2VSXA

Crystal structure of a translation initiation complex
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
382
structure length
366
Chain Sequence
QIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT RNA HELICASE EIF4A
publication title Crystal Structure of the Yeast Eif4A-Eif4G Complex: An RNA-Helicase Controlled by Protein-Protein Interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation/hydrolase
total genus 120
structure length 366
sequence length 382
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA02
3L0IB 4GNKA 1LFDB 4CEJB 3ZJYA 2ZSFA 3HR7A 1OJLA 5TXGA 5IHPA 1E98A 5JI3E 3A58B 3AF4A 1BH2A 5C4MA 4F91B 2OFOA 2ZSAA 4MGYR 2ATVA 4R2HA 1FX0A 1E2IA 2QL6A 3WHKA 4IRUB 5FL3A 5HKKD 1S9HA 4BECA 3JVUA 5CIWA 4QJ4A 5EE0A 1M7HA 4BLRA 1CLUA 1KY2A 2RGNA 3KQKA 2PBRA 3OFND 1BKDR 1VG1A 2C9YA 1G8PA 2F6RA 3RHFA 4CT4B 2ZU0C 1F48A 3QKUA 1R2QA 1WRBA 2REXB 3RWMB 4TYYA 1IN5A 3LV8A 1N3BA 4RSGA 1G7TA 1W44A 4Q9HA 5EUQB 2OLJA 1XPUA 5H68A 4QBIA 1G6OA 5DLQC 1RPZA 2GDJA 3ETLA 4EAQA 3I1FA 3QXJA 4DB2A 1VDZA 2GAOA 4YXWD 4LCBA 4JL5A 1CR4A 4C7OB 1LTQA 1KDTA 4BUJA 3ZQ6A 3R9WA 5EP3A 2FSIA 2F9MA 1KI8A 2ONKA 1JQLB 2YOFA 4OHZA 3WYFA 4NYMR 2XNDA 4IW3B 2FOLA 2D3WA 3PXGA 1JB1A 2F1IA 4CZ2A 2EQBA 5JWOA 1KJYA 3BXZA 4JLPA 2PLFA 2Z4SA 2Z43A 1KO5A 3FVQA 2A2ZA 4UKDA 3MWLA 1LV7A 2BEKA 4IOLA 4G3XA 1NIJA 1NVUQ 2BBWA 5FR2A 2Q3HA 5E7IA 4ZIRA 2B6HA 5BW8A 4B35A 1B0UA 2VHJA 4CEIB 5EP1A 2LCFA 4DLVA 5J40A 121PA 2VHUA 2WWFA 3CW2A 1SVMA 4N0DA 2O8FB 1KIMA 3L0SA 3CKLA 3KKPA 3DKVA 3OEED 4YDHB 3BH6A 4XIGS 3U4QB 1OXVA 3LXRA 3Q8XB 4PC2A 4MRPA 1JECA 3WXMA 1OFUX 2ORVA 2QT1A 3KKNA 4BPBA 2VP6A 4X8OA 2QA5A 2J7PA 3DL0A 3UMFA 2HLDA 2JLXA 2IUUA 1XEWY 1XTJA 3WRXC 3JVVA 5AR1A 4KYUA 3CO5A 3TQFA 1II8B 2C5LA 1FTSA 4AKGA 1UEIA 4AKHA 3BOSA 3WMGA 1S1MA 1TX4B 1VYUA 2IYWA 4MYTA 2FU5C 2CXXA 5JSZB 3L8ZA 1R5NA 4X8LA 5K8UA 1QRAA 4Q00A 3QEOA 4DSOA 5HTKA 1DVRA 2XSZD 4NDZA 4A8JA 5IF9A 2JJ1A 4JT2A 2HDNB 4ILEA 2R6GA 4URZR 3IIKA 4ZCLA 3T06B 3CX7A 1KNXA 2ZJZA 3LXXA 3PG5A 4R7ZA 3IIMA 3TR0A 4EFNA 2FSFA 3BERA 1UKZA 2XTMA 3P26A 4GZLA 2WICA 1L7VC 1CJKC 4KO8A 2VHTA 3AEZA 3Q72A 1E96A 2J9RA 2PEYA 2PZFA 2UVQA 3P4YA 4LJ9A 2VPPA 4GFDA 4US0R 2ONJA 1XMSA 2V54A 2GWHA 4C0QC 1VG9B 4G01B 3AV0B 1D8TA 2F7SA 3QQ5A 1ZUIA 4B73A 1FUKA 4PHHA 3VQTA 3AH8A 1NY6A 3QXSA 4A1FA 1GAJA 2VP0A 4LYHA 1FQJA 4DDUA 1J99A 3C16C 3PIRA 4R98A 4XSHA 2CNWD 5IK2A 4Y0AA 1XTIA 2A9KA 4C0KA 1N5LA 2CE7A 3SQXA 3C8UA 2XZLA 1E2HA 3CX6A 2EW1A 1NI3A 1NN0A 4XWAA 2EYQA 2C99A 4M9SA 1G291 4PHFA 2REBA 1FQKA 2BMFA 2ZJ2A 1XZQA 2Q3FA 4IEEA 5CJ2A 2OUKA 4US1R 4BLOA 1M7GA 2QP4A 5AWFC 1OE0A 2OCBA 2XITA 5LD2B 2RGDA 1NVVQ 2QQ0A 3QXXA 4GI7A 3SZRA 4MRRA 4V0KA 3GEEA 4F7WA 2IUTA 2E87A 2O8EB 3ND8A 1KAGA 1YJ5A 3D6TB 5EE1A 3Q7QA 4Q1AA 2YJTD 2N46A 4P3YA 4WZBE 5HKKA 2ZRMA 1RW4A 1AKYA 1M7BA 1Q3HA 2N1BA 2IYXA 2QTHA 3QXHA 3MSXA 3SN6A 1XD8A 1D2NA 3RANA 1XCGB 1OKKD 1D2EA 1I4LD 5FBQB 5GADl 5KTYA 1MABB 4HAWA 4I1UA 5IDVA 3OFNA 4IXNA 4II7A 1U8ZA 3THWB 4RZ3A 1P4SA 2QPTA 2XB4A 3IEVA 2BBSA 4ITRC 1CS4C 2KJQA 2GZDA 3U7GA 3EW9A 4ZDKA 1NMXA 2XOKD 3TSWA 1AZTA 1ZW6A 3B1YA 3OF5A 2DWPA 4OYHA 4DSNA 1BYUA 1IBRA 1KTVA 2JLVA 2C78A 1H8ED 1G3RA 1X3SA 3RDPA 3KQNA 3V4FA 2ZXUA 2QMHA 4ON9A 3SE0A 4P4SB 4BFYA 1G3UA 2BIFA 4ZO4A 3TK1A 3EAQA 2JLRA 2IYZA 1Z5ZA 1AZSC 3LVRE 1YZQA 1Z47A 2AHOA 4JBWA 5EP2A 4XSGA 2P65A 4GP7A 3UATA 1WB9A 3AF3A 4GBMA 3FTQA 1FX0B 4Q4AA 4MA4A 5FL7A 3RRMA 3HU3A 1S0UA 2NMVA 1JJ7A 3FFAA 4DBLC 2HT1A 3GPLA 4R71A 4FXPA 1QZXA 1DAEA 2KB0A 4B2LA 1ZM7A 4BFUA 1G9XA 1GSIA 3Q7PA 4RY2A 1CIPA 4D81A 4G0NA 2J7KA 5JCPA 2GCPA 3DZDA 3NVAA 4I81A 2QTFA 3OEEA 4B3CA 2F3RA 3TKLA 2HYDA 1KDOA 2IF0A 1FPMA 3HPQA 1AKEA 1D2MA 1ZU4A 2QGNA 3QEJA 2WKPA 2H17A 2G1KA 3ZS8A 4BRUA 4DLSA 2FA9A 1EX7A 3AKYA 3I92A 4P31A 1QHIA 4QNRA 4G5QA 2HYIC 4JBYA 5P21A 4U00A 3W8RA 3PR1A 5G53C 1O87A 3T5GA 1AK2A 3QBTA 2H8KA 1N6PA 1EX6A 4B74A 4DCUA 4L9WA 3ZVMA 4JSYA 4Z1MD 4F4IA 1KOFA 2IC5A 4Q9IA 2V8OA 4EFLA 3L0PA 4FD2A 1TTTA 1W0JD 1E32A 4DLWA 1Z08A 1OLOA 3LO5A 1ZNZA 4JKIA 2GJSA 5FOWA 5H1YA 4I4LA 4U02A 4ZIRB 3R8FA 1KK0A 3O8DA 4Q02A 4E5UA 4NCIA 3KFVA 1UBGA 2D2FA 4FIDA 1HT2E 2EFHB 3ZZUA 1GL7A 3F8TA 2OAQ1 3T5DA 2QEQA 2EWWA 4KFRA 3C4JA 4BFVA 3FHTA 2AKAB 3LW8A 4RD1A 3S1AA 1OH8A 4TSFD 5B2ZA 3X2SA 3O8BA 4M1KA 4C4PA 4JJKA 4WAUA 4XVUA 3QBVA 4QHYA 3UKDA 3X1DA 1ZAKA 3B9PA 3F3YA 3CH5A 4QGFA 2CNWA 5AUPB 1Z0KA 3IQXA 4C0JA 2IHYA 4ZKEA 3U3OA 3ASZA 2AD5A 4RCZA 5L3QA 3C14C 5JBQA 4MUAA 2WWXA 1G17A 2ZSDA 4Q21A 4C0BA 4DCTA 2ZYTX 1GRQA 3ZVRA 1BIFA 1WXQA 2AK2A 2FH5B 4TL7A 2C9CA 4RZUA 1XD2A 4YONB 3RS2A 2FGKA 3NXSA 4A8JB 1DBSA 1Q1ZA 2KWIA 2O8BA 2IYRA 4PPGA 3K0AA 3EA5A 3VAAA 3SDZA 3CWQA 1ZIPA 3ASYA 4QBHA 3O8CA 1KJWA 1ZD1A 2HT6A 2NOAA 3HYRA 5JECA 4LJ8A 3QKSA 1HURA 2W2TA 1G3IA 1ZVQA 3RS5A 4GZMA 4PZLA 2ZITA 4Q03A 2FF7A 1G18A 1P61B 4D4LA 3UG7A 4QOSA 4B6FA 4KV9A 2WTUA 1MH1A 2RB4A 4Q4LA 3PEUA 2BBTA 2ZROA 4IFBA 2QENA 3UMSA 3EXAA 1KY3A 1E2MA 1H65A 3CUEF 1OKKA 3B2EA 2G9NA 1EK0A 4D26A 4CDGA 2X1VA 4KI0A 3CZQA 4NCKA 4BEBA 5KNCA 5KSOA 1KI6A 4UQOA 1TAGA 1YZLA 2AFHE 4DHEA 3A6PC 