2VSXA

Crystal structure of a translation initiation complex
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
382
structure length
366
Chain Sequence
b'QIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT RNA HELICASE EIF4A
publication title Crystal Structure of the Yeast Eif4A-Eif4G Complex: An RNA-Helicase Controlled by Protein-Protein Interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation/hydrolase
total genus 120
structure length 366
sequence length 382
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA02
1CP2A 4XIGS 1GDDA 8OHMA 1E9FA 1EFUA 3RRNA 3U4QB 5L3QA 2JLQA 1U0HC 2IYSA 4C30A 3B1YA 2JLRA 3LLUA 2F55A 1S9HA 5GJCA 2F1RA 1RVDA 1JNYA 5DISB 2IF2A 3NHAA 2ZI6A 2XX3A 5JRJA 4Q66C 3CRW1 5C4GB 2H57A 4V02A 3VHXA 4QFMA 4C0AC 5B58C 1HY3A 1ZU4A 5HPYB 1JR6A 4P4TA 5M04A 1TQ2A 1UF9A 4BLQA 2G83A 1QRAA 5DIFA 2QMUA 2YOGA 1P9WA 4MRVA 1QHHB 1ZMXA 5G40A 3K9LA 2FMXA 1IY1A 1F5NA 4BWYA 621PA 2GTPA 1P7CA 1F2UA 1GWNA 4E22A 1XMSA 2Q3FA 2X1VA 1IN4A 1U9IA 2OBMA 3CO5A 3OEHA 1S3SA 3SFZA 1NBME 4M53A 1AGRA 1DVRA 2GNOA 1W49A 2OCBA 1R8QA 2FA9A 4G5SA 5AUQA 3RS7A 4IFBA 1D8TA 1AGPA 2A5DA 1NBMA 2WVJA 1IQPA 2NO9A 2CCKA 3AVOA 4MUBA 4Q47A 3U5ZB 5JLJA 4QM6A 5GVSA 3SDZA 1I2DA 3MJRA 4NU0A 1LF0A 1EFTA 1E9BA 1K5DA 3VKGA 1UM8A 4RKFA 4Q1FA 4W7SA 3SI7A 4BFVA 2DR3A 3VQTA 4Q7MB 2J45A 4AI6A 5E7MA 3T34A 3KQKA 2XXAA 4C9BA 1G5RA 2A2ZA 2XOKD 4Q4AA 4BFZA 3L8YA 2ZTSA 4TLEA 2IXFA 3UXMA 4L8GA 2QORA 1DS6A 1QHNA 2PZGA 3CF2A 1KHTA 2GCOB 4Q1DA 4MYCA 4CVNA 3PXGA 5FOWA 3T5DA 5BYJA 3ZS8A 2VHJA 4M1KA 4CIDA 1FZQA 5DN6A 1NLZA 1HA3A 2BMFA 2GETA 3LBHA 4D6PA 4DEYA 3TQFA 3K9HA 4YMTA 4LV6A 4KSCA 1OXSC 2OXRA 4I4LA 2QMHA 2J7KA 1NVVQ 3K1JA 1UBGA 4FN5A 4YLGA 3VR4A 1HQYE 4NMMA 2GEUA 4NZYA 1CS4C 2RGDA 5TXGA 4GBMA 1A2KC 4XH9B 4D25A 2OFXA 2A9KA 5DYGA 2FFHA 5EXPA 5JJLA 3SYKA 4MKHA 1KSHA 4PC2A 3I3SR 2C77A 2W6ID 4LV8B 3I5YA 1V43A 1Q57A 1ZM9A 1CJTC 2V7QA 1QVRA 2ZUDA 2ZETA 2FZ4A 1DG1G 1KI7A 2GXSA 3ICEA 2QZ4A 3QQ5A 2GILA 1U99A 2FNAA 3WMEA 1ZUNB 1GITA 4HATA 4PQFA 4II7A 1S2MA 3VHLB 4KYUA 2G3YA 1Z22A 4A2WA 4Q18A 2EFHB 2BV3A 2WHXA 4RZ3A 4A6PA 4BFYA 2QBYA 1E2QA 4C7OB 1VYUA 1EX7A 3N70A 2ZJBA 4LYFA 5UKDA 1FUKA 3HU3A 2YOFA 821PA 2B21A 3WBKA 2ZUCA 2J9RA 3B6EA 4GI7A 3RAPR 4Y0AA 5JZVA 4JS0A 5EP1A 5G53C 3J81k 3EIHA 3RYTC 2VF8A 4M9QA 2GHIA 1ZD1A 4Q7JB 5H1YA 4XWKA 4A2PA 3LLMA 4EJSC 1AS0A 4TMVA 1YZLA 3K0AB 1KTVA 2WPDD 3PUYA 1DPFA 1ZJ6A 4EFLA 1X1RA 2BOVA 4LJ4A 1E4VA 3V4FA 3Q5EA 3QXSA 5SZHB 2QEQA 5F3WB 1E2MA 3FOZA 1W47A 4HAXA 2Z5FA 5EUQB 3MLEA 1VIYA 2VP0A 1AQYA 4CW7A 2BBOA 1WBDA 3GLFE 1MO6A 3D6TB 1W4CA 4A1FA 2GJ9A 1US8A 3U61B 4US0R 4EFNA 3U60B 2RH5A 2D2EA 3W6NA 3GLFA 1X1SA 1FPMA 1ZNYA 1EK0A 2ZE7A 1DEKA 3GEHA 4M1WA 5BN5A 3NKVA 5CB6A 3FMOB 2XSZA 4UNQA 2YC4C 4NCNA 3K0CA 2HCJB 4ZIRA 4WIAA 3CKLA 1W0JA 1XB2A 2IYXA 4OI1A 4URXR 2I3BA 1ZNZA 3TUIC 1RPZA 1XEWX 2QAJA 3Q85A 4AG6A 3GP8A 4E5UA 4Q4LA 1H8ED 2VHCA 1VIAA 3PUVA 5FL7A 4GOJA 3K0SA 1XTIA 1UEJA 1Q20A 1KDOA 2CBZA 4MRNA 4Q4JA 4TWZA 1N2CE 1HH4A 3ADCA 1H65A 4MRSA 2ODBA 4M1YA 4Q7LA 4CGZA 3KTAA 4PXAA 2W83A 1UBEA 4KFTA 3NHBA 1PUIA 3CZPA 1F3OA 4XD7D 3WBJA 1G20E 1ONBA 2BCJQ 2OAQ1 4M21A 3T15A 3VNUA 4LHXA 3H2YA 4PPFA 1WE2A 1XTSA 1Z0KA 3U6BA 2IYUA 2RMKA 4RD2A 5EE3A 4JLKA 3BH6A 1JECA 4TZ6A 2BBTA 3BORA 5EE1A 4C0HA 2PEZA 1VG9B 2E87A 2OCAA 3NC0C 1G7TA 2NQ2C 4OI0A 1DAKA 3NH6A 1KO1A 3TKLA 3K53A 4YQFA 2DPXA 4MGKR 4L9WA 5EE5B 3PEYA 1ZRHA 4TN1A 1ZUHA 3FDIA 2ZROA 2Z6VA 3KXLA 4MA4A 1SKYE 2CNWA 3QNUA 5TARA 1OFUX 2ZI9A 3QPVA 5K8TA 2FDCA 2Q9CA 4NCIA 4XJXA 1II8A 5LB4A 1TPZA 2FWRA 3T1VA 4B73A 1BO6A 5J4YA 3RHFA 4FINA 2W0SA 4KLZA 4B6EA 2AX4A 4Q4HB 4DCSA 4A36A 1KSJA 2ZRIA 3U6KA 1JB1A 4Q5IA 3M0EA 4LI0A 2J3EA 4HAVA 3W3ZB 3DOFA 5BWMA 1K5GA 1EGAA 1K8RA 3LQRA 1RC8A 4F7WA 1Z29A 3LW8A 2BBSA 2BM1A 4P32A 2A7QA 2HV8A 5J5CA 2VQSA 1XJ0A 3NBFA 3NTUA 1XMIA 1H8HD 3GJ6A 3THWA 1KY2A 4CT4B 4HI0E 4XVQA 2RGGA 3EC1A 2IYVA 1S0UA 4AC9A 2X8AA 2R62A 5CLLA 4URVR 2CL0X 3HU2A 3BH7A 4CEHB 3HPRA 1D2EA 1J7KA 3CPEA 4MKIA 5BQ5A 2ZJZA 2GCPA 1BMFD 1NJGA 3I73A 4ESHA 1ESMA 1TQDA 1OXVA 4PO1A 721PA 4JYCA 1Z3IX 1U9IC 4IOJA 1W2HA 4QNMA 2VTKA 4P4SA 5AUNB 1DO0A 1NNEA 1VG8A 3PUWA 4MQBA 2G9NA 2SHKA 5JSZA 3GLHE 2JLUA 1W7AA 4JVSB 2P65A 2AD5A 1YZKA 3Q7QA 2J0SA 4ZDJA 4A8JA 3GLHA 2NOAA 3AVTA 1C4OA 1FTSA 1MRNA 4M2LA 1HURA 2QAGB 1RRGA 4YXWA 2IYLD 1KKMA 1D6JA 3NBZC 2CE7A 3U2QA 4BFWA 4EPYA 2CK3A 4L16A 4LPKA 4A0GA 1KSFX 2JGNA 4YDSA 4IDOA 2JJ1A 4PHTA 3IBGA 4BECA 4JSTA 1G18A 1U8YA 1DAGA 3R7WB 1WP9A 2FSGA 2HXYA 4RD0A 2IF0A 3B1VA 1YVDA 5FUYA 1E3MA 2WOJA 4LHWA 1T8UA 4TTRA 2YC2C 2OUKA 3F3YA 2GVZC 3THXA 5EP4A 3LW7A 4CRWB 1IXZA 2RGNA 4KLNA 1XD9A 4YMWA 4D4JA 1NMXA 1XEXA 3EAQA 1ESNA 1HT2E 4LZZA 3MFYA 5FTJA 4BPBA 3B1WA 5FBLB 4OI2A 1XMVA 4D4KA 5EZ6B 2EFDB 2J41A 3C7KA 5AJWA 3IEUA 1S4QA 1XX6A 4NE2A 4FD2A 3QE0A 4PHFA 2O8DA 2G0TA 2XTZA 2FG5A 1EG7A 1N6NA 1OXUA 2MSCB 2O0KA 1GZSA 3GJ3A 3NVAA 3G5UA 4HDQB 4IXNA 4LYJA 1LNZA 1KYIA 2QSZA 3I32A 4B2IA 3HDTA 4WZ6A 3EASA 2HYDA 2UKDA 4JLNA 2GEVA 3TSZA 1UDWA 3OFND 4HLUA 3QSYA 1I4TD 1X6VA 3BJIC 4OQXA 4PO8A 4V0KA 4AK9A 