2VSXA

Crystal structure of a translation initiation complex
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
382
structure length
366
Chain Sequence
QIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Yeast Eif4A-Eif4G Complex: An RNA-Helicase Controlled by Protein-Protein Interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation/hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE EIF4A
total genus 120
structure length 366
sequence length 382
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA02
5FTNA 4GT1A 3VHLB 1CJTC 4XD7D 3UXMA 4DDTA 2DWOA 3ONWA 1W0JD 2AK2A 4FCWA 4JJKA 3RRNA 2QM8A 3NBFA 2PMDA 3TMKA 2J1LA 3PUVA 3VR5A 4OHWA 5H8WA 4F92B 1WBBA 4CEIA 3SJZA 3QI2A 4PAOA 4GMXA 3TKLA 4C4PA 4GPTA 2D3WA 1KSGA 2GK6A 3A1SA 3GD7A 4PQRA 3U3OA 1AM4D 1J99A 4Q7JB 2WVJA 3EIHA 1EX7A 3VR2A 3B6EA 1P75A 1W0KA 3W5IA 4DCTA 3LDAA 4BASA 2QPOA 2RGBA 3QPUA 4LYJA 1W5SA 3I32A 3TW4A 3TSZA 1M7HA 4IDHA 4M4SA 1G20E 2I3BA 4QHTA 3BC1A 5H68A 3VR3A 1W4RA 4GP6A 4MQBA 4FWIB 1F3OA 5JMTA 2A5DA 1LS1A 4BRWA 1ZUIA 3K9NA 2XTNA 4URXR 4DDVA 3EAQA 4C0KA 3CM0A 1Z2CA 2NTYC 4DLXA 3C4JA 1S4QA 4MKGA 3P27A 4JLPA 2VA8A 1LNZA 2ZJ2A 2REXB 2IXEA 2R6AA 3KJHA 4IVRA 1Z28A 4TN1A 3ZVLA 4MDFA 1UKZA 1UPTA 2IHBA 3CWQA 1XCGB 2V54A 4B3BA 3AEZA 1VDZA 2CLSA 2ZRHA 3UANA 5JJLA 5L3QA 2XOKD 4X8LA 1AS2A 2GESA 1U2RA 2DFLA 1W36D 3KKQA 1HV8A 3LW8A 2RMKA 2OM2A 4R7ZA 2ZUDA 4UNSA 1Z6AA 1KI6A 2KSQA 4IDOA 1ZUHA 4DT1B 1S2MA 2PEYA 2W6ID 2CHVA 4URWR 1NMZA 3FFAA 2NG1A 4Z54A 1XPRA 4DDUA 2R6DA 5AR1A 1YJ5A 2JCSA 2ZR9A 5HE8A 3P20A 1E1RD 1YU9A 3CRVA 5KSZA 4PHGA 2BEJA 4CW7A 4US2R 3IPXA 2QUZA 1E9BA 2C9CA 3NBZC 5L8VA 2WZQA 3UPUA 2PLFA 4DEYA 4LUCA 2F7SA 2IUSA 4V0MA 1KDRA 4NCJA 1KZ7B 2PZFA 3QKRB 5HTKA 1F5NA 2BIFA 3K8YA 1MO4A 2H8KA 4LX0A 3B5JA 3MGCA 2AD1A 5FPTA 4G5QA 3RRZA 3VX3A 2FSHA 4TZ0A 1KI4A 4TL6A 3I4LA 1UADA 5DYGA 1KO4A 2B8TA 1U90A 1XD9A 5F3WB 1QHIA 4CDGA 4A92A 1XEWY 2YZ2A 4M1TA 4X8MA 4YMTA 2CL0X 2CMKA 2FZLA 4B76A 1F48A 1N6RA 1VTKA 4URYR 3IILA 3RNLA 4BFZA 3OIWA 5JWOA 4A4DA 2WKRA 1LS6A 2CLCX 1IXSB 2GZDA 3CF0A 4A36A 2ZSFA 3G0HA 1G4UR 4EFLA 2GHIA 3E5HA 3E1SA 1WRBA 2QU8A 2WWXA 4KU4A 4MDEA 2J0UA 5CIQA 1GZSA 2FSGA 4LHYA 4LSGA 3BH0A 2ZU0C 221PA 4N1AA 5EE5B 3AVQA 4LJ6A 2NOAA 3RS4A 4B33A 1ZCBA 2GETA 2R2AA 2ZI9A 4MGYR 2ODEA 2CNWA 2GEVA 2N1BA 1SHZA 1IXRC 3B13B 3BWDD 2XJ9A 1N6OA 3BB4A 1GOTA 2ZS9A 1IBRA 1DAEA 2IYZA 4OK5A 1DO0A 3ZIAA 3WMFA 2OBLA 1ZUNB 3W34A 4Q4JA 5JFGA 4D82A 2EFEB 2NO6A 5IF9A 2REBA 5C18A 2PL3A 3AVOA 5CITA 2O8DB 1R5BA 4Z8XA 2PT7A 4DHEA 3HU1A 3MWJA 3TSWA 2PMKA 4NDZA 1IM2A 2DB3A 2RH5A 4HB0A 1SVMA 4F4CA 1KOFA 4QNMA 3CR8A 1W44A 3F5FA 3R7WB 1KSJA 4EJSA 4DRZA 3A8TA 3NXSA 4JLNA 5EXSA 1VMAA 3THXA 1QG2A 1T0HB 5JS8A 1E9CA 1ZU4A 1UBGA 2A5JA 1SKYE 4M9XA 1PZNA 1G7TA 2J87A 1XTQA 2IUTA 4HB3A 3X1ZA 4ZIRB 1IONA 4TT3D 3TRFA 2BHRA 5A0FA 1DE0A 1E2DA 1TU4A 1U8ZA 5SZHB 4HDQB 4BFWA 1CR1A 4L4UA 3QQ5A 3SJCA 2J0UB 3SI7A 1JPNA 3EA0A 1ZAKA 4OBEA 4S2EA 3K0CA 1DAKA 2A2ZA 2WJYA 4D4JA 4GOJA 2F1HA 1AGRA 1TU3A 2BMJA 721PA 2QPTA 1U94A 3CX6A 3ZD6A 2ZJAA 2ZJZA 2FA9A 4DEXA 3VNVA 3RS5A 4ERNA 3ZIAD 5DHFA 1OPXA 4LPSA 4Q01A 1JJ7A 1EFCA 2C77A 1R0WA 2OSBA 1KK1A 3L2OB 4NYMR 4ZCMA 5L3SA 1RPZA 4C7OA 1KI2A 3C16C 2Q21A 4ZCIA 4OQXA 4S35A 4DSNA 2VHCA 1T6NA 4B74A 2QA5A 3WRYC 1PUJA 2O8CA 4RZUA 1L7VC 5GVSA 1HURA 4Y0AA 2ATXA 4BPBA 2EVWX 1HUQA 3A1WA 4BEBA 2ZI4A 3B78A 5HZHA 3H84A 3QSYA 1CF4A 4IW3B 2RGCA 2LWIA 4U02A 1M74A 4FMDF 3KB1A 1G7SA 2DPXA 3BXZA 5EE3A 5K8IA 1KJZA 3KB2A 1HH4A 1N5LA 3EZ2A 5AK0A 3RSOA 2ANBA 1Z07A 4PSVA 1XCPA 5J40A 1W0KD 2QENA 3TAUA 1BH2A 5FUVA 1HTWA 4NP6A 2ZSBA 1D9XA 2Q6TA 1R5OA 1WCV1 4PHFA 1II8A 2YOHA 4WXPA 2ZYWX 1I2MA 2OFOA 4AYXA 5GJBA 5K8UA 1Q1ZA 3KQNA 3DPUA 1CRPA 5IRCD 3N70A 2ZE5A 1YKSA 4A0HA 4OHVA 2JIZA 2DFKB 3CNNA 3AH8A 2Q9BA 1G3MA 4IXNA 3SHFA 1KI8A 1HT2E 4FCVA 1XXHB 1BOFA 1XEXA 3BD9A 4PO9A 1QHNA 3RC3A 2NQ2C 2O8EA 2XOKA 3BB3A 4P33A 4B3CA 4R9UC 2VBCA 2W0MA 3G82C 1MABA 2XZLA 4E09A 3D31A 2C04A 3IO3A 4A15A 3D7MA 4YQFA 2XB4A 3J81k 2FFQA 3PR1A 3K0CC 2R6CA 3L82B 4UXJA 2QMEA 1PVOA 2RAPA 3NEJA 1NY5A 5KHOC 2VF7A 4GBMA 4BZQA 1U0JA 4DXAA 4U00A 5FUXA 4AURA 3GPLA 4KXFB 2NZ8A 1Z6GA 3FKQA 1Z83A 1RRCA 3ZVMA 1AIPA 5DN6A 1WP9A 1Q3HA 1RVDA 2FFBA 3A1TA 3FFBA 4HEJA 2FJUA 3H0KA 4DCSA 1M2OB 2PBRA 3PG5A 3V9PA 3FGNA 4ZIRA 2D7DA 4LI0A 2AWOA 4C0HA 3DKVA 3SQWA 1N5KA 1YE8A 4HUQA 4QM6A 1EK0A 2KBEA 4XSGA 2ZRPA 4QGHA 3RHFA 5JWRA 2A78A 4W5HA 5B57C 1NLYA 5D3QA 4HSEA 1A1VA 1FP6A 4XWOA 1TMKA 4G01B 2FNAA 1E9SA 2QZ4A 2IYTA 1VCNA 4G5SA 4YMSA 4FMDB 1VG8A 2GVDC 1MT0A 1LFDB 1XEXB 4YDHB 5H1YA 2AWNA 4JZKA 3RS7A 1G6OA 1R0YA 1TUIA 1JEDA 1ELOA 3LH5A 4NMMA 2RGGA 4ZI3A 1G17A 1NMYA 4KYIB 3FHOA 4JYBA 2QORA 2OXRA 1T4GA 2IYUA 2N46A 3TR0A 3TQCA 1HYQA 2E1RA 4HAXA 1U0HC 3RWMB 2QN6A 2WWGA 4JVMA 3F8TA 2JJ1A 2QQEA 2LKDA 1AN0A 2DCUA 3K09A 4V0KA 1EFHA 1KTVA 3ZYCA 4Q4AB 3GLFA 1ODFA 2OT3B 3B7GA 4HLCA 3GFTA 2IYWA 4TMTA 1J2JA 2EYUA 2P2LA 1JI0A 1WMSA 2ZRFA 3CW2A 2H16A 1FQJA 1AGPA 3AF1A 4P4TA 4P32A 4P0TA 3U61B 1CLUA 1LVGA 4D6PA 4Z51A 3PEVA 3K0FB 3RSLA 3LO5A 3VQTA 4NPHA 5CLLA 1ZIOA 