4EYKA 4ZYLA 4NQRA 3MM4A 3DZDA 4TLMB 3HDGA 5IEBA 2FVYA 2ID7A 2RJNA 4UHKA 4DN6A 3VNAA 4YLEA 4WXMA 2AYZA 1GCGA 3HV2A 1DBWA 2AYXA 4JAVC 1F4VA 3O2JA 4KPYA 4CBVA 4YR7A 3F7NA 4W5TA 3HJFA 4HNQA 3KG2A 3L49A 2CWDA 4XXHA 1URPA 2GKGA 3Q15C 3FFTA 2MSWA 2L18A 2IPNA 3OQNA 4PZ0A 4Z0NA 1VLZA 2VUHB 5IC5A 1QNLA 2FLWA 3M9WA 3QLTA 4ZMSA 1NXOA 1R8JA 2ZAYA 3QX9A 4B09A 4Z4FA 4Z4GA 3LKBA 3OM0A 1QMPA 3A3KA 3NBMA 3SY8A 5IUNC 4M88A 4F3TA 4JB2A 4Z9BA 1YIOA 3RVLA 3T95A 5IUJC 4W5QA 4WUTA 2W42A 2L2QA 2B1JA 5T3YA 1ZHHA 4OTZA 3DLHA 2M1ZA 4RU1A 3MMNA 1JBEA 1SXGA 3TX6A 2MYNA 3FGZA 5T7BA 2HQOA 1CEYA 4W5NA 1MAVA 3M6MD 1DBPA 4KFCA 2YHBA 2FN8A 5B3JA 1ZESA 3HUTA 1PEAA 4G0MA 1ZVVA 2P9HA 4YWHA 3O1JC 4O1HA 1BDIA 1JLKA 5E3JA 1NATA 2FQXA 1LJUA 2WB4A 4D6YA 5JS1A 3KHTA 1DCKA 3H6HA 3F6PA 1JDNA 4EVRA 3GA5A 4FB4A 2FQWA 1BA2A 3CNBA 3N75A 1W9HA 3E3MA 1MVOA 4N76A 1B00A 5PNTA 3F6CA 4MQFB 4QICA 3ROTA 4RDCA 4RKRA 2B4AA 3G85A 4MLCA 4ETMA 1EFAA 2OQRA 1W25A 3BBLA 4LRQA 2HQRA 2FW0A 3CLKA 4YV7A 3CS3A 3OM1A 1TLFA 4GNRA 2GI4A 2FLKA 2FMHA 2IKSA 4KV7A 1EWKA 1KRWA 2YHAA 1JF8A 4F12A 5CNKA 3L6UA 1PEYA 3HXMA 2FN9A 3CTPA 4O1IA 4MAAA 1YTUA 1PNTA 1D5WA 2CHEA 1C0EA 3CHYA 4GPAA 4RK0A 2A9PA 3RVRA 4Z4IA 3DGEC 3NNDA 3GYBA 2QVGA 4DADA 1JFVA 2V0NA 3DBIA 4RK7A 1LBIA 3KKEA 2FEPA 3N6VA 1DCFA 4RV5A 3RVSA 2F8TA 2WWVD 4MYRA 2E4VA 5JNTA 1DZ3A 3C3KA 1OXKB 3IPCA 1TVMA 3NNSA 4IMJB 3EULA 3I42A 4H3KB 3TO5A 1L5YA 4NICA 2IDMA 5TQ2B 2JCGA 1APBA 3QLUA 1M2FA 4G0XA 1KMIY 4HYEA 1PUXA 1QO0A 4XASA 1NXVA 2LBPA 2LIVA 5CNIA 5KQPA 1KGSA 2PUDA 1ZGGA 3HEBA 3Q41A 2R47A 3OMXA 3RVOA 4QYMA 5EWMB 5BQ3A 5KQLA 1ISRA 3ROFA 4Q6BA 3NNNA 3KTOA 3SQNA 3R0JA 3OLZA 1EWVA 2GBPA 1USGA 1JYEA 3HVRA 2PUEA 3CRNA 3IPAA 4MGEA 4EVQA 1M5UA 4KVFA 1BVHA 1M5TA 4L85A 4YRZA 3CG0A 2PUBA 3KSMA 3HUUA 4RY0A 2JBAB 3RH0A 3MQ4A 3KLOA 3QK7A 4IGAA 3VNBA 2LUOA 1A0OA 2E4YA 4G97A 4MQFA 3MF4A 3O75A 3BILA 4XAQA 3TMYA 4RSMA 3QLVC 2LP4Y 1DG9A 4ZPJA 4E7OA 4ETIA 2HPHA 4OBBA 2MYPA 3EAFA 4MPTA 1JX6A 2NT3A 2QV0A 4YCSA 1MIHA 2R25B 1FQWA 2FMKA 2NZVG 2FSPA 4LE1A 3GBVA 4OLAA 4N03A 1EAYA 4NCBA 3JPWA 1RZRA 4D6XA 2PL9A 3LUGA 2TMYA 1DC8A 4RWEA 3RVPA 1NXXA 4MR8B 3HDVA 2VK2A 3EODA 4FE4A 4N41A 1ZH4A 3B2NA 3FFWA 1E6MA 2GX6A 4JASB 4RK4A 2NT4A 4N0PA 2MYTA 1DCMA 4IF4A 4ML3A 4RY8A 3N0XA 3RQIA 4LDZA 2QU7A 8ABPA 1DC7A 4EUKA 1MB0A 5TQ2A 2PL1A 2MYUA 3OLVA 2JVJA 1TJYA 1QP7A 2F8SA 1MB3A 3FDFA 3LUKA 4YO7A 3OO0A 3OQOA 2DRIA 5I4CA 1D1QA 3MA0A 3IDOA 3ILHA 4JB0A 3T38A 1GLGA 1USKA 1CHNA 4WZZA 4ZJPA 4MS1B 4TLLB 5KQMA 5EWMA 1U8TA 4MQEB 4F11A 5BR1A 5IULC 3H1EA 5TPWB 4H3HB 2FTKE 3QEKA 1I3CA 3C6QA 5BRJA 2PAFA 4JP1A 4RK6A 4P1ZA 1AB5A 2PUAA 1H9CA 1Z15A 5TQJA 3T8YA 1U0SY 4LX8A 4XFKA 5DKFA 4Q7EA 5KI6A 1QP0A 2IPAB 3IP6A 2JBAA 3DLBA 1TM2A 1Z2DA 1TMYA 3LUAA 1ZY2A 2J48A 4DQDA 3O74A 1GUBA 1JDPA 4IRXA 1RZRD 1YS7A 2QSJA 4KZKA 3A10A 4Q6WA 4S05A 1FFWA 3LUFA 1F51E 3QELB 5IEJA 1YK1A 2H0AA 4LZLA 5TPZA 4MR7B 5KQGA 1ZAYA 5C5EA 2XDYA 4OLBA 3CZCA 2O20A 3CKMA 4F8JA 2QVCA 4G0YA 4WT7A 1KRXA 2FQYA 1EWTA 1L5ZA 1NXPA 2QR3A 4TMYA 1RXIA 2PLNA 4WWHA 1IIBA 1QPZA 1PHRA 3RVJA 4EVSA 3KYJB 3H75A 1A2OA 4W5OA 2R4QA 1Z25A 3IP5A 2KYRA 3KYIB 4MLDA 1YMUA 4MR8A 1D1PA 3H5VA 4QPJC 1P2FA 2CHFA 6CHYA 1GUDA 1YVUA 4RK5A 1Z17A 1DP4A 1CYEA 2HJ9A 3A0RB 4JA2A 1T34A 1DJMA 3EDCA 4O5AA 1AB6A 3KLNA 2R48A 4YP9A 4NV3A 5EWLB 1DBQA 1VKRA 5IUKC 2LPMA 3O2SB 5D2CA 2WMYA 4YS6A 1P6QA 3C97A 3EQ2A 5HM6A 3LFTA 4G0ZA 4OATA 4KK4A 3O1IC 4LDAA 2FEWB 3UK0A 1BDJA 5ABPA 1C4WA 3LMKA 1E6LA 2L19A 4UHJA 1UDRA 1JFTA 3LUJA 2L17A 3K9CA 4MS4B 1NY5A 1JFSA 3QLVA 1Z26A 4XLTA 4MS1A 3EQZA 2RGYA 2VYCA 5GOTA 4L4UA 1QP4A 1WETA 1SXHA 4MQEA 4MR9B 2E4UA 2X7XA 3EGCA 5TPWA 3LOPA 3KJXA 2FEKA 4RY9A 4EGSA 2JRLA 3D8UA 5DTEA 2E4ZA 5DLEA 1A04A 3HM9A 3O2QB 5ED4A 2N9UA 1D2AA 2FMFA 5KWSA 2OENG 3LKVA 3EJWA 5TE9A 4P98A 3NHMA 4RXTA 1ZDMA 1VPWA 4MS3B 1OXBB 5FWYB 2PJUA
chains in the Genus database with same CATH superfamily
3ANXA 3PP8A 1R5OA 3M81A 4IUBS 4MVCA 2W22A 4PVDA 2WB2A 2ZK7A 3FR8A 4Z4IA 2IYUA 4LHXA 1K5GA 5FTJA 4U3JA 4BO4A 4QT4A 5IC6A 3VJKA 3TLCA 2I3BA 2EBWA 2YZGA 2UYHA 1NVXQ 1PI3A 1E6WA 13PKA 1OBHA 2BFFA 1R9GA 5DHSA 3O2NA 1AV7A 1FFHA 5JZ9A 5C4GB 1KWKA 1VHJA 1GZ5A 3X43A 2QZJA 2YBDA 3LT0A 3OTQA 2APJA 4ENVA 1T8PA 1PJRA 2QTVA 3MD0A 3ZWWA 1MC8A 2V58A 3EHEA 3GP5A 3R5HA 1SVKA 5FI5A 1M2HA 1WPRA 1IBSA 3HNOA 4M54A 4EY5A 1Y8QA 3NHAA 1Z5VA 3HP4A 4GVPA 1CP2A 3E2PA 4NS4A 3HL4A 2JIOA 3OJOA 5DHPA 1KIAA 2P2ZA 4IYRA 4JHXA 4QFBA 5F33A 1YC2A 2XADA 3TIXB 5CDFE 4G86A 1SUIA 1PZEA 3OVMA 6ABPA 3FH0A 3FPEA 1PK7A 4FEAA 4OU4A 4C3ZA 5BWOA 1H65A 4MPRA 1GAWA 2IP4A 3AY7A 2OXEA 3WS7A 1XZEA 2QD4A 1SVMA 4CCYA 1CQJB 4NFYA 5JEDA 1RM0A 1FJ2A 1H2WA 1U5BA 1H4QA 4G0QA 4QRIA 3DB2A 4HMOA 1YB2A 1Y7HA 1P6UA 3FTNA 4DNFA 5GV8A 4FD3A 1T5LA 1IOLA 1MO6A 3IR7A 4WY8A 