2A33A

X-ray structure of a lysine decarboxylase-like protein from arabidopsis thaliana gene at2g37210
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
183
structure length
175
Chain Sequence
MQKSKFRRICVFCGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHVIGIIPKTLMVGEVRAVADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPTAREIIVSAPTAKELVKKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
publication title X-ray crystal structures of the conserved hypothetical proteins from Arabidopsis thaliana gene loci At5g11950 and AT2g37210.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 62
structure length 175
sequence length 183
chains with identical sequence B
ec nomenclature ec 3.2.2.n1: Cytokinin riboside 5'-monophosphate phosphoribohydrolase.
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03641 Lysine_decarbox Possible lysine decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a33A00
2F62A 4LJLA 3F5MA 5AJUA 4RH3A 2F48A 1S3FA 1S2GA 1YDHA 2Q4DA 4FYIA 2F64A 4KXLA 3EHDA 1WEHA 4P5DA 4KXNA 1WEKA 2PFKA 4FYKA 3GH1A 3OPYA 4OHRA 4I4IA 5AJTA 3UQZA 1KZHA 3IMKA 1S2LA 3OPYB 3U39A 1T35A 1S2IA 3K2QA 2Q4OA 6PFKA 2A33A 4I7EA 4A3SA 2F2TA 3SBXA 2A0KA 3O8OA 2PMBA 4LJRA 4NPAA 4I36A 4OHBA 4MCJA 4PFKA 1F8YA 3O8OB 3HNOA 3QUAA 2IZ6A 4JENA 4FYHA 4LJKA 3BQ9A 2NX2A 2IZ7A 3O8NA 2IZ5A 4KXMA 4WL0A 1MTOA 1ZXXA 4P5EA 1F8XA 4JELA 1RCUA 3PFKA 1S2DA 4MEJA 4HX9A 2KLHA 2KHZA 2F67A 2HIGA 3MAJA 4U1RA 3O8LA 1PFKA 5ITSA 4JEMA
chains in the Genus database with same CATH superfamily
3DVLA 3IAS1 4HPJB 2JL1A 1D3AA 4IG4A 3AETA 3KTFA 2P5YA 4P33A 5DI3A 5SZIA 1X74A 2IWHA 4BVAA 5AJVB 2CDNA 4YTEA 4BVKA 4MRVA 1ZUHA 1Z5UA 2F48A 2Z98A 4YJHB 2NUPB 4WZ6A 5ICSA 1BQEA 3N39C 2X40A 4PYQA 1E79A 4ZMSA 4JZYA 5D5HA 3MEQA 3E5HA 1JDTA 2JLQA 4BVFA 5J5CA 2X0RA 1IZ8A 4N0MA 4AN1A 4JBWA 5ADUS 3HB5X 2WHXA 3NOQA 1QRUA 1JHDA 4JI2B 1XMXA 4QTYA 1YZGA 1BE0A 2PYIA 1YNOA 2VDWB 1KPIA 2YJ3A 3GLUA 1JA0A 3CWZA 4RF3A 1JKFA 3H42B 3HPQA 5K0NA 4D82A 5BVGB 2CLCX 1JNYA 5K0ZA 2YHIB 2DUWA 3I04A 4V0RA 4FMCB 5KOIA 4FYVA 4A8HA 4BAGA 1RI2A 1RWBA 5KYYA 3DDUA 3SZOA 1T2NA 2BHLA 1YK0A 2JH8A 2VH1A 3GJ0A 2JFYA 4Z9XA 3N76A 1BGXT 2V7WA 1X19A 1JR3E 4C7JA 3EEFA 5C3MA 1GDTA 1F20A 1G21A 2GGSA 2XJ9A 4E3WA 5CT6A 4RO0A 3NEYA 1YR2A 2AMYA 3A9TA 3C8HA 3O7MA 1A5BB 2GBLC 3ZTYA 1PT8A 1RABA 1TM3E 1E7WA 3AF2A 3OQIA 2WJJA 1KSHA 3BG5A 3SBEA 3HXOA 1CQWA 2HA4A 3FHCB 3COYA 4X1YA 4QPCA 3TFQA 3VC2A 4BUZA 3SF8A 3S2EA 3BAZA 1AQIA 5JANA 1UFKA 3K16A 4MIYA 1OLUB 2WDZA 2E4XA 1AK2A 4Z1OA 1VJ1A 3F4LA 3DGEC 3EGDA 2GHTA 4XJXA 2G70A 5LIRA 1RQ2A 2VHWA 4JI0B 1KJQA 3IUJA 1XMOB 4RSRA 2RGYA 4EJ0A 3WKAA 1XXHA 2Q9UA 1EJ6A 4C22A 4MA0A 1NQWA 4LI3X 5EXSA 1NVMB 4GU5A 2IYLD 4I8IA 2VYCA 3W4IA 1FTYA 1SGWA 3C3CA 1KZ7B 1L4NA 1ENYA 3FH0A 2VJYA 3RFVA 1UDAA 2A0WA 2JIDA 1E2LA 4KQJA 1GG5A 5CXSA 2O05A 1EB8A 4LVUA 1Y6RA 3GA0A 4LNUA 5BRNA 2H7XA 1GV1A 4AD8A 4B3XA 4C2AA 2H4FA 3KKOA 4OFWA 3VHXB 4J6EA 5ILQA 1DJNA 2ACKA 3F9CA 4RJJA 3V8PA 1NDHA 3AUJB 4F4CA 1UP7A 2CEKA 1Z6QA 2W2XA 1MFZA 3WYCA 1YTLA 4RKRA 4YVFA 4QT4A 4FNGA 5KNCH 1UBSB 2VSFA 4QQKA 3VKHA 1XKLA 3T1QA 4ZALA 2XZPA 3JARB 4XUCA 1NA5A 4INPA 2CUZA 3W5UA 3OFND 1MTOA 4WK4B 1NVEA 2ZIAA 3C5WP 2XV1A 4BZPA 2Q1UA 3HADA 1X7DA 4OLHA 4DLYA 4F5EA 5JAZA 4PSAA 2PGIA 3K30A 4TQAA 1QH1A 3CO5A 1KYXA 2Q27A 4QBKA 5HMMA 2ZWAA 4B84A 1OIXA 1C0KA 1XTBA 4RX1A 1WQ4A 2XAAA 4RORA 5ALDA 2LPMA 4F4IA 4HNVA 2BBWA 3CIFA 3NGMA 2PR7A 3F49S 2QVGA 2IDZA 2IYVA 4ZZ2A 4NC9A 3WQHA 4Y1FA 2O4UX 2G76A 4BQPA 4QIHA 2IW1A 2UZIR 2XT0A 1GA6A 1UBFA 3S7ZA 1CF9A 4MVJP 5L7WA 3LC0A 3CRVA 1MGPA 5E4TA 5EUCA 2F8LA 2BUBA 1C7EA 2VXOA 3ITNA 2J30A 3N7TA 3O4IA 1DOHA 2NQ2C 4K87A 3C8ZA 2AJDA 4FXPA 1DOAA 2PG3A 1JQEA 3P20A 4Q9KA 4FMBB 4RNCA 2D06A 4DLVA 3R5TA 4XGIA 2XYHA 5AKKA 3SZLA 1KK0A 4NP6A 4CM6A 2ZRDA 2O2CA 5CLGA 1CVIA 2ALJA 3ABIA 4LSWA 3K35A 1PV4A 2BSQA 1YHYA 2WLTA 1WV0A 1FP2A 3CJRA 4FYKA 1HFEL 1UMDB 2WG0A 3C45A 3EJ6A 3RBAA 3COJA 1N4DA 1CLEA 2J46A 5DH9A 1EH5A 3ZBUA 1KQ3A 3E35A 3ZDFA 2X9QA 1NW7A 4IJWA 4JI1B 2VP3A 4TLMB 4X1OA 5F33A 2XYGA 1XQYA 3IBTA 4TYPA 3ZHSA 1SIOA 3BMOB 3EIOA 3OPNA 1LSUA 1MA3A 1D1SA 4TKVB 1USIA 2VYVA 3R7WB 4LCEA 5DLDA 4G0QA 4R1PA 4EG1A 3B3JA 3B38A 4ZCMA 1Q3KA 2QAJA 1OFGA 3AUAA 5I5EA 5LLDA 1ZVVA 1Z6PA 2Q0HA 2IEDA 1JALA 2Q8PA 1U7OA 3DDOA 1HWYA 1OZGA 4EW3A 2YNMC 4E88A 3W79A 5TR9A 1Z7BA 5JZ9A 1YOVB 2A57A 3SX2A 4NESA 4UE6A 4ZYTA 5AJZA 1WPGA 2Y1FA 2ZS9A 1C9EA 2BFPA 1G9XA 1ZS9A 1ZU4A 3QUBA 1YQDA 4AWBA 2FXVA 1HEIA 1K89A 1ZHOA 2B35A 2QJFA 2WWHA 3BDVA 3BTOA 1CP3A 4R9NA 3SXPA 2AOVA 2PMKA 1MLDA 1DTWB 2FN7A 2DLCX 2YS6A 4GKVA 3AEKB 4BQQA 4DCCA 2O5EA 2F1JA 3RU9A 1T3GA 3TM4A 3P2IA 1NG9A 2ZBVA 1L9KA 2R7MA 3LC1O 3MTAA 2JLYA 3NU1A 2SICE 1M0EA 4BC1A 2X23A 4WXRA 1CY1A 3ZR4B 2Z95A 2MINA 2QTVA 5I51A 4FM9A 3RS9A 1UAAA 1KZ1A 2ONZA 2PT7A 1E2JA 4UNPA 1E1RD 4XAQA 2G40A 3Q3HA 5KMGB 1Z8NA 3FW1A 3LUGA 1AKNA 2VDMB 4W5JA 4ZO9A 2R5NA 1DUIA 2IGTA 4NDAA 1UJMA 4GVPA 1PGJA 3OM1A 