2VSXA

Crystal structure of a translation initiation complex
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
382
structure length
366
Chain Sequence
QIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE EIF4A
publication title Crystal Structure of the Yeast Eif4A-Eif4G Complex: An RNA-Helicase Controlled by Protein-Protein Interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 120
structure length 366
sequence length 382
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vsxA02
2IYUA 2GZDA 2FFHA 2J7PA 2JGNA 4Q47A 2A5YB 4US1R 4JLVA 4L4UA 5DI9A 2AHOA 1GNQA 1N25A 2FGKA 4Q4AB 4XOIA 4A9AA 3CRMA 4LHXA 2H16A 3IO5A 3U44B 1M2OB 1S2MA 1QHGA 4FMCB 1XEXA 2Q3HA 1VIYA 2JLUA 2IYSA 2B8TA 3TNFA 2WKQA 2R44A 2XTZA 4EPXA 2CBZA 2IXGA 4LV8B 4UNQA 4LC0A 4Z1MA 4B71A 3CR7A 1SXJE 4WVFA 1Z06A 4M22A 4Q1FA 2CVHA 2V6JA 121PA 4TMWA 3FKQA 2KSQA 2QAGA 2KBFA 5TY0A 3VNVA 5JJKA 4QHTA 3RSOA 4M1SA 2D7CA 4KSCA 1EG7A 4OK5A 4LBWA 1E6CA 2VH5R 4GZMA 5CYPA 2GJAA 1KJZA 2FOLA 3QEOA 1T4GA 1US8A 1UPTA 4ZCLA 3THYB 4KVAA 4G5QA 2OFXA 1C4OA 1Z8FA 1GKYA 4N0DA 5C1BA 4BPBA 1G8PA 1E2GA 2JJ2D 2QSYA 4DCSA 1CEEA 1II9A 2A5FA 2G88A 2XZPA 1RC8A 4HI0E 5CYOA 3KQKA 1S0UA 3RABA 3GLIB 2ZRAA 3S1AB 5JI2E 1W4AA 5AJYA 1S3GA 3REGA 5GVRA 3QY0A 4CT5A 4LJ4A 1G291 2OFOA 2WJVA 1DOAA 1NVXQ 2FSGA 1Z0JA 3SDZA 1N6HA 1VG9B 3PUYA 2EFGA 1NVVQ 1X1RA 1LV7A 4MRNA 2QP4A 3ND9A 1BYIA 4F38A 3NDBB 4Q4HA 4MRVA 2NMVA 2EFCB 2B21A 2P2LA 3SU8A 4JLKA 3DM5A 1S1MA 4QGHA 2BEKA 1ZNYA 3U4QA 2FNAA 3QENA 3HR7A 2W6IA 4C2UA 1YQTA 1E2LA 1G5TA 1TF2A 2VHTA 2VP4A 1UKYA 5G40A 1A2BA 4QBFA 1Z07A 3O8DA 1YZNA 2NZJA 4NYMR 2EWWA 4P4SA 4PO8A 4LOAA 5AUOB 3KJEA 1MOZA 4EPRA 5GJVC 1ZCBA 1S4QA 4BECA 2X19A 3EZFA 3EA0A 2O5VA 3NC0C 4LV5B 1OHHD 2B8WA 3SI7A 4HLUC 4EFMA 1FPMA 3AVXA 3J81k 2CNWA 4M4SA 4IW3B 1HEIA 1E1RD 1OH5A 1DADA 3BK7A 4V0MA 3VR3A 3Q85A 2DFTA 4QKQA 4LRWA 1RYHA 4BZPA 3I92A 2A7QA 2F43B 3KKOA 2IEYA 3ZZUA 4R71A 3PEVA 1UEJA 3EW9A 3GJ8A 3QXCA 3MFYA 4C0KA 1V43A 4JBXA 4U7DA 4GBMA 2J87A 4GSYA 2ZR7A 5FTJA 1AA9A 4MDEA 3UXMA 5KNBA 2ZJ8A 1KK0A 2A30A 2ZU0C 4F7WA 2WJHA 2XB4A 3TSOA 1G3MA 2AK2A 2GZHA 2NG1A 2V6IA 2N46A 4Y0VA 3GFTA 1KI1A 1KNXA 3EPHA 2ONKA 4PSAA 4Y0AA 3TW4A 2WWXA 1N3BA 2QTHA 3ZVMA 2E1RA 5FBQB 4AYTA 1JJ7A 1SVIA 1BMFA 2YJTD 3FDIA 3TVDA 1R5NA 1W49A 4KI0A 3WNCA 1Z2AA 1EWRA 2IUTA 4JLDA 2BEJA 2O0HA 2ZRFA 5HR5A 2QPAA 4TSFD 4TL6A 4PPQA 3I8XA 1EESA 2ANCA 1Z6GA 4ZPXA 1LVGA 2O8CB 5JRJA 2ZJOA 4UNSA 1IXSB 3HWSA 4V02A 2YOGA 3A36A 4B2IA 2J5XA 2XB2A 1ZC4A 3TSZA 2IS2A 1T0HB 2QENA 5FI0B 3B78A 3A1WA 5CIQA 5G53C 2ZI3A 2X1VA 2WPDA 1UBEA 5KDLA 5LD2C 3AF1A 5K8IA 1Q1ZA 1NKSA 2DCUA 4IHQA 4YMVA 3ICEA 5FOTA 4A0FA 1ZU5A 3T34A 3O8CA 3A6PC 5KDDA 2VPPA 2WMNB 3OEED 4B47A 1E94E 1VCNA 4FCVA 4OL0A 1X8LA 3B85A 3OFND 2OCYC 3B13B 4JKIA 4ZCMA 1NN0A 1L7VC 3RYTC 5EP2A 2VEDA 4B3CA 2IT1A 4UKDA 3D7MA 3ADKA 4PFSA 2OO7A 2ZJ5A 5TB5A 3X1XA 3EG5A 4BE7B 1D8TA 1ZM3A 2RB4A 1VG0B 3RS7A 2D2FA 4RD4A 3K0EA 1AZSC 1DBSA 4UJ5A 3QXXA 1OFIA 1JECA 1Z0AA 3CONA 1E9SA 1EX7A 4LJ6A 3VU9A 2CL6X 4FMBB 2RCNA 5FOXA 4JIMA 2RAPA 4AY2A 3IIMA 4AI6A 5L3QA 5EJEA 1NY6A 1R0WA 4CEJA 2QM8A 2H92A 2ZE5A 1FOEB 1NLZA 2BDTA 3M0EA 3KZ1E 4FCWA 2GHIA 2YINC 3C7KA 1U94A 2DWQA 3EZ2A 2G1KA 5EUMA 1NMXA 4II7A 4TL8A 4NYMQ 2YC4C 2VA8A 2Z0MA 3BS4A 3G82C 3GJ7A 1R0ZA 2NO6A 1N6KA 3I5XA 1D2MA 1AIPA 1T3SA 2AXNA 3RSLA 4UXJA 3TIFA 2OZEA 1B23P 4V0LA 1FTSA 2DYKA 3T61A 3IPXA 1B0UA 2AXPA 4IFEA 4KFTA 1U81A 3ADDA 2JLQA 1HQYE 2AD1A 1KZGB 4K46A 1QF9A 1XRJA 3LFUA 2GCNA 3GLGB 1TAGA 4YMSA 3ZLJA 4L9SA 5IDVA 4HUTA 1A1VA 4OYHA 4IVRA 2L0XA 3UIEA 3TGPA 1OB5A 3ZS8A 3OIUA 1G17A 4PAOA 1J2JA 1GNRA 3ZQJA 5KNCA 2BBTA 1U90A 4MGIR 1EFCA 1OLOA 4E22A 1MABA 5H1YA 1P2VA 4DUGA 1PJRA 2QTFA 4P31A 1SXJA 1ZUNB 1NL3A 2B92A 3N70A 1XCMA 1UAAA 2RKOA 2IYWA 4O2RA 4M8NE 4TLEA 1P5ZB 4XJXA 4C2TA 3CW2A 2WWHA 1KO7A 1G3IA 2VF7A 4QM6A 3QBVA 4D4LA 4RZ3A 4EJSA 5JWOA 4H1UA 5L3SA 3K70D 1R0XA 2W2XA 2P67A 3NBYC 3WRYC 2DFKB 4UXIA 2ASEA 3R8CA 2DR3A 3V9PA 1WE2A 3PR1A 3ETLA 2ANBA 2OXCA 1Z6XA 3EXAA 1TQ6A 3LWNA 4Q7KA 3OAAA 2GJSA 1MV5A 1XU4A 2BVNA 1CRQA 1TADA 4KLNA 1XMSA 5JECA 2XNDA 1SKYB 1YRBA 1P2TA 2PEYA 3WXMA 3PG5A 2JIZD 2ZI7A 4PO1A 4H1VA 4A4DA 4QXAA 2A3RA 3AVQA 3KKNA 4OK3A 4QBIA 2EFDB 2ZVPX 3TJZA 4WOPA 2VTKA 4A2WA 4JBYA 4LPKA 5KPJA 4O2LA 4KFRA 1OH8A 1AKEA 1GDDA 1HT2E 2J59A 3ZGXA 3CF6R 3M6AA 2WHXA 1GFIA 3R9IA 3EPKA 1IQPA 1R5BA 2ZEJA 2HF8A 1AKYA 1Z0DA 3QUSA 4C0SA 2YZ2A 4HLDA 4ZV4A 3QQ5A 1AQYA 1KI2A 5DNYB 3QSYA 5FR1A 4US2R 2O8DA 5F9FA 2BKUA 1IY1A 1QHIA 2CK3A 1AK2A 2ZI6A 3AP2A 3LA6A 4RFSB 4QGGA 3MJRA 2ZRKA 3LW7A 1TUEA 1XXHE 2R65A 2CL7X 4MGKR 4PHHA 2Z6VA 1FP6A 5BN4A 4IOJA 5KSOA 3SQWA 2BJWA 1UADA 5D3MA 3KXKA 1DAIA 3OEHD 2J0UA 2DBYA 3PQCA 2JLWA 1FMJA 2V7QD 3H84A 1COWD 1E98A 1RRFA 4LBZA 4B32A 4RD6A 3AKDA 2J46A 5DO9A 3U5ZB 2HT1A 5FPSA 2ZM5A 2PL3A 1YJ5A 3IPYA 2O8EA 3K0SA 4ZKDA 2HJVA 1E0KA 4BLTA 4FWTA 3D8BA 1LB1B 1W0JA 4NE2A 1HYQA 1NNEA 4B34A 5FOWA 3G0HA 1GOTA 2VYFA 1N6IA 2BV3A 1SHKA 4YMWA 1IN7A 2BMDA 1PV4A 4DXAA 2RMKA 4GFDA 2REXB 1TQDA 3V4FA 4DLSA 4BLSA 4AG6A 4JL8A 3FFBA 3ZIAD 1GZSA 