1RHJA 3ABRB 2NU6B 4FOLA 4CNQA 2IPMA 2QWXA 2R68A 2GVZC 1WP4A 4KAAA 1LS6A 2EG5A 5BNWA 2P3SA 1CY0A 3I5YA 4QXAA 1NE2A 4WSOA 2I76A 5HIJA 5FWNA 1GIAA 1E1MA 3JVEA 2VDOB 5K3FB 4D9MA 4F38A 4AY4A 3UV7A 2HJSA 2ZB2A 3SP1A 4ABTA 2GUGA 2X40A 3EMBA 1JHUA 4JWKA 4BC0A 2H85A 2F43B 5D6OA 2UYCA 4F3NA 4O3FA 2BGGA 1SAYA 2QTGA 1WTCA 4B3JA 1FSGA 4UAVA 4PYRA 1MV8A 4QUAA 1NL3A 5DH9A 2ZJ5A 4ZAZA 4WXHA 3WMEA 4EW3A 5KYXB 1QQAA 4JLDA 2B35A 2JVKA 1UC8A 2CV2A 2GPTA 1K3UB 3VAZA 1J0XO 4O3MA 2Q3LA 1YDGA 4E12A 4Y2YA 1XZ8A 1DQNA 1IQUA 1UK9A 4GDFA 3I9NA 1R6XA 2DT5A 4QUKA 5T57A 2JI6A 2YOGA 3QUCA 1GL9B 5K8CA 4ENQA 1NURA 3IEMA 3TNJA 1Z9BA 2WLTA 4AYXA 3WRYC 2FSVA 1YZLA 2VJCA 5FPYA 3RYHA 1LTKA 3WQSB 4R51A 1CC1S 4YC7A 3V42A 1I13A 4AZ0A 2QP4A 2C4KA 2Z2YA 2H16A 3RBAA 2GFHA 3A6EA 3D02A 2HMYB 4K9RA 5DX8A 4LYEA 5IF3A 3WC4A 2YXEA 5ALDA 1CUHA 3WX0A 3HGMA 4CT5A 1J2UA 1KY5A 2EWVA 1W6UA 2G9ZA 4P6VF 2UYQA 5C52B 3K5PA 4Q82A 1OV4A 3HJGA 2XEXA 1LRKA 2OQVA 3RROA 3WBBA 2GHTA 4YMGA 4PC7A 5EIBD 4DILA 3Q6IA 3DUWA 4UPVA 1GT6A 1X13A 2WV7A 4AWAA 1ISGA 1FYEA 1XVVA 1G6OA 5E9AA 2FX3A 3RVNA 1ISSA 5GM2A 3Q3IA 4BFXA 3DOJA 3IMCA 3HCNA 4YMTA 4RYLA 1OPRA 1LCIA 3OHPA 4W7IA 5DF1A 1BGVA 1GGHA 2H1RA 3BKWA 3IODA 3LY7A 5JMPA 2GM3A 3F5SA 3DP9A 4JJGA 3LY8A 2PWBA 4J0QA 1D8TA 4PPFA 5DB4A 3T3PB 3QNMA 5CBPB 2G5TA 1ZCBA 2Y8EA 4JYCA 4Y1EA 3BZUA 2B83A 1RPZA 2OSVA 1PT5A 2VEOA 4N6NA 4ZEOA 2JH3A 1UFQA 3KDAA 3A6GA 2NTYC 4LMRA 3RT1A 3N0RA 1Z6GA 3WP1B 4ID3A 4BO9A 2GN0A 3OZDA 4OKNA 1TC1A 2NZWA 3LFUA 4JR1A 2BCGY 2JHPA 2GD1O 2XB6A 4Q4JB 3DCJA 3VR6A 1NF3A 3MYYA 1DAIA 1SUAA 1QH1B 3EOBI 4I0WB 4UNIA 3UGQA 3HABA 2IXDA 4RTLA 2O8BA 3RHTA 3IALA 2PFSA 3BSWA 4V2IA 2XKAA 3FZYA 1RWQA 4URYR 3ZD9A 3VPDA 2M98A 3JYLA 1Z2EA 5M34A 2C5HA 1Y5IA 3DM9B 5FOTA 4DMHA 2MSKA 3EMKA 5HQ3B 3ZHUA 4F8EA 3WLJA 2CJWB 4KQCA 1SA0B 4FOSA 5JS6A 2HO4A 3U5TA 2ZGVA 4QXQA 2ZSEA 4TLMB 5HZGA 2XVXA 3OHMA 4X41A 4XIFA 1WIWA 1QS0B 1ZPDA 2W8BB 3KKNA 4YLEA 5G1OA 1AVTA 3R7WB 3QPDA 4M2LA 2D6FA 2HN9A 3GFRA 1T1GA 4QE3A 4ZAWA 1VCIA 3NYIA 4MPPA 1EM8A 3BD6A 1E1NA 4OFXA 3TCNA 4P4NA 2J9FB 5LBUA 2JA2A 2AD1A 3TR5A 1MRNA 3GMIA 4YJ2B 5JECA 4NULA 3BWCA 1GPUA 3KG2A 1G8MA 1KFCB 1RLJA 4FR5A 3CEMA 4GYYA 3QKSB 3UG7A 5HZHA 4TWZA 4UEJA 2IPNA 4OHYA 1CJBA 2J0UB 1O5IA 2X4LA 4RD2A 4F6LA 5LA6B 2HH9A 1T4MA 1VLLA 3ND5A 3CVOA 4QO7A 4XIJA 4M6WA 4JUFA 4EB0A 3VC3A 3WLAA 5AQ1A 1IULA 2AEEA 2JGDA 1KZ9A 1R27A 2B34A 3LKBA 5FRDA 2OHJA 3SC4A 3TZKA 3VR2A 3JASA 3VZCA 2WZDA 3WLTA 4EI2A 3SSNA 2D4AA 1DARA 3B6EA 3RVLA 3TRKA 2WWIA 3NTUA 1GTRA 1G3MA 1YS1X 4J94A 2BUCA 2I34A 4X6UA 1Y80A 2ZOSA 3GQVA 1SD2A 3KEQA 4JEMA 1Y8RB 1E5VA 1FNDA 2NUPA 3ZE8A 3RFTA 1BYUA 2XVYA 2F4NA 4KYIB 4A0GA 3RUHA 4YRAA 1VCHA 4KVZA 3B7GA 2I6UA 4R9SA 3ANLA 3DKRA 1R18A 3EIEA 4XVHA 1U7PA 4ER6A 1EDDA 1I10A 4C0HA 3LKZA 3KR9A 1XDDA 3BBPA 2EXXA 1N4DA 1RJ9A 3K70B 1V6AA 1JI0A 3AU9A 2QL5A 3EGXB 3CWZA 1XK6A 5DX0A 3F6PA 5G4KB 4ABYA 1CS0B 4ZJYA 2WJJA 3FPSA 1DOAA 1AOXA 1QHHB 2RGUA 4D45A 4PXYA 1OFTA 4JSYA 4WCFB 4Z6KA 3D4BA 2R8YA 3PUJA 4K6FA 4ZOEA 3RUAA 3UANA 1WU8A 5DLQC 4DNOA 1E58A 1UPBA 2PIDA 3OI7A 2ZANA 3VPHA 2IYEA 3E8MA 3H4MA 1U31A 1JJ7A 1XMXA 4OPMA 2D2FA 1EWKA 4BB9A 1SWVA 4HXGA 5ICSA 4I9NA 4RIGA 4F12A 3EXFA 1C7JA 1DQRA 3FDZA 1YBMA 1GEEA 2GN4A 2RK3A 3KEFA 3ZLBA 2M6KA 1X0XA 2YASA 2QTRA 1JTFA 5JAIA 4RL6A 4E6EA 2LRHA 2AHRA 3BXXA 3FBGA 2YYZA 4CDNA 1U2SA 1WDLA 2WKQA 2YY6A 3H9GA 3V4LA 1NUAA 1QCDA 2O8NA 4IDGA 1ND5A 1VCNA 4B71A 3O38A 1T4CB 4LA4A 1IOZA 4LQLA 4RV5A 3SS8A 3TLAA 5JMOA 1DAHA 4REQB 5F51A 3T3MB 4LHZA 2R66A 4X3CA 4TV8A 3TI7A 1Y98A 1KY4A 4P54A 3STWA 4OJYA 3I42A 3AM5A 1UZMA 5KMGB 1FTQA 1QR6A 2Z1DA 4MUYA 1APBA 1X87A 3WADA 4DS3A 1KS2A 1M6VA 4PN7A 4R9NA 4DA8A 4DFDA 4BWFB 4NOMA 1NXVA 5ALVA 1FYDA 4UM5A 1JYSA 2G5PA 2WSIA 1JKXA 3QVTA 2PUDA 1INLA 2X9LA 4FOOA 1P4SA 3U3RA 5LZ5A 4B84A 4EZIA 4DSAA 3O8LA 2G8NA 4Z3OA 3KB6A 3QU4A 5K0JA 2YHSA 3FSGA 1FFCA 3K31A 4MRSA 3RYIB 2NZ2A 3UFBA 4Q6BA 2CK3A 4UNQA 1SKYE 4X7MA 1PW7A 4DCOA 1EP1B 4HZGA 1G5IA 5FOUA 1DKNA 1A8QA 5FPPA 2CDNA 1GFZA 2J31A 3EXG2 3X2EA 3H18A 1ACJA 4M1TA 4P2BA 2PBLA 2IEYA 4IIFA 3VVBA 1LKZA 4HTFB 4MTCA 1GZVA 1LLUA 1MABA 4NARA 1E2UA 1WG8A 5FV7A 3ZDEA 5IDWA 3L4EA 4E2YA 4IHAA 2C31A 1RYBA 4TLBA 2XA9A 2NG1A 5FTWA 2FEMA 1JEQB 5KO2A 4QO8A 2YTZA 4MROA 3B8EA 5IJXA 2AW3A 3DF7A 3QXHA 3GAFA 2PKQP 5EEHA 3NEAA 4G6ZA 2P3LA 4AKIA 2PMDA 1O2DA 3O8OB 3LHSA 4RGYA 1DG1G 3GFOA 4QOIA 5FTLA 4KXMA 2HV9A 3EVCA 1PWEA 1X7HA 3AHHA 1KKMA 1YKFA 4G24A 1X3LA 2GPNA 5KB3A 4Z9FA 1OCEA 5AHKA 4U2KA 1B0AA 3DW3X 4H7IA 4FMPA 3HDJA 1GPMA 1KQNA 4FFVA 3PDIA 2YIMA 1VMKA 3OFKA 1UKBA 1N6HA 4BU1A 4XGNA 5DHTA 1EUZA 3WL6A 4BNDB 3ENZA 5CYPA 4YJ2F 1CDZA 4I4TB 3AOEC 1DQSA 1WCV1 5JAHA 1OYVA 4RK4A 3FETA 3OZVA 1NE7A 1BCSA 1OFUX 3M6WA 4XEUA 4DJTA 4K05A 4EB3A 3PHJA 1ML4A 4O4JB 4OK3A 