1D2GA 1AZTA 5A03A 4L8LA 3PC3A 3ZVKA 1E6CA 2EL9A 1RXSA 4PC3A 2I3AA 2QLNA 4GLJA 1LDYA 3M7IA 3IBCA 4UMFA 1KOJA 2C4MA 3EVDA 3O0TA 1R0KA 3BL6A 3KOUA 3LVRE 5KVAA 4RA9B 1NVWQ 4IEEA 3GAFA 3QVGA 3ROXA 1SVKA 5LZ7A 1QIFA 3FFAA 1PUIA 4ISCA 1PIWA 1RTTA 2EKPA 2FP4A 1I6LA 4YMWA 2WQ6A 3NR2A 1F1BA 5ALFA 5EIXA 2G25A 5IU6A 2X4IA 1WCXA 5EKSA 2AOUA 3RC1A 3TEMA 2XXAB 1XCMA 1M54A 1Z7WA 4R1OA 5LN1A 5L53A 4KAXA 3WHKA 1DQNA 4S35A 4FX2A 3QXSA 1Z2CA 4IXDA 4D9IA 4KXUA 2OLKA 4OSEA 3U7HB 4XUEA 3PI7A 2NO7A 3L1HA 1KFBB 5JJCA 3OZBA 4GF5A 3R44A 3LQKA 1MB3A 1FPQA 3OTGA 1O94C 3DT8A 1SUCA 2I4IA 3QH4A 1ZUNB 2ZETA 1T8WA 4BVBA 1P31A 4I1VA 4YJDA 1SPXA 2FEMA 1A8SA 1GDDA 2D1FA 3PUKA 4HNAA 4O5OA 4AY4A 1SCUA 4DFDA 1MN6A 3HR4A 3MNFA 3RUEA 1U9IA 5IN4A 3UF0A 4DR6B 1KHTA 2HL6A 2OPBA 2BELA 2WKSA 3RJMA 421PA 3DMHA 1O5OA 4E2ZA 1VOTA 3IIJA 3M6XA 3PDJA 4FDVA 3GLVA 3OPYA 4FPXA 3M2TA 3KKKA 3GPIA 3AKDA 1R4NA 1XXLA 5K51A 3V33A 3MD0A 3JQDA 3QXJA 1U3GA 4JROA 4D46A 3IC5A 4Q4DA 5IKMA 1CBUA 2YTZA 4CMJA 3AHCA 4QT0A 1VKZA 2Z08A 3QIAA 1CUSA 5TARA 4TT8A 2XMGA 4TWBA 2FFQA 4PPGA 3KEMA 3NP9A 2JGFA 3DE5X 3QPVA 4D98A 3SHVA 1QMGA 2QTLA 5FJJA 3SC3A 4NJEB 1ZISA 2AZXA 2IEYA 4I4TF 3SEZA 3KC2A 3TXXA 1I4TD 4ZZIA 3I8XA 3IOEA 2HRZA 5I9MA 3WMEA 1M3SA 1E7RA 2BCEA 2QJRA 5TGDA 3HYLA 3G8AA 3LO8A 4QOSA 4XWAA 1JIIA 4IF6A 4RK1A 2VBIA 4F12A 5BSKA 3VR6D 3V4VB 5CB8A 1ILWA 2J6IA 3EEYA 1RZVA 4Q19A 1HLPA 4YRNA 1IUOA 2XWJI 3KYJB 4KKXB 4KXFB 4TZTA 4H1VA 3C5HA 3ZV6A 4EA7A 1YJAA 3LUFA 4HLUC 4IFIA 2AD5A 2KQUA 2PH5A 4MGZR 4O1IA 4PR3A 4DTIA 1OY1A 3R77A 3FZGA 3DD5A 1R3UA 3SLRA 3LT0A 2ZQZA 4OHWA 4RD3A 5K5EA 4E22A 3ZV5A 2BMEA 3HS3A 3ND5A 3JTEA 3CLUC 3R6LA 4HDRA 1SKQA 3UJ7A 2C78A 4MKHA 3F8WA 3TL2A 2FEAA 4EVIA 4LDQA 4JI8B 2F8SA 4XGRA 2IVFA 5FLYA 2NYUA 4WJLA 2NX2A 2YFQA 4JI3B 4FKZA 1R6BX 1CY4A 4A8JC 3P52A 2EP8A 2NU8A 1TKCA 3D6MA 2IPOA 2V7QD 3C3BA 4EWLA 1OKKD 5BSWA 4CLEA 3QGMA 4L02A 1ELOA 4C0QC 2VHTA 4FK8A 3HJHA 5B1SA 5C4IA 4MUIA 3SYRA 5JS6A 2AUTA 4B7UA 4IR7A 4CCAA 4BVGA 3QWHA 5EQFA 5KQGA 1JJVA 2RK4A 4C0SA 4P3YA 2VYQA 2PS9A 2PCLA 3PX3A 4TRNA 1N5JA 2EFJA 4EG8A 4KMMA 5L3QB 3RC9A 1E94E 3QW4B 3ZQUA 4AS2A 4NNJA 4I4NA 2J0UA 4KHPB 1TEHA 3TZQA 1E1DA 4OBXA 1LY1A 2H54A 3FGOA 2ZRBA 1M5UA 1XTSA 2OGWA 4V39A 5JVDF 1NM5A 1X1EA 4S1TA 2HMYB 1ZICA 3ETGA 3OAAA 2FPXA 2QRPA 4QXOA 3DTNA 5KKCA 1P18A 1K97A 2Y66A 1U6IA 2ZLBA 2JASA 1OYWA 1TC2A 3CF0A 4ZVOA 4Y18A 2NPFA 2I8CA 4A6PA 2PO7A 2ZBQA 5E3IA 2HRDA 4LPKA 1Z3CA 4RVFA 3VKWA 3GDGA 4G0MA 4NMLA 1GYPA 2AR7A 4J0HA 5IK2A 1M5TA 1THGA 2YWHA 2VH2A 3QELB 3VTKA 1MG0A 2IXAA 4ESOA 4DG9A 1G8AA 1EXNA 2KBEA 1A77A 3D8NA 3KPVA 4I4TB 3DE3X 2DKFA 5EP4A 4K5QA 1NYTA 1IG0A 4GC5A 4R1UA 4F06A 1WB4A 2A6PA 4PXAA 3SEAA 4AI6A 2D0IA 1GPLA 1P5ZB 2P8SA 4ND1A 2OP1A 4YT8A 5BSVA 4TSRA 4O0LA 4WTOA 1U0TA 3IDFA 3NDPA 3X1WA 2VPPA 2H1FA 5C52B 1HE4A 3A1TA 3UC5A 4E2WA 2XCOA 2VSOA 4KR7A 3JV7A 4D26A 1TYZA 2OM6A 3X1ZA 2XHZA 3A4MA 3ECCA 3K5WA 5FI5A 2G88A 2ZRMA 4G2NA 1IN5A 1HR0B 1DAFA 2BSAA 3WKCA 2MMGA 3L41A 1XVVA 2A5GA 3BD8A 5F12A 4WY2A 3HB0A 1W85B 1V5GA 4UBJA 1O87A 2I54A 3NHKA 3TCKA 4PAGA 4PN7A 1VE6A 1A9OA 1PR6A 2CXXA 2IHBA 1M7BA 2JGIA 4JP3A 5LWHA 2VRBA 3PR2B 4RADA 3NUZA 3OCZA 4UEOA 1S9DA 2HXSA 4JLNA 4A2CA 4QVGA 1I2ZA 2BEUA 3IIKA 1A2QA 4AN4A 3TBHA 3FMOB 5IUJC 3DWEX 3W34A 4D74A 4FP9A 3ZCXA 3PFWO 4LQDA 5KC9A 5EEGA 1G8GA 3ZKWB 4MCJA 3C87A 1ZW6A 4WKNA 5DE3A 2V4UA 4B79A 3VNVA 3TQFA 4MNTA 2NOAA 4CPDA 1E3IA 1RZ3A 2DPHA 3A6FA 1NULA 5DCUA 3G17A 1GUFA 4QNRA 4ZQIA 5AVWA 1GL6A 4CMKA 2NN3C 5ICFA 7ABPA 4FYWA 3BJMA 4BJ5A 2VUIB 2P5SA 4N0QA 5HCUA 1LX7A 2VC2B 2JGDB 3ZJYA 3DOFA 1LK0A 4KKVA 4ZI5A 3THWA 2VZ9A 3L79A 1SCIA 5LXTA 3FYUC 1AGNA 3KE9A 5JVDB 4BN5A 3VHLB 2X4DA 3AUYA 1E2EA 2ZI9A 2AQ8A 1JDPA 2ZRLA 3LQFA 5AW3A 1N7JA 8ADHA 4ZIRB 1WKCA 1XNRB 1W1UA 1PFGA 1IN1A 3SQDA 3GPDG 4RK4A 1XWWA 4GM4A 1N2OA 4ND6A 3VU0A 3OCWA 1H65A 5E6SB 1KFEB 1RRFA 1JXQA 2PZ8A 2VFAA 3AF5A 3G2HA 1MHTA 3AL0C 5JQWA 3A25A 2HT6A 3KO8A 4S1OA 3G2KA 3M6FA 2Z5VA 2GSWA 3KQYA 1YK1A 4ZARA 5FJIA 3SS8A 1GR1A 2GPAA 1G20B 3NBAA 4HZGA 4XA8A 4D0LB 2QAIA 5EJGA 1AGPA 2VUSA 2RARA 5CFOA 1H6CA 4MPPA 4I8DA 5ITSA 2IY7A 3PGVA 5GIPE 3CXUA 2WJ4A 3DMTC 3PXEA 4D56A 3QA9A 5FA6A 1QHGA 1USVA 1MRSA 5KJ1A 4ROSA 2DHRA 4EYEA 3LK7A 4JVOA 4UW9A 1PTJA 3EH1A 4G86A 1U4NA 4RFSA 1KO7A 2WRZA 4N0DA 3OT1A 1YB4A 3G9UA 3PGMA 3OA2A 1L7AA 2H51A 2VSNA 4PAWA 1CHDA 2G6BA 3VH4A 1QX4A 3WBJA 1A8IA 4JHXA 4N76A 1OI7A 4UVIA 4R3NA 5FQOA 3V34A 4HEA1 4IWNA 2ZRJA 1K7CA 4DMCA 5F7XA 2P11A 5JXHA 1I7QB 1G20E 1JWLA 2YV2A 4J2TA 5FPTA 2HB6A 3DEIA 4GXRA 1L8XA 1RXCA 3JQ8A 2QNRA 4BUCA 3SIXA 1PYGA 1WUIS 3IJPA 4A0QA 5JS1A 3H13A 2MYPA 1Z6YA 2G1JA 1FP6A 2PLAA 3DAHA 3DFMA 3NBFA 3IIIA 4LGYA 4CR7A 1P61B 3IVMA 2VJLA 2FEPA 5HE8A 1Z45A 4QJ3A 2B9VA 1JPUA 1US8A 3MERA 3T5GA 4BMDA 5J1SB 3ITKA 2NSHA 3THXB 2CJWB 4A73A 4I55A 3RJZA 3DV0B 4LOLA 2W2OA 3FCSB 2O2YA 2JD0A 3L1VA 3KPWA 5K6AC 1ZKDA 3K6SB 1KMNA 2C9OA 1MB9A 4TL6A 2OHVA 2HDNB 4LZOA 5AYVA 3P27A 3BB4A 2IXBA 1SC1A 1ZYUA 2ZS8A 3GV0A 