4BLTA 3EG5A 1R0ZA 1GNPA 2WOOA 1OPXA 2DWQA 4MH0R 2JATA 1SQ5A 2XOKA 3B13B 3PITA 5EE5B 4PAOA 1CP2A 2WSSD 3QIAA 4IXMA 2BM1A 4WZ6A 3SR0A 1FUUA 2C96A 2VP9A 3NIBA 4M2LA 4R2IA 3TSOA 2C04A 3GCGA 3P27A 4M1YA 1FOEB 1H8EA 1MO6A 1Q0UA 1XNJA 2ZS8A 3EARA 4YMWA 4B44A 3DHWC 4QM7A 5KPDA 1NN3A 2HJGA 3PUXA 1E2NA 5KDDA 3SHFA 1S96A 1ETUA 721PA 3IHLA 4PHGA 3HWSA 2ANBA 2FN4A 1UFQA 4NYJQ 2WMOB 4NZYA 4IDPA 1E0SA 1CU1A 3IIJA 2H92A 4Q7LA 5DYGA 1D9ZA 4GSYA 3BS4A 3FHOA 4EJSC 1QHGA 4L5BA 5AUNB 1N6OA 2P67A 4N3NA 3DMNA 1OHHD 4NCJA 4PO8A 3KJGA 1ZNYA 2REOA 2RKOA 3KKMA 4A0RA 3RRYA 2CL6X 4C7OA 2ZRKA 3DPUA 4CVNA 3CNNA 4G5OA 4CYMA 1ZMXA 3T1QA 1MT0A 2O8DA 3NBFA 1AIPA 1LB1B 4HATA 5DSZA 3D31A 2QSYA 5AK0A 3VX3A 4MYHA 4LPSA 3QSYA 4IEIA 1E4VA 1DAFA 4DEYA 1U81A 5FOVA 1EFHA 2XB2A 1XTKA 2BMDA 3EZ2A 2PCJA 3M6AA 1R4AA 3NH6A 2HF8A 5EXPA 3WNCA 1AQYA 1N6KA 1GKIA 1II9A 2RGAA 2GJ8A 1R0XA 2B21A 1Z6XA 2ZE7A 3AGQA 3ONWA 1Z28A 1ELOA 4WOPA 1XJ0A 4PZYA 4WZAE 2GZAA 4JVSB 5G3ZA 1DAIA 1G7CA 4EPWA 1ZU5A 1PV4A 4DVGA 1BO6A 3A4LA 4KJZA 3SBEA 1OB2A 1W2GA 2P5SA 2ZI6A 2B7CA 1XTSA 4OJQA 5F3WB 5H70A 4CEHB 2QGZA 1N5JA 3HJNA 1D6JA 1Z6TA 4Q4AB 4EJSA 3U4QA 4P0TA 1G3MA 1QDEA 1UBEA 3DVLA 4MGZR 4AY2A 1U0LA 5J5CA 3PVSA 3QPUA 1HTWA 1MR3F 1R5BA 4LRWA 1HH4A 1TPZA 3G82C 5JJIA 1OFIA 4ESHA 4QBFA 3SYKA 2O0HA 1JAIA 4CGZA 4UJ3A 3MG9A 1KI2A 2IXFA 4NKRA 3W6PA 1G6HA 2RGCA 2IYSA 2CEAA 3KXIA 3VR1A 1CF4A 2FSGA 2R8RA 3TLXA 4DXAA 4B43A 4F38A 4Q4JB 4RJLA 2DFNA 4TSFA 3VKHA 3K09C 1VECA 1X86B 1R7RA 1I4DD 1U2RA 2R6CA 3TW4A 4D0NA 2YZ2A 1J8MF 4MGIR 2IYLD 3AM1A 2ZRNA 1L2TA 1F5NA 1ZBDA 1N5KA 5KU1A 1QG4A 3EC1A 4LOAA 4JLDA 1NLYA 4BFZA 1ZYUA 2RGGA 1Q44A 2BCGY 3BIFA 4FMDB 4FI3C 1NBMD 3THYA 1L4YA 2B8WA 3QKRB 5FTMA 1W4AA 3M1IA 3PUWA 2W83A 1EFCA 2ZQ5A 2ZSEA 1A82A 2NO9A 3QOFA 4BASA 4Q1CA 1Z0AA 3SBDA 1VHTA 3I5XA 2VLIA 3BD9A 1LY1A 4B3DA 1YR6A 2ZYUX 3RAPR 4D0GA 4NYMQ 3VHLB 4PR0A 1TL7C 2HCBA 5HE8A 2OESA 2GILA 5LB4A 3LD9A 3SJCA 4HB0A 5BQ5A 5HZHA 4FMDF 4NHOA 1K6MA 1JR3D 3A1VA 3CWZA 3WP1B 3GJXC 3W3ZB 4RZXA 2BMEA 4A6XA 4M0LA 1BYIA 3PENA 4IVPA 3S1AB 2HXSA 1S4QA 1RC8A 2A5YB 4URVR 2GBLC 1VCOA 1YHNA 2GEDA 2HEIA 3F0TA 1M74A 3K09A 4M1WA 1IY0A 1F60A 1NSTA 2GVZC 1E99A 5KSPA 2GXAA 2XGJA 2ATXA 3NHAA 4PQRA 2KBFA 4TWZA 2IYYA 1SXJD 4URYR 1N0VC 2J0UB 3O8RA 4NPHA 2LKCA 2P5TB 5G41A 1IXZA 5L3QB 2NG1A 2Q9BA 4TQ9A 1TNDA 2R6DA 1KMQA 4YMVA 1HQCA 1KO1A 1T3LA 3TUZC 4TTPA 1KI4A 1TUEA 5D3QA 4LPKA 2GJ9A 1XD2B 4B2PA 4OHWA 5IT5A 2O8BB 1XJCA 1FP6A 3K0AB 3RS0A 1SVSA 4TTRA 3P32A 2JLWA 2ZPTX 2IYQA 5EQTA 1RYFA 2OCAA 4M1TA 2Q0HA 5DN6A 1X6VA 2J0QA 1T9HA 3QKSB 1CULC 5FBRB 3EPHA 3IKJA 2VF7A 3IEUA 2P6UA 1SHKA 2F3TA 3BB4A 2JAQA 3ECCA 2QE7A 3SJBA 5BN3A 1XBTA 4JL8A 2QORA 3AVQA 1TADA 2QAGC 2YWHA 3ZH9B 1CJVC 4M21A 1MOZA 1N6LA 1OHHA 4TZ0A 3H0KA 1OYYA 3I5YA 2ZUDA 5FBLB 3FGNA 3EWSA 3N2EA 3RSLA 4D4KA 5AUOB 5JRZA 3KQLA 4P4SA 3AP2A 1NKTA 4NBSA 1KI6B 2ORWA 1GRNA 2GXUA 4FCVA 1VTKA 4KBGA 3CX8A 3ZQJA 1Z8FA 4TTQA 3ICQB 2GF9A 1E1QD 4XJXA 1Z2AA 2IL1A 5KYKA 1G4UR 3THXA 1C4OA 1KNQA 4O25A 2CL0X 2JJ2A 2ZI3A 4JVMA 3AF0A 4NYIR 4EKDA 4ZDWA 1U0HC 4TLDA 4JLNA 1NL3A 4OI4A 2UZ3A 4MKFA 4I1VA 4Q4HA 1E2KA 1GITA 4I1OA 4FWTA 1HY3A 3F5FA 3K8YA 3GP8A 1W5TA 1DTSA 1FMJA 1MRNA 3MAAC 3W8NA 4MKIA 1E3MA 4Q48A 3KXKA 4A2WA 2OG2A 3EZFA 2GZHA 2GTPA 3IPYA 1HQYE 1ZJ6A 2QAGA 4QFMA 1DAKA 1N6NA 3AF2A 1W1WA 4OKSA 4OK5A 4YLGA 3B1ZA 1R0YA 2BVNA 3VR3A 2KBEA 3H1TA 1GFIA 2H7VA 3SFVA 1ZC3A 3EA0A 4MKGA 1VMAA 1VIYA 2JDIA 5CK4A 3K70B 3IGFA 4DB4A 3SHWA 1UEJA 1WA5A 1SVKA 1GM5A 1DPFA 3E1SA 3B60A 3RNLA 4KSBA 5DGXA 2IT1A 2O8DB 1N0WA 1XMJA 3U3RA 1LW7A 2OV2A 1WBDA 4KCGA 4AG6A 1KO8A 2FPKA 1P2VA 1F3OA 3KXLA 5JJLA 1NP6A 3IQWA 5CM8B 1AGPA 3Q5EA 1KGDA 1WE2A 2FJUA 1NBME 2OCPA 4OQMA 4XD7A 2CLDX 4D4MA 3EC2A 3BAFA 4MKHA 4MYCA 4O2RA 3GLGE 1RJ9A 4Q7KA 5HR5A 5F9HA 3QKTA 1SXJC 2GEUA 1Q21A 2A3RA 3IO3A 3CRMA 5ANRB 1DAMA 5B57C 2ZR7A 1M34E 1RFLA 2P6RA 3KL4A 5J4YA 1W4BA 4ABYA 1NBMA 2QPOA 2ZRGA 4IDQA 4QJ3A 4IVQA 5KSZA 4HZUA 2VQSA 4A2PA 3GLGA 4GDFA 4U7DA 4TQUS 1LS1A 3TJZA 2OE2A 4EJSB 2W0MA 4W7SA 1A7JA 1P2TA 1US8A 1FFHA 2IW3A 3QF4A 4AURA 2XJ9A 1DEKA 1XCMA 4Q9LA 2WKQA 4HI0E 1PVOA 2KSQA 1TEVA 2R62A 2OXRA 2ODNA 4Q1BA 2BJWA 3NKVA 1CJMA 1UAAA 1UKEA 2YOHA 1I2DA 2CVHA 2A5GA 4OQFA 3PCRB 1SXJE 3FB4A 5J47A 1A2KC 2QP3A 3FKSD 4QHSA 6Q21A 2HV8A 2QI9C 2IK8A 2GA8A 4WXRA 3OEHD 4WBSA 1Z0IA 4BZQA 3B1XA 2XJ4A 3H86A 1SVLA 2RH5A 1GNQA 4PSKA 2JASA 4M4SA 1SKQA 3DOFA 1G19A 2D06A 2D74A 3U6BA 3FHCB 4JIMA 4Q18A 2DB3A 2ZI4A 3CM0A 1MRSA 1SXJA 1DG3A 3A1TA 3SI7A 5B58C 1GG2A 3SYNA 2ERYA 3BBPA 2A30A 1A1VA 1W49A 3TSZA 5CM9C 2ZVPX 4A4DA 3BWDD 2C77A 3VMFA 2TMKA 3BC1A 3N70A 4IOJA 4M1MA 2ZRFA 2PT7A 4K8OA 3RWOA 3THYB 5FR1A 1GRRA 2ZEJA 3CF6R 2OZEA 2W6JD 5FPSA 3CPEA 3EIEA 4FWIB 3ZVLA 4A0HA 4Q9KA 1YRAA 1NVWQ 2CL7X 3VKGA 1K5GA 3L0OA 4BZXA 3EPLA 3U6KA 1TEXA 4YQFA 4M8NE 3EIHA 4BGDA 2CE2X 1ZIOA 1ZRHA 2BKEA 3AQ4A 3NBXX 1NNEA 4LK2A 4ARZB 3RABA 2E1RA 2HF9A 1G8HA 3QVVA 3I72A 3NC1C 4C9BA 4D82A 3HDTA 5SZJA 4JVNA 4PANA 4DT1A 2IWHA 4IKEA 4QNMA 2JLUA 1Q20A 1NVXQ 2ZYVX 2O0KA 4QG7A 4W5JA 5DHFA 3QF7A 5E7JA 5JHGB 5JMTA 1DE0A 