2A33A

X-ray structure of a lysine decarboxylase-like protein from arabidopsis thaliana gene at2g37210
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
183
structure length
175
Chain Sequence
MQKSKFRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHVIGIIPKTLMVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELVKKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structures of the conserved hypothetical proteins from Arabidopsis thaliana gene loci At5g11950 and AT2g37210.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 62
structure length 175
sequence length 183
chains with identical sequence B
ec nomenclature ec 3.2.2.n1: Cytokinin riboside 5'-monophosphate phosphoribohydrolase.
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03641 Lysine_decarbox Possible lysine decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a33A00
1WEKA 3MAJA 1F8YA 1MTOA 4HX9A 3SBXA 3U39A 2A33A 4JENA 2IZ5A 2PMBA 5AJUA 4JELA 1T35A 1PFKA 4A3SA 4NPAA 1S2IA 3HNOA 2IZ7A 3UQZA 4P5DA 4OHRA 4JEMA 3PFKA 4LJKA 6PFKA 2F62A 3OPYB 3OPYA 3F5MA 1S3FA 2PFKA 1YDHA 4PFKA 1S2DA 1S2GA 4LJLA 2NX2A 4OHBA 2F2TA 4MEJA 2Q4DA 2A0KA 4I7EA 4LJRA 2F48A 4U1RA 1ZXXA 3IMKA 3O8LA 2IZ6A 4I4IA 3O8NA 4WL0A 2KHZA 2F67A 1RCUA 3O8OB 3EHDA 3GH1A 4FYIA 5AJTA 2Q4OA 3BQ9A 5ITSA 4KXMA 4P5EA 4RH3A 2HIGA 1WEHA 3K2QA 3O8OA 4FYKA 2F64A 4MCJA 4I36A 4FYHA 1S2LA 4KXLA 1F8XA 3QUAA 2KLHA 4KXNA 1KZHA
chains in the Genus database with same CATH superfamily
1QANA 2Z2ZA 3KOUA 3OCWA 4UQPA 1NI5A 2QB5A 2HKIA 1XROA 1BW9A 3TLZA 3DEZA 2NT3A 2XDQB 2A0XA 5HXAA 1TZBA 1EEHA 1E0SA 4PFJA 5IM4A 2JIBA 4OH1A 1I0LA 1U2DA 2WZBA 3OZVA 3QHQA 3R0XA 4C03A 3GN1A 3GPLA 5AOCA 1IQPA 5PGMA 3R9XB 1DO0A 4WFQA 3ZHZA 1LDEA 1RWXA 1M1YB 2F90A 2QI9F 2Z3WA 3H8JA 4D0RA 4HNUA 3ZJ5A 1FFHA 2ZBGA 1RYEA 1ZI8A 4A2WA 1RPZA 2ZU0C 3OE1A 4FINA 1K98A 3TSAA 2I91A 5IAEA 2VQSA 4JYCA 4CGYA 1PFKA 4AY6A 1XFAA 3I52A 1H6AA 2HHLA 4GVLA 2I8CA 4YUAA 3LO5A 4TTAA 3ZXSA 1WV1A 2QUBA 4XE5A 1G66A 1LDBA 3TIIA 1KVQA 4EFLA 3F5DA 5CB0A 4GM4A 4R2KA 3G49A 1WE2A 1M1XB 4YMGA 3UGJA 2AQIA 4CPDA 2AEMA 1AU9A 5CH5A 1UQRA 1EGHA 1DT5A 2J7PA 2G8LA 3AKCA 3BD6A 3N6VA 2QRJA 3BB3A 1PZEA 4X84A 3IODA 5JECA 1GZ6A 1ZOLA 5CFNA 1P77A 4KQWA 1JYSA 3ELYA 2QVBA 3QXCA 2J0EA 3F8TA 2HPHA 3A7DA 3FMFA 1R5NA 2XVYA 4EMBA 1TI7A 1THGA 2FPXA 2W43A 4MLPA 4QATA 1LZKA 3IUQA 3P96A 3G7NA 4QOSA 1Z2EA 3I5YA 1RLTA 4EI8A 1KL7A 2H08A 1DBVO 1M2HA 1S2DA 1TJ4A 3GFQA 1H93A 2ECPA 2UVPB 3QMPA 4LNUA 1BWRA 1J0BA 2ODQA 5K6TA 5KYNA 3HA3A 2LR0A 2J5BA 1EWRA 4TKVB 3DULA 1Z5ZA 3WSWA 3UJCA 4BP3A 2V03A 1R0LA 3DOEA 4P2BA 3X2EA 5CK4A 1M5UA 1NJ1A 2CL6X 3CRNA 3C3PA 3KKEA 3Q3GE 5EXPA 5DGDA 3Q0EA 2FR1A 2QRGA 3HVJA 2I3BA 4I1VA 5LB2A 1Q0RA 5DJ5A 4F9TA 3ETCA 4WPGA 1P1HA 4HH3C 1U2ZA 2XJ9A 3MSXA 4Q5IA 5DXAA 4F4HA 2PKQP 4K9PA 3U4HA 2ZT5A 2PPLA 3OIFA 2ZFUA 3P94A 2BZGA 1N5MA 3RE1A 1SKYB 1LK7A 2PJZA 3A1UA 2GHTA 1TAUA 2PKCA 3LFUA 2BR5A 4KWCA 4PFQA 5TMDA 2IEDA 3LZ6A 4B80A 1VL5A 4RTQA 2GFIA 4J29A 4YWJA 3AOGA 2P2YA 5HJ7A 1HQCA 1PKEA 4DUPA 4DCJA 2PWPA 3HSKA 3AZOA 3KEOA 3OM8A 4KFSA 1QK3A 3WIUA 4NCKA 4WKPA 3EAQA 3BERA 3PNVA 2WG1A 4BZWA 5I8PA 2XIQA 3DH0A 4EH1A 1RHKA 2O0MA 3JQQA 3QYFA 4QWWA 1H1LA 1BVRA 9MHTA 1JBEA 1UCFA 3JYLA 2B8EA 2P9BA 3TZBA 2XB6A 1PUIA 1AX9A 1W93A 2W4MA 4LKRA 2VI5A 2Q41A 4C4SA 4LYAA 5DO9A 4DB2A 2O7VA 3AYXB 1E32A 4MKFA 3WGGA 1JZSA 2JJQA 4KXYA 1N2JA 2PX2A 3A26A 2JBHA 1G8GA 1SUDA 3GPBA 5D00A 4E2YA 3UBTA 1H4SA 5A4DA 5T8KA 3B7PA 3O4GA 4MINA 2ZJ5A 2WKWA 3EH1A 2YZGA 4KR2A 2FFRA 2IC5A 4HMQA 4JBYA 2C4HA 4CW7A 5MN4A 1AB5A 1YMQA 4JR2A 4D0SA 1FUUA 2VPWA 4O2LA 2V3WA 3K05A 3KR1A 3RJ5A 5CUQA 2OCGA 2QL7A 2Q8QA 4AP9A 2O0LA 3KEMA 4H6XA 2BVNA 4NEHB 1NAHA 2WJ6A 1ZH4A 3V2IA 2OXFA 5AJZA 4HNTA 2HGSA 3MM4A 1B14A 2A9FA 2B6NA 2GDJA 3N8KA 2Q9CA 5AJUA 4EY4A 1CZOA 3RAFC 3FI0A 3BMOA 1OHHD 4ONEA 3PPVA 4X60A 3AJDA 3M81A 3LC2O 1PAUA 1PR0A 3RVRA 5BR4A 4EHFA 5ARBA 2QE7A 1WXGA 1NQVA 1JVSA 2Q5JA 3HU3A 1Z5VA 3S1SA 4G97A 1YOBA 4JUCA 3RUCA 2HWYA 4OJKA 1SVUA 3BX1A 4MPDA 1WAMA 4W1RA 5FNVA 3TLGA 1UBRS 3U80A 1GGJA 2B8JA 1WDTA 2C0CA 4JS0A 5JAOA 4EMTA 5HM6A 5C32A 1GLNA 1HFJA 2FSVC 1VMEA 4OA5A 4X1YB 4UOQA 2JBWA 4NU8X 2WOJA 4X00A 3R0QA 5HYVA 2ABWA 4BEWA 3FJYA 3PIDA 3OQNA 2EZUA 4UEQA 3TQRA 1Z28A 2IGBA 1A2OA 4H7FA 5CTAA 1W4BA 1GPNA 2Q1YA 3D3WB 4G4SP 3TW0A 2YX1A 1JV2B 3GGPA 3H0CA 4DV0B 1JA1A 1Y3BE 4LOJA 4ZMSA 3S7ZA 3MGKA 4BUCA 3WLSA 2C7GA 3R0VA 4V0ME 4HNRA 2MT9A 1Q1AA 5EVJA 3AVUA 3BRCA 1GPYA 1SHUX 5DWVA 4MR9A 5JNRA 3EPKA 3L8FA 5K0SA 3E9NA 1XJCA 2QNIA 2Y93A 3PL1A 4ZV4A 1JL3A 1OYOA 3L4BA 4D3FA 3A36A 2CHQA 4PHHA 1CYDA 4ZJPA 5SYMA 1DQSA 2FR8A 4JLDA 1GPAA 1O89A 3RC9A 5HVNA 4TQAA 3L4JA 1BDIA 2D13A 4LHXA 1VBNA 1J8QA 3ZV4A 4JLVA 1DL5A 1EFCA 1XKTA 1B74A 1Z07A 2OY0A 4HGOA 4MUGA 3T3HA 3WLMA 1DWUA 3DZ8A 3JZMA 3H97A 4I4NA 4QD3A 4AS3A 1R0SA 4X1IB 3SYRA 2EGUA 2QMYA 5IM5A 1EQ2A 3OCYA 2B2XA 4NPCA 5A5EA 3AVWA 2Q8PA 5KYVA 2J9RA 3OOWA 1OT3A 3F3YA 1C14A 2OZPA 4J7XA 3OJXA 3N5CA 2NUAB 4FYIA 3B89A 3V32A 1GP2A 3ZBTA 1YVDA 4QAJA 4Z1MD 4QYSA 3TZLA 4P4UA 1VE7A 4IZHA 1KMIY 4YP1A 3IDSA 3F47A 4C29A 1CZRA 2DFKB 3AI3A 1IK4A 5HDBB 