2VSXA

Crystal structure of a translation initiation complex
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
382
structure length
366
Chain Sequence
QIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Yeast Eif4A-Eif4G Complex: An RNA-Helicase Controlled by Protein-Protein Interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation/hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE EIF4A
total genus 120
structure length 366
sequence length 382
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA02
1I4DD 1XB2A 4HB3A 1IN4A 4TQAA 2DHRA 2UVQA 3EC2A 4M2LA 4TQUS 1HT2E 3F8TA 4LHVA 2B8TA 1E6CA 1CEEA 2R62A 1P9WA 2QORA 4B33A 3BK7A 2DWOA 3FHTA 2R6GA 1OXXK 2BIFA 2EFDB 4C0LA 2FFHA 2J1LA 3BFXA 2ODNA 5G3ZA 4UXJA 2QE7A 1E2PA 2ZU6A 1XWIA 5FOVA 4C2TA 1Z08A 1A7JA 2RGGA 3REFA 5JEEA 1EFHA 3KKNA 3DPUA 2I4IA 3HYRA 2PJRA 3AB3A 2VP2A 4JT4A 3AKYA 4V0NA 4URWR 4ZKEA 1OT3A 1OKKA 3PEWA 4OHVA 3NEJA 1W36C 3CBQA 1OSNA 1LTQA 4XD7D 3C4JA 2GF0A 1E4YA 3I4LA 1MV5A 1W47A 5BYJA 1G4UR 2GCPA 2P6NA 4B71A 1FPMA 3SYNA 3GLGB 3Q5EA 4D2IA 4LJ8A 3IO5A 4XVRA 3BC1A 2ZEJA 3AVUA 5JWRA 1E1QD 4CVNA 1WDTA 2V7QA 4D4KA 2AWNA 3QPVA 3TGPA 2R9VA 1XDBA 2YWFA 4A2QA 5KU1A 1U0JA 1GL6A 5FTNA 5TARA 4M1TA 1Q1EA 4Q00A 4KU4A 3T1OA 2PCLA 1VG1A 1OHHD 3B6EA 5AUNB 4DT1A 1W36D 3L82B 4TLDA 4RZXA 4LV8B 3QKTA 4Q9HA 3K70D 4EPRA 2PJZA 4YONB 421PA 3E2IA 1IN6A 1IY0A 2VQSA 5DN6A 1XEWX 2ZSEA 3VU9A 4O2RA 3A1VA 2FG5A 3VHXA 2VHJA 4MGIR 1CR2A 2HUPA 4A8JB 4IDPA 4C0BA 2YKGA 1U94A 2KBFA 2GVDC 4TTRA 3C41J 1X6VA 4KAXA 1FMLA 3K0CC 3LA6A 2OV2A 3U44B 1RRGA 1VHTA 1KKLA 2C03A 3CB4A 4I1VA 1SXJC 4JYCA 4B43A 2BHRA 2Z43A 2YC4C 2ANCA 2BMDA 2OCBA 4KVAA 2IS1A 3CONA 3SC3A 3BS4A 1D6JA 1AM4D 2VPPA 2V55B 2OE2A 2JJ1A 3GLFA 2NQ2C 1ETUA 2ZJOA 4HLDA 1E0KA 2JIZD 1IJEA 2ZI6A 1BO6A 2YC2C 3WNBA 4ABYA 4BFTA 1LW7A 3GLGA 4AKIA 1YZUA 1Z0FA 4FXPA 1Q22A 2GXAA 1G8FA 1VYUA 4M1WA 4PSVA 5L3SA 3EIQA 1GG2A 1ZUNB 3QPWA 1ZU5A 2QNRA 2GJAA 5L3QA 3PVSA 3UXMA 5JHHB 1T5LA 1ZP6A 2IK8A 4Q4HB 4NYMQ 1SVOA 2ZRJA 4B2LA 1PLJA 2IYUA 1KO4A 3PENA 4BLOA 5J4KA 5AUQA 2VP4A 4B48A 4JVLA 3NC1C 4ASUD 2DCUA 4PR0A 4AYXA 1BKDR 2AWOA 2Q6TA 1TQ2A 3H86A 4TL9A 3ZIAA 2EU8A 1NIJA 1W5SA 5FTJA 5AR1A 4TYWA 1W0JD 3IPYA 4A36A 2O8CB 2BC9A 4MKGA 1JR6A 4BECA 3O8RA 1TPZA 4OK3A 2WMNB 1OIXA 2XAUA 3EPJA 4TZ0A 5SZHB 3BE4A 3FFAA 3HJNA 1E79D 2J7PD 4IOLA 3SHFA 5CLLA 4JLBA 1YZQA 3UMRA 2QMHA 4X8MA 3BH7A 1MO3A 1CR4A 4BE7B 1D8TA 3RABA 4MRVA 3UKDA 3LH5A 3UG7A 2IA5A 2O8EB 1Q3TA 1W2GA 5JJIA 4GT1A 4C0HA 1F2UB 4BZPA 4C7OA 1QHNA 4Z54A 4UNNA 2J59A 2D62A 2QP3A 1W49A 2ZJBA 5FUYA 4RZ2A 3CF0A 4IJMA 3DEFA 3EZ6A 3K9NA 1XMVA 1GNRA 4NCHA 4ESHA 3GQBA 3ASYA 4NPHA 3AKCA 1GRQA 1XEXB 1W4AA 4LHZA 4GPTA 4U02A 1GILA 3I5YA 3I8XA 5HE9A 4MRNA 2YWEA 4D25A 2QSYA 4LJ6A 4B3GA 2G0TA 3IIMA 3BFVA 1IOZA 1V43A 3DDCA 1CLUA 3GFTA 1Z0KA 4TL8A 4QJ5A 4DIDA 4DDWA 1G16A 3TW4A 3VHLB 5EQTA 1U90A 2BEJA 3GP8A 1EFCA 3QXXA 1IY2A 1LFDB 4M9QA 5KDOA 3AKEA 2F43B 4RFVA 4W5HA 1TADA 4UXIA 3Q72A 4M1YA 4Q03A 4KSCA 2ZRLA 1NN1A 2C04A 4W7SA 2HF9A 2FWRA 2KBEA 5BYKA 3CRMA 3TJZA 1E2EA 1PZNA 1Q44A 1CJMA 1IHUA 4OI4A 4YC7A 5TY0A 3OFND 1W4CA 5JBQA 4HB4A 2PZFA 4K81B 1L4YA 1W36B 2GAOA 4IOKA 4MGZR 4Q1BA 4MDEA 4G1UC 3W8NA 4M53A 3UIEA 5BXQC 4LYFA 2EFHB 2PMDA 2VLIA 2IUTA 1RRPA 3L8YA 5KPJA 2NIPA 1PLLA 5F2EA 2IBMA 3T34A 1II9A 4OQFA 1KJZA 1NRJB 1T5IA 4WA7A 5GADl 4TN1A 2CCJA 3R9XA 3P4XA 1SVKA 2CHQA 2XTNA 4V02A 2ZR9A 4B34A 1OH5A 4M1OA 1P60A 3AGPA 2JLVA 4EPVA 3EPHA 2BM1A 1GAJA 2C95A 4XVQA 2QZ4A 2OBNA 3I61A 2CL7X 1Q1ZA 5FTMA 2ZYVX 4E09A 3EZFA 3NVAA 4DLYA 1P7CA 4PO8A 3L0SA 4MYHA 5AJYA 1GVNB 4AKEA 1P5ZB 1E98A 2YWHA 4GOXA 2DYKA 1XTJA 4A4DA 2HXYA 3RDPA 1ZW6A 1IXSB 4B2IA 1G3RA 1S9HA 2IS6A 4ERNA 2B6HA 1ZIOA 2FMXA 3L2OB 1MRSA 3D6TB 3THOA 1BYIA 4LC0A 3K70C 3K09A 2PLRA 4G01B 3WRYC 4LSGA 5DI3B 4ZCMA 2PEZA 2IC5A 2G88A 2FX3A 2ORVA 1J8MF 4LBZA 1HEIA 1RE0A 1P2VA 3TSOA 2FSFA 3VQTA 3LAWA 4DLWA 1NVVQ 3QF7A 5B30A 5A4JA 2PT5A 2H1LA 3QENA 1F2TB 1AQYA 4WZAE 1SXJB 2B21A 4PAOA 4BFXA 4EFLA 3LVRE 2DWPA 3KJGA 2RGBA 4H1VA 2HCBA 3C5HA 3RAPR 2W6JA 4E03A 1AS0A 1S96A 1G7RA 4DCUA 3T5DA 1NVUQ 2V4ZA 2VIIA 3VNVA 2GEDA 1D5CA 1DEKA 1RZ3A 1UBGA 1X1SA 2FFAA 2QN6A 3TR0A 3VKWA 1NNEA 4JVMA 1T9HA 1UBCA 1M8PA 4B2PA 2Q9AA 3MD0A 1UDXA 2ZAOA 2OUKA 2WOOA 1AS2A 2C9CA 1RJ9A 2RKOA 1XPUA 4NYMR 1E1QA 3IILA 2W2TA 3OEHD 2JLXA 4XWKA 3ECCA 4CZ2A 2C99A 3GLFE 2YOFA 4M4SA 2XNDD 3T06B 1CU1A 2HCJB 1Z28A 2IXEA 3MWLA 4M9SA 3LNCA 3OIUA 5TDHA 2IYWA 2BKUA 2FFQA 3DZ8A 4A2WA 1UKVY 1OJLA 4JYBA 4QGGA 3DKVA 4KJZA 2O8DB 5E7MA 1Z22A 1EG7A 4Q47A 1N6OA 2JJ2A 4C4PA 1DTSA 1RC8A 1A82A 3RNLA 4ITRC 3UWOA 1GZSA 2BBSA 2D2EA 3U2QA 2I3BA 4I99A 4P4UA 1YQTA 3X1ZA 2REOA 1E69A 4D4LA 4JJKA 4P33A 1KI3A 4URVR 4Z51A 4JL6A 1BH2A 3V4FA 4ZDWA 3QQ5A 4GI7A 1HA3A 4BLRA 4KYUA 1XTSA 4W5WA 2V3CC 5FI0B 4Q7KA 1L2TA 4NCIA 2D06A 4FWTA 2O8CA 1E2MA 1N6KA 2J3EA 1NY6A 3P1JA 1KI7A 3A1UA 1E2FA 3TVDA 4EFNA 2H17A 4A8JA 4M9XA 3QSYA 2WWHA 3SJBA 2CHVA 3AVVA 1JJVA 4JLPA 1P4SA 2ERYA 3B2EA 3EAQA 2ZUDA 4FD2A 3CRRA 3K0FB 2J0QA 5CK4A 1K5GA 3VTKA 1KK2A 4U00A 2OLJA 1VIYA 2ANBA 