2VSXA

Crystal structure of a translation initiation complex
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
382
structure length
366
Chain Sequence
QIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT RNA HELICASE EIF4A
publication title Crystal Structure of the Yeast Eif4A-Eif4G Complex: An RNA-Helicase Controlled by Protein-Protein Interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation/hydrolase
total genus 120
structure length 366
sequence length 382
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA02
4AC9A 4QGHA 3VNVA 3R20A 2VF7A 3HR7A 1X1SA 2IYXA 1VECA 1FTSA 1NF3A 3HU2A 2PCLA 4JBYA 2LKCA 3QPWA 2PZEA 1GIAA 5KU1A 5F9FA 2GA8A 3QVVA 4HZUB 2IWRA 2G0NA 2A5DA 2JIZA 1KI3A 4C0BA 1N6IA 2FA9A 2IUTA 1A4RA 3ETLA 3X1XA 2OZEA 5FUXA 1TEVA 5EE3A 2R8RA 1PVOA 3GJ4A 1EFRD 3QF7A 2ZTSA 5BQ5A 5JCPA 2NPIA 2VP0A 4HAUA 1XD2B 4M0LA 5KPDA 1TQDA 2GKSA 2FSGA 4GMXA 2A5YB 1IN6A 1R8SA 3KUDA 3K09A 2ZJOA 1KDOA 1Z29A 1KSFX 2EWVA 3GJ5A 2WWGA 2QM7A 3RDPA 4RD3A 4FIDA 1QHYA 4I1VA 1ZM2A 1NN1A 4LHZA 1KK1A 3Q85A 2G1KA 1XWIA 2XNDA 4UJ3A 5L3SB 3E2IA 1KJWA 4U7DA 4AKGA 1MABA 2Q3FA 1LS1A 5EUQB 1KY2A 4CT5A 1VYTA 1KI2A 4KYIB 2ZRLA 4PO8A 1CULC 4OHZA 2AKYA 2BCGY 3R9IA 1T8TA 5EJEA 2LCFA 4OQXA 4GBMA 4WZAE 2BBWA 1TU3A 4ASUD 4D80A 2VEDA 2QN6A 3FHOA 4OJKA 2V6IA 3HPQA 1Z2CA 4BFXA 4QFMA 1CEEA 4PZLA 4AG6A 2W0MA 2BCJQ 2HJGA 1CRQA 3GLIB 1BIFA 2GCPA 1CP2A 3WRYC 4FCTA 1KI6A 5HCIA 4BECA 2DFTA 5BN4A 4G1UC 2WIAA 5G3YA 4A82A 3Q5DA 2J41A 5JZVA 1DARA 3U3KA 3K70B 2C03A 3CPHA 1Z22A 2C98A 5CLQA 1Z0AA 2W2XA 2FEMA 1J7KA 2ZRPA 4US0R 3C7KA 2QTFA 3SJBA 5EE1A 4PQFA 5F2EA 4Q7JB 2JCSA 4EQ6A 2WWIA 4N3NA 4JVNA 2C8VA 3GJXC 2KJQA 3CPJB 4L9WA 3NH9A 3KUCA 5FTJA 4B6FA 1ZRHA 2OBNA 3RABA 5KNCA 5KDDA 3AVWA 4C7OB 3PUZA 1ZNWA 2BMDA 3CX8A 1YRBA 1M7BA 3RLFA 1JJVA 3CX6A 4Q7MB 3QF4A 2GK6A 2FSIA 2EYUA 4D0LB 2FF7A 4OL0A 1LW7A 1KOFA 1NMXA 2VH5R 4CVNA 2ORIA 4OJQA 1X86B 4X8MA 1YU9A 5DLQC 1W5TA 2B8TA 3ECCA 1CJVC 4ZCLA 4MKHA 5AUNB 4IXNA 4JLPA 1JPJA 1MV5A 2F9MA 4LPKA 3EPLA 1XF9A 3IBYA 2H7VA 2A5FA 3V4RA 1OFTA 2FWRA 2YWFA 2W6IA 1Z0FA 2ZU6A 4QGGA 4R7ZA 2CL0X 4HATA 1W0JA 3DHWC 2PJRA 2NO1A 5DHAA 3THWA 5EUMA 2QE7D 2F3RA 2ATVA 4RVCA 4QBGB 2NIPA 2FH5B 3L0OA 1UKVY 4G5OA 3R7WA 1YVDA 1YR8A 2DFKB 3CKLA 5JECA 2IK8A 2IS6A 1DVRA 2ZIAA 3LRPA 3ZQJA 2J5XA 2MMGA 1SQ5A 3A1VA 3T61A 2J7PA 3QJYA 2G6BA 3B6EA 4RY2A 4AD8A 1VKJA 1BMFA 1AKEA 5TARA 3O47A 1AK2A 1U8AA 4M2LA 2IHBA 2W0SA 4C2TA 3QXXA 5DO9A 3TQFA 4IW3B 1E1RA 2NGRA 1DTSA 1NN0A 3JVUA 5KO2A 1N5JA 2VHQA 1AQYA 2YOFA 4HB4A 1LF0A 1KO8A 4GT1A 3VR4A 1KKMA 3DMDA 4DC9A 5K8TA 4PPFA 3T15A 5FFMA 4B73A 1FP7A 1GNQA 1KSHA 1ANKA 2FPKA 3OESA 4FCVA 2QSYA 3MGCA 4KFSA 4MYTA 5TMPA 3GLFB 2BVNA 1E2FA 1MO4A 5SZKB 5J5CA 4IVRA 1VTKA 5FPYA 2EWWA 4BQSA 2Q3MA 3GD7A 1G3RA 1SVSA 3QKRB 3Q5EA 3SN6A 2R2AA 4Q4HA 1E9EA 2J59A 4BZXA 2ZRCA 3SBEA 1ZUHA 1GNRA 2GAAA 4ABYA 2O8DB 4NCKA 5JFGA 2AHOA 3KB1A 1XZQA 3NC1C 1ZYUA 2CCKA 4D4MA 1XTRA 5H8WA 2HLDD 4XWAA 3KKNA 3THYA 3EW9A 4HUQA 2R6CA 4TL8A 4G5GA 3AP2A 4WZBE 4NCJA 4M21A 2VTKA 1PLLA 2J7PD 3SEAA 3WY9A 5K8UA 2QTHA 3I62A 1WBDA 4JS0A 4QBFA 4IDPA 1QBKC 3HWSA 1DE0A 1YKSA 1TTTA 1BO6A 3TE6A 1A7JA 5HR5A 1OIXA 1UJ2A 2BMFA 1COWD 2W6JD 2ZE6A 2ZJ5A 3A1UA 1E1RD 3QE0A 4QGAA 421PA 4OHYA 1NVWQ 2Z4RA 2ZRDA 3LNCA 2IX3A 2GXUA 1QHSA 2ZPTX 4RSGA 2O8BB 1K5DA 1Z0IA 3SNHA 2VP4A 3WHLA 2BEJA 2VHJA 4Q1DA 1ZP6A 2BKEA 1M74A 1DAKA 3TNFA 4JKIA 1KNQA 3AF2A 4D0GA 2ZE8A 2WJGA 3U5ZB 2PCJA 3QPVA 1NL3A 2ZRHA 1UDWA 1MKYA 5CIWA 1G18A 2CL6X 4RFSB 3T1OA 4G5RA 4NYJR 3TLXA 3U3RA 1XCMA 1YQTA 1YZGA 1KJYA 2O0JA 3QI2A 4BLSA 3EIEA 4O2LA 2V55B 3ZH9B 3EC1A 1S8FA 2UZ3A 3AVQA 5JLJA 1E2HA 1SKYE 3T5DA 2OXRA 1QG4A 3U44B 4RJLA 1ESMA 1NN3A 5AJWA 2J7KA 2OFWA 3IQXA 1J2JA 4V0KA 2E1RA 4QJ4A 4QC2A 4BPBA 1IHUA 1GITA 4UKDA 4MDFA 2ZRNA 1Q0UA 2F55A 2ERXA 1BS1A 2ZJBA 1KO4A 1Z08A 2JJ2A 5IK2A 4L9SA 1QHGA 4ZDWA 3LW8A 1Z0KA 2F9LA 3EAQA 2ASEA 3OEEA 1B0UA 1WP9A 1Z6XA 4V03A 1CR4A 3SFVA 1G16A 4RD1A 3WMGA 4XTCS 3DM5A 4A6XA 2I3BA 3BB1A 3IKJA 4PO9A 5H68A 4ZO4A 2WHXA 2BM1A 1ZIPA 4N1AA 3ZDQA 4P4UA 2Q9AA 1MO3A 3B1WA 4GPTA 5CB6A 621PA 1OKKA 3LY5A 1KMQA 1YZLA 3L0SA 4ARZA 1WCV1 3H84A 2J0UB 2ONKA 1GRRA 5DI9A 2BM0A 2XXAB 1E1QA 4PO1A 5IHPA 2VP6A 3U61B 1YE8A 3BH7A 3IEVA 3FVQA 1G5TA 1E2PA 1RJ9A 3BK7A 4DDUA 4DBLC 3NIBA 2RGDA 4HDCA 1DO2A 2CHGA 4TYWA 1OHHA 5GJVC 2YV5A 3BGWA 1Q3TA 2ODWA 3GJ0A 1VIYA 2IC5A 4B3GA 2FGJA 4TLCA 1FL9A 2DY1A 2IS4A 2N42A 3IILA 1XEWX 1KO1A 4GP6A 3W5JA 1L2TA 4KXFB 3RS7A 4EFLA 2YWGA 2XB2A 2IS1A 4C0HA 2QP3A 3DOEA 4LHYA 2QMUA 2R6AA 3RRNA 4FD2A 3GQBA 3TGPA 4ZCIA 4G5SA 4XVRA 4XTRA 1YZTA 1XTKA 4AKIA 1UBGA 1E2EA 3X1DA 3V9PA 1JJ7A 2QMHA 2AFIE 2WSSD 3NKVA 1OFIA 4GZLA 2J3EA 4MRRA 1JR6A 3IBGA 1E9DA 3KQNA 4AI6A 5TXGA 2GVDC 2WWFA 5TVKA 2RAPA 3BH6A 5CM9C 1I4DD 1GZSA 2AR7A 2BEKA 3A58B 4B76A 1N0WA 2JEOA 2WM9B 4DLTA 1AM4D 2PT7A 3OFND 3PUXA 4MKGA 3EA0A 5F3WB 1Y63A 4FMCF 3X1ZA 3PV0A 1E2DA 4XJXA 4YONB 4M1SA 5H1YA 4Z8YA 5JI3E 1XD9A 1RIFA 2P6NA 3FE2A 4M1OA 4QJ3A 1TF5A 1GL9B 4W5HA 2XTNA 3C41J 3K9GA 1OH6A 5EE5B 4G5QA 2V7QD 4Q4JB 1UADA 1KY3A 2IYRA 