2IYQA 2HDNB 4QRHA 2VP5A 4C0KA 2VSOA 2F9MA 2VP6A 2H1LA 4DLUA 4RVCA 1E0KA 1O87A 2A5FA 4OBEA 2WWGA 2IUUA 1CEEA 1T5IA 2IYYA 1XZQA 1E9CA 1T3SA 4JVMA 2D4HA 3AUXA 4Z1MD 1L2TA 4FMBB 2WWXA 1RYHA 3WP0A 3CF0A 1Z0IA 3VR6A 1BS1A 3B1ZA 3OIVA 4X8OA 5KUTA 2ZM5A 3LO5A 1ZM4A 2XEXA 3O8DA 4BFXA 2OHFA 1E6CA 1P2SA 5J4LA 3TUZC 2ZSBA 2F1JA 3ASZA 2BJWA 3MRSA 2GEDA 4NYIR 1J2JA 2GJ8A 2B8TA 3GD7A 4TQUS 4XOIA 2FJUA 2XITA 1DTSA 2FSIA 2QQ0A 4B35A 3EPHA 2PL3A 1GRQA 2XAUA 3A8TA 2N46A 3MGCA 3OESA 4UXHA 1CJMA 3HR7A 1UKVY 1XXHE 2GZDA 1IJFA 1GM5A 3C15C 4KV9A 2W2TA 3IHLA 2ZYWX 3CZQA 4D80A 1XXHA 4QBHA 4NYJR 4JMPA 1TUEA 1KDRA 1FQJA 1MO5A 1EXMA 1D9ZA 1XTJA 2ZR7A 4MGYR 3DKPA 3W8RA 2VIIA 3B60A 4TMZA 4Q1AA 4QXAA 4BEBA 3K0CC 3KKNA 4NCHA 2J0UA 3MAAC 4C0JA 4Z51A 2YHSA 4PAQA 1FUUA 3EXAA 4BZQA 3LH5A 1KMHA 3M6AA 1GSIA 1AIPA 1X8KA 1T91A 3VKWA 5ELXA 3BERA 3AVPA 5EZ5A 3ZVMA 1KDPA 1E1RA 2E1RA 2J7PA 2NPIA 3AGPA 5KYKA 1KI6A 4HAZA 2KBFA 4LCBA 3WRYC 1DG3A 4PQYA 3ZIAA 1E2NA 4TTPA 3BB3A 4GMXA 5IF9A 4KFSA 1TEVA 2C8VA 4M8NE 4Z8YA 1OH5A 2QE7A 2ZQ5A 3DZDA 1KJZA 3AF4A 2PCLA 1Z0FA 3EPLA 3U4QA 3KL4A 4NP6A 521PA 3DEFA 3T1TA 1CLUA 3EPKA 2P3SA 1G6OA 1OIVA 4PO9A 4F4CA 4AG5A 5GVRA 2GF0A 3B8HA 2P5TB 3CLVA 2OSBA 3UWOA 2Z4RA 2O8EB 3S1AB 4P4UA 2A5YB 4PC1A 1E1QA 3LX5A 3ZVLA 4TLBA 1M74A 1OB5A 2CHGA 5JBQA 4KYIB 3CX7A 2FH5B 2R2AA 1P5ZB 4BE7B 2A78A 4URUR 1TTTA 1JI0A 4GP6A 2BIFA 2KBEA 2BMEA 4FIDA 5DYIA 3OEEA 4KI0A 4LJAA 4HB4A 3BBPA 3FTQA 3V00A 1MRSA 3TNFA 2J46A 5JRZA 1NLYA 2CLCX 2RGCA 5FUVA 4TMXA 1TL7C 2WAYA 5DHAA 4HDOB 1WA5A 1W2GA 3G0HA 3TBKA 2W6JD 5IK2A 2C78A 3ZD6A 1G64A 1FMLA 2QRZA 1E99A 3NXSA 3TQCA 4Q7KA 3D3QA 3IUYA 3RDPA 1XPOA 1NN0A 2ZJ8A 2RHDA 4ABYA 4DZZA 2ZRBA 4ZI3A 1AKEA 5LD2C 2O8BA 2DY1A 4ZV4A 2ZRMA 3T06B 2AXPA 2PJRA 4IOMA 3E1SA 4TL7A 3U7EB 1O3YA 3T1QA 2WV9A 2QT1A 3IEVA 5JHGB 4MUAA 2KI5A 3VX3A 5HKKA 3N2IA 1KI9A 4FMCB 3RS5A 1Q1BA 1ZIOA 2H5EA 4AYTA 3LVQE 3WYFA 5FR2A 4HB3A 4LJYA 2OE2A 2WJGA 2A30A 2GCOA 2BVNA 1GNRA 1OKKA 1XF9A 4DEXA 3MWLA 3SE0A 2DCUA 4QHYA 4A8JC 3MJHA 4DLYA 4G5QA 4M4SA 2C96A 3K0FB 4R98A 2I1VB 2QRNA 3OAAD 4U00A 1D5CA 1MABA 3RWOA 1QHYA 4UNPA 4YMSA 5LPNA 2KWIA 1DBSA 1XWIA 2DFNA 3TH5A 3DDCA 3UIEA 4MGIR 1G4AE 1TQ6A 2AK2A 4DIDA 3CW2A 3LXXA 1WBBA 1GL6A 1Z07A 2H16A 4GRAA 1G17A 4O2LA 2X2EA 4RKEA 3CH4B 5BW8A 5EXSA 3EX7C 2FEOA 2RGBA 3CF6R 1SGWA 2ZRGA 2YKGA 4QG7A 2G77B 3DHWC 2ZYTX 2XB2A 1NIJA 1N5IA 3L0OA 2RGNC 4DUGA 5KHOC 3AVQA 5TV2A 3EG5A 5IT5A 4TYYA 3W9YA 3BD9A 3TAUA 1M6NA 1KK1A 4PC7A 4PZYA 3ETLA 3TVTA 2VHTA 4D2IA 2QENA 1GRNA 1GNPA 5EXXA 4N3NA 1AZSC 1OF1A 1ZNWA 1EFRD 3HP1A 2W0MA 5FOSA 1P3JA 5JHHB 2UZIR 5KDOA 4OJKA 2ZSDA 1JAIA 4XSGA 4ESVA 1OSNA 1N5KA 2DFTA 3C14C 3QUSA 4JLVA 3LD9A 4HSEA 3OF5A 2ZRNA 4F91B 1L4YA 2QPAA 3LA6A 1W36D 4HLUC 1SVWA 2F9LA 4JJZA 2ZE5A 1E2EA 4F38A 4OHWA 4TYWA 2Z4SA 6Q21A 5FBRB 5L3SB 4JZKA 4I81A 1LS6A 1SZPA 1XU4A 1LS1A 1KKLA 1IM2A 4ARZA 2NZ8A 4GT1A 4TQ9A 2CNWD 1VYTA 1Z6GA 1DOAA 1SXJE 2VH5R 1XJCA 2BJVA 2EWVA 4AYXA 1SVOA 3PJRA 3KJEA 2O5VA 4DLRA 1R4AA 4TMWA 3EPJA 1A82A 2R6DA 4RFSB 3DMNA 2BBWA 4TTQA 5JWHA 3IO3A 1SXJA 5IHPA 4TLCA 3I1FA 1Z2AA 4TMKA 5DNYB 2A5JA 4CEIA 2JJ2D 3T5GA 2G0NA 1M2OB 5KDDA 3AVXA 1VG0B 4UNRA 3RRMA 1YHNA 4ZKEA 4WZBE 1TEXA 2DHRA 4KITB 3CPJB 3GFOA 4DXAA 1CR1A 3U3OA 4QKQA 3A1SA 1FL9A 3QXCA 1UFQA 1W5TA 3IO5A 2PT5A 1P73A 2FU5C 2W2XA 4LC1A 3R9WA 3RRYA 1N0UA 1N6IA 3K70C 1L4UA 3FMFA 3JZAA 2QP4A 3LDAA 3OHMA 3UPUA 1R5OA 2P6UA 2QN6A 1SVLA 3D8BA 3AVUA 2F7SA 3GLGB 4KODA 2QPOA 4Z54A 2HF9A 4WXPA 1II0A 2ZUBA 3OE7D 1Q22A 1XCMA 4PZZA 4RZ2A 1VKJA 2C9YA 2IW3A 3A36A 3SBDA 4ZDKA 1G7SA 3B9PA 1OV4A 4ON9A 3DO6A 2JLZA 4B3GA 4BQSA 3BC1A 4WZAE 1HUQA 3L0SA 5IDVA 3WRXC 3A4MA 2RAPA 1R0XA 4CT5A 2QGNA 1LY1A 2Q6TA 3IHWA 2W00A 5P21A 4G1UC 1G16A 4B74A 4BLOA 4B3FX 1E79A 2ZE8A 4A15A 4G01B 4GZLA 2PLFA 2CK3D 2KE5A 4IEEA 1TU4A 3SJAA 1RJ9B 3THYA 2YVUA 4JBXA 1AS2A 2JJ1D 1QHSA 2ZRFA 4B76A 2J0VA 3KB2A 4GZMA 1NMYA 1YZGA 1GILA 4Q48A 3TRFA 5JCPA 1IXSB 2QM7A 4IDQA 2I4IA 2F1IA 1UKYA 1NSTA 4Q4HA 4LJ5A 4R71A 1KOFA 4HUQB 3FPAA 1X8JA 2OT3B 4QJ5A 2FZLA 3F0TA 4W5JA 5HCNA 3UMRA 2YJTD 1OLOA 1LF5A 1R5BA 2XNDA 3REFA 3IDQA 5JEEA 3WYAA 2EW1A 2VP4A 2Q3MA 2IX3A 3ZS9A 4HLDA 1ZC3A 5TB5A 3OZXA 1YJ5A 2ODWA 4QBFA 5KNDA 3U44B 2V3CC 4HZUB 1DO2A 2UZ3A 1NIPA 1S8FA 4CEHA 4YDHB 4LYHA 3RNLA 1ZW6A 2O8FB 3B13B 3QXHA 1E94E 5SZJA 2ZJOA 1PLLA 1J70A 1XD8A 1R6BX 3GFTA 3EWSA 2V4ZA 4NONA 4D4LA 4DIEA 1JR3D 3CB4A 3DM5A 1FP6A 4OK5A 4C2UA 1NVWQ 3A37A 4BLPA 1N3BA 2BKUA 2OV2A 4DB4A 4Q9IA 4X8MA 4Q01A 3X2SA 2PT7A 1COWA 2ZAOA 3DZ8A 4DSOA 3I4LA 5EE0A 3GJ7A 1R8SA 5GADl 1WB9A 3R8FA 1I4LD 1KK2A 3C4JA 1MKYA 1PJRA 3SFVA 2JIZA 1KK3A 2QAGA 4WBSA 4DSTA 1KI4A 1XFAA 3CNLA 3FVQA 4P31A 3FMPB 3AVWA 1SHKA 1F2TA 2DFKB 1W5SA 1A7JA 2QG6A 5KNCA 2G1KA 2QY9A 4L15A 5JECA 2CLDX 1CRPA 1KK0A 2GBLA 1G5PA 2WICA 2JASA 5FUWA 3REGA 4A92A 3AVVA 3F5FA 4UNNA 1FX0B 1HYQA 1W0KD 1ZC4A 3PCRB 1CU1A 3FKSA 2VL7A 4POAA 4TT3A 1XP8A 3EZ9A 1JJ7A 4LJ7A 4DDUA 4A0FA 4EKDA 2CJWB 1NL3A 2Q21A 4QJ3A 2V6JA 5CITA 1RKBA 2DB3A 1M7GA 4PHHA 1JBKA 3VR2A 4BLSA 3QKSB 3WXMA 4DCNA 5AJYA 2B92A 5HE9A 3TW4A 4TSFA 