3HP1A 2QN9A 5A2QA 5ICCA 2A5DA 4ZALA 1TAQA 2E5LB 3ZW9A 1G2QA 1MGOA 1OXBB 3KJIA 4ZC8A 3KXKA 3CX3A 3IHKA 2WUFA 2V8BA 1EEXB 4NJOA 3BVPA 4C06A 4F7DA 5C8DA 5CBPA 5KBYA 4O3FA 2R6ZA 3AEZA 5C7LO 4Z4IA 1RXWA 3JQFA 4P33A 1JQLB 3CVOA 1V71A 4R0MA 2OCDA 4MVJH 4B81A 1MPTA 3NFYA 3WGZA 5BYKA 2AI3A 1QHHB 2DECA 4ND1A 1BMFA 4EKEA 1MEOA 1ESCA 1L4EA 1G5IA 2VWHA 1CQPA 4RA9B 4YB8A 1H8HA 1XCOA 2QT9A 3WMFA 1GTG1 4B34A 3LRTA 4FOTA 3M1YA 2X1VA 3L7JA 4H0NA 2BCGY 3C48A 1TAGA 2Y6VA 4Q01A 4AZ3B 1TYZA 3JASA 1J2YA 4XSHA 2G07A 3HB1A 3ZDFA 3ZWVA 4CMAA 3L7CA 4QDOA 2I2XB 4ND8B 4KO4S 2JLSA 3ZU4A 2HHAA 5DHPA 3AM1A 4ZN6A 4M8NE 2Z1MA 4EOGA 1UODA 2FQQA 4IILA 3WVNA 2CWWA 4ALLA 1MDFA 3COZA 2YJGA 1C9MA 5E1MA 4C01A 4QTXA 2NUPA 4I8XA 2NQ2C 1KYQA 4CLXA 3AHFA 2ZKLA 2CE2X 3RLFA 4BMVA 4O2BA 4DDKA 2X5XA 1RJEA 3R7SA 5KYWA 2ZIZA 2D0DA 1T4DA 3OZTA 3NTQA 4OB8A 4REQA 1FXSA 3LW7A 2H29A 3B6MA 4IEFB 4LNUB 1P2UA 4AJEA 2OV1A 4EG5A 3AP1A 2GHQA 4P7KA 3EA5A 5CK5A 3FE2A 2D1YA 5EXXA 3AKEA 5I7RA 2C94A 3AR3A 1U8CB 1I4EB 2B7CA 4H1HA 2ZYSA 3DGFC 5KC9A 2TS1A 5DK6A 2QORA 2QM3A 4DLPA 3DD5A 3VKGA 5AJHA 1GL9B 2CGEA 1XWFA 4N01A 5CHEA 1S9DA 3RFCA 4A16A 1XD2B 1YT5A 1LNQA 4ZZIA 3KQLA 3P19A 5E6SB 1YBMA 1S7CA 2G9NA 3SF8A 3HKEA 1K86A 4EGSA 2IT1A 3K70B 2ZSEA 2ZEJA 3GVIA 3N0TA 3SSMA 4D56A 5FWXB 2Q3CA 4GWLA 3OOEA 2DTEA 3L7LA 1JQKA 2XWPA 3I9JA 3ZWXA 5J5AA 2ZRLA 3BA1A 2UXBB 5EJ4A 1V0JA 1YQDA 4ZDIA 1R8YA 4YJFB 2HA6A 2FWNA 4L15A 1L6IA 2ATVA 4DY6A 5IWAB 2C5EA 3CRMA 5ANRB 2ZQZA 2RGNA 2DT5A 3GZTB 1P0FA 2H1HA 4GGPA 5DYGA 5K8CA 1WB9A 2IYQA 2HI0A 1H85A 1XZEA 4DJFC 1M6EX 2SCUA 3OFND 4WMLA 2GR9A 5KOIA 1EQAA 5JZMA 5HFNA 4AZVA 1XO1A 1H2ZA 2H2IA 1L7AA 2E4ZA 1I3LA 3A25A 2O52A 1JWLA 5AICA 5MGNA 2E1PA 1MQ8B 2HMSA 3NWBA 5AKHA 2O2GA 4HJXA 3GVXA 2ODEA 4QG3A 4OXNA 1A7KA 2Z08A 3M6LA 3TSZA 2DEUA 1U0EA 4M1WA 5LWQA 3QU5A 5JOQA 4ZQCB 4NZNA 4FMCF 4KMOA 2WM2A 3T7IA 4QZVA 1MFZA 2NTYC 1TYCA 3CPJB 3ZE8A 4AS2A 4LHYA 1MJ5A 1JDTA 3VTKA 4B4OA 4J0GA 5I7EA 3COVA 2I2BA 5FFMA 2FWIA 1CZKA 3EN0A 4L0DA 4EVSA 3D59A 1DBPA 3K1TA 4LWZA 1MENA 1SO8A 4O4JA 2N9UA 2RGRA 2PUHA 5I5GA 4CIXA 3LC7O 4A36A 1OPRA 3CVJA 3OZGA 2YFHA 5E4YA 4XH9B 1GZUA 4ZODA 3W7VA 3HBJA 4MW2A 1RXEA 2NSLA 4OSOA 5AFSA 3ONWA 4K87A 3BWCA 3NT2A 3M6WA 5B1YA 2XYQA 1FMCA 1K68A 3F74A 3G2PA 1HOTA 4Y2QA 5JPIA 1GY8A 3BXEA 5H81A 5EPUA 1A76A 3RIMA 2A0WA 3DZKA 3F6BX 4ALIA 2OGWA 5IULC 5BQPA 2PR7A 2MIIA 3HB7A 5IBCA 1MC1A 4I9GA 3AFIA 2RAFA 5F12A 4DIMA 4BVEA 4M1TA 2PKXA 2ZTSA 3Q2IA 5AHOA 4B35A 1ZU4A 3TRFA 1BMTA 1JDJA 3JVVA 1M1NB 1S3GA 3VVMA 1N9GA 2IYRA 4D8XA 16PKA 1BDBA 3COSA 4EARA 4R8LA 5TT0A 4PG7A 1ZS9A 2GO1A 5F33A 5A3VA 3ZVLA 4AJ2A 4CVNA 4O2AF 3TJMA 4D97A 1DWQA 1GT6A 1RXCA 2VXOA 2JLQA 3GLRA 4OHFA 2EX1A 3X2FA 3ZU6A 4CF4A 4Y0VA 4UBMA 2JFYA 4BBAA 1IDOA 1L7DA 1XL0A 2VHZA 1REQA 4FDTA 4YJ3A 1JEYA 4WKOA 1LSUA 1AKQA 1H5QA 2XVAA 1CB7A 1OH6A 4E4YA 3E2IA 4P4GA 1AUQA 4Z0NA 3H2YA 2GK6A 3GCGA 1FFXA 1GZHB 5EINA 5ICEA 1ZD5A 3A3PA 3KU4A 3G5LA 4LOIA 4B74A 1NN0A 2G6BA 2G6TA 3RW9A 3FTEA 2BJWA 2NW6A 3KOXA 2J4DA 4OXYA 4OP1A 4RFSA 4Z4GA 1CX9B 3UOAB 1JDVA 3ZGOA 1O9GA 3MWFA 4IICA 3GRUA 1FRZA 3ZCTA 2BFCB 3SQMA 2FOLA 1U2RA 3DD1A 5F2OA 4Q7QA 1T6ZA 3AB3A 2GVZC 3E4CA 4ZGWA 5C8YB 1XCPA 2NU6A 3KPYA 2OV2A 4PNEA 5M34A 4RTRA 3UOGA 4RIHA 1KIMA 3M6FA 1JS1X 1Y1RA 4YREA 4XIIA 1IC6A 1RAAA 4HH1A 4ZVNA 4OG2A 4UXJA 5MN6A 2IY7A 2R8ZA 1W1IA 1Q5PA 3R3SA 4FN5A 4L5AA 5TNXA 1CKEA 1BO6A 2HDWA 5AHKA 5KYTA 1HV8A 1N2HA 4C6SA 4HUQB 5F1OA 2HR1A 3JQBA 2KSQA 1F2VA 2ZJ1A 3LPNA 3W3AA 4K86A 5DLPA 4JB0A 4J9VA 4F8EA 4GR4A 1FEZA 1AHNA 5HQTA 9LDTA 4PANA 2ZRFA 4LOAA 3CUTA 4WOBA 2VHXA 4Y9DA 5FB3A 2X2EA 3VKVA 1BJRE 1NVGA 5F51A 2KBEA 2X13A 3HB9A 3OOYA 4H7PA 2GM9A 1E5VA 3L84A 3T5PA 2O2DA 3I8XA 1HZJA 2WWRA 2H2DA 4FEAA 3IEVA 1ZIYA 1KDYA 1ULSA 3ER8A 2IZZA 3PCXA 4YV0A 1SUBA 2OO5A 1PL6A 1MAUA 1V11A 2FQYA 3KYBA 4MAMA 5FR1A 4G56A 4BFZA 1Y3AA 1XLWA 3QU4A 4H3KB 1TMKA 4BVBA 3UKJA 1FJHA 4V0OA 4YGXB 3IUBA 1FY2A 2JFFA 1LPOA 3EWSA 1KYWA 3F78A 3LBNA 4O4LB 2RARA 2GZRA 3NETA 3D6HA 1NU8A 1VIYA 3G2JA 1I10A 3ID6C 1DAMA 1ENOA 1IOVA 2XF8A 4Q4HA 1LBQA 3BWMA 3HVRA 5DYIA 1VBKA 1Y80A 3VNBA 2H6EA 3BILA 3BREA 4C78A 3JASB 5B37A 1KOFA 4DGQA 3CLRC 1SXJB 3E7FA 4JEHA 2J85A 2FAXA 2W11A 4BZQA 1SN7A 1EDBA 2VSFA 5CFMA 3U19A 1Y4SA 3IQEA 3E81A 1FQWA 4Q9AA 1PGPA 4WZAB 4XRGA 4G8BA 3UCEA 3HNPA 4P4LA 2VH2A 3FB1A 2Z2IA 3LPDA 2HA5A 1UOEA 5GGYA 5FBWB 4HWPA 3ZNPA 2EVWX 1Y6ZA 4HB0A 1LRJA 2V7UA 3KKNA 3B85A 4JLNA 3PQDA 3G7SA 3KQVA 5CNKA 1XNHA 5FTWA 5L3ZA 2ESRA 5KYWB 3P2IA 4KVAA 1IEQA 3B9RA 1R2QA 3GXOA 5EFOA 3P4YA 2HNBA 3UICA 1Q1BA 1YR9A 2MHCA 2IOFK 3GA0A 1RBZA 5F5XA 1T36A 1IPHA 2W6ID 3E1GA 2JD2A 1ZOOA 2ZI9A 4UHEA 3O94A 4WXPA 1ORRA 4RFLA 2BY4A 1NXVA 3GJ7A 3JWJA 1NULA 1XD2A 3C70A 2GRAA 1MVLA 3SYKA 3FYUB 2DYKA 1NOKA 2RH9B 3LQQA 3MOGA 4MGZR 5CU7A 3VYRB 4F92B 3DZCA 2FW8A 4GC5A 4F11A 3U7GA 4N3GA 5ELXA 1THZA 4PNHA 1UFOA 5TVGA 4DSUA 2ALJA 3NKFA 3R0ZA 3U7EB 4C5AA 1P2GA 5HIJA 1NXSA 2VUIB 4C0BA 5JY1A 4BFYA 3MA0A 5CA1B 1P1RA 1XLVA 3F9IA 3PZBA 1FUIA 2PX5A 3E1KA 4RZ2A 1S2GA 3RSFA 3DFZA 3G23A 4KIJA 3HY3A 1X1CA 3HJBA 3NUZA 5THXA 4CL8A 4HC4A 3U7IA 1Z0UA 2R6JA 4NBKA 4Q7JB 1EP2B 4HNQA 