3NVAA 1KK0A 3Q9LA 4D25A 3F0TA 4QXAA 4HB0A 1ZNYA 4QRHA 3RVBA 1W46A 1TPZA 1TUEA 3OIVA 2ZE5A 4MRNA 3CNNA 1RVDA 2CDNA 3IEUA 1SXJC 1II8A 4IXMA 3MWKA 3OIWA 4O25A 5KDLA 4K46A 1N6KA 2PEYA 3NDBB 3NDPA 4AYTA 3KKMA 2IYYA 3FKQA 4FI3C 3QSYA 1Z6GA 2ZJZA 4KSBA 4WAUA 2P5SA 3BB4A 2R62A 3DPUA 2JLZA 3JVVA 2ODNA 3GFTA 4ZDIA 3MRSA 2GBLA 2DWPA 3EIQA 4BFZA 3CRMA 2ZVPX 4B3CA 1XXHE 2OFXA 2BMEA 1QVAA 1OXUA 4RFVA 2RKOA 1L8QA 2QPOA 4JL8A 2YOHA 4LBVA 3LQRA 4JLKA 1F2TA 1GAJA 2ZUCA 4QOSA 4R2IA 2C9YA 1J90A 2IA5A 4DIDA 2QU8A 4DT1B 2FG5A 3AGQA 4LRWA 1XMJA 3GLGB 3WNDA 2ZRIA 3VR3A 2AXNA 3PIRA 4AYXA 4HZUA 2OAQ1 2DFLA 2YWHA 3QXHA 2XOKD 3PXGA 2FFAA 3Q72A 4QKQA 1W36C 4AKEA 1OB5A 3U7HB 1DELA 3NXSA 2D2FA 4DDTA 1QHHB 1XD2A 4TMZA 1NY6A 2B8WA 1HT1E 2G83A 4DCTA 1R5NA 1N5IA 5KYKA 1M1YE 4QNMA 3G82C 3SYKA 1E9CA 1KMHB 3KQHA 1XEFA 2JDIA 2F43B 1IBRA 3OE7D 4LBYA 2XGJA 3BIFA 4CGZA 4A0RA 5L3SA 2KE5A 4D26A 4Q19A 1Z8FA 1E6CA 3DKVA 4A0FA 1JQLB 3GEHA 3A1SA 3NTUA 4U00A 4M1WA 3R9WA 2QGZA 2VPPA 2PBRA 3TAHA 2MSEB 4Q4AB 2C96A 1JAIA 1E79D 3SU8A 1NVVR 2DHRA 3FOZA 2QUZA 2KWIA 4TMWA 2WKRA 2R9VA 1TX4B 4JVSB 4DLXA 1EFHA 4UNNA 4BFTA 2CK3D 2XEXA 3KJGA 1NJFA 4BLPA 3QQ5A 2D62A 4JLDA 1EG7A 1T3LA 4NCHA 2ZRMA 2ZRJA 3D31A 4JSTA 5IF9A 5UKDA 1TNDA 4LJ9A 4KBGA 2ZRKA 3K0FA 3Q3JB 4HI0E 1P2UA 1XBTA 1NMZA 2FZ4A 1CXZA 1EX6A 1XJQA 4MYCA 2OBLA 3EWAA 3LAWA 5KDOA 1D8TA 1U9IA 1P60A 4HAVA 2VYFA 2ZI6A 2R44A 4E09A 4BFUA 4GL2A 3AKCA 1HY3A 1E0KA 2NTYC 3LA6A 4MRPA 3LLMA 3KTAB 4OQFA 5JRJA 3LD9A 3U4QA 3DDCA 3M0EA 3KL4A 3CWZA 1U81A 1Z6YA 2ECKA 2NMVA 1KDTA 1KI9A 4Q1BA 4RCZA 3I32A 4FN5A 1X8KA 3MCAA 4UQOA 2OV2A 3VAAA 1U8YA 2J46A 1P73A 1KK3A 1US8A 2H92A 3LXRA 1P2VA 3VX4A 4FMCB 1UM8A 2HF9A 4V0LA 2QM8A 4O0MA 4PAQA 5CJPA 4F4JA 1KI4A 5A0FA 4V0OA 1KO7A 3BBPA 3IDQA 2WMOB 1E0JA 5GJWC 2XSZD 2GWHA 5J40A 2VHUA 1XX6A 1ZD9A 2O8EB 4DCUA 3P4YA 4DDWA 3DVLA 1W47A 1HQYE 1E9AA 1XTSA 1XFAA 3I8XA 4NPHA 1NN5A 4MGIR 4TYPA 2NQ2C 3OIUA 2EVWX 4V0MA 4F7WA 5JBQA 4D4LA 1VMAA 4B48A 3EG5A 2V8OA 5TDHA 2Z5FA 4YDSA 1W1WA 2WZQA 2XNSA 4RZ2A 4M1YA 2GF9A 1KO5A 1ETUA 2BC9A 1JI0A 4NHOA 5D3MB 2GJAA 3CF0A 1SXJB 3KQKA 2GXQA 3IGFA 1OXSC 4U5XA 1FPMA 2FNAA 4S35A 1XTIA 3BB3A 1NI3A 1HURA 1WF3A 1CJMA 1XEWY 4D6PA 4EIWA 1U90A 1P9NA 4NYMQ 4CEJB 2OXCA 1IJFA 3MJHA 1N6PA 1F60A 4YMTA 4IFBA 1N6RA 2DFNA 3LW7A 3TUIC 1U0JA 2RGBA 3I1FA 1N5KA 1E9SA 3FKSD 3X1WA 2NO6A 1IXRC 2RGXA 1GRNA 3WNCA 4DCVA 1OF1A 2IYUA 4TL9A 2QGNA 4HB3A 3T1QA 1AKYA 3BJIC 3TRFA 4D0NA 1NSFA 1Q12A 5DI3B 1E9RA 2OESA 2WWYA 1OT3A 4NBSA 1IY0A 1Q1BA 2ATXA 1UBFA 4EFNA 2IF2A 4TLEA 4ZI2A 2XX3A 2P2LA 1CLUA 3GLFA 3UK6A 2GK7A 4M4SA 4NMMA 4PPNA 1UFQA 1W36B 1S9DA 3EZFA 2A5JA 3X2SA 3ZIAD 1NLZA 1G20E 3UKDA 1WXQA 1FW6A 3QKRA 2WKQA 4P31A 5FUYA 3QOFA 4II7A 1S1MA 5GADl 1HE8B 4KCGA 2JLYA 2O8DA 2OCYC 2QROA 1IN5A 3EWSA 2A30A 4AWXA 4YMVA 3B8HA 2GCNA 5B30A 4A36A 1DAFA 5CB8A 5AK0A 2VO1A 3PG5A 3K53A 4TT3D 2F1IA 1ZW6A 3ZQ6A 5A5GA 2QNRA 4IOKA 4Z1MA 2ZSFA 2ZYTX 1RYHA 2OE2A 2BV3A 5FH9A 4WXPA 1ZNXA 3K0SA 3KJEA 4WW0A 1I2MA 4QNRA 3B60A 4E22A 1CKEA 1U8ZA 2ZS8A 3UXMA 3RRMA 3T1VA 4HLUA 3U7EB 1Y3AA 3PEVA 4UXIA 4P32A 1OXVA 4HB2A 4Q47A 4B75A 1IN8A 1QG2A 2P6UA 1MO5A 5JSZB 1GKIA 5LD2C 1TADA 3TSZA 4URXR 2RGNC 3L8YA 3NG1A 4LYAA 2GEDA 3W9YA 2O8BA 2YJTD 3MWYW 2GJ9A 2WJYA 1P9WA 1X8LA 3AVPA 1AIPA 2B21A 2EYQA 3R8CA 3C8UA 2BHRA 3HR8A 2AWOA 1GTVA 2CL7X 121PA 4CDGA 4RFSA 3O8BA 1KI1A 2PEZA 2FFHA 3NEYA 4RCYA 1ZVQA 4BFYA 5KOYA 2ZM5A 1Z28A 3WP1B 5SZHB 4DLYA 3ZS8A 4DLSA 1N6HA 1XCGB 4R98A 2AKAB 4XD7A 3R9XA 4OHXA 4GRAA 2OSBA 2AXPA 3K9LA 4I1UA 3EX7C 4QHSA 5IDVA 1ZM3A 2DB3A 1FOEB 1HEIA 2CXXA 3SJZA 521PA 4P3YA 1E2NA 3VQTA 2CLCX 4CEHB 5L3QB 4POAA 4NKRA 1BOFA 4I99A 4PHHA 2QQ0A 1RKBA 2BWJA 5CK4A 3RAPR 2JIZD 1NG1A 5J4VA 4GNKA 2CJWB 1IONA 1LB1B 2ZANA 2P3SA 3KKPA 4AURA 3I4LA 4MRVA 1S1CA 4FW9A 2A9KA 4F4IA 1IQPA 4BWYA 5GVSA 3FTQA 2QPAA 3B5JA 1FUKA 2ZI7A 2GJSA 5D3QA 3CLVA 2PZFA 2ZYWX 2PLRA 5FOTA 4P4SB 4A6PA 4B6EA 4EPVA 1F2UB 3AVUA 3W90A 1DG1G 1JALA 5J4LA 4B35A 2ODBA 3GPLA 1II9A 1N5LA 1J99A 5FTNA 2XNDD 1VCIA 3AUYA 2J0UA 3GLHE 4H1UA 1HA3A 2FX3A 4TLAA 2XXAA 3EPHA 4HDQB 2PH1A 1D2EA 3OIYA 3CWQA 4OK6A 3VKWA 1S4QA 4HAZA 2FPMA 4JJKA 3GJ8A 4PHFA 1LVGA 4KVAA 5KNBA 2VP9A 3THOA 1ZM7A 2IXFA 3BRWD 1RZ3A 2ZETA 2GVZC 2ZI4A 3LQQA 2BDTA 3G5UA 5EE0A 2OILA 3N2IA 5EP2A 4BASA 4HLDA 1N3BA 1WA5A 1S2MA 2A5GA 4L8GA 1AJEA 4LY6A 2QAGC 1G291 4PQYA 1TU4A 3U7GA 1YR9A 2OM2A 1G17A 1XMSA 1U0HC 5FPHA 1XMIA 3C14C 4WZ6A 3TR0A 5J4KA 4Y0AA 5JWHA 1XB2A 1PV4A 3MAAC 4Q5IA 5JHHB 2KBEA 5KSOA 1JEEA 4PPQA 2IUUA 1AGRA 3RWOA 3AP3A 3V4FA 5FL7A 4C0LA 1WQ1R 2GETA 4MYUA 2BBSA 1UBEA 2YVUA 2IYLD 2REBA 3FDIA 4NP6A 4MQBA 2QTVB 1NNEA 1W0KA 2RH5A 2AX4A 1GILA 2A7QA 3N70A 4GDFA 4RD2A 1W7AA 1IOZA 3ZVRA 1G8HA 4IDQA 2X77A 5DH9A 1W4RA 3B78A 1NY5A 1UKYA 4WA7A 3CH4B 5EXPA 4A2QA 1ZCBA 1GFIA 4TYYA 3G0HA 4DRZA 1CR1A 4TMXA 3IPXA 4GOXA 5C18A 2F6RA 1I4LD 4MKIA 4JT2A 2NOAA 2W83A 2CBZA 5FI1B 4IDNA 4ZPXA 1XPOA 3U3MA 2IL1A 3T12A 2QBYB 2GZDA 5LPNA 1TMKA 4BFSA 3BFKA 5EZ6B 4JLAA 4Q4JA 1E9FA 4PX9A 4C4PA 1Q22A 2W6ID 4PC6A 4X8HA 1N0UA 2Z4SA 4YXWA 8OHMA 3J81k 1M7GA 