2O8CB 2QMUA 3PUVA 5TY0A 4L4UA 4IHQA 4HB4A 1W0KD 4NONA 3QG5A 4JJZA 3A37A 5DE3A 4EPRA 5A4JA 1QHHA 1BMFD 1IOZA 4WA7A 2WWHA 5DH9A 1E69A 1KKMA 4M9QA 2NPFA 5BWMA 3CONA 3CR7A 2GXSA 2AD1A 1T8UA 4HLDA 1UJ2A 3U3MA 4DLYA 1GOTA 3U5ZB 1XB2A 1E1QA 2WJVA 2NO7A 1GUAA 3CB4A 4XH9B 4LV5B 1XD9A 2OCYC 2VO1A 3TUJC 4Z8YA 2WIAA 2EFDB 2IS4A 1RVDA 1W5SA 4KSCA 1XRJA 4DDTA 1JQJC 2D7DA 2YVUA 2CMKA 4PO9A 2ZJBA 4HEJA 4LJYA 1EG7A 2VRWA 4TMVA 4UNSA 3E70C 4RFVA 2WPDD 4KYIB 3W5JA 3Q85A 3I8SA 5HCIA 2OT3B 2AX4A 2QQEA 3P20A 1COWD 3MWJA 1E4YA 4C0LA 1GNRA 3P1JA 2QY9A 2PEZA 4B3GA 1Q1BA 4N1AA 1HEIA 5L3VA 2W2XA 2H57A 1E2LA 1UM8A 3A36A 2L0XA 1YZUA 5C1BA 1CTQA 1YZNA 3I32A 1VYVA 4TL9A 1WP9A 4E03A 5J4HA 4YXWA 5TV2A 5BN4A 4RFSA 4W9MC 2NO6A 4O3MA 2WAXA 4P32A 4IOKA 1NY5A 4B71A 4XWKA 1HYQA 3EX7C 4M1SA 2EVWX 1EESA 4MITA 4FMCB 1FTNA 1CEEA 4CEHA 4ZCMA 3THXB 3NDBB 3ZGXA 5TVKA 3CRRA 3FKQA 1F2UA 2GHIA 1QBKC 1R10A 3MRSA 4U5XA 4BRWA 5FH9A 2WJGA 1AJEA 4LHVA 4C30A 2EFEB 1TQ4A 3U2QA 1EFRD 2GK7A 2WJJA 3EIQA 4Q4HB 3I62A 2OILA 4TLBA 3A8TA 1JNYA 1OT3A 3B6EA 3VKWA 5L8VA 1SVOA 4POAA 1G4AE 1W48A 4LYFA 3LX8A 2C98A 2QAGB 4JL6A 4QL3A 4X8MA 5FUVA 3CF2A 3TQCA 2O52A 4Q4JA 2EFGA 4PSVA 2NPIA 3WNBA 2QUZA 5C4GB 3GJ5A 1DS6A 2WV9A 2GKSA 1CR2A 2PZGA 2X77A 1P9RA 1XMIA 3LWNA 1W7AA 3CLVA 4Q1DA 3FKSA 4P4UA 4DJTA 1Z22A 2WJHA 4HUQA 3TBKA 2ZRHA 2WIBA 2JIZD 4FCTA 4ACAA 4RVCA 3QKRA 1CKEA 3R8CA 3REGA 4PHTA 4LHXA 1ODFA 2XSZA 3VNVA 2PX0A 4HAXA 3KJEA 3MCAA 1DADA 1RJ9B 1BS1A 1GKYA 4FW9A 3UMRA 3BJIC 2QRZA 4NE2A 4CW7A 1JI0A 1OYWA 1PLLA 2VP2A 3BFXA 4KXFB 3IDQA 1HA3A 1G7SA 3RVBA 2WJYA 5CB8A 2W6ID 1XTQA 2ODEA 3HR8A 4HZUB 3GLGB 2W6JA 2NGRA 3AVOA 421PA 3LRPA 4LUCA 3GFTA 2QTVB 1US8B 3ICEA 1OV4A 3QF4B 4LWZA 5LBIA 3TVDA 1ZNXA 5GJWC 3T1OA 4Y0VA 3RS3A 4B6EA 3DKPA 3A1WA 3AGPA 5K8TA 2YC4C 2F55A 4TMZA 4JLKA 4ZCIA 3B1WA 2J0UA 4HZIA 4LX0A 4O0MA 1ZD9A 1FNNA 5JCZA 5JFGA 4NCNA 3RC3A 3K0EA 2ZRDA 2WVJA 4LHYA 3K1JA 1ZUHA 1E79D 1NVVR 1TU3A 1MKYA 3C15C 5JEDA 2ZSBA 5JHHB 2ZE8A 2MMGA 3MWKA 4E22A 2GAAA 4PPQA 1XPRA 5FPKA 3M4YA 3ZD6A 1W0KA 4PXAA 2I4IA 1X1SA 4CIDA 1E2EA 3LA6A 1G16A 4IOMA 3IPXA 3W3AA 1SXJB 4JLMA 5B64A 3PJRA 3QXCA 4Z51A 3UWKA 1IN8A 3B7GA 4Q5IA 1YRBA 2QM8A 5HCNA 4GL2A 1WF3A 2OBMA 2DHRA 1AQUA 1E9BA 2IWRA 4M1OA 2V4ZA 4B34A 1M8PA 2MSEB 2ZRIA 2Q6TA 4LYAA 3GJ7A 2GEVA 4B3BA 3LDAA 2GJAA 3TW8B 3U61B 2GCOA 3QUSA 5E7MA 4C2UA 2P3SA 2OBLA 5HE9A 3LLUA 2A7QA 1S3SA 4JT4A 2G6BA 3G5UA 1XJQA 1W4RA 5J4VA 5FPYA 1TQ6A 3B85A 2WPDA 1T6NA 2H1LA 3KJHA 1U0JA 4B32A 5LDDC 1U9IC 5CB6A 3WHLA 2JCSA 3HP1A 1AS0A 5EJEA 4UJ5A 4DT1B 3BB1A 4G5SA 2VA8A 2CK3D 3V4RA 1D5CA 2RGEA 3ZDQA 4E07A 2YWFA 4JLBA 2X2EA 1HE1C 1DAGA 5LPNA 4QBGB 3DMDA 2JEOA 3RC8A 1QHHB 3OIUA 4F92B 3GEHA 1ZC4A 3TNFA 2IEZA 3CRVA 4V0NA 3KJIA 4OI0A 2CHGA 2IBMA 1T3SA 2UZIR 2A5JA 4ASUD 2QU8A 2FFQA 5EE9A 3I73A 3W34A 2YINC 3NDPA 5DISB 4TZ6A 3KQHA 3TVTA 4YMUA 4TLAA 3EPKA 3OIYA 2WKRA 4AI6A 2NZ8A 3W6NA 1KYIA 1P60A 3BORA 3TAHA 1F6BA 4IDOA 2AK3A 4S35A 2IUSA 4GOKA 3CNLA 2FV8A 2MMCA 1EFRA 1W36D 2ZRJA 2QBYA 4LBYA 2F1JA 2D4HA 2PJZA 1NSFA 2YV5A 3BGWA 4IDNA 2NO1A 4OJKA 5EE3A 2HJVA 4QGGA 5FUXA 1KK2A 3QPWA 4PQFA 3SEAA 5GJBA 3SFZA 1JALA 2BCJQ 4B48A 3CIOA 1VCIA 4CT5A 4DDVA 3QE0A 1ZM9A 3C5HA 2VF8A 4PAMA 4XVQA 2ZJYA 3CRQA 3B5JA 4B33A 4KHZA 2GETA 2ZTSA 2G77B 1IY2A 5JI2E 5DNYB 1OH7A 2F9LA 4S2EA 4NU0A 1XPOA 4URUR 2C95A 1ZD8A 2YKGA 4H1VA 4OHXA 2ZAOA 4KFTA 4DLRA 4RFSB 3K9GA 1JXOA 4RD4A 2KI5A 4QGAA 2BDTA 5EXXA 4AWXA 2V7QD 4EUNA 3UWOA 4HLQB 1GVNB 3NG1A 4ZI3A 3I8XA 4Z1MA 1J70A 5AJVB 2IEYA 2PLRA 3PEWA 4C2TA 3CPJB 2NQ2C 2JIZA 1KSFX 3M0EA 3VR6A 1W0JA 1GIAA 3W6OA 2ANCA 4OK3A 5EXTA 4US2R 4RD6A 3V9PA 1OIVA 1FZQA 1F2UB 3DEFA 4G5GA 1Q3TA 4OI2A 5EXSA 3AVWA 1OSNA 3T1VA 3MMPA 5KPJA 4TT3D 4YDSA 2D2EA 4ACBA 3QNUA 3TMKA 1NN5A 4QKQA 4FINA 5SZHB 2PL3A 5C2JB 2ORIA 2VTKA 2YYZA 4B76A 2W6IA 2GESA 1IN6A 2DFLA 4LJ5A 4J0QA 5CJPA 3U7HB 3LY5A 3Q9LA 2Y8EA 4TYQA 4IVRA 4PX9A 1E9AA 1XXHE 2N42A 2RGBA 2V55B 1YZKA 2ZE6A 1E9SA 2FNAA 5L3RA 4UNRA 2A5FA 2CCKA 2ZU6A 2ZR9A 1P9WA 1IAQA 2RHMA 2GF0A 2AKYA 1G7RA 1KK1A 2WMNB 4W5WA 1N2CE 2YOGA 4N0EA 2P2LA 2J0VA 1XXHA 3FDIA 4KAXA 5DHAA 4HUQB 2WSMA 2WAYA 2XNDD 1UPTA 1Z0FA 1VKJA 4D4JA 1HUQA 1OFTA 2JLYA 1CR1A 3NWJA 3BE4A 2D62A 3MLEA 4JZKA 4A0GA 4DZZA 2HCJB 3OIWA 1SHZA 5M04A 4URXR 1OIXA 3PQCA 1DOAA 4DUGD 3U44A 5BN5A 3A1UA 2AFIE 5AJYA 2CCGA 5TB5A 2IYVA 4HAUA 5D3MA 5KHOC 1GWNA 2YWGA 2PX3A 4ARZA 4GPTA 5L3SA 5LD2C 1N0UA 1K5DA 5LB2A 2PT5A 2ZIAA 3GQBA 1WQ1R 2ZJOA 4IJMA 3EZ7A 3UIEA 2O8CA 1QHXA 1N5IA 2DPXA 1EFTA 4DCNA 1U90A 2FFAA 1XTRA 1W36C 4JVLA 3TRFA 3TE6A 2J46A 4XTRA 3AVPA 4QRHA 5G3YA 4AC9A 3KB2A 5BYKA 4K46A 1E9EA 2I1VB 3X1ZA 2QRNA 1E0JA 2CK3A 4XWOA 1K8RA 2PH1A 2J0SA 2CCJA 2WSSA 1MV5A 1KJZA 1GTVA 3LFUA 4C0SA 2QAJA 4LYJA 3SYLA 2WWIA 1KHTA 2ERXA 1UBFA 2DY1A 1SKYE 2JJ1D 2RHDA 5H8WA 1KZGB 1LF5A 4EPVA 5BYJA 3GLFE 2QG6A 3I61A 4DCSA 2F43A 4EPXA 1JEDA 5TDHA 2EFCB 1J8YF 1Z6GA 4MYUA 1W47A 2IXGA 1P73A 2QMEA 2OEPA 2VSOA 3CR8A 4M53A 2GBLA 5FTNA 4HUTA 2GCOB 4PPNA 3GLFA 4JLOA 2RMKA 1XMVA 3BFVA 4A36A 2ZRLA 1Z0DA 4DSTA 1CRQA 3RRNA 4I99A 2W00A 5E95A 4YMTA 