2VSXA

Crystal structure of a translation initiation complex
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
382
structure length
366
Chain Sequence
QIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Yeast Eif4A-Eif4G Complex: An RNA-Helicase Controlled by Protein-Protein Interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation/hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE EIF4A
total genus 120
structure length 366
sequence length 382
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA02
1Q1EA 4X8HA 1YR7A 5JHGB 2AR7A 3UIEA 1T3SA 5KSOA 1R4AA 3BFVA 4DC9A 1RPZA 1M2OB 4EPRA 5F9HA 1GAJA 3BWDD 4HAYA 2H8KA 4DCTA 2EFEB 5FUXA 1VG0B 2FNAA 4NKRA 4OHXA 5FTMA 3MWKA 1VKJA 3EZ6A 3Q5DA 4BASA 3OIYA 2F1JA 2HXYA 1FOEB 1W4CA 1CTQA 1LV7A 2FWRA 3CNNA 4PO1A 4TTQA 1YHNA 4OI4A 3TLXA 3W6OA 3K0AA 1NP6A 2ZI3A 4BFZA 3OEHA 1P62B 3EIQA 1HT2E 1JAHA 1OIXA 2WJGA 3MG9A 5KNDA 3OIWA 3QG5A 2XNDD 2YWFA 2BBWA 4QC2A 3FHOA 3FFBA 4BEJA 2ZEJA 1KI3A 4CRWB 3H2YA 2AK2A 3NBFA 3IKJA 4ZDWA 1W0JA 1OB2A 1NN1A 3WP0A 2EFGA 2GZAA 3GEEA 3CWZA 4RY2A 3KX2A 3ZVMA 4JLJA 1P60A 3KKQA 3SFVA 3DKVA 3QSYA 2O8DA 2W0SA 2KB0A 2B7CA 4Q21A 1DBSA 3OE7A 4MYUA 4QHYA 4A15A 1ZM4A 3OEEA 3CRW1 4HUTA 2GTPA 2DFKB 2EYUA 2ONKA 3NBZC 3VQTA 5IF9A 1XMSA 3WNDA 1G8YA 2ZI9A 3AF2A 5JEDA 4W5WA 2JGNA 2R6GA 4OHYA 2VP9A 4OKSA 4RD3A 5IK2D 3A8TA 4FN5A 2Q3HA 1UM8A 3NXSA 1GSIA 1ZD8A 2XSZD 5AUOB 5HKKD 3K8YA 5L3VA 2QT0A 3LRPA 5C2JB 2ZYWX 4L9WA 2GVZC 3R9WA 2XTMA 2ZRNA 2OFOA 1E9SA 4KFRA 4NE2A 4PC7A 4C0HA 3CONA 1KI6B 3VHLB 1TU4A 2WWFA 1AQYA 1FZQA 5CDFA 2EYQA 2HJVA 3CRRA 4CGZA 2X8AA 1ZM7A 5KU1A 2VSXA 2Z83A 2E87A 1GILA 1GRQA 3QJYA 4B74A 3KXIA 1ZMXA 2GF9A 1Z0DA 3K0EA 2YWGA 4TTPA 1JQLB 1OIWA 1RIFA 2GJAA 2QU8A 1I4DD 5LB2A 4AD8A 1OXXK 1Z83A 3I92A 3K09A 5JI3E 2ZPTX 1G64A 2WOJA 4EPYA 2GESA 3R7WB 3G0HA 4G5SA 3A4MA 1XEFA 3P4YA 2BCJQ 5TXGA 2WICA 1ZU4A 3GMTA 4LYHA 2QE7D 1Z0JA 5L3SB 2YC2C 3CZQA 3CPJB 5EJEA 3EA0A 2GAOA 4NU0A 1C1YA 4DLXA 1CEEA 1GG2A 4DDWA 4MGZR 5FR1A 2O0HA 1COWD 3GPLA 1E32A 4L4UA 1YRBA 4FINA 1O3YA 2ZJBA 4PQYA 2IYVA 4JVNA 1CJUC 3W90A 1NMXA 2AFHE 2YKGA 2ZUBA 5C4MA 1W48A 2VYFA 2XXAA 2BM0A 1KOFA 3L82B 2FA9A 2ZQ5A 2FSHA 1E2PA 4TLBA 1MABB 1KK3A 2AX4A 5FOSA 2WJIA 2ODBA 4AKIA 3PFIA 2ZYVX 2IUUA 3KUDA 1H65A 2ZRGA 4BLOA 1VIYA 1JI0A 4M1OA 2NOAA 4C0KA 2ZANA 3SDZA 4L5BA 2OV2A 3OFNA 2IXFA 2TMKA 1ZU5A 3TSZA 4DLUA 2GRJA 3DO6A 4ZCMA 3KJHA 2A2ZA 2AN9A 1A4RA 1Z08A 2AFIE 1KSHA 2OXRA 3BH6A 1PLLA 2D3WA 1VG1A 1WCV1 4KXFB 2RH5A 3E1SA 2HF8A 5J5CA 4XVUA 3AVWA 4EJSC 2GK6A 2GXUA 3CM0A 3IEVA 2GZDA 2ZSFA 4OQNA 1M6NA 2W6JD 1ZD9A 2YV5A 3C7KA 5DI3B 3IGFA 2RMKA 3GLFB 4OHZA 3JVUA 4AG5A 2F55A 4P3YA 2WHXA 4TMZA 4HAXA 4EPTA 1SVOA 4HZUA 5LD2C 2BBOA 4QNRA 1W4BA 4HDQB 2JLWA 1G41A 3TSWA 4M9ZA 3T5GA 1E0SA 3T12A 4QFMA 3IBYA 5CYPA 1H8EA 4DB2A 2O8FB 4PO9A 5DLQC 3AVOA 4D0NA 3PUVA 2ORVA 3SYKA 2GEUA 1XCPA 4MRRA 2SHKA 1Z07A 3THYB 2ANCA 1U0HC 2WWGA 1OFTA 3FGNA 3S1AB 5JCPA 4I81A 3BAFA 1CULC 1RZ3A 5GVRA 1DADA 3TH5A 4KBGA 4CEHA 2CLSA 2QZ4A 1E0KA 3EG5A 5TDHA 4EAQA 2G9NA 2QAGA 4FW9A 2IYXA 4H9GA 1NBME 2OM2A 3PUWA 2JLZA 4RKFA 4CW7A 4IFEA 2DWPA 4MRNA 1DAKA 1EG7A 3Q8XB 1Q21A 3B85A 721PA 4GOJA 1B0UA 3LY5A 4CIDA 1DG3A 1KMHB 1VYVA 2GK7A 3LWNA 1F2TA 2A9KA 3DM9B 3W3ZB 3AF1A 1GOTA 1YZKA 4FXPA 2WOOA 1X1RA 2P6NA 4NCHA 4KBFA 2QY9A 5TV2A 4XWOA 4V02A 3CF0A 1E2FA 2IEZA 2AKYA 4U7DA 4W7SA 1ZM9A 4ZI3A 3OAAD 2G1JA 3C4JA 1JECA 1FQKA 4DCVA 1W2GA 2PBRA 1XD8A 1KGDA 1CKEA 1HE8B 4PANA 2O5VA 2C77A 1NN5A 1XTJA 2J41A 1NVUQ 3RC3A 1MO6A 1KO7A 1S2MA 4HAUA 4LCBA 1D2NA 3GJ4A 3D31A 2PEYA 2WAXA 3TSOA 5FPKA 2GEDA 1E9DA 5TMPA 3KB1A 5KNBA 2HUPA 3H86A 2OESA 3F5FA 3LBHA 2GETA 4C0SA 4DDUA 4RFVA 2DFLA 2IXGA 5FBWB 1Z8FA 2I3BA 5J40A 4Z8YA 4A2PA 4BRWA 3Q72A 1E1RA 2FOLA 2A78A 2RKOA 3TVDA 3D7MA 1FMJA 2ZU0C 3T1QA 1KK1A 1XEXA 3W9YA 4M1WA 2D7CA 2ZSBA 4PQRA 5CITA 2C99A 3EIEA 4DLWA 1D9XA 1G17A 4Q9JA 1CJMA 2QN6A 1NVWQ 3DEFA 3TE6A 4BFSA 3K70D 2QBYA 4UNNA 3LXRA 2NGRA 4I1VA 1PLJA 3AQ4A 4LJ8A 1R5NA 2OEPA 2A7QA 5FL3A 4ABYA 4C0BA 5JI2E 2ZRJA 2RCNA 4BLTA 5FBVB 1Z6GA 1OV4A 1XX6A 1OW3B 1G6HA 2J45A 2G1KA 3SBEA 3OEED 4OBEA 4WAUA 4C9BA 5KNCA 1G7CA 2ERYA 1P2SA 1E0JA 3B7GA 3X1DA 3PUZA 3RABA 3MRSA 4LBZA 5FUWA 5JJKA 1EESA 2GNOA 4A0RA 4LOAA 1AQUA 2XNSA 1E79D 3S1AA 2GF0A 4RFSA 1SULA 3P32A 6Q21A 4TYNA 2F1IA 4WIAA 2IS4A 1XCGB 1G3QA 3DOEA 3AF3A 4PPFA 3ZIAA 1BYUA 3FKSA 3FWYA 1U0LA 1N0UA 4PQFA 4ZKDA 2H16A 1S1MA 1E98A 1KIMA 2FSFA 2QORA 2R6AA 3EZFA 5F9FA 4JKYA 1OYYA 1HQYE 2JEOA 4B47A 3FOZA 1IJFA 2UVQA 1RVDA 2QA5A 1KI1A 3K53A 3PIRA 3RS7A 4BFXA 4H1VA 4E09A 4QGFA 1I2DA 2XJ4A 1XPUA 1PVOA 3SOPA 3GLFA 3B1VA 3IIMA 1EFRA 3GJ7A 3K9NA 4V0OA 4EJSA 4WXPA 5B58C 5JJLA 1U2RA 1NKSA 2BMDA 2XOKA 2RGAA 5L3RA 5K8TA 5LDDC 3BB3A 3U3JA 2AWOA 4TL6A 3RDPA 3VKGA 4MKGA 1YR6A 2V7QD 1VCMA 1P9WA 1AKEA 3AKCA 3L8ZA 3NG1A 2WIBA 3LLUA 1TEVA 3GLIA 2FU5C 1P7CA 4D81A 2YOHA 5FBQB 2NG1A 5FTKA 4KLZA 3AB3A 4NDZA 2OAP1 3LBIA 1NVVR 3C5HA 5EXTA 3EX7C 1CS4C 1DO2A 4QG7A 4XD7D 4BPBA 1KYIA 2R9VA 2OFXA 2J7KA 4B3DA 3M4YA 4KJZA 4E22A 3UKDA 5FBLB 4BFVA 4DUGA 1R0ZA 4ZIRA 