1W0JD 1PLKA 2KI5A 4IFEA 4B47A 3KDSE 4LUCA 1JXOA 5LD2B 4CIDA 1GKYA 1W4AA 4MA4A 1OH5A 3P26A 1NBMA 1NKTA 4J0QA 3ASYA 1HYQA 2GJKA 3AKEA 2D4HA 1G9XA 2B7CA 3PITA 4YLGA 2XZOA 1A1VA 1TUIA 3OZXA 4B44A 1EK0A 1Z6TA 1CJTC 2C95A 3RANA 1LTQA 1F3OA 2OG2A 2C2HA 3AKYA 3IIJA 4JL6A 4Q9IA 3SJCA 3ADKA 2AWNA 4B32A 2DPXA 5DSZA 4A9AA 4DSTA 1RPZA 2ZJYA 4C2UA 2J0VA 1OXTA 2NZJA 1BMFD 3BH0A 3CIOA 3QXCA 4W5JA 1NG9A 1Q1ZA 4E5UA 1SVLA 4Q00A 1ZUIA 4DEYA 4ZDKA 2FDCA 3T34A 5HZHA 4R9UC 2AN9A 5F9HA 3BD9A 3IPYA 4XVQA 1MRSA 1P6XA 1VG9B 4LHVA 1ZC4A 1HQCA 4TLBA 1FZQA 5FR2A 3AEZA 3W3ZB 5M04A 3GLGA 1H8HA 4NYIR 4GZMA 3L0PA 1QHIA 5HE8A 2GXSA 1OFUX 1E99A 4JBXA 2PX3A 5AWFC 1QZXA 5JI2E 5KHOC 1MT0A 4Q1EA 3ZD6A 1JR3A 2GZAA 3MD0A 4TQ9A 3A4NA 3O8CA 2H17A 1F5NA 1W4BA 2C5LA 2VLIA 5CDFA 2JLXA 1QHHA 1L7VC 1Q1QA 1W2GA 2RHDA 1BYUA 3M6AA 4AIIA 4IRUB 2ZS7A 5EP1A 3IHWA 2JLUA 2WWWA 2CHVA 1HUQA 3KFVA 1ZU5A 2OUKA 1KMHA 4TMKA 4URWR 1A5TA 2F43A 1NLFA 1K8RA 4G3XA 1JEDA 3PCRB 4WBSA 1E2GA 3HU1A 3PR1A 5HZKA 4Q1FA 5A4JA 4H9GA 4R71A 2G88A 1TAGA 4BLTA 3ADDA 2B6HA 1E4VA 4US1R 1G3IA 2FMXA 2ANBA 5FUWA 1S9HA 3RS4A 2CMKA 4W9MC 4LJ7A 3SHWA 2JJ1A 4UXJA 4LBWA 4Q4AA 3Q8XB 4HDOB 3BC1A 2PL3A 1P7CA 4EJSC 2FN4A 1M6NA 3WXMA 3E5HA 1IAQA 2GCOB 3DZDA 2CCJA 2DR3A 1Z0DA 4PR0A 3T1TA 4LV6A 2NO0A 3LH5A 2QAGB 5FPKA 3RS5A 2GEVA 721PA 1MOZA 1RRPA 1EFTA 1J8YF 1FQJA 4V0NA 4CEIB 3T35A 2ZS9A 4NYJQ 4TZ0A 1R5OA 4TTQA 2XAUA 4PPGA 5FBVB 2OEPA 5BXQC 3LVRE 3QKSB 1Q44A 5FOUA 2OLJA 2QEQA 1RYFA 3K0EA 1XPRA 2ERYA 4PANA 4LK2A 4QGFA 2PZGA 3AM1A 2JGNA 3OAAA 5HKKA 1A2BA 3B2EA 3KTAA 3CUEF 1UDXA 1JPNA 4LX0A 4EQ6B 2F1JA 4B74A 1P62B 2Q21A 3TH5A 3BXZA 4M9QA 1RRFA 3GEEA 5CIQA 4QL3A 1RC8A 2IS2A 5JRZA 1AGPA 4A0HA 2ZROA 3TBKA 2BBOA 2BBTA 2CHQA 4Q66C 5JJLA 2BJWA 3NHBA 3RYTC 1ZM9A 4C0QC 4PSAA 2IXGA 1PZNA 4TLDA 3AQ4A 4JLJA 2JJ2D 1R5BA 5SZJA 5IK2D 1NMYA 3NBYC 5K8IA 4RD4A 3OEED 2XZPA 1SKYB 2C99A 3REFA 4B43A 1P5ZB 1R0WA 4BGDA 5AUOB 4MDEA 3EZ2A 1HT2E 3C5CA 2WBLC 1FFHA 3UWKA 2O8EA 3IO3A 3SQWA 2F3TA 5J47A 3VR2A 3N2EA 3ZJYA 4FXPA 4EPWA 5KSZA 1CU1A 3GJ3A 3KJHA 4TQAA 1OKKD 4A8JC 5G40A 2P65A 2OT3B 3QKUA 4ZDJA 3K0CA 3ND9A 4DKXA 2ZI9A 4B33A 1JB1A 3LWNA 5D3MA 1E1QD 4OKSA 1NLYA 4ZV4A 1FNMA 2R6GA 2QG6A 1T0HB 1T6NA 1SXJA 2GXAA 3AVVA 3PQCA 1CJKC 3BE4A 3BAFA 1EX7A 2HEIA 1OXXK 5B57C 2JLSA 5FBRB 3QVUA 3WBJA 3OEHA 4CEJA 1OHHD 1O3YA 5AJZA 2QORA 1CS4C 4KLZA 1VYVA 4Q9KA 2ZR7A 5DIFA 1YHNA 2CVHA 1RE0A 3GJ6A 1SVOA 4Z51A 3I8SA 4IHQA 4URZR 1LNZA 4JT4A 4C9BA 4MUAA 3SR0A 2LWIA 1AA9A 1J8MF 1MH1A 5E4FA 5KTYA 4N0EA 3W5IA 2JLVA 5DI3A 3TVTA 5DE3A 3U6BA 4M1KA 3RC8A 2ORVA 1CBUA 2FEOA 3C16C 1I2DA 1E0SA 1Z6AA 1KTVA 2GILA 1IN7A 5L3VA 1BH2A 221PA 2QZ4A 2FSFA 4L15A 3CX7A 3NBFA 4A0GA 1EWQA 2O8FA 2WV9A 1XJ0A 1NJGA 3EC2A 2ZI5A 4ZI3A 1VHLA 2HT6A 3VTKA 2HCJB 2VRWA 4HLQB 3RNLA 3A6PC 4XWOA 4Q9LA 1XTQA 1AS3A 2RMKA 2WOJA 1GKUB 1GUAA 2DYKA 2Q0HA 2P67A 5E7IA 4GI7A 2DWQA 2PJZA 4TL6A 4TYNA 2GNOA 2CNWA 2RB4A 1G3QA 2TMKA 3CF6R 4RKEA 2PX0A 2X19A 5AJYA 2ZE7A 4AKHA 1VDZA 3L8ZA 2FJUA 3KX2A 5H70A 2WTUA 3I92A 1FNNA 5CYOA 3WP0A 4B2LA 4Q9HA 3QY0A 1KZGB 4GSYA 2Q3HA 2RGAA 5AUQA 3UMRA 3QXJA 3ZZ0A 1NSTA 2YZ2A 2X1VA 2IYZA 4EJSB 4M1MA 4EPYA 3U3JA 1ESNA 4B34A 4PTLA 5JSZA 1K6MA 1GG2A 2EFCB 2P0EA 5CITA 4YC7A 4HAXA 3P4XA 4JBWA 4NZYA 3REGA 3RRYA 4JYCA 2FFQA 3UPUA 4MGZR 3UIEA 1D2MA 2UZIR 4DHEA 3RS3A 2FU5C 3NBXX 3I72A 1KGDA 2C77A 2IXEA 2HYDA 3GFPA 1NKSA 1OSNA 3PFIA 4HZIA 3SYNA 5JEDA 2OLKA 2H5EA 1NVXQ 1XP8A 1T9HA 3B7GA 4C3ZA 4DJTA 3U6KA 3KXLA 2GBLC 2VL7A 3SOPA 1KZ7B 1PJRA 1XMVA 1AQUA 1P2SA 4JKYA 4UNPA 5DN6A 1KAGA 3KQUA 3PUWA 3QEOA 1QRAA 2QT0A 2IYSA 2YNMA 3B9QA 4Q18A 1ONBA 4BLOA 2XJ4A 3QENA 4Q1CA 4CEHA 1OYYA 5L3QA 3DZ8A 2EFEB 1SVWA 1W2HA 4NU0A 2EU8A 2Q6TA 3C4JA 3OF5A 3GLIA 1ZU4A 2OCPA 1U99A 2Z0MA 3U60B 3BFXA 1E0AA 1F48A 1FTNA 3TMKA 4BZQA 2CJWA 1XXHB 5GJCA 1X8JA 2BJVA 1G21E 1B23P 4ZIRB 1GOTA 3ONWA 4IDOA 4TSFA 1PUJA 3QPUA 5FOVA 1YZNA 3P27A 1EXMA 1GNPA 2V54A 4MRSA 1N25A 1XDBA 1IY1A 4TTRA 2D74A 4ZKDA 4ACBA 5K8LA 4P4SA 2LKDA 2Q9BA 1F2UA 3IIMA 1OW3B 5FBLB 2JDID 1OFHA 3T5GA 4U02A 4TMTA 5FTMA 1Z83A 5KSPA 3SS8A 4IEIA 1XEXB 4LJAA 1DS6A 5LB2A 2H1LA 1NVVQ 4DIEA 4A8JB 4BFVA 4C7OA 4JYBA 1R8QA 4ZCMA 2R6DA 4KJZA 3A4MA 3UANA 4DB2A 2Z6VA 2VSOA 1VG0B 4Q02A 3NBZC 3VKGA 5E95A 2EQBA 4LJ5A 1FMJA 1SVIA 2WPDA 1R7RA 5DYIA 1NVUQ 3K9NA 2CLDX 4FMDF 3ZD7A 2O8CB 5GVRA 1UEIA 1E69A 1VG8A 3AVXA 4JVLA 3I5XA 3WYGA 2ZJ8A 1DPFA 6Q21A 3VR6A 1GL6A 3THXB 1E2KA 1T3SA 1N0VC 4B3BA 2IYVA 3SI7A 4PXAA 4PFSA 2UKDA 4EPTA 1G3UA 4I1OA 2YHSA 4JSYA 3BWDD 3QBTA 3A4LA 2D7DA 1C1YA 4LHWA 3W34A 3UMSA 5KNDA 3K70C 4OI2A 3K70D 1AZTA 1H8EA 3AF1A 1ZM4A 4BE7B 2V6JA 2VP2A 5FL3A 2F1HA 2RCNA 1R10A 1VIAA 2IF0A 3CNOA 2WVJA 3CW2A 1DAMA 3VFDA 2J0QA 4IVPA 2FE4A 3H86A 4HAYA 4O3MA 4I81A 1KKLA 3DOFA 3LFUA 3W6OA 1I4TD 1ODFA 3CB4A 3VMFA 4BLRA 2ODEA 4W5WA 2DCUA 3TKLA 1ZCAA 1KSJA 2QMEA 2XB4A 3KB2A 4AG5A 2FV8A 4L4UA 1OH7A 3LDAA 4I1SA 2XTMA 4QJ5A 1DADA 2REXB 3WYAA 1SHZA 1R4AA 4URYR 3I5YA 1N6OA 1TEXA 2D06A 4M1TA 2ZJ2A 3B82A 3HYRA 3QG5A 4DB4A 2WICA 4B3DA 3RS0A 2Z43A 3CM0A 4Q7KA 5C46F 1Q57A 1ZC3A 1ZNZA 3T06B 