1XTJA 2HCJB 121PA 1NIJA 5EXPA 1N0UA 3L0IB 2IF0A 2R62A 3OIYA 3GLHA 4C0QC 1R5NA 4JLMA 4TMKA 3T1OA 4NHOA 1P7CA 3VTKA 2HF9A 1P73A 2ZRNA 1E2NA 5DISB 4GSYA 3UMSA 4B6EA 4B71A 5HR5A 4KYUA 5BWMA 1TQ6A 4G5RA 1JR3A 4HZUA 1ZMXA 4M9ZA 3U6BA 1G8FA 3AV0B 4MYHA 2IK8A 1G21E 2GVZC 4Q9IA 4YC7A 1VYVA 1TF7A 4HATA 3SFZA 3AQ4A 2GAOA 1VHTA 2RGDA 3ZS8A 2ZR7A 1UDXA 2GBLC 3CRRA 4M1SA 2JJ2D 1SQ5A 3B9PA 2PCJA 1JPJA 2ZE8A 1LW7A 3EIEA 4ZCLA 1Q44A 4DLYA 2PEZA 2IC5A 1CXZA 4HB2A 4XOIA 3IEVA 5TXGA 5FPSA 2D4HA 2W00A 1CULC 1SVWA 2GWHA 3PIRA 2Q9CA 1AKYA 1A82A 3OAAA 5EE9A 1Q1EA 1E2JA 2V8OA 2V3CC 1J70A 5CM9C 4I4LA 4KBFA 4C0SA 4L15A 4JBYA 1NSTA 5KPJA 1ZNYA 5UKDA 1NMXA 3DM9B 4ZDJA 1TX4B 3AB3A 1XPOA 1OKKD 3EG5A 4OK3A 4LJYA 1KJYA 2N42A 3I1FA 4JLVA 4Q7MB 1G5TA 1XWIA 2QRNA 3VAAA 2UZIR 1T3SA 4QNRA 1R2QA 3AVWA 2F43B 2P5SA 3U3MA 3B1YA 1Z63A 2W2TA 2E87A 3TK1A 2GCNA 2H18A 5KPDA 3AUXA 2ZAMA 5JJKA 4NYJQ 1QBKC 3HWSA 1WF3A 1ZD8A 1MH1A 4Q9LA 3AVTA 2F9MA 1XDBA 2BJVA 1OIVA 1WQ1R 2CVHA 2XTMA 3SZRA 5KOYA 4AKHA 4HLUC 4IRUB 1HQYE 3T61A 1JEEA 5L3SB 4LY6A 1P2TA 3OHMA 2P6RA 1EWQA 3T5GA 2QMOA 2ZRLA 1KDTA 2ZVPX 4NCKA 4R71A 3CRW1 5DI3B 1AKEA 3CONA 1PUIA 1X8JA 2B92A 4UXIA 2YWFA 5AJVB 4LC1A 4GOXA 3QJYA 4QGAA 5FBQB 5KDLA 3SOPA 3K0FA 5A5GA 2YWGA 2V7QD 3DMDA 4D81A 2MSEB 5FUYA 2ZRKA 4PR0A 1X6VA 5ELXA 4FMCF 1VG0B 3I5YA 4NL4H 1Z5ZA 3C41J 2R6FA 5FPHA 2H17A 2Z4SA 4DB2A 3DOEA 5ANRB 2AL7A 3S1AA 2LCFA 2OFXA 2JIZD 3BE4A 4BFSA 1OSNA 2W6JD 2GJ9A 2C03A 2RGXA 2BMEA 4KSBA 3UK6A 4E5UA 5JHGB 4RD2A 1M8PA 4OI4A 3L8YA 5AUPB 1W36B 4XSHA 2O5VA 3R7WA 2BCGY 3EARA 1JB1A 1Z0KA 4PQFA 3U7GA 2GXSA 4DUGA 4KFUA 1NKSA 1UBCA 3PEUA 4H9GA 5FOXA 1OF1A 4IFBA 521PA 4EKDA 4XH9B 1TF5A 3LQRA 2A5FA 2R9VA 3BJIC 3CRMA 3UKDA 1XZPA 2V9PA 4A0GA 3QKUA 1T8UA 4RJLA 4R98A 2EU8A 3RABA 3R8FA 3FYHA 3U7EB 1RYFA 4TLEA 3P26A 4UNRA 2G9NA 1XB2A 3KKMA 2P0EA 4W5JA 3I8SA 2H92A 2YNMA 4D2IA 1G3UA 1CRQA 1CBUA 2GEDA 2HUPA 3WBJA 3GLFE 2F6RA 3L0PA 3FE2A 3SBEA 4HAWA 3REGA 1OFHA 4QBHA 2W6IA 4O25A 3ZGXA 4ZKDA 4LJ7A 3RS2A 4Q5IA 2JDID 2J0SA 4Q9HA 1UF9A 1MRSA 3UMRA 4L5BA 3ZJYA 3B60A 4D4LA 4Q4HB 1OH8A 2J45A 3K0EA 3AVXA 1KGDA 2J5XA 4OJKA 2QSZA 2EWVA 1VECA 2IEYA 3TR5A 2ZJBA 2FG5A 1VYUA 3ZQJA 2F9LA 1OXUA 2ORVA 5FTLA 1W47A 5JZVA 1Q21A 3X1DA 2ASEA 2ZYTX 3A36A 1P2SA 4HZUB 4ZDWA 4BZPA 3DDCA 2BMFA 4W9MC 4MKHA 1US8A 2ERYA 1XD8A 2BM0A 3FKSA 3NTUA 5HPYB 2QP9X 1XP8A 4QHSA 1N6HA 1XTRA 1RW4A 3L0SA 3VKHA 1UKVY 2JJ8A 2NO9A 4Q18A 2EFHB 2UVQA 4Q00A 2QTVB 4RFVA 3WHKA 1XD2B 3RANA 1TTTA 1MKYA 3JZAA 1PLLA 4D80A 1CR2A 3C5CA 3HR8A 3X2SA 2VSFA 1E2KA 2D7CA 2EYQA 3BRWD 3KFVA 4PZLA 3ASZA 3A6PC 5KSOA 3KQLA 3VNUA 3ETLA 3NKVA 4TL7A 1S1CA 1NG9A 2NIPA 5KDDA 2F3RA 4IDNA 1G5PA 3DMNA 1S8FA 1FQKA 4RD3A 3NC1C 5C4MA 2ZJ5A 4M22A 1E79A 5B58C 2EQBA 2FH5B 5EE0A 1YR9A 4MYTA 4V02A 1DPFA 2PZEA 4KFSA 4A9AA 4ASUA 2GK7A 2ZR0A 4AKGA 1BYUA 1XCMA 4HAYA 4I1OA 2JLVA 1VIAA 3KJGA 4TQAA 5E3HA 4MH0R 4HDOB 2PX3A 5G41A 4TLDA 2JA1A 4AKIA 1N3BA 2OESA 1GWNA 1P62B 4IOMA 2O8CB 2QSYA 1UM8A 1E94E 1FZQA 5JI3E 1G5RA 3MD0A 4C7OB 4M1WA 5B2ZA 4U5XA 1TAGA 2HXSA 1XFAA 3AKEA 1XMJA 3FPAA 3JZMA 1GM5A 2VTKA 3U6KA 4LHZA 1QHXA 2FEMA 4QOSA 4OK6A 3T34A 5JJIA 3A58B 3GEEA 2OHFA 1Z08A 3CNLA 1F2UB 2KE5A 3GFPA 2FX3A 2HLDD 3R9XA 3TE6A 4NCHA 4Q1AA 2BVNA 2BDTA 1KO8A 2IX3A 4I1SA 5JS7A 4OI2A 2YOFA 1K6MA 3CPJB 4OQMA 5D3MA 1W48A 1OFUX 1SZPA 2QP3A 3KJEA 3Q5EA 4B3XA 4FWTA 4AK9A 1JXMA 5C1BA 1KY3A 1GNQA 1NF3A 4HAZA 1OIWA 3EXAA 4KLZA 4KCGA 2QE7A 4GMDA 3FDIA 1Z6YA 3U44B 2AFIE 4OHXA 5G3YA 5BYJA 3JVUA 3KQKA 4EPRA 2GA8A 4B3GA 4ASUD 2J3EA 4MRNA 2QAJA 1W5TA 5AWFC 3LWNA 2GJAA 3VU9B 4F4JA 2FFHA 2JATA 1Q20A 1XTKA 1B23P 4P4UA 1KZGB 3LVRE 2QPAA 4UXHA 3TBKA 1H8HA 3X1XA 2QQ0A 2ZUCA 4PHHA 4Q48A 4DSUA 1ZW6A 3IGFA 3HDTA 1YVDA 2YYZA 4EIWA 2YOGA 1SULA 1LB1B 1OW3B 3RRMA 2GILA 4CZ2A 2OG2A 4EFNA 3T1VA 4EDHA 3VKWA 2F43A 1U81A 5IK2A 3I73A 4Q19A 2J46A 3U3RA 4A82A 2WWHA 5AJYA 2OE2A 1G1MA 1I4TD 1QHSA 3NBYC 4KVGA 3T15A 5E95A 1MO5A 4AG5A 4DKXA 3KTAA 2IUUA 2AR7A 2ZEJA 1IAQA 4PXAA 1ZP6A 4RZXA 5DGXA 1D2MA 1ZYUA 4TMXA 2FWRA 2Q0HA 2W2VA 5FUWA 2ZU6A 1VCMA 5BXQC 3BIFA 4C2TA 1G3IA 4HZIA 1XRJA 1II9A 3U2QA 3WYGA 1YQTA 1ZM9A 1IHUA 3EZ9A 4A1FA 2BKUA 3KJIA 1DO2A 4OJQA 1G9XA 5LD2C 1TPZA 3TUIC 4PTLA 5DIFA 2P6NA 2GTPA 4BLSA 5HCNA 4PC7A 2GJSA 2FOLA 3GLHE 5CJ2A 3ZLJA 3CBQA 2BBTA 5HE9A 2IEZA 2PZGA 4KAXA 1TUEA 2E9SA 1JQJC 4KO8A 2IYVA 3K1JA 1KMQA 2XNDA 3IBYA 4JSYA 1CR0A 3AP1A 2FE4A 3BB1A 3GEIA 3A4MA 4TYQA 3TNFA 2YV5A 4E03A 4QRHA 3BFXA 3LBHA 4IEIA 4MRVA 2EWWA 2OUKA 4URVR 1NBMA 2W83A 3RVBA 3BOSA 5EZ6B 4WBSA 4TSFA 2MMGA 2BM1A 3CB4A 4H1VA 1KNQA 2FN4A 5BN3A 3KFXA 3T06B 2NO0A 2X1VA 2IA5A 1KSFX 1RYHA 3SJAA 5FFMA 4CT4B 2VLIA 2JLZA 1Q1QA 2XXAA 1IY2A 1W36C 4TYWA 4PAMA 1W4BA 2IYYA 4CEIB 4JLOA 1KDPA 4Q4AA 4HB4A 3EWAA 1JXOA 2GF9A 2IS4A 4RZ2A 4TMWA 4DT1A 5J5CA 4LPKA 3SYLA 1F6BA 1B0UA 2DBYA 4EFMA 2XEXA 2J41A 1GVNB 3CUEF 1FX0A 1FMLA 3M0EA 4Q4HA 3K9GA 3IIKA 2DFTA 1RC8A 2J59A 2VP4A 4FMCB 3TVDA 2WWFA 2L0XA 2OILA 3SN6A 1P3JA 5DHAA 4XVQA 1NJFA 2H1LA 2MMCA 3W90A 3KQHA 1XZQA 4TWZA 3B82A 4Z1MD 2JLUA 2B6HA 1GRQA 3CO5A 1LTQA 4WW0A 2GXQA 