3VTKA 3FFBA 1VYVA 1TF7A 1HEIA 1Z47A 1KJYA 1W1WA 3FE2A 1NRJB 1AM4D 2XZPA 4EPWA 3FKQA 3KXIA 2PX3A 4EDHA 5BYKA 3KUDA 3EWAA 2WWFA 4D81A 1QHXA 5L3QB 4M22A 2ORVA 2VSXA 1OHHA 1Q44A 3FWYA 2EFCB 1G1MA 1P2UA 4NDZA 5J4KA 1E96A 4E07A 4NPHA 1UDXA 2VYFA 1JXMA 3RANA 1T3LA 3VFDA 4DDWA 2ZI5A 2AFHE 4B44A 2ZYUX 2J1LA 3B5JA 5IRCD 3P1JA 4BGDA 2IT1A 2MMGA 1NMZA 4OQMA 2WSSD 2LKDA 3A4LA 2P67A 4Q03A 1JQLB 2IWHA 1R2QA 2XJ4A 2QUZA 2AKYA 4UJ3A 1KSGA 5JCZA 1G3UA 5D3MB 4OQLA 3A58B 4ASUA 1F2UB 4PZLA 5KOYA 5AWFC 1IN7A 4JLOA 4D0GA 4EPRA 3I72A 3EARA 5EQTA 5B64A 1XCGB 2ZPTX 4H1VA 2JEOA 3DKVA 1VTKA 3A1TA 2J59A 4Q1EA 4DDTA 5F98A 3U3RA 5DI3B 4WW0A 4QHTA 3LAWA 1LW7A 1LB1B 1OH7A 4JVNA 1TNDA 2OZEA 5E7JA 4A82A 1G8GA 4C0QC 1P9NA 1Z08A 5GJWC 2DYKA 3KJGA 1YRAA 3BAFA 4JL6A 4PSAA 2F43B 4HAYA 4M9XA 2IS6A 1E0AA 2GK6A 5A0FA 3ZDQA 1XTKA 4JKYA 2XXAB 1SXJC 5FPYA 2CL7X 1K6MA 2BM0A 2WWIA 2O8CB 1SKQA 1Z6XA 2VP2A 4P0TA 2K5UA 3UKDA 4P3YA 5H68A 2GXUA 5H70A 2E9SA 4V0LA 4DLSA 2HYIC 4BEJA 1M1YE 3PUXA 2DBYA 5AJXA 2REXB 4B32A 2NZJA 2V8OA 2WJIA 5CK5A 4TYNA 1N6RA 2PH1A 1XZPA 5KO2A 3QF4A 1OXTA 2D2FA 2HT6A 2IYTA 2ORIA 4LHVA 4A2QA 1QHGA 4LGMA 4US1R 5KSOA 1FOEB 2ZR0A 4DT1B 4DKXA 3U3KA 1KI2A 3EIQA 3QKTA 4BFUA 1BOFA 2VLIA 2HLDD 1XD2B 3CUEF 3MWKA 5FTMA 2GVDC 2OFOA 1UKZA 3AP2A 1DAMA 1E2LA 4AY2A 2IS1A 2IYWA 1BYUA 2WKRA 4DSNA 3LNCA 5C2JB 3B7GA 3CRQA 3B82A 1ZINA 2MSDB 3ND8A 3R8CA 3RABA 4WA7A 4FMDB 4A6XA 3IBYA 4RD6A 5FBQB 4XVRA 221PA 1TUIA 3W8NA 2ZR9A 5FOVA 3V4RA 2O8EA 2QBYB 2JDID 2ANCA 3S1AA 2YNMA 5GJVC 4BRWA 3LXRA 3WP1B 2AR7A 2NO0A 3RC8A 3V9PA 2EYUA 2W58A 1G8PA 3N2EA 3ZQJA 2GF9A 4PC3A 3SC3A 4JKIA 2CDNA 5C4MA 4E09A 3LY5A 2J5XA 2ZRCA 4G0NA 2OCPA 3H4MA 1OH8A 4BRUA 2L0XA 3IGFA 3H1TA 5FPHA 4C3ZA 4HEJA 5FOXA 3RSLA 4NYMR 4EPTA 2ZS8A 2Q9BA 2GXQA 4LJ9A 2H18A 3GMTA 4PAOA 3GPLA 2GCNA 2NMVA 3IIKA 3I8SA 4IVPA 4A0RA 4OHXA 2YWHA 4KAXA 1Q1QA 4MRPA 2V1XA 1AQUA 5HE8A 2WZQA 3NEYA 5KU1A 3AGQA 3QEOA 4D0NA 4JVLA 3CRVA 1KZGB 2YYZA 5F9FA 3CX6A 4L4UA 1SVIA 2H92A 1GP2A 1TU3A 3G82C 4AD8A 5AUOB 1GRRA 1KI1A 4DSUA 1IY0A 2ZAMA 1OE0A 4GSYA 4BUJA 1R5NA 2VEDA 5DSZA 4ZIRB 2BEJA 2IUTA 2ZI4A 4K46A 1VHTA 1XTRA 3T35A 5G41A 3AM1A 2P5SA 4O25A 4QGGA 1CR4A 3NC1C 1KO7A 5FUXA 2C5LA 2GAOA 2REBA 1FQKA 1XBTA 4HYYA 1G8HA 1Z8FA 2V6IA 2QAGC 3K0FA 1P2TA 4QM7A 2WOOA 1M7BA 1F6BA 3FHOA 2PZEA 1CR0A 4JBWA 1E2FA 3GEIA 121PA 1IJEA 4V0OA 1E98A 5DHFA 2BWJA 1DE0A 3LQQA 1NKSA 2KJQA 3M4YA 2R9VA 2ZANA 1UJ2A 3MUFA 5FI1B 4BZPA 2R8RA 2RKOA 2IYRA 4ILEA 4ZCLA 2XGJA 5EXTA 4R7ZA 4UKDA 4DJTA 1E9SA 2ATVA 1NF3A 5FH9A 2IXGA 4LJ8A 1T8TA 2YZ2A 2ZYVX 1U2RA 3NDBB 1W36B 3QKRB 4NH0A 1LVGA 1NI3A 2WPDA 2ZRLA 3SJBA 5K8IA 2EFGA 3W34A 1VMAA 2D62A 3NEJA 1MH1A 3W3AA 3EC2A 1UBFA 4PSVA 1CR2A 1R0ZA 4LY6A 1P72A 2RGEA 3KKQA 1FW6A 2J87A 1IN6A 4JBYA 2EYQA 3OEHD 4PR0A 4G5OA 3T12A 1II8B 4QGAA 1Q3TA 1SKYB 4H1UA 1XPRA 5FPTA 1PLKA 3RRZA 4FCWA 1EFCA 4OQFA 3BXZA 1T5LA 5EJEA 1E0SA 1Z0DA 3C5CA 1NBMD 1Z63A 3Q8XB 2ZU6A 5JJIA 1NP6A 2PX0A 3QF7A 1HV8A 4XSHA 5EP2A 1EX6A 3KQUA 5EUMA 4TZ0A 1E9RA 1D2MA 1TADA 3BIFA 4NYIQ 4C2TA 1ZD9A 2ZVPX 3O47A 1E79D 2GESA 3THWB 4DWJA 4Q9KA 3LBNA 5DO9A 2V54A 3BFKA 1T9HA 1H8EA 2KB0A 4DLVA 5LD2B 4B43A 4QJ4A 1G7RA 4EAQA 3QVUA 2D7DA 1OJLA 3LVRE 3TUJC 1QDEA 4F4IA 5DLQC 1JJVA 4H9GA 1D9XA 4IXMA 5KSZA 1G291 1Z83A 2V9PA 5ANRB 1YKSA 4LX0A 4FI3C 2GXAA 4JYBA 4RFSA 1E9DA 5E4FA 5DN6D 3E5HA 2HF8A 5L3VA 3LV8A 4NYJQ 5KTYA 4XD7A 4P4SB 5J4HA 1QZXA 3P20A 4R2HA 1Z28A 4W5HA 4FMCF 3VX4A 1FTNA 4RZUA 3CH5A 1U8AA 5JSZB 3TW8B 2GJAA 5CK4A 1X86B 2PJZA 3Q72A 4DLWA 3AH8A 1ETUA 2OLKA 3HJNA 4W9MC 4UJ5A 3BB1A 2BCGY 2PLRA 3VR1A 1QHHA 2ZRPA 1ZIPA 1KI3A 1AJEA 4B2PA 3GLGE 1G3QA 4EQ6B 1CXZA 1UADA 2V7QD 5E7IA 3SNHA 3UANA 4HLCA 2V1UA 4KFUA 4UNSA 3GLGA 4OJQA 3X1XA 2AL7A 1XJQA 4V03A 1J8YF 5FBVB 4MKFA 2ZU0C 1E2JA 5BN4A 2RGAA 3QY0A 2YOHA 2Q3HA 4Q02A 4URZR 4PFSA 3UG7A 5CJPA 3KKMA 3ZVNA 1Q0UA 2WKQA 2C03A 3JZMA 4IVRA 2OG2A 1P75A 5FPKA 2CHVA 5J47A 1H8HA 1XNJA 1IXRC 4N0EA 4IDHA 4DCTA 1Z0AA 2ZS7A 4TYQA 1J99A 2DFLA 3SJZA 4IW3B 3ADKA 2ZE6A 3KZ1E 1YU9A 2CL6X 3TMKA 3AV0B 4XVUA 2JLYA 2O8DB 4W5WA 2ZITA 3U7GA 1BMFA 4MYHA 5E95A 3TR5A 1IN5A 1OPXA 1CTQA 2XB4A 2BKEA 2XZLA 2QNRA 2ZJAA 3AEZA 2R65A 3QXXA 4HUQA 4B34A 4Z8XA 1XEFA 3F8TA 1S1CA 3IPYA 4JLBA 3CR7A 1W48A 4MKGA 4TLAA 5FI0B 2JLWA 3QBTA 2YWGA 4AKGA 4PPQA 5JMTA 5TVKA 1NG1A 4LYAA 1P9RA 2FX3A 2ZSAA 2DWQA 3U44A 1DELA 3KQLA 1G8YA 3TJZA 1KGDA 3D7MA 4XWAA 2Z0MA 5KSYA 3CPHA 5TMPA 2XSZD 1T4GA 2KSQA 3RC3A 1ZUIA 2RGXA 5CLQA 2QMOA 1W0JD 2I1QA 2IUSA 1LTQA 2BHRA 3AF1A 2FN4A 1KNXA 1VHLA 4KJZA 2FV8A 4LBZA 2O8FA 2B8WA 1W44A 2P6RA 4F4JA 2OILA 4NCKA 4U5XA 1NN1A 2YWEA 2QPTA 2DWPA 3DMDA 1MR3F 1ODFA 4LUCA 4JLMA 5LDDC 1KO5A 3KKPA 4K81B 1DAHA 4GL2A 2WJJA 5FL7D 4GOXA 1ZVQA 4LOAA 3GFPA 4Q9HA 4GMDA 3W90A 3A6PC 2PBRA 2PEYA 1OT3A 4C7OA 2CLSA 2ECKA 4Q21A 4G3XA 1WCV1 3X1YA 3ZVRA 1A4RA 1PLJA 2GDJA 2WJYA 4A4DA 1W4RA 3K70B 1YZNA 2VPPA 4HAWA 1XEWY 2HJGA 2NTYC 3PENA 4UXIA 1L7VC 5JS8A 3I8XA 3ZZTA 4OHYA 1EESA 3K09A 1YR6A 2XTNA 1ZAKA 2AHOA 3K0AA 3PR1A 1WF3A 1YZUA 1ZD8A 4PX9A 5F2EA 3DPUA 3ASYA 4DB2A 2IBMA 2QL6A 1Q21A 1TX4B 