4E4YA 1YFZA 2CUTA 2I4OA 3CRW1 4RY8A 4AF8A 1ZUD1 3CPSA 3CW9A 4Y1RB 1V7CA 16PKA 2I2XB 3I9V1 1TTHA 1XTKA 3MFQA 5LN1A 1ZR4A 2Q1WA 2G7MC 3I4CA 5BWNA 4BKUA 3Q72A 5BVHB 1E69A 4F2PA 2QRQA 3FDFA 1J8FA 2IHKA 2P4SA 2PBRA 3PPVA 4ZYTA 5AJVB 1X9HA 5HJ2A 4A10A 2YV5A 4CVNA 4WZZA 5JV5A 1HF3A 2JLWA 3LF1A 1EMDA 1VE5A 1JQAA 4NBLA 1V2HE 2HSWA 2I2FA 1E2LA 2PMBA 2D00A 3KQNA 2O54A 1O96A 3MGCA 2XKJE 1FP7A 1LJ8A 3T7EA 1UAGA 2PL5A 2GFQA 2CMKA 1LBEA 1M1UA 4UHEA 5T4EA 3TZCA 1XLVA 2JFHA 4Z8XA 4R5MA 1Q2XA 4JJ6A 5TMPA 2HBZA 5J47A 5LD2C 5FQOA 2BR4A 1VPEA 5BV7A 1E3LA 2JKZA 2UZ1B 4TL9A 4QL3A 5L40A 3D3KA 4ARVA 4UJ5A 1NI3A 2AK2A 2MINA 1JV2B 2AF4C 3ODGA 1R16A 2CJFA 2OG2A 4W5JA 1OT5A 4WKBA 4D3ZA 5JJBA 3BH6A 2JFPA 3DH0A 1XZGA 1SQFA 4BVGA 3UAWA 1GRRA 3WI7A 4M1ZA 3QMWA 4UHFA 2B61A 5B53A 1QO9A 3ZCVA 2IZZA 5BPFA 4PC3A 7GPBA 1FK8A 2AUNA 5JXJA 1YMQA 2C9CA 1ZAYA 1DKMA 2BFCB 2VPZA 2PGDA 3FPAA 1BMFD 3N2GA 5K8TA 1JDBB 2VL7A 4LNAA 3I4FA 4ZYWA 3RRZA 3DD5A 3NIBA 4TMYA 1C0IA 2PSDA 4RA6A 4RDIA 2XMSA 3RC9A 2CMGA 2O23A 5HRCA 4MW6A 1IZZA 1JJBA 4UMEA 5JWOA 2A5LA 3IP5A 4PCUA 4RZQA 3A6JA 3S29A 3R41A 4MR8A 1L5NA 1HE2A 3OZTA 1VLVA 3QGMA 3IHWA 1H1LB 2RCNA 1JU4A 2HJ9A 4RYDA 5AICA 1WUHS 2JLQA 3TXXA 4A91A 5A9SB 5B6IA 5AVZA 1AC5A 4A8JA 1FMFA 4XYGA 4ZQIA 2ZWAA 2ZJBA 4NV3A 2J0QA 4TX1A 4HRVA 1CTQA 2LD4A 3B6KA 1UFOA 1QVZA 3MBKA 4OATA 4LF4B 3B3GA 3N0TA 2O7VA 2ODAA 4YUAA 3THWB 3ELDA 3FMGA 4XFJA 1NC3A 4EWLA 3GRUA 3OCVA 3ZV6A 1IN1A 4G5SA 2AFRA 4GOLD 5BSUA 1KMNA 3VTZA 1L6RA 4M76B 1E9FA 1PJ4A 1ZU5A 3HXKA 1Z82A 3PXCX 4LBWA 2AEMA 1JIQA 2O2YA 5DOZA 3CLRD 4MQEA 5ITZA 4AMGA 2X7XA 4GXNA 2DQZA 2PD4A 3ZE9A 4EZEA 1HSZA 5CTAA 3BXGA 4C6HA 3P9RA 3NONA 1NVWQ 4Y6OA 4ZQEA 5EZ5A 4GKVA 1XXLA 3BXOA 5IJWA 5ED4A 1N5LA 2BLNA 3FYSA 4WXYB 1KDRA 1LPSA 2XDQA 3A26A 3QKIA 2G63A 2WHXA 4G3XA 5JBIA 4DMFA 4UNNA 1IWPB 2GHRA 3Q2IA 4BP3A 2ZUEA 4OL0A 4LHEA 1L4HA 3AEKA 4LK2A 4LFBB 4JLBA 5HS4A 3Q7QA 2QUAA 5LU8A 2PJUA 4JJZA 1RAHA 3ANNA 4K87A 4KWEA 4B3BA 3LX6A 3ZXSA 5HIIA 1ZG3A 4RGBA 1WKCA 1UBUS 1X9GA 1ZUIA 1M0SA 4LX0A 2WFAA 4ZK2A 4TTPA 4OP2A 1JYFA 2Z09A 4MR7A 4TTJA 4WQMA 2IEDA 2ZM6B 3C39A 1H22A 1JRLA 4DLRA 4R2JA 5D7BA 2NPFA 3L8ZA 4I4NA 4F8YA 1V8ZA 3DL7A 3DFKA 4IWNA 4EEKA 5D1NA 3HBNA 4LC1A 3FHCB 3L0CA 4GI7A 1VSBA 4H16A 4MCHA 3GPLA 4Q37A 4WNAA 4GICA 4DIUA 3R8FA 3DLPX 1QO0D 3A0UA 4I5FA 5GJCA 5CD9A 4KTTE 3LDAA 4M4SA 1TVKA 1ZN8A 3II6X 4RZSA 1K97A 3WIEA 4JKOA 1VB3A 1Z16A 5DRTA 3T6KA 1RYMA 1LK0A 3C74A 1GG5A 4GXQA 4H0FA 4I4TF 4TMZA 4YRKA 4GD3Q 3SJ7A 3KEMA 1C9YA 3LCVB 5J4KA 5EWLA 3EEIA 2HXGA 3TTTA 3W8EA 3OE4A 1K6EA 3SQLA 3RFFA 3FN4A 5K3DA 1ILEA 3WO1A 1T5DX 1DWOA 1W1WA 4IVRA 1IHUA 3X44A 3M34A 4HDNB 4B6GA 2IE8A 2HLDD 4EY4A 5C9ZA 3K70D 3OX2A 2AOUB 2EX4A 3ZK7A 3VA7A 3G1UA 2QR2A 1SKUA 1G17A 5ECWA 3OX1A 1NF8A 3OPVA 2PE5A 2QUZA 5C1IA 3O5AA 1QKKA 3A1VA 4UUAA 5EYPB 2JDID 4DLXA 4MS4A 2PT7A 4C4RA 1MR3F 1AUOA 3ANMA 5T4HA 1R6UA 5B7GA 5AVXA 4IOMA 2I3GA 3JD2A 4L72A 3GT7A 4WE3A 1CNEA 1WXHA 4QDOA 5TQ0B 4CL0A 2O59A 1WHSA 2PGLA 2OCBA 3KQSA 1EK1A 3PHHA 1PDOA 1V1RA 1A9YA 3KT0A 1GNQA 4UDNA 5A4FS 2IYSA 1CRWG 3C16C 2QYTA 3K96A 3O1LA 4Q4AB 4ND6A 5EE3A 4IM7A 4PTYA 3DFFA 4EYEA 1Z13A 1BVRA 2Z43A 4Q47A 4GAEA 1R15A 4YALA 3MELA 1A5SB 4HS4A 4TTRA 2QMOA 4FHCA 1CR0A 1XCGB 3ER6A 3OE5A 1SIUA 1XXHB 1JBQA 1SULA 2BEJA 1YBAA 2H29A 2NXEA 3NVAA 1FFGA 4LDNA 5FL7A 1H6CA 4AD8A 2AFHA 3IBSA 3DWGA 1F8YA 3HV0A 3LNCA 4QEZA 4DCNA 3L0PA 1L7RA 1G41A 1KO5A 1U3VA 2EGHA 3ZQ6A 1IAQA 3UJDA 2CV1A 1NFQA 2K7ZA 3VDNB 1JFFA 4JFAA 1RBYA 2J3IA 4CU5A 2QXYA 2WJ3A 4JOSA 3QMPA 4Q7MB 1DKOA 2PLFA 4GSLA 2H31A 1SXIA 3SKYA 1UEXC 5TLSA 4OYYA 4R1NA 2A2ZA 1TQ4A 3E3LA 2HF9A 3F8WA 3EVGA 4MDYA 3TRHA 5GJVC 3NRJA 3UMVA 4IILA 3BRWD 5FAKA 1S8NA 2H0QA 2R86A 4CF5A 2NPIA 5DNVA 3O9ZA 4UVEA 2FI1A 5KYWB 1YULA 2WIBA 2ZIUB 3IO5A 3ORRA 1K66A 1R4MA 1ZJJA 2OC4A 2WVJA 1HE1C 5T4BA 5AKXA 3AETA 1YC5A 1RRPA 2BMAA 5ETJA 1ZI9A 2NYUA 3NT5A 5JFTA 2CXOA 2ID8A 4ZV7A 5A71A 2H4WA 4MKXA 2CNKA 3PTLA 1N2HA 1I9CA 3DBVO 2VBCA 4JLSA 3ASVA 3AYXB 1O08A 2Y1EA 1W29A 2ZYGA 4A6PA 3VVCA 2CL5A 3NAZA 3NVKI 1W85B 5JWHA 2IW3A 4FMCF 4V1CB 4K3VA 5KVAA 3HB0A 5L3RA 3WFIA 2H3EA 3TPCA 2Q3CA 1N2BA 2BEVB 2PSEA 2WSYB 2FN7A 2FNAA 3N8IA 3H2IA 4PAOA 4UVHA 4CM4B 2XIJA 3D81A 1G7RA 1RLIA 5I4BA 2ALJA 4J0DA 3ETJA 1WXXA 3G8CA 3HS3A 1BJTA 4TKMA 4M0PA 2H1OA 5EJ6A 2F1IA 3WBJA 5AVSA 2ZAOA 1AQ6A 4JSRA 2PWZA 2RJOA 1XN4A 5E1OA 4TPKA 4ZHQB 1WBJB 2YJZA 2PRJA 3GF4A 2OORA 3OZ7A 3G02A 4IIGA 3ZY3A 2V7PA 2RE8A 5D01A 3T7JA 2Y92A 1PG5A 5DHQA 3T1OA 3T1HB 3PC2A 3QZUA 4UQPA 5JXGA 3VV2A 1LLDA 4AJ9A 5AH0A 4HFMA 1JEYA 1MHPA 4TRNA 1NLYA 3F3KA 3I2GA 2DKOA 1J23A 1R2QA 1CUXA 2EZ4A 3WGGA 1G8PA 1T6ZA 3OZGA 4MARA 1LF5A 1BRTA 4R8SA 1G4UR 2Q2QA 2QRVB 2AYXA 4IVQA 4QOSA 5TB5A 5E4JA 1VIDA 4H4EA 1P3JA 1ZJZA 4CFZA 1ABBA 1KEEB 4RFSB 