5CLQA 1G3RA 3U4QB 5IT5A 3EC2A 1OB2A 3SBDA 3Q9LA 1FTNA 1R0XA 2P6UA 5FBRB 3TAHA 1GG2A 4C9BA 5JBQA 1FP7A 1QHHB 1Z8FA 1T91A 5CYPA 2JAQA 1Z0IA 3CH5A 1LF5A 1DAHA 2WICA 4WIAA 5JI2E 2WSSD 1GNPA 4XWAA 4WAUA 1A5TA 4NU0A 3BORA 3LRPA 2R65A 4B35A 3V4FA 3KX2A 3ZVNA 1I4DD 3IPYA 3T1TA 2OBMA 4TZ6A 4Q9KA 2RKOA 2C8VA 1Q12A 2OCAA 2SHKA 2VQSA 2RGAA 1P6XA 2XAUA 5AJZA 2ZXUA 4NYIR 1OH7A 4UQOA 3IQWA 4BWYA 3VX4A 3TQFA 2PJZA 1GDDA 5EJEA 2FF7A 3C8UA 2DWQA 3ZQ6A 1JR6A 2BV3A 3QXJA 3LFUA 1RJ9B 3PJRA 4CEHB 1OFTA 3UWOA 2WM9B 1XJ0A 2GZHA 5EP1A 4US1R 3K70D 1NVUQ 1KSHA 3CIOA 3QIAA 3QXXA 1ZBDA 2W2XA 1E0KA 421PA 1MABB 1GKUB 3PV0A 4EQ6A 1ZD9A 2WMOB 4OHYA 1G8GA 3B1VA 4DSTA 2W58A 3WP1B 1KMHA 2IYSA 1ZM7A 3B85A 5A4JA 1K5DA 2VP9A 1MOZA 3PCRB 3KL4A 4MUBA 4KFRA 3DVLA 1E2EA 3SE0A 3O47A 1N6PA 3RRYA 3I61A 3TVTA 4MRSA 5KO2A 5J4KA 5DO9A 1EG7A 2EFGA 5F9HA 4K46A 1E2MA 3QKTA 4RSGA 1VG1A 2WSSA 4NCNA 1X8KA 4ESVA 4N0EA 2IS1A 4CYMA 2JEOA 4BZXA 1DG3A 1FNMA 1Z06A 3IEUA 4LV8B 4F93B 4L9SA 4URZR 1SVOA 2BMDA 1CS4C 3BGWA 3OAAD 4BFUA 4MYCA 1J8MF 6Q21A 3EIQA 3UIEA 2IWHA 2J0QA 1BO6A 1QHYA 2C9OA 3LLMA 3SYNA 4RY2A 3WYFA 5L3QB 2QBYB 1E4VA 3GQBA 1E0JA 2CNWD 1GFIA 4A8JA 4FN5A 2IYXA 2Z0MA 4G5GA 4AKEA 2NO1A 4ESHA 2Q9AA 4MGKR 2EW1A 4O2LA 3HPQA 3HU2A 2FPLA 2FPKA 1YZNA 3T35A 3GEHA 3OEED 2PLRA 3PENA 1ZM2A 4NZYA 1Q0UA 2YHSA 4GP7A 1OFIA 4IKEA 4MITA 3ZH9B 2WJIA 3NH9A 3KKOA 1L2TA 1UKYA 1QG4A 5HKKA 2CCJA 1SXJC 2ZRGA 5J4YA 3B2EA 3QG1A 4QFMA 3WMEA 3NWJA 2WKQA 4AYTA 2ZROA 1DELA 1HE1C 4ZV4A 1OLOA 2QRZA 3GLGE 1Z47A 1X8LA 5CM8B 4GL2A 2HEIA 2QAGC 1C9KA 3ICEA 5LD2B 2VP2A 1KMHB 2BC9A 1L8QA 4TMVA 1J7KA 4TT3A 4HYYA 2QNRA 2QL6A 2O0HA 3BH7A 4M2LA 2QEQA 3QF7A 5K8LA 2V7QA 1IJFA 1KI7A 4US0R 1HEIA 3QF4B 1N6NA 2WAXA 3W8NA 2C5LA 2CE7A 3RS0A 2VEDA 2CCGA 2Z4RA 3AKCA 4LV6A 4C0JA 4M21A 3RC8A 1ZRHA 5JSZA 2FPMA 4KV9A 4M1KA 3VHXA 4PPQA 4J0QA 4XTRA 2ZRDA 4JL5A 4B47A 2G77B 4QL3A 3D3QA 5SZKB 5G3ZA 2ZRCA 4TLCA 5L3RA 2O0JA 4RCYA 4P4SA 5GVRA 1HE8B 2YC2C 4CRWB 4Q1FA 3CPEA 5LB2A 4KSCA 1T3LA 2WWWA 3GJ5A 1E9FA 2O8FB 3V4RA 4PANA 3C15C 1G8HA 2ZETA 1KJWA 4ZI2A 3I3SR 2WSMA 2O8FA 1BIFA 4LBZA 4IVPA 4KHZA 4POAA 3LXXA 3FHTA 3ND9A 2IBMA 4C2UA 4P4SB 2D74A 1CTQA 1LY1A 4DZZA 3UG6A 3O8CA 3N2EA 3L43A 2YVUA 4Q7KA 4CIDA 1SXJA 2CK3A 3Q5DA 2NO7A 4FIDA 4LJ9A 1JBKA 4TSFD 5CK4A 2DY1A 2O8BB 1CJMA 3KDSE 3U60B 3GJ0A 2AK3A 4C3ZA 4HI0E 1N6LA 1YR8A 3CR7A 5JSZB 3EZFA 3IDQA 4ACAA 4YMUA 3SEAA 3AKDA 4TTPA 2C78A 5K8TA 1E1QA 1ZC3A 2WBLC 4B2IA 4QJ3A 2D2EA 1G8YA 2ZI7A 4LWZA 4R2HA 3HP1A 4M9QA 2JDIA 1NP6A 2AD5A 1H8EA 3B9QA 4ITRC 3VU9A 3WHLA 5KUTA 2VSXA 1A7JA 3QEJA 3HJNA 4F4IA 1IN6A 5EP3A 3A1VA 2WWYA 2IHYA 4A8JC 3Q3JB 4D0NA 4DBLC 4GOKA 5TVKA 4QXAA 1J8YF 4IDPA 4UJ3A 3B8HA 1CP2A 5TB5A 2AN9A 1X86B 4EJSC 1OIXA 4Q02A 3P4XA 2FU5C 3B1WA 3EX7C 3OE7D 1OH6A 3HYTA 3OESA 2IYLD 1R8QA 1WBDA 4L9WA 2FV8A 4TYNA 1XD2A 2EFDB 4A2QA 4ARZB 3SFVA 3WNBA 2VH5R 4M1MA 1C1YA 1E98A 2QM7A 2GXAA 1ETUA 2AXNA 2OZEA 4KITB 2RGNA 1F2TB 3QKSB 4ACBA 5F9FA 3SJBA 4RCZA 4OL0A 2IF2A 4V0NA 1GP2A 2PCLA 3V00A 2O0KA 2I4IA 4GNKA 3O8RA 2VHQA 2VL7A 3AGPA 2BEKA 5DN6D 4JT4A 5C4GB 5E7JA 4DLZA 2AHOA 2OLJA 3U7FB 3AM1A 4W5WA 1KI3A 3MFYA 4AYWA 5LDDC 2H7VA 2XZPA 3THWB 2GEUA 2YWEA 3BK7A 621PA 3C5HA 1M6NA 2WIBA 5AJXA 2FDCA 5FBVB 3PVSA 1KI1A 3W9YA 3ZDQA 1YRAA 3WY9A 4QGFA 1H8ED 3X1WA 1Z6TA 1AQYA 3P1JA 1JAIA 2DYKA 5TDHA 4QGGA 4V0ME 2WV9A 2ZJ8A 2C99A 1D8TA 2XGJA 2IT1A 3CF6R 1S0UA 4LHWA 3Q7PA 1YR6A 3QY0A 4C0LA 2UKDA 2YC4C 1G18A 4HUTA 3SYKA 3TUZC 2PX0A 1SHKA 3M1IA 3SS8A 1IN4A 2A9KA 2CVFA 2JLSA 4FINA 5DLQC 2C9YA 4XD7A 5JHHB 3BBPA 1WDTA 3RS3A 4BLPA 4CF7A 3MWYW 5DE3A 3GJ3A 2XITA 2GCOA 2IXFA 3GJXC 1P5ZB 2JJ1D 3EZ6A 4BLRA 4NE2A 4MKFA 1IN8A 1QHGA 4NYMQ 5BN4A 1G7CA 4LJ4A 3QG5A 3RWOA 1ZU5A 5TV2A 1UAAA 1U9IA 1RZ3A 2I1VB 2J0VA 1AS0A 1NLZA 1K5GA 3EA5A 4EQ6B 1T5LA 1QF9A 2ZREA 2ZS7A 2NPIA 1RE0A 3K70C 4IOKA 2OV2A 4DLVA 3H2YA 4B44A 1NVXQ 3M6AA 2WJHA 4ARZA 1IN7A 5TY0A 4TTQA 2QI9C 4URUR 3W6PA 2VP0A 2QE7D 1GKYA 4CEJB 2ODBA 4M8NE 1DAGA 4BUJA 2ZRAA 1GRRA 1KAGA 2JLXA 1J90A 4QBGB 4YMVA 2CJWA 3GLIA 1YZUA 4UNNA 3OIVA 2KI5A 4KVAA 4Q1BA 5FR2A 3TH5A 3AVPA 3QBTA 3W6NA 2QTFA 1MO3A 3H1TA 2V6IA 4JLJA 4LCBA 1E9DA 4YDSA 3W6OA 5J4HA 2JLYA 3LBIA 3CWZA 3WYAA 1OXVA 2AX4A 3WBKA 1QHHA 1UBFA 3T5DA 2G6BA 2V6JA 3IHLA 1JQLB 1SVLA 2KBFA 1U9IC 4AWXA 4B3DA 4QC2A 1C4OA 3IIMA 3QXCA 2EFCB 2HF8A 4GZLA 1NSFA 4A2PA 5TMPA 4ILEA 3SU8A 4GRAA 5EP4A 4BGDA 2V1XA 3CZQA 3FMFA 4QJ5A 2HCBA 5F2EA 5FTKA 1E1RA 3ADKA 3CRQA 1W46A 4LBYA 4OYHA 3VMFA 5H70A 1L4UA 4RD0A 4EUNA 4QBFA 1FMJA 1KDOA 2CXXA 4F38A 1GTVA 3CH4B 5CYOA 4BLOA 1T0JB 1WE2A 1OKKA 1S9DA 2Z5FA 3HYRA 5FH9A 2W0SA 5FPKA 1DOAA 4CGZA 3HPRA 1G7RA 2LKCA 5EXTA 1KK3A 3PFIA 1XBTA 1WB9A 4JLDA 2VO1A 1ZNZA 2BJWA 1OV4A 3BH6A 4NYIQ 2GAAA 5BW8A 4RFSA 1SVSA 1Y3AA 3K0AB 3EPHA 4EAQA 1JJVA 2AXPA 2QT1A 4PQYA 3TLXA 2CL7X 2Z6VA 1NVVR 1H65A 3AKYA 4JKIA 2ANCA 1TQ2A 4JS0A 3MJRA 2ZJYA 1KAOA 4Q4LA 1OHHA 1EFTA 1PLJA 5DI3A 3RLFA 2B21A 1U99A 4DLWA 1NG1A 3AVUA 3GP8A 4EPXA 2FSIA 1CU1A 3QF4A 1VCIA 2GKSA 2NPFA 1TQ4A 4TL8A 2VHJA 4LV5B 4EPWA 2H5EA 4IOJA 3RYTC 4C0BA 1BMFD 4B32A 