3SU8A 3EFEA 5JS8A 1OXKB 5C81A 4IX1A 4N0EA 1J06A 1S2MA 1DWPA 1XDGA 2QZPA 3JQPA 1K6XA 1JHZA 1Q22A 1X39A 1UBEA 1YJAA 2AE1A 3MK31 4G8DA 4P54A 2I1VB 3S5UA 4C04A 4NBVA 1FB5A 4J75A 3UNXA 4H4CA 2JH3A 1WETA 3M89A 4FOPA 1SKYE 2H07A 1O0BA 1YQGA 2SBTA 3C87A 1HYBA 1JAYA 1BXRA 1Z15A 2ZW9A 4LXHA 1T3ZA 4MKHA 3HFRA 3TEJA 1MZPA 2V6GA 3KJXA 2CT8A 4S24A 3BBPA 4NJMB 4FGLA 3R3JA 1TJNA 1UFVA 1FFDA 4LF7B 2EARA 2XBUA 1RAHA 2RIRA 1JIXA 1L5QA 1J2RA 2OCLA 3L0IB 4HRYA 4LZPA 4FYXA 3ZCSA 1D2MA 2XZPA 3KAPA 1I8TA 3LH5A 2M9MA 2XUFA 4R69A 3TX6A 3V3KA 3CPSA 4CTKA 4MKZA 5HJEA 1U1EA 5FBRB 1J23A 3ZHRA 5BPHA 3U4MA 3ZEIA 2FRVA 2OORC 2J9XB 2QYSA 3HEAA 3U7QA 5LP6B 1KMHA 1PQUA 1U3VA 3KIPA 3KPVA 1XLUA 2XADA 4TYMA 2HBYA 4LJSA 1RYNA 1YS6A 1GU0A 1M2GA 2P2CA 3D2AA 2FSIA 3L46A 5IVIA 4EG3A 5J47A 1GKIA 1JHQA 1Y3IA 1C5KA 4K9OA 4GNRA 1DAGA 4A6PA 3RUIA 1HC7A 1R4ZA 1G9SA 3UJ8A 2OYCA 1BMFD 2VAVA 1SWWA 2C2OA 2Q5CA 4J7AA 5BUSA 1FIUA 4QLAA 1LU9A 1NFQA 3V34A 1FP4A 3RKSA 2ZB2A 1D6SA 2YVQA 4WLEA 1I80A 2P3OA 4LMRA 4MVXA 4XWYA 1T9AA 3BCSA 1W59A 3JQ9C 1G6Q1 3NKLA 1NZJA 2CEKA 2VZ0A 2QYOA 2JEOA 1K97A 1P7WA 3TQHA 1KQOA 3NIFB 4U6QA 2ODAA 3NV9A 4C20A 1PQWA 4TVBA 1OA1A 3C6QA 2F1RA 2XT6A 4FHGA 3Q1LA 2O0HA 3CX6A 4JV5B 2PT6A 2R6HA 5ICMA 4Q66C 1GR0A 1GGFA 3CVVA 4K2HA 1PSDA 5ITZA 4CHTA 3OM9A 4PWYA 3UHFA 1T1JA 1NWCA 2VTDA 4PGMA 3R2JA 3HJTA 3S6JA 2HW8A 1UPBA 4I1YA 1E9RA 1Y4AE 4C4XA 1D3AA 2GDZA 3KPJA 2PIAA 1HTTA 3ABRB 4LJKA 3MT9A 4BE9A 3NIGB 1ETHA 2GBIA 3A9WA 3GDOA 3OE7D 5EZYA 3RFXA 3FUUA 4KYVA 3CEHA 3NEJA 4QDKA 3UUWA 3IUSA 5KCZA 4NYJQ 1YUNA 5K6AC 1E7WA 8LDHA 4WASA 3LOQA 1D0VA 1A5AB 1MC5A 1H1DA 1SA0A 4IDBA 1EM8A 3ZUPA 4EQ6A 2FR0A 4ZVVA 3X2SA 2NAFA 1Q3KA 1ID1A 2IU4A 1GDDA 4B75A 3BEDA 3URMA 1QHIA 1DHRA 2Z6QA 3IV7A 5F3WB 3E7PA 2RAPA 1A8QA 1JFLA 4DT1B 1G8HA 3ZOKA 2CYBA 3AUTA 1N8NA 1MFPA 3GI1A 1XXHA 3PC8A 3ONFA 1XMOB 1I5OA 2OQ2A 1XDDA 3A4LA 4NBLA 4ZV9A 1QDEA 4WOPA 3CVYA 3THXA 1N5IA 3GWGA 1NM5A 1V1MA 1VFNA 3H9CA 2IEIA 5DLEA 4A23A 3ZTTA 3LI2A 3RCBA 3UJ6A 3UXEA 4JGIA 3RASA 3BZWA 5JD5A 3DBHB 4PXYA 1K9SA 2E85A 1R16A 4B09A 4EW1A 3CZ9A 3PIIA 4M86A 2JLAA 5IF9A 5JCPA 1A1SA 2QRKA 3VNAA 3GD5A 3UQYS 2OEPA 3WMGA 5BVGA 1QHGA 4L3VA 4MVJP 3WISA 5CITA 4YCLA 1Y8RA 2CCJA 3FPBA 3DLIA 2R4TA 1SIUA 2C9YA 4GKJB 3B1WA 2PYZA 1KJYA 1NU6A 2Q1UA 2UKDA 1P2TA 4LRUA 4B6FA 5F76A 2I4OA 1EVLA 3QPVA 3TIGA 3EW9A 5EI5A 4IUYA 4MV9A 3WHLA 2JJ2D 1NAIA 4WV3A 5LQDA 2NZVG 1IB0A 1DG9A 2DULA 3QG1A 4UVEA 3V4SA 1DBSA 2Z3VA 3I5UA 5IT0A 5ISMA 3QNMA 4BNHA 1LSOA 1PJAA 2BFOA 3LP5A 4IIBA 4TS1A 5G0UA 1K63A 4BLPA 1GNQA 3I42A 3QEOA 3F5FA 4MV8A 1GN8A 4WFIA 5EQDA 4C4AA 5LU9A 4P35A 2GCOA 3QH4A 3CJQA 4TVOA 4XOUA 1J0CA 1KMNA 4OAPA 4QE3A 5HZHA 4X1KB 4UMFA 3VSAA 4JWKA 4B9EA 1QZXA 2BUCA 3AJAA 4IJWA 4Z9XA 4LS3A 3VPAA 3E9DA 4Q9LA 5BSFA 4NV1A 5FORA 3F2IA 4TLAA 1TKRA 3SIPA 4YQYA 2QP9X 1TIBA 4BKUA 1EK0A 2OZVA 5LQNA 1LW7A 2C3OA 4XEUA 3T9AA 3ZHCA 5T4HA 4RY0A 4DZTA 4OQFA 4DV1B 2BMAA 3EXAA 5JCZA 3OY7A 4TM8A 1B2LA 3QTBA 4BP9A 4DMUB 4GXRA 2V6JA 4L16A 2GM4A 3E5RA 4IIXA 4PAWA 4CIWA 1NLZA 3L0SA 3UA4A 3M2PA 5FO1A 5CDUA 2D1RA 5KSYA 3KVYA 4KVZA 5A3QA 3OKPA 1FYVA 1UWVA 4PY2A 4RD6A 5BT9A 5F1YA 4BLSA 1ZZGA 1E3MA 2BONA 4YCAA 4Q3KA 3SZUA 3FTDA 4UAUA 2CHVA 4TRRA 5KQRA 4DAEA 2BJVA 3M49A 2IEBA 2MYPA 1LLDA 3DE4X 3N0VA 4KN9S 2QVYX 3U37A 2VA9A 1U7UA 3U3RA 1E0DA 1V3VA 3BMXA 4A91A 3LCVB 1KSGA 2XE8A 1OXUA 1CRLA 4GICA 3T1YB 3U3JA 5DI3A 2QD4A 1EK6A 3IQFA 4GBJA 5JAZA 2PWZA 4DR4B 3L82B 5K05A 3SKYA 2YYZA 4M0KA 2PZJA 3N8NA 1IONA 1R0KA 3D5EA 3TTXA 1E6MA 3HVKA 1QFSA 2PRJA 3B12A 2FEMA 4EYOA 2GLTA 4TS9A 3PVZA 4YO7A 3V1TC 3ILYA 1TCBA 4ZEVA 4OQYA 2BM1A 3A7EA 1RXSA 4HAZA 5LJIA 3IJRA 5AQ1A 1E3QA 2JCYA 3SDSA 3LF1A 4LSWA 5CJJA 5JVDF 3ZDQA 5DM1A 3UMYA 3BXPA 2DHEA 5T3UA 1KO4A 3NBYC 4QGSA 3N53A 3X1ZA 2JA2A 1QXSA 2WHEA 2XITA 3U60B 3D3KA 3MCTA 4UU8A 3DAYA 3P9PA 1XA0A 4E7OA 1M10A 2R7KA 1O94D 4JVNA 2WPNA 1A5BB 1N9ZA 1A71A 1KYZA 1RRPA 4G86A 5FI1B 1NNSA 1IPFA 2C04A 2VH5R 1WUJS 3C85A 4BKOA 1QIKA 1PYGA 2VCHA 2DX7A 3AIIA 3K0CA 4PCVA 4X20A 3TVYA 2QX9A 4KQ6A 3EVDA 1GRCA 1OZGA 4K6GA 3V1YA 2IJGX 1PS9A 4QOJA 1DJOA 2UUAB 3WGJA 1WV0A 4YR7A 1JTVA 2Q5HA 2QW0X 4GOND 1ULAA 3YASA 3ZIAA 4LEIA 2O8CB 5DDIP 3LCJA 3QEKA 5ALVA 2I4RA 4TLMB 4M1EA 1Z2PX 1G5QA 3ZHVA 2Y4OA 2ZIUB 3W8FA 1YL7A 1JLSA 3E9QA 5JNSA 2PGXA 3IDAA 1ID8A 3RRFA 4XGKA 4A2QA 3K9BA 3QVWA 1KTIA 1CY8A 4OHXA 1QNLA 4EGJA 4ESVA 1O87A 2J5KA 1QG6A 2J3KA 3DEIA 5J4LA 3HLYA 3U4QA 2UYOA 2EAUA 4CN9A 2E21A 3R3ZA 4KXXA 4DJEC 1PLJA 2V7VA 2REQA 1ECPA 3LK6A 2WIKA 5DHUA 4P32A 5HFJA 4UXIA 1FFBA 2JFGA 1MRNA 3O8QB 4FFWA 5IC5A 4L9WA 3HN7A 1TFRA 3CZQA 4FS3A 1OFHA 3FH0A 4FTWA 4G0WA 3IXLA 2GARA 3AF3A 3LD9A 4V03A 3BE6A 2I3ZA 3DTVD 1V2HE 2UXCB 3CX4A 3H6KA 4RCYA 2P2NA 4JL8A 1SVSA 1C4WA 3OWXA 2C8JA 4JL5A 5IFKA 1F2TB 3BSWA 1HZZA 2XUDA 3P2MA 2B1JA 2OC4A 2WSIA 3K0AA 1PTJC 1QRUA 2HT1A 1MAVA 2GM5A 5IZCC 4KE7A 5HCIA 3TO5A 3WNDA 3KWMA 1P4JA 4QFBA 3QOFA 1XZ8A 1BX3A 4NU0A 2OGSA 1U31A 3DFFA 1U90A 3LGAA 5A4IS 1D7OA 1TMOA 1F17A 1FPMA 1PKXA 3GJXC 1MU0A 5FPYA 3DKPA 4F60A 2W2VA 1OXXK 5HOEA 4MW1A 1P61B 4RJLA 4OQMA 1Q92A 4WZBA 5F1KA 5GOTA 5HZMA 5HF9A 1G64A 2HQBA 5BV0A 