2YC4C 5EXXA 1FQKA 3DKPA 3ASZA 3EIHA 1EFRA 3K8YA 4B2PA 3TJZA 3ICQB 1W4CA 3EPJA 1FMLA 1WRBA 2ORWA 2O0KA 2G9NA 4D81A 1LFDB 1SHKA 1D5CA 3TUJC 2K5UA 4X8LA 2RGNA 5B58C 2EFGA 3LO5A 1II0A 3R8FA 4LPSA 5FOWA 2CE7A 3ZVNA 1HH4A 1CR0A 4KV9A 2UVQA 1LF5A 1KDPA 1ZBDA 4DLZA 1DAIA 1FX0B 4KFTA 2D7CA 2IYTA 4Q7LA 4EPXA 2OCAA 4A2PA 4BRUA 2VHTA 1CF4A 1JECA 3B9PA 5ELXA 2OO7A 3C15C 3CNLA 5EP3A 5DYGA 3VU9B 3C5HA 4EAQA 3S1AB 3PJRA 3FHCB 4ASUA 1TQ2A 3DEFA 1AS2A 4HLCA 4KSCA 4DCNA 1GL7A 2IYWA 1F2TB 2JA1A 2GEUA 3W6PA 2YOGA 1PUIA 1N6LA 2HXYA 1W5SA 2CVFA 2ZU0C 1UBCA 1VG1A 2D3WA 1PLJA 1UKZA 2WSMA 1YR7A 3TUZC 4JLBA 4MGKR 5G3ZA 4D4KA 3FPAA 5CLLA 3PEUA 3RC3A 4DZZA 1EFCA 1W44A 3IQWA 5FPTA 2Q9CA 3RHFA 1GDDA 4LBZA 4OI0A 2BMJA 4DVGA 3VHLB 3FMIA 1EFUA 4NL4H 3HDTA 3D6TB 3I61A 3F3YA 2EFDB 1P75A 2G77B 3AH8A 3QUSA 4CW7A 3PEWA 2WOOA 5AJVB 1D6JA 3U44A 2QP4A 2WIBA 4V02A 3CONA 1C4OA 1WDTA 4A2WA 5DNYB 3A1TA 1G7RA 4NCIA 4CZ2A 4C0SA 1GSIA 3K0AB 4LCBA 4Z1MD 3CZQA 5C1BA 4ITRC 3M1IA 4K8OA 2BOVA 1Z2AA 3EZ7A 4FMDB 3N5CA 4WIAA 2NZ8A 4V0ME 2W2TA 3LVQE 4EPRA 3LBHA 5IT5A 2D2EA 1G8FA 4HLUC 4Q48A 4LGMA 3NWJA 4KLNA 2Z83A 3KXIA 1IY2A 2GCOA 2GESA 1G5RA 4H1VA 3AVOA 5LBIA 2QL6A 4BLQA 3K09C 3U2QA 2QAGA 4XVUA 1M34E 5KUTA 3KFXA 5FOSA 1ZINA 4CEIA 3B1YA 1OJLA 1G6HA 4RD0A 4PAMA 1ZJ6A 4OBEA 1MO6A 2ZRFA 3K0FB 3SJAA 1Z63A 3OHMA 3NC0C 3KKQA 3QKSA 1KI7A 2J87A 4LYHA 1G6OA 5F98A 2QE7A 4LJ8A 2IEZA 4HAWA 3E1SA 1DOAA 5FR1A 4OI4A 2RGEA 1HV8A 1R0ZA 2QA5A 5AUPB 3SHFA 2JLQA 2NPFA 1XZPA 4M53A 3ZYCA 4XD7D 1G5PA 3U4QB 2FOLA 3ICEA 1LV7A 2QRNA 4JMPA 5FOXA 3L2OB 3PUVA 4BFWA 4WXRA 5GJBA 4DXAA 1E2QA 2H8KA 3LX5A 5KSYA 3M4YA 2AD1A 4Q1AA 4E07A 4KFRA 3GLFE 3KZ1E 3BS4A 1RW4A 3GMTA 4KHZA 2ZRGA 4ESHA 4PHTA 4LWZA 1US8B 3B1ZA 5B64A 3AV0B 4BUJA 1IN4A 4LJ6A 1T5IA 2V1XA 4JJZA 4NH0A 4LJYA 2GZHA 1YJ5A 2J1LA 1JNYA 3MSXA 2PMDA 3UWOA 1G1MA 2YINC 3GJ7A 3CBQA 5EP4A 1KYIA 3I3SR 3SBDA 3EPKA 1KIMA 3LLUA 5ANRB 2GJ8A 4NDZA 5BYJA 2XITA 1UKEA 1G4UR 3QIAA 1SULA 2C04A 2WMNB 4IOLA 4M8NE 3QEJA 4LJ4A 4D82A 1CRPA 4PZZA 2J9RA 3CRRA 5HCNA 3CRW1 1XCPA 1G8YA 3H0KA 2FZLA 2V4ZA 3CO5A 4QBIA 4X8OA 1M7HA 3HU3A 1Z47A 1G7CA 1A82A 3GFOA 4OYHA 5JS7A 4TL7A 2C78A 4YMUA 4PSVA 3JZMA 2VF8A 2HLDA 4B3FX 3E70C 3WYFA 3BOSA 4DDVA 1SZPA 1SKQA 3TW8B 3CPEA 3TQCA 3W8NA 4Z8XA 4DLRA 3MWLA 3GLHB 5LDDC 2YKGA 3BORA 1Q20A 3ZVMA 1OLOA 3B1XA 2HT1A 2J0SA 4C30A 1KI8A 2HXSA 1VYUA 1OIVA 3FGNA 3LXXA 4QM6A 5JWRA 4N0DA 2CLSA 5JHGB 4QM7A 1COWA 2W6JA 2ZQ5A 2X8AA 4UXHA 1KSGA 3IUYA 4AY2A 2P6RA 3SC3A 3AKDA 5JJIA 3LBNA 3AF4A 3TAUA 5E3HA 2L0XA 5FL7D 2HDNB 4OQMA 3Q7PA 4LZZA 1P9RA 2J45A 3MG9A 4XWKA 4EFMA 1W0KD 4GOKA 3GP8A 2ZUBA 3PVSA 1Z07A 1KDRA 1ZAKA 5FTLA 3AVTA 4LV5B 4RZXA 5TV2A 4DLVA 2I1QA 5AR1A 2ZUDA 3GEIA 4M9XA 4TYQA 2V1UA 1G7TA 4KBFA 2CE2X 2IHYA 4KU4A 4OQNA 4WOPA 1WB9A 5FUVA 4OK3A 1BYIA 4MGYR 1XJCA 2QPTA 3P1JA 4GMDA 4KITB 1OH8A 1HE1C 3DL0A 4AK9A 4DT1A 2YC2C 3VHXA 2I1VB 4FWIB 1Q21A 3HP1A 4JIMA 4PSKA 1Z3IX 1RFLA 1Q3HA 4ACAA 1T5LA 5AJXA 2QP9X 4LHXA 4LSGA 2ZREA 5FBWB 1E2JA 1EGAA 4DWJA 3RSLA 3HYTA 1XNJA 4UNSA 4YXWD 4TZ6A 4LC1A 4EJSA 2ZRBA 4OI1A 1VCNA 5BN3A 1DBSA 1DAEA 4B3XA 2ZR0A 3MWJA 5C2JB 4P0TA 3A1WA 2QAJA 4DSNA 3FMPB 1NBMD 5IRCD 1UF9A 2DBYA 4KVGA 2E87A 3CZPA 1SVMA 1G4AE 1P61B 1MR3F 2EFHB 2W2VA 1OIWA 2WAYA 1P2TA 1U98A 3ND8A 1G41A 3WNBA 1L4UA 5BW8A 3HJNA 1IJEA 1UEJA 2OHFA 5CJ2A 2OFOA 4B2IA 4CF7A 2MMCA 5JMTA 1MABB 3WMFA 2W58A 1KK2A 2QMOA 3A8TA 3RRZA 1ZIOA 4PC7A 1JQJC 5J4YA 2AL7A 2HCBA 2WJVA 2O5VA 2NO9A 1VCMA 4GP7A 4NYIQ 3DMNA 4PHGA 2OAP1 3L43A 3CR7A 4QHYA 4JLNA 5BYKA 3SDZA 1NIPA 2HV8A 4F92B 2REOA 1H8HD 2E9SA 2GTPA 1TF7A 2GF0A 4DLUA 2NG1A 4KI0A 1OV4A 3EASA 2FPLA 2VBCA 2AK2A 1KI6B 1XXHA 1DO0A 2A3RA 3NEJA 5B2ZA 4F38A 3F8TA 2FFBA 4ZIRA 2G3YA 1JR3D 1SVKA 3I73A 1C9KA 4KODA 1U94A 3A37A 2G0TA 2H18A 1AS0A 1K5GA 2HJVA 1OYWA 4IKEA 3AP1A 5E7JA 3ZZUA 1S3GA 2GDJA 1UAAA 4JLOA 2WSSA 2O52A 4A15A 4LI0A 2PMKA 3W6NA 1N2CE 3FFAA 4L5BA 1BKDR 1XEXA 2WAXA 5EZ5A 2V3CC 4A8JA 3EZ6A 3TIFA 1CTQA 1S96A 1P72A 3A36A 3D7MA 3ZLJA 4XOIA 2IEYA 2VA8A 2JLWA 4IJMA 2IBMA 3QF4B 1E9BA 3OFNA 3P32A 5CYPA 2JJ1D 3LV8A 4FWTA 2X2EA 1TQ6A 4IVQA 2JASA 2O8CA 2VQSA 1Z5ZA 3SZRA 1MRNA 5FBQB 3TK1A 4Q03A 2ZRAA 2WJJA 3CH5A 3F5FA 3PUYA 1NBME 3X1YA 3THXA 4JLVA 3QKTA 3D8BA 1QVRA 2RHMA 4MITA 1YZKA 2QENA 4D4JA 2V7QA 4DUGA 3MMPA 2XZLA 1HTWA 3VR1A 4F4CA 3L0IB 4EUNA 5TY0A 1YZQA 4LYFA 4D2IA 4IOMA 2WKPA 3CR8A 1AN0A 3HPRA 5FTKA 3TW4A 5HPYB 1GWNA 1F6BA 3THWB 1VPLA 2C9OA 4TTPA 3AVYA 2G1JA 3CF2A 3WMEA 2ZJAA 2OCBA 4R2HA 4Q21A 3K9HA 3R7WB 3OAAD 4HUTA 5DISB 1T0JB 3UG6A 3VX3A 5HKKD 3AGPA 4G01B 4MUBA 3LX8A 4F93B 2P5TB 3FFBA 5C4GB 1A2KC 2V9PA 3QNUA 4PAOA 4QHTA 3RWMB 3VNUA 4A1FA 3JZAA 2ZI3A 3DO6A 3GLGE 2VIIA 2YYZA 1H65A 1EESA 2IYQA 2KBFA 4PC1A 5SZIA 2ONJA 1T4GA 5JWOA 5EXSA 1RRGA 2MSCB 4NE2A 5BWMA 4RZUA 2NO7A 4US2R 1JR3E 3FWYA 2RGCA 4C0AC 1XPUA 4IOJA 1E2MA 5CDFE 5FPSA 1E4YA 4MYHA 3FB4A 1G3MA 2ANCA 2GAOA 4HYYA 3KKOA 2YWEA 3SQXA 5J4HA 3ZZTA 3CRQA 3L82B 4G0NA 4P33A 2A2ZA 4JVMA 2CCGA 3UATA 1U2RA 2DWOA 4RKFA 3SFZA 2ZAMA 3QG1A 2XOKA 4OK5A 3ADBA 2FSHA 1UPTA 3FMOB 3QBVA 3V00A 