2YIMA 2BSXA 1Q1AA 1AD2A 2Q5LA 5B1YA 1B6TA 1Q1QA 3MCTA 4B7ZA 1KTIA 3WGNA 1ZGBA 2F2TA 3QP9A 4D9NA 5K7SA 2FMKA 2GEUA 1E20A 3LC2O 4WJZA 3E7DA 4HWKA 4NG4A 1ATZA 2MSNA 2VXCA 3TMAA 2GD0A 3BXXA 3ETEA 2ZAMA 3IPRA 3BFKA 1NJFA 3R7LA 3UWOA 5KREA 1EUDA 5F3WB 4KL8S 5CGQB 4ZVPA 2J5BA 2ZB4A 1V5EA 3THYA 3GEBA 2WZQA 4MB0A 2BR4A 1PDVA 3BSSA 1GFWA 3H5AA 3OFJA 4N3GA 5EPOA 2GLUA 3UT5A 5CXQA 1KQGA 3HB1A 3CJTA 4OAQA 1JLLB 4RY2A 3VZCA 2IUSA 4MJ7A 4CMGA 1DDOA 1XQWA 5AK6A 4RIEA 1I9GA 4YCLA 1I4DD 1JILA 1ZI6A 4G07A 4L5CA 4JVLA 3LY8A 4Z0PA 3UXHA 2J3QA 4BNNA 4BGDA 2GN1A 3O83A 3Q3GE 1JE1A 3LWNA 1MC1A 1CUYA 1TZCA 1V2HE 4M1QA 3TW0A 2FDCA 3EVCA 2FX2A 3K15A 3P2KA 4ZOBA 2LWIA 4HDAA 2G72A 5IF3A 1RAFA 2R11A 1HQYE 2I2BA 5AW2A 4BNZA 4UBOA 3SJUA 1O0CA 4U0JA 1JQ3A 3HCEA 2ZSUA 4PHTA 3UGKA 4EY4A 1I4EB 1RI4A 3OMLA 5HTKA 1OZAA 1KXZA 3F46A 1BDMA 3MINA 4CWAA 2XGJA 3KQSA 2Q45A 3P9PA 5KNBD 1JP7A 4J0EA 1YRAA 2Y71A 3FZQA 3ZBQA 4NYJR 3P4UA 1JLHA 3V1TC 1NBMA 1MX1A 1ZZEA 1IEXA 4A6XA 1Z4KA 2PX8A 3MB8A 1VL6A 4IPTA 4MWTA 2RAPA 3WJAA 3QK7A 1N2JA 1POWA 3GRCA 3N2GB 3FFTA 4YP6A 4C4RA 5B2FA 2QQ5A 1R0SA 4CLOA 3RIMA 4Q4HA 3SD7A 1YDHA 5IAGA 4FCVA 3MHPA 4YROA 1N1EA 1QRRA 4C06A 3N2EA 4NCBA 4QG7A 1KZ9A 2YOGA 5GJBA 3MSXA 1R12A 1NNEA 2GYUA 5EWLA 3SJCA 4EW6A 4QLBA 2BFCB 2D5CA 2WP8J 3K0FA 1C4OA 1XWIA 3I6IA 3DR3A 4G5OA 4JA2A 2VUTA 3T1HB 4ON9A 3UOAB 3GVXA 4HRXA 2GCNA 4CLRA 2O8CB 4U2CA 3DEJA 1E2MA 2XPCA 4EY3A 4CTJA 3WLOA 1J1IA 3H0KA 2YV3A 5EP3A 2IHTA 2MSCB 3I52A 3GFQA 3WX0A 4FWTA 3HJNA 5CB6A 4OI0A 2HJVA 4BV8A 1HG1A 2E89A 3IXMA 1GL3A 5ALSA 3BK1A 3CA8A 4RMJA 1YWGO 5ERXA 1WDLA 2E4YA 4ZXPA 2AEEA 2F3QA 1TM1E 1JHOA 3HCCA 1B43A 1PQ4A 2PV0A 2QSZA 1AKVA 3QEBZ 3AMVA 1M1YB 4INOA 5JXJA 1R1DA 2BTEA 1FP4A 1GARA 2XD9A 5SY4A 3GEGA 5CA0A 5IJZA 3Q2KA 3EBPA 1WDMA 1EDBA 3NHSA 2WIGA 1QFJA 4LF5B 2ZB7A 1Y9DA 3UWPA 3JWHA 1BSVA 2SCUB 5CJPA 1WZCA 4GMXA 5DASA 2CEAA 5ELMA 1JDBB 1A72A 1CETA 1LV7A 2OAGA 4ZJPA 3VR2A 3IAUA 5LMUB 1I3OA 3O8OA 3DA8A 4MIOA 4NOKA 3AJDA 1EUCA 1F51E 3BRQA 3I6MA 3MD9A 3H8JA 5CHYA 2RG7A 4ZCQA 2BZSA 1P3Y1 3CUYA 3WGJA 1F6DA 3I2FA 5WRFA 3H8WA 3CZMA 2D2XA 4M22A 4PLZA 1MX9A 1NPDA 2RHMA 2XI4A 4OLFA 1GUBA 5HJ7A 1M1YE 1HY3A 1TMYA 2O4CA 3B2EA 4XPIA 1A9XB 3ESCA 4JNKA 4PFKA 2NU9A 5ALZA 3DOIA 2XUQA 1T6BY 3EFOA 1DJQA 1RXEA 3LZ6A 2P2SA 4BUJA 4JOSA 3OIGA 1GVNB 1PGQA 3ETJA 2C59A 2QORA 4LIPD 4HEJA 1R10A 1EYZA 3VAYA 3W2GA 3V1MA 3SYTA 3BBLA 4DQKA 4KAJA 1QHEA 3MT8A 3FCCA 4ZO8A 1T3LA 1CNFA 3TBKA 3B8EA 3TVDA 4JR0A 1MKYA 5KTRA 1ZC4A 2ZIXB 121PA 3ZD8A 3MMNA 1Z4IA 2FH5B 3GFGA 4ZOQI 2JFZA 3KDSE 4MCHA 5GV7A 4BQFA 3AFHA 1U7PA 3D7MA 3BA1A 2D1SA 2MCFA 3W5CA 5CW1A 3RT9A 1AV6A 5A71A 1EX6A 3IEXA 3K9FC 4UPDA 5HFNA 2HQ1A 5KDOA 3F4KA 4KH0A 4B87A 1U3FA 3I5AA 4O4JA 2GN2A 5B30A 3FG9A 4L2IA 1FYEA 1K5HA 1LJUA 1EVJA 2OQRA 4MAFA 4A8JA 4EKEA 1FFXB 2ZE5A 2E5FA 2IBMA 2HZBA 4XVUA 3PU6A 1FQWA 4IKOA 4FVTA 4OOFA 3QKUA 2A9PA 1BOOA 4HDNA 2V65A 4EGFA 3CWQA 3BFVA 5HDQA 3RS3A 4OKIA 3QWIA 1EDEA 2FPPB 3ORRA 3WL4A 1IAVA 1S2GA 3EVFA 4L9WA 3PC4A 4IDGA 4OK3A 1IIBA 2C8KA 4OGGA 4WA7A 5JSFA 1VIYA 3V7UA 2CXUA 1XTZA 2YWEA 4M0CA 1VLVA 1BXGB 1XI2A 3KCNA 1XX6A 1YB7A 2B34A 5HBGA 1K6JA 3SBOA 4RSMA 1XN4A 2CCGA 2YFKA 3LLCA 4ALMA 2ZTSA 1GQSA 2KW5A 2GTPA 1CQIA 1C3EA 3TRJA 1M2WA 1SD2A 4R2KA 3TN7A 2ZAIA 5DK6A 1VC2A 3DO8A 4W4TA 2GXAA 1FMFA 5C37A 4DSZA 5FH9A 2FOLA 5L3SB 4D6XA 3AHEA 5HRUA 4L4RA 1PVDA 3L82B 4N54A 5AQEA 6REQA 3CKMA 3KYIB 3HR7A 1J9ZA 3B3QA 1TEXA 3GX1A 3BCHA 2OXEA 2Y1CA 5C1OA 3GI1A 1C0PA 1O9HA 4NPCA 4WE3A 3KQTA 1ZBDA 1H2XA 3CRNA 2GFIA 1WU7A 4LOKA 2BKXA 3QX7A 4CMEC 5A3RA 2CYBA 1QP4A 4NZYA 2IYUA 3R0QA 3PHCA 2GZMA 2O3QA 1PN3A 1UQRA 3MMZA 4IVQA 3NYWA 3HP4A 2ORIA 3FPJA 3GZNA 1XP8A 3T7TA 3UN1A 4B2PA 1TM4E 1OZHA 1E2BA 3V8BA 4YIKA 4L15A 5JCZA 5I7RA 3NWJA 2NW6A 2E49A 2XUGA 2F43B 1GADO 3DUFB 4KDEA 4QBFA 4F4FA 3F90A 3IHKA 4M9UA 3EBOA 4WIAA 9ABPA 3E9CA 1W59A 2UKDA 4EKGA 3QTTA 1GRQA 5K4GA 2HMWA 2PGDA 4WEOA 2Q49A 2GZAA 2G67A 4M88A 4JBLA 4H0CA 5D3KA 2VXBA 3IHLA 3N75A 4GXQA 5D00A 1L5HB 1G8PA 2VTKA 5C35A 1PNRA 3BMCB 4C3ZA 1ADCA 3ENVA 3CISA 3E9RA 3R23A 5AHXA 4DMLA 3WWDA 1V25A 1JFTA 2HHJA 1I30A 3MS4A 5L40A 2KJQA 3RSSA 2OAEA 1PNVA 3RAEC 2PL9A 3TUIC 2WD7B 3JASA 1M0WA 1E1KA 3ODPA 1XPRA 3G49A 3PUYA 5J59A 2PX6A 4UU7A 4AXBA 3P94A 3DEYX 4Z7QB 2Z6UA 5ITZA 5BQFA 2YZ7A 2HOQA 3MGCA 2WU8A 3RV3A 3ZZTA 1MB2A 4OFXA 5FI1B 2H9YA 1ZD2P 2HD4A 5EZ5A 1I14A 4BB0A 2OLEA 5J43A 5KQMA 3HI4A 3SHWA 3C5VA 3FPGA 3I5UA 1P6UA 5CAEB 3DL0A 1PNOA 4BX0A 5EJEA 2M32A 2QGNA 1J00A 3VAAA 1FRFS 1O89A 1T6NA 3PHJA 4HSEA 5CXUA 5IT9A 2P1ZA 5EMNA 2ZSFA 2GH1A 5FBLB 3ZLUA 3QE4A 1X7ZB 2FK7A 4MYSA 1JXOA 3LW8A 3IR6A 4OQ4A 3FYUA 3E0QA 3I64A 1WCIB 4U0KA 2CT8A 4OJKA 2QAGB 5CJJA 4IJ5A 3EWNA 1VBKA 1L7BA 4U5XA 3MCVA 3REQA 5L45A 2O8DA 3W6PA 3HCFA 1NC1A 3K5HA 3U9TA 1JI3A 2OBXA 4OXYA 1IQRA 2IP1A 4MGEA 4TMZA 4UMVA 1I94B 3KJNA 2FRDA 4R01A 4PCLA 3OX3A 4P58A 2Y92A 4ZAGA 1X7WB 1CUUA 1FNMA 1ZSVA 3IVGA 5A0TA 1COZA 4HQ0A 2WWGA 4TLDA 3LUDA 4OHVA 1Y3DE 4N7RA 