1UEIA 4MRRA 2J0UB 4WVFA 3AF2A 1U81A 1FX0A 2ZRDA 2ASEA 2ZSFA 5DI9A 1QG4A 3OFNA 2IA5A 1GOTA 2QTVB 3ZQ6A 5J4VA 2FPMA 1XMJA 4LK2A 4BASA 1CJVC 3QKSA 5FOUA 2GJSA 2VF7A 4KO8A 3GJ0A 1KI6B 1XTQA 4PAMA 1I2MA 4Z1MA 1S96A 2RB4A 2ONJA 3ICQB 1G19A 3AKCA 5JEDA 1N6KA 4IJMA 4RD4A 1AZTA 4Q19A 3EA0A 5KSPA 2BMDA 2IS4A 4IOKA 2HUPA 2FSHA 2PZFA 3R9IA 2FOLA 3E70C 1T0HB 3HYTA 4ACAA 5L3RA 4KVAA 2X77A 1PV4A 2ZRHA 4F93B 3IKJA 3ECCA 3DL0A 5CYOA 3GJXC 4HLQB 2OESA 4MYUA 2RCNA 2VHQA 4ZPXA 3SYLA 1S9DA 1S1MA 3VR3A 3HWSA 3MWYW 2LWIA 1V5WA 1SHZA 4PC6A 1Y63A 4TMTA 1N6OA 4NHOA 4UXJA 5EP3A 2ATXA 2C2HA 1N0VC 3KB1A 4IEIA 1II9A 4CDGA 5D3MA 2QGZA 4EPXA 1U98A 4MDFA 2D3WA 2GZHA 3QPWA 1NVVR 4IDPA 1PVOA 2OBNA 3PEUA 3T61A 4CEJB 2JCSA 3SJCA 4YXWD 1ELOA 4NBSA 4URYR 3C16C 3HPQA 1GL9B 1XCPA 4FW9A 2XZOA 4Q9LA 1UAAA 5DI3A 2D7CA 4KVGA 3CWZA 1WDTA 2O0HA 2N42A 1ZP6A 2ODEA 2IK8A 2GA8A 4LRWA 4OQNA 1GVNB 3AKYA 1VPLA 1VCMA 2O8BB 2ZREA 3NBYC 3U7HB 1LV7A 2X2FA 1SULA 2JLVA 4B3CA 2EFEB 4BZXA 2IXEA 2F43A 1OFTA 3Q9LA 3HYRA 2NO6A 1G9XA 3BK7A 3M1IA 4EJSB 2VHUA 2NGRA 3LBIA 1G5TA 4GNKA 4M0LA 2NO7A 3BE4A 1G21E 1MV5A 2O8CA 5AK0A 3DVLA 4DCUA 1U0LA 2WBLC 1KY3A 2R44A 2Q9AA 4X8HA 3X1WA 3WNDA 4B3BA 5JI3E 4OKSA 2C98A 1Y3AA 3KXKA 1N5JA 1RIFA 2H7VA 3KDSE 4JT2A 5B2ZA 3UMSA 3KFXA 2UVQA 1DARA 1P62B 1NN3A 3Q7PA 4QHSA 3UK6A 2WMOB 1MABB 3WNCA 1R0YA 4FXPA 1NY6A 3BRWD 4C0SA 2WJVA 1TMKA 4LBWA 4DT1A 5A4JA 3GEEA 1VCIA 3AF3A 2QQEA 3RS3A 5KPJA 3RLFA 2YWFA 2Q0HA 3T1OA 5C1BA 1RRCA 2VBCA 2FE4A 2A3RA 1XD2A 2IHYA 2PCJA 4URWR 4ZDWA 1OYWA 5HCIA 4EUNA 1E2IA 3VU9B 4D4MA 4GPTA 3GLIB 1OB2A 4LWZA 5JFGA 1B23P 1GTVA 3EZFA 3KJHA 5HR5A 4V0ME 1G7CA 1IN8A 1ZYUA 4JL5A 3PUZA 4V0MA 3VMFA 2FFQA 3CRRA 4CZ2A 3HU1A 2W6JA 3QOFA 1Z6TA 2PMDA 2ERYA 2VSFA 4TLDA 1CRQA 4HDCA 3IIJA 4K8OA 2VRWA 4CYMA 2GKSA 4D0LB 4ZDIA 2F6RA 1ZNXA 1CULC 2D74A 4HUTA 4YONB 3U3JA 1SVKA 3C41J 4GP7A 3R7WA 3R9XA 2O0JA 2HT1A 2EWWA 2ZRKA 4LPSA 2AK3A 4LSGA 4N1AA 2QMEA 2CXXA 2FGJA 1A1VA 4B2LA 3IQXA 3QIAA 3ZYCA 2QP3A 4I1SA 4RZXA 3QKUA 1Q1ZA 5B30A 4HB2A 2ANBA 1U94A 4NCJA 1JEDA 3K70D 3BGWA 2AWOA 4WXRA 3A1UA 1AA9A 5FOTA 3LFUA 4G5RA 4JIMA 5TDHA 2HEIA 1MO4A 3D31A 1E2HA 2FSFA 1BIFA 1QVAA 1G41A 3QVVA 5D3QA 2C9CA 2ZI3A 1NKTA 1G8FA 4G5GA 4KSBA 4EIWA 4IRUB 3U7FB 3AP3A 3WYGA 4M1TA 3OAAA 4ARZB 1YRBA 1SVSA 4N0DA 4FCTA 3L0PA 4ZKDA 2ZIAA 1I4DD 5G3YA 2OM2A 3QXJA 5EE9A 3IPXA 1SXJB 1E2DA 1RE0A 1ZCBA 4B71A 2LCFA 2ZJYA 4CEIB 1YE8A 3AP1A 2CMKA 3MD0A 4S2EA 5SZIA 2LKCA 3O8CA 1JQJC 2FEMA 3CX8A 4AKHA 5J40A 1Z5ZA 1E1RD 2J7PD 3THOA 1YR9A 1GIAA 3CNOA 5KNBA 2YV5A 1TAGA 3GCGA 3ZIAD 1B0UA 1MOZA 2ODNA 1C1YA 3TVDA 4AYWA 3RWMB 5JWRA 3KQNA 1ZCAA 2QE7D 3B85A 1JPJA 1F60A 3B9QA 1ZM7A 2IS2A 3K09C 4Q1BA 2IYZA 5C46F 2OO7A 1OXXK 2F3TA 4JL8A 3EA5A 4KU4A 3RSOA 1EFRA 5HZKA 4KXFB 3VNVA 4BFTA 2WWYA 1IAQA 3B2EA 2ZJ5A 1MO3A 1R0WA 4J0QA 2OCYC 3NBXX 3SYNA 4PSKA 1E1QD 3PFIA 5L8VA 2BC9A 2CCJA 4JLAA 1N6LA 3PEVA 2CEAA 3EW9A 3QKRA 2BMJA 3ND9A 2IC5A 1KJWA 2WM9B 4RD3A 2JLSA 3OEED 4FMDF 3TLXA 4Q4AB 4B3DA 1GAJA 1DAEA 4RJLA 1EFHA 1U90A 3R20A 4ZCIA 1GNQA 3THYB 3GJ8A 2WJHA 2XJ9A 3I61A 3EZ6A 2Z83A 3KQHA 3P4XA 1W4BA 4DDVA 3FHTA 1KO8A 3TE6A 1E9AA 1KMQA 5IK2D 1WRBA 4LC0A 1P2VA 3VKHA 1E2GA 2JJ8A 4LJ6A 5AJZA 2JJ2A 5HZHA 2G88A 1U8ZA 4RD1A 1IOZA 1UBCA 1GKYA 2GZAA 1GL7A 4OYHA 4TYPA 3E2IA 5CIWA 4XTCS 2GWHA 4EPVA 2JLXA 3QG5A 1YQTA 1NVXQ 3EZ2A 2YINC 4LV5B 2DWOA 2B6HA 1NSFA 1QG2A 2IWRA 5K8LA 1OFIA 2V55B 4TL9A 2O52A 2QI9C 3AKDA 5JI2E 1KO4A 1T6NA 5HKKD 4Q00A 4AWXA 1T0JB 2FPKA 1X8LA 2GRJA 3NDPA 4UQOA 1QF9A 5JJKA 4A9AA 3FFAA 4DHEA 1NVUQ 2AD1A 3KUCA 1OKKD 3CNNA 3LX8A 4OK6A 5JWOA 3WHKA 3SZRA 2CVFA 1J8MF 4DCVA 1J90A 3OE7A 4YMVA 1JEEA 1JXOA 2QT0A 2RHMA 3ONWA 5KDLA 1SQ5A 1LFDB 1NG9A 3CONA 1NN5A 1HE1C 4OI4A 2EVWX 4GDFA 3B78A 5JS7A 1G6HA 3L82B 4QGHA 4MGZR 1KNQA 4B75A 1A5TA 4RCYA 4RY2A 4U02A 1C9KA 4RSGA 2CE2X 4CF7A 1N5LA 2R6AA 5CDFE 2WTUA 2OBLA 3I62A 1Z6AA 2XOKA 1F2TB 3AB3A 3UATA 4EQ6A 5CDFA 4Y0VA 2WAXA 4RFVA 5LBIA 4I1VA 5CB8A 2NPFA 1L8QA 2C04A 3RVBA 3ZJYA 2PMKA 1YZQA 4I1OA 4XTRA 3OIYA 1IY2A 4HB0A 3ADBA 1Q1EA 1Z0JA 4M9SA 2QROA 3TIFA 4DUGD 2MMCA 2R6CA 4QL3A 4OK3A 3SBEA 4JSYA 421PA 2JATA 4O0MA 4WOPA 1F48A 4JJKA 4M9ZA 4F92B 3BH0A 3KJIA 2NO1A 1MT0A 2ZVQX 1FFHA 4MDEA 4IKEA 5DGXA 3GJ4A 4O3MA 4D82A 1US8B 5C18A 3TAHA 1OIWA 1GFIA 3NG1A 3GLFB 2TMKA 3O8RA 2W6IA 1T3HA 1N25A 3SQWA 1E0JA 1HT1E 1DADA 4MITA 3WY9A 3L43A 1JR3E 3GJ5A 2D06A 2GJKA 1W46A 4I1UA 4I99A 1AS3A 4DRZA 1JR3A 1X3SA 3PIRA 5AR1A 1Z6YA 1OIXA 4DC9A 3TGPA 4Q4JB 2P2LA 3FGNA 4IVQA 1OFHA 4JLPA 5LB2A 4MH0R 1W4AA 4NYMQ 2XNSA 3KTAB 4Q1CA 3CR8A 3CM0A 3EZ7A 1SXJD 2OXCA 3QEJA 3WMFA 2GBLC 4IHQA 4OHZA 4ITRC 3BS4A 3MWJA 2G6BA 1FMJA 2MSEB 3OIUA 2P0EA 4PQRA 2HXSA 2ZSEA 3ZZ0A 2VP9A 3I5XA 1RRFA 4LBVA 1CJUC 3W5JA 2VO1A 3ZH9B 3FMIA 1N6HA 1KZ7B 4QGFA 4C0BA 5GJBA 3ZGXA 5TY0A 3CRMA 4B48A 4US2R 3KFVA 4HZIA 3WHLA 2WIBA 3W5IA 3AUYA 1OH6A 3MCAA 3H84A 4IDNA 2H8KA 4DBLC 4ACBA 2QP9X 4QBGB 4ZI2A 1W0KA 4Q9JA 3RS2A 3DOEA 1WMSA 3DM9B 3IILA 2HJVA 1EWQA 1HE8B 2ZRJA 3SU8A 1IONA 2A5GA 1NY5A 2AKAB 3O8BA 4ZO4A 4BLRA 2NG1A 4OL0A 3SS8A 5SZKB 3H86A 