2DPXA 1Q3HA 4AI6A 1ZIPA 4E22A 5GVSA 4TMWA 2H57A 4HUQA 4RZUA 4HYYA 1MABA 2ATXA 1ZM4A 5CM9C 5FH9A 5F9HA 5G53C 4BFVA 1OH6A 4ESVA 2JJ1D 2A5YB 1J8YF 4MRRA 1ZVQA 4CT5A 1YHNA 2UZIR 4ZPXA 3FMFA 4PHHA 2GXQA 1P6XA 2OM2A 1CJTC 4D82A 1DO0A 4OJQA 2H16A 4WZBE 5JEDA 2OFOA 3DM5A 1S1MA 5FPSA 2G83A 2GNOA 1JQJC 3B8HA 521PA 3DM9B 3ZVRA 1RRCA 3BB1A 4DUGD 2O0JA 2GBLC 2UZ3A 5KPDA 1RPZA 3SR0A 3FWYA 4ASUA 4C9BA 1G17A 3IHLA 3EZ2A 2MSEB 2QPOA 2C9YA 2F6RA 5IK2A 3J81k 5JECA 1UAAA 4PO9A 1E9RA 4A1FA 5BN5A 4WW0A 1QVRA 2HJGA 4DUGA 4I1UA 1EWQA 4A82A 2WAXA 1GDDA 4BZQA 3Q3JB 4ZKDA 1R0XA 3WP0A 1DG3A 3QXHA 4H9GA 2RMKA 4NBSA 3GJ5A 5JLJA 5JJLA 2QGZA 1ZNWA 2GA8A 1NBMD 3CX7A 3GLHE 2DFKB 1QBKC 4RD3A 2HT1A 1HY3A 3TR5A 3BJIC 1KJYA 3A4LA 4BFYA 1E96A 4TLBA 3REGA 3QEOA 5F98A 2QQ0A 1L8QA 2C77A 2IYSA 3ZJYA 1WP9A 2ZM5A 4RCYA 1SKYE 3U7EB 4JIMA 3E70C 1Z0JA 3R9IA 1TAGA 2IEYA 4GZLA 1M1YE 3K0AB 1XD2A 1E2JA 2CE2X 2QENA 4A0GA 1EX7A 1Z6GA 4P3YA 1LS6A 2VHQA 3MCAA 2AL7A 2EW1A 4IXMA 2FU5C 2ZSDA 5AJVB 2NZ8A 1W5TA 1HE1C 1NBME 1N0UA 1YZKA 4IVRA 4HUQB 4QC2A 2ATVA 3CRQA 1GM5A 1E9AA 5H8WA 1BMFA 3DL0A 2OXRA 3U6BA 2HLDA 3SBDA 5JRJA 1I4LD 2RB4A 2WIBA 3OESA 4HDCA 2N42A 3DOFA 2BMJA 2E1RA 3K0FA 1I4TD 1WA5A 2Q3FA 2FZ4A 1NSFA 2WBLC 2RHMA 4P4SB 3RS7A 3K9LA 3D3QA 3GJ3A 2DY1A 4NL4H 2V7QD 1OLOA 3ADCA 2ZS7A 1DG1G 4I81A 2WSSD 5JWOA 2VF7A 1AJEA 2QAJA 1YKSA 4B44A 2RGAA 3MMPA 4TWZA 1DAHA 1E9BA 4TLAA 1P62B 1KI6B 1XMSA 2P5SA 1ANKA 1IXRC 3H4MA 5EXPA 1F5NA 2EQBA 3KL4A 5IT5A 2HV8A 4AURA 2CK3A 3KQHA 4RSGA 2Q3MA 4CIDA 4C7OB 2OEPA 1KI8A 1VG8A 4M9ZA 3ZZUA 4F4JA 1UF9A 3OEHA 5K8TA 3SN6A 1KDOA 1P2UA 3BB3A 5F9FA 2CL0X 1H8EA 3KX2A 1TX4B 1E2GA 3WRXC 4Q1CA 2JLZA 1KI1A 4G5RA 3ZQJA 1KIMA 2VHUA 3MJRA 4WIAA 5FUXA 2XITA 5C46F 5JCPA 3QEJA 1AZTA 1TEXA 1VCOA 2WZQA 3T1QA 2OCAA 2WSMA 2ZRIA 5TB5A 3W3ZB 4RD4A 3HWSA 1NBMA 1BYUA 2F7SA 2EWWA 5EXSA 1XPRA 1CRQA 3KUCA 2GRJA 3K0CA 4IDNA 3FKSA 1B23P 1CULC 5FR1A 4QGFA 3TW8B 2GJKA 1UPTA 4GP6A 3SOPA 2D7DA 4KCGA 4LJ5A 4NMMA 4P31A 3BGWA 5TV2A 4GP7A 1N6IA 1WRBA 4LC1A 2BMEA 3SJCA 4XJXA 2OFXA 3RRYA 4JBYA 2ORWA 1OFIA 5E95A 1KDPA 3BERA 4PQRA 4CRWB 4Z1MD 1ZU4A 2O8BB 2VBCA 1Z0IA 1OB2A 4FCWA 4CDGA 2VYFA 4TYPA 5GJVC 3QVVA 3QIAA 2G0NA 2PEYA 1QHXA 3OFNA 1N5KA 3ADKA 1J2JA 1XMJA 3AF2A 4Q5IA 2XJ9A 5H70A 2SHKA 3EW9A 4F4CA 2WWFA 4BEBA 3BH6A 1OIVA 1ZMXA 5IDVA 4DSTA 2WWWA 3RRMA 1SKQA 3X1DA 2AD5A 2H18A 3MRSA 2ZS9A 2DWQA 3CH5A 3B78A 3O8BA 4ZDKA 1G3UA 2MMCA 2REXB 4I4LA 1UDWA 1M6NA 3E5HA 1KGDA 3W6PA 2CLDX 4HLUA 3SNHA 4DLXA 4Q21A 3WNCA 3IO3A 3IQXA 3DO6A 5EE5B 2V1XA 2P0EA 2WHXA 1Q12A 3RS4A 4B6EA 2BBTA 3I1FA 2QPTA 4Q1DA 1PUIA 2G6BA 5EE1A 1QG2A 3D8BA 2LWIA 1NLFA 3UPUA 4EPTA 2FDCA 4GNKA 3KXIA 1JB1A 4ZIRA 1ZNYA 3D7MA 1JAHA 4I1OA 3P20A 4HAVA 3ZD7A 1NI3A 1VECA 4B3XA 2QRNA 1JJ7A 3A1TA 3OE7D 1TUEA 5DH9A 3K53A 1GOTA 3BAFA 5JMTA 5CB6A 1YRBA 2F1RA 4DT1B 1G20E 1SKYB 1E94E 4NH0A 3OAAA 1GTVA 3WNDA 3DMDA 4TLCA 1UKEA 1NN0A 2J7PA 1E79A 1QVAA 3LW7A 4JBWA 4N0EA 5UKDA 5JFGA 2I1VB 2PMKA 1ZJ6A 2R6DA 3K9GA 4MDFA 4CEJB 1IBRA 1XXHA 2GCOA 2WWGA 3LFUA 1NJFA 4C0JA 1QDEA 3QXCA 4MKFA 1C1YA 5CYOA 1U8YA 2GBLA 4KFSA 4AYWA 1W0KA 2BBWA 2JATA 5KOYA 4LJ7A 3B85A 1ZC4A 4YXWA 2R6AA 1VCMA 4CGZA 2AX4A 5D3MA 3IIJA 5KSZA 2AFIE 3QXJA 4UKDA 3C15C 3DKPA 3JZAA 4JLVA 5K8IA 2WWYA 5JSZB 2ZSBA 2EFGA 3FKQA 3HU1A 2GXUA 4LPKA 5KSPA 4YLGA 2YWGA 3NHBA 4BFSA 2F1IA 1KI4A 5FBLB 4Q9JA 4LBWA 1NG1A 3VX3A 1KSJA 1N25A 2OSBA 2ZRCA 3T12A 3TUZC 4HAWA 4C2UA 1Z2CA 4QL3A 4FMDB 1YU9A 4R9UC 1Q1BA 3RS2A 3IGFA 2FPMA 2F3RA 4DDUA 3TVTA 3VKGA 2KSQA 5C18A 4G5OA 4PC7A 5CLQA 4M1SA 1S1CA 2PL3A 1JI0A 3PQCA 4BPBA 5KO2A 2ZYUX 3NC0C 1DELA 1E2QA 1YZTA 2QTFA 1ZD8A 2BJWA 1P61B 3ND9A 4KYIB 3LX5A 3LQRA 4EQ6A 2ZXUA 4OQNA 2IS4A 3NTUA 2QSZA 1F6BA 3PG5A 5LBIA 1FW6A 1T3HA 1TUIA 1II8B 1P2SA 4JSYA 1BOFA 5CIQA 5TVKA 4LWZA 4KFUA 4EJSC 1GL7A 1T6NA 2GHIA 5DISB 1QHIA 1WBDA 3BH0A 2ZI7A 4DBLC 3NIBA 4AK9A 3QG5A 4TQ9A 2FSIA 3P26A 3HPRA 1EESA 4HLUC 4HLCA 3MG9A 3KJEA 1E9FA 3MWKA 1G8GA 2RHDA 4OKSA 3GLIA 3QUSA 3GMTA 3ZLJA 4NU0A 2OAP1 4AG5A 2FNAA 3CUEF 4BLSA 2QMOA 1VG0B 2CK3D 4BLTA 3SQXA 2YOGA 3V00A 1C9KA 4X8OA 2ZRFA 4PC1A 4JKYA 4UJ5A 4XWOA 1LB1B 3W34A 1E0AA 4US0R 4QM7A 5FPYA 4QBHA 3AQ4A 2GEUA 2ZI3A 4FMDF 4QRHA 2IYQA 4DB4A 1II0A 1U8AA 4JKIA 3QKRB 1TNDA 2AXPA 1YJ5A 2GXSA 2QAGC 3LV8A 5AJWA 2ZJ8A 3U3KA 3LQQA 3LXRA 4JLAA 1HH4A 5L3VA 3NBYC 5FOSA 5ANRB 2Z4SA 1KMHB 2CCKA 2IWRA 5L3SB 1PV4A 1XEWY 4O0MA 5DHFA 4HSEA 1WB9A 3RYTC 3CX6A 3PFIA 4D6PA 1EFTA 4QHSA 1ZINA 3CLVA 4TYNA 3PXGA 3FHOA 1BMFD 1Z3IX 3CRW1 5J47A 4ON9A 3CW2A 3GLGE 4CEJA 4XWAA 1N3BA 4HAYA 4WXRA 1K6MA 1G41A 1N0VC 5FOWA 3WHKA 4LOAA 1G1MA 1XX6A 4OYHA 2ZJZA 1KNXA 3L0PA 4JVNA 2GETA 3I72A 5F3WB 3VKHA 4KFRA 1NP6A 4HAXA 2D2FA 3LVQE 5JCZA 5KHOC 4OHXA 3Q7QA 5JI2E 1MKYA 5KDLA 3B9PA 4G5GA 4A0FA 3U7FB 4GMDA 4LUCA 1RVDA 4L4UA 2J41A 4DHEA 2GDJA 3CWQA 3WYFA 2WPDD 2QAGA 3QF4A 3FGNA 4US1R 2X19A 3MWJA 1MO6A 1DARA 2XTMA 4F38A 2A5FA 4YDSA 3CNLA 5CB8A 2WM9B 2GVZC 3WBKA 1ZUIA 3CKLA 4S35A 4C0AC 1E2LA 2MMGA 1NSTA 2CNWD 3N70A 2A2ZA 4ZV4A 2J9RA 4Q4AB 4II7A 3U3JA 4BFUA 4JZKA 2WVJA 4ARZB 2JLYA 1AA9A 3H84A 