2B6NA 4PTLA 4N5IX 2ODPA 1KY4A 3LKVA 5CB0A 3RNOA 1TVKA 1ZN7A 1J1UA 3DEHA 1IWOA 3IP6A 1ZAYA 4OHRA 3RAFC 1T0IA 4H59A 2XB4A 4AUEA 1VCIA 1C9MA 2FPGA 4NFHA 4C0KA 3KQKA 2WM9B 1E4EA 3T1OA 3X43A 5IDXA 4UPEA 1G6HA 2UZ1A 4A82A 4UAUA 4OHUA 5IM4F 3DE2X 4B7CA 3S81A 2EZ9A 2H7CA 4U2EA 4KGVA 4L0CA 2JHFA 1ZGCA 4LC9A 5E9QA 5TB5A 4H7PA 3V5NA 2UYYA 2BI8A 3HBNA 3HCWA 3RODA 1B8OA 2ILTA 4ARAA 3OOYA 5A9SB 5IULC 3HABA 4KMRA 5AK5A 1NN0A 1JUDA 1GCAA 1Y81A 3TXAA 2X9NA 3GJRA 4HMQA 4D3ZA 1HC7A 4EEKA 4YT4A 3IHTA 4AJOA 5MGNA 3N58A 2WZCA 3LY7A 1A9QA 1BEEA 4JUIA 1U9CA 3CVUA 5AKZA 3KPYA 5LKAA 4RJTA 3W9SA 4BAUA 4F72A 1DRWA 4JXXA 3LDGA 5FOWA 4AYXA 1E69A 4DEYA 5IJ0B 2F7SA 3LHIA 1N78A 2BHSA 1VLHA 2CKMA 3CX3A 3IAXA 3GC6A 4XWGA 4GYYA 1RYHA 5K6AA 1W49A 3INTA 2JBWA 2O6HA 3OIYA 4S3MA 3WLAA 2AFIB 1E18A 2B5OA 2I7XA 3MWKA 3PPVA 4OTZA 1ZO8A 2XQIA 2GCOA 3NWOA 2Z8ZA 4FGUA 1Z38A 2HA7A 4Y9UA 1ZH8A 4BVLA 4F4DA 2B78A 3CUTA 3ZHOA 1N1MA 4HUQA 4YUYA 4EHHA 1YS1X 2CLMB 4W1QA 4IMIB 2FFHA 3GVHA 5L9AA 5ALLA 1QZ3A 2TS1A 1Q7EA 4BEBA 4PZUA 2GZ1A 3STYA 5CA1F 3IVXA 1AN9A 4PBSA 4XCQA 5CG2A 4DUYB 1ULHA 2IBSA 4Q4JB 1SOWA 4BC0A 2PEYA 5JADA 2C0PA 3G9TA 3PEYA 1LC3A 1L5LA 3PXUA 1YU6A 3R40A 3V6MA 1Y82A 4YV2A 2AGVA 2FUNB 1FUUA 4PG7A 2CB9A 4BLUA 1VYTA 3GLIB 3EDYA 2WG2A 2WP0A 3VO2A 1DAPA 2FPSA 2GJ4A 5FPHA 4FCCA 1O97D 4BFYA 3B6ZA 3WB2A 2ASEA 3NFRA 1JWBB 1KOFA 3AR8A 2GXSA 4FMPA 1NU6A 1SH7A 4LWPA 1D2NA 1Y48E 2CHFA 2HJRA 2IWRA 3RFFA 3PFCA 1FK8A 3WYBA 3WMXA 4CL8A 2XB8A 5GINE 1VDMA 3EB9A 1ZIYA 2GN9A 3SC2A 621PA 1X1SA 2CD7A 2O5VA 2Z2JA 3OEHD 3PFGA 4HYQA 4NE9A 4WK6A 4IQ4A 5E7JA 5BQPA 3KTOA 4RVUA 4DT1A 3KRTA 4Z2AA 1CS0B 1AB6A 4PZ0A 3TTXA 2WSMA 3G59A 4KTVE 5CG1A 3EF0A 2MTBA 4LNAA 4C30A 5DM1A 4OGFA 1JDZA 4AB1A 2HWKA 3FCEA 1YBAA 3GLIE 4LV8B 3ISVA 3O82A 4NCAA 1EWVA 1VBNA 4KRGA 1GTL1 1W4BA 4MB2A 4DV2B 3DPIA 3SYNA 1DLIA 1Z12A 4KCGA 2JLXA 1MV5A 3THOA 4A0HA 3O90A 3HYCA 1GZSA 4IJMA 2QTFA 3R6TA 1YDGA 1LS6A 1KDOA 2G04A 3KVYA 3DM5A 3R76A 1NR7A 2ZZKA 3ZXUB 4ED9A 1RC1A 5IEBA 1OA1A 5ALIA 3VDMA 1W87A 3JPYA 3WL8A 1Z35A 4QATA 2E4WA 2ZSEA 2OPHA 4JMLA 4BN4A 3OU2A 1J9EA 3ADOA 4E46A 3D6TB 4ARZB 5GZ3A 2RH9B 1R6TA 1YL5A 3QG1A 4PG8A 2RGEA 5AKXA 2JK1A 5FWYA 1NBEA 1H3EA 2ATVA 1MB4A 2D8AA 1P7PA 4E6EA 2FPMA 3E3LA 1D7OA 3C4JA 3Q3JB 1Z2NX 2JARA 3KT3A 3EIHA 1JBKA 1COWA 1R6VA 1U02A 2W2KA 4KLZA 4PZAA 1WNTA 2P2DA 3GPCA 2UUBB 4M55A 2O8NA 1KP2A 1U2EA 3NTUA 2AHOA 2LZ0A 4AC9A 4EITA 1SHTX 3AYXB 4EBBA 5C7YA 1JEOA 4EGQA 2BI4A 5L95A 4EJMA 4O0MA 2FSUA 1K1EA 2VYFA 1T2EA 4R9SA 4KE6A 4D8XA 4F6RB 2CFOA 4LISA 5DM60 2CFRA 3I9LA 3QY9A 3I4CA 4PSUA 4ZXFA 3ZZ0A 4B4WA 5JS8A 1XMJA 4D96A 3IQEA 2IYQA 2JAPA 5CEEA 4ZREA 4LYAA 4Y6QA 3W8FA 2HGSA 2PKQO 4H1HA 3N5CA 3Q8LA 1F6WA 5AOBA 2C5GA 2AJTA 1XTQA 3WLLA 1XQ9A 5KTTA 3EPRA 1A9YA 3PDWA 1VSBA 4FEEA 4JC4A 1HYHA 3OWHA 1RQGA 1Y5LA 1N2ZA 3PGKA 1AS2A 2FGKA 3B85A 4IGKA 4LXGA 2QPOA 4ARBA 1H6DA 3ZHTA 4DGQA 1Z07A 1C7RA 1V7ZA 3ZDQA 1C3LA 4BO4A 4YEDA 1IB0A 2MT9A 2W6JA 3SX0A 4ROTA 5J4LA 2B8EA 4EFLA 2H31A 4YAEA 3X2FA 3GLFA 1Q0RA 2FZGA 1I32A 2G09A 2H4HA 4LYYA 1NJ2A 4R0VA 3OY7A 3BFXA 2HKIA 4OI4A 4Y98A 5JHHB 1WHTA 3F8TA 2LE0A 1XLVA 1YDEA 3BBPA 3SKYA 1GSHA 1EGHA 1V6CA 1UWKA 5GMOA 3IOBA 1YMQA 1NAIA 1I36A 4NCHA 3ZQ4A 3EXIA 3W3AA 1ZJJA 4AF8A 4DM4A 5JRDS 3IT0A 2J09A 3CG4A 3DBOB 4YT2A 4D44A 2ONKA 2YQ4A 3KL4A 3BWCA 3P19A 3RIGA 3NVMB 3O2SB 4QRIA 3EWAA 4Z3DA 2HMAA 2QY9A 1VQ1A 3JQEA 4JC5A 1VG9B 1JMVA 3JQBA 4M0MA 1I2MA 3L8GA 4GSLA 4LMPA 4LRXA 1HT1E 2VJMB 1K88A 1ZVQA 1CU1A 3BGVA 3HJBA 3ESAA 1LX6A 2VTVA 3THSA 2FK8A 2DWOA 4CHGA 2OR3A 3QEMA 2CBGA 4CM4B 3ES9A 1YH3A 3KHTA 5JG7A 2I91A 2WV9A 4RLQA 3HO1A 2CCJA 2GI4A 4AO8A 3L0PA 1T2UA 1V47A 1PX2A 3IVRA 3TDMA 3NYIA 2BDEA 3P0EA 5IJWA 2JBHA 1WY7A 4HMPA 5D6OA 1ZM4A 1K63A 1OQAA 2A1IA 1Z5PA 2ECFA 3JAKB 1QHHB 4RXUA 5REQB 5HSGA 3FWPA 2QXUA 4QNNA 1E3EA 3B1KA 3T1TA 2YXDA 5DXFA 3T3MB 4PRKA 4ZKDA 2ERYA 2QLMA 4X93A 4AKHA 4V0LA 2O3SA 4BMCA 2H5JA 2KMLA 3D4OA 4MUFA 3BRSA 4B80A 2COKA 2H5EA 3KQPA 3T3NA 2A58A 3ICEA 2Z1DA 1W6UA 2CVQA 1OH8A 3W5BA 5JO9A 1KYZA 3AINA 3VBCA 1FX0B 2VDRB 3IP1A 1NG1A 5CLLA 5E4FA 1A69A 2VDVE 4GMFA 1JFVA 3BHMA 1RLUA 1UKBA 3ECAA 4XUGB 3K73O 3V9AA 3SIPA 1OBOA 4IIBA 1Q2UA 4N5MA 3DZJA 3AHDA 4BDTA 1Y7IA 4B76A 5GV8A 4YYZA 5K8TA 4TTSA 1WXGA 4O4LA 5BW4A 1CY7A 1DJOA 1H69A 1KJZA 2OC9A 2VP5A 2XTJA 1Q1GA 3NV7A 4JIMA 4WXMA 2A92A 1XN1A 2VT7A 3D3WA 4UUQA 2QLJA 3UMFA 1J5PA 4CV2A 4UC0A 3GYBA 3WO1A 4B6SA 4HTAA 4MARA 2WF7A 1Q7TA 3IUEA 5KVCA 5KQSA 1ZJ6A 4EKDA 1A8QA 1WMFA 5FL3A 1VKHA 3ESRA 3Q8MA 1I6WA 1CEEA 3R41A 3BS4A 1J2YA 1K0UA 2OZEA 3DCIA 4NSNA 4PGHA 4UHCA 4Q9JA 2F1OA 4F3TA 4BMNA 4QOIA 3ZWPA 5ALYA 3GJXC 2JJQA 4IH4A 1K7EB 3HDYA 4PYJA 4RPJA 4F85A 5IPFA 2I2FA 3WWOA 2WB2A 3EGCA 4CMIA 1NKSA 2B3TA 1XEXA 2WMDA 5E2AA 1SO8A 3HNPA 1R0RE 3UWDA 1G5PA 4DQXA 5FI0B 4JSRA 3KM0A 1K08A 1PJ2A 3R2JA 4L7VA 1GPDG 1D6MA 5TY0A 2X5XA 1NVTA 3DBHB 2P69A 5ALGA 4RA6B 2FR0A 3RHSA 4EGSA 2EJCA 1YFZA 1WCWA 2PWYA 3KJXA 3OBBA 3TTTA 4DJ5X 1EZ4A 4N0PA 