1E9RA 1E2QA 1KI3A 1QRAA 1TQ2A 3CPEA 4P33A 3AEZA 1Z29A 2FEMA 2ZR9A 1JAHA 2HJGA 2LKDA 3K09A 3BH7A 1KK3A 4JLAA 1DO2A 5KU1A 3WRXC 3HU2A 4KBFA 3CKLA 3D31A 3SYLA 5J4YA 1W0KD 3LV8A 3X1WA 2A5GA 4Q7LA 2D74A 4Q1EA 1KMQA 1K6MA 2WJJA 3CF2A 4ZDKA 2JDIA 1Q44A 4YMTA 1ZW6A 1E0SA 3K9GA 4PHGA 4QJ3A 4TQAA 1KSFX 4IFBA 3GEHA 3BFVA 4NL4H 1CIPA 4HB4A 5JRZA 5BWMA 2C8VA 1KO4A 4UXHA 2Z5FA 5DN6D 2ZAOA 1N0VC 3PEYA 1E69A 1E9BA 1QHYA 2J3EA 4K81B 2OV2A 1Q1BA 2EVWX 3VR6A 4O3MA 1XD8A 3RWMB 3SC3A 2GEVA 3NH6A 1F2TA 1NJGA 5BYKA 1Y3AA 4URXR 4PC7A 4ZI2A 2WOOA 4CZ2A 2YYZA 2ODWA 3CNLA 2BJVA 1ETUA 2PZGA 1EFRA 1NG1A 3FKSD 1G8HA 1HQCA 4B48A 3FMFA 3PITA 4M9QA 1JB1A 3WY9A 1T5IA 1OXUA 2AWOA 1EFTA 3O8RA 4IOMA 1U0JA 2DWPA 1E1QA 2ZJBA 3LQRA 2SHKA 3THXA 3BERA 2OBNA 3BB1A 4PPNA 2QE7D 4LYJA 4MUAA 3PENA 4ZKEA 2FFBA 1W2GA 3MJHA 1CR1A 1G6OA 4TWZA 4OHZA 3EX7C 1PVOA 3SQXA 1NN3A 1Z83A 1C1YA 2OFWA 2ZRPA 1KKMA 3FHTA 1XMJA 5JJIA 3CUEF 2C77A 4WBSA 3ZJYA 3GP8A 4LJ7A 1Z6AA 2CLDX 2XNSA 4JLJA 4LUCA 4X8LA 4A8JB 3HJNA 3GLHB 1XPOA 2RGNA 3RRYA 2XXAB 2VHCA 3AP1A 3RRZA 5CITA 4ACAA 1MT0A 3KTAA 1CJTC 1BH2A 4R7ZA 1A7JA 4HZUB 1AM4D 3KKMA 4XVQA 4A6PA 4Q9JA 3RRNA 4C9BA 4MUBA 3I3SR 3IBGA 2DFNA 3KQHA 3RS5A 1QHHB 5DI3B 3WBJA 4IXNA 5DYIA 1H8HA 2WSSD 4PZLA 2IS4A 3PUVA 1SZPA 5H68A 3R7WB 4LYHA 4XWKA 1IN4A 4TT3A 4A0HA 1W7AA 1KI8A 1RJ9A 2QRNA 3P27A 4QFMA 4ARZB 1Z0IA 4OQLA 4AWXA 4Q9HA 1NBMD 3BORA 4YXWA 4BFVA 3I62A 3GMTA 4QL3A 1WBBA 2IUSA 4A8JC 3TVTA 1AN0A 2QTVB 3N2EA 3AF4A 3KKPA 4HAXA 4FMDB 4NU0A 5C4GB 3GLIE 1RRPA 1XMVA 2V1XA 2GESA 1TNDA 3HDTA 3VKGA 4PZZA 4JLNA 3B1VA 5J5CA 1H8ED 1ZP6A 2DWOA 2J7PD 3QKSB 3MWLA 2ZQ5A 4M53A 3QKUA 1Z22A 2CCJA 3I4LA 3FOZA 1DAKA 1G3UA 1XEFA 4QBGB 3L0IB 4RD0A 1XCGB 3PIRA 1OFTA 3Q3JB 1HUQA 3NG1A 1FZQA 2C96A 2UKDA 1R0YA 2QAJA 3THWB 2WSMA 3PFIA 3CZQA 3CNNA 3B7GA 1Z0KA 5J4LA 1YU9A 4Z1MD 4KYIB 2FJUA 1F60A 2OUKA 1MRNA 3DDCA 4HSEA 1A5TA 4QBHA 3U3RA 3MWJA 4A2PA 2ZRBA 2BWJA 4JVSB 3Q5DA 5D3QA 3SHFA 1T3HA 2IK8A 4DDVA 1AS0A 1ZJ6A 4D80A 3VNUA 4LZZA 2ZU6A 5FUWA 5JS7A 1IXZA 1Q1EA 4UNRA 1VIAA 2NGRA 1U99A 4LCBA 1CP2A 1U9IA 1TU4A 2JJ1A 2J41A 1KDTA 1OT3A 1T5LA 4YC7A 4XD7A 4M1OA 5E95A 4KODA 2GXAA 3RC3A 3L2OB 4G1UC 4PAMA 5CB8A 4JYCA 2AR7A 4V03A 2ZI4A 5FUVA 2V1UA 1E2EA 2OCPA 1TX4B 2O8FA 3CR8A 1SVKA 1IN8A 1ZRHA 2E87A 2Z83A 2JEOA 3AVOA 2R9VA 3AVWA 3GFPA 4TL7A 1F5NA 3A4MA 4D0NA 4Q9IA 1VDZA 2H7VA 2F3RA 3WHLA 5EXTA 4LYAA 4PSVA 1P2SA 1RRCA 1EX6A 3IQWA 1OF1A 2VO1A 4EQ6B 1OYWA 5FBWB 1OPXA 2Z4SA 4RY2A 4TTPA 2QT1A 2QEQA 5HCIA 2FZ4A 2QAGB 2CJWA 2ODBA 3DMNA 5A0FA 4PPFA 2Q0HA 2ZVQX 3RLFA 5HE9A 1YZLA 5LDDC 2W6ID 1US8B 2W83A 2ZJYA 1XZQA 4DLXA 1E0AA 3PV0A 2IC5A 3GLFB 2CL0X 1E79A 3KDSE 4LHYA 5EE9A 3IIJA 2WWWA 4A1FA 2XOKA 3FWYA 2H18A 4EPTA 2ZUDA 4NYJQ 4WIAA 1DAEA 2JASA 4OKSA 4W9MC 3QPUA 5JHHB 1LS1A 2QMEA 3B9QA 3QXSA 3TH5A 3UWOA 3WYGA 1Z28A 1NVUQ 1UDWA 2BCJQ 1U8YA 1XEWX 3U3OA 3W6PA 4CGZA 3HPRA 3GCGA 3SZRA 4Q18A 4CF7A 1VPLA 1IAQA 3K0FA 5DSZA 1XTKA 2F9MA 1DPFA 5EZ6B 3SE0A 5K8LA 4NYIQ 2CNWD 3CO5A 221PA 2J0VA 2QAGC 4HUQA 4ERNA 1HH4A 2BM0A 4CW7A 1OIVA 1ZNXA 4WXPA 3UPUA 1A4RA 1Z08A 2OBLA 4TZ0A 4ASUA 3UG6A 2BKEA 2OLJA 4OBEA 5FR2A 4FW9A 3U4QB 1OIWA 2D3WA 1FQKA 3ZQ6A 4CRWB 3MRSA 4DSNA 1I4DD 1KI6B 2NO1A 3DOEA 1TQ4A 1OKKA 3P32A 5C4MA 1C9KA 2GK6A 1VCMA 1G20E 1CXZA 3UWKA 4XTRA 4P4SB 2GCOB 1Q1QA 1KI4A 3T12A 1WQ1R 4QNRA 1ODFA 4XSHA 1GRQA 1KMHB 4IDQA 3K9LA 1BMFD 4YDHB 1N0UA 1ZU4A 4M1TA 3G5UA 2P6RA 2NQ2C 2HDNB 3CNOA 3H86A 4R9UC 5KSPA 4A15A 1QVRA 2VP0A 3B1ZA 5DIFA 3KL4A 4FMDF 2EQBA 3B6EA 5SZJA 3KJIA 1Z63A 1R6BX 5KDOA 1KK2A 2ZS8A 4JT2A 4DVGA 4V0OA 4Q7MB 2J7KA 3OIWA 1G4AE 5DHFA 3LW8A 1KDPA 2O0JA 1PLLA 2W00A 2WPDD 3B8HA 3U6KA 1ZVQA 3DKVA 4P3YA 3VR1A 2FGJA 2Q6TA 4RZUA 1IY2A 1F48A 3W3AA 3A1VA 1KDOA 1GITA 3QKRB 4P4UA 1VMAA 2QQ0A 1JQJC 3BH6A 3ZYCA 5FBRB 1ZUIA 1JEEA 1ZMXA 5JJLA 1LF0A 2WJIA 3REFA 3EIHA 1FX0B 5E4FA 4X8MA 5FTKA 3GLGE 2IYLD 4KBGA 1OXXK 4N3NA 4GNKA 2RGDA 4Q4AA 4B43A 2G3YA 1IY0A 3IDQA 3IKJA 4DLYA 2BIFA 1J8YF 2FH5B 2FPMA 5EP1A 5KSYA 3U44A 4I99A 2PMDA 3MWYW 3I72A 5FUXA 4ESHA 3MCAA 1ESNA 5AK0A 2QMHA 1JR3E 4KV9A 3NTUA 1ZNZA 3VKHA 1M7BA 1MR3F 3DO6A 1NP6A 3EPJA 2K5UA 2FFAA 2RGEA 2IYZA 1OJLA 2J1LA 4B75A 5B30A 3TE6A 4A2QA 2VRWA 4ZIRB 4I1VA 4B3BA 4ZDIA 3AV0B 3QF7A 4PX9A 3CX8A 3H1TA 5DISB 5FOVA 3V00A 3W9YA 1IHUA 3F3YA 4KLZA 2OESA 4AURA 4C4PA 3THYA 1XDBA 2HYDA 4JJKA 4MKHA 1XJ0A 1ZUHA 1BYUA 1NMZA 2PZFA 1GNPA 4B6EA 3EIQA 4D81A 2IHBA 2N42A 3FMPB 2YWFA 4C7OB 4NP6A 2F1HA 4TMKA 3RS3A 3VAAA 3LH5A 4H9GA 3GLIA 3S1AA 2GF9A 4XVUA 1SKYE 1KSJA 2GK7A 2VLIA 3FYHA 4GRAA 1GRRA 3HYTA 1UM8A 5EUQB 2F1IA 2FX3A 3A1SA 4IDPA 5FUYA 2QP3A 3PCRB 4Q7JB 3WMEA 3HYRA 4MKFA 5JWHA 5J40A 2H17A 1VYUA 3AB3A 1E9CA 4JL6A 1W4RA 4KCGA 2GXQA 2ZRCA 2ZSEA 4G5OA 3WMGA 3UMFA 2IS1A 3PVSA 4B2PA 1JXMA 3OZXA 2HF9A 4OI4A 1GVNB 2GBLA 4KU4A 2JA1A 4DUGD 2X2FA 4B3DA 2R6AA 4QGFA 1SXJD 1Z2CA 5FH9A 4WZBE 5KO2A 1RPZA 3N2IA 1QVAA 4QC2A 3NEYA 3B9PA 4M21A 1RFLA 2YVUA 4LJ5A 4QHSA 3GJ0A 4PC1A 4ITRC 4E09A 4FMCF 2Q3FA 4IDOA 4RD1A 4G01B 1S96A 1M7GA 2VSFA 3VFDA 4BFSA 2V55B 3GQBA 1FNMA 1SVMA 1VYTA 4DDTA 4LHWA 