2ONJA 3X1XA 2YOHA 2ODWA 5EP2A 2AFHE 1YR7A 3SQWA 3RLFA 3DMNA 3PUWA 4OL0A 4ZO4A 4WZ6A 3MLEA 2PX0A 5LPNA 2FA9A 2H92A 4JL5A 3VR6A 2E9SA 4A2PA 5CDFA 1R0YA 1XD2B 1OFUX 4HEJA 4Q4JA 1J70A 1SGWA 1XD8A 2RGNA 4JJZA 5EE0A 4Q4LA 5FFMA 4PTLA 2Q21A 3AV0B 4KVGA 5CM8B 1EX6A 1Z47A 3I62A 5FL7A 2LKCA 3MWYW 2BV3A 1U9IA 2QA5A 3PEUA 4OQLA 1FZQA 3ZIAD 4KBFA 5B58C 3CNOA 2ZE8A 1Z29A 2W6IA 2WJVA 4MA4A 3X1YA 1UEJA 3GPLA 1K8RA 5DHAA 4NCJA 5EUQB 5J4HA 3ADDA 4TMZA 2P2LA 5IK2D 1KY3A 3UMFA 3M1IA 1KO8A 1VYVA 2ECKA 2X77A 2ZAMA 4X8LA 3F0TA 3L0OA 1IQPA 3LY5A 1E9SA 1XBTA 1Z6AA 4YQFA 2AD1A 3VMFA 1TQDA 2QM7A 4ACAA 3KKPA 4EPYA 3D31A 2O5VA 2WMOB 3HP1A 5D3QA 4H1UA 2GESA 1TTTA 3I5XA 2NOAA 4GZMA 1JNYA 3GJ7A 3FYHA 3EXAA 5BN4A 4KLNA 5HPYB 1NVWQ 2EYUA 4YXWD 3AUYA 4GSYA 2XZOA 3U4QB 1AIPA 3DHWC 1YVDA 3TBKA 3GJ4A 4A9AA 1RYFA 1W2HA 1IY1A 4XSGA 3B1WA 2NTYC 4MYCA 4B74A 2XEXA 3AF4A 2IXFA 3ZZTA 2V9PA 4DDTA 2DR3A 4I1SA 1ZBDA 4Q18A 1TU3A 3TKLA 1IN7A 2ODBA 4LYHA 3C7KA 5AWFC 1IJFA 1C4OA 1JBKA 3U60B 4LDJA 4TMKA 2JDID 2QUZA 2ZSAA 4LHXA 2ASEA 2XOKD 1A2BA 1MO4A 4L5BA 4BZXA 1J90A 2NPFA 2R2AA 5SZIA 5DN6D 3ZDQA 2FJUA 4HAUA 4LJ4A 3OE7A 2MSCB 3OEEA 2CNWA 3CF6R 1OXTA 4R98A 4MITA 1Z5ZA 5A5GA 4OHYA 2JEOA 2WJJA 1J7KA 1T0JB 4Q19A 2GK7A 1MRNA 4IKEA 5FBQB 4B3FX 5FOXA 3TAUA 1OYYA 4LX0A 5J5CA 5FL3A 2HEIA 2NPIA 1E4VA 1KHTA 2ZI9A 4DZZA 1DPFA 4ZDIA 3N5CA 1M74A 1XJ0A 3GJXC 1QHYA 2N1BA 4DJTA 2VH5R 4NP6A 3AVTA 1R8QA 1NIPA 2BDTA 3EASA 3IQWA 2IX3A 1LF5A 2LKDA 2O8EA 1RRFA 1YRAA 3FTQA 2QMEA 2W6JD 3GFPA 3E1SA 4POAA 5E4FA 4EIWA 1MOZA 5FBRB 1JR3D 2FGKA 2W2XA 3A1SA 2FEMA 2OBMA 1KMQA 4Q02A 4A6XA 3HU3A 4W9MC 1N5LA 4M21A 1KAOA 2VP5A 4PO1A 4Q66C 1OKKD 3THWB 1QHSA 3MAAC 5JZVA 5FUWA 2JLSA 1FUUA 1NJGA 4S2EA 3ZVMA 3SE0A 1NLZA 2QT0A 1X3SA 5FPHA 1GRNA 4Q7JB 3EZ9A 1G19A 1D9XA 2IHBA 4R71A 2CVFA 4MYUA 4ZDJA 3QE0A 1PUJA 4GBMA 4IDQA 2Z83A 4O3MA 2NG1A 1WQ1R 1CIPA 4C0QC 1Q20A 2JA1A 1DAKA 4Q4HA 1NN5A 5CYPA 1HQYE 4C30A 2IUSA 2ZE6A 4JLMA 4B3CA 3PCRB 2GJ9A 1NMXA 1JEDA 4QNRA 1UBEA 3QY0A 1DADA 3VR5A 4PPGA 3ICQB 3U7GA 3U3MA 1G5RA 2CE7A 4OI0A 4E07A 2F55A 3C14C 1G7CA 1JQLB 5G41A 5L3RA 3LRPA 2CXXA 2CDNA 4KITB 5DO9A 4G0NA 4GRAA 1BIFA 1VYTA 3GFOA 3RRZA 1KK3A 5IHPA 3CX8A 1AQUA 5HE8A 5DLQC 3KQNA 1A4RA 2GILA 2VSXA 4PFSA 5DI3A 4KO8A 3ZD6A 3A4MA 4MGYR 3EZ7A 4GMXA 3BWDD 2GZHA 2OCYC 2F43A 3B82A 2J46A 1Y63A 1W46A 1VCNA 4PHFA 5LDDC 4HLQB 1OXSC 3M4YA 1YR9A 2GTPA 2XSZA 1CXZA 1E9EA 4BLPA 1ZCBA 1JEEA 1GITA 5BN3A 4L15A 5SZJA 2ODEA 2QBYB 4U5XA 1FNMA 1E2IA 1KYIA 3SFZA 4QFMA 3TSWA 2QP4A 1CBUA 4YMWA 1TL7C 4NTZA 1AK2A 2YZ2A 3NDBB 5E7IA 3W90A 1AS3A 4F93B 621PA 4DCSA 2ZSFA 2J0UB 3PJRA 2VTKA 2YNMA 2NZJA 4GDFA 1AGPA 4M1KA 4PQFA 2WWIA 1SVLA 1AN0A 1QHHB 4PPQA 2D3WA 3A1WA 2XZPA 2L0XA 3DVLA 1EXMA 4XTRA 4QXAA 3WMFA 4EPWA 5EZ6B 1KAGA 2AKAB 3SI7A 4A15A 1KKMA 1NVVR 1R5OA 1R7RA 4RKFA 4K46A 3TE6A 1VCIA 2B8WA 1JR3A 1KSFX 3HR8A 1LF0A 1UJ2A 3CR8A 5GJBA 1VMAA 4LK2A 8OHMA 3KB2A 1FL9A 4PAQA 1HURA 1SVWA 4FCVA 2W0SA 1IXZA 3NKVA 4TL6A 2VRWA 4DC9A 3UATA 3FMIA 3QKRA 1AZSC 3VR3A 4AG6A 3KKQA 1D2MA 2ZRBA 2QP9X 2W58A 3W3AA 3W5JA 4C0KA 4CYMA 2VO1A 2NO6A 4PZLA 2R65A 2ZIAA 3RHFA 1UKYA 2ZRMA 2Z6VA 4R2IA 3GLHB 1W4BA 2FFBA 1HUQA 4NONA 3IEVA 2ZS8A 3FHCB 3THYA 4TYQA 3KJHA 2EWVA 2ZQ5A 4NCKA 4M0LA 3FE2A 2XGJA 1SXJD 1GL9B 1KNQA 4O2LA 1DO2A 2HJVA 2ZRAA 1N6PA 2IF2A 4L9SA 4TSFD 1U0LA 2JDIA 3GEEA 4V0OA 5LB2A 4OI2A 2WKPA 3ZH9B 2O8FA 5KNBA 3A4NA 4HB2A 5JI3E 3H0KA 3H1TA 1PLKA 4F4IA 1Z07A 2KJQA 5HKKA 3AVPA 2QRZA 3G82C 3CIOA 5A0FA 5C4GB 4FI3C 4CEHB 1GIAA 4L16A 1N5JA 1ONBA 3GLFB 2J7KA 1OYWA 3U4QA 1GKUB 4TTQA 3MGCA 2BWJA 1QRAA 3OIYA 3ZQ6A 4PX9A 5CJPA 1EGAA 1P3JA 2JIZA 2W6ID 2FPKA 3KFXA 3RWMB 4UNRA 4TYYA 2GAAA 3GCGA 3KQLA 5FPKA 1KI9A 3QPUA 4JS0A 2DFNA 3IPXA 1RYHA 1OH7A 3THYB 5CDFE 3QKSA 2FN4A 3V9PA 3BFKA 3JVVA 4DLSA 4DVGA 5JS7A 2QBYA 1FP7A 2GKSA 2ZUCA 4RD2A 5DYGA 3Q8XB 3KJIA 4FMCB 4XVUA 2WJYA 4HUTA 3X1WA 2V8OA 4L9WA 1Z63A 5EE9A 2IYRA 2IYLD 3W5IA 3BRWD 4KBGA 2OO7A 1NKSA 4OBEA 4P4TA 4OQMA 4BFWA 4D4MA 5TXGA 2A5DA 4G5SA 4ZCIA 2BCJQ 3KQKA 2KB0A 2IXGA 4US2R 2GCOB 1M7GA 2WPDA 2P5TB 3LX8A 3UG6A 2QGNA 2EYQA 1TEVA 1OHHA 4OHWA 4YMVA 2OFWA 5FUVA 3MFYA 3RRNA 2I1QA 1U9IC 3K0AA 2VEDA 2FEOA 3T1VA 1P73A 4JLNA 1XNJA 4LRWA 1E32A 4MQBA 4F7WA 2IT1A 3OHMA 1MO5A 5KTYA 4PSKA 3LBNA 5G40A 3QBVA 4GOJA 1FTSA 2V54A 1FQJA 4GL2A 2B7CA 1N0WA 1P72A 3T35A 2J0UA 2PT7A 1TQ4A 3V4RA 3M6AA 2QEQA 2HT6A 3U44A 3FMPB 4OJKA 5KSOA 1WE2A 5DI9A 5FR2A 4R7ZA 4EKDA 1DBSA 3G0HA 1KTVA 4UNPA 3G5UA 4XD7A 1Z8FA 3L43A 1IN8A 1EFRA 4V0MA 1PJRA 4LCBA 1OPXA 2JCSA 3EC1A 3L0IB 3U61B 1SVSA 2YVUA 1SZPA 2XZLA 4BEJA 2C9OA 1XEXA 5H1YA 3QI2A 2P6RA 2GJ8A 1NG9A 2W00A 1ZC3A 1JECA 4UNSA 4BLQA 1N6HA 1CTQA 3GEHA 1WF3A 2IYZA 3RS3A 5JS8A 3DOEA 3CNNA 3TLXA 4F92B 1OW3B 5KNCA 3AF1A 1TMKA 4KV9A 3IEUA 3W6OA 4NHOA 2HLDD 2G9NA 3ICEA 1WBBA 1DVRA 1ODFA 3IBGA 2H7VA 3SU8A 1Q1QA 1FFHA 4PHGA 2QPAA 4N0DA 4WVFA 4DCNA 1SQ5A 3VR2A 2WV9A 3BBPA 1VHLA 1KMHA 2B7BA 3VNUA 3GLIE 1S0UA 2ZPTX 1GWNA 4ARZA 2N46A 3B60A 3Q9LA 1CF4A 4Q4AA 4Z8XA 4R2HA 4BFZA 4RZ3A 3KXLA 2UKDA 1RKBA 4KLZA 1D9ZA 2PCJA 3CRVA 1M7BA 