2XXAB 2HCBA 2JATA 2QMHA 2IS1A 2Q3MA 2EWWA 4MYTA 3IO5A 3PJRA 1GTVA 4Q9IA 5CB8A 2VP5A 4HLDA 5KHOC 1RRCA 4QJ4A 4NYMR 3Q9LA 3SJAA 3I4LA 5C1BA 3KQKA 5BN4A 4G5RA 1TL7C 4TYQA 2QPAA 3SN6A 3WRYC 5ELXA 3WYFA 1QHXA 1G3IA 1E94E 4A8JC 4ARZA 5DH9A 1R2QA 3NBYC 2HYIC 5JWHA 4Q01A 1EFCA 3QXHA 3SJBA 4ZI2A 3P4XA 3EZ9A 2DR3A 4GT1A 1QRAA 1ZYUA 3RNLA 4GDFA 4MYCA 5L8VA 2JLVA 2QAGB 1RYHA 4US1R 1OT3A 3HU1A 2D2FA 3MGCA 4UNQA 4XWKA 2FN4A 5GADl 2IW3A 3K9GA 4LK2A 4BZQA 1GNQA 2ODWA 3QXSA 2VL7A 3AVXA 2D74A 3FE2A 2RGNC 5LB4A 1UDXA 4Z1MD 3F3YA 3U7GA 2P3SA 4DLYA 1W44A 3WNCA 2VBCA 4TZ6A 4OK6A 2CE2X 1IN6A 4NCIA 4M1KA 3ZDQA 4TQ9A 2ZYUX 1CRQA 4XWAA 3SZRA 2ZJ2A 3R8FA 1N5IA 2ZR0A 1D2EA 4LBYA 1PZNA 2ZJOA 3GP8A 2QQEA 1CJVC 1JNYA 1Y3AA 2ODNA 1YE8A 1JR3E 4WOPA 1MRNA 2NO7A 4TTRA 3IQXA 4IDQA 1HT1E 1T4GA 4HSEA 1DVRA 4QKQA 1JJ7A 2G3YA 3ZS9A 2BEKA 2C03A 1VCIA 4TWZA 1W0JD 5DNYB 3DPUA 2OFWA 1A7JA 3K0AB 3PV0A 4CEJA 5DN6D 1YZGA 5L3QB 2J59A 3FB4A 3RS0A 1Z29A 3GJ0A 5G3YA 1S4QA 1G5TA 2HT1A 4GFDA 4JL6A 2W6IA 1WP9A 2FFAA 3O47A 3QI2A 4QNMA 5ANRB 5A5GA 3KQLA 4CT4B 3EWSA 1P61B 4OL0A 3RC8A 3T34A 2HLDA 4Z51A 3GLGB 2CXXA 2QP3A 1QBKC 2VSFA 1VYTA 1DAEA 3I72A 3LD9A 2V6JA 3O8CA 2NO1A 3AVQA 1AA9A 4G3XA 1E9BA 2ZAMA 4JYBA 3MFYA 4K46A 4LC1A 2JJ2D 1S0UA 2D2EA 2V4ZA 5CJ2A 1X86B 3LBNA 2QGNA 3CBQA 1T3HA 2W2TA 2X2EA 5HKKA 4LYJA 1GVNB 2C8VA 4ITRC 5AWFC 2FE4A 1G19A 1D5CA 3A1UA 4FCWA 3GLHA 2KWIA 1DAFA 4KITB 2GCOB 4DIEA 1V43A 2JIZA 1Z28A 3THWB 1DEKA 5KSPA 1QHYA 2Q9BA 3EZ7A 5BW8A 3ZS8A 5G41A 1E9CA 2B21A 4D2IA 4PC3A 1YU9A 5J4KA 3TIFA 1NBMA 2EWVA 1D8TA 3LAWA 4R2IA 5DN6A 5M04A 3NC0C 3C8UA 2OLJA 2GCNA 4RJLA 5HE8A 2IA5A 2ONJA 3T06B 1W1WA 4MA4A 2BVNA 2YINC 5J4VA 1UKZA 4W5HA 4KCGA 3PEUA 4JVSB 4KHZA 1U99A 3M6AA 3U2QA 1E2LA 4HUQA 3VKWA 1TAGA 3EAQA 1G21E 4TMKA 4Q4AA 1HYQA 3MCAA 3X1WA 3SS8A 1M74A 5J47A 3Q7QA 1U81A 3C5CA 4QBGB 4XIGS 3GCGA 5FI0B 2VP6A 1J70A 4HI0E 4TT3A 1J99A 2R6CA 2WJYA 4RKEA 3FFAA 4MRVA 4YC7A 4A82A 3VX3A 5KUTA 1VPLA 1P2VA 1T8UA 3RANA 4RZUA 3QKSB 4PX9A 3SJZA 4Q7JB 2GJ9A 4I4LA 1A1VA 5K8LA 2UZ3A 1YR8A 2XJ9A 4RSGA 5EQTA 3RS3A 3MJHA 4LJ9A 1HQCA 4R71A 1OXSC 4TQAA 3GEIA 4LRWA 4Q47A 4AYXA 3CO5A 4Q4HB 4KFUA 1ODFA 1PUIA 1P5ZB 1N6HA 1SVMA 2JJ2A 2ZAOA 4B3BA 1R6BX 4ACBA 4JZKA 4B75A 4C0JA 1DTSA 2VHUA 4B33A 1WA5A 2ZJAA 2GAAA 3SR0A 1IM2A 3BB1A 2HLDD 3FTQA 3ZIAD 4GPTA 4S2EA 1YRAA 3L43A 4DHEA 2ZSDA 1F2UB 1U94A 2Z0MA 2OCBA 3K0CC 4JLAA 4OK3A 4EKDA 1US8A 5AUPB 3BORA 1TNDA 1Z6AA 1R7RA 4JL5A 4IEEA 1UBEA 4NYJR 2NO9A 5J4LA 3QQ5A 1OKKD 2W2XA 1IN4A 3QIAA 4W9MC 2CBZA 1YKSA 4RZXA 2NO0A 4P4TA 2QI9C 5BN3A 3X2SA 1XU4A 2ERXA 3U7FB 3EC1A 1WMSA 4Q9KA 1XJQA 2IYUA 1WE2A 3RWMB 4XTCS 2NZ8A 3I5YA 3PXGA 4LUCA 2RGNA 5BXQC 4OHWA 2PJRA 1E6CA 5KSZA 3QF4B 3U7HB 2RGGA 3FMOB 2YVUA 4JLKA 4EPXA 3AVYA 3SYLA 3WMGA 3UK6A 1TQDA 4M9XA 5AUQA 5B64A 3GLFE 5EZ5A 3TKLA 1NBMD 1E4VA 4QL3A 3SI7A 1XXHE 3SFZA 3KTAB 2ZJZA 1CXZA 2XNDA 2ZU6A 2GZHA 2AD5A 4Q18A 1N6NA 4LZZA 1NY5A 1NL3A 3GJ3A 1OHHD 4PC6A 4QJ3A 2DHRA 3UWKA 3B1YA 1ZRHA 1GKYA 1N6OA 3IIKA 3U4QB 1NSTA 2WIAA 4S35A 4B3FX 4EFNA 4XSGA 3CRQA 4NBSA 4NMMA 4TLDA 3QKRB 1GWNA 2GXSA 3L0OA 2FFHA 4ZDIA 3THYA 1NG9A 2MMCA 2XZLA 3KFVA 2F6RA 3GLHB 1ZUIA 2E1RA 1M7HA 1KJWA 2OZEA 5HZKA 4KSCA 4DEXA 2ZRFA 4NYMQ 2R6FA 3UXMA 2IC5A 1UKYA 4RD6A 4PHFA 1X8JA 4Q19A 4YMWA 4P4SA 4DLVA 4HAWA 1SXJB 4DJTA 2DBYA 1OH7A 3ECCA 4EPWA 4XJXA 2P6UA 1SVIA 3BOSA 4JT4A 2Y8EA 4M21A 1FW6A 4D4KA 1LY1A 1SGWA 1KJZA 4JLVA 4AY2A 4QGAA 1YZLA 1FTNA 2G77B 1JR6A 1NVXQ 1G291 4HDOB 4URZR 1QDEA 2JLQA 3N2EA 1MO4A 3HPRA 2PCLA 1FX0A 2V6IA 3IO3A 5GJBA 1DO0A 2ZS8A 3UMRA 1QHHA 2KE5A 4B73A 4OHVA 2CMKA 2CNWA 4CEJB 1XWIA 5EE3A 4DRZA 5JRJA 5AJWA 5FUVA 3R9XA 2CCKA 3VTKA 1ONBA 3AUXA 4EQ6A 3IBGA 5KPDA 1A82A 2ZI5A 1U8ZA 4JBWA 3V4RA 3VR2A 1W49A 2OUKA 5FH9A 4I1UA 1Z0AA 3CR7A 4PPGA 2HDNB 2VF7A 3IDQA 2PCJA 4FMDF 1A5TA 1G4UR 1GNPA 1LTQA 2F43B 1OHHA 2B8WA 3LXXA 1S96A 3UATA 3F0TA 4URXR 2IYTA 4FD2A 2IYRA 4O2LA 4Q9HA 2CNWD 2QBYB 2QQ0A 2X19A 1ZBDA 1G8GA 3SYNA 2WTUA 2VO1A 4TLEA 1F5NA 5KOYA 4PAQA 2H1LA 3FMPB 1YZUA 3L8YA 3U44B 1E0AA 1E2JA 1G6OA 4TYWA 3VKHA 1EX7A 3V4FA 1HUQA 2MSDB 1L4UA 2QPOA 4RZ2A 1E4YA 1Z6TA 2VP4A 5DIFA 2BKEA 4ZKEA 3IHWA 2HYDA 3VMFA 3T1OA 3T15A 2FFBA 4G1UC 1QHNA 2ZIAA 3ZD7A 3TQFA 3K9LA 4P4SB 1W5SA 3KTAA 2FZLA 2IBMA 5EP4A 1NLZA 1IY0A 1Q22A 3U61B 1OB5A 3PG5A 1IN8A 4K8OA 4Q7KA 4B2PA 3P27A 1XD2A 5JWOA 1DOAA 1DS6A 4NONA 3L0SA 3CNLA 1OFIA 2O8EA 4URYR 1NLYA 4LBWA 1RFLA 3A37A 4EPVA 1UJ2A 2QGZA 4UXIA 1E2KA 1N6PA 1XMJA 3WBKA 2FPMA 4Y0VA 1G9XA 4G5QA 2DCUA 5G3ZA 4LC0A 2QSZA 4AK9A 3GFOA 5DISB 3HJNA 3LDAA 5DSZA 4YMUA 1RC8A 3ICQB 5GJCA 1P2TA 1G4AE 1KMQA 3EPLA 3Q5EA 3RSOA 3MUFA 4NCKA 5KDDA 5C4GB 1M34E 2LKCA 2RGDA 2ZRAA 4NHOA 5BWMA 2OXCA 4B2IA 1AZTA 3Q3JB 2DWOA 2CJWA 4IKEA 4NYIR 4MUBA 1QG2A 3AUYA 4Q1CA 3UMSA 4MGIR 1BO6A 5E7JA 3DDCA 4TLAA 2VP2A 4AIIA 1II8B 2F9MA 1MT0A 2ZRBA 1QHIA 4LHWA 2YOFA 3B9QA 1BKDR 2DYKA 2ZRCA 5AK0A 1I4LD 1XTKA 2AXNA 4R2HA 3AM1A 1GRRA 3W8NA 1Z0IA 4PAMA 1X8LA 3FVQA 1JBKA 1G20E 2RGEA 3LO5A 4RD2A 3U6KA 3X1XA 3ONWA 1KAGA 5DI9A 1Z47A 3AVVA 2QL6A 1YVDA 1IN7A 1BYIA 2F1HA 2A3RA 