2VSXA

Crystal structure of a translation initiation complex
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
382
structure length
366
Chain Sequence
QIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Yeast Eif4A-Eif4G Complex: An RNA-Helicase Controlled by Protein-Protein Interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation/hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE EIF4A
total genus 120
structure length 366
sequence length 382
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA02
4GFDA 1OXUA 4DDTA 3OEED 4LHVA 2BV3A 2GCNA 3MWYW 3CH5A 5KNCA 2Q0HA 4HB3A 2X77A 5JWOA 5EJEA 3GJ8A 3WMFA 4OHYA 1KI8A 2V6JA 2O0HA 1IN4A 5LB2A 2IS6A 1GWNA 2J0UB 3U3MA 1NBME 2W2XA 2EQBA 4CEIB 5KO2A 2IF2A 4MGIR 3AVXA 1CR0A 4FMCB 3FB4A 1PUIA 4PZYA 2CJWB 3TVDA 1E2IA 3SE0A 2YKGA 4QHYA 1E2EA 1TF5A 1UADA 2ZRAA 2JIZA 4Y0AA 2IXEA 3PQCA 1KDRA 4TMVA 3VR1A 4D4JA 4MUAA 4RD6A 3TW4A 3UMSA 1UAAA 2IYSA 4HAZA 5HE9A 3PITA 2ZSDA 3I8SA 3ZVMA 1ZJ6A 4PO8A 4BE7B 3U7HB 2IT1A 2OBLA 3CLVA 3UPUA 2ZAMA 2AK2A 3HP1A 3LX8A 5B58C 2N46A 1OHHA 2PZGA 2DCUA 4P32A 3RS2A 4ZKEA 4Q9JA 3LW7A 2F43B 4BGDA 2EVWX 3EZ9A 4UXJA 2WJYA 1S0UA 2EFEB 5J4YA 3KKNA 1G64A 3AF3A 3LY5A 4J0QA 1T8UA 2B92A 4M1WA 4Q1AA 2WWWA 4W9MC 3FE2A 2GZDA 5E4FA 3RS0A 4A2WA 2ZSFA 1T8TA 2ZUDA 3N2EA 1TEVA 4BWYA 1IN8A 2IF0A 3PR1A 4Q48A 4KYUA 4AC9A 4BZXA 4HDCA 2XOKD 3D31A 4DKXA 1ELOA 2CL6X 3E70C 1RRPA 4B3CA 4Q7MB 2A5FA 1HYQA 3QBVA 2QTHA 3BK7A 3K0AA 1G3UA 4IW3B 4C7OB 4QJ4A 2D62A 1AGRA 2C95A 1UPTA 4A4DA 3GLFB 3R8FA 2VSXA 3L43A 1OXXK 3CRRA 4AYXA 2BOVA 2QU8A 5FTKA 1JAHA 2YOGA 2MSCB 2V1UA 4IOMA 1DG1G 2IEYA 2ZI4A 1G5PA 2FN4A 3GLHB 5TDHA 2V55B 1G8YA 2Q9AA 2QQEA 3Q5EA 4WOPA 2G77B 4EFNA 1KSJA 2Q21A 2H5EA 4ARZB 1TQDA 1JQJC 1Z22A 3X1DA 2YJTD 2XB4A 4LI0A 5CK4A 2QSZA 1JPNA 2F1IA 2BBSA 3OIUA 3IIJA 4R9UC 1XZQA 1YZUA 2LCFA 5AJWA 2RGGA 4BPBA 5KSZA 3B1ZA 1XNJA 3WXMA 4C0JA 3KL4A 2VA8A 4ACBA 3U3RA 4KLZA 3MCAA 1ZYUA 3LXRA 4MYCA 4JKIA 1GOTA 1Z08A 4WXPA 821PA 3E2IA 1FMJA 3SJCA 3CR7A 5AUNB 1HY3A 4PFSA 4ERNA 2DFLA 5DHAA 1Z63A 2REOA 2ZM5A 2J0SA 2QMUA 3PG5A 4DLRA 1G21E 2D2FA 3DM5A 4QBIA 1M1YE 1C4OA 4Q00A 5G53C 3MUFA 1Z6AA 2WM9B 4Z8YA 2D3WA 2MSEB 3SN6A 1P61B 2QBYB 1ZNYA 1ZUIA 3UATA 3ZQJA 4KSBA 3VKHA 4JZKA 3T61A 3MWLA 5B57C 2QP9X 5K8IA 1W2HA 2BEJA 4BLRA 2G1JA 3DOFA 3IPXA 3KQNA 4B3DA 3W5IA 5EUMA 3I1FA 4OK6A 2YHSA 3HPRA 2D7DA 1KDPA 2WJVA 1E2PA 2QAGA 5E7MA 5KDDA 4BEBA 1OYYA 2XNSA 4XWKA 2HDNB 2AD1A 5SZHB 4Z51A 1AZTA 4R2HA 5JBQA 4LK2A 5JRJA 3GFTA 1DAHA 2ZI6A 4NE2A 4IDOA 2GJKA 2WMOB 4ZV4A 1MABB 2X19A 4RSGA 1OE0A 1ZINA 2CMKA 2G0NA 4O3MA 5EUQB 1MO3A 2ZRNA 2FA9A 3H2YA 4US2R 2JLUA 1ZD1A 4RD3A 2HYIC 4I1OA 4WIAA 2GBLC 4TT3A 2D4HA 1L4YA 2IYZA 4LJ5A 4EPXA 1CJUC 1N6OA 2GBLA 1FX0B 4US1R 1GTVA 1R0XA 3K53A 2OXRA 4Q4HB 3T1OA 4LOAA 5GADl 3VR5A 3E5HA 4JYBA 1XXHA 4XD7A 4KVAA 4DIEA 3NTUA 3GLGB 1U90A 3UANA 4JVMA 1JB1A 1P2UA 2CBZA 4DLXA 3KFVA 1ZM3A 2PLRA 4NMMA 2WOJA 4Q7JB 721PA 4HUQB 3WMEA 3NKVA 1U0LA 2OZEA 4EPWA 2QPAA 4URUR 3CF2A 4JVNA 1WQ1R 3CPHA 2BCGY 5GJWC 5EE9A 3SYLA 2CK3D 1VG9B 2WBLC 4MA4A 1Q57A 3KTAB 3EA0A 1WMSA 2J0QA 1JR3A 2IYTA 1G16A 1W36D 4EPVA 3VKWA 1AKYA 2OFWA 4TWZA 3VFDA 3TAUA 3A1UA 3CF6R 3GJ7A 3GQBA 4NP6A 5EP1A 4DCNA 1E9FA 4LWZA 4MYUA 5CJPA 2P0EA 2OG2A 3TLXA 2ZRKA 3UG6A 3DMDA 4KHZA 1XD8A 2JLYA 1D8TA 2IEZA 2IYXA 2H1LA 4QXAA 5AWFC 1Z47A 2C2HA 3THWA 3UWKA 3REFA 4JYCA 2QT1A 1U81A 4BZPA 2XXAB 1H8ED 2EYUA 4M4SA 3CWQA 2AXNA 4Q7LA 3ONWA 3ZVRA 3DKPA 1XJ0A 5EXXA 4RFVA 3K9NA 4FIDA 4MQBA 4M8NE 3SHWA 4B48A 2OM2A 2YV5A 3I3SR 5FL3A 3BH7A 5K8UA 3MLEA 5IF9A 4PC2A 1JXMA 2V9PA 3GJ0A 1QHNA 2Q9BA 2ZUCA 3BFKA 2C9CA 4ESHA 3K0CC 4A2PA 4MITA 3EZ7A 1CRPA 1E79D 4LX0A 1ZCAA 1WA5A 3WYFA 2VP6A 2G0TA 2QRNA 2PJZA 3LA6A 2CK3A 4US0R 2R8RA 5L3VA 5H70A 2FPKA 4KU4A 2D7CA 4IDNA 2V7QA 5HKKD 4U02A 3K70D 1S9HA 4F4JA 1X3SA 1HV8A 5F9HA 5EXSA 1FPMA 2WWIA 4TSFD 4GP7A 2ECKA 2PT7A 1X86B 1W36C 1NI3A 1UDXA 2XJ9A 4D4LA 4B3BA 4YMUA 1G7CA 1Z0DA 2F9LA 2ZRGA 4BFYA 2GTPA 5BYKA 2R6AA 3BJIC 4NYIQ 1XMVA 4U00A 3VX3A 4ZKDA 3WHLA 3CRMA 1KNQA 3L8ZA 1VIAA 1KI3A 3OIVA 1Z6GA 1XD2B 2XJ4A 1XEXA 3A1SA 3LX5A 4NDZA 4DXAA 3VR6A 4B75A 2D74A 2YWFA 2HCBA 2ZVPX 3P1JA 5B64A 2YINC 5FOUA 4DSOA 2EW1A 5KDOA 5DSZA 1YZLA 4RD4A 5JFGA 2V1XA 3GFPA 3G0HA 3X1ZA 2IYQA 3NH9A 4NYMR 4DCSA 4DEXA 1VHLA 4G0NA 3AKDA 4B44A 5GVSA 4NH0A 5JRZA 5E7IA 1JR6A 2L0XA 4AWXA 2YVUA 1SVMA 1QZXA 1K8RA 2KE5A 2OAP1 2RGNC 4QKQA 4D25A 2O8FB 2F43A 3HJNA 1FFHA 1T3LA 3CBQA 3GJ5A 3B8HA 3TGPA 1OH5A 4I99A 5FR2A 1I2DA 3OIYA 5A0FA 1NF3A 3H86A 3U7FB 3KKOA 1IXZA 1EWRA 1MO6A 1OIXA 2G6BA 4RD0A 5SZJA 1CJMA 1FNNA 3BD9A 1WDTA 4PO9A 3RABA 3UKDA 1XXHE 5J4HA 3P26A 4MKHA 4TMZA 2PT5A 5AK0A 3IO3A 3U4QB 3GLHE 4CW7A 4B43A 1CR2A 2I4IA 3X1YA 3T06B 1KDOA 1UKYA 4EJSA 2VEDA 3THOA 2VHJA 1G5TA 1FQJA 2AKYA 3CPJB 2FX3A 2LKDA 2O8DA 1DBSA 4FD2A 1KYIA 1UKZA 2ODWA 5CITA 1TUEA 2OEPA 1Z29A 3I72A 3ZGXA 3LW8A 1TX4B 2P65A 1DAMA 1YHNA 4WZBE 1GDDA 4N0EA 2CNWA 1CXZA 1JALA 1Z6XA 2EU8A 2Z0MA 3WY9A 1OIVA 3ND9A 4M9ZA 5FFMA 1R7RA 2AHOA 3NH6A 2W6ID 2IL1A 1LV7A 3OFNA 2HYDA 5DYIA 2GXAA 3IDQA 