4DUGD 1JBKA 2ZSEA 2ZITA 1ZUNB 4Q01A 5L3RA 2VP5A 2I4IA 3WRXC 1R2QA 1YRAA 1GP2A 1YR6A 5JJKA 3K0CC 1ZD1A 4Q4HB 1G8PA 1Z06A 2X2FA 1G8GA 2KSQA 1E2IA 4ZKEA 2Y8EA 3H1TA 4E03A 2B7BA 1WE2A 1FP6A 3EA5A 3IIKA 3TR5A 1SXJD 2FGKA 2ZVQX 1E94E 3LBIA 4GFDA 3OE7A 2ZYVX 4TN1A 4EKDA 1NRJB 1KAOA 1QF9A 3IHLA 4LDJA 4W7SA 1TL7C 3THYB 3OEHD 1X3SA 4HUQB 2JJ8A 1FX0A 3AUXA 3IO5A 1NP6A 2ZAOA 3K1JA 1DEKA 1DAHA 1G19A 1V43A 1E79A 3VU9A 4LV8B 5KPJA 3S1AA 4IEEA 1DG3A 2IW3A 1KJZA 2JLRA 2CK3A 1KHTA 4ESVA 3FHTA 2R65A 4XIGS 4DSUA 1YZUA 1E32A 2HUPA 1IXZA 1XRJA 4HEJA 5FI0B 1ELOA 3H2YA 3RS2A 4GOJA 5C4MA 1P3JA 2N46A 2C9CA 4Q4LA 4BEBA 3KXKA 1AZSC 2ZYUX 3AF3A 1W36D 3BERA 1RRCA 2EW1A 1Z0JA 1OE0A 4A92A 1GRQA 4P4TA 1D9XA 3AB3A 2QT1A 3Q7QA 5DHFA 4CT4B 4DCSA 1V5WA 4K81B 1W49A 4FCWA 2QSZA 4JLMA 2PT5A 2N1BA 3ADCA 1W48A 2QQEA 4MH0R 2CNWD 4IDHA 2F1RA 3TSOA 1DAGA 2O0HA 3MLEA 4YMSA 3K0AA 2AD5A 4LC0A 4OQLA 4WVFA 4DSOA 4TMVA 2W00A 4UNRA 2XTZA 3B13B 3EZ9A 3FMFA 3NH6A 5BN5A 1CJUC 1N6NA 1TQ4A 4C0JA 3MFYA 4PQRA 5P21A 4URUR 1E98A 1T8UA 4B71A 3U3OA 4PC2A 2QRZA 4CYMA 2XSZA 2XJ9A 4Y0VA 4BEJA 3W3AA 2WJHA 2OBMA 5EXTA 1SXJE 5G41A 2SHKA 4UNQA 2VSXA 4QG7A 2IWHA 1T91A 4YQFA 3BFVA 2HF8A 2VSFA 1XTJA 2BIFA 1M8PA 1S0UA 1LS6A 2ZSDA 3GCGA 5JCZA 1G7SA 4ARZB 2ZSAA 1GVNB 1D2NA 4JZKA 4LOAA 2PLFA 3VR5A 2WWHA 1X6VA 3AF0A 1CIPA 1E96A 1WMSA 4FMBB 4C0KA 2AFHE 1IXSB 2GRJA 2ZXUA 4ERNA 5DN6D 4S2EA 1RJ9B 4L16A 4PZYA 3H4MA 3EARA 1L4YA 1XD8A 3D3QA 3FYHA 4Z54A 5JEEA 4MKFA 2JATA 3MUFA 1TF2A 1E3MA 1ZMXA 1OB2A 5HTKA 2GHIA 4UJ5A 3PEYA 5G53C 1WBBA 4JL5A 1R6BX 2QI9C 4NTZA 3FKSA 821PA 4RZ3A 3EXAA 5L8VA 3NHAA 2MSDB 4FINA 1S3SA 4NYMR 5EE9A 4M9ZA 4EDHA 4LYJA 1IM2A 4PC3A 1QHNA 2HYIC 4OHVA 2JAQA 4XH9B 3MJRA 2ZSBA 4QBHA 1U9IC 4YDHB 2ZR9A 4TSFD 5LB4A 1QDEA 4XSHA 4KFUA 4BRWA 3DM9B 3UG7A 1LY1A 2BKUA 1G64A 1T3HA 4KAXA 4YMWA 3QXSA 4RD6A 5JS8A 4I4LA 2WWXA 3VKHA 3ZIAA 4M9SA 3KJIA 1SGWA 2IT1A 3WBKA 3TVDA 2H16A 4NONA 4DEXA 2VHCA 1VHTA 1XU4A 5DGXA 4M22A 2R6FA 1X1RA 2WPDD 3O8DA 5E7MA 3W8RA 1E2LA 1CR2A 1M2OB 4Q9JA 3ZGXA 4BZPA 2ZEJA 4TT3A 1QHXA 2QBYA 2KB0A 1R0XA 1JXMA 2B92A 4A4DA 3U7FB 1P4SA 3KQLA 2QY9A 4DLWA 3WHKA 3GLHA 1FUUA 2F7SA 3CRVA 5CK5A 3TSWA 4KYUA 4F91B 5CM8B 4HSEA 2H57A 1ZD8A 4TWZA 3ZS9A 4URVR 4KO8A 4AYWA 3SE0A 1NIJA 1OPXA 1Q1EA 3RSOA 1H8ED 4XSGA 1KNXA 3SYLA 3B85A 1D9ZA 1II8B 2A78A 3P20A 3O8RA 4O2RA 4OHWA 5HE9A 3ZVLA 2RGGA 2O8FB 1R0YA 5EQTA 4CRWB 1U0LA 2AK3A 3B1VA 2IUSA 3GLIE 3PENA 1GM5A 4NCNA 1VCOA 5TB5A 2CEAA 1O87A 1J70A 1JAHA 4ILEA 4ON9A 4TQUS 3UMFA 2WJIA 1EWRA
chains in the Genus database with same CATH superfamily
1SB8A 2PMBA 5K9ZA 4QGHA 1GGHA 3VNVA 1P7WA 1FSSA 2EP7A 3H2GA 2OECA 4QVKA 4YEDA 3IE1A 1HDYA 4BNHA 3CS3A 1XNGA 4UAUA 3UK1A 2PCLA 4RTPA 4F8EA 5ISMA 5TQVA 5KU1A 1FEZA 2GA8A 3ESQA 3H75A 3QVVA 4FFLA 4GWLA 2A5DA 1DDIA 1T3ZA 1QORA 3ETLA 4FDVA 5CHYA 5C5CA 5BQXA 1I13A 4QXRA 4RGYA 4Y1FA 4XDGA 3RJTA 4UNIA 3C6XA 2VP0A 3QX9A 1U1FA 2W8BB 1XD2B 2WSYB 3D8NA 5BW5A 2DHDA 2Z6QA 3HB1A 3RG8A 2WTMA 3N0VA 1IN6A 1B2LA 2OGWA 3K09A 1Z29A 5CVDA 5F5NA 4M8SA 2QM7A 3TG8A 4FIDA 1QHYA 3DOHA 1ZM2A 4DUZB 3DDZX 2FDRA 3Q85A 2BCEA 4L3VA 2G1KA 1NR7A 3FI0A 3O9MA 5L3SB 3E2IA 3MTJA 1WABA 3SX2A 1DQNA 3ZGZA 3PGMA 4MW2A 1LS1A 3U5TA 2HWWA 1LX6A 3UFBA 4JXXA 3PUJA 1CULC 1RTTA 1RPAA 4OHZA 1D4AA 2BCGY 5EJEA 1CNFA 2LCFA 2IZ0A 2YZGA 4GBMA 4EJFA 2BBWA 3V2UA 1TU3A 3EVGA 3VV2A 4D80A 4LZNA 3NALA 3FYCA 5JASA 4FR5A 4C21A 4HDKB 1ZUWA 4LYEA 5H02A 3UXEA 1ADJA 5ICCA 4ZOLA 4QFMA 1DC7A 3V46A 3D1JA 1CEEA 4UU8A 2W0MA 2FP4A 5F52A 5T6MA 5A4MS 1BIFA 3K1ZA 4J07A 3F4BA 2J9XB 5K0SA 3IDSA 1EVJA 1WPRA 4W4TA 3RUFA 1RRKA 5KTMA 3AO0B 3EGVA 2C2YA 1UKAA 1SIOA 2ZR8A 3U3KA 2F8SA 2JHAA 5CTAA 5AW5A 4B87A 4LZJA 1RC1A 1Z0AA 3HB4X 5FLXA 3VR4H 4LYGA 1J7KA 3F6YA 1P8JA 1WW8A 3C7KA 4QVIA 2E2WA 3CTPA 5EE1A 1YL5A 2CKDA 4HTFB 4Z49A 4CWAA 3FSJX 4KNYA 1LQUA 3IX7A 2QQ5A 3KOYA 2VQ3A 1O94A 5E6RA 3GJXC 2HRQA 5B3JA 5TEWA 4MX8A 2AZXA 3H16A 5I48A 5FTJA 4AJPA 1I4EB 2HW8A 1BRTA 1ZRHA 2OBNA 3RABA 1EBBA 2C5AA 3B3AA 2SKEA 4ZOLF 3DL7A 4HXGA 2HJHA 1BFKA 3D59A 4HF7A 5FULA 3USES 4EFKA 3CX6A 1HYHA 4Q7MB 4DSNA 4MW5A 2GK6A 2N0SA 5I5EA 1N2OA 2FSIA 1U8UA 1JV2B 4D0LB 4OL0A 4E5MA 4ENVA 1NMXA 2Q6IA 5ENDA 5EWMA 4X84A 1YUMA 2QV7A 3CEAA 2LW7A 2ZT8A 1NUUA 1YAHA 1QAOA 2CDAA 4L6AA 5H4HA 3ECCA 2R5NA 1CJVC 3A3NA 4RHTA 3M81A 2O23A 1V5EA 2NTVA 1J5PA 3BTVA 4JLPA 5HILA 4A6EA 4H1TA 3L4BA 1JPJA 4LPKA 1K5PA 2VDRB 4H3HB 4RTMA 1DX4A 2O0MA 1XWWA 2H7VA 3WGOA 1RRVA 3K6RA 3ENVA 3HGQA 4KXLA 2BYTA 3ZDCA 1P7VA 1XKTA 2ID4A 1A9XB 1Y42X 4O08A 2AN4A 1JS1X 1VA4A 1KYTA 2CL0X 3NFYA 2AG0A 5TPWB 3P2MA 2PJRA 4WADA 3E9DA 4R05A 3SHVA 1RXYA 2R68A 2HFKA 4NQZA 4F46A 3RVJA 2IV7A 2ATVA 2C9DA 4RVCA 2VJKA 5TSDA 4XPIB 2NIPA 3QEKA 3L0OA 1UKVY 4G5OA 1USGA 3D6JA 4JB2A 3R7WA 1M34B 5A6SA 1YWGO 5JECA 2E5WA 3GIWA 1X15A 1H5QA 4LNAA 5C52B 3AL0C 3ZQJA 2HSJA 1L0BA 1UK7A 3A1NA 2MMGA 3JWJA 3ZN2A 4YRGA 1RXVA 1SQ5A 4QEKA 1QIEA 3GNQA 4RY2A 4E22A 2W2LD 1HE5A 1BMFA 2Z4TA 3B3QA 4L8FA 5CA1B 1M76A 2ETVA 4J4TA 2AG1A 3BJMA 3OJLA 1I2AA 1OC4A 5TARA 3ZG6A 3ZGVA 1U8AA 4M2LA 2QF7A 2IHBA 2CDBA 3LCMA 4Y0NA 