2OBLA 2VA8A 1K6MA 2ZRKA 4C3ZA 3RRYA 2KI5A 2PX3A 2B7BA 3GJ5A 1F2UA 2NQ2C 3F8TA 1VHLA 4IOJA 4LI0A 3NDBB 1KZ7B 1IBRA 1M8PA 3PEVA 2QTHA 1T5IA 1TUEA 4L16A 4ZCIA 5H1YA 4TSFD 1TU3A 4Q48A 2QE7A 5KO2A 3UANA 4M0LA 5BYKA 2VF8A 4DKXA 2I1QA 4EFLA 5TVKA 2C95A 1IXSB 2ZM5A 4G5GA 1KY2A 3VR6A 2CE7A 3KJGA 421PA 4YXWA 3CH5A 1RKBA 2DPXA 3GD7A 2AL7A 4JJZA 4UJ3A 4E03A 5FOWA 2LWIA 3VR3A 4KYIB 2BJWA 5A0FA 4WXRA 1N6LA 1JR3D 1IY1A 4AYTA 4C2UA 5K8UA 1L4YA 3B1ZA 1UKVY 2CL7X 1UBFA 3NEYA 4ACAA 5JS7A 1TADA 1GDDA 3B6EA 4BLPA 1ZINA 2P6RA 1T8TA 3ADDA 5EE1A 3BH0A 4GMDA 5IK2A 3EPHA 2CVFA 2FGJA 4DIDA 1W2HA 3SEAA 2ZETA 1W7AA 2F43A 4QM6A 1UPTA 3ICEA 2DFNA 1SKYB 1FFHA 4GSYA 3PCRB 3QVVA 3KKPA 1ZJ6A 1OIVA 4DEYA 3SE0A 2WWXA 2IXEA 5JS8A 3W8RA 1E3MA 5JEEA 2Q9AA 3MAAC 2HEIA 2MSEB 3QBVA 1XEWX 3MJRA 2XTNA 1CR2A 4FWTA 5F2EA 1SVKA 1NRJB 3PUYA 4X8LA 3NEJA 2QT1A 3DZ8A 4WW0A 3I62A 1XXHB 5HPYB 1IN5A 2PL3A 1T91A 4V0MA 4J0QA 3EW9A 1G7RA 1SXJC 1NIJA 1OH6A 4A36A 4TMTA 4B3CA 4BUJA 2R62A 2Z6VA 3WYGA 1R5BA 4CVNA 2GILA 3U6BA 3DM5A 2J7PA 3L0IB 2OO7A 2CLDX 1J2JA 3THXA 4JBYA 4HAVA 1Z6YA 2O0KA 5L3QA 3CF6R 5E3HA 2EW1A 2RHMA 5GVSA 2QAJA 2VPPA 2WAYA 4D4JA 1S3SA 1NNEA 3VR1A 2FFQA 4GOKA 1N5KA 3RHFA 1ZM2A 4UQOA 4R98A 3RYTC 2DB3A 4R7ZA 2FGKA 4TMVA 2JLYA 1JEEA 4TZ0A 2CLCX 4LGMA 3ZVNA 4PC2A 1LW7A 3AEZA 5FTLA 4A92A 4PTLA 5KSYA 2IUSA 3FHTA 2V9PA 4LHVA 2JLRA 3EWAA 1N0VC 3DOFA 3REFA 2OLKA 5KDLA 5AR1A 3TNFA 4YXWD 2BBSA 4KSBA 2OCYC 3SC3A 4LJ7A 1SZPA 1KMHA 2WWHA 2EVWX 1TQ6A 4W5JA 1SKYE 1U9IA 3QEOA 1FMLA 4TMWA 3NDPA 5CB6A 1TEXA 1X1SA 1TF7A 1ZNZA 4Q02A 3I32A 5IHPA 1NIPA 1MH1A 4QBFA 4TYPA 3KXKA 3W34A 1KKLA 5FFMA 3ADBA 4CEHB 1NJFA 3H0KA 1GL9B 3HDTA 4DDVA 2QENA 3B9PA 5HZHA 1GRNA 4YMVA 2WVJA 1ZC4A 1KSFX 1ZNYA 4BGDA 1W0KD 4DZZA 1XP8A 4V03A 3MSXA 4C0AC 4MKHA 1IJEA 5DHAA 1H8ED 1AGPA 4JVMA 4F93B 4WZ6A 1G3RA 2G83A 4U00A 2PZGA 1N6IA 1Q44A 1CF4A 1T5LA 1W36B 2BWJA 4HLUC 3N70A 2F7SA 4DVGA 1SHKA 2PMDA 5E7MA 3QY0A 4LX0A 3OHMA 4OJQA 2ZRHA 3QPVA 1R8SA 5CK4A 5BN5A 1KO4A 1ZC3A 1OJLA 4Q7LA 3R8CA 1LF0A 1VECA 3U3KA 4CEIB 1FUUA 1M1YE 1FL9A 2WM9B 4X8MA 2QPTA 4DSUA 4XVRA 2IYYA 3DKPA 2XB2A 1KAOA 5JLJA 5E4FA 1II8A 1JR3A 1XEWY 4MGKR 1XJ0A 1TQ4A 4Q03A 4DCUA 4FCTA 4RD0A 3NWJA 3CX7A 4BWYA 4P33A 1AS3A 1A2BA 1U8AA 5CK5A 3WNBA 3RRMA 4II7A 4DLTA 2BJVA 3AGQA 3M0EA 4OI1A 5B30A 4GMXA 2HV8A 2QMOA 2HXSA 2AHOA 3WRXC 3B1WA 5CM9C 3GJ6A 3KQNA 1YJ5A 4I1OA 4FWIB 1ZNXA 3QKSA 2JJ8A 4BECA 1G8HA 1L2TA 1DG1G 2MMGA 4URUR 3ZD6A 3MD0A 3FKSD 1WBDA 2HJGA 1CJTC 1M7BA 4TSFA 4P32A 1E9EA 4Q66C 4X8OA 1E2NA 3U3RA 3VR5A 2N1BA 2YOGA 2ZUCA 3G5UA 1F2TB 1DAMA 2ZROA 3KJIA 5EE5B 2WPDD 1E2EA 3OF5A 4N1AA 2ZE5A 2DFTA 2RGBA 2GEVA 4OI0A 2XITA 2C78A 4HATA 4DDTA 2EQBA 1Z63A 3D8BA 4IDHA 1UF9A 2QM8A 1IY2A 2FH5B 3BGWA 4FMCB 5G53C 4QBHA 3NTUA 2QG6A 2V1UA 2D4HA 3K0FA 3NVAA 4GL2A 3AKEA 3QNUA 1DE0A 1XXHA 3I8SA 3OEHD 1AZSC 3TAUA 4IXMA 3QXCA 1E2IA 3ASZA 4QHSA 3E2IA 2IYQA 4HB0A 1P4SA 2LKDA 4F4IA 1CU1A 5F98A 3U3OA 1RJ9B 4QGHA 2X77A 1EWQA 1KTVA 2CHGA 2ANBA 1H8HD 4Z54A 2H17A 3ASYA 3BD9A 1W36D 3SQXA 3LW7A 4IVRA 1CP2A 3PENA 4KLNA 4I1SA 3VFDA 4MGYR 1G8FA 5FBRB 4IDPA 4MQBA 3FMFA 5CLLA 1XD2B 4AYWA 4KU4A 1KO1A 4LJYA 1NSFA 3BRWD 2ODEA 2L0XA 3A58B 2D62A 1F6BA 3LQQA 3PUXA 2BHRA 1P3JA 1CJKC 2ZR7A 1MO3A 3HP1A 4JIMA 2RHDA 5FOUA 4UNSA 1IOZA 2ZREA 3LV8A 2BMFA 3A4NA 3T1VA 4TL8A 4ASUD 2KBEA 1MOZA 3CZPA 2VH5R 4QHTA 3GLIE 2I1VB 3TR5A 1XEXB 1OF1A 4D4MA 4M9SA 1KO5A 3B5JA 3W6NA 4IRUB 1AS0A 3U44A 4ASUA 1E79A 5D3MA 4EUNA 4WA7A 4C30A 1IXZA 2R65A 2BC9A 2WKRA 1TMKA 3BS4A 1FP6A 2A5DA 3I61A 2FF7A 3HU3A 5UKDA 5FUYA 1G7SA 5A4JA 4M1MA 3OAAA 5KPJA 2ZJ8A 4ESHA 2O8BA 1SQ5A 2OG2A 2WJVA 3BH7A 1LS1A 3NHAA 1E99A 3TW4A 4DUGD 3U7EB 2AK3A 2BIFA 2RAPA 2PLRA 1CR4A 1FQJA 3CUEF 4DT1A 1RRFA 1GUAA 1U9IC 1MABA 1S8FA 5B57C 3E70C 4GP7A 1LF5A 4XD7A 3FKQA 4JLBA 3OZXA 1SXJA 5SZHB 3SNHA 3P26A 1GL7A 2ORWA 1NJGA 4O0MA 5CIQA 5D3QA 1M7GA 2A30A 4C0QC 621PA 2BCGY 4BZXA 2O52A 5DHFA 3JVVA 4DSTA 3VR4A 1NKTA 4JVLA 2ZS9A 4TQUS 4KFTA 1EGAA 1UADA 3QKRA 3DMNA 3OIVA 1N2CE 2ZI7A 3GLGE 2H18A 3U60B 5EP3A 4FCVA 4A8JB 1BMFD 1O87A 2VEDA 3GLHE 1XTSA 3CNOA 1HV8A 1EFRD 4F92B 1F60A 4H1UA 3WY9A 5JWRA 3BIFA 4QM7A 2IYSA 2IL1A 4LSGA 1XB2A 1HEIA 2FV8A 2ZE6A 4M53A 2YZ2A 2K5UA 5EXXA 3SHWA 2B6HA 3BFXA 1W36C 4RD1A 3LQRA 2QSYA 2CHQA 2X2FA 1CIPA 1I4TD 2QAGC 4G0NA 3DMDA 4JLPA 1KI8A 4RVCA 4M1TA 4N3NA 2J7PD 1QG4A 2IF0A 5SZKB 4KYUA 1R5OA 1JXMA 1B23P 1BIFA 1OXTA 3KUCA 3N2IA 1NMYA 4P0TA 5F3WB 3JZAA 4D26A 2ZVQX 4ESVA 5B2ZA 3WHKA 3CWQA 4IOLA 3M1IA 4HB2A 1WB9A 4C7OB 1XMVA 3T1TA 1S1CA 1US8B 2ZR9A 1KDRA 2JJ1A 3HWSA 4LPKA 5P21A 4D6PA 2QROA 4DT1B 1TUIA 1RYFA 2A5YB 2FEOA 3LNCA 4GRAA 4E5UA 2XSZA 2AKAB 1HH4A 1Q20A 4BQSA 3UWOA 5DI3A 1Z0KA 3AF0A 3LFUA 4IOMA 3N5CA 4JBXA 4IOKA 1DELA 4ZDKA 4B43A 2J1LA 4M9QA 5HCNA 2WV9A 1KNQA 3ZZUA 2ORIA 2XZOA 3ZVLA 2V7QA 4QOSA 2KJQA 4TYYA 5JBQA 1ZM3A 5FOVA 5FI1B 2GXQA 1UAAA 2N46A 1KDOA 2BMJA 2O8FA 1W0KA 2IEYA 1E69A 5J4YA 1UEIA 2RGCA 4B3GA 1Z06A 4KVGA 4XTRA 3AH8A 1AKYA 4Y0AA 2JJ1D 1P72A 1OKKA 4IHQA 4D80A 4EJSB 3KQUA 1ZNWA 3CW2A 3HR7A 3IILA 821PA 1NI3A 1KI7A 4YMSA 