1OJLA 1N0UA 4X8MA 1CR1A 4V0KA 2O8BA 3ZLJA 4M22A 1IY1A 3OAAA 4C0SA 2ZJOA 2AX4A 3EWSA 2WWYA 5J47A 2CE7A 4CT5A 4GDFA 4LHZA 1T3HA 2VO1A 2QQ0A 1NG9A 1TEXA 4Q1EA 1S3SA 3KJHA 1NP6A 2BIFA 3F0TA 2JCSA 3KUDA 3AKCA 2Z4RA 1SXJB 2CEAA 3OF5A 2XZPA 1E32A 1R0ZA 2WVJA 4AKEA 2NOAA 1XMJA 2C98A 2FV8A 4PSAA 1AJEA 4R71A 4ZCLA 3FHOA 5EE5B 5JEEA 1JR3E 2MSDB 2VL7A 4LYHA 5J5CA 1IQPA 1G41A 1DEKA 2F1JA 2GNOA 2CVFA 4BFXA 2PJRA 2HEIA 1OH7A 4DB2A 4ZDWA 1XJCA 5FPYA 4TYNA 5D3MB 4IDHA 4UNNA 2PX0A 5FOXA 1SVIA 1Z6TA 4MKIA 2C5LA 2WIAA 1Q21A 3A1TA 4WA7A 3M0EA 3HYTA 2X2FA 3VQTA 3RHFA 1G291 2RGBA 5FOSA 2PEZA 3LAWA 1HQYE 3QKSB 1N6NA 4Q7KA 3THXA 1GM5A 3BE4A 1Q1ZA 5CK5A 1NJGA 2J59A 4LBVA 2IS1A 5JWHA 1HA3A 2WTUA 5JJLA 1U9IC 4A15A 3KTAA 3P4YA 3OEHD 2ZSAA 1GZSA 1L7VC 4HYYA 4AYTA 2GJ9A 2WWFA 4LC1A 1N5KA 2GZAA 2CLCX 2EFCB 4IXMA 4BEJA 1G7RA 2QAGC 5AUPB 1RJ9B 2JJ8A 3GLGA 3KQLA 1UKEA 1E9CA 3EPJA 4L16A 4JKYA 4G01B 3QJYA 4V02A 4Z1MA 4CEJA 4KXFB 4CYMA 5TXGA 3I5YA 2HCJB 4W5JA 4ZDKA 2A78A 3DHWC 3W8RA 4ASUD 1VHTA 3SHFA 2AXPA 4P31A 5AUQA 2CCKA 2J0VA 4TT3D 4A1FA 5EP4A 1KJWA 5IK2A 1O3YA 1SXJC 2HJVA 2NO6A 1GILA 1IONA 3VHLB 1GITA 5AUOB 5KU1A 3R9XA 1N6IA 4PC3A 1QRAA 2B8WA 3VTKA 1P5ZB 3RSLA 4F92B 4O25A 5CYPA 1WXQA 1TPZA 3RRMA 3EPKA 2P5SA 3BERA 2ZYTX 4AD8A 3A36A 3W3ZB 1R5BA 5G40A 3QENA 4X8LA 2R65A 3THYB 3U6KA 1EESA 3QBTA 4I1UA 3OFND 4NTZA 2C77A 4JVSB 2QY9A 1GL6A 4PR0A 1CKEA 2PEYA 5CM9C 4W5WA 3VAAA 4YMVA 3NEJA 1D2EA 5JHHB 1W0JA 3NBFA 1NVWQ 2FG5A 4KAXA 1X6VA 1OXTA 4PXAA 1OLOA 1SKYB 2H92A 4D0NA 1Q44A 4PHFA 2XTZA 5JMTA 1E1QD 5F2EA 5GJBA 3CUEF 1SXJE 1CF4A 1XTSA 3SJBA 4TQAA 2O0KA 2PBRA 5FBQB 1KI7A 3EASA 2QGNA 1C9KA 2PCLA 4WW0A 4OYHA 2CJWA 3A8TA 2ZROA 2GETA 4EFLA 4F7WA 2OLKA 1D6JA 2JASA 2OILA 1E0KA 2NO0A 1PUJA 1CLUA 1KMQA 1S9DA 1HURA 4GSYA 1S96A 3BRWD 2GK6A 5K8TA 3GLIA 3R9IA 2I1VB 4GP6A 3VMFA 2CLSA 2GK7A 2ZE5A 3DZDA 4LJ9A 3ND8A 3WHKA 2NPIA 3KJIA 4MGYR 2XTMA 4IFBA 2EWVA 2YNMA 3C14C 3F3YA 3PV0A 4LV8B 3NBZC 2QPOA 1NKTA 1TNDA 3MFYA 4ZDIA 3BB1A 1RE0A 1X8JA 1A2BA 4JLOA 1AGPA 1F2TB 2J1LA 5P21A 3I92A 1T91A 3DVLA 1AIPA 3NDBB 3ZJYA 4TZ6A 2GAOA 3GJ6A 4L8GA 1GKIA 4ON9A 4MGKR 1N5IA 2WSSA 2OE2A 2HF9A 2IBMA 3WYGA 3QVUA 1KO5A 1D9XA 1W5SA 5KHOC 2IWRA 1NVVQ 2HUPA 3FFBA 4MRSA 3ASZA 2WV9A 5J4VA 2F3TA 2OBNA 3W9YA 2A5GA 4PQRA 2GEVA 5L3SA 3BH6A 3U4QA 1ZBDA 1S2MA 5B2ZA 5SZIA 5IHPA 3GEIA 5A5GA 5G3YA 1SVOA 3PVSA 5GJVC 1MRSA 1E2HA 3ZYCA 2J7PD 4A2QA 2CDNA 2QAJA 3A4MA 2OUKA 3EWAA 1KI2A 1W44A 3D7MA 2IUSA 3KDSE 1R5NA 4PO1A 4BFWA 3G5UA 4OL0A 2H18A 2QTFA 1N5LA 1YR7A 4G5RA 1ZUHA 1AM4D 1LS6A 2WICA 1SVLA 2CNWD 4GT1A 1JNYA 3RS7A 1KNXA 4C2TA 1R2QA 3K8YA 4IEEA 4JMPA 3Q3JB 2O8CA 2NPFA 3BGWA 3AVPA 2QPTA 3OESA 3T12A 3TQCA 3JVUA 1GRQA 4PC1A 3BOSA 5FR1A 2J87A 2B8TA 5FI1B 4DUGA 3N2IA 3NWJA 2QM8A 5HKKA 2VSFA 1NLZA 3TAHA 1T3SA 2GZHA 3MJRA 2IYYA 1E3MA 4I1SA 1A4RA 3BXZA 3KXKA 4B2PA 1QG4A 2Z6VA 1CS4C 1II9A 1COWD 4JT4A 4A0GA 4HUQA 2XX3A 1KGDA 4MRPA 4CGZA 4LPKA 3GJXC 2ZS8A 3GLFE 5JHGB 4HI0E 3THXB 4NCKA 1VYUA 1XEWY 5BW8A 1J8YF 4AKHA 3F5FA 1GL7A 1B0UA 2QL6A 4JIMA 4P4SB 2IYLD 2BMJA 4F93B 2ZJ5A 2AN9A 2QTVB 2QROA 1KI1A 5EP2A 3TSOA 1QVRA 2QUZA 3RNLA 1K6MA 2FPLA 1OF1A 1R0WA 3O8DA 4QBHA 2ZR0A 2SHKA 4B47A 3SJZA 3QQ5A 5DE3A 1WF3A 3RWMB 4N3NA 1Z5ZA 4P4TA 2IHYA 4TTRA 3MD0A 3EW9A 1GNPA 4Q9LA 3REGA 1YU9A 2VHCA 4K46A 2DB3A 5DNYB 2JEOA 3SFVA 1KZ7B 1E1RA 4XTRA 1U8YA 1ZC3A 2UKDA 1DADA 4EFMA 3GLIE 3BWDD 4UQOA 2IYUA 4U7DA 2P6UA 2DFKB 4MDFA 1HQCA 1UEIA 2KSQA 2A5YB 3LWNA 4HZUB 4B2IA 1NY6A 4M9SA 4C0AC 2R62A 4Q4JB 4H9GA 1T0HB 2WSMA 5JS7A 1G4AE 4PPQA 4S35A 2FWRA 1SVKA 3ETLA 1NL3A 2AL7A 1XCPA 5BQ5A 4IOKA 2KB0A 4EJSC 1ZM7A 3TKLA 3SBDA 3FOZA 4OI0A 4DVGA 4B76A 1K5GA 1QG2A 5KPJA 3U44B 2MMGA 3D3QA 3IBGA 3WRXC 3CRVA 2ZJAA 4OHZA 1DAFA 3K0AB 5AJVB 1W0KA 2IYVA 5DH9A 3CO5A 4DLYA 1GNRA 5C4GB 3KUCA 2JIZD 2BDTA 4RZ3A 2TMKA 4A0HA 4LCBA 4DHEA 4URVR 4YLGA 5CB6A 2DWPA 1AS3A 3V4RA 2IYWA 4Q1CA 5EP3A 3QY0A 4OI4A 1HH4A 4V0LA 4ACAA 4KVGA 2C03A 2FNAA 2WWXA 2W2TA 1KAOA 2GDJA 1N6LA 2C9OA 1E94E 2V6IA 2XNDA 3K09A 3QPUA 4FMDB 1N6PA 4HAYA 2A5JA 4AI6A 3AP3A 4NCHA 4QBGB 3R20A 3NBYC 3TUIC 1W0JD 4DBLC 1KMHB 2ZYVX 2V54A 3CX7A 1MO5A 3B78A 3KKMA 5HZHA 1Z0FA 3CRW1 3KZ1E 4GOJA 2V3CC 1W49A 3ADKA 1E2FA 3B13B 1U2RA 4TL7A 2RAPA 1Z07A 1KIMA 1BS1A 3EIHA 2LKCA 2PCJA 1GIAA 2ORWA 1RFLA 2BBOA 1H65A 3A58B 1H8EA 1VCOA 5GVRA 1KZGB 5KNBA 1PLLA 2GWHA 3MGCA 4PZZA 1RZ3A 4EKDA 1TQ6A 5LD2B 3THYA 5KSYA 1NBMA 3PXGA 5JCPA 1GKUB 2RKOA 4E03A 3CX8A 2A2ZA 5FUYA 1AZSC 4TYYA 1DAEA 2IUTA 2XB2A 2H8KA 2B7CA 2QE7D 3HU1A 3BORA 3IO5A 1T5LA 2C9YA 1P2VA 1G3RA 1XMSA 1S8FA 5KPDA 1G19A 1VCMA 1IJEA 1P73A 2BCJQ 2OSBA 121PA 4BLQA 4D2IA 4EIWA 1X1RA 2OHFA 4IKEA 3QOFA 2ODBA 4HAXA 4P4SA 1NSFA 3I4LA 4B6EA 5BN3A 3UG7A 5HCIA 4UXHA 4BLPA 4DWJA 3MWKA 1SQ5A 2JLZA 3R8CA 1UBFA 3P32A 2W6JD 3ECCA 1NIJA 5HE8A 4DDUA 3D8BA 5J4KA 1J99A 3EIEA 1TAGA 3ZDQA 3TK1A 1NN3A 1YJ5A 5L3QB 2QMOA 3FHCB 4YDSA 4A8JA 4LPSA 4NONA 3FKQA 3Q7QA 1BOFA 2BM0A 1FP7A 5TV2A 3V00A 3HR8A 1Q1BA 4WZAE 1R8QA 2P67A 4UKDA 3ZVLA 4AYWA 2AK3A 1M74A 3B9QA 2LWIA 2WJHA 1ZD9A 4LBZA 4DSNA 1E98A 1N2CE 4V0NA 