2GNOA 1E1QD 4IHQA 2F3TA 5AUNB 2C96A 4V0LA 1NRJB 1E9AA 1GIAA 4XWKA 4TLBA 5FBWB 4BLTA 1DAIA 5EE1A 1I2DA 2AKAB 3T1QA 4DCNA 1N0VC 1ZM3A 2XZOA 4KJZA 2H57A 5CDFA 2W6JA 3KUDA 3W5JA 4GDFA 4WA7A 1FFHA 3VR6A 3K70B 3GLGA 3MWKA 3MRSA 1NN0A 4ZDKA 1XMVA 5JECA 1OE0A 1FTSA 4XTCS 3FMIA 4KFTA 2IWRA 4IOLA 4NONA 4IDQA 3ZZUA 4Q9JA 1GUAA 5KYKA 3OE7A 3B1ZA 4PO1A 5G53C 4QHYA 3LY5A 1A2BA 1U8YA 2Z43A 3WNCA 3BAFA 2JLQA 4GFDA 1CJVC 2OFWA 1AQUA 3DM5A 2ZI3A 1QDEA 2D06A 2RHMA 3A4LA 4PX9A 3LX5A 1XNJA 5TARA 2O52A 1UFQA 2J7KA 4B34A 4A8JB 1D9ZA 1Z0JA 3Q7QA 1M1YE 1G291 1D5CA 2XB2A 1QRAA 4TQUS 1JAHA 4Q66C 5FOWA 1GSIA 2GJ8A 4RZ3A 3O8DA 1AJEA 1G41A 1ZJ6A 4HAVA 3I62A 4B2LA 3DKPA 4B43A 4D0LB 1NJGA 1A2KC 4QJ4A 4JVNA 1OXTA 3Q8XB 3ZS9A 5FL3A 3ASYA 3OZXA 1YHNA 1E96A 1D2EA 3CNOA 4LJ5A 2ZI5A 2DFNA 2JASA 2X77A 3P4YA 4O0MA 1ZNXA 2HXYA 5B30A 4UKDA 1DAMA 2AKYA 1W1WA 4V03A 3T12A 4B3FX 5JEEA 3THYA 4D4KA 3CZPA 5FPYA 2CJWB 3GLIB 3FMOB 4BE7B 3DZDA 1WXQA 3GJ4A 3K0AA 4PC1A 3RDPA 4B73A 3SR0A 2ZE7A 4PAQA 2B7CA 4D4MA 1DARA 3CKLA 1Y63A 2YINC 1E6CA 5KDOA 3LXRA 1P2VA 2VF8A 1TL7C 4JVLA 2J7PA 1RRFA 3MLEA 3EPLA 3CF2A 4ON9A 4PSKA 4DCVA 2VRWA 4MA4A 5DH9A 1IXZA 2G88A 1OB5A 1IY0A 2WKPA 3R9IA 5CB8A 1Q22A 3QENA 1NVWQ 4LYHA 2OCYC 3PUYA 3I5XA 1MR3F 2O8BA 4U7DA 1SXJB 4LYAA 2CLDX 3FB4A 2OLKA 1OYWA 2DWPA 1WA5A 3K9LA 1O87A 3IKJA 1NIPA 4DCUA 2KWIA 1E9EA 1E79D 3BFKA 2XSZA 5SZJA 1E2LA 1R8SA 1YZTA 3EASA 4HAUA 4LHXA 4NH0A 5JRZA 2QY9A 4IEEA 2VYFA 2ZRJA 1RFLA 3ZZTA 1T3HA 4JJZA 4OQFA 4L16A 2OXCA 2VHUA 4WVFA 1SVKA 2ZYUX 1RRPA 4PPNA 3SC3A 4PZYA 2BBWA 2KJQA 2BBSA 2WJVA 1S1MA 1UEJA 2VP5A 1FUUA 3IHWA 4PSAA 3TUJC 4Q1EA 3AF0A 5E7MA 1EGAA 1ZCAA 2FFAA 1N25A 3SQXA 3U5ZB 3GLGB 3GJ8A 4LK2A 3IUYA 1ZC4A 2CL6X 3MUFA 5JCPA 4G5OA 3K0SA 1XEFA 2C2HA 4B6FA 1KY2A 4AD8A 1XTSA 2I1QA 4DSOA 3K53A 4O2RA 5HCIA 2ZSEA 2HYIC 3W3AA 2HLDA 2WJGA 4IJMA 2ZSDA 1ANKA 4Q1CA 1KHTA 4EPTA 4JKYA 3FOZA 3AUYA 1II0A 4MKIA 1DADA 2IS2A 2PH1A 4FD2A 5L3VA 4F7WA 1S96A 3ADBA 1Z0AA 2R44A 3H86A 4RD4A 3FHCB 3DZ8A 2CHQA 4AI6A 4LRWA 3PUXA 2CHGA 1VPLA 1HQCA 1Z2AA 2Q3HA 4DIDA 3WNDA 3VKGA 1KK2A 1OJLA 4XJXA 4A0FA 4DLRA 5FBLB 2QGNA 1G16A 3UG7A 1E2HA 4A6XA 2TMKA 4M0LA 1E3MA 3KUCA 1T8TA 2RGNC 3KQUA 1EFUA 3D6TB 3IIJA 4I1UA 3U3JA 3EPJA 1ONBA 1E2IA 2WWIA 4KODA 1GITA 4LJ8A 2P5TB 3QE0A 1ESMA 2GJKA 1Q57A 3LVQE 2RHDA 1CIPA 2RB4A 3LD9A 3MWLA 3QNUA 4JSTA 4LDJA 1SVIA 4BECA 2ZS8A 2Q3FA 3LBNA 4JLBA 4OQLA 3LW7A 1EX6A 1T5IA 2ORIA 2ZAOA 4TQ9A 4WXRA 3P32A 2CBZA 2XJ4A 1P60A 1EFRD 2XNSA 4QM7A 4NBSA 1L4YA 4M53A 1MV5A 2AFHE 2BCJQ 3ADDA 1DBSA 5BQ5A 2MSCB 3THWA 1G8PA 1BMFA 5JRJA 5LPNA 2WHXA 4IXMA 4Q03A 2MSDB 4P31A 4DLTA 1PV4A 5IDVA 3O8BA 1RKBA 2X19A 1ZIPA 1U8AA 4GI7A 1IN5A 5B64A 3NG1A 2Z83A 4G0NA 2NZJA 1O3YA 1OT3A 1TADA 3PUWA 4RKEA 2OEPA 1SGWA 3MCAA 3MMPA 1CJUC 1KK0A 4XIGS 1TF2A 3KZ1E 1KIMA 1P9WA 2G1JA 3MAAC 4KLNA 3KTAB 4RD1A 2RGEA 1N0WA 2QG6A 2QAGA 5CJPA 3S1AB 1KKMA 3F0TA 1UDWA 3EW9A 3EZ7A 2WJJA 3BS4A 1AA9A 4L8GA 4MRPA 4PPGA 1G6HA 1JR3D 4K81B 3AF4A 5G40A 3NVAA 5D3MB 2BOVA 4LC0A 1VG9B 5CB6A 1UBEA 2RCNA 2XNDD 5EZ5A 5CDFE 2PJRA 2P67A 4BQSA 4JBXA 5KNBA 1A4RA 4LHVA 4WZ6A 2KB0A 5M04A 4CEJA 3GLFB 3BFVA 1E2FA 2JJ2A 3JVVA 2QAGB 4LGMA 4RD6A 4LOAA 3NHAA 3GLIE 1EESA 1U98A 3QVUA 1NVVQ 1XXHE 3DO6A 1S9HA 3IO5A 2ZRMA 3CLVA 4DLUA 1RRGA 4I81A 4BRUA 5FOTA 1EFRA 4YXWA 1GL7A 3OEHA 4II7A 4PC3A 1R7RA 4CEHA 2NMVA 4D0GA 3ECCA 4Q7LA 2X8AA 3W3ZB 1KI9A 1XXHA 1YZGA 2WAYA 2VP6A 2ODNA 1TQDA 5FOVA 3D8BA 2HJGA 2NGRA 4Q47A 1DS6A 1XX6A 2GRJA 1TNDA 3CX8A 3QXHA 2HT1A 1OYYA 4BLQA 1YRBA 2GCOB 4LBVA 1E2QA 2QGZA 3FWYA 2C95A 1FPMA 3Q72A 4LYFA 5FOSA 4AY2A 4JMPA 2FGKA 3B1XA 3AGQA 4BFVA 2YJTD 1II8B 4OKSA 4ZKEA 2UZ3A 5P21A 4PFSA 3ADCA 5E4FA 2ZUBA 2D2FA 2CDNA 3K09C 3K9HA 2IW3A 5KNCA 4A0RA 1XU4A 3A37A 3LQQA 4Z1MA 1U0LA 2ZSAA 4BFXA 1W49A 2OBNA 3QUSA 5DI9A 2WIAA 1ZD1A 1G19A 1NNEA 2ZM5A 2BBOA 1K8RA 4C0AC 1DVRA 3SDZA 3TJZA 5EP2A 1E99A 1FX0B 3WXMA 1FW6A 2ODWA 2VIIA 2QBYA 1JNYA 3G5UA 4JLKA 3NBXX 1V43A 4YXWD 5LB4A 4Z8YA 4HLDA 2F55A 2FSFA 2A7QA 1JECA 1QZXA 4LJAA 5KSPA 3VFDA 2ZITA 4DDWA 2WPDA 1X1RA 2XSZD 1US8B 1MRNA 2QT0A 3IBGA 2G0NA 5FL7D 1BKDR 2GF0A 1GL9B 2B7BA 1MO6A 3LNCA 4ZO4A 1DEKA 4M9SA 4EPYA 1E32A 3GLHB 4MUAA 1M7GA 4X8OA 821PA 5CK5A 1Z0FA 3N5CA 3GFOA 4K8OA 2ZRBA 3SHWA 1YZQA 4JBWA 1S3SA 3L8ZA 3PXGA 4BFYA 2V55B 3QKRA 1XTIA 4C30A 1TEVA 2Q3MA 2ZYVX 4ABYA 4M1YA 3A4NA 1E4YA 3PQCA 1Q1BA 1NN1A 3EC1A 4BFTA 2VSOA 4FI3C 4DUGD 4JL6A 4TMZA 4MRRA 1SKYB 3SNHA 3UATA 4UNPA 4OI0A 3A1UA 1XEWX 2QROA 4JIMA 3AP2A 3FVQA 4G3XA 1W2HA 4OQNA 3KXIA 4RFSB 3C14C 3GMTA 1UKEA 5DNYB 2ZE6A 1CJKC 1SXJE 1IY1A 3IQXA 2ZPTX 4CT5A 5KSYA 5C2JB 3ZVRA 5EQTA 3WP0A 1ZVQA 4D26A 2HDNB 8OHMA 4DWJA 1GKIA 5SZIA 2G83A 4MGIR 1XF9A 3REFA 1NKTA 2FGJA 5GADl 5HZKA 3C7KA 1Z3IX 2C98A 1W4AA 2QP4A 2ZQ5A 3Q85A 5J47A 3TGPA 2ECKA 4D25A 4R2IA 1VCOA 3VR1A 2FZ4A 2O8DA 4I1VA 1N5JA 2ZJOA 5DYIA 5C46F 1AK2A 5JEDA 4LZZA 3AVVA 1P72A 2XX3A 2P65A 1T9HA 2ZIAA 4Q4JB 3GJ7A 3FMPB 5FL7A 3TW8B 4DB4A 3QKSA 4G1UC 5JWHA 3THOA 1LV7A 4IVQA 4AC9A 5FTJA 1R6BX 2ORWA 3KXKA 2K5UA 2YWHA 5FTMA 4HUQB 5EUMA 1KO5A 2OCPA 2V1UA 