2HRRA 2JIDA 3DOJA 4DCUA 4WLOA 5IXYA 1PDVA 2PSDA 1T8YA 1MAHA 2YV4A 1M66A 5H3LA 1POXA 2OP0A 3CRQA 4RPCA 4GL2A 1XMQB 4RPLA 1M2KA 1DFHA 2WEKA 1U2GA 2V54A 4DQVA 3S55A 4FR2A 4KQXA 3LCCA 1KKMA 5K3CA 4CLOA 2FZLA 1HT3A 5T4EA 4YJ2F 2HRQA 1ZVJA 4JJ7A 3ROTA 2BR4A 4PO1A 3L3BA 3VU9B 3PDUA 4ZOEA 3SZMA 4PO8A 1CZLA 2O1EA 2WJGA 1V6SA 3BZUA 1W4LA 3OZSA 121PA 4HTFB 4M98A 4H1VA 4HGRA 5B7GA 2J6HA 3PUYA 1NKSA 2OHFA 2WYUA 3LAWA 5BUZA 2CF5A 2FUG6 5AH0A 3HZOA 2EQBA 3HR7A 1V4BA 2PWAA 1X0VA 1QIEA 3PQ5A 3I1JA 2FKNA 1RMTA 5I9IA 3TB4A 1IJBA 5D3MA 4AJHA 1G20B 4HK4A 3RS7A 2CLFB 3FCYA 4JBHA 1XQ1A 5E6RB 3WYBA 3DEFA 3FDIA 4JITA 1USKA 3T3PB 1B8NA 4ZHQF 2ONCA 1M34E 2Y1WA 3CNOA 4HDSB 1FSSA 4OLBA 3RYIA 4RY9A 2DLNA 5EN4A 3JRXA 1XK6A 1Y6QA 3PS9A 5ARCA 1FZTA 4ERNA 4XOIA 2JHFA 4ZZ1A 1QGYA 2MSCB 1QP7A 4OK3A 3QFRA 3GDGA 1KBQA 4YLEA 2GNOA 4W9NC 3S0JA 1MOZA 2NZJA 4HZGA 3HCOA 2JK0A 3F7OA 1OBOA 5JCOC 4BY9E 1XSEA 3WZLA 2VYNA 5CGQB 4BLQA 1QX3A 1BDMA 4DCPA 5ILQA 2D2EA 2RKWA 1FTQA 4V24A 5GONB 3JY6A 3UC5A 4YCDA 4A27A 4PHGA 1ZAYA 1LDMA 4IKEA 3FZYA 1WWKA 4PLTA 1QIGA 1TB4A 2DT8A 2GO7A 4MMXB 1FPQA 4XUGB 4JBGA 2HCFA 4UU1A 2RGUA 2Y1EA 3BORA 4H08A 4JYBA 4LSZA 5CNIA 1ZJJA 5IC6A 2IQIA 4B2PA 3QKSB 4DA0A 4FYKA 1K27A 1D1SA 2XODA 3QK7A 2JHCA 3OZCA 2C0QA 5DK4A 3WV5A 5TR9A 5TQ0B 5KI6A 3CE9A 3STUA 4AFNA 3QUAA 2VXYA 1C8LA 2PGIA 5K6RA 2VHJA 3KZOA 4XJSA 2J0UA 1YA6A 3TRKA 2YXBA 2HM7A 3NH9A 3VR5A 1C8VB 3MJCA 4MQMA 1PS8A 3HCWA 2OBLA 3QFFA 4ZO4A 4HVTA 3MTJA 4NENA 3U39A 1M1YA 1E2MA 3RFUA 3AHJA 2QUIA 2ZJ2A 3C3DA 3KJHA 4TMFA 3FY4A 5ENVA 6CHYA 2ERYA 5KOHA 4ZRMA 3VDQA 1VL6A 2WF9A 3IH5A 5IBPA 4P31A 2VXCA 3D8BA 4XWTA 3T3EA 2IEZA 5IBRA 3UJBA 3UW1A 3HDTA 1SEPA 2FK7A 3DG9A 4MW6A 4KR3A 2G5PA 4P0QB 2O3QA 1T13A 1VLJA 1I0IA 2J4FA 1D1QA 3V42A 3KKPA 1EVZA 3JTMA 1EHIA 2QBYA 6AT1A 3L8GA 4MWDA 1K8QA 3B60A 2YC2C 3FNHA 4TTIA 1IIBA 3ISVA 1LVHA 5IASA 4TL9A 4OHKA 2XRYA 2B8TA 3LHDA 4LRWA 3V4PB 3PA6A 4BEJA 1UL1X 1OZ0A 2J7KA 1VFPA 5F2EA 5HUHA 5AM1A 1DXYA 4ZT4A 2P67A 4BC0A 5F4BA 1XDZA 4A8JB 1JEQA 3QLUA 4HUJA 4X6LA 3U40A 2HTFA 4IH4A 3IKTA 2DUUA 1V5FA 4L0CA 3W79A 4BGIA 2IEGA 1XF9A 3V80A 2H0AA 2CYCA 1R6TA 4AIRA 4QEDA 5EIOA 3VPDA 4BQNA 4C0KA 1WY7A 1E3IA 1R0BA 2P69A 1FTNA 2ZSHA 2ZYWX 4M22A 3UWMA 2IYVA 4URVR 3WYGA 1QM5A 4Q93A 4Y8VA 3KETA 1R10A 2IITA 1L3BA 1D2RA 3DE1X 4JNKA 3H65A 4TMKA 5BWCA 1KVUA 2ZITA 3TNLA 3LO8A 2XXAA 5AM4A 1XNRB 4CN8A 4TN5A 3KKKA 1JDPA 5F7OA 4NOJA 1YHNA 1EIZA 1DRWA 1PZGA 2K7ZA 3K96A 1M54A 3EQ9A 5CAEB 1UDBA 3ENKA 4R8SA 3FCAA 4BFLA 3ZVRA 3DT9A 1QS0A 3B51X 5LFAA 1ICEA 1JAHA 2O3SA 1UMCB 1ZD8A 4JXJA 5SYNA 2H2HA 2N1MA 5IJ9B 5J3JA 1WVIA 4X54A 3RSSA 2A5GA 4BO0A 4INOA 3SAJA 4HNVA 4GNKA 1AKEA 2VJLA 2B7LA 2OLKA 4IO0A 1S8OA 4BN5A 2W7TA 2N3ZA 1BJTA 2XWBF 4A03A 2FPGA 2VF7A 5HRUA 1I33A 2YMQA 2Z8YM 3KHUA 3R3VA 4FDUA 4Y2RA 5FUYA 3AUKA 5B4UA 3ZVMA 3M7IA 1XTSA 2RAVA 1QRSA 3T95A 1U5CA 1UOQA 3TEMA 3G7UA 3TAHA 3N8GA 3I9NA 2FSUA 4JT8A 4PZCA 4NKRA 1STOA 3GG2A 3HA7A 3IUYA 1F2TA 4W5HA 3U5ZB 1UJCA 4OVKA 4ND5A 2J9FB 3FJ1A 3LCMA 3VZBA 1UPAA 5JNWA 1ECLA 1K8YB 4L7QA 3BMQA 1DDOA 4CTOA 4IXWA 3P5BA 4RTSA 2FWJA 4N8EA 4LXTA 4KFTA 3J81A 3D4LA 5DT2A 4BQRA 3WWYA 1LLQA 3D3QA 2NSYA 2CEAA 1ABEA 1RMQA 3IJ5A 4MR9B 5DT9A 1XQ6A 2DBRA 1DQYA 1I14A 1P0MA 3BMCA 3ROXA 1W0KD 4ZHSA 5K6AA 1M3SA 4WTOA 4QRHA 3GLIE 1JI0A 3Q9SA 1KQ3A 1YULA 4P7FA 4WE3A 3FDXA 5K45A 3EEOA 4RIGA 4QPZA 1D2CA 3FYSA 4MUKA 5EY5B 1PN3A 2V6MA 1OLOA 4Z3KA 5B3JC 5A0TA 3VC2A 4IDAA 2NZ2A 2XKBA 4E09A 1UADA 1DU4A 1FA9A 4BC1A 4KWHA 2PLWA 5TMBA 4B5KA 4KFCA 1NF9A 1E4YA 1T1GA 2HF8A 3F3MA 5DH9A 1ZXBA 5DP1A 3KUKA 5GQSA 3LX8A 5A7GA 1ZG3A 3ASYA 3K9GA 3D5QA 3C6KA 3ZOZA 3UV6A 3DMYA 3DMGA 1FDIA 4MWZA 1SD1A 3EWIA 1CRZA 3RV4A 2FWMX 1AQIA 2FYTA 2PX8A 3PXCX 5FOTA 1NP3A 1XZGA 2G4LA 1SJ9A 2YXLA 4G85A 4UJ3A 5HG0A 1VPTA 2JGLA 1JDZA 3QF4A 4L4XA 1ZJ6A 3N75A 4AG3A 4F84A 3M0EA 2VQ3A 1SQSA 3DF9A 2RGWA 2BR3A 1GJRA 4OP3A 2GJAA 3E27A 3IOBA 3JQAD 4D8VA 4OSEA 2YRFA 1H3NA 1NJ5A 2Y6UA 3AEXA 3MT8A 3RKUA 5L3SB 1W5TA 3I2GA 3NS7A 3IJPA 4MVYA 4OP2A 3E3OA 3IVCA 2VSYA 2F4VB 4HKTA 2WUDA 3UK6A 1JSCA 2TMDA 3MT7A 3ORFA 4DPMA 3GIDA 4H7JA 4JCOA 4UAVA 2VJYA 4GMHA 3QA9A 5ALIA 5FP0A 3T7TA 1RJFA 1OMOA 1TO1E 5AK4A 4MWSA 5HF6A 5CFQA 4RTOA 1M6VA 4MUNA 1A9YA 3DBLA 5FTMA 3FSGA 4RD1A 3DOUA 2B25A 5EKUA 3BSFA 3S1AB 5C9ZA 2O19A 2JGEA 3FDZB 3OQ6A 3QF7A 4BGVA 2V7WA 1FTGA 2PBLA 1M0TA 4OHMA 3A32A 4CQMA 5HOQA 3PBKA 3BD8A 1OTYA 1LFAA 2ENWA 2ZJAA 3BUSA 3JVDA 3NOQA 3FPLA 3PR3A 3RRJA 1P81A 4IS2A 1K5DA 3QBEA 1D2HA 4M37A 5JI2E 3NWJA 2B34A 4D4IA 4DMCA 2WOOA 3SHFA 3T0FA 4ZYYA 4XJTA 3BD9A 2CUNA 4DV4B 4JD5A 4B48A 3MWDB 3A2KA 1FVFA 2WB2A 3KSAC 4D74A 2X9NA 1YZVA 3N7UA 3R4VA 5K4HA 5KVVA 1Q7EA 3BGOS 2IWHA 1V8OA 5FDFA 2ZSAA 4C6HA 1GTJ1 1E2LA 1SCKA 4Q9DA 4N82A 1QB8A 4H7DA 2RBKA 4XGNA 2O4UX 1VDMA 4HD8A 4OB6A 4BO9A 1O95A 2VQEB 1Z33A 4BMSA 4HZIA 3KDPA 1KH2A 3I0MA 2QXTA 2EWVA 2UZ1B 3GRVA 5H8WA 2W8BA 4DCNA 2M6KA 4M49A 1W9MA 4R83A 3LQ4A 4I3HA 2FN7A 4YROA 1G20E 4KJZA 1T3HA 2YDYA 3BQ9A 4FGUA 1DIBA 4JX9A 2PGLA 5AIAA 5BRJA 2HXYA 3UKOA 3BFKA 2FN9A 1EB9A 3UMGA 4KPGA 3AINA 3P9ZA 2GZAA 2PD4A 3PRKE 1MX3A 4LBZA 4JC4A 2P9FA 1ISJA 4G0ZA 