1BVRA 4MWCA 5ALKA 1E1RA 1PT7A 3ZIDA 4K2AA 1JH9A 4N40A 4ZYTA 5IM4F 2OHVA 1N5JA 2VHQA 2YDXA 1XDUA 3P9SA 2X23A 4GT1A 2IP4A 3G5MA 1L1RA 2FPPB 4NMXB 4OXKA 5CJJA 4HQNA 3RAGA 4LKRA 1BXRA 2BEUA 3NEPX 4EB6A 4B73A 1CHNA 1FP7A 1P2FA 1XVAA 1Z0ZA 2X0RA 1ZUD1 3CLSD 4FCVA 4LI3X 4MYTA 2C3MA 5ILQA 5DXAA 4BIIA 1MO4A 3GLFB 2Q29A 1NP7A 2I62A 1VTKA 4INJA 3P9PA 4RVDA 2EWWA 2ZOSA 2Q3MA 2QGFA 5ECWA 1G3RA 2C3OA 1E5DA 3DFZA 4N47A 3RTAA 4MQEB 2BL4A 1YHZA 5KMGB 3PQ5A 1K6EA 3L7KA 2YHIA 3Q3CA 1R4MB 5DNUA 4UPEA 4ABYA 1B00A 3KK0A 3FUUA 1ILWA 2VYCA 2O5EA 3I9V1 3A27A 4LJSA 1XZQA 4X20B 3G9ZA 5D84A 2CCKA 2WAAA 4PIVA 5HSGA 1TZBA 1XTRA 5H8WA 3GPDG 3EW7A 3W4JA 3QVWA 4A26A 3EW9A 4G5GA 4YGYA 1C5KA 4NCJA 3WY9A 3UUEA 1DIBA 3BFJA 3CLRD 3IQDB 1K63A 4KYTA 5E1DA 3PWTA 4G07A 3AR7A 3W1EA 2ZUUA 3BXHA 1VPTA 2K2WA 4PZEA 1RZRD 5DW3A 5CVJA 4CG0A 4ZGBA 2OA0A 1A7JA 3WDMA 1U2TA 1JHAA 3JZIA 5HR5A 6NULA 2ZE6A 1V7QA 4JR0A 3RS9A 3QE0A 1VI2A 4QECA 4FFNA 4Q6WA 2GH1A 2HJSA 1U8XX 4NPCA 4WOKA 5C31A 2C9BA 2ZRDA 3M1YA 3RU3A 3HKBB 2PIAA 4FKBA 4CODB 2ZPTX 5AHOA 2O8BB 4EABA 2CNOA 2DHQA 2H52A 4CN8A 1JAZA 2XVYA 4XX0B 3H9CA 4Q1DA 4YK7A 1QP0A 1M74A 3F71A 3TNFA 3E9MA 1KNQA 4D0GA 1AK1A 2A0XA 2GFHA 2C4VA 2PCJA 2DX7A 2X3YA 3EEIA 2ZRHA 1UDWA 1CF2O 2I78A 2WAOA 4OYRA 5CIWA 5BRAA 2CL6X 5EKTA 4RAOA 4F6RB 3AR8A 2PL9A 1V4VA 3E3AA 4G5RA 2WLSA 1DV1A 1E6WA 3FD8A 1XCMA 4NYJR 1YQTA 3TLXA 3U3RA 3E22A 1OV6A 3PRHA 1YZGA 4HBZA 4NARA 1WPXA 4ES6A 1L6IA 2CD7A 2O0JA 3G1WA 5DBGA 1MDFA 2WI8A 3FZNA 3IA2A 1KQNA 2H63A 4O2LA 2V55B 4BX3A 3R9XB 4J76A 1QK4A 6LDHA 4D4IA 2UZ3A 4CLOA 5DYNA 4RGVA 4D3YA 3GI1A 3DD5A 5ALYA 3VDRA 1YZVA 4Y6RA 1Z75A 4RJLA 3MBKA 5DLDA 1ESMA 1I4OA 3FTCA 3HA5A 5AJWA 1PWXA 2QVBA 1E4OA 2DPGA 1HT0A 1GITA 1KP2A 1R9GA 4MHTA 2HWUA 4G5FA 2ZRNA 4GR9A 1ZGZA 3B12A 3ZKAA 2ZJBA 2JJ2A 5FUQA 5IHXA 5IK2A 4GH5A 1UJBA 4CKBB 3BZUA 3FNIA 4V1CA 3EAQA 2ASEA 2QZZA 2EXXA 1G16A 3CLUC 4A6XA 5FWNA 3BB1A 5H3LA 3JX9A 3PNYA 2RHJA 3GLKA 3C7DB 1ZIPA 3PDWA 3NRBA 2X0FA 1O4VA 2FZKA 3LT5A 1DAPA 3O9VA 3BN3A 3RFXA 2J09A 3NJ8A 4RHFA 1XKLA 2Q1XA 2X4GA 4RWEA 1A72A 2FX2A 1XE3A 3D4IA 4TS3A 4BNNA 1HG0A 1MO3A 1CUSA 1R0BA 3B1WA 5CB6A 4PYKA 4XIIA 1Z5VA 3LY5A 4ARZA 1YUNA 4MR9B 5KB3A 4YHHB 1E6UA 4AB1A 1SC6A 3PHCA 1DKUA 5DIZA 2UVPB 5HF6A 3TYXA 4YCLA 1SB9A 3P5BA 2BM0A 1Q19A 3NW9A 4A2CA 5IHPA 3INYA 2JJMA 1JFFB 1KARA 2VJBA 2AYXA 3IEVA 2P3LA 4ZQFA 1FCJA 2CN1A 5IT4A 3ES9A 5LU8A 1E3EA 2Q3DA 2VDOB 1RJ9A 4UU0A 2QDKA 3OT4A 3Q98A 4IGIA 5JPIA 2W2OA 2QRJA 3BULA 2COEA 1BXGB 3T7KA 4DDUA 4N0MA 4YREA 1ZRSA 2QE6A 3LZDA 5K4AA 3BGWA 3GJ0A 3LOUA 1HM5A 3UAGA 3UAVA 5DGHA 4B3GA 2FGJA 1Y1KE 4X93A 2IS4A 1P4GA 2X4IA 3IC5A 4HGNA 2JAXA 3EFEA 4I8IA 3S99A 4BMXA 3K5PA 1S5PA 3G5TA 3SKYA 4J6EA 3IEKA 2CWDA 4KXFB 5DYTA 4EECA 1OVGA 1V1JA 3T9AA 2DQYA 4C0HA 4ZQEA 2QP3A 4LHYA 4F4FA 3QOXA 2R6AA 3FSGA 3RRNA 4HXEB 1PNRA 1JZTA 1XFDA 2NNWB 3K16A 4FJ2A 3TGPA 2V0CA 2X76A 4UUOA 3URKA 2ZBUA 1F1JA 1CUJA 4GM4A 4JX8A 3SX4A 3WO1A 4ZJUA 2HZBA 3NOXA 3EZNA 1JR6A 1E9DA 4BNDB 1YK1A 2AMYA 1LDEA 5TXGA 4X1YB 5LVAA 4DWWA 1G21A 2GVDC 2PV7A 4ZVUA 3MHTA 2F3UA 1VDMA 3BH6A 3NWOA 1GZSA 2VF5X 3LUFA 4H08A 4UAJA 3U19A 3F6BX 4HJXA 2JEOA 3W5SA 4G0YA 3U80A 1C9JA 2XYRA 4A0SA 3MZ0A 1VJRA 1BDIA 1WSWA 1DKLA 3PWKA 3O2NA 3X1ZA 4EMUA 4DILA 1E2DA 3V34A 5B2EA 3HNPA 4M1SA 2PX8A 1I0IA 5JI3E 2Z08A 3TLEA 4ALJA 2WZCA 1XD9A 4XGQA 3DFMA 4WD3A 4IM7A 5JSFA 3HYNA 2WVGA 3OO1A 4F5WA 1VMEA 1RAHA 1GL9B 1J8QA 3DJYA 2XTNA 1H0RA 1SHTX 3GT0A 2FW6A 4IDFA 4HPWA 5J1TB 1KJ8A 5KQRA 1REQB 4G5QA 4Q4JB 2H5IA 1BFDA 4ZMBA 1NRWA 1YS2X 2VWGA 3AG5A 3F6PA 4I9UA 4QXAA 5SYNA 1HKHA 1ZNYA 3C2QA 3SHTA 1O7JA 5LZ4A 3RVBA 1QZZA 1TPZA 4CV1A 3EGEA 3AONB 4MQ4A 5BSKA 1QF6A 4RJ2A 2ZE5A 3FUXA 4GPD1 1QRUA 3GHYA 3QBJA 5FUXA 4MRNA 3T4EA 3CNNA 1GTZA 4A6DA 1SXJC 2QTGA 1ZR2A 3MWKA 4JBGA 4K46A 4YRTA 1Z2OX 2PEYA 2W6CX 2V9CA 4AYTA 2QZJA 3OPXA 3KKMA 4FI3C 1V11A 4WLFA 3CCCA 3EJWA 2FUNB 1NQWA 4FB5A 5BV8A 5IWCA 1MVOA 3H7IA 4L1KA 2ODNA 1EHYA 3GFTA 2X0EA 3HJUA 2GBLA 2P9GA 4BFZA 4DHWA 3OCXA 4AWAA 4AULA 4KI7A 1DXYA 3KUUA 3DP7A 4WNIA 4YCAA 3P9CA 2XHZA 4JL8A 2JEZA 2YOHA 4LBVA 1WMDA 3JATB 4RNCA 4U7HA 3DTNA 1LSJA 1MAVA 2DPMA 1AKRA 1T3GA 1UAYA 1UT8A 1QNLA 4CNBA 4Q3NA 4UE6A 5IKXA 3AGQA 1R6XA 2WP8J 4PVDA 3TOSA 4D8XA 1EX9A 1VGQA 3PIRA 2OAQ1 1JZSA 4GZ5A 5PGMA 3KKKA 2W4MA 4TV8B 3PXGA 2VF4X 3PFGA 3CYFA 4TLMB 3VDQA 1WUTA 4QKQA 4AKEA 1LUAA 1TCAA 4S1TA 3NXSA 4PONA 4MO9A 5HKOA 3GLTA 5LMUB 2A1TR 3I9JA 2B8WA 3GGGA 3IR6A 4D6XA 3TSAA 4DCTA 1R5NA 1D1PA 3G0DA 2LBPA 1FDWA 1TIBA 2BFMA 2PLNA 1KMNA 3NS7A 4QNMA 2VHYA 5B3AA 3VR6H 1M3SA 3X43A 3KQHA 3WAKA 1XEFA 3AR4A 2F43B 4ZANA 4QUJA 4Y9UA 2K7FA 1ZSVA 3HY4A 3GAAA 1NW7A 2XQFA 3FW1A 4IS2A 4LBYA 4D9BA 5AW0A 1XCBA 4A5OA 1EFDN 1JQDA 5B7NA 2L42A 5LOVA 2KE5A 4PNHA 5C5EA 1HDXA 3A9TA 1YI1A 4IRXA 2BRUA 3VZRA 4BB9A 3DKVA 2Q8NA 2X42A 3DXFA 1JQLB 3GEHA 1AZLA 3NTUA 4IJ6A 4LMBA 4PIMA 4WPGA 2QGZA 5KNDH 1S8OA 3V1NA 3D64A 1E1DA 2C96A 3SU8A 2Q8PA 5IABA 4CUKA 1KXZA 3JCZA 2KWIA 2OHIA 5DCUA 3ZKWB 1JW9B 2WKRA 3DWFA 2H4WA 4JVSB 5CPBA 4C7JA 1KJQA 1QXSA 2CK3D 3AHHA 1NJFA 1T6BY 4BLPA 2D62A 1P5FA 