1XTJA 3W6OA 5FBVB 4Q21A 2VSXA 2OXRA 3B60A 4D2IA 1Q57A 4NHOA 2DFLA 3BB3A 5EE5B 4AKGA 2XNDD 2QGZA 1P4SA 5KTYA 2QT0A 2WMOB 4G0NA 4RD3A 3RANA 3KXIA 4Q48A 1R5OA 2BMFA 3BRWD 4C0LA 2QSZA 5DYGA 5BW8A 1YZGA 2RH5A 2F43A 2ZJAA 4GL2A 4BFUA 2NIPA 2QPTA 3DHWC 1KAOA 4P32A 1GSIA 3LLUA 4LHVA 1E99A 1D9ZA 1LS6A 1S1CA 2GEDA 3ZD6A 2F1RA 2R6CA 3AM1A 1II8B 1T3LA 1T9HA 3K0AB 3AUYA 4HAVA 1KJWA 2QN6A 4B6FA 4EJSB 3A37A 1GUAA 3VR2A 1P9WA 2BBWA 2NTYC 2RHMA 4XWAA 1Q3HA 2WKPA 1ZM7A 3EZ6A 5EE3A 5FPHA 4OI1A 2W0MA 3KJGA 2W6JA 3AVTA 1G1MA 4C0AC 2CK3D 4C0BA 1UBFA 1XWIA 1R2QA 1XD2B 4LPSA 2G83A 1FQJA 2QPOA 1NRJB 3GJ3A 3QXJA 3NDPA 4NMMA 4OJQA 4WXRA 4LSGA 4ZI3A 1CR0A 1N6OA 2R62A 2IYRA 1VHTA 2PLFA 3X1DA 1J99A 1VCOA 5IK2A 1VTKA 2JLYA 2IL1A 2YNMA 3L0PA 2WBLC 3H0KA 1TF7A 2CDNA 3U7GA 2G6BA 1L4YA 2TMKA 4MYCA 4RZ2A 1UJ2A 4BEJA 4RFVA 4Q1CA 1U0LA 2IUUA 3A4NA 4IOKA 3Q7QA 2A2ZA 4QJ5A 1EGAA 1JPNA 1XBTA 1W0JD 2CLSA 3AKYA 4XWOA 1WCV1 2ZSBA 5DLQC 3EWAA 2VQSA 3I5YA 1JNYA 1N0WA 3FHOA 2GTPA 2WTUA 3PUXA 1GAJA 4M0LA 3I32A 2PJZA 1N2CE 3F0TA 3ZD7A 4OI2A 2CHVA 4MQBA 1TMKA 3GEIA 2BBOA 4PANA 5D3MB 1IN5A 1CULC 3K0CC 2J0UB 5CK4A 1BO6A 3TBKA 1AGPA 5GADl 2GAOA 3WMFA 3RC8A 1W46A 4FIDA 3KUCA 5EQTA 1VHLA 3GJXC 1AQUA 1OXVA 2YWGA 4Q02A 1E0JA 1I4LD 1P60A 1CTQA 3BIFA 2LKCA 1XTIA 3E70C 2GA8A 5C2JB 1R7RA 1KAGA 3DKPA 2ATXA 3QG1A 2VIIA 4DWJA 2JDID 2IWRA 1ONBA 2VBCA 3EARA 2IX3A 4I1UA 4JT4A 3L8YA 2CHGA 2CLCX 3LBIA 4X8HA 4B3XA 3CBQA 4DCVA 2R8RA 3F8TA 1EK0A 5G41A 2VL7A 3KKQA 3R20A 4PR0A 1QDEA 1UKVY 4GOJA 1N5JA 1KZ7B 3SR0A 3GLHE 2J9RA 5HPYB 1F2UB 5J4VA 2QUZA 4UNPA 4PPGA 5FI1B 3U60B 1T8TA 3P1JA 1E9DA 4TQUS 3U6BA 1NI3A 2QNRA 3AF0A 4OQMA 4URZR 3K70B 2JATA 3VQTA 5CK5A 1DELA 1EFRD 2R6DA 3IHLA 2ZETA 4MH0R 2WJYA 3KJHA 3HR8A 1O3YA 1ZAKA 2HLDA 1Q3TA 3CLVA 5A4JA 3AH8A 1OH6A 3AVVA 3ADBA 5LB2A 3GLGA 3U7FB 4EAQA 1CR4A 2JCSA 3PXGA 1KI9A 3RRMA 3UANA 1E1QD 3RS4A 5TMPA 2XGJA 2F3TA 3CM0A 2YOHA 2ZITA 2WOJA 2JLSA 1JR3A 3QF4B 2QBYB 2PT7A 4NCNA 1EFHA 4Q1BA 3SHWA 4CEIB 3TR5A 2C98A 3K70C 8OHMA 4LI0A 2P3SA 2F6RA 3MLEA 4IJMA 3PJRA 3AGPA 4QJ4A 3B1XA 2ZS7A 1KYIA 3LNCA 4KXFB 3TAUA 1G8GA 1X6VA 2BBSA 1W5TA 3P26A 4U00A 1S8FA 3TK1A 3VHLB 3LLMA 3LO5A 5JZVA 2Q21A 3KQNA 2IHYA 4HAYA 4BFXA 5JCZA 1IM2A 4BRUA 4KHZA 4NDZA 3KFVA 5F9HA 4IEIA 4PHFA 3T06B 3R8FA 1MO4A 4IOLA 3C16C 1HT1E 3HU3A 4PZYA 4URWR 4TMVA 1JEDA 3IEUA 1GIAA 1KDRA 5JHGB 1NY5A 3DZDA 4BFYA 4D4JA 1TF5A 1H8HD 5KHOC 4W5JA 4TN1A 1VECA 3THXB 1NBME 2O8BB 2QZ4A 4EPYA 2RGXA 4IXMA 5JEDA 4Q9KA 5E7MA 4TT3D 2I4IA 2ZANA 2ZIAA 3LX8A 4ZDWA 1Q20A 4DJTA 1UFQA 5IHPA 4PSKA 2J0QA 4YXWD 1MH1A 1X3SA 3CPJB 1KI7A 5LB4A 2ZR0A 5FOUA 1QHNA 2FFQA 1TL7C 1DAMA 3AQ4A 1IN6A 3FVQA 4D0LB 2WV9A 1A82A 4IKEA 3OHMA 1GKUB 2OT3B 3JVVA 5FPYA 1WMSA 5B2ZA 4WAUA 3QPWA 4OQNA 2IEZA 4M1WA 1M74A 2GWHA 4A0GA 3PEUA 4M1MA 4RFSA 3IUYA 4DT1B 1JQLB 4F93B 2OCBA 4NZYA 5FL7A 1SVOA 1DAFA 3C5CA 2MSDB 5GJWC 3SNHA 1YHNA 3EZ9A 1NIPA 1CR2A 1E2IA 3QEJA 2BMEA 3C5HA 4NCJA 3BWDD 1G41A 1XCPA 2GEUA 3P4XA 3U7EB 2IBMA 4TZ6A 1RJ9B 4CDGA 2F1JA 3M4YA 4RSGA 5G3ZA 4DB2A 3QXHA 2ZI9A 2Z43A 1KNQA 3K53A 4LJAA 3K1JA 4L15A 3LVQE 4GI7A 4JYBA 3CRQA 4Q4LA 4KVGA 4MYUA 5M04A 4HDQB 2VF8A 3GLFE 4NTZA 5JSZB 4EFNA 1E4YA 4J0QA 4L5BA 1G7RA 5FBLB 2G9NA 4HDOB 1U0HC 3E2IA 3HPQA 3OE7A 2JJ1D 3MD0A 3OESA 3CWZA 1CJMA 4XD7D 4HAZA 4NBSA 4URUR 1D2NA 1G64A 4YONB 3UMRA 1N6RA 3TUJC 3BD9A 2IXFA 3MWKA 5CDFE 5KPDA 3WNBA 2J45A 4RVCA 1WBDA 3QVVA 2HCBA 4Q4JB 3W34A 4BZQA 1P73A 2ZE6A 2ZYVX 3NEJA 4KITB 4US0R 2O52A 1X1SA 1I4TD 2AKAB 1W47A 3DPUA 2C78A 2AWNA 4I1SA 1U8AA 1AGRA 5JFGA 4M9ZA 2IYXA 4F4IA 4Z8YA 3KQLA 4FI3C 2AFHE 1XMIA 2ZAMA 1R4AA 2ECKA 4DB4A 4DCTA 1GP2A 4AIIA 3DEFA 1DS6A 1AS2A 3SJBA 1T6NA 2ZRIA 1AS3A 2WZQA 2B7BA 1YR8A 1TPZA 4WZ6A 3LX5A 1E79D 3P4YA 5CM8B 2XOKD 3I61A 4EKDA 1E2JA 3JVUA 2HXSA 3ECCA 3QVUA 4RKFA 2XX3A 4TLCA 4B33A 3LXRA 2UZ3A 2HT6A 1OW3B 2BHRA 4FXPA 4JLBA 4M9SA 4DIDA 2XITA 1Z0FA 4LJ9A 4V0ME 4PXAA 3VR4A 2REOA 5FL3A 2G1JA 2XSZA 5K8UA 1XTQA 1IJEA 1W36D 3LY5A 3IILA 3I8SA 5E7JA 4D0GA 2Q9BA 1JBKA 3L8ZA 3WP0A 3EWSA 5AWFC 1ZIPA 1UKEA 3VR5A 4C3ZA 5HKKA 1UBGA 1YZUA 1O87A 4HB3A 2HYIC 1U8ZA 2PJRA 1JALA 4GMXA 4QHYA 4ASUD 4E07A 1U9IC 5JI3E 3B82A 4MGZR 2I3BA 1N5IA 4FCTA 3CIOA 5CIWA 1S9DA 2QMOA 3KB2A 4LBYA 5C18A 1XEWY 5KOYA 3SBDA 1CLUA 3SYKA 5KNDA 2ODNA 1OKKD 1IONA 3RWOA 4B3GA 1KGDA 3KX2A 4A0RA 3K9HA 4BLPA 2YV5A 4N1AA 4A82A 2HCJB 4D25A 2P6NA 2PH1A 3W90A 2QGNA 2WJGA 2FSHA 3DOFA 4JLPA 1KO1A 1M8PA 3K0FB 1NLFA 4A8JA 2XXAA 1W36B 2E9SA 2QI9C 4Q1DA 5SZIA 2ZRDA 4Q19A 1KJYA 4QRHA 4BLRA 4W5HA 3DM9B 4ON9A 4WW0A 4R2HA 5TVKA 4HZUA 2QP9X 4BLOA 3GJ4A 4HEJA 1LFDB 2C9YA 3NBZC 5FTNA 4IDNA 3X2SA 2V9PA 3CRRA 1QHHA 1XEXB 2P5TB 4GPTA 3LDAA 1G8YA 1RW4A 4DSTA 1JPJA 2ZYWX 5SZKB 2X8AA 4F91B 4A92A 2QE7A 1XXHA 1SVWA 2MSEB 1CJVC 4LX0A 3LAWA 1SVSA 1XPUA 4ARZA 4HZIA 3GPLA 621PA 1S9HA 1QZXA 4ZO4A 1FW6A 4CEHA 1V5WA 3T15A 4C30A 4QG7A 3A8TA 2Z4RA 1G8FA 1KO5A 3MAAC 4PQYA 2X2EA 4GOXA 3EZ7A 1NSFA 2G0NA 2ONJA 3AP3A 4QGAA 4AK9A 1W36C 1ZIOA 5BN3A 4NCKA 1ZM9A 3TLXA 1NJFA 1VG1A 2FPLA 1PZNA 3QKSA 2BMJA 2HV8A 3H4MA 3MG9A 2F55A 4IVPA 