3C3YA 4LHZA 1WSDA 4YRKA 5SV2A 4OQEA 4OXXA 1UJ2A 2YWCA 1J8YF 1S02A 2GBPA 3PQ5A 4QE3A 2F1IA 3MN1A 3VDNB 1WRBA 3QUCA 4HNRA 2PGJA 2WJZB 2O8VA 4FFPA 1Z06A 4J9UE 4TKZA 4TVKA 5KJEA 3W78A 4YMUA 3QHPA 5HIMA 4EATA 4G0VA 3UB4A 1KMHA 2Y9PB 3B9QA 1AHIA 2FP3A 3F5SA 3P26A 1QGDA 3OZSA 1AQUA 4HRAA 4PPFA 1JEYB 4BZXA 2HIGA 3ENKA 3GFFA 2O57A 2DSNA 4URWR 5HS6A 2XMZA 3W5VA 8OHMA 5LZ9A 1RAAA 1ZCZA 5EMHA 3RRYA 3TIVA 4DC1A 2P0YA 1Q0UA 1BHJA 2DKOA 4M7OA 4WLUA 4L16A 4IIJA 4D0SA 1KY2A 4F3YA 3ISJA 5LQUA 4YCCA 3NHYA 1UOEA 4DLKA 4X8LA 2WUDA 4BU0A 5T67A 5F9FA 1RZRA 3M1LA 2FRVA 2GNPA 3KTAA 5ALKA 2QXTA 3JATB 3N2IA 4KXLA 4KXQA 3NT4A 1O58A 1OAAA 2ZRCA 3L04A 5JEEA 1QAQA 4U8HA 4M9XA 5F98A 2A9JA 3FAZA 2OORC 5EIOA 4OP3A 4X94A 3WGLA 3L7KA 3ELDA 5BMVF 3BH7A 1RXUA 1IBMB 1P0MA 5NULA 4CHTA 2J07A 2X8BA 5HCNA 4MHTA 2DB3A 4ZPXA 1R5OA 1S96A 2Q62A 1NUSA 3FUWA 4XFKA 3V4FA 3UPTA 1DRJA 2Y93A 2AG1A 4ENVA 2BEWA 3ZWNA 1OYVA 3U7IA 2G06A 2I80A 2OK8A 4TSFA 4W9MC 2ZJ0A 3KQMA 3SCZA 3DBLB 4O2BF 4B1FA 16PKA 1X38A 1NQAO 3TRHA 3A2KA 2FGJA 1TUEA 4OYHA 1L5FA 4XQ0A 3DDWA 3ROKA 3N70A 4QGHA 2HLDA 1J25A 4LA4A 2DXIA 3D6JA 2IYFA 3HVUA 2Y1DA 3I01A 3OCJA 2PRZA 5D1HA 3RU3A 2G0TA 4UEWA 3NC1C 5CEJA 1EWTA 4MRMB 3K31A 2JC3A 1AX9A 3QKIA 5AOAA 5CB4F 3TG8A 1L5KA 2R8OA 1EUYA 3ZVLA 3NVKI 4TKVA 1RJ9A 1AZLA 4ZVVA 3RVKA 7MDHA 4AKIA 2WE8A 1JEQB 5AXCA 3FB1A 4A7PA 3GDWA 1ML3A 4NOMA 1NN3A 3VNBA 1XBTA 3TECE 2CNLA 2QT9A 3ONVA 1AY0A 2ZYGA 1U0HC 2IBTA 4E5SA 5HQJA 1LH0A 2PU7A 1LF5A 3Q5EA 1GQYA 1K75A 2FHSA 5IBRA 5I47A 5TQ2A 3STXA 5JBIA 2Q1TA 3CX7A 3TFOA 4BQOA 3OIVA 2NT3A 1O96B 1Z7EA 3IJRA 3AGPA 2BGKA 3GJ8A 2B7LA 3FMPB 2KPOA 3PNBA 1C0LA 2LR0A 3QIVA 3RR2A 3RVJA 2HZ7A 4ZYWA 3BB1A 2NV6A 5CMLA 1TAUA 2JS7A 3KYDB 1LK5A 3SIRA 1E3WB 4JJFA 4EL0A 3VU1A 3CKKA 2F55A 4MV4A 1K9SA 1UC8A 2PR2A 2ZSIA 3KKZA 3T94A 3UUGA 1FE8A 3S1LA 3DLAA 1YACA 2DPGA 1GA4A 3O4GA 3P9XA 4FLMA 2X41A 4I4CA 4NCJA 4R83A 2V97A 2B8JA 1QG6A 3OE7A 2BTQA 2QSUA 2MWMA 4G8DA 2COUA 2XMDA 4N3BA 4UUAA 3VUFA 3QEAZ 4FU0A 3OE5A 4UHBA 1NI4B 3LCJA 3K6JA 4L85A 4F1JA 2PQ2A 2FZLA 4IDEA 2CJPA 3ZK7A 5IWCA 2QMEA 4HG2A 2Y1LA 3L0DA 5JHGB 4RESA 3UJPA 1YCHA 2PKRA 5IP5A 4M8NE 4S1NA 5E1OA 4UOEA 3TLKA 1WO8A 4C6HA 2HPHA 4LKRA 1NMEA 4NOJA 2BFEA 5I45A 1GILA 5EJ7A 2NZJA 5KB3A 3VH3A 4GSYA 3O8DA 4ZODA 5BMVB 2ACVA 4U2FA 2R62A 5KKNB 4MUAA 1ETHA 1F9AA 5C8VA 4D3DA 1F2DA 2RFLA 2MSWA 5T4HA 1IJEA 3WQSB 2I2WA 4RZ3A 4B9AA 5EHIA 4JLJA 1R9JA 2GT1A 4Q9DA 5FTJA 3LG2A 1MO6A 1Z4PX 1ZZGA 1J24A 3HBMA 4KFTA 4L50A 4LDZA 1N0HA 4WMLA 2HCBA 4O2BB 5BPFA 2J48A 5FUQA 4N41A 1I1NA 1E77A 3ZEAA 3HZZA 1UWVA 2HX1A 4V0OA 1RC8A 2Q6OA 5FFFA 4HNTA 2NXJA 5LQKA 1IJKA 2BF4A 1WXHA 4HJXA 1TAGA 3QU4A 1T13A 1IXSB 3BIOA 3H75A 3HVIA 3EOBI 4ER6A 2RHBA 3OJ0A 5FUWA 1TCUA 2J9FB 3PWSA 2BBOA 5CB4B 4X90A 3UANA 3VR3A 2DR2A 1KYVA 4MULA 2GNOA 4JFRA 3Q7IA 1UODA 2R6GA 1KH2A 4V3CA 2W4IA 4NXNB 1JYSA 4J16A 1WUYA 2JIRA 1N25A 1QGOA 2DEUA 1DBRA 1NASA 1YS2X 1GFSA 1IEQA 1YUMA 2FZVA 1NVBA 3CRQA 4E5DA 5K6TA 2A3NA 1M34A 4XLLA 2I4OA 1WWKA 3L0OA 1KEZA 1Q84A 2PMEA 3RDPA 5JARA 5AI9A 2HCJB 4JX8A 3UMVA 5KYXB 3ANLA 1XF9A 4H7IA 2PS3A 5C8ZA 3NHWA 3O4VA 3TLGB 3IOMA 4ESEA 2W6PA 2X3YA 1G7SA 1QXSA 5EXPA 1G7TA 4B83A 1PD0A 3FNBA 5K0GA 3KJEA 1E9AA 3T1VA 1TF2A 3C24A 3LNTA 4U6NA 3QY0A 1IPHA 4BNLA 1QTIA 1KVUA 1DCTA 3NHAA 1GPYA 3O4RA 3T0FA 3V4PB 1X7GA 5FORA 1Y3HA 1D2RA 3AHHA 1BVYF 1WHSB 2BGNA 2ZI7A 1XCBA 3QVVA 4U63A 4EG3A 3H87A 3RKSA 2FF5A 1WM1A 4DLRA 4TMFA 2UAGA 4YO7A 2I65A 4DABA 2GPYA 2NIPA 2EX0A 2PEZA 5E8RA 4AO6A 1VI2A 1TA4A 2PX4A 5LMZA 3R4VA 3RJ5A 4RH1A 1QUFA 3ONNA 4R2IA 4TV9A 2O07A 5KSWB 1CIVA 3A32A 3OIDA 4Y1RB 5TMBA 5FTWA 4C4TA 1KVTA 3QBVA 1KDTA 4W9NC 3RYFA 2QP9X 4BNGA 3LDUA 3K70B 4N8DA 3VH1A 1GPMA 3EFEA 1XCGB 3N2LA 4IVPA 5DNVA 1EJ2A 1SVLA 3JYHA 3KEGA 5JZVA 4NMMA 2Q3MA 3WOHA 3FHOA 2J4CA 1JHPA 2VJOA 3CSSA 3L8MA 1Z37A 1RBQA 4YAFA 1E7QA 1WZIA 2OD7A 4UBKA 3F5FA 5I9LA 3DV9A 3D8UA 1JQBA 4D4IA 5E1BA 1ZCFA 2NZVG 1PL0A 2POCA 1ZD1A 5JLJA 3AX6A 3BXZA 1RPZA 2N46A 1S2DA 5F73A 4J75A 1WTCA 1H2HA 1JDBC 1TJPB 4G25A 5LJLA 5BWCA 5DHTA 5CLJA 2ZSKA 3NHBA 3HV2A 2R84A 1J42A 3Q98A 1RWXA 5LP1A 5DYGA 3A4LA 3O94A 2H8KA 2VDQB 1V8FA 1DKUA 2GBFA 3BC1A 4YX9A 2VJBA 5LMCA 3FCXA 2IS6A 1I2AA 1LCIA 5E4JA 4FFNA 3REOA 3KALA 3MJSA 1NXXA 4HRVA 3L46A 4E4YA 3CF4G 5JMPA 3K9QO 2P2LA 3LC7O 3HM9A 4B4VA 3ETDA 5JXIA 2HMVA 5SZKB 2V0CA 3L6EA 4GBMA 1J5EB 4IVRA 1O6CA 1F0YA 4C0BA 3BIWA 2AN5A 3HZHA 4C0XA 2P8JA 2XUDA 2Q4RA 5HHTA 1AQJA 3WK6A 1KEWA 4J6FA 4OQLA 3T5PA 1XJCA 4XSVA 4GGPA 2ZBDA 2IVZA 4JT9A 4RVDA 4KXYA 5HUQA 2ZUVA 1MXFA 1JA9A 2O3UA 3AERA 3A9WA 2XT6A 3EW9A 3P9NA 3FIJA 2JI8A 1EX9A 3BWDD 5DX0A 3VR5A 5D3MA 4D3YA 2I3DA 4AMVA 4DMHA 2C7PA 1DBIA 3L6CA 3VI3B 5KQPA 3MFYA 1XCLA 3LQYA 1PDWA 4WH0A 3HG7A 1A5ZA 5AKHA 5HJ2A 4MJXA 1EEXB 3QE0A 3G1TA 2X6TA 3G7UA 1L4YA 2WWTA 1OXKB 1ODJA 3UQZA 3CUVA 4MS3A 5AI0A 4CG0A 1V8BA 2ES4A 3VC7A 2Z0MA 5FR2A 1CZRA 1E1MA 3TDNA 3E9EA 1X6VA 1N5IA 4Q4AB 1VA5A 2C9CA 2IF2A 2EG5A 1WS6A 2WAYA 1NAHA 2XX3A 4HDMB 