4DDVA 4TMVA 1D2NA 1G7SA 3KKOA 4NCNA 2F1JA 5KSYA 4EJSA 2FPLA 3PV0A 1IM2A 1JR3E 2DFLA 3EARA 3ETLA 2CL6X 4Q1AA 3LLMA 3QF4B 4PANA 4PQYA 5C2JB 2RGXA 1GUAA 4Q9KA 3R20A 4NZYA 1H65A 1GKIA 1Q0UA 4QGAA 4JSTA 821PA 3N2EA 1W44A 1V5WA 1ZM2A 3RS5A 2RGEA 2F3TA 3CZPA 4BWYA 3AVWA 1CRPA 3SYKA 3EPLA 3KUDA 3I8SA 4LGMA 3PIRA 4PAMA 4P32A 1HV8A 4B76A 2YV5A 2KWIA 2IYVA 1P2TA 2G1JA 1OFHA 1AGRA 3IDQA 4FW9A 4Z8YA 3K0SA 1F48A 5J4LA 2HYIC 2DB3A 1VIAA 3KFVA 4MGKR 3U3RA 4DXAA 3TNFA 4KHZA 2F9LA 4D81A 4DLUA 4CW7A 1G8HA 4Q9IA 3SJAA 2ZRHA 4PHTA 4TSFA 1U98A 1U2RA 3SJZA 5EUMA 2RH5A 1R2QA 5GJWC 4CEIA 3CF2A 1Y3AA 1T8TA 4EQ6B 3QBTA 4QGHA 4IDHA 4TMTA 3TAHA 2ZI4A 3GJ8A 1U99A 2CLSA 2ERXA 1R10A 4QBGB 3PUVA 5FL7D 2HXSA 1CS4C 1KK0A 4YDHB 3T1TA 3EA0A 4JL8A 4MKHA 3JVUA 2OILA 4FMBB 4Q1FA 1W0KD 1VPLA 4GOKA 1SHKA 5E7JA 1XTQA 1ZNZA 3SYLA 1VKJA 1R6BX 4TTPA 1L4UA 4IW3B 4URYR 4QM6A 3BORA 1RJ9B 1OXUA 2RGNC 2BMFA 4KODA 3WBJA 4D80A 1W48A 1R8SA 4EJSB 3R8FA 2ZRNA 3PUZA 5JSZA 1UADA 2ZR7A 1YZGA 5EP1A 3Q5DA 5HKKD 4Y0AA 2A7QA 3TH5A 2F9MA 3NEYA 4NYIR 3VR4A 1KY2A 1YZLA 3NH9A 1E1RA 4WXPA 4ZI3A 3OAAD 2FSGA 3SDZA 2ZROA 5J4YA 1N2CE 1EFUA 4IOMA 3AKDA 2GCNA 5HCNA 3VX4A 1YZNA 4IHQA 4PPFA 5B2ZA 3ZGXA 3MJHA 1CR1A 1SXJA 4HI0E 5DYIA 4DEXA 1F2TA 1GNQA 5JJKA 1RW4A 1IN5A 1E1RD 3P4YA 4BRUA 5EZ5A 2RAPA 3LW8A 3ZVNA 1TF2A 2IYYA 3KTAB 5AUOB 1Q21A 4JLOA 5BQ5A 3P32A 3BXZA 2Z4RA 4G5QA 2D4HA 1QHHA 1G7TA 1O3YA 4MRPA 1QG4A 2ZVQX 4KXFB 1ZD1A 3TUJC 2FE4A 2K5UA 4P0TA 1P75A 4Q01A 1ZAKA 1DS6A 1CJKC 2VHCA 3UK6A 1YR6A 4JLDA 4M8NE 3ZZ0A 2P65A 3HPQA 2DFTA 3CR7A 1RIFA 3LBHA 1LV7A 3NXSA 4RFSA 2QI9C 2ZE5A 4ZI2A 1X1RA 2XNDA 3X2SA 4GFDA 4BUJA 4AC9A 4JT2A 2GK6A 2QMUA 3IKJA 4O25A 1X8KA 1Z6TA 4LBYA 1US8B 4MUAA 2JLWA 1Z6YA 1COWD 4FCTA 5HTKA 1R4AA 4Q48A 1MT0A 5GVRA 3FB4A 2J0SA 3QG1A 3I73A 6Q21A 1XTKA 2ZRDA 3T61A 2AR7A 1I2DA 5LD2C 3TUIC 2HYDA 4XTCS 2G1KA 2ZVPX 4U7DA 1NMZA 5ELXA 1ELOA 5FPTA 5HCIA 4AWXA 1ZM7A 2IF0A 2QM8A 2ZJ2A 4TT3A 1CJUC 1N6LA 2GEVA 1G21E 3U7HB 1S9DA 2XXAB 4AD8A 1FUKA 1IAQA 2Q9BA 2XB4A 2GJSA 3O47A 1HQCA 2EVWX 3IUYA 3QXSA 2CMKA 1YR8A 2WOJA 3BD9A 1GRRA 2ZRKA 5EXTA 2J45A 1Z6XA 5GJCA 4XH9B 2NO0A 3QVUA 2BBOA 3NBFA 4NDZA 3O8CA 4QKQA 4DKXA 4MH0R 1OXVA 2IYTA 1KZ7B 1X8LA 2FOLA 2WAYA 3OF5A 4LBVA 3TIFA 4ILEA 4N3NA 4Y0VA 1ZNXA 2REBA 2NO1A 4IEEA 2IYXA 4JLJA 4J0QA 4B73A 4TZ6A 2GWHA 2OBLA 1A2KC 2E87A 4ZIRB 2QG6A 5DIFA 4DSOA 3SZRA 4D0LB 2ZJ5A 2QQEA 3LD9A 2B92A 1FOEB 3PUXA 3QKSB 4DLRA 2C2HA 1FMJA 3F3YA 4LZZA 1HE8B 3PUYA 2O0HA 4EFMA 3PR1A 1ESNA 2CJWA 4WBSA 121PA 1S2MA 4E5UA 3LO5A 3WYGA 1G5TA 2A5JA 1R0WA 2XX3A 4G3XA 2A78A 2CCGA 1OE0A 1U0HC 2C96A 1GP2A 1XXHE 3BB4A 3CO5A 3DZDA 3LWNA 3KB1A 4DIEA 3R9WA 2WSSA 1P9RA 2AK2A 2WKRA 1G3QA 3RWOA 1HYQA 1SHZA 4OHZA 3A58B 4UQOA 2XB2A 2MSDB 4IXNA 4KI0A 4EPXA 3TQFA 4HZUB 3VFDA 1E2NA 1S4QA 1X8JA 1JXMA 2OT3B 2A30A 3EG5A 5DE3A 2P67A 2Q0HA 4IDOA 5CJ2A 2CJWB 5DGXA 2ZU0C 1S3SA 1S8FA 3I3SR 3EPKA 4BRWA 1W7AA 4WAUA 3FPAA 2VSFA 3PEVA 4AY2A 2OXCA 3CPEA 1Z0DA 3QKUA 3EWSA 3VR1A 1BS1A 2J5XA 1XRJA 3IBYA 3FMOB 4PSAA 4P4SA 3LDAA 2ZI5A 4DEYA 1NY5A 1GKYA 4BASA 1ZYUA 2C78A 3U3OA 4D0GA 2ZRGA 2ONKA 2JAQA 3IHWA 3R7WB 1KDRA 5E3HA 3T5GA 2FZLA 3K8YA 1OV4A 2WJHA 4XIGS 3ZS9A 5BW8A 2QTHA 2YHSA 2ZTSA 5FBVB 2LCFA 2QE7D 2YJTD 2IWHA 4LJ9A 4IFEA 1FNNA 1KO1A 4NYIQ 2X2FA 2WJGA 5J40A 3NWJA 2KE5A 4Q4JB 2AHOA 2PX3A 4TMXA 5EJEA 2EFEB 1KOFA 1XXHB 1E9DA 1TF5A 1FX0A 1EFRD 2WICA 1G5PA 1RFLA 4KFTA 5P21A 1A5TA 3B5JA 3WHLA 4MUBA 2VP6A 3HR7A 4DLZA 2KI5A 4PC2A 2C98A 4MYTA 1AKEA 2A9KA 1XP8A 3MUFA 3K70B 5CITA 4RJLA 1CR0A 1KZGB 4QHTA 1KI6A 2CVHA 3B9QA 1OF1A 1M2OB 1US8A 2W0MA 3QNUA 4QJ3A 4F91B 4DLVA 1ZM9A 1XU4A 2OG2A 4BGDA 1XCMA 2X8AA 4NYJQ 4B3BA 2BKEA 3S1AA 5C1BA 1B0UA 4EAQA 3OIWA 3T15A 2Z5FA 2ZREA 1DAMA 4EUNA 1G4AE 1IONA 1SXJE 2RGCA 4QBFA 3RC8A 1G8YA 1H8HA 1W0JA 3HYTA 4FIDA 3TMKA 3AVXA 5DNYB 3SHWA 2NO7A 3AVOA 2CEAA 3IIKA 2CLCX 3LLUA 3K1JA 1ZUHA 5FBWB 3R8CA 4EDHA 3UMSA 2AN9A 4DRZA 3UWKA 1KSHA 1O87A 4LPSA 4UNQA 4DCTA 5HZHA 1I2MA 4URZR 3RVBA 2CBZA 4D4JA 3GJ6A 1G8PA 3THXB 1NMYA 1VG9B 3NBZC 3FOZA 1G6HA 1KI2A 1MR3F 721PA 1XJCA 1XTRA 3GJ0A 1J99A 1ESMA 2G3YA 2EFCB 4YMTA 1EWRA 1TF7A 1G9XA 5AJZA 4C0SA 1VDZA 3K09C 1XMIA 2CHGA 1JALA 2PBRA 3KZ1E 4JLKA 2IEZA 2GZDA 2HDNB 4RY2A 3O8DA 1F3OA 4HZIA 3TQCA 3R7WA 3BOSA 1H8ED 221PA 1OH8A 5CK5A 2J0VA 2XJ4A 2ZJAA 2PZGA 4DSUA 2OESA 4DWJA 1NN3A 2RCNA 1Z83A 3RC3A 4XOIA 2DBYA 2JJ2D 1G3IA 3AF3A 5K8UA 2ZETA 2ZITA 3NBXX 1ZM3A 3RANA 3KDSE 2WTUA 3VAAA 1KK1A 1MH1A 2WKQA 4HB0A 1QF9A 4YMSA 2V6JA 1F60A 5HZKA 1OIWA 2ZR0A 1VTKA 3AP2A 3THWA 4HDOB 2VL7A 4PXAA 1KO7A 2VP0A 4UJ3A 3SEAA 1XZQA 2BVNA 2ZRPA 2R6FA 1GFIA 3QOFA 4A8JC 1W4RA 1ZCAA 4A92A 1DAGA 1T4GA 3AVQA 1TU4A 3TRFA 2C5LA 2NGRA 3OZXA 3WY9A 5HR5A 1LNZA 2Q9CA 2WIAA 3KQUA 1FX0B 1T3SA 2WJIA 4CEHA 3ONWA 4B6FA 1HT1E 1K5DA 2GZAA 1E99A 1JXOA 3CPJB 4LYJA 1II8A 1XPOA 3N2IA 4LV6A 4Q7LA 1D2EA 2P3SA 2O8FB 4Q9LA 1X86B 4A0RA 2FGJA 4V0LA 1L7VC 3C16C 4RD6A 3RS0A 3WP1B 2JJ8A 4D26A 4B35A 1DAEA 3TK1A 3P27A 2PLFA 1CP2A 4HATA 2WWXA 4IFBA 2JLRA 1E2HA 4UXHA 1YE8A 5AUPB 2ZE7A 1R5NA 1A1VA 3PITA 1QZXA 2FSHA 