2OBMA 1VCIA 4LV6A 1D9XA 1TUIA 2PEZA 4HLCA 4HB0A 3KFXA 3W3ZB 4QOSA 4KJZA 1MO6A 1P72A 1KSHA 1UF9A 2PX3A 4BWYA 1XB2A 1JJVA 4CVNA 6Q21A 3C41J 4MYTA 4Q5IA 5F3WB 1Y63A 3A1TA 1YRAA 1G16A 1ZM2A 2ATVA 2XTNA 2ZE7A 4KAXA 1PUJA 2IYQA 4O0MA 4L9WA 2IS6A 2WAYA 4Q4HB 5J4HA 1SHZA 1AZTA 3QNUA 1GRNA 4M9XA 3TR0A 3CZPA 2W58A 5A5GA 2I1QA 5F98A 3U61B 2IWHA 4MKGA 2PT5A 4L16A 2CVFA 4X8OA 2A5JA 1D5CA 1TTTA 4LWZA 1H8EA 2FWRA 5BN5A 1E2PA 2AN9A 1YKSA 4NCHA 3SBEA 3TKLA 4EUNA 3EASA 2WIAA 2OAP1 2RGAA 1FMLA 1NLYA 1DARA 1U98A 2AFIE 3A4LA 4YMUA 2GJ9A 4EPVA 2IW3A 4JVLA 3Q8XB 1HE1C 5F2EA 4DLTA 3CX6A 1TEVA 1JI0A 4JVMA 4WA7A 1HA3A 4HLQB 4DLVA 2CMKA 1YZQA 5TV2A 4JL5A 3T1OA 1IOZA 2IA5A 2WIBA 2C99A 4EQ6A 2QA5A 2Y8EA 3CRW1 4ILEA 1OFHA 3TQFA 4LY6A 1TEXA 2AL7A 4QM7A 2R6FA 2W2TA 4O25A 5J47A 2ZSDA 1J7KA 3FTQA 1LF5A 3E5HA 3L0OA 3NKVA 5H70A 2XZLA 3TSWA 3TUIC 5EZ5A 1UDXA 3GLFA 1U2RA 2ZSAA 1RYFA 4M2LA 1K5GA 3RNLA 3BGWA 1GKIA 1N5KA 4PO9A 2AKYA 4HAWA 1GTVA 1NN5A 2GZAA 2IF0A 2OHFA 4OQXA 1WDTA 4ACBA 4AKEA 4HATA 3OIYA 2F9LA 3U3MA 1E2DA 4BFWA 1IBRA 1FNNA 2O0KA 1YZTA 4BQSA 1UKZA 1XJCA 4DKXA 2YWEA 2ERXA 4MKIA 1JAIA 3PEWA 2J0SA 2WICA 2WAXA 3NBFA 5AUQA 1BKDR 1FUUA 1KY2A 4IVQA 2D06A 5CDFA 4UQOA 1G21E 2FMXA 1CBUA 2ORWA 1GL6A 3NH9A 1T91A 3NBXX 1G3RA 1RIFA 3SN6A 4BASA 3H2YA 2VP5A 1WRBA 2GXSA 5JS8A 5JMTA 2EWVA 4QNMA 2EU8A 4RKEA 1SULA 1Z5ZA 1KI6A 1W4BA 3BXZA 3LXXA 2FSFA 4DSUA 3C14C 4TMTA 2FEOA 2LWIA 3CWQA 2MSCB 3HU1A 4LC1A 821PA 5HZHA 2V4ZA 2GXUA 2GCOA 1OH7A 1T0JB 2W6JD 4I1OA 2W2VA 1KMHA 5HCNA 4EFLA 5K8TA 5L3RA 4G5GA 2VHJA 4GOKA 2G0TA 2NO7A 2ZYUX 2ZUCA 1LY1A 2JLZA 1WP9A 2GBLC 1KHTA 2VP9A 2OM2A 3JZAA 3JZMA 3B1WA 5GJBA 5IK2D 2QQEA 2P65A 1E2FA 1CS4C 1P2UA 2WWFA 1OXTA 2PZEA 4RCYA 4PQRA 1G3QA 4OHVA 2AD5A 2GETA 3QPVA 3WNDA 5AJVB 5FPTA 2VHQA 3VU9B 5TXGA 2JJ8A 3C8UA 4L8GA 4AD8A 5H8WA 2R2AA 2KB0A 4TQ9A 4MGYR 4DHEA 1EXMA 5L3QB 2WWYA 4HLUA 1YZKA 4CEJB 3FHCB 4CIDA 1E9FA 1LTQA 2MMCA 1QG4A 4JSYA 1AJEA 2V54A 2AK3A 2CE2X 3QKRA 1CF4A 1K5DA 2REBA 5LD2B 1QHXA 2Q9CA 1I2DA 1W1WA 2OG2A 3QJYA 1J70A 1FX0A 2C03A 1YR6A 3I1FA 4PC6A 2QRZA 4TMZA 2JJ2A 3TAHA 4EIWA 4S35A 5IRCD 4DEYA 3AUXA 3LBHA 4JLMA 2XAUA 3Q9LA 3MGCA 1PLKA 2CE7A 3WP1B 1N6NA 3IEVA 3D6TB 4XH9B 3RS2A 3UG7A 3KXLA 1RVDA 4KSBA 3OAAD 4Q00A 5B64A 2GVDC 4DDUA 5JCPA 3RHFA 1YR7A 521PA 3WYFA 5JWRA 3TQCA 4TYYA 1XD9A 4BFTA 4MITA 3L0SA 4ZIRA 1EWQA 3FB4A 2H5EA 2KI5A 1ZD8A 1MABB 1WA5A 1L8QA 2VP6A 5JBQA 5AJZA 1SXJB 4BUJA 3WBKA 2GVZC 2XEXA 4KO8A 3RDPA 1XJQA 3T1QA 1S3SA 3GJ6A 1A2KC 2ZE8A 3W5JA 1WF3A 3ZVLA 3KUDA 3U7HB 1KIMA 5L3SB 5BYJA 3D3QA 1ANKA 2GDJA 3NHBA 4C7OA 4B2LA 5LBIA 4LDJA 3CRVA 3RVBA 1G9XA 1CRPA 2C9OA 1Z3IX 5EXXA 2HLDD 1MRSA 4NCIA 4AG5A 4IEEA 4MYHA 2CCGA 5JEEA 3PUZA 3IIKA 4D4KA 4LJ8A 2ZRLA 4XSGA 2OSBA 2DHRA 1CJUC 4RZXA 1G5RA 3CH5A 4TTRA 1OHHA 1R10A 3AVYA 4D82A 1RRGA 4WZAE 3IQXA 1E1RA 5DE3A 1SXJC 1ESMA 1JR3D 2OILA 2C2HA 2QG6A 2O8CA 3V4RA 4C0JA 1VG8A 1Z6TA 1L2TA 1ZD1A 4DCUA 1QHSA 2H1LA 1XP8A 4PC3A 3SFZA 3MMPA 1DE0A 4B44A 4P0TA 1G4UR 1NVWQ 4EJSC 4PHTA 5L3VA 4G3XA 5IT5A 4F92B 2ORIA 5EE1A 3AVUA 5CM9C 5B58C 1KO8A 5CB6A 4JKYA 4Q9LA 2WKRA 4Z8XA 3T1TA 1X86B 3U3KA 1K8RA 2C9CA 2FA9A 4NH0A 5GJCA 2FG5A 2PBRA 1ZM4A 4I4LA 2O8DB 3R9WA 4BFZA 3QE0A 2ZROA 1ZCAA 5FTLA 4KYUA 1II0A 2YHSA 3UMSA 3ZZTA 1E2KA 3AKEA 3AGQA 4Q66C 1E3MA 2GAAA 1NKTA 2RGGA 3MUFA 4TSFA 3FFAA 1F6BA 2FF7A 3EC1A 3Q72A 5UKDA 3ASZA 4ZDJA 2P0EA 3DZ8A 1H65A 1X8JA 3T35A 4LGMA 1OSNA 5AJWA 1G7SA 2N1BA 3IGFA 3CF0A 2JAQA 2ZXUA 5AUPB 4MDFA 4RCZA 2PCLA 2C5LA 4R2IA 2O8EB 4BGDA 2HEIA 4HDCA 4DZZA 4GMDA 3Q5EA 1II8A 3B5JA 2C04A 3K0AA 4KFUA 1P75A 1RZ3A 1XNJA 4K8OA 4LJYA 4U5XA 4GDFA 1OB2A 5L8VA 1XPRA 1OE0A 3DMDA 5C46F 1Q21A 3WYAA 2ZRNA 4YDSA 1SQ5A 3OEEA 1ZINA 4PAQA 1XD2A 2NPIA 1ZC3A 2QU8A 1JXOA 4D4MA 2DB3A 1ZBDA 3OFNA 5FL7D 3CH4B 4E5UA 4R98A 2AX4A 4JJZA 2EFEB 4LYFA 1G5PA 3T5DA 4NKRA 3CX7A 1GWNA 1ZD9A 4BEBA 3ZZ0A 3K0CA 1FTNA 2OCAA 2QROA 3BJIC 1LW7A 5AJXA 4NPHA 2D4HA 1FFHA 5P21A 1DO0A 3DVLA 1P62B 3QIAA 5ANRB 3W6NA 4NONA 3VX4A 5DHAA 4GP7A 4FD2A 3VKWA 4JBWA 4XVRA 5FOSA 2Q3MA 4PTLA 1HV8A 3N5CA 3OE7D 2X77A 1Z6YA 3BFKA 1DAHA 1NMYA 2BC9A 3LVRE 4HYYA 2D62A 4MRSA 4D26A 4Q1AA 3FE2A 4IDHA 1P61B 4TMXA 2FZLA 1XTRA 1SKQA 3BC1A 2VHUA 3O8BA 4TLDA 5AUNB 3ND8A 4CYMA 1F2TB 3CB4A 1ELOA 1YR9A 3K09C 3VMFA 3AF3A 1GL9B 1W2HA 1N5LA 3GJ5A 3NVAA 1BIFA 1J8MF 2B7CA 4HB2A 2GRJA 2FDCA 4AYWA 1GG2A 2RGBA 3EAQA 4HAUA 3LQQA 5IF9A 4PC2A 1Z47A 2D2EA 4IRUB 1VKJA 2GILA 4E03A 1BOFA 2CEAA 3M1IA 2CXXA 4JZKA 5FTMA 5CLQA 4TYNA 5CJPA 5CLLA 5E3HA 4C0QC 5DH9A 1DAGA 3OIVA 3SOPA 1JR6A 4MA4A 1DG3A 2PCJA 2KBEA 2IYYA 3UATA 1VYVA 1F2UA 2ZYTX 4B35A 1P9NA 1XTSA 3ONWA 2ZJZA 4UJ3A 4EDHA 1P7CA 1MKYA 2NOAA 1TU3A 4B3FX 4M1KA 2JLVA 2XSZD 4XIGS 5EXPA 4B74A 5EP4A 4B76A 4GZLA 3KQUA 2ZRHA 1KSGA 2JLXA 2NO0A 1E4VA 4Q03A 1UBCA 1YVDA 4DEXA 3KTAB 5CJ2A 5HKKD 4RD2A 2W0SA 1BS1A 3X1YA 4OHYA 1E2MA 3B2EA 2ZPTX 3SS8A 2NPFA 2ZREA 4BZXA 2LCFA 4DC9A 4OJKA 2H8KA 4AKIA 2KE5A 1E96A 2FN4A 4ABYA 1M6NA 3AKCA 3TMKA 2XJ4A 3QBTA 4JVNA 5FFMA 2JIZA 4B73A 3QF4A 1FL9A 2PMKA 2ORVA 5SZHB 4G5RA 2QBYA 4A36A 2ZUBA 1OV4A 