3EYAA 1IQ0A 1IHOA 2AT1A 5CA0F 4H3VA 5KOHB 1B42A 2AHOA 4B3SB 1NRIA 1SCNE 1VMKA 1W94A 2PA0A 5L4SA 2X22A 3GJ8A 2Q3FA 3QRWA 4I4CA 3WDKA 3O38A 4F1KA 5IAAA 1CETA 4UOZA 2IXTA 4RA9A 2FHPA 1NW9B 4JHLA 3I2KA 4PXSA 4EJSA 4ECAA 2PFGA 5D1NA 5JE8A 2P2DA 3HR4A 5DBIA 1SKUA 3N87A 4TMTA 3SG0A 1AQLA 3WYFA 3KL2A 2RAUA 2RK3A 3IRUA 3TDNA 1VRCA 1N2CB 2VDUE 2WUWE 4ZVUA 4ZT5A 4YMTA 2Z5FA 4U7FA 4AXBA 4CFYA 3O21A 2FV8A 1KEVA 1OTXA 4LWPA 1YZKA 1I3CA 1UPXA 1YQ9A 3AUFA 3R0JA 4J91A 4NHEA 4PW0A 4QBGB 3W8RA 2ONKA 5MDHA 1BE1A 1O95C 3ISTA 3PNMA 5AUPB 3PEVA 1TEZA 2P4EA 1S2NA 5LP6F 1DPGA 2PN1A 1SXHA 1L7RA 3B3QA 4O2BB 4OXRA 4E1BA 2CUTA 1T2UA 4LDQA 3S8MA 4H1TA 4REQB 4B7UA 2C88A 2MCFA 1ZUNA 3Q2KA 4JKOA 4WNYA 4EFNA 5KJCA 1BHSA 1GGHA 3EGWA 3H2HA 4OLAA 4JAVC 1SZPA 3BGSA 2D3TA 2XEXA 4Q1DA 4Z7OB 5J43A 2PUTA 1UK7A 1TM4E 1WOYA 3PC2A 1EFVA 1NMXA 2YY5A 4BNJA 3AHEA 3EDYA 1AZWA 2EF1A 1YBFA 2VT6A 2QN6A 3OCZA 1A9SA 4UVHA 1E3SA 3DNPA 4Z5XA 3ICWA 1Z6TA 4XQ9A 1KU6A 1RC0A 5I6DA 4RVDA 4TX1A 1EUZA 4FWIB 2PCJA 2B98A 2E2WA 1GA1A 4J0KA 4LVUA 2F59A 3NC0C 5DHQA 2VPXA 4AY2A 3QBTA 1M7GA 2PV0A 4QUHA 2HLNA 3HDHA 2K5UA 2OR3A 3BJIC 4MUIA 1O77A 2NVWA 1G8KA 5D51S 3R77A 1Z63A 1E4OA 1DRKA 3VKHA 2WJ3A 3PUHA 2IDKA 1HWYA 1CUUA 2PCLA 4AUKA 2B37A 2PLRA 4AWAA 1WD5A 1ZW1A 3E23A 1Q0ZA 4O4HB 3L9XA 3WK6A 3D1VA 3GZNB 3I9V1 4FR0A 3W2FA 1HNNA 1P1FA 4PR3A 3KVRA 3SQXA 2SCUB 1Y9AA 1ZJ5A 5K09A 1U2SA 4D5GA 5CM9C 5DNCA 5DNYB 4A26A 3HYSA 4ZYVA 4RY8A 1P1KA 4QDJA 5E3IA 1JIJA 1F2UA 3FXAA 4IH9A 2FPSA 4B85A 1U3CA 4K9DA 3X0DA 4BNWA 2ASVA 5FI0B 4ZXFA 3V2UA 1MVNA 3V9PA 1A2BA 1GYRA 1XYGA 2J9FA 4PSKA 2P6UA 1JIQA 3CH5A 3ANYB 5FBHA 4LRYA 3ES9A 4C3UA 4BU1A 2QPOA 4ABTA 1HDYA 1UMDB 4DLVA 1JLRA 1LBSA 2ZZNA 1VJTA 1KAQA 3GR6A 2B5VA 3GOQA 1N5RA 3T3OA 1W88A 3GFGA 3RODA 3AXSA 4URYR 2WFAA 2NQ8A 5CVDA 1KR5A 4N5IX 4ZVLA 4O8ZA 3FKJA 3H9BA 1J25A 2P6PA 2PX4A 1JZTA 3W6UA 1P5HA 1SUCA 2OQRA 4HQ0A 3W8NA 5CDFE 5JXJA 3NHRA 2LDXA 3PD0A 2QNRA 3MMXA 4GOKA 1J9ZA 5AI4A 3SOZA 4GF5A 1WXXA 4FYWA 4NULA 1HMYA 1US8A 2CXUA 4TYQA 1H4QA 3FYTA 3NBKA 5F4ZA 1WXFA 1AXGA 4Q34A 3WLHA 2IH2A 3LK7A 2PTGA 1C3OA 2ZRHA 4MGIR 1PYOA 4HI0E 521PA 1MH9A 2C92A 3AU9A 3FNEA 4B31A 1DT3A 1E4VA 3H8VA 3LHFA 1MAAA 2EFGA 4UUAA 3U5TA 3KTDA 2FGKA 4AL4A 3ZWYA 5L95A 1LBHA 4OBWA 1QQBA 3EWAA 3FVRA 1BNCA 2J8ZA 2PX3A 5SV2A 4F2DA 4LYHA 1MBZA 1FQKA 2XXJA 3S7TA 4YMIA 3ZS8A 1RQGA 5JCOA 3GL9A 1ZGZA 2PUDA 4IOMA 4WNAA 3WX0A 3LYUA 3GB9A 3PNYA 2Y67A 1GO2A 3L7OA 3F6SA 1GXSA 2H2AA 3IQIX 3OQIB 1DDIA 1YI1A 2QD3A 4K9LA 4XPZA 2P2GA 3WMRA 2IZ7A 1Z83A 1HX7A 4O4LF 3EXHA 1XZBA 3IQGX 1NW4A 3O47A 3RUEA 4DMKA 3LPLA 2C1ZA 2VT7A 1Z22A 1J8VA 4RTJA 1PR5A 3E9YA 3J81k 2ZB7A 3O4FA 4Q6BA 1SXJA 5KVAA 4JLKA 4CETA 1M76A 1XB2A 1JYFA 2M98A 3WYAA 2HMUA 3AY6A 1NBWB 3VPSA 2ZULA 4C7KA 1JTFA 2CWDA 3AU8A 1TL7C 1ATIA 4CQMB 3GGOA 4HXGA 4YMVA 3ELUA 1RZ3A 1T9GS 4LBVA 3O9VA 2KM1A 2HSDA 2NADA 1SRRA 4I5DA 4QKQA 5LWHA 2D74A 3TK1A 5FUBA 4NVRA 1PVVA 1WZUA 3KLBA 4J1TA 1X9HA 1JG3A 2D62A 1QLJA 5B1IA 3VJLA 4AF6A 3PXUA 1U7WA 3KUXA 5KPDA 5KQLA 1WSWA 3HUDA 5G4LA 1OAKA 1U6KA 2YRWA 4QULA 1PWYE 1ZMOA 2EFYA 4MR7A 2ZSBA 1CUDA 1ZCBA 2I4IA 2JFHA 1LS6A 2R6GA 1UT6A 2DC1A 1TU0A 3OLVA 1B3BA 4Y2TA 3TTWA 4D3DA 2G1AA 3I2JA 2Q27A 1ZIOA 4IOKA 3W5AA 1PGNA 1H4TA 4FMDB 2CD7A 5BMVB 5JIBA 2P2LA 1WUHS 4D9MA 4K6HA 1ULTA 2GUWA 3NWEA 4LNAA 1QO7A 1YKFA 1X38A 3EODA 3V9AA 3FW1A 4QQKA 1OX4B 2CJXA 1C7QA 3QMMA 3ADCA 2BKLA 3NOVA 1IBRA 1HSZA 3GYGA 5DTMA 1EVQA 1IL0A 4BMPB 2MINA 1RQLA 4GL4A 3HI6A 4EW6A 1G4AE 3QWAA 1SHZA 3AJEA 5CFOA 1PV1A 2Q0SA 4PINA 1XG5A 1DKQA 4DIBA 3ORRA 4DIUA 2YL2A 1GTZA 3LVRE 3T54A 1B8VA 3EIXA 1VBMA 3WIOA 5AVYA 3U61B 1T25A 3RVOA 3PTAA 1AQYA 1PR3A 5EJ6A 3TR6A 3WWDA 2PUFA 4TKMA 5JC8A 4H0CA 1T9ZA 4YEDA 3RI3A 3T9BA 2YJZA 3FYUC 4L6AA 1CK4A 4LDRA 1SOAA 2PVSA 4NX2A 4Q03A 3TDMA 1MJGM 3VMFA 2ZWMA 4ZZ2A 2BAGA 2SKEA 4EZIA 3OKAA 1FQJA 3M6UA 1QHSA 3LG2A 2PMDA 3WOVA 4CTNA 4UCWA 1WU8A 1I24A 2P4HX 3GVCA 4FNOA 1U28A 4ZANA 3LOUA 1CHDA 2VVTA 4NZZA 1L5RA 2HLPA 4PHFA 3DAHA 5T41A 1Z36A 4NL4H 3X3HA 3OAAD 3REQA 5J2TA 4CM8B 1M8JA 1JSLA 2WHPA 3DUFB 1ZM9A 4UASA 4L02A 5EE0A 3ESBA 1MR3F 5A7FA 2YHUA 3CM0A 4HGZA 4D0GA 2ZIEA 2ZP1A 4KSCA 3U62A 4R8KA 3A0UA 3HH8A 1RZRD 1KZ1A 3LL7A 2EHJA 3AUSA 1R1DA 3MJVA 3OU6A 4JN6B 5EQTA 4ZCPA 4EYGA 5BR1A 3HGMA 4GKAA 1HF3A 4E31A 3I72A 1T36B 1B76A 1EFVB 1JMKC 4UVDA 1QHEA 1YFLA 2VJKA 3SCZA 2JW5A 3SDZA 4CG1A 3D4PA 3JD4A 4WD3A 5ELMA 1K6MA 2YMMA 2XWSA 3ASUA 3FYUA 2AV6A 4QSMA 3A31A 1QG4A 1SUFA 2ZU6A 3M1LA 2O6LA 4DV7B 4X45A 3W2EA 1CW2B 4D6YA 3C8DA 4DY4A 1UBMS 3LNTA 4W9NA 4E1AA 4WXHA 3NJRA 2VOEA 2MSWA 1HFWA 4HATA 2HZ7A 1TC1A 2W6ZA 2JBAB 1GD1O 3OPYA 4JU9A 1C4KA 2H17A 5ALEA 1KEKA 3TXAA 2N1BA 4KO1S 4EL5A 5JJLA 1A8HA 1DC3A 2A0UA 1TQ4A 2DQ4A 5C5IA 1V16B 3RRBA 1JUDA 2BELA 3QMWA 3SP1A 2ECOA 3H1GA 1ZVKA 2JJ1D 2GNPA 2XVZA 5E8RA 2H5EA 2JFPA 4OQ4A 5H02A 4WVLA 4RCVA 4KRFA 1JR6A 4X5OA 3ZV6A 3NORA 4LPKA 3B20A 4FT2A 1JKFA 1NVEA 4TT8A 4Y2UA 5EJMA 4EA9A 2GVNA 5BSGA 1CUFA 5H1YA 1ISGA 4F1JA 1IN8A 1HR0B 4QM6A 3R5XA 3VV2A 3USCS 4EB3A 1FTWA 4IJQA 3PKIA 3I6BA 1X1SA 3MINA 4R1LA 3OQPA 2O8FA 2FEOA 1HNWB 3LT1A 1NV9A 1SK8A 1Z5PA 5EWLA 4PU0A 3WLAA 