4ESVA 2A78A 2XZOA 2H16A 4UXIA 5FOUA 5FBVB 3X1YA 1AN0A 1Q12A 4QJ5A 3W9YA 2IYTA 2G88A 4RD0A 4M9XA 1JXMA 4OK6A 3SJZA 1NMYA 2ZM5A 1IN4A 3LBIA 5A0FA 1KZ7B 1T5IA 2BWJA 4A92A 4DDWA 1B23P 4G1UC 3RLFA 4I1SA 3FOZA 3LLMA 3K0FB 1G8GA 3JZAA 1P2SA 2B7BA 2H18A 1TF5A 4F93B 4IFEA 4L8GA 2V7QA 1W2HA 4A82A 3C7KA 4LZZA 4NP6A 4EPTA 2EU8A 3ZS9A 1Z2CA 1A2BA 4PPFA 1KSHA 1WDTA 5CIQA 3KUDA 3AVYA 3VFDA 4GT1A 4V0OA 4BWYA 3PEVA 3ADDA 1V5WA 3IBGA 1OB5A 3SNHA 2XTNA 1U94A 4LJ4A 4TMTA 3FMOB 1E6CA 3BH7A 1OXXK 1RZ3A 2HXYA 2R2AA 2ZANA 4TT3A 4AYXA 5SZKB 2V1UA 4KVGA 4WW0A 1WBBA 2QBYB 2QN6A 2JA1A 3K0CC 2ZJAA 2I1QA 4TL8A 3UXMA 1CJTC 3BK7A 3I4LA 3LW7A 5CLLA 1R8QA 4MRNA 4Q9JA 3SOPA 3WYGA 1FMLA 5KOYA 3I3SR 1QHNA 5JWRA 1S2MA 1E2QA 1T3HA 2PJRA 3RS4A 4C3ZA 1I2MA 5DI9A 2AXNA 2YWEA 1LVGA 5FTJA 2XAUA 3NEYA 3QI2A 4B75A 3AP1A 1GZSA 2GCNA 2QP9X 1UF9A 1ZM3A 1G8FA 1PZNA 3R9IA 4GOXA 1U99A 2V3CC 1N6IA 1G64A 4PO1A 2YHSA 4PC1A 5JS8A 2ZI5A 4L9SA 3PUYA 1XU4A 4HDOB 2YNMA 3DM9B 3UANA 3AVUA 3U7EB 3VTKA 1IONA 4Q47A 3AVVA 3WMFA 4BE7B 2DFKB 4JBXA 1FNMA 4OBEA 3K9NA 5FPHA 1C9KA 3R20A 4KLZA 3EPJA 1JR3E 1PJRA 5FOXA 1UDWA 1U8YA 2OM2A 5FL7D 4P4TA 1J2JA 5DO9A 1UKYA 4A8JC 1JPJA 2CLCX 4DUGA 5JS7A 1DO2A 2OFXA 3LVQE 1UADA 5FUYA 4A6PA 2BKUA 5FI0B 1YU9A 2V6JA 3K0CA 1RRGA 1TU4A 2CVFA 2FPMA 4XTCS 4LJAA 1YE8A 3MD0A 4Z8XA 2VBCA 3GJ0A 4LHWA 5AJXA 3ZLJA 5J4KA 3LAWA 1JR3A 2WHXA 1Z29A 4D25A 4LGMA 2VSXA 4Q1EA 4R9UC 2BJVA 2GNOA 4FMBB 4JLJA 2X8AA 4Q01A 4EFMA 3OAAD 2O5VA 3OHMA 2QROA 1KDPA 3MFYA 4TLCA 3DM5A 3D7MA 4DWJA 3REFA 2I3BA 4M22A 1Q1QA 2CJWA 3OZXA 4DEXA 5KO2A 1TF2A 2C9OA 2FZLA 1IJFA 5FFMA 3ND9A 4AG5A 1XXHB 1LS6A 3IUYA 5K8LA 3GLIE 1O3YA 2JGNA 3H84A 4LBVA 1E94E 1P9NA 3GEIA 3IO5A 2XXAA 3R7WA 4CF7A 3R9XA 5C46F 5K8IA 1XP8A 2DWOA 5F2EA 4TMXA 2ZR0A 1YZGA 2BHRA 3GJ3A 2B92A 2DR3A 2G0TA 1MO4A 3N2IA 2WOJA 4P33A 3B1VA 5CK5A 3C41J 3WYAA 3CBQA 3U44B 3KUCA 1D9XA 3CZPA 1P3JA 4D2IA 2GVDC 3L82B 1P5ZB 3QVUA 521PA 3GLIA 2VHCA 4O2LA 5D3MB 1S3GA 3TIFA 4TYNA 1YVDA 5L3SB 3KQUA 2VYFA 1CBUA 1EWQA 4F4CA 1CR0A 2P0EA 3KB1A 2FEMA 1VG0B 3GFPA 1KI7A 1XX6A 1Z6AA 3UG6A 1VPLA 1A5TA 4DIEA 5B30A 2ZVQX 2B8TA 4BLSA 3ZIAD 1VCNA 1E9FA 1IXRC 4C0HA 1KKLA 1FW6A 2RGXA 4BQSA 1YQTA 5DI3A 1DO0A 4PTLA 3E5HA 4A2QA 3MGCA 621PA 3BH0A 3FYHA 2Z5FA 2W2VA 4UXJA 3FFBA 3FMIA 3NTUA 1TQDA 3GJ4A 1G41A 4LI0A 2R6AA 4TMKA 4Z54A 3VX4A 4XVRA 3RRZA 3KFXA 4KFUA 1UBCA 4RKEA 4NL4H 1YZTA 2BM0A 1IQPA 1JJVA 2AWNA 4OHYA 4G5RA 4LBWA 4KITB 1NG9A 2VSFA 4EQ6A 2WWWA 2J5XA 3EASA 1H8HD 1RKBA 2X19A 1PLJA 1QVAA 2ODBA 3B78A 2F43B 2DFTA 1AS3A 2RCNA 3KKQA 4TLEA 3T1TA 2QT0A 4LSGA 1AS2A 4F4JA 2ASEA 1P6XA 3JZMA 4LJ6A 5GVRA 2CDNA 1NN1A 1SKYB 1Z07A 5JZVA 4LY6A 4AK9A 3CRW1 4E09A 1NMZA 2CHQA 4NMMA 1T91A 3FMPB 1ESMA 4UNQA 3GLFB 1KMHA 3NBZC 1P7CA 1EWRA 2JLZA 2J59A 2PZEA 4PFSA 1V43A 1W36B 5FI1B 1VG8A 1XEXA 1N25A 1N6RA 2ZRCA 2XZPA 5HPYB 1AM4D 1GKUB 4URWR 2UKDA 3VR4A 4RKFA 2JLQA 1T5LA 2BEJA 3VR2A 2FG5A 2IHBA 2OAP1 2ZI7A 1AA9A 5CYOA 4JMPA 4MUBA 4KFSA 4ZPXA 4PQYA 4ZV4A 1X8KA 5GJVC 3THOA 4B47A 1P62B 1R8SA 4LC0A 5E3HA 2LKDA 3WY9A 2FX3A 3CNOA 4BFTA 2X2FA 1F2TA 4TN1A 1G21E 2F1HA 2EYUA 2V6IA 5CITA 1Z06A 2XEXA 1T8TA 2VEDA 4HSEA 1JBKA 1ONBA 3RYTC 4PZZA 4WIAA 1JAHA 1QHYA 1XFAA 4PC3A 4FMCF 4GMDA 5FTLA 5E4FA 1Q1EA 2KE5A 2J3EA 3QJYA 4OQLA 4ZDIA 2WWGA 2ZS7A 5JWHA 1ZCBA 3AKDA 2O0JA 3T34A 1KSJA 4BFXA 8OHMA 1NJFA 1S9DA 2FEOA 3D8BA 1YR9A 1L4UA 2ZRPA 1NIPA 1J7KA 4L15A 1E2PA 3H4MA 2K5UA 3OEHA 1QF9A 1S8FA 5DIFA 2QM7A 2QZ4A 3ZVNA 3A1SA 1J90A 3OAAA 2IXEA 4HDCA 3VU9A 2FFHA 2AXPA 1VHLA 2Q9AA 3LQRA 3NC0C 2GXQA 4TMWA 4A0FA 4AIIA 5JEEA 3W5IA 1R5OA 2OO7A 3K9HA 3WP0A 4V0ME 3VR5A 3T35A 1FP7A 2DCUA 3OIVA 4C0AC 5EP4A 3AB3A 4H9GA 2F1RA 1ZINA 5CDFE 4ZKDA 4LC1A 2Q21A 1ZM2A 3T61A 4UNPA 1XWIA 2GK6A 1DARA 4MGKR 1E9CA 1KI1A 1G5TA 3SQWA 5FOSA 4EPYA 1TF7A 4YC7A 2LWIA 1OXSC 1XEFA 1M6NA 2DYKA 3FMFA 5A5GA 4V0MA 3O47A 2FGJA 5KUTA 1G20E 2FE4A 2WJIA 4BLQA 4ZI2A 221PA 4LDJA 5FPTA 4D80A 1NJGA 5CDFA 4L16A 1X8LA 1E1RD 1Y63A 5ELXA 1E0AA 1RE0A 4NTZA 3X1WA 1QHSA 2HUPA 3U3KA 3LQQA 5TARA 3GLHE 4B3XA 4RCYA 1KI9A 2R65A 4A9AA 2OHFA 1HE8B 3GJ6A 4Q7MB 1RIFA 1PUJA 3ZIAA 2PCLA 1Z83A 4D0LB 4LV6A 5EUMA 1IJEA 2A5DA 1E0KA 1KAOA 3QG1A 3T12A 2WM9B 1BMFA 3WRYC 3WMEA 4OL0A 3GFOA 3GLHA 3KTAA 3FPAA 5KDOA 2CJWB 3DZ8A 2ZUCA 5C18A 2Z0MA 2FZ4A 4PSAA 1RRCA 1KSGA 1C1YA 2V9PA 1Q57A 1XCPA 5JLJA 2GJKA 1KDRA 2XXAB 1PUIA 3R7WB 4AD8A 3BB3A 3WBKA 4B3FX 3NHBA 1LNZA 1X1RA 2W0SA 1Z3IX 2BBOA 3NEJA 3IILA 3CH4B 2ZYWX 1A4RA 1G5PA 1T0HB 2FMXA 2J45A 2XNSA 3TAUA 4EDHA 4MRSA 3QPVA 1H8HA 4UNNA 4BFWA 3DDCA 3GLIB 2C03A 3ZYCA 1OH5A 4FCWA 4GRAA 4FN5A 5SZIA 1T4GA 4AKEA 1COWA 3OESA 4MQBA 2QSZA 4TYWA 1E2DA 3WBJA 3U3JA 4BLPA 1XDBA 3MWYW 3KZ1E 3RS7A 3FE2A 2QNRA 3PUZA 4V03A 1CJUC 3A4MA 3K70D 1U8AA 1VIAA 4RD3A 3KDSE 1IN7A 1DELA 1OW3B 1OF1A 1Z0JA 2FSHA 2C2HA 2J87A 5DI3B 2ODWA 1IM2A 3GMTA 4PC6A 3B8HA 3T15A 3MJHA 3K0FA 3TGPA 3DOEA 3IHWA 4QXAA 1XZPA 1YR8A 3PV0A 1DG1G 4LHZA 4CEJA 5BXQC 4DC9A 4BZPA 4DRZA 4JYCA 3TUIC 1PLKA 2XX3A 2AWOA 1E2JA 2ZRAA 1EXMA 2IS2A 4MRVA 4YMSA 3V00A 2R9VA 2IS6A 4V0LA 3CF0A 4V02A 3B9QA 