1KKLA 4OHWA 5HTKA 3ASYA 3SJCA 4YLGA 1HURA 5E7IA 4JMPA 4CEIA 1E2HA 3FMOB 3GEEA 2B6HA 2WM9B 2I1VB 1PLJA 4N0EA 2KJQA 1J90A 2DY1A 2RGNC 3ADCA 3VTKA 2XTMA 5EXSA 1XFAA 2C95A 2JLRA 3BB4A 4OI0A 2XZOA 2NZ8A 4URVR 1OYYA 2EYQA 2QY9A 1M1YE 1SVLA 2ZRMA 421PA 3P20A 5J4KA 3NXSA 4G5SA 2FV8A 1MO3A 4FN5A 2HXYA 5AR1A 3BOSA 3SFVA 1P9RA 4MRPA 4DCNA 1CU1A 3Q7PA 3OEHA 1RKBA 1NN1A 1XZPA 2O8BA 3W5IA 2V7QA 3VX3A 2GJ8A 3VHXA 1COWA 4POAA 3SJZA 4TL9A 3U3JA 2YC2C 1E9EA 4YQFA 5TDHA 1HTWA 3X1ZA 2QORA 2YOFA 1G6HA 2GKSA 4DBLC 4DLRA 4DDWA 4GT1A 3NIBA 4TTQA 2A78A 2OAQ1 4LHZA 1IJFA 3TRFA 3TW8B 1RE0A 3GD7A 4OK6A 3T5GA 2CHQA 2CCKA 2GF0A 4P4TA 3NC1C 1G19A 2VP2A 2F7SA 3FMIA 2HUPA 4NYJR 1HE8B 3IHWA 1WXQA 2RGCA 4W5WA 3NHAA 5LPNA 3OF5A 5BQ5A 2EYUA 4JLOA 1OFUX 2D7DA 1X8KA 4F4JA 1GILA 2PLRA 4TLBA 4V0KA 3A1UA 4OQFA 2EW1A 1CJKC 2WVJA 3RAPR 4DT1A 1R8SA 2O8FB 4I81A 1MO5A 4NYIR 4PQFA 3T1VA 2GCPA 5KSZA 4W7SA 4TYWA 1NIJA 2QM7A 3ICQB 3ZIAA 4DLUA 5HZKA 2GJKA 1EFUA 1M7HA 1YE8A 1G7TA 4F4CA 2YKGA 3AVPA 3F5FA 4M1YA 1XXHB 1W44A 3HP1A 3KB1A 3SYNA 1N6LA 2DPXA 2ZRGA 3K9NA 4Q01A 2BOVA 1KTVA 3UK6A 2UVQA 1W0KA 2BM1A 4AKHA 2P6UA 1P3JA 2ZI5A 1P6XA 1OIXA 4CEHB 4GP6A 3FGNA 2QL6A 2CJWB 5JSZA 3THOA 3ZVNA 5EP3A 3QKTA 5DGXA 4BRWA 2KWIA 3RS0A 4DIEA 5BXQC 4XTCS 1W4CA 4Z51A 2RHDA 3W8RA 4DRZA 5EE0A 4DSOA 3EC2A 4MRRA 5DN6A 4U02A 5G3YA 3A58B 2EFHB 3K8YA 5GVSA 1XX6A 1PUIA 1GL7A 3BFXA 4JSTA 3BAFA 3PUWA 3MSXA 1OXSC 3BE4A 2WWIA 4FWIB 2ERYA 2IF2A 1DEKA 2ZS9A 2MMGA 3DL0A 3I73A 2R6GA 4Q4JA 3GLHA 4BLQA 4D6PA 3C4JA 2QMUA 3BH0A 3LBNA 1NF3A 4TYPA 3FKSA 4HUQB 2OEPA 1GM5A 3CPHA 4AYXA 3IO3A 1D6JA 2A5DA 2IXEA 2XJ9A 4OHXA 1I2MA 3ZDQA 1L4UA 1FP7A 1NVVR 3SEAA 5DI3A 1NG9A 1R8QA 3FPAA 1DVRA 1ZYUA 1CKEA 4LK2A 3WHKA 2IYTA 3NWJA 1Q22A 3QOFA 3R7WA 3LRPA 3L82B 5B57C 5JLJA 3ZH9B 2IYVA 4RJLA 2ZRJA 1ZNWA 4KFSA 3C15C 2ZTSA 1LNZA 4TLAA 1WB9A 1Q0UA 5ELXA 2V3CC 1XF9A 1IXRC 3BBPA 5HE8A 1KK1A 1DTSA 4S2EA 3R9XA 2P5SA 1QG2A 1E2NA 3E1SA 3W8NA 3B1YA 2V8OA 4FINA 1Q12A 4ZCIA 2OLKA 4V0NA 4ESVA 1QBKC 1M34E 4CT4B 1D2EA 1UEIA 2OE2A 4URYR 1KOFA 1SGWA 3ZVRA 2H57A 3QI2A 3L43A 2FPKA 5TARA 3SJAA 2WWGA 1N6PA 1FUKA 1DG1G 3THWA 1NSTA 3LD9A 4JS0A 2FU5C 1W48A 2PX0A 2YWHA 3QG5A 3IBYA 1G7CA 2BCGY 2FSIA 2GNOA 2ZJ2A 4DLZA 4AC9A 2WSSA 4A6XA 2VSOA 1KY3A 1E9AA 1T8UA 2FE4A 1F3OA 2ODEA 2ZSFA 3EPLA 5KUTA 1G18A 3EA5A 1E32A 3EIEA 3UKDA 4EPWA 3GFOA 4Z54A 2G77B 3U2QA 3TUZC 1NBMA 4UNNA 3AF2A 2NO9A 1W5SA 4LBVA 4C0HA 2Q9AA 5FPKA 3O47A 4DLWA 5KYKA 2UZIR 3ZS9A 4TYQA 1HY3A 721PA 2A9KA
chains in the Genus database with same CATH superfamily
3F90A 2IYUA 2GZDA 5BPFA 5HFNA 5B36A 4US1R 1N4DA 4DR5B 1OWLA 4P0PB 3F3MA 2O05A 4JLVA 4LRXA 1GNQA 1D1SA 1OTXA 1UBHS 1ZMBA 4OBWA 1BCSA 2WHRA 1NC3A 5DOZA 4ML3A 2XKBA 3CRMA 4LHXA 3IO5A 4LWQA 4YMIA 4FBMA 4R8MA 4L8WB 1EJ2A 2PKCA 2NYRA 1RWWA 2Q3HA 4YIHA 2IOQA 1FSFA 4JDUA 3ZW7A 2FTKE 4EPXA 1F20A 2HU7A 2J31A 1P4HA 4DY4A 2J9ZB 5EIHA 3KALA 1SXJE 4WVFA 3GLSA 4M22A 4D9MA 4K9RA 4DV0B 1JA1A 1CQIB 4BDSA 1D03A 4DN6A 2V6JA 3AUUA 4QUIA 4E5NA 3RVOA 4EFKA 4JELA 3MJVA 4GC5A 3HKEB 4HDAA 4X7MA 4FFWA 4O5AA 5TY0A 5HOEA 3AHIA 1LX7A 1RQXA 3T5DA 3QUAA 2VH5R 3G6WA 4GZMA 2GJAA 4RMIA 2GEJA 4RV4A 4ZV7A 3ES9A 1W88B 1O95D 3HY6A 3QEOA 3HM2A 3P2JA 4LWOA 4CQLB 3RAFC 3N6RA 4KVAA 1N2IA 2PD4A 1C4OA 1Z8FA 5T3YA 4BX8A 3D3WA 4BPBA 2JGLA 2C82A 4Y2PA 5DK4A 1IJKA 2GBIA 1II9A 2YZ7A 3GVXA 4WT7A 4KR6A 4G0XA 1JLHA 1S0UA 2TMGA 3ET5A 2ZRAA 4GYKA 3S1AB 4HR7A 5A0VA 5CBKA 2I71A 3B48A 3QFCA 5CNMA 1C3OA 3THSA 5E4YA 2UXBB 4FR0A 5DLPA 2XE6A 3VPHA 2IU4A 2QTWB 2RFLA 2FSGA 4MQFB 1MU0A 1F8UA 2JAXA 1N6HA 2PYZA 1SCKA 1Z4KA 2Q5LA 4R31A 5K3DA 3ZWCA 1P0IA 2GZ2A 3JQAA 4IILA 2EFGA 3L7OA 3NT2A 1E3SA 3QE2A 1QO9A 1LV7A 4IQ8A 1J9ZA 2QP4A 2JBWA 3ESDA 4H16A 4WECA 3ZOKA 2NMVA 1A50B 1NJ5A 1E62A 5JZMA 4YQZA 4C4RA 5GGYA 2CXRA 4MW0A 2P4QA 1WUTA 4OGKA 1BVYF 5FLXA 2H5JA 1WPGA 3OD1A 2A84A 4TUYB 1T6YA 2FNAA 2GPJA 3QENA 3HR7A 5BSTA 1NTOA 4BJ5A 4DR7B 1YQTA 4C2UA 2O5EA 1QNLA 3JQRA 1TF2A 5IKMA 2VHTA 2VP4A 5CW2A 1DTWB 3HUFA 5T5QA 3GX1A 1Z4QA 4QBFA 2NACA 3O8DA 5CLHA 3TRKA 1TLTA 2NZJA 5GPBA 4Z49A 1BKSB 2OG1A 4G63A 2X22A 1RRKA 3X0DA 1NBIA 3RB8A 1PSZA 2H2IA 3C1OA 5DWVA 5CU7A 5T41A 5B5SA 3NMUF 4B3SB 3A1NA 2ZBRA 1O54A 4DBZA 5A2QA 1FU7A 4HLUC 1FPMA 4X95A 1KPIA 4NWIA 2GPWA 4N6NA 3ASUA 4YRLA 1AURA 2R0QC 4IW3B 1XZIA 1XN1A 2BY4A 4RH1A 5CEFA 1PJLA 1TYCA 2VRCD 3Q2KA 5A1TA 1KOJA 3VUEA 1QYDA 2PXCA 1WKBA 4I6JA 4H0NA 1JDUA 4ZODA 1RADA 3I2IA 3D7NA 3QVOA 4KYVA 4JI0B 1UCFA 4MI6A 3EW9A 4C0KA 1V43A 4WLUA 4U7DA 4GBMA 4R6WA 4BO0A 2QX8A 3H2KA 2X0EA 4LF9B 2ZR7A 5A06A 4MDEA 4UW9A 5EMKA 1SUEA 2Y27A 2ZU0C 3P0EA 3WGGA 2XB4A 2XTJA 4GX0A 1FP4B 2P3LA 5GOTA 2NG1A 3AR2A 1QZZA 4P93A 3PNQA 4N3BA 5JSQA 2HL6A 1R15A 3H75A 1V4VA 5FEUA 1KI1A 3F71A 1VRWA 3QWFA 4WTOA 5D6OA 3N1UA 4FFBB 3QYAA 1ONPA 4NBVA 4Y0AA 1H9BA 4G25A 1EVJA 1VC2A 1FVFA 5THQA 3V8BA 3ZVMA 2E1RA 2Q6KA 1ZJWA 1JJ7A 3SR4A 1JHZA 3PNYA 4FEYA 2ZRFA 5BSVA 2QPAA 4TSFD 1OGIA 5T4HA 1GFZA 5GZ1A 3EWIA 2MYUA 3DBLB 1QFYA 3O7MA 3AJ8A 1RXCA 1ORIA 4TV9B 3CO0S 3TGWA 1YC5A 3ENVA 1SC3A 1Z6GA 5LMZA 1XZEA 4BMNA 2WUWE 