4IOJA 4IEIA 3AF0A 2H8KA 3AVYA 1R0ZA 2VF8A 3FVQA 3CWZA 4LHYA 1DAIA 1XFAA 2YINC 2AK3A 3HDTA 3GD7A 4QOSA 1JPNA 3ZVLA 1T0HB 4ACBA 5BWMA 3A37A 4PC3A 1S3GA 2RGDA 5D3MB 5L3QB 4CT4B 3A36A 3GLIB 4HDQB 3M0EA 1P9NA 3PEYA 3NG1A 4A0HA 2OHFA 3RSOA 1NF3A 4QBIA 4NKRA 5EE3A 1G18A 1LS1A 3F5FA 2G77B 2R8RA 4CEIB 4FINA 4RKEA 5C4MA 3HU2A 5IRCD 4DCVA 2XXAA 1Z06A 3NHAA 2ZJYA 4QG7A 2TMKA 3B7GA 2OAQ1 1GNPA 4QHYA 5B57C 2P6UA 4OK5A 3TSZA 1UM8A 1DAFA 4IVPA 1XZPA 2XSZD 2ZYWX 1N6RA 3AUXA 1E2DA 4X8HA 3B1ZA 2O8DA 5M04A 4Q1EA 4AKGA 4PPNA 1XJQA 2D7CA 1UBFA 2BJVA 2AXNA 4C3ZA 3U5ZB 1XEFA 4URXR 3NH6A 3JZMA 1M34E 4FMCF 5EP4A 1U8ZA 3EA5A 1KJWA 3AP1A 1ZD9A 3NDPA 1N6NA 2XNSA 1KO5A 4LYAA 2R44A 4K8OA 5B64A 2VHTA 1COWA 4FWIB 4B47A 2O0KA 5LD2B 3VU9B 2QY9A 2NMVA 3SFVA 3EIEA 4DLTA 3S1AB 1W1WA 2VA8A 1XCPA 4AKHA 2PZEA 4QJ4A 5FOUA 3ADBA 1G6OA 2JASA 2OZEA 1NKTA 4XSHA 1DOAA 1UFQA 1XTIA 4TT3D 4JBXA 5H68A 2Y8EA 2GF9A 1Z0AA 4JMPA 5JRZA 2BEKA 1E0SA 5JWHA 4Q7MB 5SZKB 4RD1A 3SBEA 1SULA 4PZZA 4CF7A 3GEIA 3KTAA 5G3YA 3EIHA 4B75A 4D0NA 4LHWA 4OK6A 3A8TA 4PZYA 2IS2A 4TL7A 1U81A 3THXA 3B1VA 1HTWA 3EX7C 1JAIA 5FOTA 1EK0A 5K8LA 2A5GA 4A6PA 5FTLA 4LY6A 1T3LA 2IW3A 1MABB 2V1UA 2JGNA 1G3MA 1AKYA 4LJAA 4PC6A 1CJVC 1E0JA 1WXQA 3OEED 5JHGB 4JVSB 4YMUA 2AKYA 4OI1A 3LBIA 1SVIA 1Q57A 2D74A 1KSGA 4QNMA 2J87A 1LY1A 2BOVA 3K9HA 2FH5B 3I32A 4W5JA 1WMSA 2XOKA 4KSBA 3A6PC 4WOPA 5AJXA 5EP3A 3ZYCA 1OB5A 3EWAA 2QL6A 2W83A 2Z0MA 4N1AA 4RFSB 1E9CA 4V0KA 3ND8A 1UKZA 1CKEA 1FQKA 2QAGB 2V6IA 2ZANA 1OFTA 2A3RA 4IRUB 1NL3A 4L8GA 5KUTA 4LI0A 4BQSA 3B1YA 2O52A 2ORIA 1E2KA 1NVXQ 5CIWA 4B32A 4B3DA 3I92A 3KKMA 1NLYA 2H5EA 4HZUA 4OQXA 3WXMA 3QJYA 3W9YA 3AM1A 3W8RA 1TQ6A 5L8VA 3ZS8A 3SS8A 1T8UA 5IF9A 5KYKA 1JPJA 3L8ZA 2F1HA 4V03A 4DB2A 1PVOA 2IL1A 1XD9A 2IHYA 5KNDA 2YYZA 3B1XA 2FV8A 4LJYA 2VP9A 4ZCLA 1ZRHA 4RVCA 1LVGA 3K0EA 3B13B 4TLEA 1M7HA 2ZYTX 3KXKA 3H2YA 1XF9A 1R5BA 2BCGY 3Q7PA 5J4VA 3Q85A 4NE2A 5LB4A 2QTVB 3RSLA 5DSZA 3ASZA 4MKIA 2O8BA 3CZQA 5FTKA 5EXXA 3AEZA 2QROA 4NYJR 3MSXA 1XCGB 4M1MA 2C8VA 1GSIA 4V0ME 3AH8A 4IVQA 3C8UA 4AIIA 3BIFA 1KDTA 2NO9A 3WMGA 2ZUBA 3GLHA 4DSNA 5AK0A 3U6KA 1FTNA 3CH4B 1H8HD 2JLUA 1G64A 2BM0A 3WYAA 2JLQA 3C5CA 1G291 1Z2AA 3CPHA 1FP6A 4AYTA 2X1VA 4RCZA 1N5IA 4LV5B 3FDIA 4M22A 4HAZA 1QHGA 3LXXA 5TMPA 2VSOA 2W2VA 2PH1A 1DE0A 4RD0A 4MRSA 3UANA 2XTZA 1E3MA 3AP3A 3OIVA 3CM0A 5FI1B 2FF7A 3FFBA 1F2UA 2OCPA 1SVMA 2QT1A 1WCV1 3W6NA 4Z1MA 3AGQA 3FKSD 3WMEA 4URUR 1T91A 2OLKA 4FN5A 5KDDA 1UEIA 2R6CA 2QU8A 2X2EA 2Q3HA 2HF8A 2IUUA
chains in the Genus database with same CATH superfamily
1IBMB 2I0FA 4NCXA 3I42A 4F9TA 4E13A 4GLFA 2D0OB 1IN4A 3E27A 1BHJA 2RB5A 1C9EA 4HB3A 1OTYA 1ZN9A 3JQEA 1GQFA 1T3ZA 1WDKA 3K3PA 3OUTA 3SSAA 5LL6P 1HT2E 4LHVA 2PQ0A 2B8TA 4P3NA 1YCGA 4QOHA 4G0VA 1P9WA 3D0RA 4DCPA 3T9CA 3H1BA 4HAIA 3BK7A 2NO5A 2DWOA 1DT3A 4HWSA 2BIFA 2Z09A 1ZOIA 4L85A 5AHOA 1RPAA 3BFXA 5G3ZA 2ODNA 4UXJA 2ZU6A 3HC7A 1XWIA 4C2TA 4C4RA 2YXEA 1A7JA 3REFA 2R6JA 4H59A 1X7HA 3VPGA 4ALLA 1UBJS 1SOAA 3DPUA 3HZOA 1Z8DA 2PJRA 1K3FA 1MPXA 3AKYA 4V0NA 1QIMA 2KM1A 4ZKEA 3CLKA 3K71B 8ADHA 5I8WA 3NEJA 4DNPA 1PYDA 3CF4G 3QVLA 4CCYA 1F8GA 3DZBA 5A04A 1OA0A 4EKEA 1L1QA 1LTQA 4XD7D 2CLLB 1SIWA 1IG0A 1BA2A 2PKEA 5BYJA 1MV5A 1U7DA 1U9ZA 1G4UR 3TQIA 3WK8A 4JOQA 3TW6A 5C8YB 1W4LA 1DUVG 2GCPA 3HGQA 3WNQA 4B71A 1FPMA 2FRVA 5JD3A 5F7JA 2UVDA 2XUDA 2NZVG 2OZPA 4PV7A 4IHJB 5A4KA 1A5SB 4D2IA 2XWJI 3IO5A 4XVRA 4DL9A 5AXBA 4J07A 1TJ5A 1PS0A 1ZW1A 3MWGA 2REQA 4M86A 4B84A 3DO8A 3FYUA 4ALKA 1LNSA 5GOTA 5K3BA 4D4KA 5KWVA 5LU9A 3ER6A 4N4AA 2PKWA 3R0JA 1M3SA 3OQIA 3PL5A 2YWFA 2ZB4A 3MCWA 3MMZA 4RXTA 4WCVA 1U0JA 4XZ3A 4HQOA 3M9XA 3VC1A 3C6XA 4NE9A 4WWHA 4HXFB 4Q9HA 3T4EA 4K6CA 4LV8B 1GN9A 4Y1RA 5GM1A 1RZUA 3EY4A 1SCBA 3U9LA 3R44A 7REQA 1WLSA 2JHFA 4M7WA 5FA6A 1IN6A 1V1MB 1T1EA 2H52A 1XEWX 3I5UA 4FFSA 4JCOA 4N0QA 2XOXA 4QICA 2X15A 4O2RA 4K9DA 1F9AA 1QQ5A 1UXHA 4MGIR 2ZYRA 4PXSA 1VSVA 2HUPA 4GX0A 5HYVA 3ZVKA 4RF4A 4IDPA 5EPEA 2YKGA 1U94A 3KT0A 1JN0A 2GVDC 4Y18A 1PF7E 2BM8A 2EGGA 4R2LA 3DMGA 3U9TA 4P81A 5D01A 3JQAA 1QRRA 2I66A 5CW2A 2ZDHA 2WK1A 5KCMA 4J43A 1EAMA 2F59A 4MV4A 1VGQA 4YDRA 3U44B 1SUBA 1KKLA 4OGGA 5CCBA 3B6KA 3AX6A 1U9JA 5BV7A 4JYCA 2YN0A 3RYIB 4HVLA 4B43A 2Z43A 1SOWA 3MZ0A 4IIJF 4ZXFA 4AW9A 4AP9A 3MWDA 1BCSA 2QTLA 2IP4A 4I8IA 3RVOA 3OJCA 3BS4A 3WOVA 3U09A 2VCEA 4G56A 2G5CA 2VPPA 4XUCA 2JB9A 3L7DA 2JJ1A 5IS2A 2QY6A 2B4QA 3HRKA 3LBFA 4NZZA 4Q3EA 2ZJOA 2UXBB 3TD9A 3PS9A 3VJKA 2IYPA 4BFTA 4CMEC 1BO6A 5G4LA 5KTSA 1LW7A 4RLSA 4GM1A 4IUYA 2VNIA 2HA4A 4AKIA 1U0RA 5DBEX 3VSEA 3W77A 4L76A 4RM2A 2GXAA 2I2CA 1J2YA 3ZE2B 5L3SA 3EIQA 5JNSA 2X5NA 1ZU5A 1JFFA 5F64A 3OKFA 4MLCA 5L3QA 3W5CA 1RAGA 4JI3B 2Q1WA 3G9UA 2VHVA 4XGQA 2V65A 4YT5A 2ZRJA 2P9YA 2IYUA 4FYIA 2RHTA 3PENA 4HRAA 4WGGA 5EXDA 1W85A 4P5DA 4BUZA 1KP2A 2QXUA 3IE0A 2H85A 2CWDA 1UZNA 5AUQA 2VP4A 5B58T 4DV2B 1JHZA 3NC1C 2DCUA 2WABA 3A3NA 4U5QA 2D6FA 4WJKB 5DK4A 1SD1A 2C29D 1G60A 4BO0A 2W43A 3I0MA 2IXBA 2PG3A 4NS4A 4R51A 4TL9A 3QOWA 1BROA 3D8SA 5AR1A 2O3RA 2OQ2A 4LZWA 3TDKA 4B8WA 3IPYA 1BC5A 4A36A 