3RIGA 4NK5A 1RPJA 1BAPA 2B4YA 4WJLA 1LNSA 4NXMB 1RKXA 4ASUD 1VI6A 1ZWKA 1EP3B 4KODA 3LBAA 3NHKA 4YPOA 4UHBA 1XQVA 2A1TS 4URHA 1ZRMA 2GERA 4KI0A 4IUCS 1OE0A 3QOXA 3VMMA 2Q3BA 2M1XA 2GM3A 4L72A 4ZRDA 1H6DA 3FMOB 5EJ5A 5DBGA 3CYFA 4CF6A 5IUNC 1OAOA 2Y2UA 3JQEA 2JLVA 2Q4TA 2QPTA 4NSNA 4XUCA 4R9NA 3MMPA 2PNFA 1RE1A 5KQSA 2XB2A 2ZPTX 1TMYA 3I76A 3CZAA 4MH0R 1Y1LA 4P4TA 1GPBA 4P84A 4RTPA 3PE4A 3UWSA 1US8B 3GNLA 4N65A 3UWPA 3H1PA 2XA1A 1E2FA 3PJGA 1Q50A 1QFZA 2WTEA 5JROA 2JK1A 3THYB 2UZ0A 4CKBB 4MP3A 2HDHA 2Q1SA 1TCUA 4Q37A 5E0KB 1YU6A 3FLMA 4YRIA 1QU3A 1ZI9A 4HDQB 4OLFA 5HMMA 5TS2A 1Z45A 1WDWB 2CCKA 4BFTA 3OQMA 1JQAA 4WQMA 2RMKA 4A1OA 3MT0A 1TM3E 3GAMA 2VP6A 1S8NA 3P0IA 2YIVX 7MDHA 2HQSA 1OH5A 4H6PA 3OETA 2VYQA 4C22A 3BTSA 5C3MA 3C4JA 3ZBQA 1O4VA 2WF7A 4PC6A 3GLIB 2FSVA 4ZCSA 3VJRA 1V96A 3EVFA 2QVZX 4KTTE 2X6QA 1JU9A 4G25A 3KSUA 2F4NA 3GMIA 2OXEA 5DTQA 5EEGA 1FTSA 2IYOA 1EQUA 2JL1A 2UYQA 3FFTA 4EUSA 4KUHA 1BOOA 4Y7DA 5GJBA 4FDAA 1BGXT 1TLTA 2QUZA 2YV2A 3N2GB 4L3OA 4B46A 4C0XA 4CWAA 3I12A 1TTTA 4COOA 2FMTA 3LVFO 1URPA 1ADFA 2QTVB 2WPDD 4QHSA 2D5CA 3D6JA 4D4HA 3CJTA 5E4TA 4ARZA 2B0JA 3DZHA 2EKDA 1KP2A 4J3JA 2G9QA 1LB1B 2ZYTX 3TRJA 3ECAA 2FEKA 4QC2A 2IWRA 4UQLA 1RADA 3ODPA 1DKUA 1ZNWA 2GFHA 3OT1B 4UUBA 2QRVB 1CP3A 4FLMA 4RX1A 2AZ4A 4PLVA 3ZEAA 2C4TA 1G6KA 3DDHA 2CUZA 1M34A 2C00A 4UU7A 1S2IA 2H65A 4A6EA 4Z51A 2QTFA 4NCNA 1V8PA 2WMOB 3IILA 4ZOBA 4J3NA 4ERXA 1UJ6A 1R3DA 3DVAA 3ETLA 3OE5A 2H2GA 2GD1O 4RGVA 1D6NA 4YY3B 1M2OA 4QNMA 2CVFA 3HI4A 4M3NA 1RJGA 5DI9A 1WG8A 1YVEI 2GN8A 3DMTC 5JATA 3TZ6A 4D4JA 1A77A 1QHXA 4DR3B 3BXZA 4YS6A 2QD5A 4XDZA 2RHGB 1TO2E 4ES6A 4IDFA 3D0QA 2M6RA 4DXAA 2CL0X 3ZZTA 2WABA 3MCVA 3ZY5A 3HBMA 2OPHA 1IZZA 3LSTA 1CPYA 2VAWA 2XDYA 3MJSA 1FYXA 3QKRB 4Q3LA 3LDGA 2NO9A 1BU8A 2K4MA 4ZGBA 8ADHA 1ESEA 1TK3A 2DBZA 3B1ZA 4Q24A 3AHCA 3SJCA 1U81A 5JHHB 2WB4A 2JASA 1KBZA 3TCNA 3T3GA 4KOEC 4Q7EA 3AUJB 2EW2A 1Y7LA 3KDAA 1U3FA 2FEWB 2MINB 4NMMA 1TIPA 4C88A 3OI7A 3G9ZA 4LV6A 1DUVG 1NN3A 2PXXA 2IHVA 3EVGA 2A5LA 3PDJA 2G70A 3O8NA 2R68A 3LWBA 5JCXA 5JY6A 1FRVA 2V4UA 4IUDS 3OUUA 5BVGB 1OKKD 1XAJA 1CXZA 2BEVB 2XHZA 3AM5A 4L51A 5ENZA 5KCMA 4NMLA 4OQLA 4IV5A 3S1LA 5FAXA 3UJHA 4U7GA 4AMYA 4R9SA 4IMPA 1FP2A 4TTJA 1NVUQ 1R5JA 5LZ7A 1KK0A 2XE7A 3C7CB 3GNQA 1VKHA 2YYYA 5E7QA 5EJAA 2A9JA 3MJTA 1XRQA 4KQ1A 2ZYAA 3CWQA 3H17A 2IHTA 2PIDA 3ETJA 3SYNA 2RCNA 1VPLA 1VB5A 4NZ9A 4Q1AA 3ROKA 5E8JA 4JXZA 4LDAA 1P3Y1 1QR2A 2H7VA 4X93A 3R7DA 1JBQA 3CU5A 4Q4JB 1RXUA 1COWD 3MERA 1HT2E 2JDIA 3A1DA 4RZXA 3K92A 5CT8A 1YTUA 2DR2A 1L7VC 5J2TB 2QTGA 3KR0A 2RG7A 3T7SA 4GW3A 5TV2A 4YYEA 1IUOA 4WKNA 1NVTA 4TV8F 3B6ZA 3LZDA 4N03A 4WIAA 2E4YA 1COZA 2J0QA 2PSHA 4IHJB 5B3JA 4ZZ3A 2BMDA 3WLIA 3IAFA 2FF5A 1UOOA 3ANTA 3NNSA 4FZ5A 2DU8A 5B3KA 2FDXA 1CEQA 1B8OA 3MAJA 4IRMA 4CKCA 3PUJA 4EGFA 3INRA 1MTOA 4OPMA 4NH0A 2HIMA 4Z2YA 4I1PA 3PEFA 3V8EA 3AESA 2IYUA 5AKJA 4CEIA 2G40A 1ADBA 2QD1A 2DJIA 1XEWX 3EXEB 3LDUA 3MIIA 2OCBA 3ONNA 2CBGA 4C3ZA 4AKIA 1JLHA 1FFYA 3C5CA 2W4IA 4GGOA 4TWIA 3PV0A 1OGIA 2NVUA 5I9LA 2WILA 1XQ9A 2D4AA 3ST7A 2RGBA 2HJWA 1YTLA 1UK6A 5M04A 4UD2A 3WSVA 1XEAA 2BFNA 2HT6A 4W63A 3TLAA 1NBMD 4AMUA 5BQ3A 5E6UA 2JAPA 1N2BA 3SSAA 3LXUX 1NW7A 2ZJZA 3B78A 4TLDA 3TNFA 4AU1A 2BDUA 1WULS 5BNTA 3V2GA 5TS3A 3BL8A 1Z0JA 5ER6A 3KM0A 1L5MA 2YY6A 3KQMA 3LUJA 3MTDA 2ANBA 2H51A 1W1UA 3G2HA 1QO9A 2ZR8A 4MP6A 3KYCB 4KN5A 5GGXA 2R96A 2QRHA 4QGBA 2CXXA 4G0XA 2WIBA 1Y3HA 3P0RA 5TX7A 3FNFA 4LF8B 3F5MA 4Q18A 2YWXA 2M32A 3BB4A 1BXKA 3BHNA 3LPCA 1F7VA 1KK3A 4D42A 2ZK7A 1G38A 2Q45A 2WYOA 2C4WA 1NN1A 2GPJA 5LQCA 3W9SA 4GKVA 4IOLA 2HYIC 2FZEA 1QKJA 3BWDD 1SIWA 1CJKC 2WIDA 2X3UA 1APBA 3SICE 4P9NA 1PYDA 2CLDX 4RL4A 2F9FA 1V7PC 3TQQA 4BO4A 2ZB3A 1J1UA 3NC4A 3AEYA 4AMZA 4X20B 1OV4A 3E9EA 3T3MB 4BASA 1BA2A 1F20A 1KQPA 2C4NA 1I9GA 1N6PA 4PSVA 5IX8A 2BF4A 4Y2JA 4EA7A 5L3QB 1J2TA 1NJ8A 3T0IA 1KTVA 1POWA 5FOXA 2FZWA 2EERA 2X76A 3CR8A 3FCEA 1V3TA 2JVKA 3I5MA 5B1EA 5AW4A 1AN0A 2GKOA 2RHHA 3N7TA 2FVXA 3PEWA 3WGMA 2F67A 1UDWA 2BZSA 3WIEA 3OTGA 3FTFA 5JXIA 1G17A 1Z6YA 2GCGA 1Q0PA 2AZMA 4NECA 4N41A 4RV9A 3I8OA 2QQGA 2CHFA 1J00A 1D09A 2NOAA 2C77A 1P8AA 2WVGA 3QVLA 1RHRA 2IUEA 3NALA 1XJ5A 3AEQB 1Z2OX 1A4RA 5KNDD 3VUEA 1I1NA 2DPHA 5M2QA 5EUMA 3L79A 2O9JA 5AOBA 1IMJA 5FPPA 3BGDA 1KYVA 3OZIA 1GV1A 2NV0A 1Q7GA 2QU7A 5BSUA 2VSXA 3PHIA 3DP9A 4R05A 4FYMA 1RPTA 1WXQA 1VKJA 1DBIA 5K99A 2RBGA 3NTOA 3WBJA 1IMOA 1QYVA 4RKEA 1ZQ9A 1YE5A 1JP7A 3DFMA 5AVXA 4MEAA 3F4BA 4A0SA 4EHHA 5M29A 3LL4A 4E5SA 1G18A 1R9JA 4ZO8A 2QTNA 3OT1A 4CMGA 3B6EA 1R7RA 3LBIA 3CRZA 2DLCX 2GCIA 2H0RA 2LCQA 4BNNA 3OZEA 2JNWA 3P8ZA 5LN1A 1C50A 1LVGA 2XQGA 4ISBA 1E9SA 3ZK9A 5DGIA 2FZ5A 1M72A 4ER5A 3ESZA 2R1TB 3RYTC 4WEOA 1PT7A 2AOVA 2GZMA 1O97D 5AUNB 5L7WA 2ZBVA 1LC0A 4J2OA 3RFFA 5KX5B 2A88A 5ALKA 3HV2A 1I4DD 2R5NA 1BD4A 2QMQA 3B53X 1AN9A 1SB9A 1VYTA 2QM7A 4JJFA 4OGLA 1L5VA 1QUFA 3PFBA 1RVV1 1R0RE 4CXMA 4BTEA 2CVPA 2VPQA 2W2XA 4LVOA 4MV5A 4IIYA 1IUKA 1B73A 1TTQB 1DBRA 3HJRA 5HF5A 4CIVA 4UNIA 4FFMA 3L0YA 1FZQA 1AF7A 3QKSA 4J16A 1W9HA 4EJMA 2INGX 3DBIA 4J76A 5FL7A 2FG7C 1IOLA 4J43A 4O6VA 3L5OA 