1UBJS 2KHZA 4ZVSA 4JI2B 3DWFA 4QPJC 4UNSA 3HWSA 4I5EA 2BN4A 3A36A 3KVRA 1A3CA 4LDRA 1PL7A 5EPEA 4TQGA 1NNUA 2IS2A 1GU1A 2DP4E 4BQQA 4MPRA 3CIFA 2I2WA 3BHJA 5G53C 3GLTA 3NAZA 3ZWAA 2HGSA 2ZI3A 2X1VA 5A7HA 2WPDA 1UBEA 5KDLA 4MP6A 1QIFA 2PTHA 4G0QA 2OBBA 1MB0A 2HRRA 3C1AA 3TIXB 2IPLA 3R8XA 4YAKA 1GDTA 3OA0A 1EFVB 4V38A 3ULKA 2VPPA 2C2BA 1X7WA 1YACA 3OEED 3QJ5A 4LA4A 4W5TA 1G55A 1E94E 5F64A 5LSAA 4FCVA 5JAMA 4TV8A 4HGQA 1X74A 3FH0A 3O92A 2ZJFA 4YAOA 1NN0A 4YP1A 5C5EA 4UUOA 5EP2A 3LX6A 4B3CA 5KWVA 3QW2A 5EWLA 4MW9A 5C1PA 1HDEA 3ADKA 4L76A 2OO7A 2W8BB 2ZJ5A 3PFCA 4NBLA 2APJA 4GC9A 4UCFA 5EIAA 3OBBA 5FNVB 4J6EA 2PU7A 4C7VA 4OXNA 1V16B 3PWZA 1VG0B 3RS7A 2D2FA 1L7MA 1VYHA 3I09A 1AZSC 3UYKA 3W1EA 4TOIA 3T54A 4CKWB 1KU6A 2P9YA 1GPNA 1YL6A 3VZCA 1AF7A 1YQGA 1BC5A 3BXHA 1JECA 1Z0AA 3CONA 3PXDA 4IGFA 1EIWA 2VKQA 1E4EB 3AJ9A 4LJ6A 2CL6X 3REQA 4KIFA 4H35A 2QW1A 4JIMA 4YN3A 4B1FA 1KH1A 3C85A 3IIMA 2JLBA 5L3QA 5EQJB 4CEJA 2CBXA 2H92A 2ZB2A 4XQ0A 5AW3A 2I78A 2O3RA 1U8CB 3MWDA 1A69A 1AMUA 4DV4B 1UAGA 4PYIA 4RK1A 5EUMA 1YI1A 1NUQA 5DHQA 2Z0MA 1NU6A 1Q3KA 8GPBA 2EP7A 4C1BA 2ODQA 1D2MA 1M1NA 1M6VB 2AXNA 1R50A 2FSVC 2O8NA 3C5EA 4HNGA 1M73E 1YB7A 2OZEA 1IY8A 1JIXA 1FTSA 2VYVA 3EXEA 1G0NA 2FN9A 3OUZA 4WGFA 5ETJA 3ZZMA 4CTKA 3PF8A 1B0UA 2AXPA 3EAFA 4IFEA 1U81A 3VSEA 1GO2A 2R8BA 5JT1A 1QKJA 1KZGB 4KX3A 1YJCA 4DZRA 5M2QA 4KGDA 3WLPA 1N2JA 1QRDA 2DY0A 3NONA 1QF9A 1N3YA 2HKIA 4UUMA 4JB2A 3ZLJA 3LRXA 4MVJF 5IDVA 1JVNA 3NRJA 3KC2A 4BYGA 4HUTA 1TM2A 2D00A 4OYHA 2NXNA 5D86A 3UIEA 3OIUA 1G17A 1J2JA 4GKJB 1QONA 2IUEA 5KNCA 2HUNA 4K0KB 1U90A 3UT0A 1ZH4A 1LVHA 1PN3A 1SCDA 2R96A 2RBKA 3FR8A 4R8SA 2HIHA 3M8KA 3ONFA 1ZITA 4KVFA 4E22A 4ZZ2A 3RVJA 4DE5A 5CB4F 4MYDA 4U4AA 1LXCA 4BN4A 1CERA 3M9XA 3GAFA 3K0BA 4NSNA 1XCMA 2IZ5A 3OE4A 3O94A 1LLCA 2FJPA 2H52A 1AU9A 1FUEA 1WMFA 4FYKA 4K5QA 4MGHA 1P5ZB 2CFIA 3INGA 2JGAA 1R5JA 2ZQZA 5ED4A 4D4LA 5B2FA 4U7HA 3DZKA 2PSFA 2OAEA 2C4MA 2ASEA 3KR9A 1FFBA 2DR3A 2ZULA 4FPXA 2GSDA 1BWRA 3GROA 5B2EA 3KVVA 4J0EA 1KDZA 2JKVA 3CVOA 4Q7KA 1JLLA 2BVNA 2WIJA 3ZGOA 4F6LA 4XWYA 1TAHA 1TRKA 3D7LA 4FJ0A 4BKOA 3PDIA 1XMSA 1Z5UA 3C3KA 1SKYB 2WFZA 1DRKA 1DQRA 4MB2A 2VBGA 1T2EA 4LZLA 5ALSA 1YASA 5FO0A 5B3JA 3BRWA 4KKXB 3NM5A 4QJBA 4BQOA 1MXFA 1YR1A 3KKNA 5JO0A 2PUJA 2V4UA 4IQGA 3S7ZA 1XTTA 3H1BA 1JHXA 2J6IA 4KQMA 3F4BA 3GNLA 1C3JA 1M8GA 3M2PA 3TZCA 1RKQA 4V0SA 3X43A 3HN7A 2QTTA 4AS2A 5KPJA 2C1EA 1BGVA 4RK4A 1OH8A 1RMQA 4AZVA 1HT2E 2VPTA 4HF7A 5G0SA 3EF0A 2QW0X 1R5BA 4RQBA 3KKLA 2HBQA 1Q6YA 3GPIA 3HGQA 4HNAB 4N39A 1ABBA 4G4IA 1DUVG 1AHIA 3M4JA 4XX0B 1CUWA 1QK5A 5E38A 2PUTA 3DYVA 4MEJA 5T7BA 2IGBA 1FP1D 1I6KA 2CK3A 1NURA 2H1HA 5IYZB 1T5OA 1QDLB 2C5GA 2IIPA 3Q9UA 2WT4A 2I87A 2Y93A 1C1HA 1I80A 5BN4A 1XMXA 2GUWA 2JK0A 4IOJA 3V46A 3AYXB 2BJWA 5C5CA 4L3OA 5D3MA 3T0FA 4HSGA 1E2UA 2V8BA 3PF9A 1CE8B 3LVFO 3GFRA 3Q98A 1QP0A 4UM7A 4PZAA 2G08A 4GH5A 1FMJA 2V7QD 3D2CA 3EBOA 3EODA 3H84A 1ILWA 1E98A 1RRFA 2I62A 2W6NA 3ED1A 2HSJA 4RD6A 4DGQA 4F45A 3ER9A 3IDZA 4YT2A 2H8GA 1T1IA 5DO9A 1WXFA 3SIWA 4DHWA 3PFHA 3R0XA 2WLSA 4OHPA 1O2DA 3TZBA 2VJDA 3IJRA 4JX8A 4WK6A 3S27A 2I4TA 5F7OA 4IWXA 4RF4A 4YRGA 2O8EA 4KXLA 3K0SA 3OU2A 2FPGB 4Z1OA 2UXDB 3LCCA 5GV8A 4UOZA 3UUWA 2ZJ0A 4X1OA 1WUKS 3E3MA 4XUEA 2EZ4A 4QU0A 5IN5A 4X91A 4NE2A 3FTNA 1HYQA 5KS2A 5FOWA 1JLSA 2R4QA 4UMDA 3BBLA 3F6YA 3ZIUA 4P4LA 3D7KA 1RSZA 2OO3A 1DBRA 2RDMA 4MVJG 3RUFA 1NQOA 1SHKA 1Y6JA 1IN7A 1Z2DA 1JQEA 1I9CA 1YQEA 2NNLD 3ESYA 4KE7A 3LXMA 4NOLA 1PGOA 2F1KA 4PW0A 5ALIA 2FDRA 2RMKA 2W22A 3N2YA 1ULAA 2W37A 2R79A 3BA1A 3HDYA 2BT4A 5EMLA 2PX4A 3H04A 3N74A 1GZSA 1KI3A 1QRAA 2O2ZA 4F2WA 2D0IA 4XPIB 3WRVA 2ZR9A 3TTYA 3QV1A 2L18A 2LKDA 3UHAA 3O3OB 4KDRA 3CEAA 5EJ6A 4G4SP 5KU1A 4O8ZA 4OUDB 3HU2A 4PSDA 4CTOA 5LU8A 3SYLA 3DW3X 5AJTA 1USGA 4X1YB 1UEXC 3ZBQA 4F11A 1INLA 2XYVA 2P2DA 1KMQA 2YXDA 2NWQA 3G8YA 2WJJA 1UZLA 4II3A 1G5HA 1DC8A 1SKBA 3LUDA 4F4DA 2DKNA 5CFMA 3FYUB 4EO9A 3FOCA 5E6RB 4RVGA 1KSFX 2QYTA 3GEHA 5IM4F 2XTAA 2JFOA 3C87A 4NL4H 1C1XB 3FGPA 3ZKWB 4BB0A 5J43A 5JRZA 2O1SA 3I37X 4OJNA 2O3JA 1EEXB 4FGZA 1A98A 3E1KA 1L5ZA 1B14A 3OZUA 1DQNA 5A3RA 4MIOA 4P3KA 2ZAOA 1XF1A 4E31A 1E9BA 2AN3A 2J3EA 3VJKA 1Q1BA 3D0OA 1EK5A 1PR5A 1XD8A 3RWMB 2ZZNA 3T5BA 2GEVA 4BP1A 1F2TA 1LX6A 4URXR 4CE6A 4JEIA 5KC9A 4XOUA 5BMOA 4CZ2A 2YYZA 1BX3A 5EMNA 4V3BA 3LUGA 2PZGA 1N2CB 2DT5A 3MTJA 4XFDA 1EFRA 1GG5A 4AB1A 1ZWLA 3H0CA 4G26A 3DL2A 3F7OA 3MUEA 2WP0A 4RY0A 2CXHA 1I6LA 4O4IA 3AL0C 4HAOA 1XALA 2AJCA 1GKLA 3JZFA 2JI7A 1JB1A 4I9FA 2Q62A 3OIFA 1OXUA 4Y2UA 2AWOA 1EFTA 1GNTA 4EG6A 4LDNA 5AW5A 3PRKE 4Y6PA 1YDEA 2DWPA 3RYCA 4PFKA 5FORA 3ZU4A 2Q1WA 3KJFA 2CXSA 2OBNA 3BB1A 4W7HA 2Z04A 5COAA 3WFZA 2QE7D 2VCHA 3GW8A 1M8KA 3WA7A 1N75A 1Z5VA 2RGYA 3PX3A 4OLAA 5A2GA 1GGMA 3F9CA 3DE7X 3MJHA 2H2GA 1U9ZA 1PI3A 2HJ9A 1MAVA 2ACEA 3A7EA 1HZZA 1Y34E 3EH2A 4OHZA 4G8JA 4M8KA 3S1LA 1I5RA 1LSUA 1KKMA 3V1MA 3OQPA 2PYDA 3UW1A 2C77A 3L9WA 2G1UA 4JLNA 1ID8A 4I3GA 4CR6A 3ZGLA 4E21A 4EHJA 2G1PA 4HQ0A 1BXGA 2CLDX 1NW3A 1V4NA 3GPBA 2J9GA 3GEDA 1XPOA 1YJXA 2XXAB 1EKXA 