2IHBA 3TW8B 2ZXUA 5H68A 1JECA 1XTQA 1ZM2A 2QE7A 1R0YA 1Z6YA 3Q7PA 2RGCA 1Z0AA 4TMTA 2YWHA 4B74A 4IFEA 1QF9A 2XTNA 4DCVA 4BFZA 4M1YA 3FPAA 4CVNA 4KLNA 3KFXA 2AFHE 4NHOA 4JS0A 4EQ6A 1TTTA 2X8AA 1E9DA 1G5RA 4FCVA 4QNMA 3RAPR 2VTKA 4DSTA 2OFOA 2ZJ2A 3AF1A 4TL8A 4YQFA 4LBYA 2E1RA 2FSGA 3DKVA 3DEFA 3ADBA 4S2EA 4BLTA 4EPYA 2NG1A 4FW9A 2KJQA 1L2TA 1KI6B 1S1MA 4XSGA 1ODFA 1ONBA 5ELXA 4II7A 1OKKA 4E5UA 1ZVQA 3EPHA 2ZETA 2ZREA 4G1UC 4HDOB 2WMNB 3SEAA 3QNUA 4TTPA 5DN6A 3AQ4A 4NL4H 4TQ9A 1IY2A 1ZW6A 3O8CA 3GMTA 2V7QD 5CLQA 4A6PA 3CZPA 621PA 4QHSA 4I4LA 3VR2A 4Q9HA 3KQKA 1OFTA 2YZ2A 3AEZA 3RRYA 4TL6A 1P62B 4FWIB 4GPTA 1FUKA 5FI0B 3U2QA 1C1YA 1ZMXA 5KUTA 5C18A 2OCPA 2RHMA 4HAWA 3UMFA 2B21A 1K5DA 4BQSA 1Y3AA 1PLKA 3BBPA 2F1RA 3OIWA 3U3JA 4GBMA 4AG6A 2CCJA 2ZJZA 3BC1A 1XTKA 3PCRB 3GPLA 3HWSA 4ZI3A 1E9SA 3AP2A 3IHLA 4DB4A 1EG7A 3RC3A 1U0JA 1A7JA 2ZSBA 3C41J 1R10A 2J7PA 4DIDA 4CEHA 5JJIA 4LDJA 1SXJA 3FWYA 1W1WA 4RD2A 1FMLA 2ZAOA 2PH1A 3TUJC 3GJ4A 1DVRA 3EIQA 2OT3B 3K70C 3TRFA 2JLXA 1FL9A 3ZQ6A 1QDEA 3LNCA 3QF4A 2ASEA 4QG7A 5IRCD 3KQHA 1DOAA 3C4JA 1G7SA 4ABYA 1IN5A 2WAYA 1W47A 4D4MA 3U5ZB 3AUYA 2FPMA 4PHGA 1D9ZA 5EE3A 2GCOB 4CT4B 1T6NA 1U9IA 3ZIAD 3K70B 2GESA 3GFOA 1NNEA 1FNMA 4A9AA 3RYTC 1DAGA 4BECA 3KXIA 4TYPA 4CEIA 1EFRD 4KODA 4R7ZA 2FGKA 5D3QA 5FPKA 1OPXA 1YZGA 5C2JB 3Q5DA 2V4ZA 3I62A 4ZIRB 3CZQA 3I8XA 2WJIA 4RZUA 2IXGA 2JATA 4NKRA 4OHXA 5BN4A 1T4GA 4A82A 1CULC 1EWQA 4XH9B 3KJEA 3TVTA 1HE1C 3ZS8A 3SQXA 3WNCA 1Z0IA 4RZ2A 1E2GA 2QEQA 4ZO4A 1GVNB 1VMAA 2VF8A 4RVCA 1OW3B 4DDVA 1WRBA 3PIRA 4HB2A 3GP8A 4XTCS 3K1JA 3CKLA 3M4YA 4IVRA 4JLVA 4FI3C 4HZIA 2ZITA 1W48A 1M7GA 2FZ4A 1NVUQ 3J81k 3LVRE 3LRPA 3ZH9B 4JT2A 1M6NA 2DBYA 1RRCA 4UXIA 1KO8A 2O8FA 1YZKA 2PLFA 3N5CA 1TL7C 2ZRIA 1ZP6A 2QG6A 4GZLA 4YMSA 2OO7A 2QORA 4RFSB 5J40A 3GLIB 1E79A 1IAQA 3A1WA 4QL3A 5TMPA 2YWEA 5GJCA 4KFSA 1MO4A 1KJZA 1G7TA 3CM0A 1U0HC 1I4DD 2JJ2A 1OSNA 3WYAA 4RCYA 1G8FA 4WBSA 4HAUA 1QHYA 4IRUB 1KK2A 4CDGA 5BXQC 1LS1A 2QZ4A 2IA5A 4C0QC 1H8HA 2QP4A 2FE4A 1Q1QA 4GMDA 2GXQA 1G8GA 2JA1A 1DTSA 4HLDA 5DYGA 3SDZA 2DPXA 1YR8A 4UJ5A 1F3OA 2EFDB 3U6BA 5BYJA 2NMVA 4Q4LA 2GJSA 1JXOA 5IK2D 4LJ7A 1LVGA 3Q72A 1NLFA 5FTLA 4B6FA 3NIBA 2ZQ5A 5EZ6B 4MKGA 2ZR7A 5DLQC 5E95A 1NBMD 2EWWA 3GLHA 3LD9A 4MRVA 1SHZA 5EE1A 2FZLA 1XBTA 3ICEA 1P60A 2H7VA 3NC0C 4H1VA 3QEOA 4TLBA 3AGPA 4JJZA 3ZD7A 1UFQA 4P33A 1IJFA 2BMDA 1Q1EA 4JVLA 4F4CA 2JJ1A 4NCNA 4M9QA 3ZVNA 2PX3A 2J9RA 1RC8A 1US8A 4Q9KA 2BEKA 2F55A 3QI2A 3K9GA 2Q9CA 3VHXA 1NN0A 2ATVA 4YMWA 2R2AA 3SNHA 1XPOA 3B82A 4LHXA 1XCMA 1OIWA 1P75A 3LLMA 2O8EB 1SZPA 1XP8A 1P9NA 2W0MA 2XEXA 2ZRFA 4Q66C 2G9NA 1E2LA 4EQ6B 3B5JA 1XFAA 1YRAA 2CVHA 5M04A 4AKIA 3DMNA 2GVZC 4IXNA 4URYR 4XVRA 5FTNA 1KSGA 2GCPA 2DWOA 1E2DA 4IEIA 3EC2A 4HEJA 4POAA 3L2OB 3G82C 4OJQA 3CONA 4LYAA 2ZJ8A 3LLUA 4QJ3A 3IHWA 1VECA 1DAIA 4CZ2A 4RKFA 3X2SA 4Z1MD 1FX0A 1AA9A 3PFIA 4BFTA 3QKRA 1II8A 1XRJA 3SBEA 2A3RA 2J3EA 2VLIA 2VP2A 1YRBA 1F6BA 3I61A 4P3YA 1XEFA 1CJKC 4Q9IA 3LV8A 3QPWA 4K8OA 3GJ3A 1ZAKA 1F2UB 3QXSA 4RD1A 4HLCA 4QNRA 5D3MA 5DO9A 5FTMA 1D5CA 2RGXA 1JBKA 1F5NA 3QXCA 1LY1A 2W58A 2F7SA 4G5GA 3RS4A 5JS8A 1EK0A 4OK3A 3L0PA 2ZRBA 4TYWA 3LO5A 1LB1B 1MRNA 3PEYA 1U99A 5L3RA 1XF9A 1ANKA 1PLJA 2VQSA 5L3SB 3AV0B 2R6FA 2O8DB 2J0UA 3AH8A 1KHTA 4GMXA 2Q3FA 1CTQA 1KSFX 3WP0A 4CRWB 1QHXA 1E9EA 3UMRA 1E0JA 2BJWA 4D4KA 2RCNA 4V0OA 1VDZA 4F91B 1UDWA 3KKQA 5FPSA 1PZNA 5F3WB 1O87A 2ZIAA 2ZYUX 4V03A 3PUWA 2GJ8A 1R8SA 1IN6A 2VP9A 1OV4A 1ZC4A 2KBEA 4DT1A 1GNQA 2FDCA 4M1KA 4A8JB 4DLTA 2G88A 4ILEA 3MSXA 2BVNA 2DFTA 1N6KA 1VCIA 2WOOA 1E69A 3VX4A 2R6DA 1ZM4A 4LYFA 1SGWA 4DCUA 1OFUX 5JI2E 2VP0A 2ZRCA 4BFVA 2OESA 3DDCA 4TMWA 3T34A 3OE7D 1M8PA 2QA5A 1Y63A 1J90A 1GSIA 2YYZA 2GJAA 3BH0A 4LUCA 4QC2A 3H4MA 4TN1A 1TU3A 1KKMA 4G5SA 4RFSA 3C15C 2C99A 4TLAA 4Q47A 1TQ2A 1XU4A 2N1BA 4MUBA 5CYOA 3WMGA 3K0EA 4FMDF 2R6CA 4WXRA 1PVOA 4B32A 2WPDA 1W4CA 421PA 3P20A 4B33A 3Q85A 3OZXA 3QPVA 3TSWA 2VRWA 5FOWA 4DJTA 4EJSB 4FMBB 2PZEA 1XB2A 1E2KA 5CIQA 2CHGA 2NO9A 2IC5A 4QGHA 3EPLA 1OH6A 2FOLA 3IUYA 3SS8A 3RDPA 1W46A 1ZNWA 2J45A 4WVFA 5HZKA 1P7CA 5E7JA 4XOIA 2OBMA 1VCNA 2ZS9A 3AVUA 2D06A 3GEEA 4DRZA 3PEWA 1IM2A 2VIIA 4JL5A 4TSFA 3W8NA 2HF8A 1ZU5A 4MDEA 2ZE7A 2ZUBA 4CEHB 5E3HA 4UNSA 1OT3A 4JL8A 1WBDA 4OQMA 2QENA 4AURA 3QKUA 3IIMA 4ZPXA 2X2EA 1QHHA 2XXAA 1WCV1 1DE0A 5H8WA 1AS2A 3X1WA 3OE7A 1KI9A 2ANBA 1E9RA 2DYKA 1XEXB 1Z28A 4GOXA 3IEVA 1GFIA 2ZSEA 2ZI3A 4Q4HA 3NBXX 3EZ2A 4ZDJA 3IIKA 1E9BA 2VPPA 4XVUA 3B2EA 1SVWA 4KV9A 3VKGA 4GOKA 1F60A 5FUWA 3P4XA 2MMCA 2OCAA 1MH1A 2RH5A 2ZJYA 5DGXA 1AQYA 4R98A 5FL7D 1XPRA 5KSOA 2PMKA 5C1BA 3JZAA 4M0LA 3ASYA 4LSGA 1YZNA 1AKEA 1OXSC 4PC6A 4D80A 4LJ6A 4B3XA 3I5XA 4JLKA 5CDFA 1OB5A 3HU2A 1EFHA 4ZCMA 4HZUA 3TH5A 2F9MA 2AD5A 3HDTA 4PAQA 1VYVA 1YQTA 3OHMA 4TLDA 4Z8XA 1E2MA 4LY6A 2P5TB 5CJ2A 4Q4AA 5DIFA 3CNLA 1VTKA 5UKDA 3T1QA 4HAVA 3FMFA 4OQXA 2IWHA 2NIPA 4MKFA 2NTYC 5KYKA 2QP3A 5F9FA 4JLDA 2R6GA 4KJZA 3SFZA 1EXMA 5IT5A 4HLUA 2HT6A 4Q01A 4TLCA 2HLDD 1CP2A 4LGMA 3VU9B 3ICQB 2ANCA 4GI7A 1YZQA 2Y8EA 2XSZD 3RRZA 