1ZNWA 3QOFA 3CPHA 3E2IA 4XVUA 4X8HA 4QG7A 3GCGA 3DOFA 1GL6A 1YZKA 3HU3A 4B75A 3AP3A 4KBGA 1G64A 3FKSD 3I72A 3LAWA 5IHPA 2IS6A 2OO7A 2D62A 1RIFA 3NEYA 1R10A 1GRNA 1NBME 4JVSB 4DC9A 3THYB 3OEEA 1N2CE 3QVVA 3EWSA 4GZMA 4H1UA 1NLFA 3L0OA 3U3KA 1PJRA 4TYPA 4A6PA 4DLSA 2P3SA 2A30A 4PHTA 3NIBA 3ZZ0A 1E0SA 1NN5A 1FL9A 2FEOA 2ZRIA 4E22A 2JGNA 1VHLA 5HKKD 2R6GA 2IXGA 2V4ZA 4UJ5A 5AUOB 2F1JA 5J4LA 3THXB 1G4AE 1M34E 4JYCA 4QBIA 4TLAA 1RJ9A 1SKQA 4EJSB 3H4MA 4ZDIA 3U7HB 3QPWA 1IQPA 4W7SA 2A3RA 2O8EB 1OHHD 1NL3A 2B8WA 2WOOA 3M4YA 3TIFA 1N6KA 2OCBA 5KU1A 3NDBB 3OFND 1ZINA 4TYYA 2JLWA 4DIEA 1E2GA 3WRXC 3EPKA 4FCTA 2BKEA 4JLAA 1VKJA 2VHTA 2G3YA 1OH5A 5FI1B 1COWD 1Z22A 3LLUA 4HLQB 1F2UA 2G0TA 4HDCA 3NDPA 4OI1A 3PEWA 5KTYA 3MJHA 1Z29A 1YR7A 3QEOA 5CIWA 1F60A 4B48A 3PEYA 1D6JA 2HJVA 3R20A 1KO1A 1XJQA 4RVCA 1E0AA 2OAQ1 4Q1DA 1AZTA 1VIYA 3I92A 5GJVC 4AG6A 1IJEA 5BN5A 5J4VA 4N0DA 5EXXA 4LBWA 3R9WA 2GBLA 4YLGA 3AVYA 2X2EA 4RKFA 1KI6B 2PT5A 4FMBB 1Z0DA 2ATVA 3OEHD 5F98A 1R4AA 2IYRA 1G3QA 1LF0A 3BERA 3QXSA 2WOJA 3R8CA 1N6IA 5KNDA 1EXMA 1XMIA 3WMGA 3AF3A 1BYIA 2ZANA 3CX7A 2GZAA 4P3YA 4PO8A 1W7AA 1OXSC 1NN3A 2WTUA 3RAPR 3UWKA 4YONB 3QBVA 4JL8A 1BS1A 4EPVA 1AZSC 4V0OA 4JT2A 3DL0A 4B2PA 1W2GA 4FW9A 4WZAE 2G1KA 1F2TA 1ESNA 5E7IA 2XXAB 4DVGA 3DEFA 5GJWC 2HV8A 4WOPA 1R0ZA 4PZZA 1UEIA 4E07A 1UJ2A 2F1RA 2CK3D 1SXJD 1FUKA 1AS3A 1FOEB 1HA3A 1QVRA 1V5WA 3OFNA 4OHZA 2ONJA 4F91B 1IOZA 1FNNA 2GDJA 1P9NA 1W4CA 4PPFA 1N5IA 1DG1G 1H8HD 4QKQA 4O3MA 2A5YB 1COWA 2GCPA 3NH6A 2ZTSA 3LA6A 4M1OA 1PLKA 3ZD7A 3F3YA 1QVAA 5JLJA 4XVRA 3LX8A 1DTSA 1P9RA 5EUQB 1VYTA 2CEAA 2ZI6A 1KO7A 2F1IA 1P2UA 1E69A 3OIUA 1KKLA 1NI3A 5IK2D 3X1YA 3ICQB 4TTRA 3HR7A 1CR4A 1EWRA 4N3NA 2REOA 3W8RA 4MYUA 4I99A 4BEJA 2GXUA 4Q21A 4PC2A 1P61B 1TEXA 1W0JA 2CE2X 2VPPA 3ND8A 4FXPA 3AF2A 4NCIA 4Y0VA 5FR1A 2WPDD 3U44A 1M7BA 1CKEA 3MG9A 3NC0C 1I4LD 2R8RA 5BYKA 2QMUA 3UMFA 5LBIA 4IFEA 1YZLA 3MSXA 4NYJR 1P4SA 2J7PD 1GILA 1ZM4A 2ZVQX 1Q3TA 3DHWC 5FI0B 2IYQA 1OXXK 2YKGA 2J9RA 2QTHA 1KYIA 1JR3E 1HY3A 1X1SA 1Z6XA 4CVNA 3OF5A 1XPUA 2XTZA 3TSOA 4HLUA 4DJTA 1X3SA 1S3GA 2HYDA 3KKPA 2OAP1 1E2PA 4YMWA 4TL9A 2HT6A 4UNQA 2ONKA 2IL1A 5FOUA 5JCZA 3LV8A 4WZBE 3PUZA 3NHBA 4MGZR 2JLRA 2WMNB 3I8XA 3FTQA 4PC6A 4NKRA 3U4QA 2DHRA 3KXLA 3QPVA 3PITA 2FMXA 5AJWA 5GJCA 1KNXA 1DAFA 2A5GA 1JALA 5DSZA 3GJ6A 3KKNA 4AIIA 2BWJA 1GAJA 1GNRA 1NY6A 2ERXA 1E9RA 4A2WA 3VR4A 1CEEA 2QMHA 3N2IA 2CCKA 1D2NA 3E70C 4ZPXA 1HT1E 1XMSA 2Y8EA 4KI0A 5AUQA 1XJCA 2X2FA 1NBMD 4NTZA 2DR3A
chains in the Genus database with same CATH superfamily
3IOBA 3RWBA 2WU1A 4OGFA 1CUFA 3VHLB 2RCYA 1CJTC 2X9VA 4A73A 3IQFA 4FNMA 4O2AA 4BHTA 1VPEA 1QWSA 4DDTA 1ARZA 1P7ZA 1NPTO 3IA7A 4QU9A 4PYKA 3JASA 4XM0A 3EDMA 4DRXB 4E70A 4NE7A 3PUVA 5L6MB 1S2LA 5AVKA 3QI2A 2PFSA 4C4PA 4Z53A 3WKAA 1J22A 2NZVG 3CEPB 1UC5B 1YGYA 3G1UA 2GK6A 3G89A 4ILKA 4O4IB 5EWJA 2OYCA 3RT7A 3UPDA 4D9NA 3D2LA 2XGOA 1J99A 2EX0A 2JFZA 2MR5A 2ZT5A 3ZZMA 2OKCA 3VR2A 3NALA 2VXOA 1OBCA 1WVMA 1L5WA 5G4KA 3W5IA 5C5IA 2XB9A 3O2JA 2A9PA 2QRVB 1NNLA 2GA9A 5LP6A 4AXXA 2VPWA 3TSZA 1M7HA 4QTTB 4W9NA 2I2FA 2H48A 1UIRA 1G20E 2I3BA 2FWIA 2PDAA 4ND6A 2R8ZA 2OWDA 4YMHA 1DJQA 4GP6A 2O57A 1P33A 1GTZA 4MQBA 1X77A 4MHSA 2WA2A 4HQRA 1HDZA 4QUJA 4ZT2A 5HK8A 1YXMA 1ID1A 2GEBA 1I01A 2ZT7A 2XTNA 4NR0A 1NWCA 1HOXA 3O1JC 3RRJA 3INYA 3VR5H 2Q29A 3WYBA 1Z2CA 2I7CA 1YOVB 3T7EA 2X0IA 3GT7A 4WOCA 3C4JA 2GF2A 1S4QA 3M1YA 1FYDA 2K7ZA 4BJ6A 2ZJ2A 4EECA 2IXEA 1FEZA 2R6AA 2IHNA 1VHWA 1MEJA 5FULA 1UKZA 2F3UA 1ZL0A 2IHBA 1FYWA 2V54A 2JGFA 3JATA 4OH1A 5JS2A 3KKQA 1YJQA 2OM2A 1T5TA 2A59A 2NACA 4GBED 1Z6AA 1JFLA 2WILA 4YV7A 1MO2A 1S2MA 3NEPX 4WERA 1G2IA 3W05A 1NMZA 1RXSA 4DDUA 1KVTA 2R6DA 3KHSA 4MGHA 2JCSA 3QLTA 5HE8A 2GAJA 3QOYA 2BKAA 3BMNB 1E1RD 2G04A 2BEJA 3W9UA 3JZDA 1FRVA 1DV2A 3AO0B 4INPA 1L7PA 1E9BA 5DULA 5C81A 1QYIA 5AICA 5BV0A 4RHCA 2G36A 4D0SA 2WZQA 1NXOA 4DEYA 4RY8A 2RC5A 2VS1A 2IUSA 3BG5A 3RV4A 2ZPAA 4C4YA 2VK1A 2V7EA 2HNBA 4OGGA 4W1RA 1U9ZA 2H52A 5AHWA 2VEOA 2NYRA 3FNHA 2BIFA 2H1RA 3ILYA 4F46A 3DKRA 3OBBA 4J0GA 2NZWA 2CY0A 4F85A 3I1YA 1UQUA 1RRKA 2E85A 2RSLA 2EOAA 3OLWA 5MDHA 2WAMA 3A06A 1ECFA 1T8RA 3ZQKA 5K0JA 5LZ2A 2BFCB 2WHEA 5KNBH 4UUPA 1VQ1A 4OU4A 5DYGA 4NAHA 5A4MS 4BO0A 1KY5A 3HJBA 5KNDD 1XD9A 1WG8A 3GRPA 4MYSA 3EQ8A 5D8DA 4A92A 4YMTA 5HEKA 5CXUA 1RJDA 3ZX4A 3OQBA 2FZLA 3W5HA 4B76A 1S3FA 1KAHA 3D8SA 5AH0A 4W8HA 1FYVA 3C4QA 4UUBA 3UUFA 4XGNA 3IILA 1IZZA 1RP1A 1EQ2A 3RNLA 4DLPA 2VK2A 2ZDQA 1E2UA 3OIWA 3BWYA 4A4DA 8AT1A 5JWOA 1BTOA 2NSLA 1GKKA 1LS6A 3CF0A 1WW8A 4A36A 3UMGA 2CDCA 1PNTA 2XDAA 2CXUA 1GPJA 3MQ4A 1B74A 5FB3A 3E5HA 2V5VA 1ZBQA 2HIHA 3E1SA 2WWXA 4MP8A 3TZBA 4HVLA 1CDZA 1GGMA 4YJGA 1GZSA 1WLSA 1AOXA 1ZVKA 1XTBA 3TJMA 3U4AA 3WL6A 3JYHA 4Y2PA 4IDFA 1KP9A 3BH0A 3G0BA 2RH4A 221PA 3BF8A 4MQLA 2GTIA 3UH0A 1ADJA 1BMQA 7REQB 3MNFA 4E14A 4N5DA 5IC6A 1WCYA 2GETA 1MIOA 1D4OA 1MJ5A 1Z5GA 2HO5A 2IX9A 4GGOA 4QAQA 5TT1A 3QTBA 3F7TA 2VTEA 3BWDD 3DTNA 4K9RA 2VRBA 3LF1A 3T5AA 5E4JA 5ADVA 1Y8RA 2OQRA 3O4FA 1BXRB 1QV6A 4GYKA 3WMFA 1JDBB 2G9VA 2Q1XA 