1NJSA 2LDXA 3ZLTA 1SWVA 3BICA 3PNSA 5DXJA 2GR9A 3V8QA 3OTIA 4I9HA 5LU8A 1K6IA 1IK4A 2A1UB 1TPZA 2NU6B 3PI6A 2XAUA 5C37A 1EK1A 3EBOA 4Y2RA 5LKRA 5SZHB 4L1KA 5BSVA 1E79D 2DHDA 5FLXA 2O2XA 1QP7A 4YWHA 1LQ2A 3UMRA 3D5QA 1CQJA 2XGGA 3AB7A 2AFHB 1WHTA 5T6MA 2OB2A 4ZAFA 3AM4A 2ZKIA 2O8EB 5JJIA 1F2UB 2Z9BA 1H3EA 3EG9A 3HKBA 1X38A 3Q7TA 4BIMA 1DMRA 2F1KA 2XY4A 3KD3A 3PHGA 2J59A 3BCSA 3DYVA 1N8TA 4UNNA 4DCCA 2UYGA 3IH5A 2QP3A 4JP8A 1QJCA 2II6A 2ZJBA 1NHGA 3T5PA 1E3EA 3RVKA 3CY6A 4IVNA 3D4BA 2VBFA 4IJMA 3WMXA 1EVIA 1W29A 2BFCB 5CEFA 1TM2A 1GNRA 3GQBA 2WHQA 3OFKA 3QPDA 3AKCA 3R6GA 2GKGA 4CUZA 5IAKA 1A8PA 4B6PA 4D1YA 2FDXA 3I5YA 3EE6A 4IJVA 2XCSB 1QV6A 1TD9A 1WMFA 2KS6A 1ZL0A 4B45A 5TQJA 4B3GA 3BEOA 3RUAA 1EGMB 4F2HA 1VPEA 1CDEA 1FFBA 1K8ZB 1XA3A 5JATA 3IKTA 4QJ5A 4Z2AA 4FT2A 4EO7A 4DDWA 1W2WB 3KTOA 1I3MA 1P2DA 3AIIA 1U90A 1Q0QA 1BHO1 2C8LA 1ZMRA 4FP9A 4H7PA 1HMPA 1IY2A 2C5SA 3VPFA 3R9XB 4DRXA 1JYEA 3AKEA 4GKKB 4RFVA 1TADA 3DAYA 4M1YA 3BGDA 4JJ4A 2ZRLA 1NN1A 4FW8A 1VMKA 1WTCA 2HF9A 3M6MD 5BYKA 1PTKA 4ZALA 2B1IA 4XIIA 1HZZC 1UMDA 1E2EA 1XTTA 1PZNA 1T9DA 3KYCA 2ZB3A 1BVUA 2PVSA 3H2BA 3SZLA 1IHUA 1M2HA 1NFFA 4J4HA 1J49A 4OI4A 4ZQEA 1HM5A 3OFND 1W4CA 5TY0A 4CHTA 5KX5F 5DPMA 1M6VA 4MDEA 3W8NA 3ABOB 2ZZKA 1IEXA 4GVXA 1ICIA 2X2PA 4I9FA 4LYFA 4RTMA 1N5RA 4AIRA 2IUTA 3AY6A 3L8YA 2AOVA 4QQ8A 5AI9A 2YMMA 5LSAA 2NIPA 1MRZA 5F2EA 2IBMA 5GADl 3EXIB 3BE6A 4OA5A 3B2NA 4BV8A 3C3XA 1KEVA 1SK9A 3UO8B 1SVKA 1XK7A 4COKA 1OH5A 1P60A 2P3OA 3KR9A 4X1YA 5TJHA 3DGEC 1X80B 2ZYHA 2BGTA 3FDZA 3HJCA 3UWDA 3WFJA 4EPVA 2VA9A 3S81A 3EPHA 3MQ4A 1OQAA 2PKCA 1ZISA 2QZ4A 3TO5A 5FTMA 4E09A 3EZFA 3CJTA 1S6YA 4D96A 1DCTA 2FQXA 5T4BA 1WXDA 4PONA 3F98A 3OLZA 3JAWB 3NTLA 2G08A 1C1XA 3A9UA 4S3MA 4XWGA 3T4PA 5JFOA 4JFRA 1P5ZB 5FB3A 1N75A 3WMRA 3FDZB 4GPAA 1CFZA 1N9GA 3N6XA 2YWHA 4A4DA 1XTJA 1DIRA 4B2IA 4OFBA 3WBBA 1C8VB 1S9HA 5DLYA 4I3FA 1CYDA 4ZICA 1GL3A 2HZ7A 2IDJA 3L2OB 3D6TB 4J03A 1BYIA 2QJWA 2X6RA 3R6WA 2GBCA 5IXYA 5H80A 3GGCA 2VUSA 4BO7A 5ALYA 1A50B 2GX6A 1ZK3A 1WKCA 1H2RS 4ZPJA 4ZCMA 1IYZA 2CFSA 3RC1A 2G88A 2FX3A 4LBZA 4AJKA 1YHYA 1ISFA 1KA9H 1DX4A 1UC8A 1P2VA 1Z2OX 1GUYA 3K2QA 4KSYA 3W3AH 2PDAA 2C3YA 3LAWA 3L4BC 4DLWA 2AXQA 3VNRA 3W4KA 3ZE7A 1OAKA 4KP7A 4E21A 4NWIA 4BO6A 3VAYA 2O2CA 4CKCA 1F2TB 4LJKA 1TC1A 3KYCB 1SXJB 2C61A 3OQVA 2R87A 3ZEAA 1NDUA 2PL1A 2QN1A 1NAIA 2DWPA 1QG0A 2RGBA 3W0LB 2F8LA 3CZ5A 3S70A 3C5HA 3QFSA 3W5SA 1S2IA 1DRJA 2FQWA 2NXCA 4X9XA 5D7NA 1JEYA 1G7RA 4DCUA 1PCXA 1NF9A 4LKOA 1NC1A 3BMQB 1G8SA 4H17A 1DEKA 1RZ3A 1UBGA 2WTMA 1X1SA 3ZY3A 1RWOA 1T9HA 4UUBA 2GSDA 3MD0A 5JS1A 3OQ6A 3JVEA 3WZ2A 1W93A 1PGJA 1TXGA 1ECBA 1ACLA 2W2OA 3VZQA 3EVAA 3OEHD 2LW7A 1UFRA 4FC7A 3U4GA 1TW3A 2C99A 3WJ1A 1NV9A 1X77A 4M4SA 4HNAA 4CM8B 2H2WA 3T06B 3IL2A 2HCJB 1Z28A 3LBYA 3MWLA 1M2EA 3OOHA 3OIUA 5DP2A 1FJ2A 5LZ2A 4M88A 5AVKA 4EFKA 1OJLA 4FDMA 1I2AA 1VXOA 3A3YA 4QGGA 1L9XA 2WIKA 3WQSB 3DKVA 5AKHA 4KJZA 2ODPA 1NM5C 1EG7A 2DPMA 4G5HA 4Q47A 4C4PA 2EERA 4L6CA 2LD4A 1PEYA 2TMGA 3AYXB 3J7TA 1A82A 4IQFA 4ITRC 4KLCA 2JHCA 3FJYA 1AKMA 1S4MA 5B3AA 3G88A 5HRUA 4J1QA 2PXXA 2XD4A 4K6FA 4P4UA 3X1ZA 5KVAA 4YRAA 1B6GA 4D4LA 3B5IA 3Q10A 3NWBA 3IXMA 3QP9A 4XWWA 5ESXA 4LOKA 2EQ5A 2OGZA 3BHMA 4P33A 4URVR 3CEAA 3EUWA 2NQ8A 1YVUA 1Y8RA 4JL6A 2MSKA 5CCXA 3U4HA 1F20A 4Q16A 2WHEA 3CV3A 2AIRA 1HA3A 3TFQA 3L7YA 1TQHA 1FFCA 4G9EA 5C3MA 3HHPA 3WL4A 1CYEA 3HB7A 5IBRA 3RC2A 1PJQA 1XFDA 5BQXA 3MQFA 4MRMB 2ZBQA 3LWBA 2D2IA 5T41A 4EY7A 4G37A 2R1ZA 2J3EA 3L7NA 4KZKA 5PGMA 1SCIA 1KI7A 2B1GA 4DBLE 3BE5A 4NXNB 3A1UA 1PX0A 2R85A 3IP6A 3N8GA 2B1QA 3SJBA 1N3LA 2CHVA 3VTAA 3OEYA 4PYLA 2H31A 1LV8A 1USWA 2TS1A 3KAKA 5F7ZA 4O5AA 1I3NA 2ZWAA 4HVAA 4JEMA 2ERYA 2L18A 4Y98A 3NBMA 3VOTA 3CRRA 3K0FB 3EQ2A 1AHNA 4YK7A 3H2JA 1CW2B 3UK2A 2LIPA 1Y9ZA 4KQHA 4AI6A 3G6WA 3CRZA 2IVZA 4BNDB 2H57A 3FPLA 2ICAA 2FUG6 4N48A 2NYUA 1YBAA 4FYYA 2ATXA 2M9MA 4RZUA 5CM9C 4AO8A 4D7AA 3OCXA 5BNZA 4AUEA 3I2GA 2JJ1D 4G8BA 2A5YB 4RPKA 1U0OC 3UWMA 3PI7A 2ZULA 3RVRA 3LHSA 3JWIA 3NLLA 2UZIR 2QD1A 4PHHA 4CL0A 3GDWA 2GXQA 2OM2A 3IT3A 4LSZA 2RFLA 1DO0A 2FQYA 1OC4A 2PIDA 1SXPA 3LUFA 1J1ZA 3DM5A 4IX9A 4C76A 2Q6KA 1JU3A 2G83A 3F6RA 3HFRA 1WXEA 5MN6A 5E2BA 1RXCA 3ZVRA 4R69A 4UCFA 3MJVA 4EBBA 2GBLC 2UZ3A 1RRCA 3FWYA 1OZFA 1CFJA 2IIVA 3EGEA 5EG5A 1HGXA 1MC8A 2I78A 3MW8A 5ADVA 2DSTA 1FW8A 2CB0A 2F6RA 2B4TO 3J81k 2WILA 3AFIA 5C1DA 3DQPA 1BZYA 2XWPA 4WFJA 5BN5A 4ZZ1A 4DLPA 5K3EA 2VPYA 2BGKA 3JQAB 4QUKA 4AMZA 4BZQA 1Y1QA 3SBOA 3GJQA 2H3EA 3ROPA 3HCCA 4K03A 3VVMA 1VKNA 3H7IA 2JFQA 4I6JA 1UPBA 3QXHA 4LW8A 1D7OA 5C5DA 8AT1A 1QC5A 5JJLA 3QV2A 4EW2A 1ZNWA 2GA8A 4NBVA 4BBZA 4O29A 4C29A 4MRAA 3G2OA 1NBMD 4LOJA 3H0EA 4MQFA 4ZMSA 3MELA 2DFKB 1QBKC 4MB0A 5B1YA 2ZJ0A 4IIXA 4YALA 3TR5A 3O3MB 3L1IA 1ZK1A 3V7FA 1ORWA 2BMAA 2C4WA 4DM3A 4RTOA 5CAEA 1E96A 3MT8A 4J16A 4M60A 3VBEA 3G0IA 5F98A 3OBIA 2C77A 1XDGA 3DJYA 4O02B 5DBHX 3H9EO 1M34B 3HKCA 3E70C 3LCUA 2XF2A 5FQOA 3R9IA 1TAGA 3DEYX 5EZYA 1SUWA 1YBMA 3OLXA 1E2JA 3KR1A 1EX7A 1XCJA 1KR5A 1LS6A 4UUOA 3OZRA 3N3AC 2VHQA 2KLBA 2BELA 