3MG9A 3TBKA 4UNRA 1J7KA 2CHVA 3B1VA 4PQYA 2ERYA 3GCGA 5FUVA 4Q21A 1GRNA 3PEVA 1II0A 2BKEA 1M34E 1VYTA 2GF0A 4PHTA 4TMXA 3C8UA 3AF0A 4OHVA 1BO6A 3MAAC 4JLNA 4JJKA 3VNUA 4QOSA 1ZNZA 1NJFA 2QNRA 5AJXA 4A0FA 1TF7A 1Z0KA 1KMHA 1SKYE 4AK9A 4Q1BA 3PJRA 2HT1A 1RJ9A 3NHBA 2N42A 2AWOA 3EZFA 4P4UA 2IYRA 4M53A 2CLDX 4QRHA 5H1YA 5CM8B 2QM7A 4G5QA 4FCWA 2WZQA 4OJKA 1S1CA 3U44A 3VR3A 5K8LA 3L82B 3U3OA 1G8PA 3Q8XB 3MWJA 5JEDA 3KB2A 4PAMA 2DFNA 2ODNA 1NVXQ 3H1TA 1M2OB 4Q4JA 4YXWA 3U60B 2WAXA 521PA 5BWMA 1LFDB 4L4UA 2W0SA 2E87A 4DCTA 1N6RA 5J4LA 1F2UA 2GKSA 2ZRPA 5DN6D 3C5CA 1RYFA 3LBHA 4WZ6A 1ZD8A 4A36A 3K0FA 2FFHA 3WP1B 1JR3D 3ZIAA 4MGZR 4KBGA 1AQUA 1A1VA 4D26A 1JEEA 4HB4A 1RKBA 5TY0A 1BYUA 1SVSA 1NN5A 1BH2A 3TNFA 2CHQA 3AGQA 2OLJA 1YVDA 5FBRB 2WJJA 1KI6A 4D82A 2PMDA 2EFHB 1CRQA 1E0SA 2JDIA 2RMKA 3N70A 3R7WA 2BBWA 2REXB 4PPGA 4CF7A 1S4QA 3CNOA 1W36B 4M9XA 1YR6A 3HU3A 1XJQA 3CX6A 5JCZA 2GEUA 3NDPA 5EXPA 1T5IA 3DPUA 3WNDA 3W34A 3L0SA 4K81B 1YKSA 4RY2A 4MRNA 3SYNA 5JWRA 1XZPA 4GNKA 1XTIA 1P2SA 4DSUA 1R5OA 1P9RA 3LQQA 1P4SA 4TMKA 1G6OA 4LV6A 4E09A 3AVTA 4LJAA 1WBBA 3NEYA 2Z4SA 1WE2A 1QHGA 4IVQA 1IXRC 2CCGA 4C0KA 4URWR 3C7KA 1OFHA 1II8B 2ZE8A 3QXHA 3ZZTA 3UIEA 4PPNA 3P27A 3TQFA 2JJ2D 4UJ3A 2DHRA 1P3JA 2VHQA 3NHAA 1COWA 3NC1C 4URZR 4DLVA 1EGAA 2QT0A 2WKQA 3AVWA 4MRRA 4OI1A 2IS4A 4PZLA 1CBUA 4OQFA 4FCTA 3AM1A 1T9HA 4YDHB 1BYIA 1U98A 4QGAA 3SOPA 3SU8A 2ZRMA 4UNPA 3GLGE 4C0BA 5JECA 1NVVR 1KAGA 3R9WA 4C30A 1KI4A 4ASUA 4DC9A 3EARA 3QIAA 3W6NA 1N3BA 1HTWA 4QHTA 1TUIA 4B34A 3FMOB 4BFUA 1WB9A 1Z3IX 3QUSA 1G3QA 2ATXA 4M1OA 4Q03A 3SC3A 3BB4A 4C2UA 2B7BA 3HYRA 2WKRA 4NPHA 3C5HA 2FEMA 4JLJA 5SZKB 5KDLA 2DWQA 2BMFA 2GA8A 1VG1A 3CR8A 4IOLA 4HLQB 4QBFA 4ARZA 2XNDD 2FFQA 3KKPA 3U61B 4QJ5A 5TB5A 4PX9A 3V9PA 2XAUA 4Q1FA 1ZIOA 1E2JA 2UVQA 2QSYA 1W4BA 1UJ2A 2HV8A 3FYHA 4AKGA 2QAGB 1NSTA 2ZEJA 5LPNA 2VH5R 1A5TA 1EFUA 5ANRB 1Z0JA 1M7HA 2O8BB 3W6OA 1TQ4A 4BLSA 1XTRA 1FTSA 1RYHA 3OAAD 3CW2A 2VP5A 1BIFA 1KDTA 1ETUA 1GRRA 2QI9C 3DM9B 4FMCF 3X1XA 4DLWA 4Z54A 4FN5A 4X8OA 1NLYA 2RB4A 4PSKA 4LV5B 2AR7A 3AVYA 3W6PA 5JSZA 2C78A 4WAUA 4GRAA 4ITRC 1CJVC 2YOFA 1TADA 1ZM9A 4GZMA 4FXPA 4M1SA 2FSFA 3SZRA 2BWJA 5FOVA 2VHTA 3PUYA 2W83A 3B7GA 3S1AA 4Q5IA 4RJLA 4PSVA 1W2GA 2FJUA 3GLFA 2VP4A 1IBRA 3W90A 3A4NA 4JLAA 3WNBA 4OBEA 1P72A 5F98A 3CB4A 2H17A 1ESNA 1DAKA 1N0WA 1NIPA 1NKSA 2J41A 1XWIA 5B30A 1G8HA 5KOYA 1KK1A 1D2NA 2HXSA 1J2JA 1JJ7A 1E0AA 4PTLA 2IX3A 3B60A 3BAFA 5CB8A 2R44A 5JJKA 3O47A 2KWIA 1CIPA 2Q6TA 3LH5A 4NYJR 2YOHA 1YE8A 2WIBA 3PEUA 5CLLA 1CU1A 1J70A 2NZJA 1Q0UA 3KXLA 4G3XA 4MYTA 3OEEA 5AR1A 1XMIA 1E9AA 5BN5A 3AVOA 1U8ZA 3C16C 4KCGA 4TTQA 5A4JA 3BIFA 2RGAA 1Q20A 3DOEA 1EFCA 2ORVA 3B85A 1TF2A 1E96A 2XZLA 1G6HA 1E2QA 2AFIE 4O2LA 1AN0A 1KY2A 3W3AA 3RRNA 2F3RA 2ZI5A 3NG1A 4LJ8A 5LBIA 3BS4A 1S3GA 3B1WA 4M21A 3JZMA 4V0MA 3TJZA 1A82A 4JBWA 3FMIA 3QKTA 1GG2A 5KNDA 1UEJA 2JLQA 1HUQA 3IPYA 1LTQA 2FFAA 5KSPA 1Q12A 1G18A 3QG5A 2XGJA 1GAJA 2F1HA 1KO1A 3I73A 2J7KA 1KJYA 5FPTA 4C9BA 1HEIA 3IQWA 1RRFA 2VHUA 2VYFA 4GL2A 2WPDD 1I4LD 2OAQ1 2Q3MA 1LF5A 4XWAA 1GL9B 3K0CA 3U7GA 1A2KC 5G3ZA 1NMYA 4D0LB 1FZQA 3M6AA 1LF0A 4F38A 1EFTA 2G83A 2IXFA 4IVPA 3VNVA 3R7WB 3TSZA 2HJGA 2ZPTX 1FUUA 3GEHA 3MRSA 2P2LA 4JL6A 1PJRA 3RWOA 4Q19A 1F2TA 4XSHA 1N0VC 1VPLA 1CR4A 3AUXA 2ZRJA 4ESVA 2FFBA 2ZU0C 3QF4B 1XDBA 221PA 1JI0A 4LHWA 4LRWA 1Q3HA 1ZCBA 2VBCA 3RS3A 4BFSA 1E4YA 2GAAA 3B1YA 3I32A 1Z2CA 4W5HA 2ZU6A 2CXXA 2BC9A 2BM1A 3QVVA 5DI3B 1I2MA 1DARA 1VG8A 4MYHA 2BKUA 2IW3A 1MV5A 2HXYA 2XITA 4KFTA 3ZD6A 3UXMA 2BMEA 1EFRA 1KK3A 1X1SA 2JLSA 4HSEA 1HT1E 2QRZA 2WKPA 1ZRHA 4EAQA 3CRQA 1RW4A 2F6RA 1DO2A 4AG5A 2XZOA 3H0KA 2REBA 4JSTA 3FKSD 1WP9A 2YC4C 1TU4A 1XPUA 4JBYA 3KB1A 3FHTA 1SXJD 2QMEA 2ZI9A 3AB3A 1KTVA 1XEWX 4Q1DA 3Q9LA 1P9WA 5LDDC 5LD2C 4PANA 2UZIR 1MABA 3IGFA 3T35A 3EA5A 1FP6A 4MH0R 2EFGA 4AIIA 4PAOA 2RGNA 4BRUA 4JLPA 1E1RD 4UNQA 1L4UA 2GEDA 1FOEB 3BFXA 4RKEA 4RCZA 1UF9A 1OKKD 2ZYWX 3ZZUA 2O8CB 4KFRA 3UK6A 3LDAA 4NU0A 3HR7A 3QXXA 4M2LA 5FBVB 3FGNA 1F48A 4PHHA 4XJXA 2WSSD 1BKDR 4KFUA 3BFVA 2RHDA 3BB3A 4DZZA 3L8YA 4A0RA 4ZCIA 4OQNA 2DY1A 3RVBA 1KO7A 2ZJBA 5EQTA 2WHXA 4X8HA 2HLDA 4QM7A 2RGDA 4OKSA 2IUUA 4HB0A 2YWGA 2XOKA 2ZI7A 1JQLB 2GHIA 1H8HD 1MR3F 1US8B 2RGEA 4U5XA 3KQUA 3FKSA 4YC7A 3CNNA 1FQKA 5HTKA 3V4FA 4QM6A 1V43A 4QGFA 2ZS7A 3K0SA 4N1AA 3B6EA 4ZIRA 1XD2A 3KX2A 4OK5A 3CWZA 4IOJA 4C0LA 1KY3A 2CE2X 4NBSA 1N5JA 1SULA 2O8EA 4BRWA 2GXUA 1DG3A 4EDHA 1E4VA 2OFXA 2Q3HA 2Z5FA 5HPYB 4L9SA 1R4AA 2WJGA 3K9LA 4D0GA 1IY0A 1Q22A 2ORIA 4XIGS 1OFIA 4NYMQ 5JSZB 5TARA 4C4PA 2P6NA 3W5JA 3IBYA 1QHSA 1Z8FA 1XTJA 3K9HA 3U7EB 4IHQA 3U3KA 2JLRA 2GRJA 3THWB 4LC0A 3RANA 4A8JC 1QVAA 3A6PC 2FF7A 4NYIR 3S1AB 1UKVY 3QXJA 1EX7A 1FTNA 1IHUA 2ZANA 1JEDA 1NN1A 1AK2A 5DISB 1FW6A 4DUGD 3PUVA 3OEHA 4QGGA 2Z43A 2J5XA 2QGZA 3EC1A 4Y0VA 1U8AA 2A5DA 1ZU4A 4TYQA 1G3IA 2OV2A 3DL0A 4DLSA 3EAQA 1KOFA 2X1VA 3DO6A 3ZZ0A 3CH4B 3JVVA 4KYIB 4BASA 5EZ5A 3HPQA 4NCIA 4D6PA 2JDID 2ZE6A 2KI5A 1G3MA 1X8KA 1EX6A 3T5GA 3FDIA 3T1TA 2XSZA 2ZVQX 5G41A 1Q3TA 3O8BA 