5CYPA 5EZ6B 1U98A 4QGHA 5JJKA 1P72A 2W58A 4X8HA 4MDFA 4GP6A 2G1JA 3GJ8A 4GMXA 1RYHA 4EQ6B 4PAQA 5IRCD 2H5EA 1CXZA 3AVXA 1DAHA 2AL7A 1ZM4A 4HYYA 3Q5DA 1IY1A 1N6HA 2ZE5A 1ZCAA 2VIIA 1NRJB 1U9IA 5DN6D 2Z6VA 2DBYA 2ZRBA 5EZ5A 4HLCA 1OH6A 1BOFA 4DLXA 3OE7D 4NCHA 4OHVA 3X1XA 2QE7D 2VP4A 3AUYA 4B2IA 821PA 1Z6YA 2ECKA 1XEWX 4JLVA 2OBNA 4HAZA 1KMHB 1WCV1 3LX5A 2PMDA 1W46A 4KODA 1UDXA 1KO7A 1NLZA 5CLQA 4AYWA 5KDLA 4BEJA 1ZNWA 1XEXB 3K9LA 3ZZTA 3ZZ0A 3UPUA 3BRWD 3AF1A 1LF0A 1ANKA 3QENA 1M1YE 3DO6A 3P4XA 3B82A 3HPRA 4PC7A 3TH5A 3WNDA 4LBZA 1TQ2A 2BC9A 2OLKA 2IYUA 4H1UA 2WZQA 3ADKA 3EZ9A 4HDQB 1ZP6A 3RSOA 1SVWA 3EZ6A 2J41A 5J4LA 2BOVA 1ZUNB 2IF2A 2FDCA 5UKDA 4DKXA 2Q3MA 2JJ2D 1OFHA 1F2TB 4QHTA 2ZAMA 4K81B 1FL9A 2BV3A 4A15A 1IXSB 1IHUA 1SGWA 2G0NA 4Q19A 1XF9A 2AN9A 1Z63A 5HZKA 4CEIA 4TL6A 1GILA 2R44A 4HAVA 1JPNA 1Y3AA 3NBYC 4WVFA 1KO4A 3BFKA 1CRPA 1ESNA 2OXCA 4RD2A 5AJZA 1OIWA 2O8FA 4KVAA 4BFSA 2XTZA 1X8JA 1GL9B 5AJWA 3U60B 1Q22A 4NYIQ 3KKOA 4D6PA 4JLAA 1MO5A 2VL7A 3LBHA 1T0JB 1E9RA 1S1CA 2ZUBA 4OQXA 3N5CA 2JDID 2R6FA 4HLUC 1E1RA 5TMPA 3NH9A 3SJAA 4DIDA 4DLTA 1QG2A 3C5CA 3KX2A 2RAPA 2ZS9A 1II8A 1G3QA 1SVIA 4XOIA 3SC3A 1E2FA 1UKVY 2JJ8A 1AGRA 1E79A 4AKIA 4WXPA 2GRJA 2Q9CA 5JSZA 3K70C 2V1XA 4JKYA 2MSCB 4HB2A 3AUXA 2OSBA 4XD7D 5DYIA 3VU9B 5FTKA 2WWYA 3J81k 3G0HA 2E9SA 3SS8A 3LBNA 4AYTA 3FWYA 1EGAA 1P75A 2CBZA 3H2YA 3AVTA 3E2IA 3TR5A 5JRJA 2IA5A 4JSTA 3HYTA 4Q1FA 4QC2A 3D3QA 4RZ2A 2EWVA 1RRFA 4LV8B 1JR6A 2JLSA 4LJ7A 3GD7A 3AKCA 1KK3A 5KNDA 1RRPA 2Z4RA 1NG1A 3EWAA 1YKSA 4DSUA 4ZDJA 1VYTA 5F9FA 3HU1A 1I4TD 1TUIA 3PEYA 1NLFA 1WMSA 5FBWB 2WBLC 3ZD7A 4Q66C 5GJCA 4W5HA 2IS1A 2J7PD 4HLUA 2FWRA 2HLDD 3W90A 1VCMA 1W4CA 2Z83A 3A4NA 3MUFA 4DLUA 4HAYA 1QVRA 3AP3A 4OI1A 3K0SA 1G1MA 1P2UA 2CLSA 2MSDB 1GDDA 2QMOA 2ZETA 5AUQA 4DCVA 5F98A 3LNCA 3U7FB 1YR7A 5FOTA 2BMJA 3ADBA 2VH5R 2D7CA 1NF3A 4CRWB 3IBYA 1R0WA 4NH0A 4NYJR 5FUWA 2NIPA 1GP2A 4KBFA 3HU2A 1HT1E 3AKEA 2ZREA 3L2OB 1E2GA 2SHKA 2YC2C 3GLHB 3LH5A 4IDHA 3KTAB 2G3YA 5KSYA 2C8VA 2ZJ5A 4TYPA 3VHXA 2IX3A 4ASUA 4JYBA 1MO3A 1SULA 3CPHA 3MJRA 1R6BX 3SU8A 1EFUA 2VHQA 4OQNA 4EIWA 3UK6A 4TQAA 3PFIA 4JS0A 4Q7JB 1NKSA 2O8EA 4GOJA 1GL6A 1HV8A 1SZPA 2NO0A 3L43A 1G8YA 5G40A 2ZJ8A 4KLNA 1L8QA 2OFWA 2QPAA 4ERNA 1II0A 3K53A 2PMKA 5KNBA 2NTYC 2RGNC 5GVSA 1MABA 2J1LA 2VP5A 3THWA 5IK2D 4MDEA 1JEEA 2P6NA 4M9ZA 1G5RA 4KU4A 4UXHA 2CHVA 3OE7A 3QY0A 3ADCA 4HB3A 4DLZA 3L8YA 3Q3JB 2FFBA 1OXUA 3VNUA 2NZJA 1E9DA 2AR7A 2ZI9A 2G83A 1KI3A 4QM6A 2FPLA 1M2OB 1TMKA 1OXTA
chains in the Genus database with same CATH superfamily
1AV7A 1U6IA 4PGHA 4PQGA 3LHFA 4GNKA 4Z4GA 3BRWA 4IXDA 5C0OE 4AN4A 1U3VA 2ZSFA 3HR7A 3QYFA 1UT5A 3QFRA 5FYQA 5TXGA 4C7VA 2DE0X 4XUEA 3HNRA 3R5KA 3UQZA 5A03A 3UJ9A 1VRVA 3A58B 5EG5A 3WBFA 2GPAA 4F91B 2OFOA 4E1VA 2VXBA 2ZSAA 1HDZA 4C87A 4TTAA 3V4VB 2GA9A 3HGQA 4TRJA 2ZRQA 4MR8A 5JH7B 3USZA 1LPBB 2H00A 3WHKA 1S9HA 4BECA 4EHDA 4PYIA 3N3BC 2FUG6 1CNMA 4QJ4A 5H4HA 1OASA 3S99A 4FGLA 4FHGA 3CG4A 2B5VA 1M7HA 3ESRA 1TUBB 4BLRA 1E62A 4YT8A 1U28A 4FILA 5L95A 3QFSA 1I7DA 1V41E 2PBRA 2J9FB 2IHNA 2JGRA 3AUSA 2J3QA 3OFND 3NGMA 3H2ZA 1NYQA 3A2LA 3MWGA 1GTRA 4DMFA 2HO4A 3C8ZA 2TRSB 1SUEA 4CT4B 1VJ5A 2HNBA 2ZU0C 5M3BA 3DE6X 3QKUA 4RA6B 1WRBA 3IESA 4FNOA 3RWMB 3TXXA 3FUXA 3G2LA 3LV8A 6GPBA 2OLJA 1L7BA 4ROSA 2ILVA 3SIWA 3U80A 5H68A 4QBIA 1XPUA 4FSDA 1GNSA 1Q0LA 4R4JA 3WLNA 1BC5A 1IUKA 1XG5A 3HYNA 3KQYA 3O2JA 1RWKA 2HMYB 3TL3A 3UAVA 1SHTX 3EG9B 3HCWA 3OO0A 3PZRA 3S28A 3H83A 4EYQA 4E5VA 4YI5A 2R8ZA 2IKSA 3AY0A 2C07A 5EP3A 1PTJA 2OFPA 4W1PA 4DMCA 2XA2A 3R7NA 3PRHA 3WYFA 3HDGA 1OZAA 1USKA 2YFYA 3GLRA 3D54D 4H77A 3ZWCA 2ATEA 2FOLA 4Y0NA 4IJVA 5CLFA 1SEVA 2CMGA 5LBTA 1VZ3A 1PFGA 5AVRA 4CMBA 5JWOA 2VJYA 1JVBA 1G2PA 4FOPA 1KO5A 2C1EA 4MUMA 4PG8A 3PRKE 4BMDA 1PWZA 8GPBA 1NIJA 2BBWA 5E7IA 5K0FA 1LBIA 1L4KA 4D9CA 5AKHA 1TYAE 1QYVA 2Y1GA 3H8WA 1NW7A 2NVUB 4CEIB 2NACA 3QJ5A 1LK0A 2QJRA 3IAXA 4CIXA 4D44A 5J40A 1WD5A 3FXAA 1VPVA 1YOVA 121PA 3CZ5A 3PVCA 2VHUA 1A95A 2WWFA 4GZ5A 4BQFA 1T0PA 4DMLA 4N0DA 3M4JA 3PDJA 1NBIA 3PYLA 4J8PA 3RVSA 2K7ZA 4C89A 4PGGA 5ITZB 3HV0A 2Q2WA 3ILSA 3C3BA 3FNGA 2HFJA 2X0EA 1OXVA 3P96A 4FYYA 2DJIA 3Q8XB 3ZU5A 3U4QB 4MRPA 1JECA 4FSHA 4BXOB 4Z4FA 3AF5A 4LJLA 2J9GA 4AQ7A 3JQBC 3LPCA 1EBUA 3OBIA 3ABZA 4CU2A 2NZ2A 3HK2A 2J7PA 3DE7X 3NIWA 4M3NA 1NUTA 1C30B 3TB6A 1HE5A 3ZOKA 3VAYA 5AR1A 4FGSA 3Q7IA 1II8B 2C5LA 1V1RB 2FPUA 2YZ7A 4D7AA 1WW8A 2HR1A 4AKGA 4AWBA 5J3JA 1JT9A 1M5TA 2IYWA 2Q6IA 3GA0A 4MYTA 4N39A 2CXXA 2Q07A 4A5SA 4CHGA 4CKEB 3X1MA 3LKZA 5KNCH 4LDNA 3MQ2A 2D2XA 4NPCA 3U62A 4F3RA 4ZXFA 4HBZA 2WHQA 4G25A 4ODIA 5BQ3A 2EJUA 3EXEA 4R8RA 5HTKA 3STUA 2LUOA 2XSZD 2GB4A 2FXVA 1Z4KA 3BQNB 3I52A 1X77A 3DEAA 4A8JA 2MTBA 2OOKA 1JMKC 1WZEA 2YQZA 3DQPA 3M4NA 4OREX 4P8RA 2F1OA 1JMYA 4URZR 5F2KA 4ZEOA 1QX4A 4D3ZA 4EA7A 3WLRA 5I7AA 3IIMA 3TXAA 5AW9A 2VJPA 2Q2OA 4KXUA 5K05A 1GCIA 1L7VC 1RI5A 1V9CA 1CJKC 1OR8A 3CH7A 3O1HB 4KO8A 3TIXB 2VHTA 4DL9A 4U7PB 2J9RA 1X7DA 5B3JA 4UBKA 2QZZA 1QV6A 2PZFA 4R84A 3SWWA 1J1IA 2RI0A 2VPPA 2ZT8A 2JB9A 2ONJA 1MA3A 