1K5GA 2WPDA 2Q21A 4PSAA 3TGPA 4FMCF 4Q7MB 4C4PA 2FJUA 2GJSA 4PR0A 4RZ3A 4B76A 5FL7D 3P20A 1XTQA 2R8RA 2Q6TA 3KJEA 1D9ZA 2WSMA 2ZE7A 4HUQB 4WVFA 5LBIA 4Q1DA 1G3UA 3BJIC 2CCJA 4KV9A 3QVUA 3RLFA 4UNPA 3T35A 5DO9A 3ZGXA 2BV3A 1RJ9A 4LJAA 4B6EA 2BM1A 3EXAA 4M1YA 3C15C 3UMFA 5L3SA 4QJ5A 3I8XA 2CL6X 4XSHA 5EP1A 1H8HA 2C2HA 1G7TA 2YWHA 1IAQA 2O8CA 4F4CA 2IYZA 2P0EA 2JDIA 3OFND 1DARA 1HE1C 2DY1A 1XRJA 2V1XA 5DE3A 4M2LA 2ZRIA 3RS5A 3RVBA 1G3MA 2NZJA 2D06A 1KI2A 2WJJA 3TUZC 1KHTA 1PLKA 2W00A 4L9SA 3X1ZA 3TMKA 4DCNA 4A8JA 3W5IA 3LVRE 2RB4A 3QXXA 4Z8XA 5FR2A 1L7VC 1IXRC 5G40A 1GFIA 3BBPA 3ZQJA 2C9OA 2VRWA 2FDCA 2QMUA 1EX6A 1E1QD 4GI7A 5JHHB 1UDWA 2FSGA 5FPSA 4B35A 3A1TA 3CR8A 2CK3A 3ZYCA 4DLRA 5SZJA 2REBA 3WMEA 1EFHA 1Z22A 3A4LA 3T5DA 4A6PA 2ZJYA 3CPEA 1IHUA 1T0HB 2XZPA 1ETUA 4IFBA 1Z5ZA 4CT5A 3G82C 1G1MA 4Q5IA 3K0FB 2VHJA 4MRSA 4LHXA 1D6JA 1GNRA 1TF2A 1JPJA 1WF3A 2W0MA 4JSTA 3THWA 2PX0A 1R0YA 1JEDA 1OFHA 3QEJA 1KJYA 4BRUA 2H92A 1AS2A 3REGA 4NCJA 2WZQA 4TMXA 4ZPXA 2C04A 2IUTA 2WJHA 3QXJA 5TY0A 4XH9B 2EFDB 5JZVA 2IS6A 1P6XA 4JSYA 3I73A 2G88A 3TW8B 3AVTA 1KI6A 3NIBA 2JLXA 2IYLD 2BEJA 1ZIPA 3KFXA 4LHZA 2BKUA 4UNRA 1NY6A 5FOTA 4AKHA 4IJMA 4JMPA 3KKOA 2J0UA 2A5JA 4K81B 1XNJA 1AN0A 2J0UB 3AP1A 1T0JB 4MUAA 5C46F 3AGPA 4LWZA 4IVQA 1P9RA 1N6RA 3ZH9B 1Q0UA 2GA8A 1DAIA 1NVVQ 3NH9A 2C98A 2XX3A 5HE9A 4V0LA 4LJ5A 1XZPA 3L2OB 1NG1A 5J4HA 2WKPA 4PHHA 4IVPA 4DSOA 2CEAA 4O2RA 4A4DA 2ZTSA 2QP9X 2YWEA 5TB5A 2XAUA 3RSLA 4OK5A 4GOXA 1CR1A 2AWNA 3FPAA 1BS1A 1KKMA 2R2AA 4JJKA 2O8DB 4A2WA 4AI6A 2GKSA 3ZZ0A 4M22A 1BH2A 1W47A 2QNRA 1E2DA 1VHTA 1GKUB 4BFWA 4A9AA 1Q1QA 1DPFA 2Z43A 3EPKA 2F1RA 4XVQA 3T61A 2A5GA 3CF2A 4B2LA 4D0LB 2C5LA 3OE7D 2AD1A 3QF7A 1VIAA 2BOVA 4JLMA 1ZUNB 1II0A 1N5LA 4O3MA 2QRZA 2Z4SA 4HLQB 4WZBE 5EP2A 2VHQA 5TARA 1XMIA 4JL8A 5FTJA 3RWOA 4ON9A 3EARA 2GWHA 2GCOA 5FOXA 5EE0A 1D2MA 2H7VA 3IEUA 5FTNA 3R20A 3WHLA 2YYZA 4ZCLA 3KDSE 3KQHA 1KSGA 1PJRA 4YDHB 2V3CC 2VSOA 3TBKA 2IT1A 1E9AA 3B13B 3A1WA 5BYJA 4PXAA 1W4RA 2WSSD 2JASA 2IYWA 2ATXA 2EFCB 2J0VA 3LA6A 1ANKA 1SKQA 1VG8A 3MWYW 4P4UA 4HZIA 5H70A 2IWRA 4N0DA 2NIPA 4EDHA 2AXPA 4UXJA 3E5HA 1UKEA 1JAIA 4PAOA 5CYOA 2Q9CA 1LS6A 3BB4A 5AJVB 4JLOA 5EZ6B 2J5XA 4B32A 2P2LA 3CH4B 4LV8B 4LYAA 5JRZA 4IW3B 1QVRA 2XOKD 2JAQA 2B92A 1JQJC 4QXAA 4ILEA 4G5OA 3ND9A 1PUJA 4AKEA 5GJWC 1BOFA 3PITA 3THOA 1KDPA 2ZYTX 1XTRA 1GKIA 3Q85A 1K8RA 4LY6A 4BE7B 1J8MF 2NMVA 2D7DA 3CRMA 4LV5B 3TUIC 4A1FA 1MO5A 2IHBA 2Q3FA 4BFYA 4XOIA 3SHFA 3EA5A 4ZDJA 4OQLA 5LPNA 4Q4JA 3LVQE 2ATVA 3AVUA 1G5RA 1NMZA 4FMDB 4YQFA 4ZIRB 1AJEA 1XPRA 3BC1A 1OH5A 1Q3HA 1Z6XA 4NZYA 4OQXA 5JSZA 4KVAA 4ZO4A 4L15A 2IK8A 2QP4A 3I1FA 4CEIA 4GZLA 4OI2A 4TLCA 5FPTA 3RRNA 3A1SA 3PEWA 1CRPA 2PEZA 2YC4C 2ZS7A 2F3RA 1ZW6A 5HR5A 4PSVA 2NPFA 1ZIOA 2UKDA 3GLGA 3ADCA 3NBXX 1N5JA 5EUMA 4AURA 5GJVC 4JLDA 5H68A 3Q7PA 3PVSA 3KB2A 1UBCA 3AP2A 3NH6A 5EE9A 3DZDA 3HPQA 1TX4B 4NYJQ 2REXB 3O8DA 3SU8A 3AVPA 4PPNA 2R44A 3C41J 1WRBA 2ZI4A 4BLSA 1E96A 1XBTA 4TL9A 4G01B 4RCZA 3R7WA 2JCSA 5AJXA 1QHSA 2FMXA 1E2MA 1U8YA 4P31A 4V0NA 1KNXA 5CIWA 3QENA 3RS4A 4URVR 4KFSA 1U98A 3TRFA 3CLVA 4ZV4A 1W4AA 4ERNA 2YHSA 3GJ8A 3TJZA 2ZSAA 1Q12A 4F38A 1C9KA 3U3MA 4AWXA 1ESNA 1KK0A 3LW8A 4U02A 2H5EA 4Z1MA 5KTYA 4IEIA 3CX8A 1NF3A 2C9YA 1WXQA 1Z0FA 3B8HA 3DHWC 4A6XA 3WP1B 2P67A 2VHTA 3TK1A 1XJCA 4D25A 2WSSA 3B60A 4LHYA 4Q4LA 4TL7A 5AUNB 2W2VA 1HY3A 1ZD1A 2ZVPX 3BXZA 2FPKA 2QTFA 1RE0A 3VU9A 4AKGA 4LV6A 3ETLA 1Y63A 3H1TA 1ZAKA 4PZYA 2MSCB 1R0WA 3RRZA 3MWLA 3ADKA 2JLUA 2ZI6A 1XF9A 2ECKA 2CL0X 2PT7A 4HAZA 4HLUA 1SVLA 4DBLC 1MV5A 2VHCA 3KL4A 4QRHA 3VX4A 1XCMA 2ZITA 5IDVA 2P5SA 2O0JA 4QGGA 5EUQB 4BLRA 3RAPR 1EK0A 1FP7A 1KO8A 1SVSA 2WBLC 1E2HA 1MR3F 4UXHA 1EWRA 1FPMA 2A5FA 4UJ5A 1SHZA 4ARZB 5AJYA 1UBGA 2H57A 2QMEA 1JALA 2ZE8A 4EIWA 4GBMA 3CIOA 4HDCA 1S9HA 3MMPA 4DXAA 3EPJA 1P2UA 3QOFA 1E1QA 2B8TA 4QBIA 2ZJ5A 4PZLA 1N6KA 1NN0A 4BLQA 2QRNA 3GFPA 2FEMA 3GLIB 1E9RA 1OSNA 2HT6A 5FPYA 2CK3D 4A0FA 1MKYA 2BBTA 2PH1A 1AM4D 3NC1C 4F7WA 4LDJA 1Z2CA 2R6DA 1J90A 5HCIA 5JSZB 3I5XA 4M1SA 4NH0A 4M4SA 1HURA 1X3SA 2N42A 2PT5A 1KSJA 1W5TA 4OJKA 4PC1A 4Q00A 1QZXA 2JIZD 2REOA 4JKIA 4A0HA 4WZAE 1OYWA 1TF5A 3OIUA 1X6VA 5HTKA 1XFAA 3THXB 3ZZTA 4US0R 1OLOA 1Z3IX 2F3TA 1E2GA 3LX8A 4O25A 5KDOA 3B1XA 4HLCA 1UEJA 3GQBA 4PHGA 2PZFA 4GZMA 1T3LA 3QPUA 1OH8A 1N25A 4US2R 1GZSA 2W58A 4B34A 1E1RD 3VHXA 4B44A 1TTTA 4PO8A 4PPQA 1EFUA 2PZEA 3D3QA 3ZLJA 2HCJB 2G0NA 4YLGA 5D3MB 3K70C 1NLFA 4RFSB 1N0WA 5DYGA 4C0LA 1F3OA 5AJZA 1NN3A 2OE2A 3VU9B 3NKVA 4DLZA 1ZCAA 4DSNA 5FL7A 2CVHA 3RS2A 4OQFA 3QKTA 3CKLA 2EU8A 4NCNA 5JFGA 2NTYC 3K1JA 2GDJA 2W6ID 2VQSA 2V8OA 3C16C 2O8EB 1W46A 2GHIA 2KBFA 3W5JA 5JJIA 1Q3TA 4CDGA 4BFTA 3IIJA 2FX3A 3KZ1E 3UPUA 4CF7A 1U0JA 1J8YF 3AKDA 2W83A 1GIAA 1LB1B 4F4JA 3K0CA 4HYYA 1AGRA 5DYIA 3AKYA 3FYHA 1KK2A 2CCGA 4HB3A 3WYAA 121PA 4YMTA 3U5ZB 2J0QA 4PSKA 4N0EA 4MKIA 1ZUHA 2OCAA 3WMFA 4FI3C 2ZRLA 4PFSA 1OXUA 4IDNA 2J46A 3EIHA 4LJ6A 2WWYA 4FMBB 3ND8A 1TPZA 1VTKA 2VIIA 1KI4A 3J81k 2YNMA 3AF4A 4HB4A 4BEBA 2OAQ1 2GBLC 1KI9A 3QG1A 1GM5A 