4KBFA 3VR5A 3SHWA 2QU8A 2AWNA 3PG5A 2G1JA 1VECA 3TSWA 3QJYA 4YMUA 2ZS9A 3TR0A 2WKPA 3QG1A 3X1ZA 4PPGA 3SEAA 2WWWA 1KI8A 3VAAA 1NJFA 1GKIA 1TQ4A 4EFMA 4X8LA 2FF7A 2NIPA 3AQ4A 4D26A 3HR8A 1DAFA 1M34E 3C8UA 2FPLA 4R9UC 4NTZA 1KAGA 1ZU5A 3LRPA 5L3SA 2C95A 4WAUA 1JPNA 4LDJA 3W6OA 3MSXA 4V0NA 5FFMA 3JVUA 3CIOA 5FTLA 1GUAA 1IBRA 4BLTA 1OW3B 2IHBA 3QF4B 1RZ3A 4OHVA 4NL4H 4BFSA 3SN6A 4S35A 5FR1A 1WQ1R 1ZBDA 1M7HA 1UKEA 5G3ZA 5CIQA 2WSSA 5FBWB 2Y8EA 4L9SA 1E2PA 1U0JA 3PITA 2HCBA 3AVYA 3ZZUA 4DLXA 4GFDA 1A2BA 1VDZA 2Z43A 3BOSA 2B7BA 2XNDD 1SVMA 4M1SA 4A8JB 3GQBA 3GLHB 3A1VA 4R2IA 2ZEJA 1RYFA 1RFLA 4FCVA 1TF5A 1CJKC 2X19A 2JAQA 5K8UA 4AIIA 4TL6A 3WNBA 1W36C 1RW4A 4NKRA 2OAP1 2CCGA 4MYTA 4QOSA 1P4SA 1G4UR 1FNNA 1G3IA 1CBUA 1PZNA 1ZM3A 2F1HA 1E69A 2ZJ2A 1VCOA 2QM8A 3H0KA 1Q12A 3L2OB 4U7DA 4PHGA 1ZM2A 1CF4A 1CKEA 3OIWA 3NWJA 1R7RA 4E03A 2AN9A 2C9OA 1COWD 1GKUB 3C5HA 4LHYA 3X1DA 3B1XA 3K8YA 1QHIA 3RS0A 1P6XA 2QSYA 1Z06A 2XTMA 3AKEA 3THXB 5CJ2A 4AKIA 3UG6A 1VG1A 1D2NA 1BH2A 2C99A 2JIZD 4CEJA 3MG9A 1XEXB 5DE3A 4B6FA 2N1BA 4PPNA 4KBGA 2R6FA 1GG2A 1IHUA 2IEYA 4PANA 5CM8B 5CYPA 4KFRA 5KPDA 4YC7A 1PUJA 1G3MA 2FFBA 1RJ9A 3QI2A 4ERNA 1YZTA 1NLFA 2CHQA 2GK7A 4L5BA 4C0LA 3Q3JB 5AUPB 3BB4A 3BFVA 4RCZA 5FTNA 4B3XA 4JLJA 3BWDD 4ZCMA 1FNMA 3N5CA 3QPUA 2GAAA 4QC2A 4TQAA 4IFEA 1HTWA 3PQCA 2JA1A 1DAIA 2ORWA 3FKSD 1TF2A 4DVGA 3A1WA 3AF0A 3P26A 4TT3D 4KHZA 3IIMA 3JVVA 3P32A 2HLDA 2BEKA 4TL8A 5CM9C 3RS4A 4EJSA 3LWNA 3PEWA 2F3RA 3EIEA 4B33A 2OEPA 3SR0A 3ZLJA 4QBIA 3TSOA 5B57C 4QNRA 2WWHA 2ZXUA 2ZI7A 1CIPA 1EWRA 5AJVB 4DLTA 4TSFD 2EQBA 1XDBA 4HZUA 5F9HA 1ANKA 2AFIE 5DH9A 4M1MA 3MMPA 2WIAA 3BFXA 4JLDA 1AK2A 3K9NA 1AKYA 4C4PA 1XRJA 1E4YA 2IEZA 2WSMA 3P27A 2EU8A 2OLJA 3I92A 3FB4A 2ERXA 2WMNB 1QBKC 2JDIA 2ONKA 2FFAA 2FGKA 3ADDA 1OHHD 3PV0A 4PTLA 3K9GA 4KCGA 2CVHA 2R6GA 1E2KA 3GLIE 2W2VA 5BN3A 3SOPA 2BDTA 3K0EA 3SQXA 1JALA 3UMFA 4XWOA 3CBQA 3VU9A 1Q3HA 3GLIA 1YR8A 5A5GA 3A4NA 3NH9A 5FTKA 3FHCB 4IOLA 2AXNA 3U3MA 2QA5A 1R10A 1BKDR 1KAOA 4FWTA 1OYYA 3IQWA 1HQCA 2OFWA 1BYIA 1YR7A 1N0WA 1KIMA 1XXHB 5H8WA 3SHFA 1P61B 5FPSA 4ASUD 1S3GA 1E9EA 3KX2A 3ZD7A 1XPUA 3Q5DA 4GOKA 1UPTA 2J0QA 4AKEA 4P33A 3QENA 1G3RA 1KDTA 3P4YA 3PVSA 5FL3A 4HAUA 1P60A 1WXQA 3WMGA 4LHZA 1KMHB 5HTKA 1FP7A 2CJWA 4DLZA 1AN0A 1RRPA 3FYHA 2IL1A 4LBYA 2REOA 3QBVA 4AURA 2QTHA 1Z2CA 3L0IB 1VCNA 3CWQA 1M8PA 2VA8A 4FWIB 1E32A 4O2RA 3KKOA 5E3HA 4M1OA 3NIBA 4JT4A 3W6PA 4A0HA 2ZRAA 2B7CA 1JAHA 3TK1A 2H17A 2QTFA 3UWKA 3L8ZA 1N6PA 2P6NA 5BXQC 4B47A
chains in the Genus database with same CATH superfamily
4LS3A 1JDTA 1EFUA 1AZWA 2H4WA 5FNVB 4JI4B 1CVIA 1T2AA 2FCAA 2VUIB 1I7SB 5JD5A 3OOSA 1NJ6A 2MR6A 3BHNA 2CWWA 2JLRA 3NKFA 3LLUA 2GLTA 1P19A 1S9HA 1YGYA 5GJCA 2F1RA 3GXOA 3UCFA 1J0DA 1R6VA 2H7CA 1ZG3A 3SPXA 5TS2A 2XX3A 4AICA 2F90A 4YAOA 4V39A 1K4MA 2B1JA 2BR5A 2H57A 1PG0A 3DHYA 1K3TA 1UBRS 1KBZA 3EDRA 1WX1A 1ZU4A 2XPCA 5HPYB 2AH5A 5JFTA 1TM2A 1C4XA 1IOWA 2H0QA 1OU0A 3TS1A 1XMXA 3VNQA 5ICEA 2G83A 4OXKA 5DIFA 2XVAA 3V4PB 5E1DA 1JUDA 3NHZA 3THRA 3V32A 1QIMA 1BXZA 3WX0A 2YOGA 1P9WA 1N2OA 1IH8A 4X6XA 1D2RA 1CF9A 1KY4A 1CUWA 5GOTA 3KV3O 1GUFA 1ZMXA 2WAMA 1FUEA 1LSJA 3HP4A 1IY1A 4P7KA 1F5NA 4BWYA 4C08A 3L0YA 3T6KA 5AW9A 2J09A 1P7CA 3VZDA 4L8FA 2BSQA 1GWNA 2PKXA 1XMSA 4FR2A 2X1VA 5BRJA 3CO5A 1K68A 2NU6A 3Q12A 5IANA 1KU0A 4HD8A 1T2UA 3EXG2 3VDRA 2HA5A 3Q0TA 5T6MA 2C1ZA 1N8TA 1DT3A 4F46A 4HBZA 3RS7A 2WE7A 3BDAA 2GCEA 3FZNA 3GVXA 3QA3E 5C3UA 4DR6B 4UHDA 2BFCA 1C0IA 2H06A 1TA4A 2PR2A 3QEKA 2IOQA 4ZQFA 2AI3A 1I2DA 2JGLA 1A9PA 1K5DA 3C7CB 4GEKA 3KEGA 1DXOA 4Q1FA 4W7SA 2WF8A 3SI7A 4BFVA 2BI8A 3FSRA 4KREA 1EBUA 1TJ5A 2J45A 2RHHA 4R9SA 2QF7A 5EZYB 1G5RA 4G0ZA 4C9BA 4A7PA 4BFZA 2XXAA 4N12A 3LUHA 1XRRA 1LRJA 1LDBA 3F6CA 4M9RA 2VUHB 4PNZA 4HNGA 1PD1A 1Y4SA 1HZZA 1QHNA 1U7PA 2PZGA 3QKWA 3EGEA 1E9VA 1S3IA 4CVNA 2VDRB 3C6KA 1JHDA 1LA2A 2MINB 1RLOA 1E3LA 3ZS8A 5I4KA 1NV8A 1TAHA 4D6PA 4DEYA 4YMTA 4NHEA 1WAMA 1IULA 4KSCA 1U3TA 2WIJA 3WIBA 1N9ZA 1LD3A 2ZYAA 2WU0A 1RPJA 2DTEA 2J7KA 3K1JA 3TBHA 2G9VA 2FW8A 2QKYA 3BPSA 3ITEA 4FN5A 1Z6ZA 5E9JA 4QJBA 4L7QA 2RGDA 3LT0A 3RC9A 1QO9A 3PXDA 4GBMA 4JYMA 4XH9B 2OFXA 1O9GA 1WOMA 4N5LA 5DYGA 5KREA 1HL7A 3SYKA 4MKHA 4X7BA 5L95A 1KSHA 1MDBA 3KT6A 1JXQA 4Y1RA 3I3SR 4R2WA 4BGEA 4PN3A 3ABOB 2JH3A 1ZM9A 3KR0A 1Q84A 3O3CA 4J3JA 3A6EA 3NNSA 5IAKA 1QVRA 2P9CA 3F2VA 1NOIA 1O8BA 3KKKA 1SD1A 4XQCA 4UQLA 2IQIA 4ZT5A 1DG1G 2GXSA 1GZVA 3ICEA 2QZ4A 3QQ5A 1WPGA 1U99A 4U7WA 3WMEA 1N33B 1V2HE 2WKSA 4LK3A 1YE5A 4P6VF 2ODQA 4RVFA 1BW9A 3CLKA 4P4NA 1S2MA 2J5QA 3O4IA 4X95A 3UY4A 3VHLB 5EPUA 1KQFA 1Z22A 4IZIA 5FBZA 1LJ8A 4E30A 2C3OA 3AFMA 3OLVA 3OQHA 3TPFA 4F3RA 5BVGB 1ZAYA 4FNGA 1EX7A 2UYOA 4XFDA 4ZQCB 4E51A 3EXFA 1EJBA 4N65A 2W6MA 4YXFA 4BBZA 2RI1A 1ZGZA 1FUKA 3GY0A 2JK0A 1SURA 1E3JA 2PLAA 2UVPA 4YREA 4CM7A 2JHAA 4Z1OA 1GPDG 1NBIA 3CU5A 4AW9A 5EJ5A 3B6EA 3ACBA 5AJTA 3ENKA 3HCPA 5A6SB 2EAUA 2NV2B 1HE4A 5KS2A 1UH5A 3OZRA 3RYCA 2GHIA 3C6YA 1ZD1A 3EVEA 3CRNA 5H1YA 5BW5A 4A2PA 1EK2A 2WJWA 1DP4A 1J0EA 2Q4EA 1T6YA 2F64A 2Z30A 4U7TB 1GU7A 