1ULAA 1XMSA 3CURA 1VG9B 4ZC8A 2UVPB 3AV0B 2FDRA 3ZG6A 5BV1A 1Y3BE 2BMVA 2XRYA 5EEGA 2MINB 4YECA 1AGXA 2AXEA 1FUKA 4YJ3B 2DBVO 3HY3A 4PHHA 3O73A 4XOUA 4ZQCB 3V3KA 4K05A 2P9CA 1DX9A 1GAJA 4LYHA 1Z12A 1J99A 2WF7A 2PJUA 3PIRA 4LXIA 4UTPA 1XTIA 3QUTA 2O4UX 5AP9A 1Q0SA 4OXYA 2OFFA 3IT0A 4TKUB 3DFMA 5U9CA 3E9CA 2EW1A 3QUQA 3DFIA 1SBIA 4YI3A 3MT0A 5NLLA 1VE9A 4XI9A 2HBQA 1WNTA 1K6IA 2UYHA 4PHFA 5TMBA 2GN6A 2QN2A 3MTEA 1H2AS 3BICA 3IOEA 1JWBB 3CSUA 2L69A 1FQKA 4RIEA 3ET5A 1AQLA 5JY1A 5LYYA 2W48A 4P5EA 2ZT7A 4QD3A 4J75A 2OUKA 3GGDA 2YWJA 3TQRA 1W85B 5EJ4A 4BLOA 1M7GA 3B38A 4JLUA 1EP9A 1PYDA 4X84A 2Y9PB 2HF2A 2I3AA 4RPGA 1Y9AA 5BSMA 5FNVA 5LD2B 2QTAA 1N9GA 3AJAA 5BW6B 1NVVQ 5HTOA 4KRFA 4GI7A 1PR0A 5SYMA 1U5CA 4V0KA 3GT0A 4F7WA 2IUTA 2OKCA 4YVFA 2E87A 4AUNA 1PR3A 1S2GA 4ZTUB 5MGNA 3Q7QA 3LP6A 4P3YA 3LKBA 3PNMA 5AT1A 5DP2A 3ZHQA 2VEOA 4Q9DA 4D9KA 1VHWA 1AUVA 5TLSA 2N1BA 1AKYA 1M7BA 1Q3HA 3EF1A 3BGVA 1GCOA 1BKSB 4Z0TA 1D2NA 2OQ2A 2E4WA 1I4LD 2XVMA 2ESRA 1OU4A 5AKLA 4BB6A 5KTYA 5IDVA 3THWB 3OFNA 2L42A 3ZBQA 1U8ZA 1SXGA 4JODA 2BBSA 4WZBA 3LUBA 1RQLA 1KFBB 4DMGA 4KR6A 2VRNA 4KX3A 2KJQA 2GZDA 1TKAA 3U7GA 1XGKA 3AERB 2BLNA 4XWGA 1YRWA 4BYMA 1KH3A 1RJFA 4JJAA 3CNHA 1AZTA 4Q3LA 5AMXA 3AEXA 2JLVA 2C78A 2O2CA 4LYYA 1T2VA 3JATB 4PZDA 1D09A 1H8ED 4C04A 2BMWA 2QVYX 3V4FA 2R4QA 2JFZA 3LCCA 4ON9A 4HK4A 3SE0A 3WK4A 2Z3ZA 4YEDA 3PC7A 3BD7A 2WTMA 4B40A 1V7ZA 4KN9S 4DR1B 3PB3A 3TCKA 3LVRE 1AZSC 4HGYA 4K03A 1NC1A 2I7VA 5EP2A 2XUHA 4GP7A 1NWHA 4C4XA 4KWEA 4F8YA 3T5PA 4AY6A 3O3OB 4WDQA 1E1CB 1GLGA 2NT4A 4ZYLA 4ZOEA 5AKGA 4DQLA 4CM5A 1UKBA 3DAOA 5IEBA 3VSDA 4D6YA 1U2PA 2PWZA 2ZK7A 3HU3A 4H08A 4KPUA 3TIIA 2CHUA 1E7QA 1S0UA 4LZJA 2ZJ7A 3DVAA 3GFGA 4ZOAA 2V7PA 4HZGA 2O14A 4KLRA 1QZXA 1JPVA 4RVFA 4A26A 3GJRA 2P6OA 1CUXA 5BWCA 4FNAA 5TF0A 5EMKA 4CTMA 2ADFA 2GD6A 1SG9A 3H5NA 5IJ0B 4ISBA 3OH8A 2M6KA 4KKVA 2GX6A 1ZKMA 2J7KA 2GCPA 1L8XA 3LVBA 3DZDA 3NKFA 3RIGA 5AVKA 4ETMA 2QTFA 2NSYA 3TKLA 3MYYA 1D2MA 1U8TA 2G06A 2F59A 4X1YB 3VTFA 2ORED 2G1KA 1XAHA 3ZDYB 4JWKA 2IXBA 4F56A 2FA9A 2QRQA 3I92A 4JJIA 4P31A 3D4OA 3ZEAA 5CHYA 2C8KA 13PKA 1CQWA 3I9FA 4JBYA 5EL0A 4U00A 5T6BA 2HYIC 5KOHA 1O87A 2WTXA 1AK2A 3QBTA 1B15A 4DCUA 1N6PA 4IKOA 5FFFA 4D9MA 1KC1A 3HCFA 2HPVA 4FEAA 1EX1A 2R2GA 4L9WA 3QZUA 2RE8A 1U1DA 5AM1A 3NOOA 4R41A 4X1KB 2JIQA 4FYWA 4H15A 1XUOA 1L5GB 5A0TA 5DLYA 3O93A 1H4TA 2B36A 2IC5A 4QJIA 4WT7A 4Q9IA 1GPDG 1BKYA 2V8OA 2J08A 3DNPA 3L0PA 1ZK2A 2IHJA 4HN2A 4QYSA 1E32A 1OLOA 4GECA 3LX6A 3GU3A 5HBRA 3Q8WA 3RAEC 5DBHX 1ZNZA 2IHUA 3ICCA 2FCAA 2GJSA 3DO8A 3N86A 3M6UA 1MC8A 3FYUC 5AXDA 1VKOA 1Q6ZA 2E1PA 1FFYA 2OBBA 4Q02A 2R8PA 3UC5A 3I6BA 2CY0A 2XY4A 1XKQA 5MDHA 4S1TA 3OE5A 3E3NA 3ZZUA 5LQMA 5ALUA 3FSGD 1ONSA 1U8UA 4P80A 3KPWA 5C8YF 1T24A 5HJ7A 3C4JA 3IE0A 3H04A 4PYLA 4Z3OA 3PLRA 4BFVA 4RK5A 2OENG 4AF8A 4RBNA 2O2ZA 5ENDA 3FWPA 4V2IA 3NOXA 3SJUA 1OH8A 3O21A 4S1NA 4LNAA 4TSFD 1UXIA 4XDGA 1EHIA 1V7CA 4M1KA 3K9WA 4QUAA 3TW8A 1EQ2A 4BCDA 3H13A 1M2HA 2IV7A 2R7LA 4FE3A 1G1AA 3REQA 1XQ9A 1LC3A 3QBVA 4OAQA 4XIJA 3IUPA 2Q0SA 4QHYA 3AEKB 2VCYA 4WNAA 3I1YA 4X6LA 2QYTA 3IV9A 3UKDA 1ZAKA 3X1DA 4DN6A 4CF6A 4P2GA 1J22A 4QGFA 4L51A 2CXPA 1HPLA 3TNDA 1GGNA 4ZKEA 4TKMA 3U3OA 3S1SA 3MERA 3SSNA 4IJQA 5JBQA 2FSSA 2M1ZA 2P9FA 3LC2O 1TJ3A 2ZSDA 5I6DA 1TYCA 2YJZA 3DBVO 3RUHA 5JZBA 1QAOA 2FZ5A 3OCVA 2ZYTX 3LYAA 1GHTA 3KR1A 1W87A 2X5XA 4H0NA 3DLHA 4DMUB 3DBRA 1U3UA 3GMDA 4W5QA 4RZUA 2BSXA 2HADA 4KAFA 1NT2A 2K2QB 3NXSA 4UHJA 3RS2A 3H42B 3AF6A 1DBSA 4PPGA 4HTFB 4TM8A 4Z9FA 3UUFA 4WLNA 5I9LA 5KC9A 2WB2A 3RIEA 1RI1A 2I80A 2QXUA 2DPHA 1DMRA 1I3NA 4MHSA 2NOAA 3U26A 5D5QA 3A9RA 3SHOA 1HURA 1SCUA 1G3IA 3P4UA 3RKUA 4LDZA 4UUNA 4GZMA 3HJTA 2ZITA 2VJQA 3UK0A 3M49A 2FF7A 5EIXA 2H2DA 2NUAA 1VL8A 1G18A 5H16A 3ME5A 3KLOA 1QU2A 2D1RA 1OT5A 3LJKA 1V9LA 1K1EA 1IHOA 1SZCA 1XKLA 2IXTA 2P9YA 3E5NA 4JJ8A 1FXSA 4KV9A 4O4LA 3WSTA 4DPKA 5KIAA 3ZWAA 2WABA 2EXXA 3WRYA 4C20A 2ZJ6A 2QENA 3B2QA 5JMWA 1DX6A 2QYOA 5IU6A 1E2MA 3VOSA 4QVIA 3CUEF 2I6FA 4W9RA 1JIJA 3FI9A 1JLRA 4NCKA 1NF8A 1Q7RA 1AUXA 4JD5A 5KSOA 4PVCA 4UQOA 1SUPA 3W5UA 1N2GA 5IYZA 1OPXA 5BNWA 4DV6B 5JYEA 5AW4A 1TXGA 3B13B 5F52A 3PITA 3W5DA 1CP2A 3SR0A 4V24A 4IXMA 4WZ6A 3KVYA 1BN6A 3H2KA 1AGYA 2IYPA 3CTPA 3GCGA 4KUGA 4MJLA 1H8EA 5KMGA 1Q0UA 1ZJ5A 2R4TA 3AWIA 3PR2B 3DHWC 3EGOA 3Q9SA 1N2ZA 4LQ4A 5KPDA 4E2YA 2ZIXB 5BSVA 3AHHA 1TT5B 4D8XA 1E2NA 3LPMA 4KR7A 1HG1A 5KDDA 2ZBEA 3SHFA 1ILEA 1BX0A 1EVKA 4FS3A 2AX3A 3IHLA 4PHGA 5HX7A 3JQAD 3TLKA 3WLJA 1OUMA 2OQRA 3CX3A 2BEUA 1B8PA 3M82A 3TE7A 3QBJA 1CU1A 2ZAYA 4WBNA 4O2BF 3GJQA 3PXUA 2JHPA 3EISA 4UUBA 4GSYA 4YRIA 2PXCA 3FHOA 3HUFA 4HFRA 4BMXA 2WD7B 5IKPA 4ZO6A 4NCJA 5ALYA 3O4JA 2ZOSA 1AA6A 1MFZA 3IQEA 2MR5A 4FK8A 2QTCA 4K3VA 2R1UA 4A0RA 1YDGA 2XQKA 1A8QA 3VBEA 3KPUA 4KQKA 4IS2A 5AKEA 5I4BA 4ZQEA 1ZOSA 2TMYA 1G9SA 1FPQA 2WAMA 4CYMA 3FPFA 3LT0A 3NBFA 1AIPA 3CZAA 3I64A 4HATA 4M76B 4O4HF 5JVDB 2QD2A 2QSYA 5AK0A 4TSKA 3VX3A 4FDMA 5EEHA 2P69A 1NDUA 3INGA 4LY0A 4G63A 1HETA 2P9QA 5JXJA 2BMDA 2N0SA 4C4AA 1Q1GA 2QVLA 2PCJA 3I2YX 1R4AA 