4C4SA 4HVTA 1B7GO 4UVGA 4WRRA 4FFBA 1USGA 1W0CA 3U4GA 3WLMA 1DTSA 1U9YA 2PL3A 3L8HA 2VR1A 3PR3A 5DB4A 1JE0A 1AA9A 1MD9A 1ZJ5A 6ADHA 5KYUB 1WD7A 3RVRA 2JDIA 2O0LA 4IHAA 4FEAA 3ELBA 1EK2A 1T4CB 2BFFB 1OPXA 2K2QB 4N3CA 3ROEA 4CEJB 2ZBGA 5J2TA 4PZLA 3CZ4A 5GM1A 3U4CA 4IEIA 5AVZA 5JRZA 2EG9A 2Z2YA 3P4XA 4TRRA 3ORSA 2H63A 1Z8DA 4J1TC 1ADJA 2FF7A 3K7EA 3PNYA 3PRHA 4OM8A 5HKKD 3WLPA 3TD6A 1OPRA 5T7BA 4M0FA 1HGXA 2VDUE 4OD0A 1GOTA 3NHJA 2GZHA 4TTPA 1ZEMA 2QHXA 4CL0A 4G4SP 3VJMA 1XUOA 4BLQA 4DNOA 3ZY2A 5DTEA 3HXMA 3M1YA 3QF4B 2ANBA 5FIUA 4RS3A 3TQHA 2G1KA 3K72B 3CUUA 3HRHA 3LCVB 1EP2B 1U2TA 1OT5A 4DM3A 1CUCA 2D62A 1G8MA 2I9PA 1NW4A 1Y89A 3LQ2A 4GMHA 4L28A 1DKLA 4YBZA 4BO7A 2A5JA 4LCJA 3VFDA 4COOA 2Y2UA 1SCQA 3NFYA 3OE4A 1VE5A 4RL4A 2PXXA 4UM8B 1RKBA 4FW9A 3A0UA 4YBRA 1Q57A 1N5LA 1VJ5A 3DS8A 4MI9A 4X8OA 3IUBA 5AVXA 4AX4A 1QLWA 3STTA 2I8AA 3NPMA 4UCWA 1T9ZA 2GEDA 1UJ6A 1QC5A 3OEEA 4B73A 4Q21A 3T9AA 2DE0X 4Q7JB 2HFKA 4PO1A 2PNJA 3TOXA 3DMPA 3WLRA 2IS4A 1EM8A 1PJQA 2HRRA 2IFTA 3GEHA 4QGSA 1KDVA 4UFPA 3SXJA 1SXGA 1IZYA 3ZVRA 1YRLA 2KSQA 5CP8A 1GL9B 3QV2A 2QTHA 4O5AA 2GBGA 2FKNA 4RXTA 3G13A 2I6GA 4DRYA 3O84A 4JL5A 3E4CA 1QNLA 3FUXA 1JHYA 4G1FA 4P81A 2K6GA 1E6EA 3ZYZA 3I2YX 1I3CA 4G1MB 2XECA 4L5AA 1TZ2A 4N1AA 1QNFA 5LD2B 5E6RB 7REQB 1DWUA 1LBHA 4D9BA 3UENA 1H5NA 3IJ5A 4QBIA 4TOIA 5HKAA 2H6EA 3GCDA 1X1QA 1VZ3A 3A1UA 4CFYA 1EB9A 1PEAA 4DSOA 4ZV4A 4BE4A 4B8ZA 4KN5A 3IDSA 1QIJA 2E1PA 2ILVA 3KB6A 1Q1EA 2GVDC 2RCYA 4RQAA 4KIWA 4OGWA 1ML4A 3IMFA 5CVVA 5EKTA 4EHLA 4ND8A 2I87A 1NRIA 3T9CA 4DADA 5AI4A 3G2NA 1QO9A 4B0PA 5KU7A 1QFYA 4F8JA 2R1VB 4ZYVA 3NZEA 3CNBA 3I30X 4FBMA 4TWJA 3TGPA 4UKDA 1FQOA 3GXOA 2Q5OA 1KARA 3PA8A 1Z08A 2NU6A 1ZDMA 1P1HA 2GILA 4TTTS 4QUEA 1A4IA 5ED4A 2CLDX 4LJ7A 4B31A 1WNFA 1BN6A 4P8RA 5HS4A 4F84A 1CIJA 4JJZA 4LHYA 1GPBA 4TGLA 3ITEA 4FZ5A 2ZBFA 1XYYA 1NBIA 4LJYA 2J0SA 2I7DA 1E0SA 2JNWA 4D9GA 2H06A 5HMLA 2MYTA 3KZXA 3OPMA 1GU7A 1MDFA 1Y3BE 2OORA 1BCRB 4MR7A 4N40A 5F5NA 2D2FA 3G0OA 1FJHA 5KYWB 7AT1A 1UEIA 1S2IA 2QAGC 4DA0A 1SXPA 2Z83A 1M2HA 1WZEA 6PFKA 1DVRA 4X00A 2QV7A 2X2EA 4DTCA 4DB2A 2HI0A 4CKEA 5BUZA 1E3JA 1K8XB 2REQA 4FHCA 4BGIA 2D6FA 3EY9A 3K9NA 2CCKA 3L7NA 2R751 1E5TA 4CQMA 1D07A 1I6KA 2QG9A 5SZJA 1OC4A 4MS1A 1ADGA 1QCYA 5A9RA 4WK0B 1OBVA 3IR5A 1S2NA 2JI6A 3KXDA 2NXWA 4Y6GB 2BLNA 5AP9A 1W0KD 5KVVA 2OMKA 2ZG6A 4JS0A 4YK7A 1AIPA 5CDFE 2HWWA 1PWXA 2ZT7A 2PD3A 1XP5A 4M60A 2GN0A 3EASA 3ON5A 4QFDA 4B2IA 4O2AA 3UUWA 4G1UC 2Q6VA 5D8DA 3SG0A 1OH5A 3EVAA 4NOLA 4RD0A 1UANA 3CXRA 3RS0A 3PTLA 4E30A 4K9MA 2PZGA 3MLBA 1FRVA 3FWKA 3KSMA 5G2OA 1NXSA 1Z3IX 4K6OA 3DDSA 4JUBA 4R54A 5FAKA 3ND8A 1WJGA 4KVFA 1P5JA 2VF2A 1C80A 4LRYA 1BNCA 1MRNA 3HKDA 3R0IA 1HDOA 4Y2YA 5FD8A 4RPIA 1KI8A 1SD1A 2EFGA 5FYQA 1CRPA 3H4TA 3DULA 3O91A 3UOWA 5HQ3A 1GTSA 3JX9A 4CFZA 2CLLB 3UAOA 2YW2A 1RM4A 1T3TA 2VA9A 3H1TA 4MCIA 4EQ6B 2AOXA 2RGCA 3HA3A 3L7AA 3N86A 5A4JA 4WNAA 2X0NA 1X77A 3CWCA 1Q0LA 5M7EA 3VJKA 2WT9A 5CLIA 5E9AA 4KIFA 4WUVA 2DHDA 4TXLA 2UUPA 4X7BA 2VRCD 4EB6B 2ZYSA 4IRUB 3UZUA 2F3UA 4JYPA 2ZPUA 1U0GA 1VP9A 1L4FA 1N2BA 3GZTB 4W8GA 2H2WA 1MQ8B 4R51A 3VDQA 2BOVA 4XWTA 1C30A 1JQKA 1J8FA 2C4KA 3GFVA 1XO1A 2VNHA 4K03A 4B2YA 3DVQX 2WJIA 1JJBA 4G26A 4AMGA 4E6PA 2EFYA 4HB4A 3AU9A 2GPSA 2PJZA 4RTLA 1AT1A 5T5QA 2DECA 5BN5A 1ORHA 4ER5A 1J6UA 3B1YA 2V4MA 4KIUA 3DE7X 5K8CA 3OT5A 3HXLA 1OWNA 2J8ZA 2LNDA 3G2IA 3RK1A 5BRAA 3IAM1 1QH8A 1AF4A 2DULA 5K0EA 4I50F 4OX9Y 1TD9A 1CQZA 2IXTA 2Y1XA 4DPLA 2QL5A 4R8RA 1Q7RA 2HBRA 3HN7A 3E22A 3I4FA 5KUTA 4IYJA 5DPMA 2AG0A 2PT6A 1UEXC 4MVYA 3R5XA 3TOSA 3UQYS 5DCWA 4PAQA 2P1DA 1YJ5A 2QQEA 3O4FA 3QPCA 1AKWA 3TB6A 3UO8B 4CQJA 4GECA 5B12A 2IU3A 3B70A 4G5XA 4DLSA 3DG9A 5TQ0A 1M74A 3INYA 4M3NA 1REQA 2RIPA 2OBFA 2D4AA 1N2EA 2QN7A 4WADA 4LWOA 4EY8A 2ZKIA 1R0CA 1Y33E 1GKYA 1IOWA 1I8TA 4GG1A 3TGLA 2GVZC 4IS2A 1J06A 4ICIA 4MQBA 3SDSA 1FSFA 5J47A 1UFOA 5D7BA 2VJQA 2ZVJA 1L5RA 2ZSHA 4W7HA 2NVBA 4RS4A 1ISPA 5BNWA 3FPSA 1LDNA 2YV1A 4ZAZA 3FNIA 5E9JA 1JJFA 3G8BA 3R7FA 1AUXA 1C1XA 2ECOA 2UVDA 3L0SA 3NBUA 3QUQA 1ZONA 4US0R 1L4KA 1NXWA 4RGVA 1JSCA 5LQJA 2ZWOA 4MQFA 3C2QA 3L8ZA 1VB5A 1E6MA 3QXGA 5JSYA 5A6SB 1LGYA 1C2TA 3DEKA 4Z4EA 4NENA 1LSOA 4DYVA 2OO5A 1KO1A 1BGWA 5KOHA 1ZCAA 3B51X 3BF8A 1E1NA 4MVJF 2C8LA 3Q7SA 3TI7A 4G65A 5EA2A 4BS9A 4MCAA 3JSAA 3QUTA 2FQQA 3CH7A 4EUSA 1A2OA 3ZH2A 2H1SA 2V3VA 1U8TA 3MAAC 3C3EA 1UOPA 3REGA 4EJSA 4MI1A 1Z83A 2X2FA 1PGNA 3RI3A 5B3LA 3MWJA 1HUQA 1MPXA 3GFPA 2QTWB 2PSEA 1V0JA 4JJGA 1JZSA 4H31A 3UMBA 4FHZA 4I3GA 4P3PA 4P92A 1TDJA 1Q1NA 1ZK2A 4M0EA 5DWVA 4EHDA 5D5PA 4OXKA 1BE1A 4MW2A 3ID6C 4FBLA 5CK4A 2ZE6A 3V8MA 4OHXA 3TMKA 3OBIA 1SZJG 4G56A 1MX5A 4C76A 4CG1A 1NJ1A 4CT5A 5IX8A 4KVGA 1M8JA 2H8GA 3C3XA 3CZRA 2R2AA 3JQAA 3KR9A 2FWPA 3LYUA 5FLKA 3SYLA 5AD1A 4GWKA 5F52A 3TVTA 5SY9A 4Z1MA 4HK4A 1PQUA 1W1WA 3GW8A 4G41A 5EUMA 2YOHA 4TYNA 2FZCA 4RGQA 4YRTA 1OA0A 1SCNE 2OXIA 4B4UA 3ZDZB 1GDHA 1XMIA 1Z2PX 4I50B 1U28A 1ISJA 4D8YA 4OLJA 