3KQOA 4LY3A 3K16A 5FULA 3UTCA 5HX7A 3HUTA 5DBEX 1DC7A 3IIIA 4YYZA 3F0TA 1Z7BA 1IY9A 2QAGA 4FJ2A 4IZOA 4QA9A 3SE7A 5JJKA 2E48A 3T94A 4RVFA 2D8MA 3TPCA 3IO3A 3KK0A 1YJBA 2WP0A 4KBFA 4OM7A 3VBEA 3W6NA 2VQ6A 3ZN2A 2O8EB 3FBGA 3JRWA 1FFSA 1U7PA 1E4EA 1M83A 3F46A 3NHJA 3P26A 1T5OA 1SPXA 4NENB 4RXTA 1JJ7A 5D3MB 3R7LA 1G2PA 2IP2A 1HQDA 2R84A 3GO4A 4LECA 5CVVA 1VMIA 3PFGA 1A8PA 1U1CA 4PHCA 1RP7A 5J63A 4HAYA 1U63A 2IXGA 3C8HA 3HWRA 3RF6A 4KMMA 5LD2B 1KR2A 1DRUA 4MGKR 3RC1A 4IBOA 3U16A 5C8YF 4TZTA 3DE3X 4HEJA 3HWWA 3W3AD 4CQMD 4DMHA 3ZU2A 3FPSA 1V1RB 4OX9Y 3M5CA 4GU5A 3PRHA 5IDVA 3A6PC 1SBNE 2EW8A 2QZZA 5CCBA 2WG2A 3UC9A 2FPOA 1TTHA 4YJGB 5KNLA 3PWSA 3EISA 4M4SA 2IOFA 1J8DA 3O7WA 5LSAA 2Z5GA 2XRZA 2R6R1 3CCBA 1E0JA 2OXRA 3QLUC 2OO5C 3H1BA 1MC4A 1K7YA 3TE6A 4G5OA 4LE2A 3FPKA 3QYJA 1GGMA 1DIOB 4P2GA 1WJGA 2GILA 1HE1C 5DVZA 3IDQA 3LY7A 3R6WA 5EYPA 1EGQA 1P2BA 2XHEA 3GNTA 4GPTA 3JQAA 5LP1A 1L3CA 3ESAA 3X1XA 1UK8A 1T9BA 3CSSA 5BV7A 1K7CA 2JIOA 1WPXA 4LQ4A 3LTNC 3K9HA 5TQ0A 1OD6A 3NPMA 1E1DA 3AQ4A 3VO9A 2JGIA 2PT9A 4JLAA 2NU8A 5KTTA 3PPYA 4NBTA 4BRZA 4P38A 5JWOA 1LTKA 2JVJA 3M5DA 4OFBA 1N0UA 2L18A 3PXBA 4E11A 1X3LA 3QU9A 4WFKA 2I1WA 3H1AA 5CAEA 2ZCVA 3HMKA 3HXTA 1ULHA 1DLIA 4EYSA 2FFBA 1KY4A 3MQFA 2AEEA 3QXHA 3U7HB 2WYVA 1Z6QA 2NZUG 1MW9X 4DLNA 4DUZB 1A7JA 1EJ6A 2JCVA 2RIPA 4ROSA 3WBFA 4AK9A 3D7NA 5C52B 1QBKC 4BB9A 2HRBA 1JFFA 5IK2D 4P7GA 2KJQA 1RLOA 2ETXA 2OLJA 3NQ41 4FB5A 1FK8A 1W0CA 3NYWA 5AKEA 4PX5A 1GZVA 2WE7A 4WOKA 3BXOA 5EP3A 3PJDA 1QH1B 4QX6A 1I01A 4YRKA 3GVPA 4Z9AA 5C1IA 5EIBD 2CNNA 2QT0A 1NMSA 3CIFA 3D6AA 3MSCA 3EGXB 4DIDA 4DLWA 1H2XA 3BD7A 3JZFA 4UOEA 1SCUA 5JQGB 4Z4QA 4X63A 1AIPA 4CIDA 1L4MA 4OL9A 4DVGA 4F4JA 3UV3A 3MWEB 2HREA 4JP1A 1EA7A 5CFZA 5AK5A 5GIPE 4RM2A 5A6VA 2FP4B 4HYQA 4M1ZA 4CYMA 3BJZA 1IXYA 4BUJA 1VP3A 3CVXA 5C1DA 4MUYA 1TF2A 2YDXA 2WTUA 1ZGJA 3D7LA 1QGDA 3CWZA 3T99A 1XN1A 3ACCA 1OJLA 1SUPA 2DLDA 3I1FA 3SIWA 4DCOA 3MTQA 1G3IA 1GLGA 3DOOA 3ONDA 1UPFA 3JATA 4DS3A 1GRQA 3OOSA 4GX1A 1J90A 3WB1A 1Q20A 2C20A 5KOJA 1B23P 4P3KA 1Y89A 1B0PA 3PE3A 3A04A 3WRYC 3W4JA 4REMA 3DNFA 3EA0A 3UMVA 2PH5A 1P4RA 2GEKA 4LK2A 4B5LA 2W5UA 5B4VA 1OYWA 1DAIA 4RGQA 2UZAA 2HRCA 1K1EA 1P4HA 5CB8A 3MNFA 2OV6A 3CLKA 1YZQA 3AF2A 4GR5A 1FCJA 4I6EA 1YMVA 1SOUA 4CCSA 2IU3A 3EK2A 3LQ2A 1UXIA 1XPJA 1WMDA 4QU0A 4XYEA 4BECA 4KZKA 2CXSA 4AYWA 2IY8A 2JJ2A 1R4NA 3JQ7B 4E6PA 2V0CA 1G0NA 3JZDA 3LQYA 2ACKA 1FMTA 4F4UA 4YACA 4P80A 3LOPA 3DEKA 4X64B 4MGYR 1U3GA 3PG5A 3R9IA 4BQSA 4F85A 1L4NA 1IG3A 5C8XA 4O33A 1T5IA 1MB3A 4UD6A 2QTRA 1B1AA 3DUWA 4BE7B 2C9BA 2JG3A 1N32B 4WNIA 3UENA 5H70A 2C5SA 1C7FA 5LQSA 1SCDA 5BN5B 4AI6A 1BE0A 4JQYA 1IJKA 3ND7A 2WJIA 4IKPA 5KO2A 3KG2A 2Z43A 3FD8A 3E48A 1EBBA 3PCRB 2FU5C 1C0LA 1O2DA 1ZMBA 5AKIA 4B6JA 5E7MA 4ALMA 2VDMB 1CEEA 1G5PA 3HKCA 3I23A 3HP7A 5B58C 1N8SA 4NMHA 3U26A 2AJLI 3I45A 4M1OA 1JDBC 1FUYB 1P39A 2OBYA 2CVOA 3AT1A 4EMUA 4MEBA 1NSFA 2CJYA 2CDRA 4XTCS 4V1CB 1CJVC 1QYWA 3QVKA 4O2RA 4XQEA 3WK9A 4GMGA 3ABOB 3OO1A 2B5WA 2VRNA 4HMOA 4J90A 2B1QA 2BEWB 4KJXA 4Q15A 2KLHA 1T6BY 2IOQA 3AZPA 4J4TA 5LUBA 2YQ5A 2ZIVB 3N0XA 4IX9A 4S0ZA 3FCXA 5JT1A 3JYPA 2CZQA 5FUQA 2PSEA 5KYYA 4F93B 2GF0A 3AOEA 2LUOA 4TL8A 5DASA 1A3CA 3KWLA 5FUXA 4BJ3A 5I9NA 2XZOA 2X3YA 3L5KA 1VLQA 1OAOC 1Z7YA 2X5NA 4H1WA 5ADHA 3T3IA 2AXNA 4I1IA 2Z1DA 2HU2A 4Y6OA 3ND8A 5K3SA 4PYQA 3SHTA 4CHGA 5KINB 2RJ3A 2HEIA 5FBKA 1YCGA 5BO5A 5I47A 2QLMA 3VX3A 4AY3A 3HYRA 2LE0A 1F12A 1RQRA 3TEFA 3CNLA 1S3SA 3LHIA 4OHCA 4WGFA 5EE1A 4MRSA 2PO5A 4AKSA 2C1EA 4DL9A 3EZ2A 1P4AA 2WYHA 3S81A 3PFWO 3QVSA 3KTFA 4XVQA 3U7RA 4BMCA 5DWDA 4AURA 2C31A 1U2GC 4E2XA 3OX1A 1GAEO 2WAYA 4DLKA 2QSYA 4EG6A 2NZYA 1E64A 3F5SA 5IKPA 4E1VA 2B1IA 4G2NA 4M21A 1II8A 1OZAA 1VC2A 5HHTA 3IIEA 4JGGA 2IU0A 3RHFA 1SXPA 1PR1A 2J3MA 2H2FA 4OHOA 1CLEA 4MW0A 1KEPA 4LDZA 3LC1O 3KQUA 2IH4A 3HL0A 2ZJOA 1FX0A 2C83A 3TLJA 1CULC 1GWNA 2H00A 2GLXA 2PRKA 2A30A 3LU1A 5CH3A 3ZIDA 4E5MA 1ECFA 1GA4A 1YDHA 2GAFA 2GVDC 1G7CA 3DC7A 1Q6ZA 5JANA 2PD3A 3EGCA 3DONA 4FLEA 1N77A 1V1RA 2WG0A 3IEUA 4TTTS 3QJYA 1AA9A 1YJXA 1CV2A 1IN4A 1DJLA 3MJFA 2VHTA 1DKMA 3H42B 4L5IA 3TUZC 2B61A 1IWBB 2ZUSA 3S8EA 5BSMA 5ALRA 3PTZA 2O0KA 3CTMA 2C4KA 1RKBA 3HLKA 2XB4A 4KN6A 3JQ6A 4W8OA 5I7AA 3ROQA 2EYUA 1OFVA 2Z6VA 2FPWA 3JWGA 1JEEA 1ABFA 3GLQA 3SWWA 1VJ5A 4AJOA 5AVVA 2XD4A 3DE5X 4ENRA 3HJUA 5EIBC 3ROEA 3GEEA 3WKCA 3WYNA 1KY2A 2LIVA 4TOIA 4KIFA 4PO9A 3URKA 3PLRA 4GDFA 3UVEA 2YFQA 4BRUA 1CIJA 1BQEA 1HYGA 4DE5A 3BSYA 3GV0A 3BFJA 4TSFA 2FJPA 2GSWA 4KUGA 3G82C 5T6MA 1MX5A 1L8AA 1QIHA 1ZITA 2PBFA 3B5EA 3DVRX 3FPCA 2D0PB 4RKQA 5AXCA 3TBFA 2PGNA 1VJCA 4LC9A 1N92A 2H9YA 3MD9A 4Z2AA 4J7CA 2VPPA 3Q41A 5K0EA 2HADA 3GJ0A 1WPGA 4E30A 1ZL2A 3N8IA 2VRCD 1MQSA 3BWEA 1Z0AA 2O48X 4GI2A 2VJCA 4CV1A 5DLDA 4ZU6X 3USES 3DA8A 4TUYB 5FBZA 4LA4A 2VLIA 2BWJA 2DPLA 4RJJA 1PNOA 3PEUA 4K40A 1PG2A 1HEYA 1JJAA 3A1VA 2R8YA 2ATCA 2HCRA 3GZNA 3KR9A 5AW5A 5KYUB 1T8WA 1MKYA 3DPUA 4IDPA 4LCEA 4XAQA 4Z4HA 5CW1A 1CR0A 1SULA 1MXHA 3K0CC 4KO8A 4B4WA 2PZGA 4UUPA 5IKOA 4XD7D 1E92A 1BCRA 1X7XA 2JGFA 4ZDWA 3V4ZA 4O2AA 4AN1A 4DBLC 1GTRA 3A1WA 2IS4A 