1D7AA 1KYYA 3GC6A 3GARA 1KE2A 1Z5GA 5JZMA 5KS2A 4MV1A 4V3CA 1VHDA 1EHCA 2GPNA 4BO4A 5AJVB 1I6WA 3N8KA 4HTAA 2NZ8A 1W5TA 3ZJVA 4IVRA 1YZKA 2NUAA 1KFJB 4QC2A 4X41A 2ATVA 4XGKA 1MW8X 1Q2UA 4DA9A 3QK7A 5JRJA 3UFXB 4DV6B 1HDGO 3H2IA 1XRLA 4HXGA 1PV1A 1FSZA 1OVMA 1RI5A 2CLEB 2N42A 1PW7A 3C3WA 3DOFA 3PDIA 3T7RA 5LMCA 1AN9A 3MCTA 1MJNA 1JG1A 3TX2A 1I4TD 2Q3FA 3F6CA 1N7HA 4CODB 1B0ZA 3VDXA 1Q2XA 3ZV5A 4L8LA 4J0GA 2H00A 2G25A 3JQGA 3LCRA 1MIHA 3K9LA 2K2QB 2V7QD 3ADCA 1Z5OA 3SC4A 1LPPA 2ZS7A 1ZX1A 1IZYA 2YYYA 3AFOA 1DG1G 1DV1A 4I81A 3R7DA 1ZRMA 4C7XA 4FKMA 5TGZA 2C9MA 1YKSA 4B44A 4HUJA 2Z2ZA 5TIIA 1DAHA 2E21A 2R1VB 4IMRA 4TLAA 2VDVE 2X9LA 3DE3X 2ZB7A 3QMWA 1XQXA 1GPKA 2G5PA 4N8EA 3V55A 5KKNB 1EDEA 3BZWA 1XKLA 4S04A 1HL3A 4PHCA 1Y1SA 4I4TA 2WM8A 2HV8A 4OQZA 5TSDA 4XDYA 4R9SA 5NLLA 1T24A 1T5HX 4E30A 5EMNA 2L42A 3DAPA 2OEPA 3GJSA 3LUBA 1RWMA 3AIOA 3NHYA 2PD6A 4K2AA 4M9ZA 4YCMA 1GADO 3PFFA 2RG7A 4HGOA 4Q3DA 4MCAA 3E9CA 5IHXA 3BB3A 3LC1O 3O0DA 1VE6A 4HDRB 3SXJA 1U6JA 2DU8A 2ZIXB 4HX5A 3E5MA 1XAHA 3FSJX 4MUNA 2ZQZA 4FFMA 4HH3C 3NP9A 4FX5A 2VHUA 4QUIA 1XZDA 2AUNA 3MJRA 3TDMA 1EUDA 3WLRA 1A9PA 2WZQA 2ENUA 2ZRIA 4LE2A 4DQVA 5JYDA 2Q50A 1Y4UA 5B37A 3BHIA 1HORA 2F7SA 3IE2A 2XGSA 5BRNA 3TLYA 3P0JA 2O7RA 5ALOA 1CRQA 1XPRA 2WYIA 2P35A 4LYEA 4WPGA 4GXQA 3IP1A 3JX9A 4YI3A 5IKXA 1IVYA 1ESDA 4QGFA 5DX0A 2GJKA 3ZDEA 4GP6A 3AUTA 1Y5NA 1MVLA 3FB1A 4UCWA 5TV2A 3BGWA 5CG1A 4MUFA 1SNYA 4EKIA 5BPHA 2V9ZA 3LYUA 3DYIA 4PGHA 3UJHA 4PQRA 3T7IA 1PO7A 1ZU4A 3I83A 3C2QA 2VBCA 4M38A 4WNIA 4G5YA 4FCWA 1YNOA 1ONSA 2VYFA 1MQ8B 4TYPA 5GJVC 1RZRA 3KU4A 4F1WA 1O0CA 3H5AA 2FVYA 4N5HX 2G0NA 2PEYA 1QHXA 3OU2A 3ZHVA 3DWGA 2FZEA 2RKBA 3EIFA 4Q5IA 3EW9A 4YUVA 4F4CA 5HK9A 5BYBA 1A9TA 4WKPA 4BEBA 3CVWA 1YBVA 5IDVA 4PU0A 1B7GO 2C1EA 2WWWA 1SKQA 4RKRA 3MRSA 4EMSA 5IC4A 5JSHA 3O8BA 1UKAA 3WA6A 4LJSA 2MMCA 2QMYA 3RJMA 1J4AA 2XYPA 4UMFA 3TI9A 5CB0A 1KGDA 1AXGA 3FY4A 4K9QA 4MAMA 3TIIA 2J07A 3A26A 3QA3E 5DX1A 3SNHA 4DLXA 2QV0A 3JPYA 3L1HA 5HKAA 2YNMC 1P81A 3A9RA 3GT0A 2QMQA 2I2BA 4Q21A 4I5EA 3F6BX 3WNCA 4YRGA 4FSHA 2B9EA 2ID7A 3KEOA 3KNZA 4QUBA 4K9KA 5ES4B 2E2WA 3WGIA 1W59A 3IAAA 1FP1D 1ZLXA 1AKQA 1NW7A 4K9OA 1BGXT 4TKMA 5D8DA 1Q12A 2CB9A 3RS4A 1ZLYA 5C80A 2Q62A 1JSXA 3TOVA 3VV2A 2G6BA 2OD7A 1K7YA 3EQ6A 3UPUA 4JI4B 4U7JA 5JYEA 5IDQA 3BXEA 3KXIA 3VHXB 5LQKA 1QU2A 2XNJA 5CD9A 1E3SA 1WNTA 4J3NA 2HO5A 4EZEA 3L8GA 3ZD7A 4IQ0A 1ZOSA 1JJ7A 4F71A 3S1SA 4W5NA 2HK8A 2VJBA 2QXYA 5DH9A 1GOTA 4JB8A 1M2WA 3K1AA 4EW3A 4DT1B 3WGYA 5AW5A 2BZSA 1SKYB 4NH0A 3L7KA 4GX1A 4ZQFA 1GTVA 3K94A 1VJTA 1ABFA 3IVXA 1VBKA 3QBJA 2X58A 3MJTA 2N9UA 2PS9A 2J7PA 2PPLA 1F8XA 3ZGNA 1T2UA 1L4HA 3EEFA 1OWLA 4G4SP 3ACCA 4L57A 2F00A 1R4NB 1T8RA 1DTWB 3VPBA 3IP7A 3HS3A 5COAA 2UZ0A 2DJ5A 2GI4A 4J0CA 1XXHA 2CVOA 2P6PA 3ABRB 2FG7C 2AEMA 3PDWA 4RA9A 3RJ9A 3U39A 1XNQB 2IOHA 1MEJA 2VN8A 1ZONA 4MKFA 3URMA 1AHIA 1U8YA 2O2GA 4TYMA 1GN8A 5DJ5A 2C7RA 3PXXA 1QYXA 4CGZA 4G8CA 2R6AA 4D8VA 5ESDA 3VPCA 1YJBA 4MZXA 4M76B 4BB6A 2HMSA 4B6GA 3EOBI 4UKDA 5A7GA 1FDUA 2NPOA 1H2BA 4DCJA 2O3TA 4A6EA 3PXEA 2ZSBA 2WFAA 4ZO9A 1KJIA 2EFGA 4LPKA 3DCJA 4YLGA 1KMMA 1YGYA 2GF2A 2VATA 2YZKA 4QWWA 2FCAA 2F1IA 3O1LA 2R1TA 1JW9B 5FBLB 5LMUB 1XSEA 1EVLA 1NG1A 4LBWA 2OSBA 2ZRCA 3GK3A 4UAGA 4WNAB 5EESA 1IZZA 4HAWA 4AZ0A 1BFUA 4QL3A 3OURA 1YU9A 4WLFA 1Q1BA 3MFQA 3IGFA 3ZCPA 4GZ5A 2F3RA 4Q39A 1MG0A 2XKKA 3OWOA 5F5LA 2AR0A 2KSQA 2Q5CA 4G5OA 2DBQA 1RKXA 2QL9A 1UBLS 4MI6A 4BPBA 1ZVMA 3ZWCA 4QPZA 3D0OA 2QTTA 4ZI7A 1K98A 3ZZNA 4QQKA 5BQFA 4OX9Y 5F1OA 8LDHA 1U1EA 4KYIB 5K7SA 1I3LA 3LX5A 3KZOA 2J5QA 2FFJA 3NTUA 3PG5A 5LBIA 3ZDZB 5CDYA 1T3HA 1USUA 1FW6A 1P2SA 2IE8A 3ILYA 2V6BA 4FT4A 4M9UA 9ATCA 5IKMA 1NVMB 1GL7A 1H66A 5DISB 4E4TA 5BSFA 5KWEA 3HHEA 5EIBC 3OQPA 4UU7A 4ZA2A 4CKBB 3NIBA 3I5MA 3C6BA 4TTJA 2DHCA 2FRDC 3HDQA 1AUQA 4MWDA 3V8RA 4JI0B 5HF5A 1EESA 5L7YA 1S7CA 2PHZA 1WY7A 4R41A 4LSMA 4HLCA 2WJPA 4N0MA 1EQAA 1E9FA 2RHDA 3ZLJA 2OAP1 3MB5A 2QWXA 4TZTA 1X39A 5IPFA 3QLJA 4Q6BA 2Z8YM 4N7RA 2CK3D 5G1NA 3SQXA 3V00A 3LNTA 4BQRA 5A0VA 1XE3A 3DE0X 4RK7A 5DWVA 4EM6A 1Y1TA 4MGHA 2ZIUB 3IAHA 1WMDA 4YROA 4US0R 4AF8A 1QTQA 4XB2A 4B0OA 2ZI3A 1WXXA 5JH7B 2XWSA 3H75A 4DC1A 4YUXA 1E1NA 2IYQA 4QDUA 3DFIA 2RH8A 1VZ3A 4E2ZA 3JTEA 1PKEA 3HXMA 4EF6A 1ORIA 1M5UA 4G85A 2ZJ8A 4TKUA 4XVHA 3GLVA 3LQQA 4N5IX 1H9BA 3LXRA 4H7IA 4YJGB 4MCHA 5HCUA 1I94B 2PUBA 1OMOA 1QIGA 1ZVJA 5ANRB 2VK1A 3MOGA 1ZUNA 1R9NA 2JA2A 2D8AA 5HKLA 2IDMA 2ID4A 3EUEA 1MDBA 1NYQA 4YP5A 1G9SA 1YIDA 1XEWY 3P97A 1C9NA 5DHFA 4XI9A 2JH9A 2YTZA 4ZVUA 3UNXA 2O07A 3HADA 1GNSA 1UZAA 3PFIA 3RGWS 2CFIA 1ZINA 2V58A 3SVZA 1OC2A 2WSYB 2PWPA 4FEGA 4CEJA 1DX9A 4HNQA 4ON9A 1Z4NA 5ESRA 3WWOA 5LP6A 3K8QA 4MEBA 3KCNA 1Y1RA 2JI6A 1LLQA 3HBJA 4PG6A 4WXRA 1BSVA 1K6MA 5FOWA 5BUSA 1QZUA 2YIDA 1JHMA 4LOAA 2D1QA 4XYLA 4EG0A 4OYHA 2RIPA 5ALUA 1C14A 2ZJZA 1KNXA 3PXBA 3L0PA 4JLUA 3I72A 4JVNA 3VKHA 3PSHA 1KEUA 4I1IA 1APBA 5DEOA 3UJ3X 4PYMA 3WDSA 1ZG3A 3F47A 4GMDA 3OPYA 3AL0C 1RWQA 3IQZA 1Z26A 2J41A 2DBZA 2QVBA 2VF5X 4K6GA 1D4AA 1N1GA 2BR4A 2Y05A 1DHRA 1IUNA 