1RYYA 3NH6A 5DTQA 4MCAA 4DOMA 1J7JA 4EI9A 1RC0A 1M75A 1II9A 3IC5A 2GJ8A 3ONWA 1Z6XA 3IQGX 2FDXA 4TV8A 5BSEA 4RHUA 1XJ0A 4PZYA 4HN4B 4KZPA 4HNHA 2CLIB 2DQYA 3NM4A 1QYCA 1JYEA 3MUNA 3EDYA 1N33B 3KUXA 4BN5A 1ZU5A 3A26A 1PV4A 4KQGA 5KBYA 1N34B 1O58A 1PGOA 2EGHA 4CL2A 1D2AA 1OB2A 4HH0A 2C2ZA 1QYIA 1SU6A 2PU7A 4Q4CA 1XTSA 2I4TA 3A31A 3D2LA 3E03A 5H70A 3T3MB 1K3FA 1XZEA 2DTEA 1W19A 4WZAA 4BIMA 4EH1A 4Q4AB 3QVGA 3B3AA 4GKBA 4P0TA 1QBGA 5BVHA 6REQA 4MGZR 1U0LA 5HFJA 3RRBA 4B7XA 4YR9A 2KLBA 1V1MB 3G82C 4LC9A 1ENPA 4CV2A 4ESHA 1Z7WA 4GX0A 3V8VA 1M6HA 2PL1A 5L45A 5LXTB 1NLMA 3PNQA 5B3LA 5EKDA 5IAKA 2MCFA 1E3LA 3ECSA 4GLJA 4GC5A 1LBSA 4ZAZA 5FRDA 3DFKA 1CY8A 1ECFA 3FSGA 2CEAA 1UOPA 2W2NA 3LHDA 2R8RA 3TLXA 2QS9A 3LK7A 2I76A 4DXAA 3VZPA 4HADA 1VLLA 2DGDA 2V4MA 4F38A 1NUPA 4D9HA 5GOTA 1P80A 4G0ZA 4RTMA 1GZ6A 1KAHA 4TSFA 4ZJZA 4OLJA 2A0YA 1HOTA 1A98A 2I67A 2VDMB 1I4DD 2GPJA 4RF5A 1BCSB 3PDIB 1IOLA 4LZPA 1L2TA 1F5NA 4I66A 3S2YA 4P0PB 1DRVA 2GZ2A 1ZBDA 1YZHA 3WO1A 3KVRA 3QFHA 1TAQA 2GYVA 2R3SA 2YXEA 4TYMA 3V8MA 3EY4A 4WK0B 3SHQA 4E2ZA 2VP3A 4IHJF 1F0NA 1ZYUA 5IAAA 2O8EA 2BCGY 3BIFA 4FI3C 1RI3A 5AICA 1AO0A 2XEDA 1L4YA 2PO7A 5KU7A 3QKRB 3OZVA 5C5IA 2I8AA 2FLWA 3M1IA 5DVZA 1K2VN 4ESOA 1C3EA 2C9DA 2D59A 4N5LA 1EFCA 1BDMA 2R86A 4CCYB 1I7QB 2RSLA 3IH5A 1JX6A 1XVIA 2H2IA 3D0OA 3I5XA 4K6CA 4Q6BA 4ZCTA 3BD9A 3S70A 4TTIA 2ZYUX 3RAPR 3B5IA 4MS3A 4QPPA 2HRQA 2IOFA 4HDKA 2OESA 5LB4A 2H4JA 5JZ9A 4CM9D 3WP1B 1XKXA 4JBGA 5DN9A 3U7QA 2NP7A 1NPTO 2ISCA 3MAGA 3ONFA 3V2IA 4B80A 1QK5A 1R4NB 4EP1A 3ZY2A 3DHVA 5A5DA 3HCCA 3OC6A 2UUCB 3GRVA 4E15A 1VCOA 3AR9A 4ZYVA 2HEIA 5T3YA 1V47A 3CZRA 5JTUA 1YB2A 3MCWA 1LTKA 5DGDA 1LJLA 2CVOA 2PH3A 2ATXA 3WAKA 5DBIA 2IYYA 4ER6A 4URYR 5TNXA 3C6XA 3G23A 1QGUA 1N0VC 1IU9A 4GOLD 4NPHA 4XYLA 3F8SA 2P5TB 1IXZA 1TJYA 4DNFA 1IZ7A 4RSHA 3I5AA 3FLEA 3N2ZB 3LF1A 1R5JA 4BVBA 2B7LA 4R0NA 1HQCA 1EM8A 1UC9A 1S7GA 2HHLA 4L9AA 4WNYA 1QO7A 1T3LA 1WLSA 2YUIA 4EB6A 5C7LO 1WB5A 2DQZA 4B4UA 4LPKA 2GJ9A 5COBA 3D1JA 4F5DA 4B2PA 3VZRA 4XX0B 4C5AA 3ANXA 3TMYA 3FYUB 3ZNPA 2P0AA 1YNSA 3C2QA 4DJTA 2O48X 2ZPTX 5EQTA 2LDBA 1W1UA 1F51E 4CR7A 2E4VA 4XQ0A 1RYFA 2OD2A 1V3UA 5A9SA 1X6VA 4RDXA 5DWVA 4N6OA 3T1HB 4J3FA 3PTZA 3EN0A 1PP4A 3FNIA 3E1KA 2CFSA 3GRKA 3IEUA 4G36A 3VU0A 5DZSA 3S5UA 1AG9A 4QPCA 3CLUD 2QE7A 5ALTA 3KEMA 1XBTA 2X5JO 1AUPA 3O2QB 3AVQA 4XGQA 2JGJA 2O1XA 1PT8A 2QAGC 5DM70 4ZC1A 2YUTA 5ER6A 3WE7A 2YRWA 1V6AA 4M54A 4R1NA 4TZ0A 4L4XA 4CKCB 3JZIA 5F5LA 1FYXA 2H4ZA 3ENZA 2RCYA 1FU7A 1L7NA 3DV0B 3N2EA 4FDVA 2OV4A 3RV3A 5F21A 3PP8A 5I9MA 2IV2X 5LFAA 4P4SA 1PK9A 1RQNA 1NBHA 3A14A 3AP2A 1ML4A 1KEEB 4YRDA 3H6KA 1KY5A 4FCVA 3A9UA 3U4IA 2AR0A 3IVXA 1DJLA 1P4RA 2DP4E 3PQ4A 4BO1A 4TTQA 4Y1RB 4JJFA 1M1UA 1OWNA 4XJXA 5BSHA 1YF3A 1Z2AA 4EWLA 3THXA 4FTWA 4QGBA 3F90A 1N7GA 4L4SA 4FM9A 1OLSA 2JJ2A 1DNPA 1HZZA 1RS0A 3W5BA 4XGIA 1FDUA 4KQWA 4OI4A 3ROFA 2AFHB 3IR5A 4UBOA 5H82A 1Y34E 4WK2B 2X2OA 4C76A 1CVRA 2H1HA 3NONA 2WUVA 4B0OA 1GZHB 1MX9A 2BRUC 3F5FA 4DE5A 1J97A 4KWCA 1FMJA 2NXWA 4L5JA 3W8NA 3OCWA 2P9TA 3RFCA 4MAMA 1YAJA 2P11A 2BZSA 1SU7A 3KXKA 1VE6A 2GZHA 1C7ZA 2PFKA 1N6NA 4EZIA 5JNSA 4Q12A 4UW9A 4B6QA 1K86A 3G79A 1OWOA 1PWHA 2KBEA 2Q3JA 4CLHA 5HM8A 2Y77A 1R9NA 4F1KA 2N75A 1VSBA 1VMAA 2JDIA 4GVLA 3BSFA 1Z56C 4P92A 1GM5A 1HLDA 3B60A 3JAKA 2W37A 1Y5IA 3PGVA 2HSDA 3T5MA 4QQNA 2ZIZA 2QTRA 4EI8A 4OMCA 2HWKA 1GKLA 3QYAA 4WQMA 1LW7A 3IVCA 4WY2A 4X7PA 3U3RA 1WSDA 1R0BA 4DV4B 1G42A 1KO8A 4QFBA 4OIFA 5AXAA 5KQPA 4C21A 4NBTA 3AI7A 5JPIA 4CTKA 1NHWA 5JJLA 4IINA 4JFRA 2C88A 3IQWA 5CM8B 1E8MA 2OCPA 2C5HA 1NYRA 3I9V6 1POXA 4D4MA 2FQ1A 2ZYDA 2IPNA 1KEZA 5AW8A 1LRLA 3T4UA 10MHA 1GADO 1JHQA 1I3MA 1CG6A 4WFKA 4X91A 1LGYA 4GP9A 4M55A 2HDHA 2Q6VA 3CVUA 4E5PA 4YTEA 3C3MA 3NBQA 2C3UA 4PO3X 1M34E 1UPBA 4KX5A 4XM1A 3V7UA 3KL4A 4LVUA 5J4YA 4UAUA 1U7ZA 3L0YA 1N0HA 4FNMA 2ZRGA 4IDQA 3UAXA 3V4OA 4AQDA 1QH1A 1BXZA 3I2HA 4LOJA 4EKNB 4GDFA 2B5WA 3TJZA 4LSWA 4RA9B 1HQDA 2G9RA 1C1XA 3DDOA 1ONPA 3QWHA 3ZH2A 3GDGA 3GLQA 4P53A 2QTVA 2EERA 4C6HA 5GINE 4NNPA 1US8A 1FFHA 1UWLA 2WC1A 2WMYA 2IW3A 1X19A 2B4QA 2EEPA 1JEOA 3UJAA 2QL9A 5H59A 3HFSA 1XHEA 2ODNA 1FYVA 3MVEA 1J8QA 2JFFA 3M8KA 3O83A 1FP1D 2FJPA 1UKEA 2YOHA 1O7JA 1UAAA 5TS2A 3HCRA 1SXJE 1E1LA 3FB4A 4N12A 1A2KC 4N8SA 4W8GA 3FKSD 3LK6A 3Q3CA 4ABTA 4AJIA 2QI9C 3AUUA 5HBGA 1OAOC 2X7JA 4WBSA 2XJ4A 2ID7A 2RH5A 1ZESA 4PSKA 4OH1A 2JASA 1WWKA 3C85A 3DOFA 1LZLA 4JY7A 3U1VA 4I4TB 3V2HA 5ALWA 3IERA 1UK6A 4JIMA 3I6YA 2ZI4A 1RWOA 3A6HA 3G2KA 3CO0S 3B89A 4YRLA 3CM0A 3TF5A 4PLWA 3FA2A 3VPCA 1YTUA 5B58C 3ILVA 4ZU3A 3BBPA 2A30A 4Y2YA 4JROA 2M32A 2JVKA 2MU1A 4O29A 1IM8A 3B9BA 5IHXA 2Y1LA 2FOIA 3DQQA 4Z0NA 2TMKA 3F7MA 4IOJA 3RWOA 2PT7A 4K8OA 3UC9A 1CETA 1I36A 4TXLA 3UUGA 4MUNA 3LOQA 4BGEA 1EUCA 2W6JD 3DAFA 4RMGA 3WJAA 4AP9A 1HDEA 3KOMA 3BL8A 3EIEA 1N75A 4CCWA 1VPEA 3ETCA 2P3LA 5DHPA 5J23A 1A9YA 4P84A 4Q9KA 1YRAA 2XKJE 3IYLW 3L0OA 3EPLA 1LI5A 1TEXA 2SBTA 1NU8A 4WMLA 4NZ9A 4QRIA 5EWJA 2GSWA 4BWFB 4OCZA 3RTDA 4W5OA 4N48A 3AQ4A 3R6WA 5ADVA 3H5OA 1XELA 2VDRB 2IU3A 1PGJA 3M34A 