2I2XB 1ZRMA 4NCHA 2AW5A 2ZRMA 5AVJA 3TRJA 5CDHA 3B1KA 5IF9A 3TZQA 5IH7A 3K72B 1YQUA 1M75A 2VT7A 4LJ9A 1CIVA 3LUCA 5AOVA 3ZNPA 1NBOA 4X94A 3VU1A 1KOLA 3NCHA 2FZ4A 1CXZA 3V7FA 4MLPA 1TT5A 1DZIA 2Y1WA 5E1BA 2OBLA 4U39A 3WE7A 3LAWA 4G6ZA 3ANSA 1RYEA 1CUHA 3OLVA 1ZESA 4HAVA 5DNAA 4UUBA 3R7DA 1NM5C 2H2FA 4LZAA 3VVMA 2OO5A 2J48A 1EFPB 3QEBZ 4GL2A 2AR0A 1IBLB 4I4TF 5FAXA 3C97A 1E0KA 3SQOA 2NTYC 4LF7B 3OM9A 4OB8A 1VPWA 2ZP1A 3LLMA 2IYPA 2J9GA 3LD9A 3KM0A 2ZB3A 4UCWA 3ZQKA 1DEXA 1P3DA 3TLZA 3M0EA 3KL4A 5ECYA 2IYNA 2V0NA 1B16A 2NWQA 4EATA 1Z6YA 3O9ZA 4LEIA 4OL9A 5DEIA 4I2NA 2FB9A 2EKPA 3HKCB 1E20A 4ZCPA 3IPRA 3A1CA 1W35A 2CLEB 3U17A 1CVLA 1K3TA 1DQPA 1W4LA 4UQOA 5KS2A 1CE8A 1GR1A 1U8YA 2J46A 2VJPA 3MOIA 1P73A 5HK9A 2QRUA 1H85A 1KK3A 3EVTA 9MHTA 4XDHA 1P2VA 3FIJA 3Q1KA 1L5OA 2G72A 2XUGA 4G9BA 5CTJA 3STXA 1EGMB 3EVDA 1N2XA 1UM8A 5E4TA 1IUOA 2JJQA 4FFOA 2VT2A 3WGZA 4TWAA 1FFAA 2NYUA 1RD4A 4F4JA 5KWIA 1KI4A 3CLTC 5A0FA 1WW3A 1XNQB 2ZB2A 3KVOA 3QKWA 1U7HA 2X0KA 2ZATA 1O95C 3V4SA 5J40A 3W3AD 2VHUA 2OZPA 1GG5A 1USUA 1W47A 1J0BA 1KDZA 2QSUA 3DLPX 1A7KA 4H7PA 4KWCA 2PTHA 4B6QA 3QEAZ 4OJYA 4LOLA 4TYPA 2PNJA 1N36B 2PUFA 4D4LA 1FYWA 2Y2UA 3NUZA 5TDHA 4YDSA 4EGFA 4J90A 5LCXA 3U09A 4YCNA 2PA0A 3UGJA 2BC9A 1ETUA 1JI0A 2ZIVB 1E7SA 4HWPA 4KPUB 5FV7A 5LWHA 3ZJTA 1BJRE 3N8KA 4HH3C 3AI2A 1BZYA 4DQLA 2VNHA 4YRBA 5HM8A 4S35A 3NAQA 3QPCA 5KTTA 1HURA 1WF3A 1XEWY 2DR0A 2ZG6A 3IMEA 3EEFA 1ZY2A 2HU5A 3MS7A 3NVMB 2PYZA 4EVQA 1GXSB 1PT8A 3DLAA 3ILVA 3WB0A 3DV0B 4DA6A 5B7QA 5JXJA 4IJUA 2DFNA 3BWCA 4HGPA 1T13A 4L7QA 4RK0A 3HEBA 5G0TA 2G82A 2HA6A 4MYSA 1V7CA 1E9SA 1TRKA 2HK8A 3FKSD 3IAS1 1IXRC 2DTXA 1GRNA 3U39A 3WAJA 1ZH0A 1PL6A 4EKGA 3CEPB 3FOCA 3R7LA 1AHIA 3FDXA 1T0UA 1KAMA 3LL4A 3WQRA 2QX4A 5KYNA 3DVRX 1NSFA 2Q4EA 1XG5A 3BMCA 4FYXA 3KQYA 2WWYA 3CB2A 2V6GA 4KZKA 4Y1EA 4L8VA 3S8YA 1Q1BA 1SBZA 2ATXA 2RG7A 4CKEA 5CA0A 4ZI2A 2AFRA 4MV4A 2YXEA 2C7BA 5K05A 1VSUA 7YASA 3LWZA 2C2GA 1C7FA 2ACKA 3QVTA 3S28A 3SHOA 1QGDA 4PRZA 3NIGB 2A5JA 1O6GA 3FAKA 1V8PA 3BL6A 4PGMA 3W2HA 4EUEA 5ADUS 1FW6A 4C03A 4OLHA 3AYXB 1ULTA 1Y33E 4P31A 5A4FS 3JQ7B 2PUGA 4II7A 3WWOA 4MS1B 4ROSA 4KCGA 3IE0A 3F5SA 3OJ0A 4LQDA 3IMCA 5CR9A 2JLYA 2O8DA 3EWSA 1IN5A 1NYLA 2A35A 3AZOA 2Q6LA 3LC1O 3GP3A 5AXBA 3OUZA 3G2QA 2HNBA 3ZWKA 4JXKA 2WJ3A 5CB8A 2VOEA 2Q0XA 1YE3A 2AJDA 3F3MA 4LVCA 3ZQ6A 1H2XA 1KR2A 1SQFA 3IPAA 4QBTA 4QOFA 4Z4CA 4WKNA 1KS2A 2BV3A 1Y4DE 5BMOA 1KFEB 4GEGA 4WXPA 3ET5A 3BRQA 4WW0A 1EQAA 4RCVA 4P08A 2FZGA 3DGFC 3IUQA 2P77A 4QNRA 1DIOB 1NAHA 1V35A 2ODPA 1U8ZA 2WF7A 2ZS8A 3BREA 3UXMA 3HMQA 3VC7A 4DM3A 4UBMA 5HQ3B 3L0ZA 5LQSA 4ND8B 8ABPA 1GT6A 1Y9JA 4HB2A 4P32A 1IB6A 4Q47A 4WN3A 3WGTA 3ZE8A 5DNDA 1MO5A 1L4NA 3Q1LA 2G9VA 3CZ4A 2QOEA 3UKOA 1XZDA 5TNXA 4AO6A 2OC9A 2G7ZA 4MVJH 4URXR 4LYAA 1WIWA 3R0XA 1DC3A 2WILA 3NANA 3CNQS 3OVMA 4C78A 1ZH6A 3PVZA 5ITSA 2GJ9A 2VYVD 1I3LA 3ZE0B 4CDNA 1X8LA 2NPOA 3ISJA 3R8CA 2BHRA 3PHLA 1MJ5A 3FWPA 3TZBA 3AB8A 1Z4OA 2A8YA 2RGWA 4O4JB 4RFSA 5IG2A 1W8DA 1KI1A 1ZX1A 4M0MA 4YJ3F 1EDDA 1ZVQA 1D6NA 2AUTA 4P4NA 4K1LA 3V32A 2FEWB 3GZJA 3RYCB 1Y3CE 2ZM5A 3UT6A 3NP7A 4Z3DA 3EISA 5JQGB 3ZS8A 3FKJA 4R98A 4LE2A 4XD7A 2EZ4A 4GRAA 2ZZNA 3HV2A 2OSBA 2AXPA 3JU3A 4C1NA 3PDJA 4QHSA 1FOEB 2AI2A 2CXXA 2O48X 4MIOA 5FWYB 1PZXA 2PXXA 2VRBA 4D9GA 1WDLA 1PSDA 2WD7A 3GFGA 3PGA1 4ISCA 3MRVA 1LLQA 1SU4A 3HUUA 4P36A 4QYWA 2I34A 3BUSA 2JAOA 2HQBA 4P82A 4YJFB 1U0BB 3DZBA 2QQ0A 1S3FA 2BWJA 5CK4A 3RAPR 4OCZA 5A9RA 5K0ZA 3QE9Y 4GNKA 4QDZA 3AHGA 4TTTS 3EVAA 2V4MA 2P3SA 3PQ3A 2RJOA 3EZGA 3L5KA 3ANTA 4XASA 1PL0A 3JQFC 3CU5A 1KRXA 4MRVA 1XC7A 1IQPA 4BWYA 5GVSA 3E9QA 2FEAA 2YW9A 2IELA 4B4VA 2FPIB 3DUFA 4FBGA 5HF9A 1E3DA 3QSGA 4BPRA 2ZYWX 2PLRA 4B6EA 4P4SB 3DTVA 2NACA 1IEXA 2PRYA 4CUZA 1PJ8A 3H5LA 5F7ZA 2ERCA 3NTVA 2G17A 3W90A 4BJHB 3PXXA 3OQJA 1NYQA 2FWMX 2VRNA 1WHTA 3GC6A 4IV0A 4YRPA 2OL4A 4CF3A 3G9UA 2HRCA 2AI1A 4KQMA 2J0UA 3GLHE 5SYAA 1KPHA 1HA3A 3P9QA 2FX3A 3UO8B 4CR6A 5KQPA 2XXAA 1AC5A 1WBJB 1FY2A 1DJNA 1T9AA 2PH1A 2R7LA 3CWQA 1BCRA 3KVNA 4ZZ1A 4HAZA 2FPMA 5HJ5A 3P9YA 5BSUA 5HUQA 1EWTA 1NQAO 1QYIA 1X92A 2VP9A 3KAPA 1XHFA 1ZM7A 1U3WA 2IXFA 3UT0A 1EE9A 2ZETA 1CS0A 2GVZC 3H8SA 3ADDA 5EE0A 5IDWA 1C3EA 2GI4A 4HLDA 4YP9A 1WA5A 3L40A 1C2YA 2A5GA 3TI7A 4B7CA 3ET4A 4LY6A 1AJEA 1G291 1TU4A 2FR8C 3U7GA 2D0DA 1YR9A 2A4KA 2GAJA 2OM2A 1G17A 1XMSA 1U0HC 4KRGA 5ALWA 5BRJA 2XRMA 1YJAA 1GQOA 1NQ5A 5AKEA 1I2ZA 2VJQA 1K9SA 2BKXA 1ZVMA 3C14C 3OCVA 4NY1A 4K9RA 4WZ6A 5DT9A 5IN5A 5JWHA 5JRDS 5JSHA 2LUOA 3MAAC 4C2BA 4PO3X 4RTQA 1U0OC 2KBEA 1E58A 1P44A 4LVUA 1XQ9A 2FZCA 5HMMA 2G9RA 2GYWA 4EA8A 3ELBA 3GO4A 3PTLA 4MYUA 4UD2A 5EIOA 3DDHA 3G2LA 3KT8A 1JLHA 2IYLD 1Q0ZA 3QM1A 4NP6A 4MQBA 4TUYB 1SRQA 4U2EA 1N0HA 1WUJS 2PKRA 4FLMA 5K0FA 2Y66A 3OY7A 4ZAWA 1N3YA 4EUKA 1Q0PA 3TZEA 3TX6A 4K6FA 4RD2A 5F3DA 1GO2A 3TLGB 4AX8A 4HYQA 1V95A 3NT2A 1O94D 4BB0A 4EYEA 4F84A 2H1RA 4U63A 2Y4NA 1NY5A 1L5QA 1UKYA 1LDMA 1WB4A 2I4MA 1RWVA 2J0EA 2W98A 2WT8A 3PB3A 4XYMA 5EXPA 2HIAA 4ILKA 3W2GA 1J5EB 2GZSA 2F3PA 3OE4A 5E4JA 1U0GA 3WGVA 1CNMA 4S3MA 1Y1PA 1NWHA 