1F0KA 1CB0A 2FAXA 5ALPA 1N8TA 2CSUA 3AEKB 4ACAA 1MT0A 2IOYA 5CXUA 4G1BA 1CJTC 1BH2A 2WF8A 4BTLA 4HZUB 1UBSB 3UQYS 5EWMA 3CVVA 4A03A 1BWSA 3OOSA 4PLYA 3I39X 2IDJA 4A6PA 4C9BA 1LNQA 3GT7A 2B4RO 3KHSA 3NUZA 4EELA 1X9IA 1RYZA 3WBJA 1ML4A 3SAJA 1C7JA 1X42A 3QEBZ 1H8HA 4NF2A 4GQAA 2WSSD 4IF4A 3WAKA 3DPIA 3PUVA 3ROPA 1SZPA 5H68A 5A9SA 4K9KA 4RADA 5AM2A 3PEYA 2NP6A 4Q12A 4TT3A 3T4EA 1KI8A 2H1RA 3BMOB 4XKJA 1F8FA 4P35A 4WGGA 2VH1A 3MAGA 4Q9HA 2GPTA 1DDIA 4FFOA 3GMTA 4ABYA 4YCDA 1FFAA 1JMYA 3TVTA 1YHZA 4JQSA 3N2EA 1CWUA 3FNEA 5JH7A 3I6MA 3QHAA 2B36A 3GLIE 4AN4A 1RRPA 1XMVA 2V1XA 1POWA 2GESA 1TNDA 3CXRA 1VE9A 2PVCA 3CH7A 3HUTA 3OPQA 3B1VA 4IM7A 1PT8A 1P6QA 1JKXA 1AK1A 1U6IA 2JGIA 2SBTA 2LV8A 2J7PD 2PXHA 3QKSB 4JT8A 2JAUA 3GJQA 3U7JA 4UFPA 4M53A 1C9MA 5IBPA 2MDTA 3HVUA 4GZ3A 2QXUA 1DAKA 2LIVA 3KSDO 3FOZA 4RD0A 1PF7E 1OFTA 3Q3JB 1ZK0A 1SUIA 3FBGA 5EOVA 1FZQA 2C96A 4Y30A 3UNXA 3CH6A 5G1OA 1T36B 3P0JA 5EHNA 3ZTYA 3CNNA 1YBHA 2HZBA 3RJ9A 1XJ5A 4QTYA 3D4PA 2VNSA 4Z1MD 3RAEC 4ALKA 4KYIB 4JUIA 3CUWA 1NXTA 1V5IA 2H1FA 1H5UA 4XQCA 4QBHA 2BF7A 4EGCB 4RS4A 3WJ1A 2I5PO 3U3RA 5BV1A 1Y5NA 1WB6A 3EMDA 4JVSB 3UA3A 1T3HA 4CG1A 1MGOA 3CLUD 1AS0A 1GNVA 1MB4A 5I7UA 2BDEA 4EJ0A 3M9LA 4YDRA 1EQ2A 3QNMA 2RK3A 4QYIA 5I9NA 4KBYA 1P3Y1 1SCUB 4NZOA 5JXJA 4LCBA 5ENZA 4ZVUA 4YP6A 1V3UA 4XD7A 2H00A 4OQDA 5EN4A 4CL8A 4F72A 1W4LA 4BS9A 1GCOA 5AQEA 5BN5B 1RE1A 1NQ5A 5CDUA 2GXAA 3TQRA 2JFHA 1UZUA 3P2OA 1FJ2A 4UVEA 1Q6ZA 2V1UA 2JB9A 5DXFA 4Q4DA 1P1CA 3HCFA 1IN8A 1E63A 1TU0A 1ZRHA 2BH2A 2YYSA 5F3RA 3M1LA 2JFNA 2ZFUA 3LY9A 2GFIA 1U8UA 3WDKA 3AVWA 1F5NA 1PR6A 2Y0PA 5K0SA 5G2OA 1ZUD1 4B7ZA 3LK7A 1RRCA 3UY4A 4L0QA 1TFUA 1QZUA 3UENA 1JHMA 4GR5A 4DPMA 1UXGA 1XAJA 3G02A 4QQNA 1UJ6A 4DXDA 4PNHA 1VGRA 3WQSB 2HX1A 3QPCA 5B37A 4I1PA 3PQ6A 2FPSA 2ZSHA 2CJWA 4QOJA 2HK8A 1ZW1A 1WCXA 1EXDA 3RLFA 2O8VA 5L51A 5KKAA 1XKLA 2I66A 1XMPA 5LDDC 2QVYX 3Q8LA 1YXMA 3QY9A 4R81A 3HMQA 3PV0A 5EKSA 2ZB3A 3GLFB 1QYWA 2PPLA 3CZ5A 1E79A 1SCIA 3KDSE 5EE9A 4DJEC 1ZEMA 2WWWA 4EPTA 2OKCA 1YA6A 2Z6QA 4U2FA 1KMIY 3NNNA 1DAEA 4CG0A 3QPUA 2AQKA 3CLSD 5B12A 3GRUA 1VKNA 3QXSA 3TH5A 4B84A 1UDWA 2W2QA 1TYZA 1WY7A 4Y7DA 1IBKB 3RVMA 1RHRA 1U7OA 4P86A 4L5AA 3DZFA 1GGJA 1IAQA 1Q83A 1VPLA 3EEBA 3K0FA 4Q18A 3ZCPA 1PJ8A 5F4BA 2UYCA 4U9IS 3IAHA 3SE0A 5K8LA 3SP1A 3DXZA 4RC9A 2CNWD 3HCEA 2DKFA 2QAGC 2YUIA 4ERNA 2Z95A 1PJSA 1EBBA 4ZC1A 1H2XA 1ZNXA 2FCRA 3LDUA 4MMZB 1WETA 1CZKA 1A4RA 2C58A 4G2NA 4KFCA 2OBLA 5KB3A 5H4HA 5CFQA 1F5SA 2O20A 4IXDA 4OYLA 1N92A 1Y3DE 2OY0A 1ZS9A 1LDYA 4ASUA 2BKEA 5CRIA 2OLJA 4L28A 3HVRA 2GUGA 4OBEA 4EW3A 1FQKA 3ZQ6A 4DSNA 1ZCFA 2HADA 2KLBA 1I4DD 2HEGA 4J9UE 3A14A 1GDHA 3DE4X 3LHDA 5KNBD 3FWZA 4JEMA 1TQ4A 3KTDA 3P32A 3L8GA 2JFGA 1EP1B 2I03A 1VCMA 1D6NA 3HFSA 2GZMA 5LQDA 1G20E 1H4QA 4DV6B 1CUJA 3P0HA 1XR3A 1Q0HA 3T12A 4EKIA 1NJ1A 3HK2A 3U37A 3DBVO 1JWBB 2R7NA 2L2QA 2QVCA 2QPLA 1GRQA 2VHYA 4B82A 2Q2VA 1H0SA 1KMHB 4M89A 3UW3A 2POQX 2VWHA 4RDIA 2R97A 3EMBA 4TKVA 1I3OA 4Z9AA 1N0UA 4B4DA 3FUVA 1B41A 1NKVA 3AO0B 3C70A 3EWNA 4ALNA 1WTCA 2XDQA 4R9UC 3I9MA 4HNTA 2OBXA 3PDUA 4ITUA 4XM2A 4XXHA 2VP0A 4UFNA 3E8MA 3KL4A 4HY3A 2WSLA 2ECFA 2EQBA 3QGMA 2EG5A 3QVXA 5SY4A 3AK4A 3KJIA 2Q3CA 5CA0A 4C6HA 5HKLA 2COKA 1CHNA 5AOAA 2OQIA 3GRFA 1UM9B 2B1QA 5BV8A 1LBHA 4JT2A 4LZJA 5E9QA 2BLNA 3JY6A 4Q7MB 1BHJA 1FDIA 1PKXA 5DHPA 5BWNA 3K5WA 4UVHA 3TIGA 1IC6A 1ZVQA 3DQPA 3KE9A 2WQ6A 2H59A 3HO1A 1WKCA 2XMBA 1F48A 3L18A 1Z88A 2RBGA 3C4VA 1KVUA 2FYTA 2NXJA 1UJBA 2O2DA 4RA9B 1PR4A 1VMAA 1N9GA 1AN9A 2Q3BA 3MW8A 1H0KA 3F5DA 4MVCA 1NBOA 3EW7A 3REFA 2W2MA 4R1LA 3L7DA 1V96A 1YB4A 2BMVA 4X8MA 4BTEA 4H4CA 1DHTA 5CFZA 2QZZA 1M67A 3FA2A 4RTKA 3H2GA 3GLGE 2IOFK 2OB1A 4N3NA 4Q4AA 2XVAA 3SQMA 2FUCA 2G3YA 3B52X 3D3KA 1OY1A 3FBWA 5CPFA 3IKJA 5C35A 3IBTA 1FRVA 3H5LA 5EP1A 4QFDA 1KEWA 4L4YA 3R23A 2GNPA 2KM1A 2NU9A 2NXWA 3AY6A 4HFNA 1H69A 4H1HA 4EG4A 4ER5A 2QMHA 3EVCA 3DE2X 3NTUA 3M6XA 3VKHA 5I7SA 4NJOA 2N1MA 2E3JA 2K5UA 3OPYB 4MLCA 5SICE 1RYNA 3PFGA 2FFAA 2RGEA 1I01A 3JASB 1IATA 4G81A 3NHLA 4R8LA 3DUFB 4B75A 1FBNA 1JA9A 3P9CA 4PN3A 4ILKA 4G8CA 3ESBA 1Z8HA 3IH5A 3AV0B 3FNGA 3QF7A 5AI4A 1J49A 5T64A 2F59A 2AZXA 5DISB 4L2IB 5FOVA 2C7GA 5JSHA 4CL2A 1X7WB 3DAFA 1PG0A 3W9SA 5KWEA 3CKKA 1L4KA 4IBOA 2AVDA 4CR8A 3E8SA 3THYA 1BRTA 5F1OA 2XD9A 4MKHA 1DKNA 1ZUHA 4NNOA 3E18A 5D8DA 1NMZA 2FWNA 2WPNA 4RTOA 1A97A 1GNPA 3P2IA 3ZHSA 4B6EA 2GK3A 4D81A 1L3BA 2N42A 4O4LF 4WXYB 1VLHA 3FMPB 4YTEA 1XCBA 4LF6B 3ZIDA 4CCWA 1UDRA 4NP6A 2F1HA 3RS3A 2CZQA 3THRA 4H9GA 4ANFA 4P53A 4WFKA 4D97A 4YUZA 5C31A 4B5LA 4YJGB 3MJFA 4YV2A 3H7IA 1GRRA 1GPMA 1EVLA 1LC3A 1N2EA 2XHZA 3FSGA 5FUYA 2BYTA 2GM4A 3OLWA 3PCRB 3I58A 2BFNA 4E5PA 4LE1A 2WJAA 3IA2A 4MB6A 4MKFA 4P38A 6ADHA 2VNIA 1GNLA 2JFFA 3A1FA 1VYUA 1IIRA 1FFGA 2XQFA 3O73A 2ZRCA 2ZSEA 4G5OA 2AI3A 1L9KA 4KCGA 3OWHA 2I55A 4UDXX 5CTJA 5D51S 3FNQA 4MINA 3TTUA 2DECA 2RI1A 1LVUA 3DTVD 1OXMA 2HF9A 3RROA 3WTBA 1L5VA 2GBLA 4G6ZA 3OH8A 2JA1A 1SXJD 4GLFA 2PX8A 2B99A 4ENPA 1QVAA 1RDFA 3MIZA 3WLHA 4HRVA 4LJKA 2WA1A 4MQ4A 3S99A 2NZVG 2PZAA 1ZHHA 