4FIDA 3CB4A 2ZRDA 4POAA 3V00A 1G5PA 1SXJD 5H8WA 1J7KA 1IQPA 3HR8A 1HA3A 1U90A 2OBMA 1WQ1R 2PMKA 3PQCA 1QHGA 3ZQ6A 2OCPA 1HTWA 3FMIA 3WBJA 5DGXA 1VCNA 4Q1AA 2CJWB 4NYIQ 3UG7A 2J87A 4AG6A 4D4LA 1FNNA 3K70B 1L8QA 4MH0R 4MYHA 4HEJA 2LCFA 1VMAA 3HYRA 2WMOB 2QEQA 3BK7A 3IPXA 4MRPA 1FUKA 2FG5A 1JJVA 2G6BA 1OE0A 2P5TB 3X1YA 1KZGB 1RRPA 3BERA 1ZVQA 2C96A 2OT3B 1JXOA 3ZJYA 1ZCBA 3H4MA 2J3EA 4PHTA 2ASEA 3A1VA 4V0KA 4Q4JB 3LH5A 5LD2B 2VP0A 3VNUA 4I99A 3D6TB 1SVWA 1RRGA 5CLQA 5EXSA 4C2TA 2VTKA 3QUSA 4WBSA 1E9FA 2GVDC 1A2KC 1FTSA 2FZ4A 1R10A 4B48A 2OILA 1P75A 2GBLA 2J0SA 2V55B 2EFHB 3R9IA 4LJ4A 2BMEA 3I3SR 2YJTD 3AV0B 4PZZA 4BZPA 3U4QA 4YDSA 4NPHA 4IDOA 2J9RA 4E07A 4A0GA 1S9DA 3PR1A 1SXJE 4JLNA 1G16A 2GJ8A 1OXVA 2Z5FA 3BFKA 1P73A 4L8GA 1VDZA 2OSBA 4B6FA 3IQWA 1WBBA 2F9LA 2NPIA 2FSIA 3HYTA 3TVTA 4Q1EA 3IUYA 4V0ME 3TUJC 4NP6A 1TQ2A 4Q1BA 2ZXUA 3ZVRA 1CBUA 2JA1A 1QF9A 3L0PA 4M8NE 1XPOA 1JB1A 3B2EA 1DAGA 1T6NA 4AC9A 4NL4H 5IRCD 3K09C 3MWJA 2C9CA 5JMTA 5KYKA 1CLUA 1CR0A 2KSQA 4RD4A 1AIPA 3QPWA 2ZRMA 1EXMA 3OESA 1LFDB 4KAXA 1Q1ZA 4Q1FA 4MDFA 2Z4RA 2WMNB 3TR0A 1I2MA 3BE4A 3FHCB 1GP2A 1WDTA 3QKUA 3P1JA 2XGJA 1QVAA 2CDNA 4LPSA 3KKMA 4NTZA 2IHYA 5FPHA 521PA 1DAHA 1T9HA 1VYUA 1GL6A 2QTVB 1VG9B 2VLIA 3C14C 1ZP6A 2JDID 2ZRPA 1XDBA 4DCSA 1GITA 1P9NA 3GJXC 1YQTA 1YR9A 1II9A 2GCPA 3K9HA 4GNKA 1G8PA 4KODA 4EFMA 3EZ2A 2DWQA 2WWIA 2X1VA 5BQ5A 3O8RA 2O8CB 1X8KA 1JPNA 1OFUX 3CRVA 1XD9A 3DVLA 3IHLA 1N3BA 4YONB 4BFUA 5IT5A 4EQ6B 5CM8B 3QF4A 5SZIA 2WKQA 1PV4A 3GEHA 4A2QA 4LYFA 4LBVA 4KI0A 2W6JA 3EASA 4B71A 1FX0B 1Q1BA 4Q4HA 1XTIA 4TN1A 2I4IA 4GP6A 2BDTA 3CPHA 1LNZA 2NO6A 2RGXA 4IXNA 2XTZA 3AP3A 1BMFA 3SQWA 3CX6A 3W6PA 2FPLA 2QM7A 3TAHA 1V5WA 1VCOA 1EFTA 5CJPA 1KY3A 2P65A 3SJCA 4HZUB 2GXAA 3VNVA 3LLMA 2V54A 4B3XA 1RW4A 3B78A 2XEXA 1MRSA 3IPYA 4F91B 4MKFA 3MLEA 3QE0A 2O8BB 2UZIR 3NHBA 3JZMA 4DLSA 4U5XA 221PA 4Q4AB 2WWWA 1QHHB 1S3GA 2G0TA 1K5DA 5E7IA 2ZSEA 3A6PC 1ESMA 1AK2A 2HF9A 4D0GA 2IS2A 4DB4A 1UFQA 4KO8A 3QBTA 4OQMA 2JLSA 4TT3D 1LVGA 2Q0HA 3SBDA 4Q9LA 2E9SA 2XB4A 3UG6A 3DL0A 4MDEA 1E2QA 5JECA 2IX3A 2IWHA 5C18A 3V9PA 4MITA 5K8IA 3A36A 1FNMA 2PJZA 2CHVA 3H84A 4C7OA 1XZQA 4JT2A 4D82A 4JS0A 1OPXA 1YZNA 1C4OA 1R8QA 2ZUDA 2OHFA 3B82A 1COWA 3O8BA 4UKDA 3WXMA 1YZTA 5CDFE 3GFTA 3VAAA 8OHMA 2IF2A 1R0XA 4JYCA 1Z2AA 1ELOA 3PEYA 3HU2A 3KXLA 2PLFA 5EXPA 1G18A 3TQCA 4CZ2A 3EC2A 1Q57A 5JCZA 3LX5A 3W3AA 5E95A 1F48A 4URWR 4OYHA 4RCYA 3FDIA 1IONA 1KDTA 3K0SA 4DWJA 3KKNA 2GJKA 2OBNA 4CYMA 2QUZA 1YZQA 4R9UC
chains in the Genus database with same CATH superfamily
2XUOA 5JHGB 1EGVB 1I0IA 2UDPA 4FGZA 3TZHA 3UIEA 1ARZA 3ZU6A 5JH7A 1NVKA 3QOYA 2OP1A 3AL3A 1O5TA 2X15A 3LTEA 1MNAA 3JQBC 5E3JA 1PR5A 4ECEA 1LK7A 3R0ZA 4HAYA 2H8KA 2P2SA 4DCTA 2EFEB 4PFQA 3G85A 5FUXA 1WD7A 5FTMA 2Z04A 1BC5A 1TOAA 5CYFA 1MIOA 3OIYA 1SCIA 2HXYA 1O8CA 2BW0A 4D9BA 1W4CA 3CNNA 1LV7A 1JMYA 3DEKA 3BQMB 2XYPA 4OI4A 2G80A 3W6OA 4P34A 3D0OA 3CLSC 2ZI3A 1JAHA 1OV6A 3VYWA 3WWOA 3I9V6 1YOBA 2EV9A 4FFLA 2BTEA 3GH3A 2ID8A 3CH7A 3ULKA 1NQAO 2ATIA 2ZEJA 4NOKA 3ROQA 4DBLE 3WIUA 1XZDA 5J2UA 1QQ7A 4TPKA 4LRUA 1C7QA 4F3RA 1W0JA 1OTYA 2EFGA 3GLKA 5HF5A 2Q3EA 1KQGA 2ZIXA 5FYQA 1RQGA 3KELA 4KN8A 3KZVA 4U7GA 3NHZA 3U7JA 1E1CB 4NCXA 5ALTA 1CY0A 1CQJB 1RPAA 3CWZA 2IH5A 3KX2A 4R8RA 4WN9B 4JLJA 1P60A 1ZMBA 4LY9A 3SFVA 4RF4A 3DKVA 2W37A 1CUCA 1AMUA 3F7MA 3QK7A 3TKYA 1BQ3A 4IYRA 1RTTA 1DBSA 3N86A 1QB7A 3NTRA 3TGLA 2HRQA 5DIZA 4L0MA 2XNJA 5K3AA 1XDWA 2EOAA 1TMYA 3PDHA 4XIYA 3GRKA 5DDIP 5SYNA 1D0IA 5AM3A 2R7MA 3VR5H 4CR6A 2ZI9A 2PQ6A 2NUPA 3CNHA 4W5WA 4YT8A 1A50B 1YS6A 1EUQA 2PD4A 4B7AA 4I5EA 1JHOA 1T8RA 2D5AA 3CVVA 3AIOA 2GPBA 2YDYA 1FU7A 3J7AC 1J8QA 1ZD8A 2GS9A 2RHLA 2XSZD 1W5BA 2YCLA 3K8YA 2ZJ6A 4OVKA 4RGVA 3LRPA 3OEYA 4WKOA 2ZYWX 4L9WA 5C2JB 4QT4A 4LDRA 2GVZC 2QMQA 4AMYA 4WCFB 3LSTA 4KI7A 1XK6A 2YWJA 4BVLA 1OROA 2OFOA 3TJMA 4PC7A 4C0HA 3CONA 2X42A 3ZWYA 3HY6A 2Z6QA 3A6DA 4I9UA 2X9QA 2WNSA 2HJVA 5A5DA 4MA5A 3OQ1A 4XLZA 1LNQA 3T3HA 1XLUA 3DWEX 3IEXA 4R7TA 5AI4A 1ZM7A 3NCTA 5HIMA 2VSXA 2ZAGA 1GILA 4U7FA 4YWJA 3VPDA 3DWGA 2BM8A 5J2TB 3DVAA 4IDCA 4F1KA 5I7RA 1GG8A 1Z0DA 2RAUA 3DZGA 3K0EA 1DEHA 4KXQA 5TGTA 4UTXA 3WBFA 3GRVA 3FOBA 1Z83A 2WM8A 3I92A 3LP6A 4FLMA 4QICA 4DV2B 1OZHA 5E0KB 1Q6YA 3O8QA 3ZDDA 2WOJA 3IR7A 5TQVA 5BPFA 1X2BA 4IV8A 1XEFA 2RHCA 1SU4A 4D92A 5C1DA 3ZCTA 1I2AA 3KUXA 1ZKDA 2CBGA 2WICA 3RVPA 2VWHA 3GMTA 3DUFB 3ZQUA 1Y0BA 2QE7D 4DLAA 1RQ2A 4BY9E 3IEMA 4KP7A 1VZ3A 1Z3CA 1ML4A 1GJRA 3HXPA 2Q1XA 3FPJA 3KPVA 5JSUA 1BJKA 3L6EA 4QDOA 3EA0A 3I1JA 3TZCA 1C1YA 2PUJA 3UA3A 5A4DA 2FK8A 1ATZA 5AW5A 1GG2A 3KWJA 3HO6A 3HA7A 1M0WA 2UXDB 3PI6A 1L8AA 5KVVA 3MD9A 4Q3AA 2C7GA 5IAAA 3O82A 2JGJA 7MDHA 2IYVA 4TV9F 4JVNA 5KS2A 2DFVA 3QJ5A 3W90A 3QE4A 4Y7DA 5KYUA 2NXJA 2WHRA 3LXMA 3KYDB 2YKGA 1W48A 2WF7A 3H18A 2BGUA 4RSHA 1NTRA 4W9NC 4YCBA 2HQBA 4O2AB 2I91A 5GONA 4AJEA 5FNZA 3R7BA 3KVNA 2GO1A 2Z1MA 3RNOA 2AX4A 1TLLA 3WB0A 5FOSA 3W2FA 1L5QA 2QK4A 5J23A 5L6LB 2ZZNA 1VHDA 3AYZB 2ZYVX 2A9VA 3KUDA 2PGLA 1Y4DE 3H16A 1XC7A 2ZRGA 1N3IA 1I6KA 2CNNA 2X7HA 2Y1KA 