4MKIA 4O2AA 2W83A 4JBLA 5EMKA 4UHFA 1HORA 3BSWA 3ENWA 2G67A 1URPA 2XVXA 4FU0A 2IL1A 4IXTA 3RARA 5LQAA 1K8QA 4CN9A 3D3NA 4YRKA 2HRZA 2N9UA 3CLSC 3NTRA 1M33A 3WZMA 2ABWA 4LDNA 2VFAA 1VHWA 3MC1A 4JLAA 3WBBA 4AUMA 1XROA 4AS3A 3RT9A 4Q6BA 3P2KA 3TL2A 5K4HA 1ZRNA 2JHCA 1WCIA 2OZVA 3IJRA 3PDCA 4PC6A 1MPTA 8OHMA 1U1DA 3LUBA 1IPEA 1PLKA 3PPYA 1RQXA 3A06A 3FI9A 4B47A 4BMYA 1ORDA 3EE6A 2KLHA 3KDSE 3OZRA 1JXOA 4LUCA 4UTPA 2QYOA 4JITA 1GKYA 1W4AA 2XVZA 2BJHA 5AK4A 1L5LA 1OH5A 3T3OA 1A8UA 2GCIA 3N8IA 4CKCB 1NBMA 2VQFB 1MA3A 2P1DA 2GJKA 1EXNA 3AKEA 1CY8A 1XN1A 4MYDA 2W37A 5JPCA 1MU0A 3LK6A 2XZOA 5L4NA 3L7JA 2B3DA 2FLVA 2YN2A 1C50A 3JPYA 4HV4A 5ILOA 2H85A 1TJ5A 1F3OA 2OG2A 2C2HA 2VDPB 1DC8A 3H6HA 4Q9IA 1L5YA 5DBHX 3OJOA 4HDNA 1P2GA 5JO9A 1MAUA 5B4TA 3CLRC 4AW9A 3TTYA 2ECFA 4E2ZA 4JU9A 2OP0A 4CR7A 1XKQA 3BH0A 1OXTA 3QXCA 1BMFD 1NG9A 5AM2A 3MBIA 2RI6A 4XGIA 1XK6A 3L84A 1GAWA 3MF4A 3VC1A 2R0QC 4DEYA 2FDCA 1UOOA 5HZHA 4R9UC 4G25A 4RWZA 3NJ4A 4HEHA 3CEMA 2ZIXB 5T7BA 2WRZA 2JK0A 1CJCA 2UZ1B 3AEZA 3ILHA 3JQ6A 5DU2A 3W3ZB 4DMKA 1F8GA 2HLNA 2RHLA 3GVIA 4NYIR 3W7AA 1JQKA 4FS8A 3OE5A 3L0PA 3EOAI 4DMLA 3WBFA 5IZ4A 2HREA 3LYUA 3R5HA 4U7GA 1LDGA 1QTRA 5JI2E 3UJAA 1RPNA 3OPYA 4UEQA 3OWHA 4EWLA 3B7PA 3ZD6A 1JR3A 4TQ9A 1GHTA 3A9UA 3A4NA 3O8CA 2X4LA 5CDFA 3A32A 1UIMA 3SFTA 1V16A 1PT5A 2ZS7A 1BMQA 3IHWA 4IGEA 4X6UA 5IFKA 1BOOA 1M83A 3HVUA 5LMCA 2H7YA 4KLCA 1CUAA 2W2KB 4IGAA 2P8JA 4DARA 1F4VA 1WU8A 2X14A 4FE3A 4MB0A 3S2SA 2P9BA 1PK7A 3HU1A 1Q1NA 4D6YA 5A4JA 4I1PA 4F3YA 2BGKA 2B6HA 3L77A 2FI1A 1G3IA 1WDKA 3CBGA 1P33A 2FMXA 1F6WA 1GVHA 1S9HA 3D43A 2CXOA 4W9MC 4LJ7A 1C9EA 2JJ1A 4UMDA 2O3UA 3S1SA 1VRCA 2YYAA 4LBWA 4Q4AA 1V41E 1PHPA 3SPXA 3Q8XB 4I55B 1P1CA 3RJ9A 1PTKA 1DXOA 4DM4A 4EJSC 3KPWA 4TV9F 2PUAA 3MTIA 3GXBA 4DRXB 3E5HA 1LSUA 2A9RA 1IAQA 1ZFNA 2EARA 2GOYA 5GZ6A 3DZDA 4Y2HA 5CD1A 1NVMB 3FXAA 1Z0DA 3MB8A 4PZDA 3GYGA 1Y9AA 4PXYA 3LH5A 2QAGB 2VZEA 4HK4A 2NU8A 4DR6B 4MS4B 1M6VB 4MAAA 4LDAA 1FQJA 2ENWA 1N8TA 3EDMA 4UATA 4NYJQ 2ES4A 4V0NA 4WI1A 3T35A 5A7FA 4LFAB 4LXIA 4TTQA 4YRLA 4RGBA 3LGXA 5AVTA 2FEXA 1GU1A 2EL7A 5KX5B 3QKSB 5TMEA 3WG9A 1Q44A 1J33A 5CP8A 5AI9A 5FWXB 1Y5RA 1QFYA 2QEQA 4L08A 2PK3A 2Y3IA 1XZAA 3PC7A 1CY2A 1MQ8B 4LK2A 4B4KA 4KTTE 1AHPA 5IJWA 2GCGA 1LH0A 2JGNA 3E2PA 3B1FA 3JWEA 4MK4A 4OJTA 3U3DA 3UHFA 3G2PA 1IL0A 2WYIA 3JASA 3TNDA 1THZA 4LX0A 1P0MA 1E3TA 3UJNA 1Q95A 5DTQA 1SQ6A 4CFSA 4EY7A 1YA6A 3TH5A 3BXZA 1VJDA 1RC8A 1BEUB 2G71A 5I4CA 2DZDA 3NYRA 3U9TA 1BKYA 3TBKA 1E2BA 3L8MA 4IJ5A 4Q66C 1PGNA 4FHDA 4WZZA 5LLSA 4RHYA 1ZM9A 5E4YA 2GN1A 4PSAA 5CGZA 5TEVA 4C0QC 1M5RA 4RF2A 2VVTA 1SM4A 2ZAGA 1TPYA 3DLBA 4LF4B 1I7PA 1I6LA 2JJ2D 1MX9A 2OV3A 3GRAA 3IDOA 4RMJA 5EUBA 5SZJA 5IK2D 1N7HA 5K8IA 4UU1A 3FYUB 4N7JA 2R2GA 5A5VA 4YAFA 5HX7A 1ZWKA 2C99A 3I4CA 4B43A 1IVNA 4BYMA 4XB1A 1AX9A 1NE7A 3MT9A 3OTQA 4AF8A 1CB7A 2WJ4A 3EZ2A 3H5AA 5AW3A 1XMOB 3F3SA 3TOCA 3D6NB 4O2BB 1SURA 1QB8A 2XCIA 2H7XA 3GPIA 3WDSA 4W5RA 1EBFA 2PX5A 4MPPA 1C3JA 3AX6A 3F7OA 1TJ4A 5AH0A 4EHJA 4E11A 4FXPA 1K89A 2XYPA 4I9HA 1CU1A 4MQLA 3GU3A 3UB3A 1HTTA 4YRAA 4DXDA 4C6TB 1C0EA 3CGGA 2FQYA 2NW6A 3LLSA 3LFTA 2FEKA 4OLJA 2DT5A 2OT3B 1X14A 3QBDA 3VZQA 4DPLA 2H4ZA 1MMFB 3ND9A 4FDLA 1CG6A 4DKXA 1T9BA 3P9ZA 1CVIA 3ZI0A 4OKSA 3K0KA 4YJGB 2H1HA 4F72A 1XZEA 1VPVA 3BTSA 4OHBA 4XIFA 4KG7A 1MXHA 3ZK7A 2G8NA 2C5BA 5B57C 1M0EA 1ONNA 5AI4A 1Y1RA 1CP3A 1NZDA 1QIMA 3UJCA 2RHHA 3WBJA 4RSRA 1TKAA 1YU6A 3I6ZA 2ODAA 2XBLA 4BNJA 4EB8A 1FSZA 2QORA 4QT0A 2O1EA 3HNRA 1P9LA 3DXZA 1NZJA 3LHIA 1ZJJA 3MWDB 1M2WA 1FP2A 1YHNA 1TQ8A 3F1LA 3GJ6A 4Y2UA 5A3VA 4IHQA 5BVHB 1EQ2A 1AK9A 3K1TA 4NBUA 5DBFA 1DGQA 2Q99A 3E9EA 4P58A 3CZCA 3SR0A 1JDVA 5IX8A 1YBMA 3H3XA 1S2NA 1OFVA 3DBRB 5E4FA 4CLHA 4N0EA 3W5IA 3LPMA 3FSGD 4KDFA 1VMDA 3ETDA 4S0ZA 3U1VA 5JJBA 1EBUA 3ZZNA 2NP7A 3QPBA 1EYZA 4YIKA 4L5YA 1XLTA 1KTVA 2BEUB 4WCFA 3PFCA 4AMYA 4EB6B 2PZBA 1YIDA 3BJRA 3AERB 4A0GA 1X1AA 2CUNA 3SYMA 5EMMA 1MN6A 1R0LA 2P78A 1HBJA 1QX3A 1E1YA 2GJ4A 1CCWA 3OBIA 3IDZA 4GO1A 1IRXA 4BVJA 1VHLA 2WHRA 2VWQA 2AN3A 3FROA 4INZA 4IQ4A 5HUHA 5LQDA 1TAQA 4DA9A 4GKBA 4PQGA 4BJ3A 1A5AB 1L7MA 1J0XO 1AS3A 4IIDA 3JS5A 2J9ZB 1OTHA 4RCZA 2JFNA 2BEWA 1GKUB 1GUAA 1N4DA 3TL6A 2CXUA 2R751 2Q0HA 3UB2A 5E7IA 4MINA 1CZLA 4GI7A 3TTWA 3LPAA 1LLUA 1DLJA 1UEXC 2PJZA 4FBLA 4FGJA 3SYRA 2GNOA 1M8FA 3F5QA 2CNWA 2GO1A 2O2HA 2H2GA 2TMKA 3CF6R 2PX0A 4A03A 4AKHA 2ZE7A 1RI5A 3COYA 3KX2A 2OPBA 1GA6A 3KOOA 5HKLA 4NZMA 4FHZA 3RFUA 4Q9HA 4B2LA 3QY0A 5I3CA 4GSYA 3WYBA 3UMRA 2I1LA 3I2JA 4LTDA 3ZIUA 4POOA 3TL3A 5AKJA 3H9QA 1NSTA 5EHIA 5BNFA 2G1UA 2X1VA 3FDFA 5F4ZA 4MARA 1PDWA 4B2YA 4RMIA 2G70A 5CT8A 2FK7A 2GNPA 1QG0A 3M6WA 4PHCA 3DW3X 4C08A 1VJ5A 2EFCB 3I6BA 4RAQA 2P0EA 3E9YA 3FZQA 3N75A 5ERYA 2N75A 3P4XA 4JBWA 4NZYA 3REGA 3HRKA 2FFQA 3FTPA 4JYCA 2QW8A 3RRYA 3VAYA 1G8SA 3UIEA 4YCMA 1C8BA 2H54A 3DT8A 1QU3A 4GE0A 2FU5C 3ACBA 3LHDA 1VL0A 3BRSA 3I72A 3T3HA 2Y93A 2VUTA 4E31A 1NKSA 3PFIA 4EW2A 2OKCA 3M34A 1TM2A 2OLKA 2FN8A 2ZIEA 1XP8A 3TIIA 1T9HA 1DEOA 3U3ZA 4QSMA 2QNBA 3LXMA 1J1ZA 4XQCA 3U6KA 1JA0A 1H5UA