3FAZA 3B3JA 2X0DA 3DD5A 4J76A 3SIXA 3EZYA 2P4QA 4DG5A 4YRMA 2YX1A 1RMYA 3F9RA 2ZUSA 3G2JA 4P8RA 4KR3A 1IXYA 2Z5FA 7MHTA 3MJEA 3QU2A 4CQMD 1DEOA 1VIYA 1S2OA 1TZBA 2VP0A 3NETA 4FFRA 3O75A 3QPCA 3RSSA 2P9YA 1MO6A 1QIKA 4WFJA 4YCJA 3QM1A 2VDUE 3QRWA 2GJ9A 3L0BA 4DWVA 5I9TA 3USZA 4L5AA 4RTKA 3IEMA 2WWRA 3DQQA 3N2GB 5ITSA 1EK0A 4M1WA 3GEHA 3RC2A 5BN5A 2TMGA 2ZXEA 3NKVA 2H4FA 2QW8A 2HRBA 3FMOB 4UNQA 4BPRA 4EBFA 2IPAB 2JFHA 5DNVA 4WIAA 3A4TA 4P38A 1W0JA 1XB2A 3L6OO 2Q6IA 5U4QA 3UAZA 3TQIA 1XHLA 3EVDA 4AKSA 5C1PA 4OXIA 4OI1A 1Q5PA 2W6QA 4INJA 1P1IA 1G63A 5LQNA 4RTSA 4MR8A 5ECGC 1L5ZA 2CLLB 2VHCA 3O92A 4DFDA 1VIAA 4NMXB 2QRVB 2RAUA 3AEXA 3P97A 1JE0A 1XTIA 1NVKA 5E4JA 3NQ41 4E4YA 1QQAA 5IJ9A 4J7AA 2XKKA 4GW3A 3OQIA 4DIFA 1FYEA 1H65A 3WRYA 4DIBA 2H08A 3P2OA 1P5RA 4Q7LA 2HLNA 3TCKA 4CGYA 1RQLA 2VNHA 3U49A 1T1SA 4YRCA 2D1RA 1NHGA 4XB6B 2N0SA 2AKEA 4I8DA 1PUIA 1KJ9A 1ZGGA 1TTHA 2CNDA 2YS7A 2Z04A 3CQ9A 2QTGA 3CZPA 3USCS 1ONBA 2A9QA 3T15A 3UGQA 2G1PA 1Z2EA 2QWXA 3DMFA 3HKCB 4ITVA 4LVUA 1O08A 3RQIA 3COWA 4DXHA 3AEKA 3RV4A 4CIBA 4YP9A 4ZXFA 4UZSA 3BH6A 1JECA 1B3RA 1E7MA 4CXMA 1WLYA 2E87A 2QRMA 2DFPA 5AI5A 4ZVVA 5FI5A 1EVJA 4X60A 4B87A 4BDTA 1WMEA 3TKLA 2RGRA 4TYMA 4Y2QA 4NZ9A 3RU2A 2QNBA 1N9KA 3FYDA 1CNMA 3ZI7A 2R66A 2Z2ZA 2YIDA 2Z57A 3A6HA 4L9WA 3FDIA 2J08A 1JZSA 1V5EA 1YS4A 3KXLA 4MA4A 5FA6A 3V7FA 1CY8A 1RWVA 2PNJA 3VYUB 4HG2A 2A0WA 3N53A 1I9CA 4B5LA 4PVCA 2DU8A 5AW1A 4Q24A 1AA6A 2I55A 3K3PA 4XJXA 4P53A 3T1VA 1TPZA 2F3SA 4KEAA 3STHA 2Q2NA 4O33A 3KQYA 3HVUA 3NPMA 2H48A 3ZYZA 5ALQA 3M0EA 2NQ8A 4LI0A 5IKEA 1GCGA 4EGQA 5BWMA 4JT8A 1P2DA 4BVEA 4RDXA 2A9RA 3PHLA 3LQRA 1REQB 2C61A 3W78A 4YRGA 3U9LA 1C7ZA 1ORHA 2BBSA 1MXHA 2XGMA 1JAYA 1FVHA 3I0MA 2VDWA 4KNYA 4K9PA 4IH9A 1CB7A 3TN7A 1UBLS 4W1SA 1H8HD 2PHZA 2R85A 2ZBDA 2M6SA 4N4AA 1G21B 3RUHA 2VQFB 2NVBA 2P1ZA 5JAQA 1RBYA 3T0FA 2I7DA 3VHRA 4DCGA 4YRRA 1L5OA 5JJCA 1BHJA 1U3VA 2CL0X 3HU2A 1E5LA 3BH7A 3JARA 4PIMA 5E6SA 2DT5A 3WYCA 1J7KA 4C2BA 4F2GA 5IT0A 2VXBA 4KH0A 2GN1A 1AF4A 2DVMA 2ZJZA 3OTIA 4RPKA 1NJGA 3O03A 5F2KA 2APJA 3NGMA 3GWZA 4ESHA 4CBVA 4I1PA 1OXVA 2HWYA 4Y3UA 3W7AA 2R4TA 4ETMA 4QXQA 3ZWYA 1UT8A 3GPIA 3HBFA 1TRHA 2JG3A 1F0YA 5JQWA 1BWQA 1JEQB 2A1TS 3EF0A 4FZ5A 4MO9A 2G9NA 2SHKA 5C8YB 4WRRA 1E2BA 3STYA 4HXEB 3V4SA 2P65A 1JIJA 4EOGA 2ZT5A 3Q7QA 1U11A 3RYFB 2J0SA 4ZDJA 3INYA 1E1CA 5A5EA 2JRCA 4JUIA 1FTSA 1MRNA 4BNJA 2DFDA 5IVPA 1KKMA 1D6JA 5LJIA 5EQDA 2W2LA 1VP3A 4BFWA 1SRQA 2CK3A 1U3GA 4A0GA 1ESCA 1KSFX 1KWKA 5FHRA 4C2AA 2HHCA 4MIEA 3ZV6A 3BL8A 5SYNA 4YRBA 2IHKA 3JQAA 4IKPA 4GE0A 3H13A 3DL2A 1G18A 1U8YA 4ZHSA 2OBBA 3IE1A 1XQ9A 3PXEA 4AZ0B 1KGSA 4UHJA 4C5CA 1WKVA 3EIOA 1PJ4A 3BXPA 1PL6A 3H1PA 4KQIA 4PTYA 5DTJA 4R8MA 3CWCA 1YVDA 3Q7IA 2Y0CA 2O5CA 2NZWA 4JJ4A 3RU9A 3A31A 1A8IA 3A9VA 1ICEA 3I2YX 3ZZ1A 4AMYA 5JAIA 1FMFA 3O90A 1M3SA 4O4LA 3QHQA 5CYFA 4B0PA 2FMIA 1OC4A 2OUKA 2OBYA 4I9NA 2WIKA 3I83A 2JGFA 2BZ0A 1KARA 1ZDMA 3JASB 4FJ2A 1P45A 1UOPA 3KCQA 3LW7A 3THXA 4HS4A 4PG6A 4RC9A 4D4JA 1IXZA 2RGNA 5AKHA 1XD9A 4XX1A 5KU7A 4D79A 4UCFA 2Y1WA 5H80A 5KKCA 4LDNA 1ESNA 4LZZA 2NQTA 4PZ9A 1Y89A 1HPLA 4IV8A 5T4FA 4Y0NA 3SS9X 3B51X 1XMVA 4TKVB 1QH8A 2OAGA 2J41A 2GSDA 2GPBA 4G4GA 4CF4A 4PHFA 4CDRA 4O08A 1PQUA 2G0TA 2XTZA 2FG5A 1EG7A 5IJWA 2I4TA 3L6CA 4FK8A 4KQHA 2W37A 5I7AA 2XMBA 1FTGA 2H5IA 1FLVA 2CMFA 4TV9A 4ARAA 4CUJA 3GJRA 5U9CA 1WMFA 2NXNA 4CM4A 1RT9A 1BX0A 3NNDA 4YRDA 3F1KA 3SCZA 2FUEA 4OQXA 4V0KA 4AK9A 3TTWA 2FDXA 2PU5A 2GNAA 2HDNB 1X19A 2VQ3A 2WFAA 3HJRA 4C0KA 3QU4A 4R1MA 4KXXA 4NOJA 3UK0A 3WLFA 1ZONA 3ZV7A 3G2QA 1EDEA 4RF5A 4JQZA 1O87A 3TEJA 1O96B 5JQGF 1U1DA 2IUUA 3N2ZB 4LVCA 2JIQA 4OP1A 4PW0A 1T3SA 2VK4A 5F1YA 2D4HA 4E32A 4Z1MD 1P2GA 1L2TA 3WGHA 5LQDA 1Z0IA 4Q9AA 3NTVA 4B3IA 3PC3A 2ZM5A 3LO5A 1RZRA 1YS2X 2I2AA 4ALMA 3WKEA 2TYSB 5FWYB 8ADHA 3FF4A 2VYND 4RA9B 1ONOA 2MCFA 1V8BA 2OHFA 1RHQA 5HOQA 4CM3A 3OHSX 3DYIA 4QDJA 4EI9A 1R6XA 2F1JA 1RMQA 3ASZA 2ZJ0A 4HN9A 2J4CA 3DDHA 3MRSA 1ZSNA 1F0PA 2B8TA 1DRWA 4XOIA 5ELLA 3A4IA 2W8BA 1QH1A 3TB6A 4CL2A 4KWCA 4MQFA 1GRQA 3EXEB 4W82A 5EVCA 4MS3A 3WGJA 1GD1O 3L6BA 1K2WA 2P4HX 4Q3CA 4JLSA 1CUAA 4L8LA 4NG5A 4EG0A 3A8TA 2N46A 4QOGA 3VR3D 4YRZA 5KNBH 3HR7A 4TTVA 1XXHE 4G9GA 2VWQA 2VQDA 1EINA 4MV0A 3D4PA 2DE0X 2IXTA 3IHLA 2OLEA 2ZYWX 3CZQA 5KJEA 3ULKA 1XXHA 3MTBA 3TG8A 2CSUA 4ECEA 2OMKA 2QTZA 2XE4A 4WFIA 1TUEA 1KDRA 2H63A 3IEXA 2ZBVA 2CJPA 1PBNA 4AZ3A 1LQ2A 3VH3A 1VKZA 4Q1AA 4JR2A 3K0CC 1NU8A 3D2CA 3KHSA 3KKNA 2J0UA 1DIAA 1XVAA 4C0JA 2YHSA 3D4LA 4IIJA 4M0UA 4PAQA 4CKEB 5K0GA 3TRIA 2EDCA 1CVLA 2HN9A 4WXYB 4B7XA 2YBDA 1X8KA 1SCDA 3WGKA 3HJTA 3B2NA 5ELXA 3ZXIA 1HFEL 1YTLA 1TKRA 3BERA 3AVPA 2G4CA 4QYWA 1YK1A 2E1RA 3AGPA 1ZVMA 1BGVA 3GRZA 4E4RA 5FI3A 3TCNA 4HAZA 4EEZA 3N39C 1DG3A 4MMZB 4B6PA 5EIXA 3OZGA 4GMXA 2POCA 4KFSA 1M0EA 2PG3A 4M8NE 2PXAA 2QL7A 3LUDA 4BNGA 4CLRB 1E5XA 1DKLA 2XLCA 4YJ2A 5DM2A 3W06A 3WIDA 1Z0FA 4MPRA 4MV6A 1NW4A 5KWJA 4ZQEA 3JQCA 3B70A 1QGYA 4KMSA 2FPIB 1KF0A 4R4JA 1KRWA 2P3SA 1Z75A 1MB0A 1UC5B 3IJRA 4N3BA 1PZMA 1H2ZA 4HADA 4RZQA 3DGEC 2DQKA 1EG2A 