1UBCA 1MKYA 4OHWA 5L8VA 1PV4A 5LB4A 1G4UR 1XCGB 1KO4A 3QKRB 4FINA 4M1TA 2G1KA 2FSHA 1YR9A 1G1MA 2K5UA 3T1VA 1M7BA 4YMTA 1UBEA 3ADCA 4LZZA 2AKAB 3LFUA 4C3ZA 2C04A 1X8LA 5TVKA 1JPJA 3DZ8A 5CIWA 1G20E 5HCNA 3T15A 3KJGA 4LBWA 4Q18A 1NY5A 5FOTA 3VU9A 1OXVA 1Z06A 2EYQA 2ZRDA 4A92A 3FTQA 4OQLA 4O2RA 4Q02A 3SYKA 4BZQA 4L5BA 4B73A 4JLMA 4I1VA 4YONB 4AY2A 2O0JA 4F4IA 5FPHA 3ZS9A 4DLZA 1OHHD 1OYWA 3NXSA 4YXWD 3AKYA 3PUXA 4XWOA 2JGNA 4W7SA 2O52A 3AVQA 3LXXA 1RPZA 1JJVA 2J46A 3MJHA 4JSYA 1T0JB 4IDQA 2H57A 5CDFE 4B3GA 4EUNA 1D2MA 1ZUNB 3QF7A 3AF2A 4RZXA 4URXR 5C4MA 2JLWA 4CEJB 4HDQB 3TIFA 5C46F 1E1QA 1NRJB 1RVDA 5JZVA 2OCBA 1L8QA 3FFAA 1DELA 2BHRA 2C8VA 4HLUC 4PPFA 3EG5A 4PQFA 2NQ2C 3A37A 3WBKA 4TLEA 3IQXA 4QFMA 3EZ6A 2QBYA 3TMKA 3AP1A 3AKEA 3IILA 1E2NA 4Q4AB 6Q21A 2ODEA 2GCOA 3QG1A 1VIYA 3M1IA 1E99A 1VKJA 1SHKA 2FEOA 5DI9A 3CPEA 4XVQA 3PUZA 2H16A 3D6TB 5KTYA 5JI3E 2NO7A 8OHMA 3QKSA 3E1SA 5HR5A 1N25A 5JLJA 4HATA 1QHHB 4P0TA 5AJZA 3TR5A 2OXCA 4L15A 5EE0A 2W6IA 1U94A 5EXTA 2ONKA 5IDVA 1UM8A 3EXAA 4BLOA 2JJ1D 1J8MF 4KO8A 3B9PA 3CF0A 3VR4A 1RIFA 2UZ3A 2VSOA 1VG0B 2FSIA 3LBNA 1P2TA 1QBKC 2NZ8A 2ERXA 2R9VA 3NVAA 2WWHA 3IEUA 1XD9A 4KITB 1P6XA 1LW7A 3MMPA 1YZTA 4DT1B 3AVVA 3K09C 1UBGA 2OCYC 2P3SA 5L3QA 1ZIPA 4L9WA 1DO0A 1IN7A 1QHIA 5AJYA 3UWOA 4PC7A 4FWTA 2FU5C 5FUXA 3TR0A 1HE8B 3RLFA 4LJYA 4KI0A 3QEJA 4IDPA 2IK8A 4R2IA 2ZRHA 2WWGA 1NMZA 4O0MA 3FVQA 2DR3A 1E6CA 3QE0A 1RRGA 1HT2E 2Z83A 1DPFA 1W0KD 1MOZA 1XXHB 2W00A 2ZR9A 1N6HA 3FMPB 2FMXA 1CEEA 1LNZA 1Z83A 2ONJA 4B2LA 1MT0A 4HUTA 5FH9A 3RSOA 1ZNXA 2IS2A 2A7QA 2ZTSA 2NO1A 2QN6A 5FTJA 3T5DA 1JAIA 2W2VA 4NZYA 1IOZA 1CJTC 3IKJA 2CL7X 2I1QA 4B3FX 1BMFD 2A30A 2BJVA 3SJAA 2W6JA 3F8TA 2KBFA 4JLBA 4B71A 2VF7A 3L0OA 3RS5A 4OI2A 1W7AA 2FGJA 1KK0A 1Z2AA 3O8RA 1KSHA 1GKYA 2BBTA 3SQWA 2JLVA 4A6XA 4CIDA 4NYJQ 3K0FB 2PL3A 3RC8A 5FBLB 1W4AA 4ZI2A 4LHYA 4DEYA 5DI3A 1GP2A 2AWNA 1OH8A 3EX7C 2GF9A 2P6RA 4G5OA 1I4TD 1W5TA 4NCJA 4IJMA 4JBXA 2NGRA 4DLUA 2JAQA 4EPRA 3L0IB 3PENA 4TL9A 2GXSA 1DS6A 2QMHA 4M1MA 4KBFA 1KKLA 1NMXA 2GVDC 3LQRA 3TUZC 4TZ0A 1G17A 4H1UA 3QSYA 1OB2A 2YC2C 2I3BA 2V8OA 5FL7A 2E9SA 4EPTA 2A9KA 2PZFA 1G9XA 1NG1A 3H84A 5DHFA 3LVQE 1B23P 4TQUS 3SR0A 4B35A 4I81A 3CIOA 4N0DA 1AS0A 3A1VA 2FH5B 4LJ4A 4LYJA 1R6BX 2O5VA 3ADDA 4KSCA 1GUAA 4V0ME 3SI7A 1XX6A 3GD7A 4XD7D 1BMFA 1TMKA 2D2EA 3TE6A 3B1XA 3LBIA 1V5WA 3WRYC 2G3YA 4D81A 4E07A 3A4LA 1SKQA 1ESMA 3WBJA 5FBWB 4DDWA 4BUJA 4C0HA 2B6HA 1IXSB 2C96A 1W4RA 2GILA 2CL0X 4C7OA 2ZRLA 4E22A 3AF4A
chains in the Genus database with same CATH superfamily
4PXSA 4FE4A 5FFFA 4CTKA 4A0SA 3CLTD 3KXPA 5AQ1A 1FBTA 1N9ZA 2GN8A 2CJFA 1SC4A 3B9BA 3EEQA 1JIUA 3NTLA 1H0RA 3ODPA 4R5HA 4UTRA 3CH5A 4KQEA 2Q0HA 2ZBDA 4HB3A 5JPDA 1ETHA 3HG7A 4DG9A 2I4RA 2IDKA 1KI8A 1JX6A 2V6JA 3TMYA 2YMQA 4UOQA 3ZW7A 4AU1A 1DJPA 4IDFA 4K9PA 5DLDA 4JBHA 3DMPA 4HVTA 2J0UB 1SHUX 2A0UA 3TECE 4KL8S 5KO2A 2C3PA 2YXNA 4FGZA 4UVEA 5H80A 3AVXA 1XHEA 3O0DA 2ENUA 3FB4A 3GRZA 4PZYA 3ROGA 4PZ0A 2CJWB 3TVDA 1UJ4A 1Z2NX 4P54A 4MXDA 4JXXA 3ORYA 1UADA 3AYXB 1JEAA 2CXPA 4YJHB 2EW2A 4TWJA 1FFSA 4CR6A 2M1XA 2DU8A 3PQCA 1IEWA 4UFOA 1KDRA 1SMKA 4AF6A 4JXZA 2VYQA 4RD6A 4RZHA 1M6EX 4MVJI 4WOCA 3UMSA 1W93A 5LWHA 4HAZA 5HE9A 3PITA 5FIUA 1ISJA 2NVOA 4XZ3A 4LK3A 2ZSDA 4EI8A 3I8SA 4PO8A 1BEEA 3PFFA 1DBRA 2IT1A 4PCUA 3IP5A 2ZAMA 3PC7A 3HP1A 5LBTA 4X60A 1W2WB 4P32A 5JDCC 4ZKEA 3LW7A 2FLVA 1EUYA 2EVWX 2X2PA 1YT5A 3PVZA 4G36A 4CQLB 3C6BA 1J56A 2VNHA 2EFEB 4Z4CA 5LYJB 4J0QA 1HETA 3WLEA 4Q1AA 1MDFA 4MULA 5CW2A 5FP0A 4C4ZA 2WWWA 3FE2A 2GZDA 5E4FA 2ZUDA 5CH3A 1W88A 5F51A 1NQAO 4J1TA 1TEVA 1K97A 2EJCA 5JBIA 5A7FA 1QMPA 3N3AC 4KYUA 1GQ2A 1T2UA 2G06A 4DKXA 4ETMA 5ILGA 3VISA 2BFCA 4PG8A 2CL6X 1HZJA 1G20B 1N33B 1HDGO 1HYQA 1ZIYA 1TM1E 2EKBA 5CXXA 1Q1GA 2QDKA 1P9OA 1SZCA 3LPAA 4QDKA 5I45A 2BGLA 5KZMB 1G3UA 2LW7A 4IW3B 2R1ZA 5CFMA 1ADGA 4QJ4A 2H2HA 3U56A 4JY7A 3ZDCA 3NRCA 4G9GA 2IZ7A 3PPVA 3DAYA 3L43A 2GTHA 5KNBD 1NM5A 2V4UA 3O8QB 5CUQA 2QU8A 3HY3A 1OC4A 2BHTA 2QL7A 4PYQA 3W6UA 3M6VA 1VRCA 1AVTA 5B7GA 1MB3A 1B43A 5CVCA 2QK4A 3SVTA 3FTPA 2QQEA 3E5NA 4ZVTA 1TCUA 2BONA 2BUBA 2G77B 1ULZA 4IIJB 4GGMX 1W96A 4ARZB 2BFDB 1EZ4A 1JQJC 2CHFA 2Z2JA 1Z22A 1YU6A 3F9IA 4RSRA 5B5SA 3REQB 5CH5A 4R9UC 3W5DA 2HI0A 3OC6A 2VYNA 3G1TA 1YZUA 2Q4TA 1ZKMA 4XOUA 2LCFA 5AJWA 5A3SA 3B3JA 5HQ3A 1GEEA 2QRPA 1E6MA 3Q7EA 4BO4A 4NU5A 1MEOA 3F6RA 3KL4A 2VA8A 2I2AA 3OPVA 5TQ0A 2CXRA 3RRJA 4F6RA 1ZYUA 1BWQA 1T9BA 3LXRA 4JKIA 1PNQA 3GFGA 3IMKA 3R5TA 4BEVA 1YXMA 3OZBA 2OZLA 3D2BA 3TQRA 1ZICA 4WXPA 3UHFA 2ONZA 3E2IA 4UHHA 3SJCA 4Y9TA 5IUJC 4YJ2B 4ZTUB 3N28A 1CUVA 3PLNA 4IPTA 5ARBA 3BEOA 1QH8B 3GPBA 4PQEA 1AXEA 1OA0A 2DBQA 4IFTA 2VDRB 4I6GA 4ER0A 5HJ2A 2ZM5A 3HCAA 2QMUA 4XQGA 3R7AA 4LFCB 1T5DX 1PQWA 1G21E 2WSLA 2D2FA 4FYXA 3DEIA 2BYTA 4GWLA 3Q11A 4QBIA 1DIOB 3JQ9C 5G53C 3MUFA 4QOJA 3OBBA 3U9SA 1Z6AA 2PIAA 3JASA 3K2QA 4RHTA 3WHIA 1P61B 4OJNA 4KWTA 4R1OA 1GRVA 2DBRA 3S0JA 1CLEA 3ZQJA 4MQUA 3T61A 1KEKA 3ORFA 1PTJA 4QTUB 3HJFA 3VKHA 5KJFA 4QUKA 1SBZA 3ZE2B 1ODJA 1FBNA 2PUEA 3LP5A 5HKBA 2XCRB 