1CUZA 2GAFA 2CNLA 3Q5GA 1KPIA 2EC5A 2ZB3A 2V54A 1HKUA 1JUDA 1ZIYA 1WB4A 3AI7A 3P2YA 3PUKA 4EI8A 1E77A 2Y1FA 1GEGA 3PA8A 1OVMA 1Z36A 2JKYA 3OX4A 4Z0NA 4QJ3A 1JDSA 2VUHB 2IXGA 4R8KA 3T06B 3LGXA 3LAWA 3BXZA 4EB6A 1QNLA 2GYUA 3ZZUA 5KWIA 3OFSA 1DC5A 4Q48A 1QGDA 3RTDA 4CCWA 1I2CA 3PC3A 2I6QA 2X3YA 3AVUA 3ZHYA 2IP2A 4HNVA 1IWOA 1L7NA 3BL6A 3QWAA 5TR9A 4UZSA 4ZI7B 3PUHA 5C46F 1TTPB 2O2HA 4Q1FA 4FFMA 1EWRA 1GGEA 2OFPA 2C04A 4HDKA 4ED9A 2XQVA 4MW1A 3GN2A 4JV5B 5LJIA 1ATZA 1SMKA 4K6GA 4ZJUA 1VJ5A 4D9JA 2Z2JA 2OXTA 4YCAA 4LF7B 2HQOA 1QDUA 1Q21A 1P9OA 3EDMA 4OD0A 5I51A 1II8A 1MAVA 4EJSC 1NWCA 1UZAA 2IEAA 3LLVA 4MV3A 4UOQA 4Y2QA 4IFIA 2ZI5A 3F47A 1YL5A 7MHTA 3TFWA 1NSTA 3O1JC 3FYTA 3Q3HA 1K2WA 3VDRA 4P3KA 2FQXA 2FRVA 3TW0A 2O6LA 4KXXA 3L4KA 3DUFB 3OZWA 2BT4A 3CMCO 3BF7A 3M6IA 4BX8A 1LX7A 1T35A 4EPXA 2O8CB 1CFZA 1M2VA 1W9HA 2BMEA 2WHQA 3BWXA 4K0KB 3QQPA 2XUIA 3D0RA 1RXSA 1JWAB 2LVBA 4IGEA 2IS1A 4RKRA 3V32A 1ZHOA 3G85A 4XQCA 1RRVA 3PVZA 1LF0A 3PYMA 2HQRA 1M67A 2O50A 3I39X 4L6AA 2ZUUA 3LO5A 5I01A 5DO9A 2H7YA 5HF6A 4F5WA 3EIWA 4UTOA 2XYGA 4KV7A 2NSJA 1SVNA 1J9ZA 3DAFA 3T7AA 3ZZNA 2WTNA 4F92B 1ZFNA 4LCEA 4C89A 4TQGA 2VSXA 4B6FA 1HE4A 1RHUA 3ASYA 521PA 2KSQA 3GGCA 1ONPA 3A36A 5CIQA 4CL8A 1W2WB 3MMXA 4J76A 2G5CA 2J4CA 1PE0A 2XMPA 4B2PA 3HJRA 2FRXA 3M2TA 3VO9A 1DEHA 2AFHE 1K08A 3C43A 3EF3A 4FWIB 3QEBZ 1WZCA 2H2HA 3D3WA 1O87A 1DCFA 4UCQA 2NXCA 4MSUA 1GYPA 2WHYA 3RVSA 1DZ3A 1Y5NA 2DB3A 1DBVO 2E7ZA 3HN7A 4FTWA 2B94A 1L7VC 5FIUA 4JU9A 4LDQA 2YZMA 5ALPA 1LDEA 4TT8A 4X5OA 1VBKA 2J09A 1O8CA 1EFRD 5JANA 2FZLA 1WUJS 1EUQA 5CITA 4AUNA 4V2UA 1ZZEA 3G2IA 5BUQA 2HJRA 2GAJA 2X0IA 1G8JA 1V4NA 5DLYA 5JO9A 4ARAA 4QGBA 5DBHX 2FAXA 1T4GA 4DXDA 3LSYA 4RZ3A 1VMDA 1Q15A 4AVYA 3AR2A 2DEUA 2C7GA 2O7RA 1UR5A 3V4ZA 2ZXFA 1XD8A 3PVSA 2CLLB 2GPYA 2ENUA 4JGIA 5CDGA 2V0CA 5F5LA 5E4YA 1Z0JA 4KX3A 3IUQA 4HAUA 1T5HX 1POWA 5DYNA 1GQ2A 5BWMA 1JVSA 3WOVA 4EBBA 4KAJA 3KSMA 4QG7A 1HGXA 4KC0A 4CKWB 4DA6A 2GGSA 2DM6A 4HB3A 3GZTB 2FPUA 2REBA 3VNBA 3T61A 4C0QC 2E4YA 2QSUA 4P3XA 2NLOA 3W3AA 1ZNZA 3N70A 2OCYC 5B3KA 2D7JA 1T8WA 3QKTA 4ZHQF 4B7AA 3ESCA 3I1JA 1XELA 1UM8A 1NW7A 3DBOB 1CX9B 2JJQA 4EFKA 5K3SA 5BOSB 1EX1A 3UTCA 5KTKA 1VL6A 2BGNA 1U2EA 2XCOA 5TT1A 3SR0A 1LTHR 4J91A 3ZNNA 2I1LA 4D6XA 1QZTA 3DCIA 4B0PA 3T1TA 3C7KA 3ND8A 3BJZA 4GGPA 3HJTA 3IO3A 1KDZA 5JH7A 1S7GA 4D9EA 1LQTA 5JRDS 3SXPA 2AOTB 2K6GA 3VSAA 3GUCA 2A67A 4A6EA 5KJFA 4TWRA 1NMXA 1NW6A 1Z88A 2I9PA 2JJYA 3WLLA 2CYAA 4OAPA 3R9XB 2GCOB 4LY9A 3QE0A 2AK3A 5EMKA 4DJEC 4IQ0A 1LZKA 3NR2A 4IF4A 4L4ZA 1L8AA 1K5HA 2ANCA 2PX3A 3HYNA 4KQJA 3RQIA 1ULBA 2WF6A 3WLEA 2R1TA 5K8IA 2BH2A 1I0IA 1FCJA 2JFVA 1O6CA 2VTKA 2ZRKA 4GECA 2R84A 3EPLA 3G6WA 3V2GA 2X4DA 3FI0A 1SB8A 5C8YB 3KPWA 4WNIA 3QA9A 1F8FA 4XOIA 4ZTUB 3RRFA 3AOGA 3OOJA 3AR5A 3SZOA 3DEZA 4E31A 3G8AA 3WKDA 2Q6VA 3D6FA 3K9LA 1AXEA 5KQMA 3TMKA 3HXQA 2I3DA 2DECA 2EJUA 4OM8A 3JWHA 4DV7B 1WXFA 1X8KA 2HSZA 5TARA 4BUJA 4DCGA 2FTKE 3KJFA 3M82A 1XMJA 4C88A 1TK2A 4MO2A 2H9AA 3OAAA 1ONBA 4LZWA 4J49A 3K1JA 4UREA 2BSQA 1AB5A 1G1MA 4ALJA 3OZIA 4ERXA 3KL4A 4WHMA 4H15A 1DMSA 2VRWA 4II3A 3LGSA 2FPOA 2HA6A 1F48A 1VE1A 5F1PA 5I7UA 1QRRA 3KR1A 4GOJA 1AGNA 2ZTLA 1Z2PX 1KQ3A 5TGTA 3EPRA 3PQCA 3HJBA 1GUAA 2UVQA 1GN9A 4LYAA 4OSPA 4ANFA 4MULA 4AMUA 3QHPA 3O6VA 2O4CA 1MO4A 4M53A 2NX2A 4BLSA 5A4AA 2AE2A 3UH1A 3DE6X 1JEDA 4FEGA 4G4SP 1X7ZB 4I14A 2ZRPA 1NXPA 4PBTA 2FUKA 3WMFA 3INRA 4Y9UA 1ZEJA 3C1AA 3CZQA 2Z3VA 4Y2PA 5E7IA 3W7BA 4BX2A 2CB0A 3JWGA 3UT5A 1D2RA 3IT0A 2FDCA 1D1PA 2CNBA 1JU3A 3IBFA 3WYCA 1N1MA 4PIPA 3ZGZA 3I6BA 5EIEA 4PHTA 2D1TA 4JA2A 3A0RB 4GT1A 4RO0A 4KLNA 5CH5A 3VO2A 5JXHA 1EIZA 2JJ2A 2KS6A 3HVHA 1KQGA 3HWRA 1BXRB 3GJZA 4MJ7A 1ZRMA 4BAZA 4LOIA 1TEVA 3C7CB 4FIZA 1U9YA 5E7JA 1I3MA 1MB9A 1DAMA 2WD7A 1U0GA 2XXJA 2WOJA 3PLRA 4MRAA 5LMZA 4UULA 1IONA 2YC2C 2CFSA 4G8BA 2QQ0A 3HTXA 3L1VA 1ZN7A 1AS0A 2R2GA 1BVUA 1FDUA 2O0LA 1MC1A 1TCBA 1SXJA 3HKCB 3ROEA 4CMGA 4R41A 3GLFA 3FAZA 4I1OA 1Y37A 2P2LA 4PO3X 1C1YA 4TSKA 2IGTA 3U4MA 3U7QA 4QC2A 4HQ0A 3OEYA 4L57A 4L4UA 1GVNB 4JP8A 3LVQE 2FK8A 1RWOA 4H08A 2QPOA 5IJZA 1KJIA 1PBTA 4HDOB 3LPCA 2IHJA 4C01A 3M6XA 2XCUA 1QXSA 3MQ2A 3QBJA 4DW8A 2F3QA 3H8VA 2DHDA 4I9HA 2NQTA 5CFRA 1WQ1R 5DYYA 3GJRA 1AMOA 3VKHA 4BO6A 1K8ZB 5KOHA 4LNUA 1ECBA 2NAPA 3DMRA 4XSGA 4WEOA 5KNDD 1GDTA 1E1YA 4RF4A 2N0SA 2Z4SA 5LWHA 4BDSA 3WYNA 1H0RA 3QKRA 1LDBA 1TQHA 5JASA 5FB3A 4H0CA 5L4LA 2NPOA 3TZEA 2RGNC 1IK6A 1PL7A 4CQJA 4B5KA 4TTSA 5ELXA 5CPBA 4GGOA 4CT4B 4KIUA 4DRXA 3JVDA 3GIDA 4G0WA 1GFIA 3JS5A 3QEMB 3COPA 4HN2A 4IGKA 1ZJWA 4N7BA 4GLBA 3DS8A 1KH2A 4BFLA 1Y1QA 2ODQA 1GG9A 2ZRMA 2VSQA 3GG9A 5EINA 4XEHA 4B8ZA 3ZWKA 3PNQA 3ZV4A 1R4NB 3FAKA 4IIHA 1K8QA 3CKYA 4KR0A 1T6YA 1XAJA 4HGQA 5CVJA 2R00C 2X19A 2XGSA 2VNKA 