3D6HA 5IH3A 1RPJA 1C9KA 4QTUB 1JQLB 2YN0A 4RBNA 3JD1A 1OXTA 1ZNWA 4BLPA 1P74A 3G0DA 4LDJA 4H1WA 2CXHA 3U7GA 1U98A 2MYUA 2BGGA 2YYYA 2FG6C 3LDHA 3DL2A 3EY4A 1SUPA 1E2QA 3ZLTA 3ICCA 3R7BA 4MYRA 4QUGA 2HA3A 1HEUA 1R37A 5IDYA 1NX9A 2W43A 2QTBA 4FCWA 4CF6A 4OX9B 3DE4X 1TJYA 3Q12A 3ZN2A 2RHTA 3E8XA 2ZR7A 4C0LA 4F5DA 3CVYA 4LVNA 1MF7A 4DE5A 3K0SA 3QOXA 4IDQA 4DAOA 1PR1A 1GD1O 3INRA 3Q9UA 3HVJA 2NYVA 1AF7A 4EG0A 1EX7A 1KEUA 4HCJA 3UAZA 1CFJA 3E5NA 4DMGA 1RFLA 2L82A 1YA6A 1ADBA 5I8ZA 1WOMA 1E7YA 3U7QB 1QIGA 1H8ED 1LWNA 1WZNA 2OFPA 1JEDA 4LF4B 5DGDA 1LBSA 1MTZA 4AWAA 4GR5A 1EBBA 4B3RB 3K70D 4TVSA 1YF3A 4HQOA 4ZVNA 1I24A 4M8KA 2PT9A 1Q22A 4WPGA 5F3DA 3WDMA 4IH9A 3DMFA 3UBTA 1EINA 2CE2X 2ZM6B 2Q28A 1M67A 3C3DA 2WYVA 3HYTA 3UAXA 3VX3A 3R9WA 4UD6A 2J3KA 1QMPA 1JB1A 1RADA 3FA2A 3HWWA 4MKZA 4RMHA 5TDHA 1CULC 4MVXA 3I2GA 3RWOA 1Z6AA 4HUJA 1PSZA 2R8YA 1S89A 2HWUA 1CIPA 1XPOA 5DHUA 1K66A 4ZVRA 3CTMA 2XJ4A 1W35A 1PV2A 2ZDHA 4V03A 2J1LA 4KK3A 1NUTA 2JD2A 2OXRA 1JTFA 1JAHA 1SK8A 2O7SA 3KTDA 5ENZA 4AZ0A 1MAWA 1UM9A 1R9NA 5C1PA 3HJUA 2PQ0A 4KGZA 4W5QA 5CFZA 5FWXB 2UUCB 4JHLA 2FJPA 3HACA 2X14A 1UM8A 4MVJE 1J2UA 1FTQA 1OI3A 1XLUA 3FRIA 5C5CA 3PRYA 5FUMA 3PTAA 5BR8B 1ZA2A 2J4FA 1N6KA 1UADA 4F71A 1IQPA 1F8YA 2HQBA 2I99A 4LY9A 4EPXA 4MUBA 4KQFA 1DKNA 1E2FA 1T9DA 2RH4A 4EYGA 2PE5A 1BDHA 4RVOA 4UVEA 1N2XA 1IPFA 1FTSA 2UYHA 2XUHA 3P0FA 2R4TA 3HY4A 1V43A 3BWYA 3LCCA 3YASA 1M2EA 4WHMA 2YJ6A 3C6YA 3ELUA 4ML3A 1RKQA 4DIEA 4ZT2A 2IELA 1IG3A 4XIFA 4ARUA 2MSDB 2UVQA 4AJ2A 4YHHB 3ZLJA 4C0WA 2V59A 1M6VB 1V1MA 4K3UA 4O63O 6CHYA 4E12A 1GTRA 4LJ4A 3G5TA 5EIHA 1AQLA 2OZVA 3ZJTA 3AIKA 1KKUA 2C7VA 4EA9A 5IYZA 1PUJA 4QULA 2JHCA 5EZYA 2QG4A 1O6GA 3ZY3A 3PVSA 2C7OA 4WNIA 3DZDA 5FTKA 5FOVA 5JNLA 4HX9A 3T06B 3R8FA 4G0UA 2AXNA 1VSVA 5T6MA 2GQ0A 5AVSA 1Z8HA 2QUZA 3ORHA 4J3FA 3FOCA 3NTLA 1MAAA 3CR7A 4C01A 2GEBA 4F9EA 1L3CA 3GJTA 1AV7A 1XMQB 1GPAA 3EZ9A 4BFWA 4Z9AA 3UMRA 3ZGXA 3RSCA 1C14A 1DQYA 4MV6A 1EGVB 1Q15A 5BUQA 4II3A 3EGXA 1NUQA 2HPVA 3TJRA 2DPYA 2PYZA 3KLMX 4OGKA 1PJZA 4CKZA 1Y0BA 1X80A 2D7DA 4F45A 2XNJA 1KNQA 1RYFA 2WPDD 4UVHA 2FA9A 4PXSA 1J7JA 1QLHA 1P75A 3QPAA 2FWMX 2C07A 2X6RA 4OLBA 2R5WA 2IH4A 3D6FA 2ZT5A 4BY9E 2ODQA 4ZKEA 1FDUA 3N87A 4G1VA 4B35A 4P4SB 5LC1A 3EHEA 4Z51A 1N0WA 1QPGA 4LN1A 3DZGA 3OIUA 2JFUA 5ES3A 3EK2A 1C9JA 5B7GA 1THMA 2AYXA 3MJFA 5MN5A 2XH8A 3V8EA 1QUEA 1SUFA 3L7BA 4NCXA 1WBDA 1GPJA 3I1FA 1AGRA 1ST3A 3PIIA 2PA0A 1JJ7A 1QQ5A 3ZGNA 4DLUA 3OF3A 4YB8A 1IWBB 1SQ0A 1U65A 2OGTA 4XX0A 5KIAA 3E61A 2EW1A 3LKDA 3R5HA 3P9SA 3AHGA 4RHUA 3HVKA 3DOUA 2IUEA 4JC8A 3T5MA 5HILA 3TPCA 5IDWA 3O26A 2SBTA 1R8XA 4IJVA 1C4WA 4ZHQA 3RSGA 5F4BA 5LQAA 3JU3A 1PRYA 2LD4A 3IO3A 1TO2E 4DBLE 4BB6A 5BNTA 4AYWA 3LP8A 3CV3A 3N0XA 2C1ZA 3AF0A 3VOBA 4AKSA 2CK3A 3JALA 4RE5A 5A4KA 4AY6A 4XQCA 4TV8B 3I37X 4TPKA 4CM9A 1YQWA 2AR9A 4YI3A 3R3VA 1QJCA 2BI7A 3Q9SA 1RXYA 4MGHA 5TGTA 4BKUA 4L9SA 1O7JA 3ZDAA 3FJ1A 4KO4S 2YWGA 5B37A 3GRPA 1EBUA 1Q0QA 2PX5A 1PT7A 1T0JB 2XNSA 3M1AA 2FDRA 2XZDA 2JANA 1APBA 4HVLA 1BDBA 1WLYA 2BY4A 1XZEA 3TSWA 3F7TA 2H29A 3AG6A 3QE2A 3W2IA 1XZPA 1KU0A 2H1LA 2A86A 2WU1A 1C50A 1ODFA 3KJQA 5J4YA 1L5OA 1W2HA 4OL0A 2VATA 3GLKA 5GGXA 4EHNA 3E2IA 1SBCA 1XJQA 4F97A 2FW8A 1NP7A 4FYPA 5A62A 4A26A 4XJSA 2PXAA 2E5LB 4E13A 4X3CA 1RP7A 2G0NA 3NIGB 1R00A 2JI4A 5DM70 5E9WA 4YMTA 1B1CA 2BIFA 3H2YA 5F7JA 3BE6A 2R1TA 2B61A 1YQ9A 3E8MA 3C48A 4UHDA 4LOIA 1TYBE 3LVBA 5JSKA 1TGYA 5CIWA 4B7XA 1T2FA 3TE6A 3AEQB 3F74A 4G9EA 1AXEA 3BRWD 5FAXA 5ABPA 7GPBA 3DGFC 2IC5A 1K6IA 3TD2A 5IBCA 4HNSA 4Q00A 3O8LA 4TQUS 3BVPA 5KOJB 3H65A 4FKMA 5CITA 4FDUA 2ZUWA 4MWGA 3UMJA 1X9GA 3NIBA 4HUTA 4ZZ1A 3UMYA 1ULTA 5CR9A 3VYWA 1XZHA 1N36B 1VMEA 3MELA 1O3YA 3MLAA 4MR8A 2R6FA 4C6RA 1TJ5A 2PXCA 4JLAA 6LDHA 1OU0A 4WFQA 4CKBB 4DR5B 1WB9A 5NLLA 1EGQA 1OAOC 1RQXA 1QFSA 1CUVA 3A1WA 4R1SA 2GCPA 1EU1A 5GVRA 2EKQA 4EF4A 5BP7A 1XCJA 4PX9A 4BHTA 5C5IA 3R9IA 1GTG1 3C5EA 2ZB2A 3AETB 3PGXA 4MZXA 5DI3B 4AJKA 4B3IA 1F06A 3L1IA 1XCOA 4RHFA 3ELYA 3EQ8A 1FQJA 5FOTA 2C9YA 4YRRA 4YXWD 1KO8A 1FS6A 4G0PA 2WU4A 3TIFA 4K2AA 3COPA 5LJIA 3E1SA 3PX7A 3R9XB 4A2WA 1V3TA 4OUKX 3OLXA 1T0HB 2FSGA 1EFHA 1BJKA 2AD1A 2I71A 2HBQA 4PR0A 1ODKA 3L40A 5AIAA 1XOIA 4KBYA 2HR1A 1KK1A 1SR8A 1DKOA 3NM6B 1HDIA 5KINB 4KPEC 3U4IA 4ZDIA 4K40A 2YR0A 4A0RA 1SB9A 2EHJA 2ZVQX 1TMGE 2AXQA 1YS4A 1GZ4A 5KYYB 1Q0PA 2BMAA 2CFSA 2GZSA 3PFIA 2RAUA 3FKSD 2VHVA 3CR8A 4K05A 1M2KA 4E5PA 2HK6A 1M76A 2JGRA 3BWBA 1PYOA 2QF7A 1FZTA 1JDNA 2QMYA 3E9NA 4REOA 3DMNA 4DBVO 4NEQA 5IZCA 1G21B 2DP4E 3B3GA 2B36A 2QX8A 1FUEA 1ZI9A 3ZUGA 1I4WA 4GEGA 4CG2A 4EA8A 1S8NA 3Q5DA 5CD9A 5ICEA 3F2VA 5AI6A 4PHGA 1B26A 3GVCA 5DEIA 3I2KA 5AVTA 5SZHB 1SULA 3OQIB 3UV6A 5KHLB 4YDRA 1UKEA 1BHO1 4P32A 5FV7A 3LPMA 4X1YB 1BFUA 3SF8B 2PH3A 3VR4A 1U9ZA 2FEKA 3AOEC 4H6VA 4K0RA 2QU7A 4G97A 4Z7OB 3LQ1A 4BNHA 1NHGA 3IULA 4KFRA 4TTJA 1J97A 3EGDB 2O2IA 1FQKA 2J31A 1KJYA 1NURA 1YZUA 3EVBA 1TADA 4Q3KA 3WXBA 1R5BA 1J8MF 