2QX8A 5LJIA 3D4BA 3GFFA 2WY2D 2O5EA 2G1JA 3DOFA 5EJ6A 3KQNA 4RXUA 4WN9B 5E8JA 4D44A 5EUMA 2ZSJA 2V5AA 4OK6A 1R4ZA 2WQ7A 3RVSA 5GM2A 4FYKA 2C7BA 1E2PA 1NGSA 3IIIA 1GAQA 5E7MA 3IR5A 3HA5A 4IQFA 4JODA 1WKBA 2XNSA 5T4HA 4Z51A 4WA8A 5JT1A 5JBQA 1VXRA 1V11B 2ZI6A 1ZSNA 3ET5A 4D9KA 4NE2A 3IP9A 3TKAA 1OILA 2YV4A 5JMWA 5JFTA 1QDLB 3BZUA 4FTWA 2F1OA 2ZJ7A 4UUOA 3HGQA 4V2UA 3ZXXA 2CXHA 3M6UA 3RJTA 3M34A 2G0NA 5F33A 4CFYA 1YK0A 3E53A 1AUOA 2FUKA 2XXJA 4RD3A 3HBJA 5KYTA 7YASA 4WIAA 2GBLC 2XHEA 4MCIA 3G1WA 4TT3A 3EXHA 4CQMD 4LJ5A 3WGVA 2BCEA 2I2WA 2ILVA 2P3QA 4DMCA 1JHXA 1MGOA 2G71A 1QLWA 1GTVA 1VKOA 3L1VA 4FLEA 3GW8A 5D7BA 5J58A 1L6IA 3QBDA 3K53A 2WUEA 2Z57A 2O4CA 5ALKA 5JIBA 3DV9A 1DX9A 1P4RA 5TC4A 1T0UA 1P4JA 4W99A 3K2IA 3T3HA 5CD1A 4KPEC 4LOAA 4UE6A 3T7CA 3BMXA 1DQRA 2V74B 1XXHA 4L74A 5MFZA 4DIEA 3GLGB 5KKAA 1U90A 3TDKA 3PQ2A 3VJLA 1P2UA 2CBZA 2Y0CA 3G0GA 3OU2A 5LQMA 3VJRA 4F9FA 2CT8A 2FPGB 2NUPB 3EEBA 1QU3A 4HEHA 2FWAA 721PA 1UQUA 2VHYA 4KN9S 4YCDA 1U0LA 3UMCA 2O48X 4X84A 3EGXA 3CF2A 3CPHA 1JMKC 2AZTA 3FI0A 5EE9A 3S2FA 3SYLA 4F5YA 3D5EA 1F4LA 2CK3D 2XH8A 3HNOA 4G37A 1B14A 2A3NA 4MA4A 5CX1A 4BVFA 2O50A 3EA0A 1WMSA 2O3UA 4ZTZB 1G16A 2IYTA 2SCUB 1HYGA 2LR0A 1W36D 1QC5A 3UJ9A 3VKWA 1MAAA 1IG3A 4TWZA 3VFDA 3A1UA 3CF6R 4CM7A 4N6OA 1ENYA 5EP1A 3T41A 4DCNA 5A3QA 4PYLA 1HO3A 2P0EA 2ID8A 2FMKA 3TLXA 1R9MA 2H9AA 2XUZA 3TF5A 1ZUD1 2J0EA 4DKJA 1Z7WA 3DMDA 3EIUA 3EUWA 2JLYA 2IYXA 4QXAA 4HXYA 5AWFC 1HK7A 1WZCA 2I99A 3CJRA 3JQAA 3TTXA 3DPSA 3WICA 4DTIA 4JOSA 3BREA 4CE6A 4F1JA 3BHJA 4BZPA 1XQYA 2BHNA 3ZDRA 2JI9A 2PZMA 3KEFA 3KYBA 3CWQA 4YCJA 1TM5E 2WC1A 3ONWA 3PA8A 3SZLA 3ZVRA 2YMLA 3HCRA 4M0KA 4J0IA 3W2TA 4RFVA 3K9NA 3DOOA 3H5NA 4M8NE 5BSVA 2DR0A 4ZCTA 3GGDA 1DBWA 1L4MA 5IPFA 3I3SR 2ZWVA 3ELYA 4MB2A 5FL3A 4CKZA 3JR7A 3TQHA 2A9OA 3P45A 5AFSA 4R7GA 2Y92A 3A0RB 2PFKA 1AY0A 2C4MA 2XZDA 1QYXA 3LZDA 4LX0A 2X0DA 3ZD9A 1YA4A 3HRIA 3WGKA 1CZNA 4MVJE 4G0MA 4EG0A 4GQBA 5A9RA 1R50A 1DGQA 2QRNA 5KYVA 3N8IA 4FJ1A 1N4AA 4RH1A 1UWKA 3O9VA 1H22A 4JI2B 1DJNA 4TRRA 1QIJA 1KYXA 1TKRA 1G9SA 2X9GA 1S9HA 1LVHA 3FJ1A 4QAQA 3ZI7A 5BXYA 2C5AA 2RHGB 3V7FA 1FPMA 2VAWA 3OOJA 1M75A 2XVAA 3H8WA 1JYEA 1IAVA 3IE2A 2PT7A 4MWSA 1NI3A 3L1KA 3BRSA 3FOBA 4D4LA 2C8JA 4B3BA 1G7CA 5H83A 2GTPA 4CIVA 3U0VA 4NHEA 3BJIC 4NBUA 5I7UA 1Z12A 4X7PA 5I7WA 4GMFA 4WUVA 1JFLA 4ZKDA 5KS2A 1KQPA 1CRZA 2NVUA 2C07A 3G9TA 3VTAA 2M9MA 3B7WA 4CMIB 3DYVA 3QVKA 3W8EA 1JQKA 3BPSA 4BJ6A 4RCVA 4ER5A 4NDZA 2P4QA 3LX5A 3Q41A 3VV3A 4RPGA 4BOYA 3VR6A 2OVBA 4N5NA 4OQEA 1U7XA 1I4WA 2OB2A 2YWFA 3P1JA 2OV4A 1ND5A 1X42A 3TOSA 2YINC 5NULA 3GT4A 4KXLA 4NMXB 2F90A 5DCYA 4HMPA 1IVYA 3Q6NA 1RM4A 2D3TA 1VDMA 1GFWA 2FX2A 3OU6A 3GUZA 2V1XA 4RD4A 4PLVA 2PS3A 4RK4A 3G0HA 4H2DA 3LCVB 1XXLA 1FDOA 1T2NA 3NH9A 1A88A 4MLCA 3UHPA 4R2MA 4DCSA 4CIWA 4B44A 3CVUA 3RSFA 3CURA 1XLUA 3KR9A 4L6IA 1O58A 2MIIA 4AWXA 3L8GA 1VIDA 4H7KA 4QKQA 2KE5A 1ATZA 5FLYA 1FRNA 2F43A 3O4JA 4BEWA 2DH6A 4FUQA 3ZY5A 2JAHA 5JYBA 3GJ5A 1U7OA 3B8HA 4LAFA 1U8CB 2NXWA 4G5HA 1I2DA 1DINA 3CUKA 3TJRA 1KYQA 3I6BA 3WGUA 4JC5A 3BWBA 2AJTA 5B7PA 1ZJJA 1IXZA 2PM8A 4XJTA 4XD2A 2F67A 1M33A 3DE1X 1FCJA 2LP4Y 2QJRA 3AEXA 4RD0A 3GVPA 2CXQA 5SZJA 1VMEA 5FADA 1SXIA 1CJMA 3OLYA 4EB6B 1W85A 4HWRA 4FHCA 4YCAA 3ROKA 2FOIA 3P26A 1QIKA 4CNQA 4TMZA 5B3JC 2PT5A 1WW2A 5AK0A 4MCAA 4J1NA 3VGPA 5I7AA 4WZBA 1L1FA 1RM3A 4B43A 5BP7A 1I7QB 1PTKA 1QRTA 2IBTA 3G2LA 3T06B 1HTBA 1EK1A 2CBXA 2VEDA 4DREA 3THOA 4IX9A 4OXNA 3CPJB 1DKUA 3MW8A 2FX3A 2NV6A 1TYBE 5AXAA 1YAHA 2WM8A 3IYLW 4G9BA 1UKZA 2FEXA 2WLSA 3PX2A 2OK7A 3N76A 5CFNA 4J7XA 3WG9A 2ZIXA 5TIIA 4ARIA 1Z29A 1FFEA 3JRNA 4YAJA 1QV6A 3ZGXA 4OF4A 3LW8A 3S5UA 4C6HA 3P9RA 4E51A 4OGLA 3I1YA 4BNKA 2PX2A 4WZBE 3UAVA 2D4AA 5FV4A 2FPPA 4K5QA 4N76A 2FZCA 3FA2A 4N5MA 4B81A 1Z6XA 3ZC3A 1P5HA 1OIVA 1TK2A 3CO0S 4CV3A 2IV3A 1JFSA 3LUPA 3KD2A 5HS4A 2R7AA 2I80A 4LXGA 1O96A 2GXAA 3R3WA 3VUFA 3IDQA 4Y1FA 3FF1A 4Y67A 1CR1A 1H4TA 1E6UA 3C7AA 4M22A 1IY1A 5HQJA 2V5VA 2R751 3EWSA 1ICEA 3MM4A 5AP9A 1A9ZA 1QORA 1GPDG 1SC6A 4Z0PA 5CB4A 3I28A 3UC5A 1NG9A 3ER8A 4MWOA 1S3SA 2BIFA 2Q4OA 3A1EA 3F0TA 3KUDA 3FUTA 5A4MS 1SXQA 3VI3B 2CEAA 3OF5A 4OH7A 3P9NA 2JFBA 2H1VA 1OU0A 1A4IA 1R0ZA 2JCXA 2QL9A 4KLCA 4M55A 4AKEA 3BHIA 3EGCA 3NO4A 1RXYA 2C98A 2GEBA 3DB2A 2X0RA 4PVCA 1P44A 5C1DA 1AJEA 1SUFA 3KSMA 1Y8QB 3IB3A 3QLVA 1D0VA 3ZJTA 1ZSVA 1IHPA 1NU6A 1NVAA 5ALMA 3PDIA 1S3FA 1CEQA 1G41A 1DEKA 1FQWA 3NHPA 2IEDA 2WTEA 1OTXA 1PYOA 2XOEA 2YHUA 1AKNA 3AY0A 4BFXA 1OH7A 1FVXA 1RQPA 4DB2A 3EA4A 4MLZA 4FSXA 4P2GA 1PFQA 3A31A 5DWVA 3VDMA 1Z4LA 3OQPA 4RQBA 5G1PA 2LTAA 4NXNB 4F9EA 3N07A 4NFLA 1BDBA 1XZEA 1SVIA 2JGIA 1Z6TA 3FYSA 3FPGA 3KB8A 4J7AA 5FXMA 1QRSA 2WIAA 1GO2A 1RWVA 1RWMA 2P77A 2BY4A 4L8WB 5FLKA 5JYDA 1JDTA 4HV4A 2X2FA 4P81A 3N9IA 5HRAA 3S68A 2WK1A 3V55A 3NC4A 2WTXA 4B4UA 3PLRA 1T2CA 4YQYA 2P1ZA 4D6XA 1HQYE 1DJMA 1GU1A 1N6NA 4IRMA 5E6UB 4MRMB 3RTCA 4YP7A 1HDEA 5CK5A 3SNKA 1HT0A 5K3AA 1RQLA 4IUBS 4RACA 4LBVA 3L92A 3ZBUA 5B4UA 5HTOA 2VLBA 1EAMA 2IY8A 2VDVE 3D6AA 3M1AA 1QJCA 5EQJB 3WBFA 4PSDA 