3COVA 4MWCA 3IX7A 3FGNA 1Y8QB 2X19A 1BOOA 3MWJA 4F38A 3K30A 1E6UA 4LNUB 4ODIA 5B1HA 4E1BA 3BA1A 4FFPA 3SZ3A 1MO2A 5EKDA 2F3UA 2M2IA 5JD6A 4UM5A 1C9DB 5ADWA 4OOEA 1GYQA 1E3JA 4OHUA 5BN5B 1E2LA 2Y2VA 5LQSA 2MMGA 4KTVE 2B99A 5TF4A 2CNWD 3HDYA 3FDJA 1U5BA 1UZUA 2JIPA 3G9XA 4ZV4A 3LF2A 3O3CA 4HDKA 4E5KA 1DKUA 2WVJA 3HFJA 3U4AA 1AA9A 3H84A 3RM3A 4ARZB 5HZMA 2IH2A 5TPWB 3X1XA 2IGBA 2YOHA 2ODWA 1NW8A 2PX2A 3PPWA 2AFHE 2DLCX 1U1FA 3O8QA 1B1AA 4OL0A 1E2BA 2BSXA 2UDPA 5HA5A 1VHWA 2FZWA 4JL5A 1KU0A 5ECYA 3SQNA 3TLGB 3VR6A 4TSRA 3MBOA 1OFUX 1FFXB 3FOAA 3PXCX 2RGNA 3LZCA 1QFMA 4GP9A 2QRGA 5H0IA 4PTLA 3I4CA 1IU9A 1VQ1A 2BTOA 1EWKA 3HDHA 3OI7A 4KVGA 2OL4A 3FHLA 4TXHA 5CM8B 4YJFB 3E23A 3WK7A 3AEQA 2VDNB 2BV3A 1O6CA 2QA5A 3PEUA 1LDEA 3IEIA 1JQ3A 3NHJA 1J8VA 4N65A 4PZ9A 4RHEA 3EH1A 5C34B 3IUMA 2F3SA 3MINA 3K6KA 3CNOA 4I6EA 1RD4A 1SELA 1ICEA 2GPTA 2R6HA 3DD5A 1E60A 2IITA 2WJVA 3E53A 4MA4A 1NC3A 1TC2A 4OKIA 5FCDA 1L5HA 3X1YA 4H31A 3GPLA 4FNGA 2FPGA 5EUQB 4XB6B 5J4HA 5GV7A 5B4UA 3WYDA 4MVXA 3A70A 3M1IA 3UYKA 4P1ZA 1VYVA 3CHYA 2BKXA 2EX4A 3H3FA 4GZ6A 4OLFA 4RNCA 4X8LA 2W2KB 3LY5A 4Y6PA 1KAEA 1V5IA 3LQKA 3WDLA 3KTFA 4YR9A 4YQFA 1NX6A 3FCEA 2G9VA 1ZSVA 4B0PA 2WU3A 2JPDA 2PX4A 2P3QA 3L46A 3QFTA 3I53A 2JH3A 4H1UA 3HKEB 4CMEA 3PXUA 5BVGB 1NQOA 1TJ3A 3OZCA 4GZMA 5TNXA 1JNYA 3MS7A 3ZTYA 5HPYB 4KLNA 1NVWQ 1RPTA 1DKNA 1EB8A 4PGAA 4UAJA 1TLTA 4FFLA 4B6RA 5FWYA 2XZOA 1IBSA 3DHWC 3EIXA 3T38A 1UPCA 4QTTB 2BD0A 3KSMA 3L41A 1I0LA 4MHTA 4MPRA 1TCBA 3B36A 4KK4A 5FULA 1GYRA 5GZ6A 1L4LA 1LWOA 5BOSB 4MYCA 4OP3A 1CY7A 2C9DA 3QEMA 2BW0A 1YDEA 2O50A 3KLOA 4KTTE 4ABTA 3H99A 2AVNA 1KRHA 3QVGA 2DR3A 2N3ZA 1MC1A 3CEHA 1RQ7A 1I33A 4TTIA 3RUCA 2YIJA 4HDNA 1EK6A 2QDKA 2ODBA 4UATA 1EH5A 4OQEA 3C7KA 1P6UA 4YJGA 2HWKA 4Z0NA 5AWFC 1O6GA 4TKUB 4LDJA 1QYDA 2JBWA 3IPCA 2V7BA 4DCGA 1EFKA 1U2GA 2QUZA 3L04A 4TKVA 2ECFA 1HMYA 2ASEA 5KTTA 2XOKD 3QWBA 4W1QA 1V8BA 1FBTA 1H6DA 1MO4A 2H29A 4JWTA 1LLCA 2R2AA 4XQ9A 5SZIA 3STUA 3VPHA 3W1VA 2PK3A 3QIVA 1JMKC 1FRVA 3ZZ1A 1UAGA 5B55A 5HWSA 4HNHA 4MW7A 4Y9UA 4R98A 1HF3A 5K01A 3W5HA 4BVFA 5FWAA 1SUEA 1Z5ZA 3QW4B 5BW5A 3QOYA 3PGMA 2R68A 4C22A 3I9LA 5I3CA 4OHYA 2HRRA 1T2EA 2P7IA 1O96B 4DA8A 2FUCA 1Y33E 1J22A 3W2HA 4GNRA 4RTRA 4BDTA 3IJEB 5JXJA 1FX1A 1MA3A 3D02A 4NG5A 4N0PA 5J5CA 3H4TA 2NPIA 2VT7A 3KEFA 4DZZA 1DPFA 3RBZA 2R4TA 1Z5UA 1YVPA 3GFGA 1SCUB 4AO7A 2HRCA 4DJTA 2N1BA 3ANYB 4NP6A 5AW3A 4IR7A 1I8TA 4D9EA 4Z3KA 3EASA 1V4BA 2NACA 2Q4OA 2Q3CA 1LF5A 4EMTA 4CLOB 4BQIA 1GPJA 3ST7A 3KEQA 2NQTA 1QORA 2QMEA 2W6JD 3OQBA 3I9V1 4IY1A 4NRDA 4RQBA 3CZMA 3ZBQA 2JLYA 5FBRB 3DKRA 3PJGA 4OLBA 2PAAA 1ZJZA 1IM5A 3ROQA 2W2XA 5CGQB 3A1SA 1XZIA 2FEMA 1G21B 3F2VA 1MX1A 3DTVA 3L7BA 2EOAA 3LUKA 3OPMA 3A6ZA 3OD5A 4OGWA 8GPBA 3RYCB 1FQWA 1Z5WA 4XW2A 1OBHA 4YACA 4JN6B 2XB6A 3R6LA 4Q66C 3I2YX 1NVFA 3CKKA 1GRCA 5JQGF 5KZMB 3DVSX 5CXXA 1V6AA 2AMVA 3L0CA 1T2DA 2JLSA 1MC4A 4YX9A 5C52B 3A1CA 5E8JA 1NJGA 5AOAA 1C9JA 3ZVMA 1CQXA 2G63A 2H1VA 2QT0A 4JUFA 1K89A 5CGZA 5FPHA 4YCLA 4Q3KA 1UOPA 1LFAA 1PYOA 1UBUS 3CXUA 2HRDA 4ZAYA 1G19A 3FYCA 4R71A 2CVFA 3RYFB 3T99A 1I30A 3TI7A 1HDXA 4YT2A 4R0MA 4V3BA 3F49S 4ZVSA 1M0WA 4PYRA 3HVHA 4PRKA 4QU9A 4O3MA 1GGFA 1GTMA 2CMHA 1N2IA 2H4YA 1KVTA 4C0QC 1CIPA 3BMOA 4L5CA 5JY1A 1A97A 1NQUA 2ZBDA 4AAYA 2RDMA 3T5CA 1ST3A 1PP4A 1T29A 3NC4A 1ODCA 4C30A 1TO1E 1IZ7A 2ZWPA 4B3CA 3PCRB 3QMMA 1Z62A 1KQOA 2HSJA 2JI9A 3PC8A 3NHLA 3Q8MA 1Q0LA 3F4BA 5IUKC 4KE8A 1IZ8A 1J07A 1FP4B 2WYVA 4TSKA 3U7GA 3ICQB 4FE4A 2OBXA 4OKNA 3MMNA 2F55A 1QZTA 1JQLB 5G41A 3OCWA 1BFDA 4O1IA 2CXXA 3NKLA 4HDMA 5T5QA 4ZJUA 2XUGA 1MTZA 4HS4A 4OXQA 4D97A 2VPZA 1ZR2A 2PTGA 1U5CA 1RM5A 1RXSA 3N6VA 4MTLA 3TX6A 5HQ3A 1KK3A 1FEZA 4K88A 5DLQC 4FPXA 1BU8A 1A4RA 2GILA 5KX5B 4TRMA 3A04A 4Y30A 1HLGA 2BGLA 3H4IA 2LV8A 4GMXA 2OCYC 1CQPA 2EL9A 2IIBA 1W46A 1VCNA 3L7CA 1V37A 3FZEA 3WQBA 4F1KA 2WNIA 3HRHA 4GC9A 4YV0A 1S8OA 4K1XA 1NXSA 1A27A 2L2QA 4CIYA 2RGWA 3DMYA 1IOVA 3F67A 3FYTA 5I9TA 5JS2A 4M49A 1B14A 1GITA 2B4KA 2ATCA 3GXBA 5BN3A 2QBYB 1N32B 4AWBA 3ZR4B 2I1WA 4U5XA 2ZUTA 3WRYA 4KREA 1YE5A 2IZZA 3QLVC 4KBYA 3SFZA 2XCIA 1EX9A 4XYGA 3KSRA 1RQPA 1TL7C 2QJFA 3C6YA 2DWCA 3E9DA 1AK2A 3LCMA 1JLLB 2ADMA 1C7JA 3GQBB 4F93B 1A9YA 1OD6A 2F3PA 3PJRA 5JSFA 1G8JA 2VTKA 4B3HA 1AGPA 1K88A 4MW4A 3L5OA 3R3XA 5DHUA 1MHTA 2R2GA 4PQFA 4EHHA 4HRXA 1AN0A 4PPQA 2BF4A 2D3WA 1EXMA 1W9HA 5GZ1A 1SKBA 2WWRA 3WMFA 3IKMB 5I51A 2GOYA 1YZ3A 4IHJF 4MWTA 4COOA 2P41A 3SI7A 1L4NA 3CVOA 1R7RA 4PZCA 2EZ4A 1NJ2A 4RKFA 1DXQA 2M6SA 4PGFA 2XA1A 5TF0A 1DZIA 5C1IA 1O4VA 1JR3A 3NDJA 4BX9A 5JAOA 4DR1B 3T3EA 1LF0A 2QQ5A 2O1WA 3VR3D 5IFKA 4NCBA 2PUHA 1U7PA 2RJOA 1YKGA 4GOND 5HKOA 2C7QA 1Y6RA 4QDOA 5AVRA 2IEAA 5H82A 3V42A 5CURA 4R8RA 3IAS6 2FUKA 3F4LA 4FZRA 1IXZA 3NKVA 4Z0HO 2VRWA 4FGJA 4TROA 3FMIA 2WU8A 3IVAA 3PE4A 3ZKWA 1MZVA 4CMCA 4RAQA 3V1YA 2X40A 3W5JA 4NPCA 1DFIA 1CY1A 3WI7A 5L4SA 2J4DA 4KMOA 3CC8A 2R65A 3VC2A 3MUOA 3RHFA 2ZRMA 4AL4A 3Q8KA 2FFBA 4O3FA 3UA3A 1UP6A 1QE0A 2OGUA 3PNVA 4UARA 4TYQA 3KJHA 1AGXA 1Z56C 2EWVA 3L93A 4PS0A 4AN0A 4CQMA 1M8GA 5GINE