1J0AA 4JNKA 3L5KA 1U04A 3GFFA 4J07A 3V4ZA 3VSEA 2P77A 4WY8A 2ZIEA 4CLOA 4HFJA 5T4EA 2AXEA 3K2BA 4UUAA 1MJFA 3LX5A 1HOXA 1LRKA 4MIOA 3OKAA 4KO3S 1H9BA 2HQRA 3JTMA 3VYRB 3RVQA 1D07A 3H87A 3MJFA 3AHGA 1TTTA 3VO2A 3QEMB 1SCIA 3SXUB 4KPEC 4LYDA 4NEHB 1A5SB 1WXFA 2BMEA 3KR9A 3OEEA 5C5CA 2PRKA 2OP0A 4RY9A 4D9GA 3GLQA 3JQEA 1T5BA 5AJUA 1JIUA 1BJKA 4GECA 1U2DC 1MORA 5CCBA 3HJFA 4HFNA 1MO2A 4H4DA 1TL7C 4G9BA 3OC0A 4IUCS 3OD5A 2WWTA 3L41A 3C97A 3DOHA 1LVHA 3TBKA 2W6JD 3OZWA 2PYDA 4AS3A 3PC6A 3LRTA 2C78A 3ZD6A 1A9RA 1G64A 1HFKA 1ST2A 1TYCA 2J6IA 3NXSA 1GDTA 2XADA 1B8NA 3O1HB 1KDVA 3BMQA 1ADFA 4Y9UA 2IP1A 2I22A 1V1MA 2FI1A 1HZJA 2RHDA 2ZRBA 3EAGA 3LL4A 3O9MA 4X1IA 5FB3A 1FSPA 2EHJA 1XQXA 1N7JA 5KIAA 4L22A 3MB5A 4X66B 1SC9A 4MWEA 2ROQA 2KI5A 4KC0A 1J2YA 5AVUA 1ESZA 3PDIB 3N2IA 1KI9A 4H4CA 2ISSD 4W1QA 4BO5A 1BX1A 4BO9A 2M98A 3AZPA 2PVSA 4F86A 3B36A 3H97A 1DUSA 2PFKA 3A7DA 3GP5A 4LJYA 4AUKA 1N1MA 4M9UA 2OFFA 1SOUA 1GNRA 3EBPA 4O4HB 3NIWA 5COAA 2JCGA 3I0ZA 1L3BA 4UBIA 3SE0A 2DCUA 1YL6A 2H3EA 4KN5A 2PM8A 2IE0A 2WHYA 3I2IA 4QHYA 5CNMA 3S44A 4ARBA 4CNBA 4Z3KA 5KTOA 1BN6A 3C3AA 5GY7A 2HM7A 1NMEA 2Q0QA 2C96A 1GRCA 2HA0A 2IUYA 4IJWA 4U00A 3SX0A 1UP7A 2IJGX 2GD6A 1JIKA 4AN0A 2AG0A 4YMSA 4KR9A 2I80A 2Q50A 2WDPA 4J7XA 2REQB 3W5VA 5DVZA 4EY4A 2EKZA 5H4GA 4RTOA 2EJTA 3LY9A 4F6RA 5FWNA 4JEMA 1GL6A 4NI5A 2YRWA 4B3TB 4MDHA 2PBZA 1YE3A 3MW8A 1RRVA 4GRAA 1G17A 4O2LA 3SLKA 2R7LA 1Y7IA 2AR9A 1Y5RA 3CH4B 5BW8A 4N9QA 5EINA 4YJ2F 3UWSA 5CVTA 2ZRGA 4G23A 3PI6A 5TPZD 1I6WA 2G77B 3I5MA 1F14A 1SZJG 2XCQA 4KN6A 1NIJA 4CUKA 4MEBA 3TRHA 3L7MA 3H16A 6REQA 3AVQA 5TV2A 1EFPB 1O7JA 4GM1A 5DW3A 2O0LA 3W9YA 2PAAA 1WXXA 1SQFA 1VE5A 3TAUA 3PJGA 4N0PA 4ZC1A 3W0LB 2V7TA 4E0BA 4ENSA 3TVTA 1BCRB 3HACA 2C2WA 3FPSA 1LGYA 3OFKA 2BGIA 2UDPA 2BP7A 1GNPA 3NIFB 5EXXA 2HLHA 3RUAA 4EF6A 4DRXA 3HP1A 4IM7A 4F21A 2W0MA 1PWYE 2VWPA 2WR8A 2ZJ6A 3PFCA 1K6XA 4WUVA 5CURA 5DXAA 4NWIA 2R7MA 3L3BA 3JR7A 4OJKA 4KR0A 1HRDA 4ESVA 5DT9A 2WG2A 1OSNA 5GGXA 4C3OB 5BXYA 2BFFB 3EYWA 2X8LA 2FWPA 3OF5A 1L4YA 2QPAA 4K05A 5E1MA 3VM6A 3QKIA 4XJVA 1BE8A 2OK7A 2LCIA 4UTXA 2I87A 4FHCA 2A0XA 3BL6A 3OU2A 1J6UA 4LKOA 1O57A 4DOMA 2P3LA 5KQSA 3RIHA 4FFBB 1KY5A 5L3SB 5H82A 1U5BA 1LS6A 1XU4A 1HLGA 2FW7A 4ETNA 3IAUA 4WWHA 1DUIA 2VK2A 4ARZA 2NZ8A 4IH4A 1DOAA 2VH5R 3U4GA 4AYXA 4I5FA 3LX6A 2IUEA 3UYKA 4QRIA 2O5VA 3T41A 5AW7A 3N6XA 2R6DA 3T9BA 3BD6A 5JWHA 2PZAA 2Q5QA 4ZARA 2FQQA 4RH3A 4R1SA 1GTMA 1SCQA 5DNYB 3OSUA 4ECAA 4CEIA 5D01A 1MW9X 2ISCA 1TC2A 5KDDA 1H1DA 4C6SA 5CIYA 5A9SA 2CNOA 3OLXA 4ZI7B 1T5TA 2V6GA 4F5DA 1YHNA 3PNYA 4MW1A 4ZKEA 5F7XA 2J3MA 1OI2A 3U3XA 4KE8A 3GFOA 3RYHA 3U39A 3E7FA 4KIFA 3U3OA 4C1BA 4EMUA 1IRXA 1FL9A 3HHPA 3K6JA 1UFQA 1W5TA 4MCJA 4B6JA 2OHJA 4JROA 4HWRA 4LC1A 4EKNB 3R9WA 2OYCA 2OG1A 1O6BA 2GR9A 1U7TA 3ESDA 3LDAA 3UPUA 5G1PA 2HKIA 3ZTYA 1JU4A 4G2NA 3REQB 1Q7RA 3DAOA 2QVXX 4HQKA 1B15A 2DBVO 2PH7A 2QPOA 2YN4A 1RHJA 3AB8A 4X84A 2XUPA 1RWNA 2HF9A 3D02A 1HTBA 1II0A 2ZUBA 3I6YA 4ZALA 5JCOA 3D81A 3SDBA 3A36A 1DAPA 4PBTA 4L4SA 1G7SA 1M2KA 1Y33E 4I4IA 4ON9A 3DO6A 4XGIA 3C1UA 1BVRA 4KPGA 4J49A 3RSQA 5IDVA 2SICE 4HEHA 1JT2A 2PWBA 2VHEA 3VVMA 4DGSA 4RJJA 5A05A 1WDLA 3URKA 3U26A 5FA8A 4G89A 3ZCVA 4CT5A 2XMDA 3OE4A 4G1UC 4J0JA 4FYJA 4KYVA 4UAJA 2NU7B 4E3ZA 3ZOZA 1E79A 1D2GA 4XDZA 5ILQA 3FDFA 3OU6A 3U16A 4A15A 3BTUA 4GZLA 4CL0A 1Z36A 2QTCA 3MJVA 4LSWA 1RJ9B 1FBNA 1EA7A 3BWMA 4QSMA 3R7NA 4DLTA 1NRXA 1T36B 3HM2A 3OETA 2BF7A 2JJ1D 1PZXA 2GYYA 3PRKE 1Z17A 2J0VA 2VDQB 4GZMA 4LY9A 3H2GA 1PEYA 2DCMA 4KRYA 4KXYA 5AVJA 4EJ0A 2QM7A 4IDQA 2AB0A 3SQOA 1KVQA 1OQAA 1UKYA 4MJ3A 1HE5A 1ZGBA 2O8NA 1PE0A 4B7UA 1JNXX 1F6WA 4KZKA 1ZOLA 4GOND 3GZJA 4J9VA 1X8JA 2ONZA 2R00C 5J1SB 2WF6A 2ZTVA 4WDQA 4EZBA 5KYNA 1TTPB 2BDEA 3CGWA 4IJQA 2TSYB 5IAGA 3UMRA 2YJTD 5CJJA 4D9JA 3RARA 3REFA 1W1IA 2V7UA 5TC4A 1RWXA 5JEEA 1M1UA 1MGPA 1ZJZA 5H9VA 5KTMA 2QN9A 3QWIA 4HLDA 1ZC3A 3WIUA 2VLBA 1ZVVA 3A14A 3U44B 1WUKS 5IBQA 1CUUA 4G4JA 1NI4B 1WY7A 5HUQA 2QIOA 4M0DA 4IYRA 3FOAA 3C39A 1IXKA 2G63A 3DLBA 1JH9A 3ZXXA 2SBTA 2FQ1A 3LRXA 4WECA 5FLYA 1JSRA 1PEDA 1ZW6A 3K5HA 3QXHA 3ILVA 4Y6OA 5BSTA 1PJ2A 2ZJOA 3DDNA 3I39X 3RVKA 1PLLA 2OCXA 1J70A 4F3CA 1VCHA 3AKZA 1XD8A 1NDQA 1QYVA 1NGSA 1R6BX 1FDIA 3GFTA 1Z8DA 3S2GA 4Z4FA 4DIEA 1M2JA 4PG4A 1AQ6A 4BKOA 4C3VA 1GTRA 3AESB 1KXZA 4KXWA 2UYGA 3DP9A 4CKBA 3ZOKA 4L76A 4BL5A 3X2SA 2PT7A 4UVDA 5DCLA 3DZ8A 5SYAA 4B4WA 3GOHA 3HLKA 4A73A 5L4LA 4DSOA 2DLNA 3I4LA 3GJ7A 1R8SA 4R6WA 1GGMA 4MGHA 2IU6A 2PUCA 4CI0B 1CQPA 1GSHA 1R5JA 1MKYA 1VP9A 4LXQA 2PS0A 1L4MA 4GO1A 2QAGA 4DSTA 1BA3A 3C3XA 3CNLA 1LV8A 4KQGA 4O4JA 2FPUA 1A5ZA 3PIDA 4P31A 2ERCA 5HUHA 4NEGA 1RADA 1SHKA 1YL7A 2GMWA 4RHFA 1OY1A 1MAAA 3AWIA 4MW5A 1A7JA 1MFPA 2QG6A 2QZPA 5F2OA 4FOOA 4RHCA 1GCUA 2G1KA 4LJSA 4L15A 5JECA 1L9KA 4IRMA 2BT4A 2VAWA 3DAYA 1KK0A 1J39A 1L5QA 1G5PA 1QCCA 2GBLA 2H4JA 4OAQA 5FPPA 1UQUA 1UQRA 1F8UA 5FUWA 4A92A 5IJXA 2LW7A 3F5FA 1HMYA 3ZV3A 4ES6A 1W0KD 5E2IA 1CU1A 2VL7A 2ZB2A 4TT3A 2BHSA 4DDUA 1U0BB 3ACCA 3QPDA 2AEFA 5BWOA 4QJ3A 4URFA 4YAKA 2BAGA 2V6JA 1CUZA 