1JJAA 2AJCA 3R5HA 4JT9A 4LEIA 3W34A 4DRYA 3U16A 1NTRA 3IUPA 2NO6A 3AOGA 2REBA 2VJCA 3Q88A 1VSBA 3ASVA 3GEDA 1PJQA 4BTVA 2R60A 3CUUA 3H1GA 1QYDA 2P1ZA 4GX5A 4MUGA 4Z8XA 1BCRB 1M0SA 3I01A 4E2WA 3BTOA 3K6KA 3MWJA 3AB8A 3TSWA 4ZZ0A 5IVPA 1I9CA 4QPPA 4UOQA 1HSOA 2RH5A 3JD3A 4RLHA 2X7JA 1GXSA 2IYAA 1KOFA 1SCNE 4OA8A 4C0WA 3IB6A 4F4CA 5DK4A 4RV4A 4N47A 1X9IA 3LT1A 3ROQA 4B7AA 1XHFA 4P38A 4ZCTA 1QR2A 4JLNA 2GEFA 5C4IA 1UWCA 2QQGA 3BCUA 3D3WA 3PF8A 3Q5GA 5JS8A 1E9CA 3I4FA 3IV7A 3DMRA 4HF7A 4IZHA 5KQGA 1PZNA 3FCAA 2IHKA 4RK7A 4YFVA 2WTEA 2IUTA 1KOJA 4HB3A 4TV8A 3VZQA 1R37A 2CZQA 4F5DA 1T5DX 1QCCA 4LNAA 1W87A 1QQ7A 2B35A 5CVCA 1NBAA 5A0FA 1E2DA 2V9CA 4EJ2A 2QDKA 1CR1A 3I6MA 4KO1S 1F8YA 4MVXA 5CX1A 5HKLA 1U2DC 2WIJA 1S2DA 2J0UB 5DGDA 2XIJA 4S2EA 3PXCX 2WSYB 3LUAA 3E9CA 3E18A 1JIKA 3PC7A 4KKXB 4MINA 3W77A 4LGVA 1TCVA 4D4JA 3NHFA 3CSDA 2H4ZA 4WLVA 1ONSA 2C7RA 3KJNA 1TU3A 2JFNA 4GUDA 3ZV7A 2QPTA 1U94A 2JC3A 1C9EA 3CX6A 3ZD6A 4YRBA 4LJRA 2ZJZA 4FB5A 1LQTA 2QE6A 5M29A 3JRXA 2O1WA 5JLAA 3OP1A 2WDZA 1J2EA 4Q01A 1JJ7A 4LNUA 2BFFA 1EFCA 1T9BA 1MBZA 5AK3A 1FDUA 1R0WA 3L2OB 3L8FA 4NYMR 4DW8A 4L4XA 3KYCA 4OXXA 4Q3BA 4C7OA 3LO8A 3PDUA 4DLAA 1QIEA 2VHCA 4HGPA 3SF8A 2DUWA 1CE8B 3PB3A 1SEVA 4INOA 1QE3A 4J2OA 4B74A 1L7VC 1BE6A 2YW2A 1XCJA 4Y0AA 5FX2A 1XDDA 2EVWX 4BEBA 1JHQA 3FDFA 2BR3A 3B78A 2A94A 4MLPA 3D7KA 4PM4A 5HZHA 3H6KA 4KZKA 5IX8A 1TRHA 3ESBA 2V7WA 4FMDF 4Y9TA 4AY5A 4EB3A 2PX2A 3RROA 3BXZA 3ONNA 4O5OA 1DEAA 1XWWA 4CF4A 5BSKA 4QYWA 1R0SA 1X9HA 1A5ZA 3RSOA 4OB6A 4KGDA 1P4RA 1Z07A 3V6LA 3IDZA 2JRLA 4F4UA 3ZEAA 3HKBB 4DQLA 3S8YA 2Z57A 2C57A 3FWHA 4NLLA 2C5EA 3TAUA 1BH2A 2EHJA 4XUDA 1T1SA 3WK7A 3RFFA 4C3OB 1T9GS 5C1OA 4NICA 4XYEA 1E8NA 5DXAA 3GFRA 3PEFA 4MWDA 3DOHA 1ZRSA 5FORA 3ZXIA 1TD1A 1XR3A 2OFOA 3LY7A 1WMFA 4FSHA 4GPAA 3JVDA 5F7XA 2WMYA 1S8NA 2F8TA 1CRPA 2FK7A 2JPDA 4RDXA 1TVKA 3OTHA 3H5OA 3PNOA 4ZWNA 2ZE5A 3F4BA 3CT6A 3GT3A 5LP6F 1W85A 2G1UA 3PHHA 2FY8A 4IXNA 1ORRA 1KI8A 1ZH2A 1BX0A 3MOSA 5IJZA 1XXHB 2NVBA 3KL2A 2JANA 4H31A 4I46A 4OGLA 4CIXA 2HBQA 4MV8A 1DWPA 5HF6A 3V1TC 4ZGWA 2YFKA 2O8EA 1TO6A 4DR3B 1XNHA 1I1OA 4O2BA 1MABA 3KOUA 2XE8A 2QUIA 4QVKA 2QN9A 2C04A 1L7RA 4A15A 2O2CA 2ZBRA 3E15A 2YW9A 3ZDYB 1P7YA 2FFQA 2H2AA 3F8WA 3MJVA 3G0IA 3TGWA 1GTJ1 2QMEA 4FW8A 2UZ1A 1E1CB 2RAPA 5AM5A 5JVDB 2C3OA 1HLFA 4TTIA 3A9UA 4U63A 1CQIB 4U00A 5FUXA 1RWOA 3UBTA 5LQAA 2M6RA 3UAZA 4FKBA 1DZIA 4KYTA 5BNTA 3LX4A 5DN6A 3KQVA 2IV7A 4C14A 5FT9A 3GRYA 3D1JA 5AI8A 3V9PA 4LI0A 3BHJA 3OF3A 4TVKA 3ZK7A 4BVGA 3VOAA 2VJNA 4EI2A 3SQWA 2CNLA 4AJ9A 3ZHCA 1K08A 1QGYA 4XSGA 4NZPA 5AJTA 1JL3A 1SBTA 4K86A 3UXEA 5JWRA 2A78A 4W5HA 1NLYA 3PJEA 1THMA 4QECA 1UC8A 4U3JA 4X71A 2FMKA 5D3QA 4YP1A 4O2BB 3V6MA 1C3LA 5ESRA 1RVV1 4XWOA 2QZ4A 2Q41A 5K3EA 3C8HA 1V5GA 4M7RA 2GVDC 5DMXA 2HJRA 2QL9A 2V7TA 1G6OA 1TUIA 2P6MA 3TS1A 1J07A 1ELOA 3LH5A 4Y98A 2G1AA 3WGJA 3SX4A 3B3AA 2RGGA 4ZI3A 3CNQS 5CXQA 4KYIB 3LGAA 1OAAA 1C2YA 1XLUA 2P68A 2ZDGA 4F4FA 1GPKA 4JYBA 4RL4A 2OXRA 4D9GA 4KO2S 1KY4A 2PKQP 4HWKA 2R5NA 3TQCA 1HYQA 2E1RA 1C3OB 1SBYA 2XGGA 1U0HC 1TKCA 2Q7XA 4FOLA 4J9VA 5E6RB 4JVMA 5DTRA 1NBHA 1UMBB 1D1SA 4K9MA 2QQEA 4IQ0A 5T64A 3WQHA 2DECA 3PS9A 4G1FA 2IU3A 2BM9A 2AN5A 2G9ZA 3IJEB 5BT9A 1UM9B 3ZYCA 3HVHA 5K8CA 4HNUA 1IULA 4Q4AB 3GLFA 3JTMA 6REQB 2VHYA 4GKAA 3QWBA 4HPJB 3ZOZA 4TMTA 1JQDA 1V5FA 2BMAA 2FR8A 2IYWA 5G0SA 3V5NA 3RAEC 1E5QA 3K05A 2EYUA 1PG5A 3WL3A 3WLIA 4HGOA 5E9WA 3IL2A 5FA5A 1LVUA 2ZRFA 4HXYA 4IV5A 4KPUB 2H16A 4QQFA 3K5WA 4P32A 4JCOA 1E18A 4XDHA 1TO2E 1GU7A 3Q87B 4FYMA 2HWXA 3K0FB 2BP7B 5IH7A 3RSLA 4X85A 4L2IB 4U4AA 5L3ZA 2PLAA 2WF8A 3TCNA 4B4WA 1NIJA 2VZEA 3CLTC 1RJGA 1CB7A 3HBJA 1UZAA 3H2SA 3OIYA 4IUBS 3OC6A 5ITWA 4P3PA 1CQXA 3NI2A 3NU1A 4G0PA 3MGBA 1CZOA 3P71T 4JLMA 4KMOA 4RX1A 4RXTA 4TMKA 4NHOA 2CNOA 2FETA 3T1OA 3VTKA 2HF9A 3GEGA 3KZXA 3NPAA 3RK1A 4BLWA 2AC7A 3G2IA 2A0WA 4M9ZA 1ZMXA 1V35A 4YCMA 2E49A 3EJWA 4MYHA 1G21E 2QW1A 1YVEI 4GYYA 4Q9IA 5KOHB 1U4SA 1CIVA 2AR9A 2P4HX 2ZFUA 4B4OA 1V9SA 4BX8A 2GAOA 1VHTA 2RGDA 3HHPA 3P2KA 3N74A 5BN4B 3ZS8A 1UFRA 1Y81A 4OYYA 5FJIA 3WGUA 3CRRA 3FNQA 1QLJA 1CETA 3FSGA 3KOMA 3H05A 2MSLA 3UCXA 1Q17A 1VLQA 1LW7A 4JXKA 3EIEA 4ZCLA 1QK4A 1GJRA 1K89A 1Q44A 2HHJA 1T1GA 4JN6B 5THQA 3REQB 4MHTA 2R6ZA 1ZN7A 1QS0A 3QLEA 5KTSA 3QE3A 4A8TA 5FPSA 2W00A 2E5WA 2VVTA 1T4CB 2EIXA 1PS0A 3AETB 1WPQA 4XQ9A 3GA0A 2QN1A 1E2JA 4YRLA 2CLOB 2ZBQA 3KTDA 4JBYA 4S1VA 4WXHA 4AZ0A 5KPJA 4YP7A 3ZE8A 2ZYHA 5UKDA 1IG3A 4WGFA 3OJFA 3HCDA 3HA5A 3BQNB 4QUBA 1TX4B 3ZKWA 5TQJA 4AJLA 1EK2A 4DAEA 4E2ZA 5JAMA 1HNXB 4ZC1A 2Q5JA 2DETA 1A8SA 3OLQA 4R8VA 3QWFA 5EZQA 1WU7A 2XUJA 3U09A 3RT1A 2QJWA 3WA7A 4E13A 1XWIA 1WB4A 1BX1A 1LC3A 5BSTA 4KPFC 2VC2B 3D43A 3JYNA 4QNRA 2GWRA 1BD4A 3CKKA 3NUZA 3EJ6A 3K8OE 2P5SA 4RA6B 1WZCA 3BGSA 1Y3HA 4OCZA 4F5WA 1F1JA 1Z63A 3E9DA 1D2RA 1T2UA 2YWBA 3IFSA 2GCNA 3L6DA 4QYIA 3TK1A 2WE7A 4LC9A 4DSAA 5KPDA 4ZQIA 3WLNA 1ZD8A 4Q9LA 2AFHA 1WQ1R 2XTMA 3PNYA 3SZRA 4GPIB 3L01A 4ESOA 4TROA 3M1LA 3WADA 1XNQB 2CB9A 3DW1X 1P2TA 3OHMA 3EQ7A 1G59A 2BFDA 1YL5A 4M46A 4O08A 