4HWOA 5L4SA 4POOA 3FYHA 4P4LA 5L3SB 1KBQA 1PV1A 1WDKA 4HAIA 1YB6A 4G0NA 4XDGA 2VNHA 3P96A 3TKLA 1HT2E 2HEIA 5C2JB 2ZYVX 4NESA 3DJFA 4ZXFA 3UJCA 3WYBA 4EHLA 4G2NA 3U6KA 3VH3A 3MB8A 2YXDA 1T9CA 3EEBA 1VC2A 5ITZB 3L04A 4G65A 3S2GA 1TJ3A 1GD1O 1IC6A 1J5EB 1P81A 1MDFA 5CLIA 2X13A 3M6LA 4PAWA 3KLPX 1HMYA 1XZMA 1P0MA 1QDLB 1AJEA 2DHEA 2HSGA 1WQ3A 2J6HA 3OCCA 3HZZA 3KQUA 2BFOA 4ZVMA 1JPVA 3S2SA 1Z6TA 4N5HX 4EYGA 3DQQA 3HH8A 3CUTA 3HGTA 4MKIA 5FI3A 5C8YF 3OQMA 3WJAA 2Q4BA 1V2GA 2YJGA 1U3FA 3BRCA 3QXGA 4D5GA 4LVNA 5KNCH 3UCFA 2QMZA 4Q24A 1TZMA 1YZGA 5LQNA 4BNWA 3ZX4A 4MNTA 3QYFA 1WB5A 1B8OA 3IRUA 2A1UA 4RJKA 1EH5A 2PUGA 1PN3A 3HKBA 5AW8A 1VRCA 3A6ZA 5ICFA 2LW7A 2HF2A 4QELA 2FWJA 5E38A 5K0CA 2EFDB 4NZ9A 4RPHA 3SVTA 4HB4A 4BNHA 5EUMA 2WC1A 4F46A 4BIIA 2BR5A 3G8YA 3R7BA 1XEXA 4UE3S 3U4GA 2JLUA 1DV2A 1GWNA 5JSZB 2N75A 3MJTA 1PWHA 4PZDA 5ALMA 4YCBA 1GZ7A 1FVHA 1E1RA 2ZSDA 5CA0A 2QTFA 1VHLA 4DBZA 2FU5C 2WZCA 1PR6A 4D4LA 1Q57A 1RKUA 2FPIA 3BEOA 3YASA 3O3NB 1Y4ZA 5TF0A 3E4DA 4N3CA 5E1MA 1BAPA 3Q3VA 3AUKA 4MQ4A 4DMRA 3D6VA 4LKOA 3C7TA 1L3BA 1U0TA 2GTHA 2A1TS 1Z2OX 2YL2A 5CP8A 3Q9NA 1ZCFA 4Z99A 4HATA 3KEOA 3M33A 2W2VA 3GO4A 3QX7A 3OZEA 3NDJA 2JH8A 2XA2A 3MCTA 3C2QA 3EXEA 4XRRA 3VOTA 1MUUA 3V8NA 2C7RA 3WDKA 2FSVC 4OMFG 1NJGA 3VR4H 3CN9A 1X7WB 4QUHA 2GEBA 3PJDA 3PJFA 4OB8A 4BNJA 3WG9A 2PX4A 5I7FA 1IN7A 3C87A 2PZLA 4HEQA 5EIXA 3ZS8A 4JP3A 3L8GA 1OX4B 1US8B 3FUXA 3HFSA 1O1YA 3KUKA 3MAJA 5JVDB 3RIGA 1OTHA 4BVFA 4S3MA 1UMDA 5D86A 4BEJA 1YCHA 2FP4B 1RHKA 4M1QA 4AXXA 3M4NA 1AHNA 5DP1A 2ZPAA 2VR1A 4UNPA 1FDIA 3AUXA 3NEJA 4CW7A 1T0IA 1XNRB 1JP7A 4XM0A 3S5JA 821PA 1L7MA 1A9RA 3EY9A 3SFVA 1V9SA 4EATA 3QPCA 5CLFA 1WUTA 3CF6R 3TFOA 2VNJA 5HR5A 2P65A 1V0JA 3C0KA 3DVQX 3TAXA 4F7WA 1W8IA 3AI1A 4AY6A 3BIFA 2Y0CA 4ZVQA 4MHSA 3EVNA 3PXAA 3WRXA 4EHKA 1M2EA 3MW8A 1Q1GA 1SXJE 3ZU2A 4Y6PA 3GLFE 2WF5A 3OWXA 4QODA 5MFZA 3HLKA 1NZFA 2JFGA 3KPUA 1SEPA 4H27A 4IYJA 2INGX 4PSCA 1E1KA 4EGJA 4EJ6A 5JQGB 1AHPA 1SCQA 3L5KA 1GP2A 4E5SA 3QVXA 3WNCA 1JBKA 1L4GA 3KCQA 4HWTA 5EXSA 3SPXA 3UMSA 1PGNA 2XUAA 1Y3FE 2PYIA 4Z7OB 3CB4A 4JUCA 5JSQA 1P39A 2Q8NA 4HEJA 5IMSA 4H1UA 3Q5EA 1SZPA 4LOLA 4EY8A 3RTEA 1UXKA 3NWBA 3UJ8A 1NSYA 2ZS8A 2E37A 5G0TA 1TECE 4A2CA 3V7YA 5C18A 3QE9Y 2O52A 2HSDA 1F4VA 4QGAA 3G2KA 4MV8A 5EIWA 1WXDA 1AKMA 1YAHA 5HYVA 1CEXA 1D03A 1ULZA 5B1HA 3KKPA 5D87A 4YYEA 4HNQA 1Y9ZA 1NJ1A 3K1AB 2DBVO 4B4WA 1N5KA 2AX4A 2H9IA 2W48A 3BGVA 1R8QA 3AK4A 1T0UA 1F8XA 3FFTA 3NS7A 2Q8QA 3AEQB 5AI9A 1JQLB 3NBZC 3WNBA 3V2HA 2AFIB 5KPDA 3NOQA 3MUOA 5CYGA 4E88A 2HMAA 5EE5B 1E89A 2W2PA 3JU3A 2R1ZA 4P7BA 3ELWA 3FZEA 4G9BA 4WN9A 1E5XA 2E89A 1V4BA 1H5NA 1YR2A 3Q8XB 1FRNA 2WAOA 5IJAA 3L0IB 3U1BA 2B1JA 3M6VA 2W5UA 3DT8A 4O6VA 4BE7B 5F7JA 2UDPA 1FUEA 4RJ2A 2NSLA 3CINA 1RM3A 3F2VA 2F9MA 3T12A 1X74A 2NTNA 3OETA 1VKOA 2PZJA 2QR5A 3DDZX 4Z2YA 3OCXA 5SZJA 4CUJA 1G60A 2YJ5A 1YDWA 2J9ZB 3P2IA 3D5EA 3ENNA 3T1QA 3EFOB 1SG9A 4GBJA 2JIBA 2Y77A 3D59A 5DLDA 3KJQA 4B6SA 2G17A 3TS1A 5DMHA 3ZBQA 3FVQA 3TBKA 1EJBA 3IIMA 2Q5HA 3RIYA 1C3OA 2HIAA 4O2AA 2YUTA 1I7PA 3MUEA 1UPTA 2IH4A 3LHDA 5EFZA 1ARZA 1Y1RA 4RDCA 2H2DA 3N39C 2B4AA 2XTZA 3QU2A 4RV4A 3AJRA 4QXPA 2I4TA 3UK6A 3ZPXA 1PUJA 1M1NB 1EG2A 2PU5A 2YRFA 4Q3DA 5LQMA 4QNNA 1FDRA 4NMMA 2ZXUA 1XL1A 4C87A 2AOXA 1T43A 4JWTA 1Z06A 4ZOBA 3K3PA 3VH1A 3WVNA 1LSJA 1QRSA 1VE7A 4G4JA 1Z7BA 1E1QA 3F90A 3C3XA 4KWHA 2EQBA 4NS1A 4BDTA 3HO6A 3PEWA 4EQ6A 3RVRA 1UFRA 1UKEA 3PFKA 1TYAE 5D3MA 3EMVA 2C2KA 2JFYA 4LRTB 5IW8A 2QAGA 2HZBA 3VR5D 2FZCA 3JCZA 3LQ2A 3L8EA 3PCRB 4AQYB 2PWYA 1REQA 3GYBA 4JI8B 1OYWA 2XHZA 4IV0A 1FXSA 2IUYA 1ZJ5A 4CLEA 1UBTS 1HORA 3K1ZA 3P0EA 3C7DB 4CZ2A 2PT9A 3RARA 4CU2A 3ZD7A 2X15A 3HBAA 4H3KB 1HDZA 1ISPA 3JQPA 1Q3KA 4HX5A 4NICA 4JI1B 2W6ZA 3KHKA 5TQ2B 2AC2A 3H0EA 4PIMA 1EA5A 2CL7X 3A1DA 3E82A 4R3NA 3B5IA 2Y05A 3FGOA 3HCRA 3PDCA 4DABA 5LD2B 1R0RE 5ARBA 5GINE 4HYTA 2P2NA 3BWMA 3I6ZA 1KMHA 5M29A 5BOVA 3CA8A 1YKGA 1TO6A 4FKMA 4H1HA 4FK8A 4M8LA 1XZCA 5KSYA 2PKQO 1LWOA 2DUJA 1QGZA 2V8BA 2GETA 4JLUA 4PG5A 2V1XA 3DXXA 1JA0A 1EXVA 1J06A 3KZNA 4XX0A 4FX2A 1E2EA 2CZCA 1HT3A 3DE7X 3R77A 3AZOA 4A0SA 2IH2A 2ZRJA 4B3GA 1VG9B 3JTMA 2OGTA 5TS2A 1KE1A 2PJRA 3CG0A 1BGXT 4WNCA 2C84A 4G1MB 5K45A 2JFZA 1IPFA 1FZQA 3QK7A 2V4MA 5HXAA 2W90A 2LCQA 5CA1B 1YB5A 4FOPA 3HJAA 1A9PA 4TQ9A 3P4XA 1N6OA 1NMSA 5ADWA 4LJKA 1P18A 3GJ3A 4BEBA 2PEZA 1HETA 3BFVA 1JR3D 3PXBA 4I4CA 4RQBA 1LDYA 2VXOA 5ENDA 1P62B 4DXHA 1V16A 5THXA 3WLSA 4E33A 4UDXX 2XGGA 4B79A 1W87A 3UATA 4FN5A 4OHZA 1TC2A 2FZWA 4EGAA 4OLAA 1RZ3A 3RBZA 1YR6A 3K2BA 1E61A 2P9YA 2HK7A 1KPGA 1T2CA 2PVCA 5IANA 1M33A 1E3WB 4HYQA 5CLGA 4HWKA 4AYWA 3OESA 1RZRA 2I7DA 5L53A 5DW3A 1NOKA 1RWNA 1EFPA 5J2TA 3CNLA 5HOQA 2CFCA 3BVPA 2YHIB 1NLUA 1RBZA 1NW8A 1G7CA 4ZVLA 