3ENQA 4BLOA 2WYHA 2NOAA 3C3YA 4C0KA 2H9IA 2ZANA 4RZQA 3GDHA 2GUWA 3DFKA 4O1IA 1B8OA 3AEQB 1EX1A 1U0OC 2ZTHA 3PQ5A 4KDEA 3SR3A 3FWHA 4YY3B 4DLUA 1CZRA 3V9AA 1NDHA 3ACDA 5REQB 1E5XA 5HZGA 1U63A 3II6X 2G4VA 2A2ZA 1EDOA 4ZI7A 5BOSB 4LRYA 2AFIE 3I83A 5CA0A 4YJFB 2A0YA 4CMBA 2IH2A 3JZFA 5A9SA 3E1SA 3OJOA 1GQ2A 3AVWA 2M6SA 1C7ZA 3CM0A 4Z0HO 2GZDA 1K8QA 3EXG1 1R6VA 2AMFA 3QZUA 2YV5A 3PCTA 5JPIA 2QX6A 2FEWB 4AG5A 3KZXA 4ZEVA 4MVCA 3QQPA 3RCBA 4TMZA 3JQQA 4EPTA 2BBOA 3QI7A 3FZGA 1L5RA 1TVCA 4QXQA 3KT3A 2NZVG 5C52B 2OYRA 1I3KA 1O0CA 5BMVA 3T5GA 2VRCA 5JJBA 2B4YA 2LTAA 3FNQA 1NBEA 1E0SA 1LPOA 1MHPA 2VBFA 3ESBA 4RK6A 3HHEA 1CY7A 1H8EA 2GF2A 1R4ZA 4QYIB 5D3ZA 5EJFA 3BDIA 1U2DA 3OQMA 4L8FA 4Y1RA 1X7WA 1U3VA 2XNHA 3NYWA 4B8ZA 1F2VA 3AVOA 4D0NA 3I1YA 2XRMA 2UYCA 3A6ZA 2GEUA 1XCPA 2C7BA 1XSEA 2AA3A 3PC8C 2I78A 5CGQB 5G0SA 5IAOA 3D1JA 3T7KA 2WWGA 2B5WA 3OPVA 4MUIA 3ZVKA 1PT8A 5JCPA 4UM8B 1IB0A 3VV2A 4I81A 4O4LA 1GDHA 1CULC 1Q74A 1RZ3A 1UK8A 4FXOA 4JC5A 5FLEX 4MIYA 4KBGA 2HK9A 4HEQA 4CN9A 5A0VA 4BDSA 4ZT5A 1E0KA 3EG5A 3ISJA 1SUIA 4PLGA 4CI9A 4Z4FA 1Z38A 2CDAA 4NIMA 5L4LA 3EVCA 2VYVA 4REMA 4XJSA 3SM9A 2OCKA 4JNKA 1S2DA 2JLZA 3M70A 1PQWA 1WMAA 9LDBA 4ENQA 721PA 5IXJA 5CA1A 3ND7A 3MJDA 1T2DA 1XE3A 1P17A 1T1GA 2YFHA 4A16A 1O0BA 2RGYA 4HDMB 4XYEA 2WDZA 2XUAA 5A03A 1PW5A 3IQFA 2QL9A 3IQDB 2ZPAA 3O0TA 5GOTA 3LT4A 1FSPA 1F2TA 2FJ0A 1H4TA 5TQJA 5KWVA 1XP5A 3OZAA 4RF2A 4ARVA 1YZKA 2HH9A 4OJMX 2DBQA 2P6NA 3EGXA 3T7DA 4KBFA 2QY9A 1EFVA 4X93A 3TEJA 4XWOA 4C4TA 2JFOA 2XZTA 1DBIA 4JFAA 2R1VA 4JB2A 1UJ6A 1V25A 3HP7A 1QK5A 1ZM9A 2RIPA 3AHIA 4U7DA 4U7PB 4D42A 1H4QA 5ES3A 2G1JA 3TLGA 4I2NA 3PC6A 5DOZA 5AKEA 5AKHA 3T3MB 4BE4A 2DHQA 1OLXA 2C2ZA 3OPYB 1FRNA 1XD8A 3GN2A 2WJ6A 1CKEA 3RK1A 1QXSA 2RI0A 2H00A 3H5TA 2O5VA 2QPLA 3FZNA 2ZKIA 3FCAA 2C77A 3GA5A 1OBHA 3LCCA 4GU5A 4RHUA 5FA5A 3W3AD 1NVUQ 1R9JA 1EWTA 1MO6A 1WCWA 1PCXA 2CF5A 2Q6KA 3CVJA 4NI5A 3G17A 2PO5A 4HAUA 3ZJUA 1KPGA 3GJ4A 3D31A 3W1VA 1JWAB 4AVYA 1TO1E 1Y7IA 2HSDA 4J0KA 3TSOA 3UK2A 1RXIA 2GEDA 1NW8A 2A9FA 4P22A 3TJRA 3TWOA 3WL4A 4DSAA 1UJCA 3KB1A 1RQLA 1Y7HA 4YAUA 5TMPA 2HUPA 4GI5A 4NX2A 3F5FA 1F6WA 2A67A 2ZM6B 1OREA 4R16A 2HRBA 4RFVA 4ZO7A 2I3BA 1IBSA 2WEKA 1YC5A 3RYCA 3SKYA 3I6MA 4A2PA 5DNEA 1T9GS 4BRWA 4CE6A 5FAKA 3I39X 2BGLA 5IAGA 4W4TA 3B9BA 3E84A 3Q72A 1E1RA 4P86A 2R97A 4D4HA 4EEKA 1J09A 3IVRA 1KK1A 1MTOA 1XEXA 2RJ3A 3P0IA 1Q0QA 4M1WA 1KZ6A 2ZSBA 3NO4A 4FWBA 1JU3A 1PFVA 1WW3A 1D9XA 1KBOA 1VM6A 2QN6A 5DHPA 3ROMA 3WSTA 4TV8A 5F5XA 3ECAA 2QBYA 1QE0A 4REOA 1U8TA 4RTNA 1PLJA 3AQ4A 2HGSA 4H16A 5FL3A 1ISFA 4ABYA 3LZDA 5AFSA 1O1YA 2YBDA 3JS5A 3JASB 5LBTA 1JE1A 2G1KA 1VJDA 4INJA 1LSJA 1G6HA 2J45A 4XQCA 4B6JA 4C9BA 4WBNF 4N48A 3FWKA 3AJAA 3DHNA 1P0QA 2ERYA 5JD6A 2ZG6A 1E0JA 4YPOA 3M6LA 4O4IF 1CCWA 4GWLA 4CMCA 4EHHA 1W25A 4ARCA 4G5FA 1M6WA 1QVWA 4DGSA 3RFCA 3DFIA 4JC0A 3S29A 5B4VA 4HH3C 5JJKA 1L8LA 3DBIA 4YJ2A 1QX4A 1P4RA 1YB4A 3OZBA 5H5JA 3VO1A 5C7IO 2F8MA 1X9HA 1Y3BE 2GBGA 1EJ6A 3DF9A 2AOUA 4TYNA 3O6VA 3RUCA 2PL9A 4WIAA 1OXBB 2Z6AA 3T5CA 1HYHA 3UJHA 3N2NA 4WESB 2FWBA 2OHVA 2R11A 1BYUA 3FWYA 2PRKA 1Y1PA 1N0UA 2W2OA 2ISCA 3DJYA 3HJAA 3NTLA 5BQPA 4CQLA 2H16A 1S1MA 4PGMA 2QORA 1R5JA 1U0BB 4R84A 2JEOA 4Q7EA 4TRRA 4B47A 4Y1FA 4G25A 4I50B 4J43A 4MR8A 1DB3A 4BFXA 3PIRA 4YLEA 4RKWA 3FHJA 1XVAA 2K2QB 5T7BA 3DLAA 3NHFA 4QGFA 1JA0A 3G79A 2JGMA 4ZC1A 2BFPA 1TAUA 3IIMA 5B58C 3T8YA 3K9NA 1HEYA 4WXPA 1U2RA 2C9BA 2MJLA 3W5HA 3G0GA 5EIWA 1EINA 1EVYA 4ITVA 3TD2A 1O0SA 2O2YA 2W22A 2WTAA 3AEXA 2A3NA 3S2UA 3LKDA 4TL6A 2G8LA 2HO4A 3RDPA 1YR6A 2V7QD 3JD0A 1VCMA 3NG1A 1AKEA 4JP3A 2M6LA 4D4MA 2B1RA 2V7BA 3A7EA 2WIBA 1UJ5A 1PNQA 2I4TA 3C4VA 3N6VA 1CE8B 3GLIA 5FBQB 1Z2DA 3VJMA 2XVZA 4UFPA 4KLZA 3PEFA 3IDAA 2RFLA 4NDZA 4ZOAA 1OT5A 4DMKA 4LF8B 4KR6A 3OJ0A 1KWGA 1TPYA 4G8DA 1P1CA 4R8LA 5DSTA 5EXTA 3TE7A 3UMCA 1V1JA 3IPCA 5JC8A 2EG5A 1SCUA 3RGWS 4JSRA 1CS4C 4UM7A 4M0PA 5AO9A 1Z7EA 5JDCC 3TRDA 4WN3A 1Z4JA 4Z9YA 5HBRA 3CLSD 4RKYA 5ALWA 5E9WA 3DV0A 1J0AA 1BCRB 2ZYRA 4KJZA 3HJFA 4UFOA 4RVSA 4HBGA 2Z9BA 4BFVA 3EPRA 4OP3A 4FOSA 5HF6A 4ZIRA 2HCBA 1A71A 2J3DA 3ZE6A 4BGIA 2JATA 5A1JA 5L7TA 4FFMA 5FBKA 4TRNA 1F51E 2W9XA 3TCXB 1IEWA 2B9EA 2P11A 2WU3A 5IVHA 4Q9IA 4TQGA 5CB8A 1WZUA 2CMDA 3ITEA 4HLDA 4N82A 4J76A 5K8VA 4JR2A 1K8ZB 1RRCA 2XGSA 4ZYXA 1E7SA 2FF5A 3DFFA 1K5HA 3KL2A 4PO3X 5C1BA 4NH4A 4J0CA 4KPFC 3KQKA 1N92A 4RV4A 3TOSA 4V24A 3VPGA 1TL7C 4E1BA 3QPAA 3MYYA 2VDMB 3G5TA 4FONA 4X7MA 1QHXA 4D9JA 3G0DA 1GA4A 1NUHA 1LC3A 3PT5A 4F6LA 2Q6LA 2J30A 5E8RA 3D4IA 4G1EB 3HL0A 3P4XA 4P98A 3ZWBA 1Z4LA 4YXFA 2BTQB 5E9JA 3C1TA 4GT1A 2ZIVB 1MTZA 4HN9A 4A5SA 1RRVA 1U4NA 2GSDA 4GYJA 1W5EA 2BUBA 4GDFA 4R69A 2QAGB 4QQFA 4GQBA 2VF5X 4US1R 4RS3A 1YBMA 2ZTUA 4WTOA 3DB2A 1OT3A 2NZYA 3EIFA 3HU1A 3MGCA 4MUXA 4PCAA 4TT8A 3UB2A 3V7WA 4E5PA 4QTYA 1HFEL 2IW3A 3K5WA 2AOVA 1KEVA 3NJ4A 5TVGA 1AKNA 2A59A 1GNQA 3ELUA 2Y1CA 4FR2A 5BUQA 2XUDA 1XDZA 2AG0A 3AVXA 1TZMA 3KVYA 3O03A 5IBRA 3BREA 2RGNC 3SC4A 2NP7A 3HBLA 1U4SA 3ABSB 2OFPA 3F3YA 1U2TA 1WPQA 2P3SA 4QT0A 5LQCA 3AF6A 2GASA 