3F4KA 3K0FA 4L50A 3SHVA 4EZBA 4FN4A 4M60A 621PA 1F9AA 4KXFB 1KVRA 2B1RA 4BO8A 3M34A 4AMVA 4LJ8A 3T3NA 3THRA 4FBMA 4FDMA 1U0BB 2HSEA 4MP8A 4D41A 4D9EA 3W06A 3QX9A 3TLXA 2PA3A 1KSJA 1JDNA 1SXJD 3HMQA 3NR2A 1MP0A 4FNAA 3OC0A 4MQUA 1W88B 2YJ6A 2DZDA 1JKJB 3E2PA 3H84A 3T5BA 2PPVA 2EG9A 4G23A 1SZCA 1HG0A 3DCIA 4HP8A 4FHCA 4MW7A 1U0RA 2I55A 5U4QA 4XZ3A 3UPTA 1WZEA 2HHCA 2KLBA 1GILA 4UULA 3ZDYB 4IIUA 2F3SA 3LF2A 4N54A 4R16A 1QGZA 4ZFNA 4EJ6A 2AI2A 5DHRA 4IQ0A 2WKPA 1T3TA 3FNIA 1W4AA 3BOSA 1NT2A 2BE9A 3F6PA 4TZKA 5AOAA 3M1IA 3V4RA 4CEJB 4QXRA 5B64A 3JV7A 4MS4A 1S2OA 1YB6A 4DA4A 1M8KA 3TB6A 3DDOA 1DJQA 2ZAIA 3IVXA 1W8IA 1CUHA 3OPMA 2IBSA 4JA0A 2XA2A 1VLHA 4FHZA 4H31A 2PAAA 3ANXA 1YJCA 5A9TA 3VHRA 4Y1FA 4EUFA 4ZV7A 1QE3A 4ZREA 4F5EA 5C8ZA 4QPDA 5IDYA 2I6UA 3LT5A 3QMVA 4EHLA 1LI4A 1O0SA 4KFRA 4BB6A 4EVIA 2PZMA 2GEVA 1SEVA 3O2QB 2WM3A 3BKWA 5TEWA 4DLBA 4UUQA 2OQVA 4EY6A 1HE3A 3HL4A 4XQCA 4O63O 1U8EA 1D0SA 3NTLA 3MS7A 1I3OA 1VIMA 3QP9A 4FFNA 3N8HA 2FPRA 3GA7A 2B4AA 3M5PA 4RKWA 5H83A 3AGPA 5J58A 1GAWA 5L6MB 4YMWA 2FX3A 4KCGA 5ALLA 1PT6A 3U0VA 4N5HX 2OFXA 1I3KA 3OQHA 4DJJA 5BN5A 4CLDA 2BCJQ 1JRLA 1YZ3A 2XQVA 2ASEA 2BM9A 3K73O 3O6VA 4NQZA 3IYLW 4PLWA 4BBJA 1QU2A 3WFIA 1E2JA 5KEIA 2CLIB 4FBGA 6NULA 4GIBA 1PEKE 2H4JA 1UWCA 3I01M 1TVCA 1UQTA 2FSHA 1ECJA 2VJBA 3BXFA 3LBHA 4HAIA 5B3LA 1ZSNA 5THKA 1GQOA 2I33A 2OL4A 4AICA 2HMVA 1N0IA 1E69A 3OZBA 4NBUA 3UUFA 2YINC 4Y3UA 3ZXIA 1J2JA 2E18A 2ZS9A 4B76A 3CKYA 4RHFA 4HLCA 3HDVA 4RA6A 5TDHA 1E1QA 3C2QA 5BNFA 3JALA 5KYYB 3H4TA 4TMZA 2FI1A 4OJMX 3JAKA 2PQMA 3GEIA 1MO6A 1JPJA 3D0RA 4XX0B 1HH4A 4H7KA 1EHCA 3SMVA 1WHSB 4Q3AA 3KQSA 3PNBA 3W2HA 1ZEJA 4YRFA 1SBIA 3IHTA 4DTCA 4IL5A 1JGTA 1ZO8A 2JFZA 2YNMC 1HLFA 2LKDA 2OXCA 3G9XA 3Q87B 4G81A 4JSYA 4QOEA 1ODKA 5I9TA 3SZOA 5CIWA 2QQFA 4OGGA 3MVEA 4Y2SA 5IHPA 1IOWA 4LV5B 4J0JA 6ADHA 3OA0A 3WLOA 4BVLA 1NQOA 3H2JA 4RD0A 2FSSA 1Z74A 4CMEA 5AVTA 1RZRA 4LF9B 3MPOA 5EGSA 3U56A 3I5AA 3K2BA 3LM8A 3AL3A 4JENA 3K0SA 5JZSA 5LYJB 3COWA 5LPNA 1DBWA 3P45A 4CZ2A 5CBPB 2W2PA 3JWPA 1KI8A 4GPD1 1II8B 2DQZA 3MS2A 1AGPA 1EWYA 1A72A 1YB5A 4R3UC 4XVHA 3Q7QA 4GHWA 3U3XA 2G1PA 3U0BA 1GAXA 1WTCA 1OB2A 1Y4ZA 2QTCA 5DW3A 2QK4A 3D3WA 3WQHA 3PYMA 4RELA 2ZRJA 4N3AA 5FOVA 4AZ3A 1HY3A 1GG9A 2GI4A 4WLNA 3TYXA 4EVRA 3HJCA 3I9FA 1LGYA 3CN9A 3G2MA 1I1QB 1YBVA 3DTVA 5GJWC 3P9KA 4LHSA 4Q3OA 3TPFA 1QCCA 4GE3A 4INZA 4AZTA 2TRSB 4DM4A 1GITA 2WHXA 3V8VA 1Y3CE 3RQIA 5JJCA 5FO0A 2B0CA 4ZQBA 2I3AA 1K5PA 3VFDA 1RRCA 1JEOA 3UANA 4EUKA 3KQTA 2DHRA 4E4TA 5HNKA 2AD5A 3K8OE 3OUTA 1ENPA 1RW4A 3JQRA 4MKXA 4Q9KA 1BHQ1 1J07A 3G88A 3GJ5A 1Z47A 3DHNA 3M3HA 2VNIA 4MQBA 5A1TA 2JB9A 4FOOA 4L0QA 2JCXA 2Y2VA 3HYCA 4X1IA 4ZAXA 2IPNA 4L5JA 4X7RA 2A1IA 3ICQB 1QQTA 1TADA 2P40A 2PUEA 1ZVVA 1OLSB 1QF7A 2G06A 2JJYA 2EBWA 5T64A 3N5KA 3QJ5A 4B2LA 1GOTA 1Q16A 2GEBA 3BH6A 4KP7A 4DCMA 3BDAA 1J0AA 1G2OA 3SFZA 1IBKB 3RJZA 1W4ZA 1EZZA 4R1QA 2WAOA 1QTRA 1D5CA 3TUIC 4MDHA 4RC9A 1K0UA 2BGLA 3KL4A 4X3OA 4DAOA 5IANA 3ESXA 4PZEA 2YXDA 3IT0A 1A9ZA 2EJUA 3I73A 3JARA 3ICVA 2H18A 3HDYA 4R7TA 3K1ZA 4QUBA 1KDZA 2JJMA 1N6KA 3ZGNA 1XPOA 1OVGA 2IL1A 4IMIB 1PBTA 4S12A 3NBUA 4XVUA 4NYJR 3K1JA 5LQUA 1PWEA 2VT3A 2OBNA 4LE1A 3E5HA 1AUVA 1MB0A 1S0UA 2JFBA 1G8MA 1KQNA 6REQA 4O3MA 4TWBA 4UPDA 1R50A 1BDHA 4HDCA 3CC8A 2AZDA 5ITSA 3KOMA 3RSHA 3GCXA 5FT9A 1A50B 2V9PA 2ZS7A 5JVDA 3T5AA 1RYFA 5TMEA 1M8FA 1R0CA 3BG5A 4PAMA 1W85B 2WPDA 2L19A 1KK2A 1WDMA 2I03A 4PPNA 4QICA 5F64A 4ZAZA 4DNFA 1K4MA 3H3XA 5JNUA 1Z35A 4ZYXA 2HL6A 5EIEA 4HN9A 4Z4EA 3ONEA 1PT9A 3AWIA 4RK6A 4WZBE 5GONF 1XTRA 4ZICA 5JNLA 2GJ9A 1SCIA 4RSMA 5BQOA 4R68A 1EYZA 2H59A 4FGZA 1TK2A 2YNMA 1NONA 1Y98A 4RZSA 3QLTA 1U04A 2FH5B 1E7QA 4GXNA 4J0IA 2O2JA 4QLBA 1U0NA 1M9NA 4AJKA 5CCEA 1T0PA 4RVNA 3ETEA 1Q83A 3KCNA 1PZNA 4PCLA 4EP1A 1VE5A 2D1SA 1W5BA 4GEGA 2IYLD 4CUJA 3ER9A 3QLVA 2PT7A 3IEXA 3RR2A 2Z6AA 3JAMA 4BKPA 4DQUA 4HQ6A 2GYVA 3DEJA 4Q82A 1CNEA 2AK2A 2QUAA 3ACDA 1EMDA 1P9LA 3KKMA 5A0FA 1A82A 2GN4A 3G3EA 1T1IA 3L77A 3FHCB 1R74A 2C2KA 4YJHB 1LK0A 4AUNA 3TZKA 2XT9A 2IHJA 3HACA 4ZVPA 4G0UA 3NVKI 4EPYA 4R3NA 4FYJA 5EZYF 4M1MA 1UPUA 3ROZA 1L7XA 5CW2A 3D5TA 3IOCA 2W6OA 2ZYRA 4C4OA 4F2PA 1TRKA 3OPYB 3W3AH 4LXGA 1KGSA 5ENDA 2BFEA 4G5RA 3KQWA 1D9ZA 2P62A 4U2BA 2BFBA 5TPZA 4FC6A 1DADA 1V16A 1VTKA 3K5IA 3Q5DA 2EATA 1HRKA 3SXUB 1O6BA 3PKZA 1QGUB 1V7QA 1IEWA 1P5ZB 2B3DA 1HETA 4L4YA 3UPDA 4RYLA 3IJEB 2MDTA 3HVUA 2IIBA 3NBAA 3ZE2B 2I87A 4GT1A 5JS2A 3W90A 3TOXA 1EG7A 3AX6A 4NG4A 4P4SA 1E8DA 4XYLA 2R8BA 2XGGA 4LMBA 4AZ0B 3I53A 3IEPA 2GYWA 2JAWA 5K0NA 2O8FB 1SELA 3AF4A 2RGCA 4Q47A 4R9RA 3QKWA 4ZIRA 1T3SA 3WA7A 3TQOA 3VH1A 4KDFA 1HQYE 2EYQA 2YWJA 3PQFA 4HRXA 4NAVA 1VI5A 2PQ6A 2GT1A 4DPKA 5U1PA 3SKXA 3KAKA 4EB6A 1WD7A 4YALA 3CNBA 1KGDA 3JX9A 3H19A 4J8PA 4RHCA 2EFEB 2YJ3A 4PS1A 4US0R 4D99A 4R1SA 4E94A 1V8DA 2REBA 1RJDA 3CQ9A 3WS7A 2QUKA 3GJQA 4XLTA 2DXIA 3RU7A 3PX7A 3U17A 2QLLA 2CVHA 3KKZA 2BFDA 1ZNQO 2PUAA 2JI6A 1K7XB 3E2MA 1PO7A 1X3SA 3QPBA 3D81A 1UBGA 5ALPA 1NP6A 4UHKA 3HCBA 3ITNA 1MTZA 5AHXA 2GTPA 1CUSA 5K0LA 1F6DA 3E58A 3OFNA 3RUHA 1EP9A 1A8UA 1OC2A 1WEHA 2WT9A 4KGZA 3HCPA