2QTLA 1ESMA 3U16A 2JFFA 5FFNA 2HDHA 2JH9A 3M5CA 2WU3A 4I08A 1SU4A 3AM4A 3WLHA 1O6ZA 3P0IA 1YJQA 2R6DA 4G0UA 2N46A 3FIJA 5BSRA 4YT4A 1PFUA 4C7VA 4RMGA 4UCXA 1KFBB 4RV9A 3DMTA 3GEMA 2SKCA 1MNAA 4CKEB 3GJXC 3MGBA 3ZZ0A 1CNMA 4ALMA 1JLRA 3CEPB 1AD2A 2C4MA 2OM2A 1H9AA 1YRYE 3E7FA 1ESCA 1Y5RA 4EW1A 5ALTA 1GLGA 2YWGA 2ZUWA 3L1UA 3E0QA 4FYJA 4U7GA 1EVQA 4WFKA 5FI0B 4LNHA 5I48A 3T0GA 5I7WA 2P6NA 3ZBUA 3D7KA 1AKRA 5HF5A 2RG7A 2C94A 4C1BA 2RIPA 4K6OA 2IU0A 4HNAB 5B3LA 4ZDKA 3L18A 4RHTA 5CRIA 3OIUA 3WRVA 3NATA 3HVIA 1NBEA 3IOMA 1E60A 1QHXA 1WCIA 2X86A 1PL6A 3SYLA 3U1TA 4TSFD 1SC3A 1EEXB 4XFKA 4BVBA 1T2AA 1KPHA 3S28A 2XKKA 1TO1E 2FJ0A 2H2GA 1NYLA 1OX5A 2ST1A 2Z1MA 4CDRA 4Q34A 5EXPA 1QOZA 2BFEA 1EVEA 2WYHA 1XA4A 1XYYA 2J48A 2V45A 3CWCA 4M8IA 1K0FA 3HJNA 3VMMA 5HIAA 1JEEA 1V3VA 3B6MA 1N6RA 2XZOA 3RLFA 4ZPXA 2OBYA 3LYAA 4C0WA 2POCA 5K03A 5BSMA 4DLVA 3ABZA 1XEFA 5DWVA 1GY8A 2I2AA 4OEHA 3SHFA 1OAOC 2P78A 3W5JA 3NKVA 1E2FA 1P91A 3VC2A 4E94A 3Q0EA 3ZH9B 1MW8X 4ASUD 5DI3B 3H9BA 1NQXA 3KYIB 2NZYA 2O05A 5AD1A 2YZNA 2I2WA 3GA7A 3X3HA 5ERXA 3EGOA 1YTLA 1YZUA 3G23A 1VKNA 3RHFA 4UARA 4QVIA 1HZZA 4JLJA 1YBFA 5EP1A 2CW5A 4MGIR 4WECA 4TM8A 2EGUA 3MC1A 2IDKA 2WHRA 1OA0A 3FFAA 3NV9A 3CZ4A 3IVCA 2PUAA 1EVJA 3EQ2A 3EGWA 3LFTA 4IIVA 4CCAA 4ARCA 1TT7A 1PGQA 2BFBB 2CN1A 1S0UA 5I4IA 1DX4A 2FY8A 5KDDA 3LTNC 1Z7GA 4A8JC 3BEDA 2FW6A 4U2EA 2H1CA 2PRSA 5AKYA 3UYKA 3EEQA 3LUJA 5EGNA 4KQMA 4LPKA 5LQJA 3P27A 4GMFA 3BFXA 1EFDN 2RH4A 4GC5A 4M83A 1RXCA 1TIBA 3GI1A 1R10A 1VOTA 4EG7A 4ACBA 2EJVA 4TYNA 4XWYA 1FP4A 2Q6LA 5JD3A 5CUQA 3EGCA 4MVJP 4QEKA 2PMFA 2QP9X 3A14A 1BN6A 2VWPA 1CE8B 2BWJA 1DJOA 2DFPA 2GD2A 5FBRB 4BNUA 2E4ZA 3BL8A 4P3YA 4DTCA 1I4OA 1F6DA 2WLSA 1S3GA 2E2WA 2QQGA 3N7AA 2XY4A 3FWYA 3IJ5A 3EJWA 3LKVA 5K51A 3QBTA 3RIEA 3D2CA 3GGDA 2Z2XA 4X00A 3SMVA 1AA9A 1N75A 1X1DA 5FWYB 3EZFA 4OP3A 3VU8A 2BI8A 5EJFA 1RYNA 1KAOA 4A8TA 3W5DA 1H05A 3U3DA 2FWNA 1DXHA 1RBQA 3RAPR 4CEJA 3LPDA 3IVXA 1ONSA 1K27A 3FCEA 1TRHA 2JI7A 3PE3A 4YXWD 1SRRA 3QELA 2DULA 1DIGA 3VHRA 1T10A 4JC4A 4Q19A 1F14A 3CRRA 3DHWC 1JI3A 2Q50A 1IAVA 1JAIA 2BEUB 1F17A 1BU8A 1GFSA 4P4SA 1TI7A 2AMJA 2IXFA 1BD4A 2XOKA 3AJ9A 4IXMA 1HKHA 2B3DA 3SC2A 4IGFA 3ASUA 1JB9A 1KI7A 4DCSA 2XMQA 4FFPA 4FFLA 4UZFA 5JR3A 1ZH2A 4IZ6A 4YAFA 1N6PA 5AI6A 3WL5A 1BKDR 2O2ZA 3B6IA 4V0NA 4ND3A 2I0FA 1Z4NA 1DDIA 3UW3A 1QIJA 4YR9A 4E1VA 4R71A 2X76A 2PXAA 3T7CA 3SZLA 2QTNA 3OPYI 1FUKA 3N1UA 5EHGA 2BAGA 4M0FA 3BGIA 3NRCA 4H7FA 1A8PA 2W11A 1SHUX 4KIGA 3G3EA 1UINA 5DTIA 3T54A 2GERA 4J0JA 1NQUA 2DBZA 5AK3A 4PG7A 5A9RA 2X8LA 1HDRA 1QAQA 1P73A 2EYQA 1XNJA 2ZTUA 1IHYA 1OFHA 2ZSKA 2C0QA 4US2R 3OCWA 1WEKA 3NANA 1T5BA 1XZQA 3HZHA 3VR4D 5AVYA 3B36A 5HTKA 1KAEA 4KFUA 1PSWA 3S5UA 4DMCA 1IM5A 4FQ8A 1MX5A 2V9ZA 3RYFA 2QE7A 3ZE7A 3F49S 1PR3A 2VAMA 5KC9A 2GBLA 1CZOA 2E6UX 4P32A 3DQZA 1DJQA 1YJXA 3K6RA 4IEEA 4YPVA 4EY7A 1B0UA 5C37A 1PR0A 3FZGA 3NBXX 3ZVNA 3K71B 1M75A 1NSFA 4KN9S 4KMRA 2FXVA 4KR9A 4S2UA 3D7LA 3WGUA 2FKNA 3QFHA 3OEEA 5REQB 4JI7B 2C54A 3AY6A 2CJXA 3KUUA 3WA7A 2F3UA 1O9HA 1Q0LA 1EX9A 5ESDA 4ZT5A 4EPVA 4O4IF 2JHAA 3AFGA 2JB9A 3A1EA 3LZCA 1J09A 4DNXA 1U98A 3CRVA 5CDHA 5BMVB 3GUUA 5FFFA 1JHDA 1WX1A 3NG1A 3X0DA 2VOEA 3ZKWA 3N7TA 1KY2A 2Q27A 1Z6YA 5DE3A 1V1MB 1X86B 3SDBA 4ZJZA 4MRMA 3PEUA 5B55A 1MBZA 2IELA 2RHGB 4ZCLA 2NUAA 3TNFA 3T5CA 2ASEA 2DHRA 2R8ZA 4CT0A 1TPYA 4DT1B 4YRFA 7REQB 2ZRGA 3EFHA 1N2IA 1I3LA 1QBGA 3NBFA 2XXAB 4JYAB 2HCBA 4NMLA 1XHLA 5ALZA 4IEFB 1DBSA 1B8PA 2Q5CA 4FQ7A 4N47A 1HX7A 1JMYA 5CT5A 3RFVA 1D6MA 3ECAA 1U6IA 4MW9A 2W6JA 2Z95A 4RCVA 4WLNA 5DBOA 3L7BA 4MUGA 2PUCA 1ULHA 2BBWA 2P1ZA 2C9OA 2XTJA 3ASZA 1CQPA 4KRXA 4NTZA 4US0R 1E4EB 2F3PA 1G9SA 3HSYA 4JOCA 5BSHA 3A58B 3ZC3A 4BO3A 3HO1A 1T9AA 4FHFA 1T8RA 3LI2A 3GDOA 3N0WA 2KX7A 1Z0AA 2G72A 3AY0A 4EUNA 2IYNA 1VG1A 1XDUA 2GN9A 2SCUA 1MEEA 3BRSA 2CF5A 3CG4A 3DT6A 4CG2A 2B25A 1SZDA 1EP3B 1ZA2A 2H4HA 4EJSB 1LA2A 1ZITA 3C85A 1Z4IA 1Z5PA 3SNKA 2UAGA 4FDTA 4N40A 4BLVA 4H60A 1YGPA 4ARSA 5HNKA 3JATB 1Q7TA 3GDHA 1YS4A 2ACWA 3FZNA 5IDYA 3BB3A 2OPBA 1BEZA 2OQ2A 2R2AA 4C7OB 2X3FA 3TM5A 3UFXB 1DZIA 2NXNA 3UMJA 3HCPA 4KR6A 1USWA 4Z4QA 3I0MA 1QM5A 1K8RA 1P9NA 4RPLA 3LP6A 2NSDA 4PG8A 3GHYA 3GJ5A 3KHSA 3V1LA 2GUWA 3BH7A 1BCRA 1Z0KA 2XSZD 3AFOA 3GPDG 1DUIA 3ESZA 2ZYWX 2Q5FA 4PQRA 2VXCA 1O58A 4BQFA 5JHGB 3ZEAA 3KOUA 3P5BA 4P35A 2FUNB 1TK3A 5J1SB 3BB1A 1R0BA 4A4DA 2OCXA 3L06A 3IAEA 4RM3A 4CFYA 4I6EA 4QHTA 1WSDA 5FPKA 1Z35A 4FE7A 2PG3A 2WT4A 3W9UA 1RVDA 4DJJA 1ZR2A 3N05A 4EKYA 5T41A 3Q7RA 1IN5A 2J9GA 3LXUX 3MMZA 3O4HA 1ZRHA 3I23A 3RVQA 2AUTA 3IUBA 3ZBPA 4ZDJA 2BM1A 3DDUA 3KSBC 3FPLA 3NGMA 4LYFA 1YZTA 2X42A 4BASA 2QZSA 4B35A 2XWJI 1L5HB 5JNSA 1RAFA 2H54A 2VDPB 3FFXA 1P1HA 4UTZA 4PZCA 4HJXA 3HL0A 2BZ1A 5IEBA 2ZZNA 