3U1BA 4KAJA 1FYWA 4DV1B 1U2TA 2WYOA 3GP3A 1HKUA 1GGEA 5BT9A 3UMJA 1NJ8A 3NMUF 1Y6FA 3WADA 2GZAA 3ZWAA 5EWJA 2QAGC 2JJ8A 4WN3A 4LY9A 3FSJX 3QFSA 4ITVA 3E9RA 1BX3A 3DL4A 4D7AA 1KAEA 1ZD5A 4L16A 4G01B 3HDYA 4DV5B 1K8XB 2XBLA 2XRFA 1E2UA 1V3TA 4PLCA 4W5JA 5CGQB 5JSYA 3A27A 3NI2A 2A78A 1ZITA 1U2ZA 3KEMA 5A62A 4MUJA 2I87A 2AXPA 4P31A 4DMLA 1YKGA 5IK2A 4HGZA 4Q37A 5B58T 2B1GA 1W25A 4BP9A 2G5CA 2O7SA 4BAGA 1A95A 3VKVA 2BHSA 2PFSA 2GFIA 4KLRA 4ZOLF 3WISA 1JFRA 5J2TA 1GITA 4WBNF 2OCKA 2B1QA 3R9XA 4LF8B 5GGYA 1N6IA 1Q2UA 1QRAA 1L7AA 3LO8A 1JLKA 2W48A 1P5ZB 1BMTA 4M0FA 3RSLA 3V9AA 4F92B 2JL1A 3FTFA 1K7YA 3NBQA 4CLOA 1BE6A 1L7QA 4H4CA 3KOYA 4V2IA 2ZYTX 4AJ1A 3OUTA 3W3ZB 4FSHA 1TTPB 5A06A 4W8OA 2B8EA 1KC3A 1UMKA 1M2NA 2IIQA 3BXGA 2WJWA 4BAUA 3THYB 3VZQA 4LS3A 2AEFA 3FNEA 2XHZA 3KYDA 2P91A 4XIFA 5CT6A 1EESA 3E6AA 3GI1A 2IX9A 4NTZA 4P4NA 1QAMA 2I2DA 4YREA 2PJDA 3GMDA 4OM8A 1PT8A 2QY9A 4G56A 1GL6A 2R2GA 5JDIA 3IQIX 5KREA 4W5WA 3TJMA 1SU7A 4EVIA 4MI6A 3VAAA 3OZWA 3LBFA 1T1EA 3M83A 5EPUA 3U81A 3GDHA 4DQVA 3L7LA 4RTNA 3NBFA 4O4HF 3TWOA 2FZWA 2ACKA 3T3DA 1DDIA 2YYSA 1SKYB 2H92A 3EPPA 4B80A 1LK5A 3DHEA 4D0NA 4S05A 5E9QA 1Q44A 3N58A 3V2GA 5JMTA 4UEKA 3CUEF 3EULA 1XTSA 4G84A 3UPTA 1ZLXA 2G72A 3OEYA 5K6AA 4EFLA 4FDLA 4HJXA 1D6JA 3WGTA 2OM6A 4ILKA 1RXEA 1PUJA 1U2GA 2CD9A 5AVTA 1V95A 4IH1A 5AMXA 1FLVA 1S9DA 2UXDB 1HURA 2DWCA 3E18A 1JQ5A 3AT1A 2I7VA 3BRWD 3PL1A 3QUBA 3FLEA 4GSYA 4LXQA 3A3OA 4ZT4A 2PNJA 1V41E 4GP6A 3DE3X 2GK7A 3DZDA 1L8LA 2UUPA 4JELA 4LJ9A 2E3JA 4BQQA 4FYJA 2GD6A 3ABRB 2EWVA 3AIOA 3FW1A 4JJ8A 1TO2E 3C14C 1AHIA 4AS3A 4MB0A 1RBYA 1DQNA 2F64A 3MFYA 2PRYA 3CB2A 1QHEA 5EJ4A 3H18A 4ZDIA 3R6GA 5C52B 1RE0A 1CJBA 1VZ2A 1X8JA 1JJIA 1D4AA 1YBMA 1M54A 3HWWA 3A1CA 4MQLA 5P21A 1F8YA 3G5MA 4MJLA 1KFEB 3S81A 4H08A 1SBQA 3CVJA 1F0PA 1ML3A 1SCIA 2EFYA 3KEOA 1T2AA 4KIGA 1YC5A 2PL1A 3MELA 5EMKA 2Z9DA 3DEYX 1I0LA 3ON5A 3ZBTA 4O8ZA 2WSSA 2OE2A 1FU4A 3KHKA 1YCGA 1V6AA 4H27A 1I8TA 3LWDA 2NN3C 3A0UA 1K66A 4ZV9A 4OB7A 5SYNA 5KHOC 5LJLA 2YY5A 3IQEA 1NVVQ 1DRJA 1A5SB 3RVPA 5CT4A 1XQ6A 5AD1A 3COJA 1RM5A 4DJAA 5J4VA 2F3TA 1SG9A 3I09A 4PQRA 4WD3A 1N1MA 1OVGA 2R79A 3LPMA 4MB6A 4UHFA 3WLPA 1T4BA 5J5VA 3UTCA 3BH6A 4J0CA 1MPXA 3ID6C 3KYIB 3SKXA 3NM6B 5DOZA 5HP4A 4RVDA 2ZB2A 3HU5A 4NF2A 1MRSA 3QV1A 1W9HA 1E2HA 3BRQA 4UUBA 2QTBA 1DEHA 2QVYX 5KNLA 2J48A 2HQ1A 3EWAA 1T9DA 3AI7A 3QLUC 2A1TS 5ICFA 5JG7A 1L5HA 2B0JA 4NABA 4Q9DA 3BMCA 1KP9A 5CR9A 2MYUA 2YXEA 3H1BA 1NXXA 4X71A 3NVDA 2OQVA 5IULC 1ZJWA 2B3TA 3GEPA 1AM4D 3E23A 1QFMA 2HV9A 4FZVA 2GT1A 1SVLA 2Y2VA 3R3UA 4IQ8A 4K2HA 2OGSA 3THSA 3RS7A 2WVAA 4QULA 5LQUA 2QUHA 3SEQA 2NPFA 4HMQA 3BGWA 1JWBB 3KT0A 5D51S 3I58A 2B69A 2QM3A 1THZA 1XZMA 3L7MA 3VZSA 1GRQA 3M4XA 4PC1A 1V47A 2J87A 5FR1A 5AOVA 4CG3A 3L8FA 2C00A 3BWMA 5FI1B 3DTNA 4YIHA 1QQAA 1V5EA 4HWTA 2QM8A 3IKTA 4HRYA 3Q7RA 2VSFA 3UV6A 1A5AB 1EB8A 3HBMA 4WCFA 3D0RA 3PDHA 3AWIA 1VBMA 2AXQA 3HDJA 4I1SA 3HJHA 1D1PA 3EY4A 3KXKA 1LRLA 2BFAA 1CS4C 3HKBA 4A0GA 4HUQA 1R8YA 1EDDA 4YJGA 5IM5A 4MRPA 4LJRA 1UDAA 5CEFA 4CLRB 3AHJA 4LRSB 3HLTA 2HMVA 2RC5A 1TJ4A 3FSRA 1XNQB 1LTKA 4P86A 4NCKA 4H1WA 4FOPA 4UHCA 3N7AA 4FOOA 1WVMA 2WT4A 1FP1D 2DFDA 3F5FA 3LUJA 4Z86A 3S7TA 3WGLA 4Q4CA 4AKHA 2IYLD 2X4IA 1QZZA 3V4OA 2BMJA 2ZJ5A 1U80A 2RGWA 4B45A 2UYYA 1XJ5A 4AF7A 2RGYA 1EM8A 1SC3A 3IQZA 4FMPA 5EP2A 1POXA 1U3CA 1X7XB 1OF1A 1XJWA 5EEHA 3D2LA 5ENVA 2JARA 3MBOA 3O8DA 5CYFA 3FAKA 1Z56C 4MUHA 1D7OA 2FSVC 3IERA 3HEBA 3VV2A 3PX7A 5AVYA 2PVPA 4LQCA 2PWPA 4N3NA 1Z5ZA 4P93A 3ZLVA 4EHFA 3SF8A 4TTRA 4ARSA 1GNPA 4ZOAA 1SURA 4WCVA 2VHCA 3RYIB 4CEIA 5DNYB 2JEOA 1KZ7B 1E1RA 1G4HA 1U8YA 3IT2A 4QDTA 4E6PA 3MTGA 2R6R1 4I9HA 4LQLA 1M2OA 4HPJB 4E2YA 1XMPA 3ETNA 4MIKA 1HQCA 4WKCA 1HI9A 3I9OA 1JH9A 4C04A 1FRVA 2O3RA 4HZUB 1E5XA 1L5LA 2IIPA 4G41A 3JZFA 4M9SA 3R76A 3SSMA 1DUVG 1FSFA 3C3EA 4H9GA 2QZJA 4QDUA 3CMMA 2WSMA 3IAAA 4QT0A 5IAEA 1P2DA 2X86A 5SYAA 4ZZIA 5JS7A 5AJUA 5IVKA 1E61A 1RWNA 3U62A 4DLLA 2FWRA 1XZNA 1PJ2A 1SVKA 3ETLA 2IP2A 2AL7A 3F7MA 4R1MA 1WDLA 3SVLA 1BHQ1 2KB0A 3ORSA 2CBGA 4EJSC 4MYSA 3GPCA 2Y9PB 3EF0A 3FOZA 2N0SA 4DY4A 3CV3A 5KPJA 3U44B 1K2WA 3IBGA 4OHZA 3K0AB 1ORTA 4R2WA 3C87A 5CHEA 1W0KA 3KWLA 5AJVB 2AVDA 3CO5A 5DH9A 4DLYA 2C2GA 3SDSA 4DSZA 1GEGA 4O5AA 1RSZA 3K6KA 1WZNA 4ZRNA 2AEMA 1TYAE 4S1VA 1R00A 4HGNA 2I6QA 3CRNA 4MQEB 4PG7A 1RXWA 3KUUA 2FYTA 1ISRA 1QGED 4J49A 4JNKA 1YKFA 3OC0A 1IDN1 1LWOA 2N75A 4LCBA 4HS4A 5ARDA 2DWPA 1AS3A 1ST2A 2WJZB 2FRXA 1EDOA 4M0PA 4IX1A 4MSUA 2YQZA 4KQHA 4V0LA 4YP0A 3V1KA 4EUKA 1L5SA 1Y8ZA 1ISGA 1YB6A 5H9WA 1BRMA 4MUFA 1LPPA 3EUAA 4EFKA 2FNAA 1OFUA 5ELMA 5GADl 4G1BA 5K2OA 2G28A 3GYGA 2DHCA 4DAOA 1E94E 3EHEA 4ZO8A 2R60A 1N2HA 5CVDA 1Z7GA 4NV0A 5BW6B 1JG2A 4NCHA 4S0XA 4XRGA 5HQ3B 2IPOA 3R20A 4XB6B 5ER9A 4B6GA 1TRHA 2VPTA 3OCVA 1PHRA 1I6KA 3AR2A 3H99A 4I4NA 5DNAA 3W5SA 1YHYA 2C58A 2HH9A 2QV7A 3FWZA 1ZEJA 3OX4A 4LOKA 3RH0A 4D1YA 5GTDA 1TUGA 5KTMA 1SR8A 4DXHA 3UJBA 1MQSA 5HZHA 2JS7A 3CEMA 3D8SA 4YWJA 3W5HA 1VPEA 3DULA 3ND5A 1PN3A 3PBKA 4DRYA 1XRQA 3NRBA 3H0CA 4GOJA 2V3CC 2VJBA 