1ISHA 4DADA 4LTNA 3PNSA 4WE3A 1F20A 3JV7A 2YNMD 3CONA 2BELA 4MWCA 4C1BA 1DRWA 5AJVB 2JCBA 4GF5A 3R3VA 5FBQB 3A9VA 1ZXXA 1ADGA 3BWCA 5IC5A 2YWGA 4NX2A 1ZGAA 1ISFA 4WJLA 3QMPA 1U02A 1EVKA 2VJBA 3DMDA 5FUYA 4D81A 3FSJX 4PR0A 4I1YA 2VWHA 1RBQA 4NBUA 5BNZA 4KW7A 4J49A 1VG0B 5HGJA 3FAZA 3QE4A 1OLUA 3HV0A 4KVZA 3OZVA 1T26A 2R6FA 2O7RA 3C97A 1ZK4A 2QTGA 5LZ8A 4DB2A 3CV3A 1M33A 1YFZA 3HR4A 5ALDA 2OFXA 4MS3B 2JIZD 3DV0A 1U1GA 4KSBA 3OX2A 1ODIA 3COPA 2ZZNA 1OTXA 2AN4A 2O1SA 2UUOA 3C8MA 1C0KA 3GJYA 4MVJE 1ULBA 1XTUA 3ICVA 4O02B 4TXJA 3RIYA 1M1YB 4FEAA 1W36B 4E6PA 4XSHA 1VFPA 2TS1A 4OOEA 1JB1A 1Z0KA 1F0KA 3IE0A 4PQFA 2PPVA 4F3NA 4J90A 3OO0A 1MQ9A 1NKSA 1C29B 4H9GA 4BUZA 1NVBA 5HRCA 2Z1DA 4IFBA 4HTFB 5C8YA 2IV3A 3LQRA 4BUCA 2R9VA 3CC8A 1NW3A 1L5RA 2V9PA 4JU8A 1ZMOA 3UJ6A 3QKUA 3KEMA 3C45A 5K3BA 4RIEA 3BIWA 3RABA 3R8FA 2ZJ3A 4GM4A 3FYHA 1SKAA 3QA3E 3U7EB 1RYFA 4TLEA 3ZKAA 2Z8YM 2JNWA 2D0OB 4D9JA 4FFBB 1XB2A 3KKMA 2P0EA 1CY2A 1RHMA 2OYSA 1PQUA 1OJ7A 1ORHA 4WUTA 2UVDA 4FOTA 2GEDA 3UUGA 3SJUA 1GAQA 2W6PA 3M3PA 1F5SA 5IXYA 4XARA 1VZ3A 1RQLA 1SHJA 2ST1A 4HAWA 3L6RA 3A10A 4RHFA 1BC5A 3NBKA 3EQ9A 2NW6A 5JISA 1P8AA 2ZT8A 1WVGA 3N2GA 4O4LF 3HSYA 2W6IA 4ZEWA 3CT4A 1E20A 5DBFA 2YFYA 5CA0A 3ZGXA 4Q5IA 1E8DA 4KIJA 1ILEA 2HMSA 4JC0A 5EUBA 1GTMA 4L5BA 3B60A 2R8BA 4GECA 1X8XA 4Z9XA 1YQQA 1H5UA 1QV9A 4P54A 1QCZA 4OH7A 3L1HA 4XQEA 2Z3WA 1SCBA 1B1AA 1RYZA 4G5HA 1OV6A 2EWVA 2C3PA 1VBMA 3OE5A 4J7UA 2ZJBA 1SC1A 5IUKC 1OQAA 4AZTA 2ORVA 3RRFA 4FDTA 1Z7YA 2D5BA 3X1DA 3KQSA 4CFZA 1OGIA 3A36A 1P2SA 2M9MA 4MDFA 3PGJA 1OTYA 3H1AA 5EL0A 5JPIA 4BZPA 1PTJC 3HP4A 5TPWB 4XWGA 5KKCA 1WQ3A 2BM0A 2ZWVA 5HPYB 1JJIA 1FB5A 3HCEA 3I30X 4QHSA 4Q34A 1VI6A 3VKHA 4PQGA 2Q6VA 2NO9A 2VZ9A 4Q18A 2UVQA 4RFVA 5I7SA 2QTVB 4IO0A 1SVUA 1BJTA 1WDKA 3BN3A 4PNEA 1MKYA 4GOND 5IVHA 2X5JO 2D0IA 3N75A 1TVKB 1DQRA 4EENA 1GQOA 2HF7A 4M7PA 4LXYA 4RK5A 4PZLA 4LF6B 2B83A 4EG6A 4BVKA 5T4BA 2JGLA 4INAA 3PRKE 4YAFA 4F6RA 3EPPA 5DNCA 2QGFA 3A6EA 2F3RA 4U7FA 4DANA 5JNWA 3A9SA 1CY8A 3DMNA 3PKZA 5MF6A 2EV9A 4RD3A 2IBTA 4DNPA 4M22A 1QRUA 2IE0A 4C6SA 2LV8A 1XVLA 3H65A 2FH5B 5EE0A 5B58C 2NTNA 3BXHA 3RK4A 2GD6A 3E7WA 3WGVA 1HQDA 1DPFA 1JAZA 4KFSA 1U7DA 3V7WA 3FRIA 3MT9A 5ETJA 2GK7A 2ZR0A 1OYOA 5B1SA 9GPBA 1BYUA 1TA4A 1LDEA 3LPDA 4CMGA 4ZHQF 4EA7A 4DR6B 4UTRA 3MVEA 2JVJA 3RIGA 3FLEA 3IB3A 3L7KA 4WKOA 1JZSA 4JI3B 2R86A 4FQ8A 1AXRA 3DV2A 2NP7A 1GXSB 5GV7A 3EOZA 2JA1A 3G9QA 1CUJA 1UWKA 5F2OA 1GWNA 3QVOA 4CDNA 3AFIA 3MW8A 1CE8A 5B4VA 2FQQA 2XYRA 2QSYA 1H1LB 1UM8A 2OV1A 3H2IA 3KR2A 3PD7A 1E94E 2V0CA 4J0IA 4MPDA 4PINA 5JI3E 2W6CX 4I4TA 4C7OB 2ODQA 2FMUA 1E61A 4U5XA 1LPMA 4X1KB 5EJGA 3AKEA 3G79A 4LHZA 4JA0A 3TQHA 3IRUA 3LZDA 3EH1A 4NS4A 5C37A 3GOQA 3THYB 5GM2A 8ATCA 5JJIA 2E37A 3A58B 4N6GA 1IBKB 2D2XA 1TKRA 2HC9A 3CNLA 2KE5A 3D2AA 3FBGA 2EGHA 2GQ0A 2FX3A 4MV5A 4L78A 3FUVA 3GGOA 4M1EA 3ZV6A 4ZCRA 1SD2A 3VPFA 3HJAA 2ZIFA 4Q1AA 3V8VA 3PHCA 2PT9A 2C2OA 3VC3A 3O5AA 3ECAA 4WFJA 1PJTA 3OLXA 4OI2A 1GPLA 3UJ7A 3UJ8A 4E11A 3ANSA 5D3MA 4V2UA 4XYMA 1V4BA 1SZPA 3TNYA 3O03A 4AK9A 5AW8A 1GNQA 5CG2A 3E6AA 1YO6A 1NF3A 2FJ0A 5CBPA 3GCZA 5JE8A 3EXAA 2FG7C 4KCGA 3VTFA 5HRAA 3RFUA 3PPVA 5BYJA 1C50A 1JZQA 4J0JA 3E9YA 5JXWA 4ZHQB 2EARA 1JQEA 4B3GA 1OT5A 3PE3A 1N0HA 3LWNA 1WY5A 1TAHA 3FWPA 4JHXA 3GH3A 4TX1A 5EG5A 3AL2A 3UFBA 4WL0A 2FQWA 2E3JA 4R2MA 4DSUA 2EKQA 1DGQA 1ZW6A 3OIDA 4BGVA 1RHJA 3PTAA 3L9WA 2GT1A 4LOIA 4EIWA 5A2GA 1TVMA 1EGQA 3ACCA 4R8MA 4OXIA 5TGTA 4M8KA 2GILA 3T7AA 2RAVA 5ITVA 4QDUA 5IABA 2OG2A 2MTBA 3EXIA 1RYEA 3WJ1A 4EGAA 3FTFA 3T1VA 4EDHA 4XX0A 2F43A 5GPBA 1VGRA 3I73A 4RY9A 2J46A 3C3DA 1YWGO 3D8UA 4TQGA 3LF2A 4DCPA 3TI7A 2WWHA 1N2HA 3ZHVA 2BHTA 2R6JA 3BQ9A 3JQCA 3GLVA 1JFFA 4WY8A 1JILA 1ZZGA 2QUHA 5FYQA 4DKXA 3MJCA 4LOJA 4MW0A 1MV8A 3DJYA 3S8MA 3H2ZA 3HB7A 4JYAB 1KFEB 4PXAA 1SBIA 1XRSB 1ZP6A 1L6RA 2NV0A 4RZXA 3B2NA 2LW7A 1MGPA 3LHFA 2BGNA 3I2KA 2IUYA 1J2RA 5F3RA 2XIQA 3VNQA 4HHEA 2ON6A 1TMOA 4O4HB 1SQGA 5DSTA 1G3IA 2VAPA 1E6KA 2Y1XA 3A4TA 1II9A 1YQTA 1ZM9A 4AZWA 5DGIA 3KJIA 5HS6A 5JJBA 5ALOA 1M6VB 1YK0A 4I5EA 2A1IA 4FFOA 4X20A 3RC7A 3TMAA 4J8PA 1DCKA 5LD2C 3IP1A 1CUEA 4G65A 1ISJA 1C4XA 2GTPA 3C70A 3HXMA 2OO5C 1ZK2A 2AG0A 5HCNA 2D5CA 4IHJA 4DBZA 3ER8A 1X92A 4X6YA 2NU8A 3R0IA 3GFGA 2I54A 1UK6A 3ORYA 5DWDA 3K1JA 1KMQA 1K88A 2AUTA 1GY8A 2DQ4A 2GRUA 2XNDA 1MAAA 3C87A 4JSYA 5CFLA 5IWAB 2Z9CA 2DLNA 1GUZA 1C7ZA 2XR1A 1D4AA 3E05A 5JSKA 1AUVA 1KBZA 2NQ8A 1NNI1 4YMLA 1NT4A 1JQAA 2BD0A 1USUA 1EI9A 1QIDA 1BS9A 3AJAA 4O8ZA 1DT3A 3U7QB 5CEEA 1K75A 4LRXA 3K6RA 4LE2A 3TB4A 5CDYA 2MYUA 3MGKA 4UVGA 3TLJA 2YV1A 4QFCA 5EA2A 1JH9A 5EZ6B 1UBJS 2R48A 4H1VA 1D0VA 4ALJA 3DBHB 1U63A 2DKOA 4F56A 2NO0A 3KE8A 1BGWA 4CLRB 2D8AA 1KZHA 2PD6A 2X1VA 3IVAA 1KSFX 1NZJA 2P69A 5FFMA 2JLZA 2VLIA 1DKMA 1Q1QA 5K4GA 1W36C 2NVUA 1BQ4A 1K8XB 1W4BA 4V0QA 2Y05A 2J0EA 4JLOA 5C5EA 4JI0B 4HB4A 4WY2A 3KHTA 1Z34A 5JY6A 2I8LA 2IS4A 3CN9A 2GARA 5DNDA 3HM9A 5BSRA 4LPKA 1JSXA 4IHJB 4YI5A 5I9LA 1NATA 3WJ2A 3VOSA 3SYLA 1F6BA 1NQWA 1TM3E 5JSFA 2HWWA 2H4HA 1JNXX 1ULHA 4X94A 4YJHB 