4UHKA 4TXLA 4CLRB 1C1DB 3RKUA 4WXMA 3FDJA 4K26A 3DQPA 2WAYA 1FNCA 2UZ3A 3FKSA 1GCGA 3DPIA 1GT91 2GO7A 3L1JA 1M8FA 1ST3A 3ZGOA 3PF9A 4CFSA 2QLFA 2VZ0A 4CM6A 4ESOA 3Q0IA 2IT1A 2OORC 5AXBA 3TJZA 2VSNA 3OOWA 5F52A 3LL4A 3T0IA 2I67A 3PUWA 4XWTA 1YCDA 1GHTA 4KWTA 3NDPA 4NZPA 1P4GA 3DZCA 4XDZA 3CYFA 1CLEA 4RKFA 2WUFA 3X1WA 4PBSA 4XB6B 2L18A 3T3GA 2X7JA 4XJSA 2ONJA 3AG6A 4B4KA 3LLSA 2F1OA 2GS9A 1NJ5A 2YQZA 3BGWA 3F71A 2FG5A 4X1IB 1FDSA 3G5UA 3T34A 3DMFA 1TU3A 4GL2A 1UZUA 4HKTA 1NTOA 3SY8A 5IUNC 1EK2A 2GEFA 1Y89A 4F4UA 1ZN9A 4N0EA 4UVGA 4ZFNA 3HKEA 1L4YA 5HGXA 2FLVA 2GNAA 4RD6A 2F1KA 5BT9A 2DOKA 4YRBA 3TTYA 2QIOA 2ZBQA 2H1LA 1BEEA 1XX6A 4IO0A 4EL0A 3TX6A 2BBOA 5ED0A 3GLKA 2QKYA 1TM7E 3I34X 1CUDA 4PS1A 2REOA 1I2BA 4KFCA 1SGWA 4HAWA 2PL3A 2O8VA 4NZNA 3TQSA 3NPAA 5A5GA 3FUVA 2IPXA 2HYDA 2MWMA 1RI3A 4X92A 3A3PA 1DXYA 3ESAA 1ZVVA 2EBUA 4MQLA 4RFVA 4D8TA 1E79A 4CKCB 5K3CA 3D8HA 2Q4RA 1WDTA 1FA9A 1Q6YA 5H16A 4CM9D 1YNOA 3H6HA 3L41A 3UMYA 3GA5A 1KK3A 2NO5A 1GAXA 3B1YA 4K9MA 3JAKB 4MW2A 3F98A 3PIIA 5K0GA 2ZR8A 2X6RA 3OFNA 3H16A 1UJNA 2W2XA 3CUWA 3G9TA 4H4DA 2V5UA 5DASA 1ULTA 3LQYA 4YO8A 1NDHA 2G0NA 5KOJA 3S2EA 1MC4A 4R5HA 4ND8B 4EJ2A 3HZRA 2IWHA 2UXBB 4BUCA 2Q4TA 1S3IA 2C2WA 2R7MA 1NC1A 4RSGA 1C9MA 5GGYA 1A7KA 1Q1QA 4BUZA 5HG0A 1UK6A 2AZTA 1T0BA 3MXTA 2JGAA 5SZHB 3DEAA 1BC5A 2BFAA 4DZRA 1WVGA 5HW0A 4WK0B 1ADJA 1C7EA 3NWPA 3IVRA 3ST7A 4EHHA 3CVUA 3A6DA 1H2HA 2ISCA 3IOBA 1DBRA 1E0KA 4UFNA 4UXIA 2VH5R 5DBIA 1F4PA 3WB9A 5LLTA 1FNBA 3VHXA 3SR3A 4QVGA 1OUMA 1B23P 2GZAA 5FQNA 4S1WA 5CVEA 1QRTA 2WWVD 4FJ2A 1UUFA 1AS2A 1L9KA 3UV6A 1EFLA 4BV9A 3IPCA 2OYRA 3WGIA 3IUJA 2SHKA 3T5DA 4Y3UA 3DKKA 3I5UA 3UB4A 4GKJB 3LBIA 4RMIA 1BE8A 4HDRA 4D6PA 5KKAA 2P8SA 1M8KA 2QJOA 4R1TA 3AQIA 4RHUA 2Q41A 4AP9A 1HRKA 3VU1A 4UMVA 3IL2A 4NV1A 3CUUA 5CNIA 2OV1A 4JUDX 1RI1A 1B6GA 1W5BA 2AWNA 5I7OA 3V6MA 1KZ4A 4H7DA 3GRPA 2JD1A 1YQXA 2FWIA 1YZFA 2PIAA 3RF7A 4BP8A 3IV6A 1ISRA 3FCOA 4YI5A 4HNTA 3VPSA 1T4DA 3F8TA 4UBMA 4UXHA 1GZ4A 2O1SA 2ZWPA 5BWCA 5AKKA 3TW8B 4LGMA 1ADGA 3R7FA 1V3UA 1AZTA 4C7OA 3UT6A 2IYPA 3PXXA 3KELA 4KJXA 1KAHA 5BQOA 4GMGA 1BVHA 2VDNB 2C5FA 3IE2A 4UNRA 4L85A 3V4PB 2VJQA 3GQBA 5DXFA 1W30A 2Y1GA 1DAGA 1IE3A 1TM5E 4OXIA 3TRIA 3RH0A 1JLHA 4B8WA 4W9MC 4HUQB 4HY3A 3LVBA 1B4DA 5IH3A 5YASA 1Y6FA 1T3GA 5IYZB 1C8LA 2B7CA 1FLAA 2CD9A 3TK1A 4F6RA 3LC7O 5JOQA 4QPPA 4D25A 3PFWO 3FVRA 3QLVC 1E8DA 3I0NA 1VHWA 1T5SA 4A9AA 2O7QA 1B6TA 1IFXA 1HLFA 4TRJA 1LDMA 1DQYA 1GV1A 1YQGA 3DV0B 2Z4TA 3D6JA 3ED1A 3KB1A 2FSPA 4AI6A 3HHEA 1W5EA 3L02A 3L7DA 3WYEA 4ZIRA 3PQDA 3T3NA 5FLKA 3UPUA 2OLEA 4N65A 3JPWA 3HCCA 3KWFA 4BX3A 2HCJB 2DE0X 2R6FA 4NDZA 3RVPA 4J90A 1ZX1A 3SZGA 1A1SA 1P3Y1 2ODEA 1HFEL 4MVJA 2C2BA 4WJZA 4R0NA 1AH2A 1K98A 1M8JA 1GPH1 2GPBA 1LPOA 3INYA 3U13A 3S81A 1VL8A 2V6MA 5SZKB 3BTOA 2NT4A 1TUBA 5ALKA 2LCFA 4JJ8A 4DUGA 3AZPA 1KJ9A 4YECA 4CMBA 2VTBA 1U9ZA 2Q46A 2BMJA 3G5AA 1UBJS 1TEZA 5HBRA 2C9YA 1DC7A 4E70A 3D4NA 4ZAFA 4F4CA 3WWPA 4KLCA 3ES9A 3OQJA 5C3MA 2PUHA 4OF4A 1CPYA 5GPBA 2G83A 4ZEMA 1RLOA 1KOGA 3HYRA 4RA9A 3RSLA 2J30A 2Q99A 1FFDA 2Q1UA 2X2FA 4JNKA 4AG5A 1E8NA 2AQIA 1PAUA 1L3CA 3IS3A 4URVR 2BKUA 2LDBA 3K09A 4TTQA 1QDEA 2GK6A 4DSOA 4ZJPA 4JY7A 4ZQFA 2WMOB 4UAUA 1KSFX 1L7QA 1BO6A 3WIDA 2VJKA 2VTVA 5IAAA 3L7CA 4KMOA 4ZCSA 2PBFA 4G4SO 4DTIA 1NBMD 2IY9A 5F9HA 2QMUA 8ATCA 4ACAA 5BQFA 1OI3A 1RTKA 3LSTA 3LWDA 2C9DA 4Z0HO 3UC9A 1Z38A 4RM2A 5CEJA 4RVHA 4YCLA 1O94D 5E3HA 1M73E 1E6CA 1YIAA 3FPKA 5JHHB 2C4VA 1NQTA 2GN8A 2Q9BA 4DDKA 4N1AA 1R7RA 4EAQA 3O74A 5T67A 1K86A 2W2TA 3QVSA 2A3RA 3I12A 3Q1LA 3HN2A 4U3JB 4D4KA 3OEHA 2YCLA 1F51E 1TAHA 4YRNA 1SVLA 2ID4A 2Q3DA 1DO0A 5IEJA 1RYHA 2BFFB 3WB0A 2XDYA 1OX6A 1YQQA 1RRGA 2BL4A 4INPA 5LL6P 4BECA 2PAAA 4J0KA 1S8FA 2QTVB 2ZRBA 4TMXA 3MWYW 2CVFA 1FS4A 1IM8A 1SBTA 5EFOA 2QW0X 1T2EA 3OQPA 1YBVA 2CXPA 2Z2ZA 1MEJA 2REXB 4DLKA 1I7DA 3GR6A 5AJHA 4G9EA 1WZIA 1K9VF 3N87A 4MINA 4RLFA 1FUUA 3IB3A 4XI9A 3VI3B 5AYVA 4DA4A 1UBEA 4BO8A 4DCCA 4IX1A 3DBRA 5EGSA 2ZYDA 3PBKA 3C3YA 5DX1A 4PGMA 4CCYB 2FFJA 2GAAA 4RMJA 3KQYA 5IUKC 3I3OA 3N2NA 1TKRA 3ND6A 5J43A 1U5BB 2XKBA 1POXA 3DMDA 1KYXA 3L7AA 3UV3A 1HMPA 1KJQA 1GPYA 2W71A 4Y30A 1OE0A 1RABA 2WKSA 3RTBA 2HCRA 1KR2A 3CZMA 3NIDB 3R9KA 4B74A 1Z8DA 2RD2A 1V25A 1E2GA 2CEKA 3AMVA 4K8RB 5M3BA 5BNTA 2ZCVA 1XZKA 4D9IA 4OGKA 3TL3A 1W35A 3AKZA 4IZOA 5LM3A 4K9LA 4PN3A 3OICA 3V8BA 5ECDA 4D8XA 3H05A 4NPCA 1NNI1 4CWAA 2C59A 1I4TD 3LXRA 4ZOLF 4YGYA 4WKNA 1WM1A 4EHBA 5CFMA 5DNWA 3K2IA 1E7SA 4IIJF 1QX3A 1XR3A 2VP5A 2PLAA 1C30A 1S96A 2VIIA 1SXJC 3DWEX 4YMWA 3RC2A 1N78A 3O2QB 3H13A 2O19A 1GYQA 3C8MA 4UU7A 5C8DA 4G07A 4J0GA 3QEAZ 5KWSA 2NSYA 2GR9A 4BC1A 3HR7A 4EO7A 2HWWA 3H42B 1TZKA 4I55F 5TIIA 1SBNE 2JL1A 4GRIA 3UB3A 1PYDA 1VSVA 2OFFA 5H8WA 4UDOA 