5FPPA 4OPMA 1SUPA 4W7HA 3PFFA 4OKIA 4LQCA 4OK6A 4NCIA 4M1KA 4P83A 1QIMA 5HX7A 2CJPA 4XWAA 1F7UA 1M5UA 2YHIA 2ZR0A 3CHYA 1PZNA 3GELA 5FPQA 3TXAA 3WJ7A 3IBSA 4YVFA 5JAPA 1A9YA 2QQEA 2WKSA 3ELWA 4YAEA 7AT1A 4JJGA 2J3MA 3BMNA 1RZVA 2BH9A 2OGTA 1N57A 4IDQA 1JTEA 2GHTA 1JJ7A 3P9NA 4BS9A 4WNCA 4B9AA 5K0GA 1YNSA 4TWZA 4BQNA 3R9XB 5DNYB 4HNAA 5EHGA 5CT6A 3PV0A 2TRSB 1KRWA 2AZ4A 4I6EA 5DN6D 3TEMA 4MWBA 2VAMA 4YJKA 4AP5A 4DIUA 3VTFA 1B2RA 1UZMA 2BE7A 3BJRA 3GJ0A 3R3HA 3GXBA 4NDNE 2YMMA 1S4QA 1RWWA 3TLMA 2HT1A 4BCDA 1C3VA 2R60A 4GFDA 2W6IA 4JL6A 2FFAA 4QNMA 3WK4A 1P1JA 2CV2A 3ZGVA 4ISBA 4XWGA 3R4VA 1XROA 3EWSA 4BVHA 3IJPA 3ZW7A 2R25B 4I5FA 4EY6A 2CXXA 5A62A 5IM4F 1HZZA 2QP3A 2VSFA 2Q5EA 2J9GA 2KX7A 1DAEA 2BAGA 1O89A 3P2EA 1W87A 4M7PA 4ND6A 4QYSA 2HMSA 2B9VA 3E4DA 4DCJA 3AVQA 1NU8A 4G3XA 4LF9B 2C92A 2CF6A 5DCUA 1TTQB 2QJFA 4GVLA 1S0UA 3KHTA 2D2EA 2V4ZA 2R7LA 2ZB7A 3DVQX 4GEKA 1VMDA 5CJ2A 3LBNA 4YH1A 5AJUA 2QGNA 5JALA 3Q0IA 4E15A 1C8KA 4WFQA 5CB4A 5K0EA 4ITRC 2FE4A 4OP1A 1D5CA 1KYYA 2CSUA 4C4SA 4A0SA 1BD4A 4FCWA 4DR1B 2TS1A 3GLHA 2KWIA 3NUGA 4B45A 2VNHA 4DABA 3GVHA 4KITB 2SKDA 2HF7A 1WXFA 1BAPA 1JZQA 2VJKA 1SBCA 3ABRB 4OOEA 3M3DA 4IXWA 5KSPA 1P4AA 1UJNA 2SECE 3CT6A 1D1QA 1QHYA 3EZ7A 1WXHA 1VP3A 1LFAA 2ZQZA 1SU6A 4CTJA 3IE1A 1E9CA 1WETA 1MJGM 2B21A 2BHTA 4L72A 4BB0A 1KOJA 1LLDA 2SCUA 1U7DA 1RQPA 4PYLA 3TIFA 2C4WA 3BE5A 3LWZA 4RJLA 2FRXA 1PGNA 3HUEA 1UWLA 3OCZA 5EVCA 2BVNA 2O2IA 3IBTA 4W5HA 1BN7A 1JT2A 1BU5A 1E3JA 1YIOA 4KHZA 4UM5A 1U99A 3OLWA 4IDAA 2BEVB 4P6VF 4ZZ3A 2ZOSA 4HUQA 5DTEA 4LGVA 3EDQA 1G21E 3DHYA 1D1SA 3LM8A 3Q7EA 4L6CA 4OHKA 3Q8WA 1B1AA 5J47A 1G9TA 3CY6A 1XZAA 1YZVA 2VBIA 1NURA 4QBGB 4DIKA 3GCGA 5FI0B 1HRKA 1UC9A 2VP6A 1J70A 1QQ5A 3N8GA 4HI0E 4CFSA 3LPMA 3I05A 1QR2A 4G4SP 2NP6A 2Y1XA 4I7EA 1VSQA 5BQXA 5EMKA 2MYTA 1IWOA 3BXXA 2QG9A 1CZOA 4ZO9A 4ZVRA 1E9VA 4P4LA 4B7CA 2GJ9A 1LQUA 3FY4A 5DMHA 2PKXA 4JP8A 3TF5A 1OAOA 2Q3LA 2D59A 1IULA 2Y9MB 3EPPA 3S5UA 1DXOA 2Y67A 2XJ9A 4EZBA 3IUBA 2HJHA 3A2LA 2JH3A 1OXSC 4WOJA 1ZGAA 1Z7GA 4PG4A 1QZ3A 1TK9A 2O1WA 2QTGA 4Q47A 3CO5A 3T7SA 2HDHA 3GOHA 3PJFA 1PT7A 2JJ2A 5EKSA 5HJ5A 3LL7A 2ZAOA 1LDGA 4CLHA 4IGEA 3T52A 1HEUA 5CPBA 5EHIA 1CJBA 4B33A 3EDMA 4F3YA 1WA5A 1J0DA 2ZJAA 5HIJA 3SR0A 4E4RA 4QYMA 2BY4A 1T2AA 1P9LA 1TCVA 4PQEA 5WRFA 3ZIAD 3WRYA 1X13A 3OQPA 2WWVD 2PSDA 4S2EA 3KQQA 3SG0A 3LYHA 2V65A 4FNMA 4HGNA 3UAZA 3QE3A 2E0IA 1U94A 2IEGA 2P62A 4QDJA 5KTTA 1RXCA 1J7JA 1P7YA 2QS9A 1Z6AA 2R751 4XWWA 1P1HA 1G8SA 3IP7A 1XNQB 1P7VA 4NYJR 4QUGA 4G2TA 4OMUA 1XRPA 4YS6A 3S28A 3TD6A 4CFZA 1IN4A 3CUKA 1U2GC 3PVCA 3W77A 2A6PA 2NO0A 2ZBFA 3JRNA 2QI9C 2FKAA 4Y8VA 4PZUA 4F6CA 2FHSA 5BN3A 4FNOA 1YTUA 1MXHA 3KTOA 2PX8A 1HLFA 4KTTE 2JANA 4BAZA 1S02A 1XTBA 3JQDA 4HRYA 5DV9A 3FSGD 5KTRA 2PMWB 1R15A 1XNRB 1E6CA 3HU5A 2QB5A 3FTDA 1QIHA 1UQTA 2YVUA 3SYLA 4H7EA 4J75A 4M9XA 1ZZEA 3R2JA 4FYKA 4KPGA 4YYEA 1Y6ZA 2X5JO 1XXHE 2XMGA 3A3YA 1EB9A 1N9KA 4CLRB 4EUKA 1CXZA 3IOCA 2PWYA 2SBTA 2GZHA 4X6YA 3RYIB 1N6NA 1MX3A 1TIKA 4F9EA 3VNSA 3C7CB 4QXPA 1NL3A 3M6FA 3GJ3A 5ARBA 2PRJA 1UM9A 4K8RB 4QJ3A 2FSUA 4CMJA 2H4XA 3BXFA 1ZR4A 3NRCA 4P36A 1O08A 3DTNA 4JELA 2C59A 1GKYA 1N6OA 4I4CA 4ZAWA 4YJHB 3FNIA 4DLPA 3LQYA 4QUBA 4S35A 1HQKA 4XEUA 1F38A 4U7HA 4FYMA 5TJHA 3THYA 2XE6A 2XZLA 1DRUA 1NT2A 3HLYA 1ZUIA 2E1RA 1M7HA 3KFVA 3QVJA 1A88A 5HF8A 4AW9A 5I9MA 1EM6A 4RLSA 2OZLA 4LG1A 2ZWAA 2QU7A 3MHPA 3PC8A 3UXMA 1X7GA 4MIKA 4LVCA 1XVIA 1QAMA 3T9EA 4K7JA 1KJQA 3C3PA 4KUEA 4OGGA 4PHFA 1X8JA 4ZU1X 4REQB 5AVWA 3RAFC 4HAWA 4JWTA 5JVDA 4EW3A 3C1OA 1D6NA 3FPFA 4JC4A 3OTQA 4EPWA 1OH7A 2AR0A 5BWNA 1VHJA 2AMLA 5AMXA 4ENTA 4L8LA 2Y8EA 1IK6A 1E7WA 3UB3A 1WXEA 4M21A 4YYZA 5H16A 3H9UA 1MPTA 4D4KA 1SGWA 1YOVA 2CFIA 1UOQA 2KYRA 3F6YA 3GVIA 4HFMA 3VNRA 4U8HA 2P2GA 2G77B 1E7QA 3TDMA 1V9CA 1K75A 3FUVA 4I50A 5DHTA 3U4DA 1NVXQ 4EL5A 2D54A 5IFKA 1HFKA 3PHIA 4K9RA 1MH9A 1ZRNA 5DNAA 4Z0PA 5K09A 4FHZA 5A0TA 3L8DA 5JMWA 1MO4A 1QAQA 3NZEA 1FX0A 2HMAA 1JYSA 2ZS8A 2CXSA 1IATA 4LAFA 4MQEB 1BGXT 1ESDA 1C9DB 2PXXA 4C5BA 4DR7B 1ZH2A 2CNWA 4UQPA 1ZVVA 2YHBA 4DHWA 2DRIA 2BFFA 2FZGA 3ANLA 3VTKA 3WJ1A 5KAPA 3AUXA 1P1FA 3QWAA 3SQMA 4EQ6A 3D8RA 1M0TA 1NZJA 5EJ2A 4RQUA 1AHIA 2AG5A 3AF5A 4KQHA 2FWAA 1IQRA 4BBJA 5F23A 1U8ZA 4JBWA 5MFPA 5SY4A 5C1IA 4H1WA 3EXHA 5FH9A 4O5OA 4B76A 1OD6A 5AW6A 2IHVA 4BAUA 4FEEA 4GI1A 5DX8A 4U9IS 4AUEA 5A04A 2D8MA 3IDQA 4W6ZA 2I4RA 4FKMA 2YWXA 1A5TA 2X5OA 1XKQA 3ZJTA 4LJLA 2IZ7A 2OUIA 2IYTA 1RQXA 2IYRA 4O2LA 3H9BA 1OGYA 4TV8B 2QQ0A 3RHSA 2QBYB 4I46A 2FPIB 5T3YA 1EDZA 1V7ZA 2PBZA 1QFMA 4TLEA 1NT4A 3LFHA 3OY2A 5NLLA 3L8YA 1TM4E 2IYOA 4FBLA 1IM5A 4DCOA 3EISA 3OJWA 4YT5A 4COKA 3P9ZA 1SUCA 3FMGA 2DBVO 2GAFA 5HIIA 4DV0B 1HUQA 4NU6A 1QRTA 1KDVA 1L4UA 5J59A 4ZKEA 2BKEA 4DMRA 2XI4A 1DKUA 1JVSA 4NS4A 3DUFA 1YRHA 4YRLA 2P6OA 3T1OA 5CFOA 4G1UC 2DT8A 4IINA 3PF8A 1JYFA 3TQFA 1LDEA 3JQCA 2IHUA 4FMPA 4Q9DA 4YMHA 2O3UA 3GZNA 2C7OA 5L4NA 2O05A 3LVBA 3TFOA 3U61B 5GP1A 3HHPA 2IU3A 3PG5A 2W5UA 1JKIA 1IN8A 4RXTA 3RUFA 4B2PA 2I71A 1XD2A 5JWOA 3GRRA 1WSAA 1CNEA 2CDRA 3ORSA 4R9NA 