2X3FA 4U1RA 5JROA 3G0DA 4B3CA 2EHJA 3HDTA 1SQSA 3MLBA 4DT1A 2O6LA 2IWHA 1KL7A 4IKEA 2JLUA 4DV1B 3K70B 3MWDA 1Z7GA 2O0KA 4QG7A 5CXSA 4BB9A 1MVLA 3QF7A 3ZDDA 4EW6A 1ZKDA 2JGKA 1V2HE 4CMIA 1QQAA 2O2EA 2YFQA 2GN8A 4M0UA 3E9MA 1TKCA 3FPJA 5WRFA 1TCCA 2OV1A 3Q8MA 1JKFA 1ISFA 1BDJA 1VC2A 4REQA 3HABA 3E35A 3EMBA 4BJ6A 4BKOA 5BRJA 4BAUA 4IIJB 4Q3EA 5BWMA 5EAIA 3CR7A 1Y89A 1JHDA 2AD1A 1T8UA 1LPMA 1QLWA 1UJ2A 5EFZA 2VTBB 2VAXA 2VH2A 4Y1GA 5KYXA 3B7PA 5ALNA 1MNAA 3CB4A 1JFVA 3GVCA 1ZMRA 1YHZA 4KRXA 3WIUA 2YQ5A 1ZH8A 3VNRA 1CNFA 2EFDB 3AYXB 5E1DA 3GGCA 3OJXA 5CX1B 1Z8NA 3L8HA 2Z4TA 3LDGA 1HZJA 1JQKA 1E6MA 2HMSA 4M0FA 2YVUA 3VR6H 1U2ZA 4BC0A 2ZJBA 3QE2A 5I7WA 5LZ5A 4FE4A 4TMVA 3O1IC 3W5JA 3IODA 2WPDD 2Y1EA 4KYIB 1DWQA 4IIJF 5DBFA 2H63A 5D51S 5K4HA 4NOJA 4WY5A 4QYTA 3ELUA 4AUEA 4QUGA 3T7KA 4U2DA 1MMFB 3MT8A 2QE6A 5K6RA 3KPYA 2IPAB 3UK2A 1LX6A 2PEZA 2H85A 4B3GA 3VO9A 3EXHA 2GQ0A 5BNTA 5SV2A 1PZHA 4ZYXA 5KAPA 1UM8A 2L0XA 4NENA 1F5SA 2CYBA 4X97A 3VU1A 3SS9X 2YVKA 4PR3A 3LDUA 1XT6A 5JU6A 4LRQA 3C70A 5J4HA 4IGAA 2ZYSA 5TV2A 3O3MB 2WUWE 4W9MC 3N3AC 3FCCA 4HWGA 3UMMA 2XF8A 4LY3A 4FFDA 4IOKA 2OHJA 4JBLA 4JUCA 2AG6A 3D3NA 3L6UA 2D5CA 2O2GA 3AESA 1T1EA 4WI1A 4AO7A 3GF4A 4M1SA 4M7PA 4YCCA 5LP6F 2V96A 1D7AA 4Z7JA 5K8CA 1E6WA 3HBNA 4DR3B 1LQUA 1L7DA 3JQQA 2Q1UA 3OLCX 4YRMA 4FMCB 5AKZA 4U7FA 5JXWA 1FTNA 3AB7A 3MWEA 2O2XA 4X9XA 3ZLBA 1EK6A 3DMHA 3HGTA 2WU0A 3ZGXA 3CRRA 2ABWA 3FKQA 3IAAA 3MRSA 3OC0A 4U5XA 1UK7A 3EVFA 4YV0A 4MIKA 4WLOA 3TQIA 2EFEB 1EFRD 1ZFNA 3VYTB 2P3QA 4HTAA 4BX9A 2JG3A 2OZKA 1OILA 3WRWA 1SC9A 3HDYA 4HDAA 4Z4QA 2IEIA 2P2YA 2Y6UA 4GRDA 1GN8A 1Z2OX 4LOHA 4BP3A 3TOCA 4DMRA 3LX8A 2VBGA 2QAGB 4JL6A 4KBYA 4QVGA 4X8MA 3TQCA 3ZHUA 3F9RA 2FHSA 1BWQA 1F6DA 1CFZA 2NPIA 5JSUA 1OXBB 1ZPDA 2QUZA 2VQ6A 3M81A 3PPIA 5C4GB 3SXJA 1YMVA 2CKMA 5GIOE 2X41A 1OFVA 3ZWBA 1TM5E 4YWHA 4L8WB 1WDKA 4P86A 1YQEA 4ZAYA 1YK1A 4XUCA 2R47A 3KWFA 1Z37A 4EVQA 1UMDA 2XMGA 3LZDA 4DYDA 1AU9A 4BWGA 4DBLE 1XMIA 3JQ6A 4MUIA 3CLVA 2WYHA 2RB5A 3FKSA 4P4UA 1KAMA 4PVDA 5DCLA 5DF1A 5HIJA 5JE8A 3TBKA 1VHQA 1HT0A 3DNFA 2WIBA 4CQLA 1GZVA 4FCTA 2OXTA 3PIDA 4BFCA 1KE2A 3BDVA 1AGNA 3ZV4A 1UJ4A 2PN1A 4D9BA 1W25A 2G07A 3CEPB 1IULA 3R8XA 5M5BA 3ZJUA 2BZ1A 2L82A 1U0TA 4J94A 2DKOA 4HAXA 4FYIA 3MCAA 1L0BA 1DADA 4X5OA 4Y2HA 2CMHA 4UUMA 4D3YA 2BHNA 4EY5A 4ZYYA 2GF2A 2XD4A 4FW9A 4WECA 3DMTA 1F3LA 2DUUA 4JI1B 3BWYA 4CW7A 1STOA 4E12A 5ADWA 2VP2A 2B3DA 3JU3A 3NPAA 3URMA 4MPTA 3V46A 1KRWA 5ED4A 1P44A 2SKCA 3TG2A 1HA3A 2QUIA 2WJYA 2B34A 2W6ID 1XTQA 1Y5RA 5CB8A 5IKEA 2F8TA 4TV9A 1P17A 3L7AA 2W6JA 4IGKA 1VE3A 421PA 1QHEA 1H4VB 1ECPA 3LNTA 3PJFA 3HFRA 2Q50A 4HQLA 3ZEIA 1JEQA 2J33A 1ZR4A 2P79A 4JCCA 4I6JA 3I01A 4AZ3B 3TVDA 5GJWC 4Y0VA 1OD6A 3R9KA 3K3PA 3RS3A 4CM1A 2I87A 4RZSA 3D8HA 5CH5A 3FNEA 4DCCA 1K06A 1XVLA 2YC4C 3AI2A 1PI3A 5B7NA 2J0UA 3K73O 2I65A 3SK0A 3KELA 3C3KA 2C4VA 3H5LA 4ZO9A 3EGXB 2H5JA 3CLHA 1C4XA 4I9HA 3MBIA 1A2OA 2F48A 1ZUHA 1YRQA 1M9NA 1WZIA 1X7WA 2YJ5A 5JHHB 3FDJA 3MWKA 2MMGA 3RIXA 4HWRA 3M4YA 4QWMA 3ZD6A 3GEGA 4PXAA 3HBAA 3KLPX 4Q3CA 5LA6F 4CIDA 1OU0A 3HZOA 4D9JA 5HOQA 4PSUA 3UT6A 2QNIA 5JW6A 3NUGA 4DIOA 1GPAA 3JXEA 5GP1A 1EM6A 1PIWA 3TN7A 1IN8A 3WMWA 3JAWA 4AF6A 1VKNA 2GEBA 1WF3A 4RYLA 1AQUA 4XYMA 2IWRA 3S8YA 3MS2A 5HF9A 2V58A 4D4IA 1ZGCA 2IY9A 5LBUA 1UCFA 2PV7A 5KYVA 3EC7A 1YI8A 2F67A 3F5MA 1PT9A 2VK8A 4U7GA 3LDAA 5DRTA 1XZDA 3VZSA 3D4IA 4R3WA 4B3BA 1A2QA 1G2OA 1OXKB 1RKQA 3NJRA 2P3SA 2OBLA 3FROA 4IR7A 3UKJA 5A1TA 1NX9A 1S3SA 1X80B 1T8WA 2H4XA 4UNIA 3H99A 2G28A 2Y67A 4LA4A 1TQ6A 1G5IA 3B36A 2WPDA 3VKUA 1PG2A 1T6NA 1TVCA 1GT6A 1I1NA 4HWTA 3RNOA 4B32A 5K0JA 1QH9A 2WIJA 5LDDC 4QT4A 4JU8A 2LR0A 3O8OA 3EGDA 3JQ8B 3UXHA 2EX4A 3JQGB 4DBZA 4MQLA 5C53B 3BJMA 4UJ5A 1JAXA 4G8CA 1DIBA 2GTIA 3H18A 1LX7A 4RDIA 4QT0A 5A9RA 2H7YA 4C88A 3V4RA 3F4BA 4E07A 3PQFA 3A11A 3EVNA 2FPGB 3Q3VA 3K71B 4OATA 2YWFA 4JLBA 2A86A 3QLUA 1HE1C 1DAGA 1N5DA 3F2IA 4YAWA 5LPNA 1PL0A 4QBGB 1RAAA 3TM5A 4CL8A 4DJAA 4RKRA 1ZC4A 3TNFA 2JIPA 2ZT6A 3NHFA 1VJDA 3KJIA 2AW3A 2P2GA 3QEMA 2A9JA 3HZHA 3OT4A 1GZ3A 3QX7A 3GFSA 1F4PA 3F6SA 3UHPA 2JFXA 4S0XA 2QU8A 2NYUA 1OWPA 4PTZA 2HHHB 1GSAA 2A4KA 2NSDA 3DP9A 2IKQA 4Y2TA 3NDPA 4HBGA 3ZU2A 4LZOA 3EPKA 1E3TA 5KTSA 1NOKA 2PA0A 4EARA 1W4ZA 3EIFA 1QGZA 2NQ8A 2QW1A 2Z9DA 4YRRA 4UM8B 4TLLB 4KG7A 1EFRA 4FN4A 2ZRJA 3WGGA 3B52X 4L0QA 4N9WA 5EMNA 3C5WP 2F1JA 2D4HA 4ERXA 4OJKA 5AHXA 2ZAGA 4HDSA 4IDNA 3VH3A 1MLDA 2HJVA 1V8PA 4QGGA 3ZN2A 5GJBA 1Y8ZA 3CZ4A 5C3UA 2PHZA 2PZ8A 2PRSA 4OU5A 4UUAA 5D2CA 4C3OB 5BUQA 1VCIA 4DARA 2WJPA 4QA9A 1XLWA 3LWZA 4ZRNA 5GGYA 5FA6A 3MGGA 5CUQA 1KYVA 4XVQA 1LPAB 3THSA 1UP6A 2ZJYA 1CJBA 2EQAA 3CRQA 3PEEA 3VHRA 4ENPA 2G77B 4C7KA 5J9FA 4MGEA 4UC0A 1T4DA 2DKNA 3BL5A 4BO7A 3VBCA 1XK7A 2YKGA 2UYCA 1DQYA 2Y66A 4KFTA 2BM9A 2KI5A 1QRUA 2Z1DA 2IH2A 2V7QD 1Y4ZA 4WY8A 4KREA 3NG1A 4BHTA 4Z1MA 1J09A 1UXOA 4KUEA 4FNGA 5EJGA 2PM8A 3PEWA 3PC8C 4MUGA 1N7JA 2E7ZA 2NQ2C 3M6XA 3BRQA 5ICSA 1KBQA 3ER9A 3MQFA 2FCRA 3G0OA 3Q41A 3TEFA 1W0JA 1WOYA 4DMKA 1ZGBA 3TM4A 1XVAA 1DJMA 4LXGA 3N1UA 8MHTA 2G71A