3IUQA 5EA2A 1REQA 3G59A 1LK0A 2EJBA 3R7NA 1U0GA 3AY7A 3NHJA 1X77A 3FTDA 3EXEB 3PKZA 4HDRB 4PINA 3SY8A 4D1YA 5LZ5A 1ATIA 3X1KA 2RHCA 4UREA 4G01B 1N3IA 4WK0B 5PNTA 4FYPA 3I3OA 4Q3KA 1M7GA 1L5YA 1YMUA 2VSFA 1ZD4A 4FJ2A 3U7IA 2NQTA 1DWPA 4E11A 5TS3A 1VYTA 2WKSA 4Z9BA 1XTJA 1Y82A 3HDJA 4Q21A 1JQDA 4C4AA 3R6WA 1B74A 3PZBA 2OXRA 2A9VA 3JD0A 1BROA 2V5AA 4AKGA 2EIXA 3BL5A 3ELUA 1GTMA 2WB4A 1K6JA 4OQPA 4Q48A 1DXYA 1WXDA 3DCIA 3E3AA 4RXTA 4UBNA 1M34A 3C7DB 1WP4A 2F43A 2WUDA 4IUBS 2O1XA 3H87A 4BFUA 2QPTA 3DHVA 3CRZA 4L6CA 3H8VA 4IHAA 3W1WA 3SM9A 4WDRA 4DCCA 1JG6A 3CU5A 1QFMA 4XM1A 1ZH8A 1S1CA 3DBOB 1II8B 4RMHA 4RMNA 4HAVA 1FS4A 1Y5IA 1KJWA 2O1WA 2QN6A 3HXKA 4ND8A 2YHUA 3A37A 1J4AA 2EARA 3U81A 3FI9A 2X6RA 2BBWA 2QF7A 2BUCA 1QIJA 1A2QA 4F3TA 1N7GA 3KJGA 3AVTA 1G1MA 1T1EA 4C0AC 2NUBA 1ML3A 4UCXA 5C1DA 1OJ7A 5F2NA 1YIAA 1C0LA 1U5AA 1O96A 4X54A 1JG3A 2HTFA 4MUGA 5GY7A 4RTLA 2QPOA 3IS3A 5FLKA 5IKOA 1PD0A 4OJQA 1RXSA 2NUPA 4DMFA 4ZI3A 2Y92A 3FF1A 5HMLA 3FCOA 4P36A 4MA5A 2C88A 5BQOA 4R84A 3H7AA 2VJYA 5IK2A 3DNPA 3H5OA 4LC9A 4RWEA 2QUAA 1BMDA 2IL1A 5DDIP 1CQJB 1NUSA 1S6YA 1VGVA 2BAGA 3L0PA 3OLXA 4XCVA 1OUMA 3U7GA 2CDNA 4TMFA 3B1JA 1L4YA 4MYCA 4RZ2A 3DBIA 1UJ2A 1Y7IA 2EJCA 3DEZA 3GL9A 4HQ6A 3ZWPA 5FV4A 4NY1A 1QO0A 5JANA 2IUUA 3PD7A 4PS1A 2ZM6B 2JF0A 3A4NA 5AI6A 3WWOA 2AJLI 5KTRA 2QVBA 4JMLA 1PKEA 2FN3A 3ETNA 3AU8A 4RJ2A 5LZ4A 4H3VA 1AK9A 3CINA 3BJZA 3AKYA 3TSAA 1XBTA 3SF8A 3JVEA 5H82A 4XWOA 1WCV1 4XARA 2G9VA 2VQSA 2VTDA 1RI4A 4LG1A 1N0WA 2VYCA 4GVXA 2GTPA 4C7BA 5BV0A 1AA6A 5IS2A 2WTUA 1P1JA 3E5NA 3TJRA 5ICCA 1PAUA 1P7WA 3LCUA 5HM6A 4OI2A 2DUUA 4MQBA 5FWDA 2VFAA 4EA9A 1EI9A 4CFZA 1QGAA 4LCJA 4Y6RA 4PANA 2YXBA 5TX7A 1H1TA 3IHTA 5D3MB 3LT2A 1IN5A 3EIOA 3SSMA 1LW6E 1MQSA 3FMGA 5CK4A 3ZE6A 3TBKA 1AGPA 6ABPA 2GAOA 3QWIA 3WMFA 2AVNA 2ONCA 1W46A 5K0ZA 2FSVA 3KUCA 5CG2A 5KINB 5J2UA 1U1DA 4WOCA 3L1HA 2WDPA 2YZKA 4QZVA 2Y1OA 3BX1A 1P60A 1T9ZA 2V7EA 1OU4A 5B1DA 3BIFA 2LKCA 4PVCA 4DMLA 5AVXA 1YD7A 1XZBA 1R7RA 1U6JA 1XAIA 1E1LA 2W71A 3DGEC 3JWHA 1LLQA 4OIFA 1S02A 4G97A 2D1FA 2PKQO 4HG2A 2IWRA 3V3KA 5EHQA 4IIDA 4RPLA 1X80A 2P11A 3L8YA 2CLCX 4FQ8A 2GM9A 4X8HA 1NQXA 2HREA 2OD9A 3R4CA 4G0PA 3HB1A 4X90A 2A0YA 4AKSA 1ECJA 2ZUUA 1QIGA 4IZ6A 3OP1A 4Y9DA 3L01A 2BZ1A 3R44A 2GARA 3CEHA 4PR0A 4RPGA 5ESRA 1QDEA 2C0CA 1XHLA 4ECAA 3U19A 1NDHA 2WNIA 3OCUA 3VR6D 1VJDA 5HPYB 3C6QA 2OD2A 2Q3LA 3HCWA 2ZZMA 3KYCB 3H1AA 2DOKA 4TV9F 3VOBA 1YU6A 1OBHA 4ZTBA 4HKTA 5CLFA 2PGJA 4URZR 2CFSA 3WQHA 4A2CA 3AR5A 5CK5A 2H2HA 3LQFA 2XBLA 3R5FA 4FUQA 4C5CA 2VZ9A 1A4XA 3X2FA 3OT1A 3HR8A 4C6SA 1Q3TA 3KYDA 3AH8A 3AVVA 3A9TA 2CDRA 4RKQA 3O1JC 3CX4A 4FT4A 3PXGA 4WFQA 2FMIA 4BV2A 4L3WA 2C7QA 3CF4G 4A6EA 3N3BC 2AN1A 1KEEA 2ZITA 1E4OA 4BJ6A 3VPDA 5A4FS 1QOPB 3BSSA 1JR3A 1ZISA 3UMVA 2ZYGA 2XVXA 4Y2TA 3OG9A 2CYAA 4NCNA 5LP6F 2AUTA 4ZYTA 1ZUNA 5CM2Z 4P5DA 3CG0A 4PVDA 5DHRA 3NC4A 4HYTA 2E5FA 4BO8A 1SHTX 1JT2A 2XUQA 2C98A 3K70C 3BE6A 1RP1A 4IIEA 4O4JF 5FNVF 3A04A 2P3SA 3D7SA 3MLEA 3N53A 4RVDA 3AGPA 5IC5A 3VOTA 4BNVA 1Y3BE 1WSDA 2XGMA 2ORED 1J0AA 3ICVA 1GTZA 2YASA 3TAUA 3R75A 2BBSA 3ZV7A 4U00A 3EY4A 4I2VA 3R9KA 3TK1A 2WHPB 1VLVA 3LLMA 3I34X 3N2ZB 3U62A 1PU2A 4EUHA 1IM2A 3WLTA 3NPMA 2P77A 4YJKA 5ALYA 4RS3A 2WFMA 4FEAA 4PHFA 4LQ4A 1U4OA 1ISHA 1IOLA 3IV9A 3F5SA 5F5XA 1HT1E 3KR2A 5DV9A 1KYVA 4YO8A 1JEDA 1P18A 1ITZA 3LHKA 1Z2OX 1AUQA 2HMYB 4PLTA 4D4JA 3RYCB 4LSMA 4W5JA 2WZDA 1VECA 2O8BB 1NXOA 4EPYA 3U09A 2OCGA 4YPOA 1U65A 4C5BA 5JISA 3U56A 4CV3A 4ZDWA 4Z5XA 4KH0A 1SZCA 2ATIA 1J0DA 4IFTA 1MAUA 1UJNA 1Z15A 4N76A 2WAAA 4YXWD 1J8VA 1OC4A 1V6SA 4IJWA 2HSEA 3KPJA 5TF4A 1TMYA 1DAMA 4A8TA 1IN6A 2J5QA 3FVQA 1JIQA 4UASA 4Y2JA 1A82A 4LF4B 3CZAA 3KJNA 1TA9A 1TTPB 5FPYA 4R8RA 2H0AA 4IJKA 1CNMA 4W1RA 2BFDB 4OQNA 4YIKA 2X3YA 4JGIA 1OVMA 2HM7A 2IEZA 3GRYA 3M1AA 4FLEA 4A0GA 2GWHA 4H27A 3IUYA 3Q7SA 4M0FA 4R83A 5I9SA 5T4FA 4DT1B 2Y1EA 2UVPA 1A9XA 1OX4B 2XY4A 4L57A 1XDWA 1NF2A 1SVOA 4R3WA 4BNMA 3WQRA 4E13A 3N6XA 5C37A 4WLOA 1DWUA 2AG8A 2CJYA 3VMMA 1CR2A 5D01A 2BMEA 4LOHA 1CRZA 5A4MS 3S55A 3VYWA 5KJ6A 1L5GB 3G8AA 1CCWA 5L53A 4EUSA 2F1JA 4RIEA 4GDMA 4RSGA 5G3ZA 1YMVA 2HI0A 1X9HA 3OJLA 3QXHA 4BNGA 4P2GA 1SWVA 4NDAA 3JARA 5LKRA 3LVQE 2DH5A 3UMYA 1A7KA 4MYUA 1ZGHA 4AZWA 4HEQA 5TJHA 3LSYA 3KTOA 5JZBA 2MCFA 1G7RA 3ZK8A 3E2IA 3HPQA 3MD0A 1F2VA 1QS0A 3CWZA 5CVCA 3BGDA 2I7XA 3EGEA 4Z86A 4YAUA 4WJLA 5B4VA 3WICA 3PNSA 3ER8A 2PMBA 4DYDA 3PL5A 1EZ1A 1EHIA 1DLJA 3V8NA 2O2YA 2JKYA 3C3JA 3H1GA 4Z99A 1NAHA 3CLHA 3STTA 2FMFA 4IZIA 5F73A 4CGYA 2PSEA 4NESA 3NHKA 2E55A 4INZA 1SH7A 1U7WA 3LKDA 1THZA 5KNBH 2IXFA 2PH3A 2VDWB 2H65A 5CDFE 2HQ1A 3MN1A 5KPDA 2PD6A 4Q7QA 2J45A 1K7FB 4UTNA 4Q4JB 5I4KA 4F21A 4BZQA 1W25A 1JXAA 2VOJA 2HHHB 2ZYVX 3HKCB 1YJAA 1UOEA 2I3ZA 1KRWA 4US0R 3VGPA 4MRMB 1UQTA 3RI3A 1W47A 1FYVA 4I4TF 5DHSA 4CV1A 3HZHA 1AY0A 1EFPB 1U8AA 2DQYA 5NULA 5JFGA 2IH2A 4AJEA 3LMKA 1HDYA 1XMIA 4FYXA 1XI2A 1E59A 2V7XA 3AOGA 2VH2A 4HH4A 3RUIA 1AS2A 5IYZF 1XSEA 4M46A 2B7BA 4Y9SA 4BB9A 5CM8B 5C52B 2I4NA 4AMZA 3I61A 1KZ6A 4FM9A 2IXDA 3JVUA 3DR3A 2JCXA