1JA9A 4EY5A 3CVVA 3H8SA 5LZ7A 2R1ZA 1IVYA 2TRSB 3M0EA 3O7WA 1N9GB 1C0PA 1FP4B 3IIKA 2VP4A 3H2HA 3WYDA 5BWBA 3TVDA 3N86A 2GOYA 2HO4A 1FLNA 2AZMA 2FRXA 2PWAA 3OEYA 4TTSA 2PMFA 4PIVA 5D87A 4Q3OA 2RHOA 1U0OC 3PYXA 1SQSA 4XVQA 3W90A 2BUBA 4AUMA 2HOQA 4DCMA 1U2GC 1XZQA 2CGEA 3B82A 1HLGA 1PHPA 1GRQA 1W96A 4DLVA 1MB4A 3LE8A 2GXQA 2ZZKA 1G3RA 4DZTA 5K9ZA 4WCFA 2R7LA 4FR5A 4CG0A 3V4ZA 1OB2A 3EBOA 3TRHA 5FBRB 1GG2A 4HNQA 3EVGA 1FP7A 1ZD5A 2G8LA 1ODCA 3NT4A 4AY3A 4BMSA 2GK3A 2I7DA 4REQA 1O77A 4RS3A 3DZCA 2PGIA 5AK6A 4YLYA 1Z0IA 3GCDA 2EW8A 3CH5A 1LF5A 1QRTA 1DAHA 2WICA 4WIAA 3OP4A 4J1SA 4WAUA 2LVBA 3BE6A 3H5WA 4HTAA 3LPCA 1H69A 4P80A 4YO7A 5IANA 2O1EA 1M2OA 3OWXA 3BVPA 3NAMA 3PTLA 4L4RA 4F9GA 5FWYB 3DHNA 3DUFB 3WQBA 2PGLA 3KB8A 1BAPA 4MIKA 2ZXUA 1XQWA 2OP1A 4IGFA 4QEZA 1QPGA 2VQ3A 4YBZA 3EGVA 3EGDB 5CTJA 3IQWA 1ECGA 1ECBA 3G8CA 4KQGA 2IRWA 4XFDA 1KQGA 2BFMA 5G4LA 2BV3A 3BX1A 4IS2A 2XDYA 2VJLA 3UWOA 4TLMB 4E21A 4O4LB 1M73E 4PZ9A 1RQNA 4MCJA 3CIOA 2CXQA 2G8NA 2PGXA 3LXMA 4O33A 2IY7A 1AGNA 1SRRA 2NU9B 1W4ZA 2ZWPA 2FWPA 2FR8C 2BTOA 1QKJA 4PWYA 1ZD9A 3LLSA 4TS3A 2B8NA 3U7RA 3ZCPA 1OU0A 4BMOB 5BR4A 1JXAA 1UZUA 4OHYA 2ID9A 4DSTA 2J4DA 3U5TA 2W58A 2IYSA 1RD4A 3IP9A 2OZLB 1K5DA 1S2IA 2VP9A 2VOJA 4RVSA 1ULAA 5P8WA 3JYOA 4DGSA 4F60A 1L7AA 2O0MA 3NLLA 2Y0BA 3KL4A 4DN6A 1V11B 1EHYA 3IH5A 1E2EA 2FN7A 3FOBA 4G5FA 5T6BA 3T9EA 3TOVA 3C3BA 2AMJA 1KA9H 3DOOA 2HNKA 1JRLA 4KAFA 5KO2A 2GFQA 3QEBZ 4Y2GA 5F9HA 1VE5A 1GRCA 3HCOA 4S05A 1AB6A 1Q7CA 4OMFG 1X7YA 3ACDA 3R5TA 4FIZA 2GO1A 3EQ2A 4KLCA 1VG1A 4NCNA 5DXFA 2OAGA 3GC6A 2EXXA 4R8KA 3M6FA 4CYMA 1NDQA 2AHRA 3L7LA 4IY1A 4KMSA 1BVYF 3E1KA 1BG6A 2FSVA 1Z06A 1VKOA 1KQPA 2C07A 4C4OA 1F06A 2P9YA 4CR7A 1MN6A 3ZWNA 1LD3A 4F93B 4UEQA 3RTCA 4FHFA 1G20A 5B6IA 2XQJA 3KWMA 4R1OA 4WOJA 3RIEA 3OAAD 4HT3B 4QFBA 4R7GA 6Q21A 5D01A 3TTYA 3CLRC 3LFTA 4B6SA 5KWJA 4MR7B 4NS1A 1LU9A 2AVNA 3WFZA 3VPHA 4YR7A 1QHYA 1NWHA 3LLMA 1XK6A 3HKCA 1TCUA 3RUHA 5L3QB 2QBYB 2W93A 5FBHA 2CNWD 1GFIA 1K7EB 4A8JA 3W8DA 2FUG6 3MUNA 5COBA 3RU2A 2IKSA 4PYNA 3UAXA 2IHUA 4ESHA 3M4NA 4CM9D 1EWTA 4O2LA 2EW1A 3B1JA 3HU2A 1O0CA 1D0IA 1M6YA 1XFDA 2GZRA 1QTIA 5EIAA 3CVOA 3TNLA 3ETEA 5CGZA 1ISIA 3BXPA 3GUCA 3LQKA 4IKEA 1WXHA 3P9SA 2WJIA 5F77A 4KX3A 4MA0A 4EJ6A 1K27A 4OU5A 3MT0A 5A6SA 2EERA 2I65A 5TF0A 3BHNA 1EJ2A 4A8PA 5HSGA 2CCJA 1CFZA 3HA7A 2IDKA 1AGXA 2O4UX 2QLNA 3NS7A 4WXYB 1XZNA 4X95A 3WMEA 2FP3A 1L3IA 2WKQA 1XVIA 2WUVA 4N5MA 3GUHA 3O95A 4QTXA 3ZTTA 4FC6A 1K5HA 2ZB8A 4AYTA 1OLOA 3VYUB 2Y27A 4CTMA 1AO3A 3GLGE 3ZDFA 2HSEA 1M75A 3B6KA 4F2GA 4L85A 2LD4A 4ZEVA 1XRQA 1ZH8A 1Q50A 2ZP1A 1KZ9A 3R5XA 2DERA 3KPYA 4QREA 1NJ5A 1XQ1A 1NM5C 2C82A 3BMQA 3DNPA 1OBFO 1QH1B 2BC9A 3DQPA 4TMVA 2TMDA 4KRXA 3I42A 3NTOA 2QMYA 5HTOA 5DLDA 1J7KA 1YZHA 2O0HA 3BH7A 3F1LA 4M2LA 1LZKA 4JP8A 5IBQA 2OUIA 5K8LA 3FVWA 2V7QA 3MTEA 1DC8A 1OPRA 4US0R 4ZOQI 2FEKA 4AUKA 3I52A 1N6NA 1W34A 2VJDA 3RS0A 1MXHA 3WWYA 1DRJA 1SJ9A 3ESZA 5JXHA 1D09A 4LV6A 1FDSA 2P0AA 4BX3A 2GH1A 2IP1A 4FR0A 4M1KA 5JSZA 2C4NA 4PPQA 3WMWA 4JL5A 2YVKA 4COKA 4NENA 4QL3A 4ZVOA 4YWJA 2HIGA 3D3QA 1KZ4A 5G3ZA 3SJAA 2JG3A 4MUMA 4P84A 4AZ3A 1I3CA 3W5BA 2NSHA 2O06A 4P4SA 1MG0A 4RGYA 3VPXA 3ZXYA 3WLMA 1HE8B 2VRNA 3SXPA 4Q1FA 5C52B 1J1UA 3E1GA 5LB2A 1XHLA 4IWXA 4EO9A 2WWWA 4OD0A 3ROZA 5GP1A 3HBMA 3KO8A 2O8FB 1JH8A 1YUBA 4I36A 3UW1A 3KB6A 1KU0A 1KJWA 4KPGA 1N5RA 1T0PA 1JT2A 3I3SR 4ZI2A 1W6RA 3K9FC 3JU3A 1EVJA 3OCXA 1V95A 3KELA 4YUWA 4POAA 1QH8B 4LMBA 1DX6A 4R5HA 1HFKA 2D54A 5G1NA 5MN5A 3ENNA 1SCQA 1JWLA 4X3PA 5K2MA 3WFJA 5HDQA 3PX3A 2I03A 1ZS9A 4WK6A 4I9UA 4D96A 3A05A 2IXDA 4Y18A 4GG1A 5CFZA 2Q5CA 1HDIA 3H42B 4A6PA 4B17A 4QLOA 1SXJA 4RK1A 3Q5DA 2OCDA 1HDGO 1JBKA 3B12A 3FFWA 2FUEA 2BSQA 1Z5OA 3NYRA 3KDSE 3QYAA 4C3ZA 3L8MA 1YR8A 2J4FA 5JSZB 4YEDA 3EZFA 1GZ4A 2XCOA 4YMUA 3SEAA 1NRIA 4G0QA 4TTPA 4YJFB 1E1QA 1LK5A 2BLNA 1PR4A 3NDJA 4B82A 1XMQB 5T8KA 4CQMA 3KTFA 4YAIA 1H8EA 3JYLA 3VU9A 3WHLA 2JHPA 4AF7A 1NR7A 1NTOA 4K6KA 4K8RB 1A7JA 2B5OA 3E7XA 1XZBA 4RVHA 2OGSA 3E3AA 3IP8A 1YZYA 3WGMA 1IN6A 2HRDA 3RJZA 4RVGA 4Q6BA 4NOJA 3HXQA 4DBLC 4GOKA 5CFQA 4ZVKA 1Q0RA 3B8HA 3GN2A 1DKRA 2AN9A 1E2BA 1C3XA 1QAQA 2D00A 4CLHA 5IAEA 2HWKA 3HXKA 1H2WA 1OIXA 3NM6B 3TTSA 4F8EA 1DWOA 1CEXA 3P4XA 2H00A 1D0SA 3EX7C 1S3IA 4WBNA 1DP4A 3HYTA 3G0CA 1GKLA 2IYLD 3D9QX 3OESA 3QFTA 1P1BA 4MTCA 3KP1A 1SXPA 1ADFA 4TYNA 4KH0A 6LDHA 2DUUA 4R16A 2EFDB 1CUXA 1P18A 3P9NA 3PQ8A 2QM7A 5ILOA 5JFOA 1ETUA 1RAGA 2AXNA 2J6HA 3GEPA 4N03A 1M9NA 1P31A 2XYQA 2Y3IA 3QEMB 2F8LA 4HQKA 4V0NA 3SJBA 3FTEA 1XNGA 1B0AA 3F6PA 2JJYA 2O0KA 2QU7A 2VKTA 4RESA 4HFMA 1P3DA 1Q7RA 4JI8B 1URPA 2LNDA 1YK1A 2BEKA 3KJXA 1HG0A 1JGTA 2FMTA 4MOWA 3V1MA 4DLZA 3LWZA 3AM1A 4AYWA 1X7HA 2QRUA 1H2EA 4DYDA 3NT5A 2ECOA 4U2BA 4INJA 2OYRA 1WPXA 2YWEA 3FRHA 1M6NA 3INNA 3VSCA 3ELWA 1LI4A 1XN4A 5C5CA 2MDTA 3E4CA 3QELA 1AUOA 1FNBA 3ZDQA 3HY4A 1I9GA 3WY9A 4QGFA 4HQFA 4MQ6A 4QSMA 1Z6TA 1AQYA 1IRIA 1FCJA 1GNSA 1NUSA 2DUMA 3P1JA 4RPJA 3PZRA 1UPUA 4NMXB 5TDHA 3MYYA 4HXEB 4QGGA 1KQOA 1MHPA 4M1QA 3WC4A 1MJGM 1V37A 4FZVA 3ZV3A 2IT1A