1HFKA 5K7SA 3PNSA 2NTEA 3PNVA 4RF5A 5KVSA 5AI8A 1P4GA 2OMKA 4TL7A 4MVWA 5DEIA 4HWOA 2LKCA 3SIRA 1RFLA 2BBOA 1H65A 2I8LA 2XUJA 1EJ2A 1Z36A 3NOOA 3UJPA 4AX4A 3L7OA 1NP3A 4Q05A 1Y82A 1L1QA 1VHDA 4ZYLA 1RLJA 4QNNA 3IPCA 4J0KA 2GWHA 3OMWA 4PZZA 4XGIA 5LD2B 3THYA 1F06A 3R77A 5FQOA 4BN0A 1B73A 5JLAA 3WWZA 5G0SA 2Z09A 1JZSA 2QLJA 2HBRA 3FDZB 4WSOA 3SMVA 4AJLA 1DAEA 4D3DA 2XB2A 1GUZA 2QE7D 4OHFA 5AI5A 5TS3A 2H8GA 5CBKA 1PV2A 2C9YA 1P2VA 2VPQA 2Q1TA 3T7AA 1F6WA 1QGUB 2HLHA 5IZCA 2ZSIA 1ZQ9A 4OU4A 4FBMA 5JRDS 1G19A 5K8JB 1VCMA 1M2FA 1IJEA 2BCJQ 2OSBA 3GO4A 4D2IA 4ZGWA 1X1RA 4Y9SA 3Q1KA 2OHJA 5T67A 2C94A 2FRVA 2HRDA 4KGDA 2ODBA 4P4SA 2FR8C 4HH0A 4Q3OA 1P6UA 3I04A 4GEKA 4KR9A 3SQMA 2MINB 4DWJA 4WKBA 3O1LA 1QIFA 1UBFA 2Y1DA 3Q4GA 5EOVA 3UVEA 1KFKB 4KX5A 4B7CA 4LSWA 1YC2A 4DQDA 3SHVA 4PQGA 5T3YA 3QMMA 3TK1A 1JFTA 1NR1A 3FHCB 2JCGA 1XDUA 4HOYA 2MHCA 4KE8A 2BF7A 1POWA 2ATIA 3DLIA 3LDFA 3SF8B 4E15A 1FP7A 2Y1FA 1V45E 3JRXA 3HR8A 5D7NA 1PRYA 1XROA 4PV7A 1Q1BA 3I1JA 4ZEOA 2J9YB 4UKDA 1XUOA 3NUZA 3JAKB 3V97A 4AYWA 4CI0B 4EW2A 4KR7A 1JR6A 4EJ0A 5AKYA 3B9QA 3WLTA 4YJ3A 4DSNA 2FW1A 1DFHA 1E98A 1N2CE 3GV0A 4R01A 5IFLA 1J9ZA 1UZLA 3DO5A 2BEWA 4GOLD 1RAFA 3I01A 3UMVA 5LQJA 4ENTA 2IODA 3D64A 2QUJA 2X8JB 3PTZA 4NEGA 3GDFA 4M1YA 3L8HA 4IM7A 1YDEA 4KLNA 3DZJA 3IUBA 2WIDA 4WJLA 4HWSA 3OMXA 3C4QA 4Z6KA 2Z6AA 4NZ9A 4JQOA 3CLUD 3RAPR 2B20A 2VTKA 4RZIA 6PFKA 1Z4OA 2IZZA 2OFOA 2ZJ2A 1ZWLA 3H11B 3LRTA 5LYJF 4QZVA 3MOGA 1M1YB 2W2PA 1W5EA 5L53A 1WLYA 4QTTB 4EZEA 3DWGA 3AVYA 9GPBA 3WGMA 4NZPA 1A7KA 2P2CA 4MP3A 4OGGA 4E5UA 2ZETA 3AR7A 2D5CA 3SEAA 5HIAA 3QNUA 4KDFA 3EMDA 4IKPA 1IZYA 4KQKA 5BURA 4M8LA 1XZDA 4TWIA 3RTAA 3BQ9A 3GMTA 1JWLA 4YRTA 5G0WA 2YVAA 2G1PA 4DNXA 4A6PA 1I9CA 1TCCA 3CZPA 3PB3A 3Q98A 2C0CA 1DWPA 3PCXA 3PIIA 5NLLA 4Q9HA 3VR2A 2QJOA 4ZEWA 4U6SA 5K6AC 2YZ2A 3AEZA 3RRYA 2HJHA 1P39A 1P62B 1OAAA 2JJQA 3GVXA 1L6RA 2M6RA 4LYGA 3U2QA 5KUTA 1IL0A 2D1SA 4YI5A 2FUEA 3TTUA 3A6EA 3IAUA 1OZGA 1EUCA 2JHFA 2Q2OA 3D6MA 3B2QA 5DJ5A 4QFBA 1NBOA 2I6GA 4GBMA 8ATCA 1U31A 3FDFA 3GPLA 4ZI3A 1ZD4A 5ICCA 2Q5CA 1E9SA 5CVUA 2JFXA 3IHLA 4BX8A 4NPAA 1EG7A 4H16A 1GKKA 3KSZO 1R10A 2X9VA 2CY0A 3ZZMA 4DIDA 2VJYA 1JN0A 3R5FA 1H2XA 2VRCD 1W1WA 1FMLA 2P3OA 3N39C 4FZRA 3L9WA 1E18A 3S70A 1YZVA 4ZJYA 4LYDA 1CY0A 2WDZA 4JP3A 3ROEA 2AQIA 5EC8A 4Y6PA 3GJTA 1FL9A 1CE8A 1ZSYA 2Z2ZA 4Q9NA 2XE7A 1P0CA 2RAFA 2BGKA 4E1VA 1NX9A 1L7XA 2VDMB 2AE1A 1DOAA 2WINI 3C4JA 3DWIA 2Q6IA 2FMIA 2NZUG 1ZHFA 1QZ3A 2ZATA 3L5KA 4KN8A 1KE1A 5IXJA 4XLLA 2GLTA 1YDMA 3AUYA 1WPRA 1YS9A 2D8MA 5EE3A 3U9LA 1PNRA 1X92A 1U9IA 3ZIAD 1EA7A 4W8GA 4KO1S 2GESA 5C51B 2R6JA 5ADVA 1NNEA 1FNMA 5JAPA 4ISCA 2XQGA 4GSKA 3PI7A 5C1OA 3Q8LA 2J9GA 2W98A 1EFRD 4R7ZA 3TFQA 5FPKA 1NE7A 3IV9A 2IXDA 3IUSA 3RBAA 1DC7A 1C8KA 2SECE 2V4ZA 1PW7A 4KXVA 4X1IB 3SSOA 4DVJA 2HAEA 4ZIRB 1FF9A 3WGQA 2FMFA 2WJIA 4X3OA 1CSEE 5ERYA 4KQCA 5LCXA 4A82A 4C1BA 2EBFX 3HKEA 4TTJA 1N7HA 3R3HA 4ZODA 1S02A 3NOQA 3HJCA 1KRHA 4XH9B 3TVTA 3ZE0B 1HDCA 3P97A 4KDEA 3ZS8A 2D1FA 5I4BA 2FE1A 1HMPA 3OLVA 4RZ2A 3VKFA 1B26A 3NTRA 4ZO4A 1SM4A 2VF8A 1PBNA 4EKIA 2IVZA 1WY7A 3PIRA 4HB2A 4R2KA 1SXHA 3SMQA 4XTCS 3K1JA 4IVRA 1TEHA 1P31A 1V1MB 2XNKA 2KS6A 4RORA 2EC5A 4N5DA 2BUCA 4YALA 3WO1A 4IJKA 5CRIA 2AXEA 5TRTA 3A4TA 4OD0A 1OWPA 4N8SA 4F96A 1OZHA 3N5CA 3BGIA 1U3GA 4IMJB 5EIHA 3RGGA 1AQNA 2ZG6A 2OC4A 5FKJA 5JARA 2OO7A 3EVGA 1BW9A 1E79A 1IAQA 3A1WA 3WWPA 1NVEA 2YWEA 2PUAA 4KFSA 4DAEA 2W2KB 2PO7A 4YBZA 1NPDA 5T5QA 5I9MA 1OSNA 3HMKA 3ORHA 3WYAA 1CYEA 3CT6A 1G2OA 2WIKA 1F7VA 3BCUA 1V9CA 1QHYA 1Y7IA 3LT1A 4HAUA 4WDRA 3KAPA 2IA5A 1M73E 4QFDA 4UEQA 2QN1A 2ZJ4A 2ADOA 3AHEA 1XEAA 3AHDA 4U3JB 5LQRA 1F3OA 2W4MA 3R23A 3IEPA 2EFDB 5BVHA 5B1HA 3M6LA 3CLSD 3AR8A 3LU1A 1B6RA 3JWHA 4H31A 4LJ7A 1N2BA 3NIBA 5EZ6B 4NZZA 3DMRA 4MKGA 2ZR7A 1RCFA 1X94A 5D6OA 2AI1A 3GLHA 1IHDA 3RAJA 1SKAA 4D3ZA 4K1LA 5MGBA 1SUEA 1DBVO 3U4CA 2BZSA 4GECA 2Q1SA 3OE1A 3QEOA 3ZD7A 2R7KA 3H1AA 3TSAA 1T24A 4YX9A 2JGRA 1PVOA 2BMDA 3TD9A 1NW9B 3KOXA 4L4ZA 4NCNA 3P2KA 3ZVNA 1LLDA 4N8EA 4C7VA 2J9RA 4BTEA 3PXDA 3TD6A 4JN6B 4DW8A 2H7CA 1CDOA 1RC8A 1ZG3A 4HQOA 4IWNA 2BEKA 1VCHA 3GP5A 4KSYA 3V4SA 1IOWA 4R2JA 1Z34A 4TV8B 4CL8A 3BDVA 1TA4A 4CM8A 2R2AA 5L7TA 4D02A 5JC8A 3U4GA 4XE5A 3LLMA 2IE0A 2R97A 1P9NA 3CPSA 2AOVA 2RK4A 1EZZA 4Q66C 4Q3CA 1E2LA 4EQ6B 3B5JA 1YRAA 3QBJA 4AKIA 2GVZC 3VZCA 2P9ZA 3E3NA 4NIMA 4Z7JA 4R2XA 4R5MA 4MVJP 1KY4A 5A0VA 3EC2A 4HEJA 5SYMA 2QMZA 2XGSA 3L2OB 4OJQA 1SQGA 3LLUA 3MCVA 2PG3A 4YAOA 4M49A 1FX0A 1RZVA 1V6SA 1YBVA 2CFIA 4D9GA 3FOAA 4X93A 1II8A 1CUWA 1XRJA 2H59A 1F6BA 2YJ3A 1S2IA 4P3YA 3I61A 2I54A 5EHNA 3FDJA 2B98A 3QPWA 2V7BA 3JAWB 4NOLA 1KBOA 3WB0A 3WMRA 3AFHA 3GJ3A 4D3YA 3TCKA 3WQQA 4NY1A 3EEFA 3HSYA 3UC9A 3I6YA 1TKAA 1VGVA 4G5GA 5AW9A 4OK3A 1HLGA 1MJNA 3LO5A 3TINA 3PEYA 1XF9A 1QANA 1ANKA 1PLJA 1PR9A 4JI0B 1F9AA 4BO5A 4UULA 2ZWIA 1Z4IA 3FSGD 3WB1A 3I0MA 3JYNA 1YIOA 4HTAA 1ISMA 4BUCA 1KSFX 2VJAA 4GF5A 1QHXA 1E9EA 4KUHA 4EUFA 3FB1A 4D4KA 5JNSA 3MXOA 1EP3B 1H6DA 4WTOA 4NOJA 1JPUA 1UXHA 3KKQA 5TSDA 4FK8A 3V46A 3C74A 4LN1A