3Q0TA 1RWVA 2KB0A 4BAGA 3PCTA 3WMXA 4TSRA 5FLEX 3TR0A 3AKYA 4C3UA 3IR5A 2BY4A 4NEGA 3CH5A 3W1VA 3GK3A 4ZT3A 1W5FA 1AURA 1EXNA 4DR7B 3QI2A 3L9WA 1V3QE 4UDYX 3RYHB 4AZ0B 2Z6QA 1Q14A 3ADBA 1Z6XA 2W6OA 4J6EA 3K7EA 1YGYA 4TL8A 1TCVA 1F2DA 2WOOA 1D2CA 2Y4OA 4N4AA 1XAGA 2WG0A 3JPYA 5JD4A 1D6JA 2C3OA 5C7OO 2C8KA 4ZEVA 1PQPA 1XCOA 2BP7A 1IEXA 4FZJA 4G56A 4PGAA 2B1RA 2JJ1A 4KSYA 4NL4H 4Y67A 1J2JA 3G0HA 3LECA 2HT1A 2AX3A 3Q11A 1Q0SA 3H4VA 5CH8A 3FZQA 3G0CA 2C0CA 3JD1A 5JSYA 4B9AA 1ODKA 4HGPA 2Y1LA 4D9CA 1Q2UA 4BRSA 3SG0A 3A2KA 2MR5A 4XVCA 3ZHSA 4UOZA 3H0KA 4GU5A 3L92A 1SKYB 4FDMA 3U0VA 4LGVA 3C5EA 2I33A 4QREA 1DOZA 4W1SA 2YNMC 5EE1A 3MINA 4MVJE 3EVDA 5EQDA 5HPYB 3E7WA 5DM1A 3F7TA 3GNQA 3GVXA 2R751 1ND6A 5EIOA 1I6LA 1Q12A 2D54A 3KU4A 2HU8A 2OCPA 4D0LB 1UM9A 2JHGA 1U7OA 2GCIA 5CGQB 1LPNA 2NUBA 2CBGA 1WCWA 2VEDA 5LQSA 3QKUA 5IAEA 2ZYTX 4H6PA 3LUCA 5DEIA 2QIPA 3C45A 2C3PA 2O8BB 2YRXA 1RKQA 3NHKA 3S1AA 1AQIA 4LISA 3INGA 4G67A 3BORA 1H0HA 1RHMA 5SY6A 4E3WA 3ECCA 3H9QA 4AJ2A 5JT1A 3UUGA 3NDBB 3ZDCA 1HE8B 3NYWA 1DRWA 2RH5A 4Y98A 6REQB 3CLSC 4AZSA 3ZV7A 1X3SA 4M36A 5ES3A 4XWWA 3CPJB 5DN6A 2J5QA 3QYJA 2PZEA 4L50A 1QF7A 1HK7A 3MGAA 4IF6A 4PZLA 4NU6A 3WDLA 2ZBGA 4D99A 2BF4A 1L5RA 2YYSA 2WJVA 2YYYA 1M7HA 3U0BA 2BZSA 2R8EA 5EWJA 1EM8B 3QY9A 4M0UA 4P8RA 1ZD5A 3E15A 3SM9A 3ZWAA 1FFXA 2VP4A 4MV6A 5ENVA 2EKBA 4G09A 1NN5A 1AKQA 2A3NA 2Q5OA 2ATXA 4KYTA 4PGGA 3BD9A 4UUNA 4N82A 2Z57A 1G2QA 4CM3A 2CZQA 5DJ5A 3G1WA 3E5HA 5B2FA 2F90A 3ME5A 1O5OA 3O3MB 3ZV3A 1QIGA 1E64A 2BHSA 3ESDA 2PU7A 3TJMA 1VZ3A 3HY3A 3V3TA 3V8EA 1ECCA 4A8PA 5FUMA 4Y2RA 4Z4HA 2BGKA 1Q74A 2C99A 4KNWA 4M6WB 3OQIA 5EY5B 5JMWA 2JGDB 4PTZA 5SV2A 1OQAA 1BROA 2GZSA 2UZ0A 4QIHA 1UPCA 4GM1A 3JASB 2ZSJA 3I8OA 3CSUA 3EUAA 3FVWA 4D3SA 4DWJA 3EX7C 2HFKA 4C30A 4TS1A 2D4HA 1E66A 3UPDA 2MHCA 1NGSA 4E13A 1XB2A 5AQEA 4ER0A 3LT2A 2GK7A 4HEHA 3HXTA 2B30A 2NUPB 4N49A 4LRUA 3COYA 5E4FA 1P61B 2QYSA 2B6NA 4DDMA 2HMTA 2OAGA 2VSFA 1G6HA 4BEWA 5I9NA 5JZMA 1ODLA 2QS9A 2XZTA 1SBHA 4XA8A 4N3BA 4PF1A 2P2GA 3OUUA 3T9BA 3LC0A 3R3SA 5IVDA 2F64A 2HB6A 5LP1A 1MAHA 4BMOB 1PZXA 1WAMA 1YZ3A 1HEIA 2VP2A 1XRMA 3NHJA 2O2CA 2RFLA 3NOOA 1N4AA 3WGNA 1H23A 2WHEA 3CBQA 1AUPA 1RJ9B 2G8LA 5BN3A 3NTXA 3C5VA 3RABA 4DJFC 2DUUA 3T94A 3U6BA 1DTWA 1TIKA 4LBYA 2R44A 4CF6A 5CAEA 1Z45A 2Z8YM 5CT6A 4B87A 2QM0A 2JHFA 2JGLA 2B8NA 3T7KA 4K9DA 1VXRA 5AI0A 4EY3A 3OA2A 4L76A 3SWWA 3FLEA 2EERA 4QU9A 4WZAA 3RVDA 4LF8B 4YFYA 5K3BA 1U2PA 4EKGA 4WK6A 1ZK1A 1BIFA 3WJ2A 1PBNA 2O3JA 2JFNA 4HZIA 2RHMA 4D3XA 1W4BA 3HRHA 4HZUA 5J5VA 4ZI2A 1I1QB 5K6RA 3U3MA 4PHCA 3A9VA 3WRXC 4DV5B 3U7FB 1N7JA 1A3CA 2Q6OA 1LEHA 2X7HA 3EXFB 4JBXA 3EE6A 3FDZB 3DAHA 3GUVA 3U7IA 4EL5A 4BQOA 2P41A 3L6DA 3AU8A 3DKPA 3K0BA 2TS1A 3VH2A 3NV7A 4RSRA 3FF4A 2OR3A 1W2HA 3L77A 1CR4A 1VYVA 1MX9A 4J16C 4JX9A 4B75A 4D9BA 3OOYA 3VPBA 3ZCUA 4CTJA 1NW4A 3ZDBA 2QA5A 2WWWA 3W6NA 1DIRA 1URPA 3E03A 1X7DA 4FGKA 1W94A 3KT8A 3OQNA 4BNXA 2K2QB 1YI8A 2G9UA 3A2LA 3DE5X 1LBTA 3H2ZA 3QTBA 4TV8B 4EELA 4BO0A 1GKIA 1MMFB 1P60A 1A5TA 1SUBA 5LMUB 1R8JA 3ZWDA 1BW9A 1JDJA 1YIDA 3AR8A 2A86A 5ALNA 2JD0A 3DDSA 4JXXA 2CB9A 4B2LA 3OY7A 1C7IA 1FBNA 1M6VB 4FZ5A 3G59A 4XZ3A 5B4UA 4BBZA 5JZSA 2P1DA 1CHDA 5AW9A 5JAOA 5K20A 1FBTA 1QV6A 3ROQA 4GNKA 3E9CA 2IUEA 3R0IA 1SUSA 1E20A 1ZHHA 1ZO8A 2C9BA 5B6JA 4PHFA 3PX3A 1Y34E 2J41A 3KQVA 4ZYUA 4KU4A 4BEVA 4KLZA 1SXGA 2HNBA 2WPDD 1DUSA 1CEYA 4N48A 3A9CA 3BK7A 6AT1A 1XJCA 4F2GA 2XRYA 4C4PA 2YVAA 1QWSA 1C41A 3B78A 3BMQA 3QA3E 4L78A 4WXPA 3THRA 3JQ7A 4C22A 4EPTA 2XMBA 2F4VB 1T13A 2OEPA 1IHDA 3G2OA 3OKAA 4FMDB 4K8OA 3C6MA 1GNVA 3B1FA 4GOMD 4C4OA 5L3QB 1IUPA 1MABB 3DO5A 1QFXA 1P75A 1SOVA 2OHIA 3DDOA 4JVNA 3E0XA 4X91A 4B40A 4N0MA 4HFJA 2P7IA 2PEYA 2QPTA 3JALA 3BS4A 4WY2A 3T5PA 3ZTTA 3S2YA 2OMKA 3B7PA 3H1PA 2FFAA 2EFJA 3TEJA 4CLOA 1P5RA 3WK9A 3ROTA 1BMQA 1RQ2A 1SNYA 3GRFA 4AP6A 3PUYA 4BMXA 3KYDA 4HH1A 1HH4A 2C9ZA 1DSSG 5HDQA 2TMKA 3IB6A 3IQXA 5FOXA 1UBHS 3SOZA 4LQDA 5AK4A 4G5FA 2FV8A 1P0IA 2ZATA 1NUUA 5HFJA 4YV7A 4TMWA 5MHTA 4LXQA 5EQTA 2CT8A 2DQ4A 3P9NA 4ES6A 2GDZA 3ZD8A 4G25A 4IDOA 4MEBA 1J0DA 3V2UA 5IXSA 2IP1A 3DVLA 2WNSA 3CTPA 2GBFA 3UJ9A 4IJWA 3G2MA 3PDIB 4O1IA 1PJ3A 2IU4A 3IP8A 2XX3A 1VFPA 4BU0A 5CBKA 3RYCA 1PDWA 1TCCA 2XV1A 1M6WA 3J81k 3TQOA 4CCSA 3GRYA 4YNBA 3PITA 1ZISA 3DGEC 2O3TA 5JQWA 4BNTA 3VPXA 4FUQA 4OQ4A 3JZAA 1Z5NA 2QI9F 3ID6C 3N8KA 2DFLA 3UIEA 4BNYA 4L5BA 1BCSB 1PGJA 2RI6A 1PK8A 2KMLA 1MLDA 1DWQA 2COEA 3HPQA 2YFKA 4J3FA 1O9BA 4LF9B 1TF2A 4MKGA 1X1RA 2PZGA 3M70A 2W2KB 3BWDD 4WBNA 1K6XA 4KMMA 1DAKA 2HDOA 4PO1A 3CUYA 4IMPA 4P36A 2NU9A 2IDMA 1GCUA 2EJWA 2QAGC 3CE9A 3KWLA 3VVMA 3QLUA 1PT6A 3DDCA 3CX6A 4MHTA 2EL7A 4FR0A 5F4ZA 3U4QA 4HYEA 4L2IA 1A4XA 4PYNA 4XASA 2LBPA 1JHAA 2HK9A 3K30A 5AW7A 2HCFA