4ZGWA 4YCLA 4KQMA 5LOVB 1CQZA 2PFGA 3SGLA 1MHPA 3IQDB 3IOMA 1NR1A 3JYLA 1Q7GA 1JBKA 1IOLA 1KFKB 4MARA 4PHHA 4ZO8A 1R4MA 5KI6A 3PZRA 3V4VB 1WMDA 3V1KA 3VR5D 5JE8A 4AUNA 1DIRA 2DEUA 3ZE2B 2I3AA 5HE9A 3DONA 2MR5A 3FGOA 3V3KA 3WLLA 2PVPA 4BB6A 2W4QA 4IQFA 1VBFA 1K86A 3MAJA 3MCTA 1ADYA 3FE2A 4IIVA 4FQ8A 1XK7A 4GE3A 2L2QA 2O2IA 3P71T 3WIEA 3FD8A 1BXGA 3FKQA 3GGJA 4U5QA 2EKPA 3AEQB 3VSBA 1X94A 3KUDA 4D81A 1U9YA 4E1VA 4M22A 5IVHA 3R3YA 4QDXA 2VSXA 1Q44A 3FWYA 3T7EA 2OCLA 3FZEA 3ZWQA 2PMEA 3B1FA 2DQYA 1C7FA 1UDXA 4G4IA 4XEHA 5K0NA 3ZWDA 2IY7A 3LGXA 4RL4A 1RNLA 4RPCA 4F3YA 2P9EA 5AVOA 5DTEA 3ROFA 4JXXA 1LJUA 5IZCA 4JT9A 3NWOA 3DE1X 4K9NA 3PTLA 4MKXA 2C7PA 3EZLA 3B5JA 5KQLA 2PRSA 1IQRA 1V41E 2IT1A 2MMGA 2A92A 1P1RA 1P7PA 2YICA 2JCVA 2M1XA 2WSSD 1J8QA 4HOYA 3Q3EA 3QA9A 1IK6A 2UUAB 3FCEA 4IHJA 5CT6A 4LGVA 1X15A 2AKYA 4WKPA 1KSGA 5HQ3A 4R8SA 5D3MB 4WCVA 4RZHA 2DHQA 1UOQA 5KVQA 5BUSA 3CF4G 5KOYA 2DERA 2TS1A 3EARA 1KJNA 1MDFA 2AQ8A 4NSNA 2HWWA 5EQTA 1M6VA 2JEOA 4H0NA 3NLLA 2J59A 4BNNA 4K0RA 5F98A 3U3RA 4WW0A 3ZHZA 3WGUA 4MKRA 3CKKA 3F6PA 1R9MA 4PRYA 3A6FA 4Y8VA 3U4IA 1ADJA 3FSGD 3KO8A 5E7JA 1QC5A 2HMTA 3IAFA 3LQKA 1G8GA 3PSHA 5CX4A 4OGWA 5AOBA 2UV8A 3RVOA 3UN1A 1P9NA 1RXVA 1TO1E 1XZEA 1X7HA 1Y9AA 4QEDA 4LWQA 4YY3B 1QVWA 4Q9NA 3M6IA 2WU4A 2RGWA 5T67A 3VC1A 1QGDA 3H83A 3HXPA 4HAYA 4M9XA 4PSAA 4B9AA 3L9WA 1E0AA 2X5JO 3ONEA 4JKYA 2XXAB 5D6NA 1YS6A 5C53B 3G2PA 1E6LA 1EM6A 3R6GA 2Z6UA 2O8CB 3BD7A 4JU8A 5EKDA 3RRFA 3OZ7A 1KEUA 4P3YA 1BN7A 2C4WA 2I8AA 3E53A 4QELA 5CLGA 3DBOB 5AHRA 1SBCA 3WTBA 1OI7A 3OTGA 5DLPA 2OORA 2HYIC 1HK7A 3MN1A 4BVHA 5JDIA 1AXEA 3ANMA 3PUXA 1TM5E 4YN3A 2Z8XA 1Q6ZA 3CEAA 4B32A 2XRZA 3PXUA 1K7EB 4O0LA 1GQSA 4Q7EA 1ODTC 3PPYA 3OPNA 1N6RA 5CK5A 1XZPA 5HBGA 4RF4A 4LHVA 5DX8A 2ORIA 3B5EA 4FS8A 3DF7A 3IMCA 4R0VA 1TYDE 1BEZA 1YB1A 1V5GA 2BFMA 2NNWB 3KHTA 3OTQA 2P9BA 3KUXA 4MQ6A 5K3SA 5BR1A 4XR9A 5ALHA 3PGJA 3U3KA 4BDSA 5AP9A 2ID9A 4K9OA 3MPOA 3B1KA 4TM7A 5C31A 1A7KA 1LSUA 4BFUA 3KOZA 4IZOA 3RWBA 2HLDD 1GHTA 1UPBA 1Z6QA 3TTVA 2GVDC 1AVTA 1AQIA 1U6IA 1M8GA 3FR8A 4BVJA 5GPBA 1UWKA 1UKZA 1OMOA 3F96A 1DAMA 3LJKA 1RJGA 2QLLA 2WP8J 5A4FS 1RC1A 4C5AA 1NXXA 3I2FA 1J07A 2I67A 4P7JA 2H85A 5AKLA 4P7BA 4AF7A 1DG9A 1I94B 4DQUA 3OCZA 4WPGA 3RABA 4WA7A 2BTQB 1BW9B 1N8KA 4RD6A 3A28A 221PA 5AJHA 1GQQA 1V8OA 3ZY6A 4BCCA 2BR4A 2PBFA 2ZR9A 5P8WA 3V4RA 1BMDA 3EEBA 3LX4A 1QZUA 5BRNA 2GNPA 4KWIA 2YNMA 3HBMA 3UJ9A 3R9XB 4NFSA 3EXFB 2AR7A 3IMFA 1VZ3A 1PEAA 2G70A 3Q87B 4HGQA 3RVRA 1ZHOA 2W58A 3P2KA 3A27A 5ED0A 4PC3A 5IASA 1K88A 1CY4A 4IHJF 3S2ZA 5DF1A 4ND6A 1OPRA 1JR4A 1JKJA 2ZRCA 4G0NA 2OCPA 2PAFA 3H4MA 2RG7A 2WKWA 4DA4A 1RI3A 3V8MA 4II3A 2WPNA 5LQSA 4V1CI 2GPSA 1V1JA 5IP5A 5FOXA 3LYUA 2JI6A 2VPQA 2ZS8A 1T13A 4NYMR 3F9IA 1PTJC 1Y5IA 1OBFO 3BN3A 4MXDA 4LJ9A 1WSAA 4I8IA 4PAOA 5FWXA 3WKBA 1SUEA 5AVKA 5KTNA 5MN4A 1LPNA 2NMVA 4IVPA 4A0RA 4MW0A 3DPIA 3P9KA 4ZT2A 2QYTA 2R4UA 5CVCA 1QFMA 4A23A 4JMLA 5HE8A 4DCPA 5BNIA 1PQPA 1KEEB 4CKWA 2B9VA 4JVLA 5BSGA 3CRVA 5KKNB 2ZB4A 5KAMA 1O94C 1Z0SA 2YYZA 4YJHA 4AIRA 2QT9A 3GHHA 1LLFA 1GP2A 1TU3A 2H92A 2ZBQA 1BGXT 3IKMB 4GPZA 1GRRA 3TW0A 3EF1A 4FFMA 1IY0A 4L28A 2B8JA 2ZAMA 4GSYA 4WOBA 5G4KA 4NC9A 2VEDA 1L5LA 4BUJA 4I5EA 3OURA 1RE1A 2EWMA 1VMEA 1RKUA 2Z95A 2ZI4A 1Z35A 2ZFUA 2ZT8A 4OQDA 4ZVKA 3VZQA 4BTVA 1VHTA 3T35A 3QYAA 3R5KA 5G41A 4YCMA 5JADA 3M82A 4EUSA 1KO7A 1BD4A 1Z15A 1NBAA 1HT3A 3AM4A 2REBA 3R3VA 5LMZA 1FQKA 2ASVA 3ZW7A 2WQ6A 4Z3OA 1VHDA 3GMDA 1G8HA 3D3EA 1Z8FA 5LQRA 4YMLA 4QM7A 3K0FA 1V4NA 4EF5A 5IN5A 2G7ZA 4BJ6A 4TZKA 5DNAA 1SB8A 2ZSUA 5IJ9B 1FMCA 1ONNA 1N5OX 4GXRA 5KINB 1CUVA 3ILYA 2C5HA 4V0OA 3RK0A 4KMOA 1NKSA 1P4HA 2KJQA 3EVCA 3IHTA 5AICA 5CG2A 2EBWA 3L7JA 4CFZA 1YB2A 5FI1B 5F52A 4F60A 1Q77A 2JEZA 1NVAA 2R8RA 5IMBA 3LCRA 4HDAA 4PG7A 4XPZA 1J42A 3IP9A 1N75A 1W30A 2NX2A 2ZTUA 2QUHA 1R18A 3QIVA 4JC0A 4JJAA 2XZDA 5CFQA 4BTEA 4RTNA 1NX9A 1LWNA 3OTWA 4IZHA 4X9XA 3SF8A 4DMLA 4RTRA 1SK8A 2IXGA 3E9QA 2YZ2A 1O2DA 2ZYVX 2FZEA 3MERA 3FCAA 3KEQA 4E2XA 2OGWA 3KWJA 1CNFA 2YRFA 4R05A 1AT1A 1R0BA 1KS9A 2QVLA 1YR1A 2XWPA 4E5SA 3Q3IA 2VYVA 1WZNA 4OA8A 4JEUA 3WLRA 3ET5A 3W3AA 3EC2A 3QWAA 4UHCA 3EGWA 3ZC3A 4EY7A 4V24A 2JB9A 1CR2A 2VNKA 3HCNA 1QYDA 1H6BA 2NU9A 4NIMA 5LYYA 4JBYA 2EYQA 5B7QA 3O2QB 2H2DA 4G5OA 4FYIA 4J7UA 1GTG1 3T12A 3F1LA 2VZ9A 2C2BA 3I4FA 4XARA 5WRFA 3VHQA 4E5DA 2D4AA 3IB6A 4F71A 1DAOA 1PLKA 3FUCA 3UJ6A 5D85A 4R01A 3BXZA 4LYGA 1Y1KE 4HTFB 3VKVA 4UPVA 3EQ7A 4EMTA 2BZSA 1NP6A 4RV9A 1JP7A 4LXHA 5AHXA 3FFWA 2RHRA 3A25A 1B6TA 1EX6A 5ECDA 3UMYA 1WTAA 1QGUA 2B8EA 4I66A 4RPLA 3VOBA 5EUMA 5C1DA 4M55A 3ZWPA 5I4BA 1D2MA 4NYIQ 4C2TA 1LJLA 3VDNB 2ZVPX 3O47A 4LXXA 4DWJA 2QW1A 4QATA 1VHQA 4H60A 1H8EA 1YJXA 1MJNA 5HBRA 2UUBB 4JLUA 4DLVA 5LD2B 4IFIA 2SCUA 3HSYA 2OKCA 5KOHA 1OJLA 5E6SB 1L7OA 3R40A 1OBVA 4JQCA 2HOQA 3BTOA 1ECJA 4RE5A 4REQA 2BELA 5ITWA 2GXAA 1VL1A 4JYBA 1C3OA 5DN6D 4H3HB 4QWMA 3E5HA 5L3VA 3LV8A 4W8OA 3CR3C 4NYJQ 1PWXA 1I9GA 3L02A 1SUPA 2A1UA 2BL4A 2XRYA 4CM8B 3T5AA 3BZBA 4R2HA 4ISBA 1Z28A 4B09A 2OR3A 4FMCF 4BQPA 1J06A 3GA7A