2Q3CA 3CNLA 4X62B 5GY7A 3YASA 1RFLA 2CYBA 2DUMA 3EXEB 5TEWA 4KN5A 1H1DA 3GT4A 1D4FA 2IP1A 2Z3ZA 1LQ2A 4FGKA 1GZDA 4EKEA 2NN3C 2ZT8A 3QW4B 4YRDA 2FPMA 5BSTA 1QOPB 4X20A 1G9XA 1A9ZA 2AN4A 5G3ZA 5K0CA 4LF4B 3R1IA 3CW8X 3ZWMA 4LC0A 2G5PA 2VJQA 3RVRA 4XWTA 2HA7A 2W6NA 2H9YA 2E5LB 2RHBA 3HJNA 2QTBA 2XQGA 3O91A 2PSEA 3ZHXA 4BBPA 2QTTA 2OO5C 1P2TA 1QGYA 1G4AE 1MQ9A 4M60A 4NVRA 3OTIA 3RSOA 1EFVB 1FRFS 4RTLA 3EPLA 1GVHA 2JKVA 5IAEA 1IN1A 2QVCA 1L5MA 3WLAA 3ZW8A 2YS7A 4UMFA 5JDIA 1MJ5A 2JEZA 4NHOA 4IIFA 3VOTA 1FFEA 1AUOA 1AZTA 2H59A 3Q3JB 4RCVA 4UBOA 1Y4SA 1K6EA 3D64A 3NEAA 3S7ZA 2HSZA 4UEWA 5H59A 4RLFA 4Q1CA 3UV6A 2X4DA 4MGIR 5BV8A 4TLAA 5KQRA 1CJSA 4JBNA 2OK8A 4YCAA 1MT0A 1H2RS 3VC7A 5BWBA 3IAS1 1C0LA 2DP4E 1UIMA 4F5YA 4LHWA 1KFCB 1MN6A 1U28C 2H1HA 2YOFA 3ACCA 3BAZA 1WUYA 3U3XA 4ALNA 2ZRCA 3VSEA 1T4BA 1IPFA 1VSUA 1UC8A 3UPDA 1JBKA 1WSBA 3OZEA 2QDXA 1H6CA 3H6HA 2VJOA 2C2XA 4KMMA 2O2DA 2J5KA 4E94A 5LQRA 5MDHA 3SYMA 5JXHA 1PFWA 2OBLA 1OC2A 3RRYA 4UBJA 3BQ9A 2KI5A 2B7BA 3GJ5A 4C7BA 3HB1A 3F8TA 4LRXA 1W1UA 4IOJA 3U1TA 3NDBB 1SNYA 1H2HA 1IBRA 1GT91 3E9ZA 3R5JA 3PEVA 4WXEA 3TSAA 4UTPA 3IP3A 4M9UA 3UWPA 4Y6RA 4L16A 5KU7A 3BG5A 3QP9A 1GTG1 1JRLA 4TSFD 5IX8A 4YCLA 5KO2A 4NDAA 5TC4A 4M7OA 3UANA 4M0LA 1XZEA 4S1WA 4DKXA 1N2CB 3UAYA 5TVKA 5DHUA 3NI2A 3OMLA 1IXSB 2VDRB 4EI2A 2ZM5A 3OSUA 1VA5A 421PA 4RANA 4YXWA 4JJZA 3BIOA 3EA4A 1H2ZA 1JHPA 2OPBA 3CQ9A 3D4NA 3VR3A 3ZDXB 1T4CA 2BJWA 2OYSA 2GPTA 3HLTA 3IT2A 4IQFA 3TG8A 2OGUA 1IY1A 1H4VB 2VP3A 2VS1A 1PR0A 2I22A 3B1ZA 1UBFA 2GNPA 3L41A 1E1NA 3H05A 5EI5A 2GM3A 1DIBA 2I6TA 1TADA 3AR9A 4WSOA 5AQEA 3B6EA 3U49A 3N76A 3ADDA 4QU8A 1CD5A 3PJDA 4FFOA 4N12A 2G9VA 3EPHA 3HV2A 1X7WB 4HQKA 4DG8A 3KK0A 3LF1A 1HMPA 1SC6A 2BZGA 2HU8A 4J8PA 1MOQA 2VDPB 4QM6A 1G8KA 1PJ2A 1UPTA 1YRYE 5DLEA 2DFNA 4FFVA 3TG2A 4BV3A 5ALVA 5JOQA 1NQXA 3QVVA 4FLEA 3WSVA 5BMVB 1YU6A 3FCEA 5BQOA 1OC4A 2XCIA 3GMIA 4WKGA 2X0JA 3FDZA 3MTQA 4DSZA 3E3LA 2WWXA 3MB8A 1E3MA 1FMFA 4LZLA 4IZ6A 1S8NA 4X63A 5CXXA 3WLHA 4RJ2A 4I5IA 3FVTA 4IO0A 8AT1A 3MJRA 1ISGA 2R1TA 1LPNA 4MXDA 5I9TA 1RI1A 4G56A 3ZH2A 1QV9A 4E4TA 4EP1A 2YIVX 5CBPA 5DM4A 3AR3A 2OV4A 3GUCA 2ZBDA 2WTNA 1MB3A 1QH8A 2Q6OA 2PL3A 1T91A 4OQPA 1Z45A 4TMTA 5ESXA 1CF9A 1DEAA 2QOEA 4IUDS 1G42A 4PU0A 4TKUB 4P93A 3E4CA 3DM5A 5IJ0B 3FLBA 2QNIA 1QCDA 3ZKAA 2YY5A 1ORWA 3THXA 4O8CA 4MS1B 3WDMA 2H51A 2QD3A 2QI9F 3NHPA 4NBTA 1U4OA 2QRJA 1E1DA 3GVXA 1GXSB 2VPPA 1NNEA 1XHEA 3VR1A 4QNNA 1VYHA 4WK6A 5DBOA 1JAXA 1K97A 5AVOA 1G21A 2PUTA 3CXRA 4D46A 1SBQA 5JAIA 4M8LA 3ZXXA 2NU6A 4L8YA 2TMGA 1VKHA 3RYTC 3P0JA 4PCUA 5COQA 2FGKA 1HQDA 3BMNB 4TMVA 4WA8A 3FVRA 4QJIA 1XRRA 1K4YA 1Q0ZA 4LGMA 3WLEA 2OZLB 4CNQA 3ZVNA 3FHTA 3CZ9A 4LHVA 3EWAA 1N0VC 4C3VA 2QN1A 3R6WA 3REFA 2AZTA 3N07A 4IJ6A 4QFDA 2I34A 5ADUS 4CMIA 1C8VB 3PFBA 3VVMA 3OLZA 2BBSA 3GEBA 1YMVA 1SUDA 3SC3A 1KXJA 3E7PA 4HH4A 1GFZA 1UBKS 4GRIA 4EA8A 1YQEA 1U0GA 1UJBA 1NYLA 3L7YA 2XDQB 4KN9S 1RAEA 3PQDA 1P0IA 4L0CA 3AOEA 3VO2A 1JHQA 1FMLA 4TMWA 3SLKA 1ZK0A 1X1SA 1BX3A 1ZNZA 1G4HA 4BO6A 4HVTA 2VDKB 3QBJA 3QEBZ 3UK7A 3WLFA 1OFUA 3HSSA 1MH1A 4C7KA 3K1AA 1UPFA 3E23A 3KE8A 1SUFA 3QUBA 1LWNA 1O9BA 3ESZA 2V8BA 2A88A 2NXEA 1ONPA 3HDTA 2QENA 5FT9A 1G2OA 1NVMB 4F96A 3NMUF 3KVRA 1C3OB 3CZAA 2WVJA 5IDXA 2QL5A 1KSFX 4BGDA 2F48A 3GRCA 3MYRA 5JCJD 2VZ9A 3MWGA 2DOKA 3AHEA 4EY8A 1QV6A 4DE5A 1QTRA 1IJEA 1H8ED 4MI9A 3UPUA 1BWSA 3DKRA 2FPPA 3UWMA 1HYGA 4CTKA 2G83A 1G3RA 2BEUB 1N6IA 1Q44A 1CF4A 16PKA 1JKJA 1PTJC 1JFFB 3NHKA 2F7SA 5CIYA 2PMDA 3MINA 3NV9A 4OJQA 4YECA 4YT4A 5JTUA 3L0CA 1T4DA 4N3BA 1ZC3A 5BN5A 2QUKA 1I8TA 2ZAYA 3M5PA 4AY4A 1VECA 3STVA 4BRSA 4KMOA 1NAHA 4YI3A 1NU6A 5EWMB 1FUUA 1M1YE 1FL9A 1NF9A 3C6YA 3ETCA 1SU7A 5CVEA 4AF7A 4X8MA 2QPTA 1H2WA 4HGOA 2REQA 3LDUA 4XVRA 1K68A 3DKPA 3BXGA 4R6XA 1EAYA 3VMMA 1KAOA 2EERA 3VTAA 1RAFA 5FI3A 3X2EA 1Z8NA 4MGKR 5L53A 4KO1S 4Q03A 3MMXA 4YBRA 5CVJA 4MJXA 3LC0A 1S7GA 1SUAA 2NYRA 3CX7A 3NWJA 3FZQA 3PUHA 5I45A 2F1OA 3WNBA 4RK1A 4II7A 4N6NA 3IOEA 2HXSA 4ZOLA 3TLKA 1RWBA 3OIFA 3PQ4A 3DWFA 5EG5A 1FLNA 1YJ5A 3BWBA 3I9V1 4N6OA 1ZNXA 4I8IA 5DNUA 3L8MA 3C5EA 1ECBA 1UPBA 4B6RA 1V48A 1Y3CE 2EZUA 3AXTA 4HX2A 1FFAA 4G1CA 3UHAA 1DG1G 4BECA 3DDUA 3E05A 5HHTA 2DBZA 4FSDA 1RI2A 2D2XA 3N6RA 2YRFA 3MS7A 2JFHA 4Q66C 3CZ4A 4I3HA 5AVKA 1WJGA 3VR5A 2N1BA 2R85A 4C7VA 3KJIA 1IH8A 1UXIA 2WPDD 3WL5A 3GU3A 2ODAA 3OF5A 1Y5MA 4MB0A 1NI4B 2GEVA 1UINA 2OAEA 3COZA 1L5KA 3UCFA 4ZAGA 4PGGA 3UQYS 3VOBA 4TTTS 1VLLA 2R68A 3KKKA 2AEFA 3EIWA 2QM8A 4Q05A 3S1SA 2RI6A 4UHJA 2GN0A 1ZD5A 3E22A 3GROA 3DKKA 1IOLA 2B7LA 4XIJA 4H6XA 4O29A 4E5KA 1AZSC 3CZCA 1BW9B 3ASZA 1NRIA 2PZAA 3DOJA 3KEQA 4W1QA 4TMYA 2R1TB 2LKDA 3PPXA 3LK7A 3FTEA 3U3OA 5F3DA 1RJ9B 1ZK3A 1Z8HA 4TTAA 4DY4A 4EI8A 1EWQA 1ISMA 2CHGA 2ANBA 3BSYA 3PL5A 3A9CA 3PNLA 3ZI4A 3HABA 5JNRA 5LNK1 3STWA 3HDYA 1W36D 1XDGA 2Y6UA 4QO8A 4U3JA 4JP1A 4RVHA 1MA3A 1UK7A 1YAHA 3OJEA 4BP3A 1PWZA 2HIGA 4OQDA 3VFDA 4H3SA 5ISMA 1O6CA 1BNCA 4IDPA 4EB3A 1AA6A 3ET5A 4AYWA 2MIIA 1A72A 2AN1A 1NSFA 5BWOA 3L5KA 1NYRA 3A58B 3PUXA 1NUPA 13PKA 1QQTA 2BHRA 2MYNA