2X2PA 3N2ZB 4KG7A 3G0IA 1HI9A 1XXHB 2K7ZA 1G21E 3IB3A 3PFNA 5EJFA 3ZIUA 3QA3E 2FN4A 3AEYA 5K3BA 1QWSA 3W2TA 2YJNA 1GN8A 2QZSA 3CH5A 2MDTA 3D7LA 3FRHA 4KQ9A 4MW4A 3SXUA 4ITVA 4MUJA 3N53A 4QLOA 2FPWA 1RAIA 1OASA 2JLSA 1FFAA 3A2NA 3EZYA 2GMWA 4JP5A 3QYPA 5F77A 3JYLA 2R6ZA 4LNUB 2GHQA 1DQRA 4Y7DA 5TMPA 1MO5A 3V80A 4AZTA 4G1CA 1U04A 1L5GB 2ZYDA 3RV4A 1G7CA 3EOZA 3NAZA 2IH5A 1W25A 2MU1A 1MZVA 1X0XA 3G8CA 2VHEA 4BKQA 1XLTA 2A84A 5LVAA 3WIUA 2OZLA 3ZZUA 3HEBA 3I5XA 2VAWA 2W6CX 2ANCA 2XUZA 3L6DA 4GPEA 4E5NA 1DAIA 1N34B 1ABEA 1BRMA 3NDBB 1KSFX 1PR3A 1Z25A 3KOWA 3R3WA 2JIBA 3TNFA 5IC4A 3SHQA 1V8OA 5TT0A 1FFDA 1MORA 1BTOA 1QH1B 4HEHA 1NLUA 1V7QA 2EF0A 5CH8A 2XXJA 1KETA 2VT3A 4JYCA 1L7EA 4NV1A 1W19A 4XD7A 4I66A 1KI4A 2PWAA 2V1UA 4AKEA 2QL9A 5FLEX 4A0FA 3B5EA 2I7VA 3G2JA 4QDUA 3OUTA 2QL6A 1FX1A 2IW3A 1CNEA 2Q6TA 4XGKA 5FO0A 4C4OA 3LJKA 3V2UA 2QBYA 4ZI7A 3SQLA 1BEZA 3WTCA 2QI9C 5JJIA 2QVYX 4X44A 1WEHA 4WA8A 5CFMA 1VKNA 4WECA 3UMMA 1TCCA 2WSSA 1ZUD1 2A88A 2D74A 3KVRA 4GI1A 2PUAA 5EIAA 2GYWA 4GI7A 1RHKA 4JBHA 1PCXA 4PFSA 1IOVA 1WMEA 4XLTA 1OR8A 4IIHA 2R8PA 3VPBA 5IABA 4KR3A 4HZUA 2QP3A 3DW3X 2QZPA 3I23A 2EIHA 1SXQA 4II7A 5DXAA 1SVIA 3IA7A 3PTZA 4JKOA 5K0BA 3SYKA 4E4RA 5K3SA 4C2BA 1D6JA 2FFJA 3OM0A 2Q99A 3AVOA 4FR0A 5KEIA 1E3MA 3W0LB 3MWDB 1GU0A 1NQVA 2GUGA 3CJQA 4MKFA 1P0PA 3CZPA 1W6RA 1F8UA 5TRTA 2BFDB 4D8UA 3EDRA 2FSSA 3DVAA 3W8RA 1G16A 3I45A 1SA0A 4IDBA 1FLAA 1QPBA 2HWYA 3JTMA 3LH5A 2PGLA 3F9IA 4Q1AA 5ITVA 1QGUA 1BMTA 2VI5A 4E7OA 2WFAA 1IH8A 4YCAA 1CX9B 3DDNA 1NTOA 2F9LA 3KXIA 5F76A 3BGDA 1ZD5A 3WRYA 1M2GA 3GRUA 2C58A 1OB2A 3KZ1E 3ANSA 3QFHA 2AJCA 2HT1A 1E3DA 1KZ4A 1TU0A 4FBGA 4UBIA 3ZHQA 2PKCA 3WGMA 3WK7A 1QP8A 1V41E 3JYOA 4NFYA 4URYR 2NNWB 4HD8A 3NBZC 1C0IA 4HAVA 4YY3B 2WT4A 4DREA 1DQPA 2VQEB 4GZ5A 1RIIA 2X5NA 4ASUA 3OCYA 5HZGA 4PSDA 3T41A 3D4BA 3LHDA 3HH8A 5JZSA 3AR2A 3DKPA 4XJTA 3GUZA 1GKLA 3QLUC 4L78A 3ER9A 1R4MB 2IQIA 4PVDA 3CNQS 4AIRA 3EA5A 1ZSNA 3DZKA 3HU2A 2HF2A 1E59A 4RV9A 2J5QA 4KGDA 2GD6A 1XTTA 1N6NA 4BWYA 1IHPA 4W5RA 4PLVA 4RD4A 2XTMA 1A7KA 2IZ7A 2NU7A 4QJ5A 4Q9HA 1E92A 5LBTA 1UQTA 2AG6A 3R0VA 2MINB 2QTVB 3RRXA 2O8EA 4PYKA 1DC6A 1LDBA 2ZUUA 4PYLA 5HJEA 2JEOA 3UJCA 4R68A 5JZBA 4QJIA 4YDSA 1GZHB 1JFRA 1ORRA 1G64A 3QLTA 2GO1A 4G5FA 1N2CA 2FUG6 4KNWA 3DDZX 1R27A 4NY1A 4OHOA 4DLPA 5GONA 3ZWBA 4RM2A 1U31A 4QDZA 3HMKA 3QVKA 1J39A 4NE7A 3U60B 1SFRA 1N9KA 1UF9A 3H9BA 1XDSA 5BUCA 2D0PB 5BWBA 2REOA 1Y98A 2HGZA 2RHOA 4MVJD 4MWEA 1SC3A 2OV2A 4HWOA 3ZIAA 2AVNA 1L5YA 4HTFA 3QVGB 2JFQA 2XCSB 4P3KA 4DEXA 1CDDA 1SHKA 2FP4B 1JIVA 4R6XA 1H4QA 4WOPA 4DZTA 4QD3A 3C3WA 2BISA 2BE9A 5H4HA 1P4RA 4RENA 2AOUB 1SCBA 1U7WA 4RK6A 3IX7A 2GAIA 2GXQA 1GRVA 3CNOA 3VZPA 5JO0A 4JWKA 1LSSA 1RWOA 2QT1A 1H2ZA 3OF2A 4Q05A 1QYVA 5AICA 1YQQA 1B8PA 2XYVA 1ENPA 4M9CA 3FROA 3IIEA 5DF1A 1XAGA 3HNRA 2D59A 1ZD8A 4HGZA 1MR3F 3HWRA 1RCFA 5G1PA 5DDIP 4DCVA 4Z49A 4YASA 4PAOA 2XBUA 4IHKA 2HK7A 4UDNA 5DV9A 4RTNA 5K3AA 3H5LA 2TMDA 1II0A 3LVFO 2ZUBA 3RRJA 4HNAB 1NKVA 1VIAA 1V35A 1RRKA 1SCUB 2I33A 1VI5A 3O8QA 4XZ3A 5BQOA 3TZBA 3Q7EA 4C04A 5FBVB 5B3JA 3GLGE 5BR1A 2F3SA 2V54A 1A27A 3OKPA 3IE0A 4CQNA 1AC5A 2UUOA 1ECGA 3MWFA 5CT8A 4YXFA 4TYWA 5JSZA 1P2DA 2R7AA 4JXZA 2OFXA 4PNPA 2JGNA 2R66A 4OHFA 1PTKA 3OPYB 4BIIA 4ZU6X 5GZ1A 1U0OC 1GA1A 1R4NB 1Y9AA 3AIOA 4FUTA 4MUYA 4RFVA 5JDCA 1WX1A 4G23A 4U3JA 3FFBA 1AO0A 5LD2C 4MYUA 1Z36A 4Q02A 3CNLA 1LNZA 4W8OA 4EGAA 5ADWA 1YZHA 1VRWA 4DG5A 3AI1A 4OREX 2P3OA 3ZOZA 2HU8A 2P5UA 2DJIA 5EEHA 1K3TA 4B6FA 3AVUA 4TZKA 1A8PA 3NETA 1HLDA 3AW9A 4HAIA 2C3MA 4JGGA 4RD2A 3KKMA 2YWXA 4EY6A 2ORYA 2ZQYA 1G60A 4O4IA 5BOSB 3CLRD 3ICQB 3NTRA 1ODLA 1MFPA 4AT1A 2B1IA 2C8VA 2CHGA 4JBNA 1JMKC 1DHTA 3MJRA 1KI7A 4W9RA 4Y9RA 1GPUA 4CTNA 2V7PA 4JV5B 4WY5A 3EZNA 4C4YA 4YR9A 1DIOB 4JQYA 4M0LA 2PZFA 1FSZA 4OSPA 4N48A 4ISBA 2XRZA 4I6JA 2DH6A 1ISHA 3UYLA 4IDOA 3PXCX 3HNOA 5L7TA 2G17A 3NEJA 1B93A 2PJUA 2WJAA 3TW8A 4FYHA 1KNXA 4CTMA 5AXDA 3GUUA 4GPTA 4QYXA 1LW7A 1BWRA 2OEPA 3KJGA 3KYCA 4RTRA 2IU6A 3CMCO 3MWEA 5D2CA 1EAMA 3DZIA 1QAOA 4OY3A 1PW5A 2IS1A 2ECKA 2P7HA 3ST7A 1FP1D 4BFCA 4RDCA 4UXJA 4XOUA 1KI9A 3AVYA 1JG2A 3H9UA 3BAFA 1NVDA 4BX8A 3W90A 4DIOA 3O03A 1TVMA 4RVSA 4RHEA 3WG9A 1HDCA 4BMXA 1Z5OA 1MABA 1QB7A 2HHAA 3IQIX 1YA8A 4LOHA 1OLOA 2ISCA 5DRYA 3S2ZA 1EFLA 3WQBA 5DFAA 4FSDA 1C3JA 2G1AA 4R2HA 5TS2A 3B2QA 3HK2A 5AHKA 1SOAA 4TX1A 3BXGA 2QIPA 3OJFA 1X14A 2WTNA 2IF0A 1S4QA 3IPCA 2XNKA 3JWPA 3P2EA 3LBNA 2A0UA 4HXYA 1CEQA 4IF4A 4JSYA 4X1KA 4ADSG 4C9BA 1NQ5A 5JLAA 3PNSA 1U3UA 4JLPA 2W6IA 3SVTA 2J3HA 5JDIC 2XW6A 3AEUA 3IR7A 4AG3A 5CVTA 3BIJA 3FPAA 3KLBA 4MRRA 1L0BA 2J0UB 2VZ0A 4IDDA 2E4VA 2V7EA 2XOXA 1PZGA 2XB2A 5G1OA 1ZMTA 2Z5GA 3KZNA 2MMCA 1RWVA 1B42A 1Y8QA 1H6AA 1WKVA 2Z2XA 3R3UA 5LXTF 4BO9A 4LSGA 2AFHA 4IHQA 4I1OA 5KNCA 3DXYA 3H86A 2PFKA 1JR3A 3WLFA 3QVWA 2G9ZA 1BXRA 2XWBF 4P4TA 3EPHA 3I09A 3QU7A 1FUKA 1ZL2A 2WIJA 3AP2A 3QKRA 4OU5A 1GPKA 2QIOA 1YJCA 1YRQA 5AIBA 2I78A 2FV8A 3HDQA 4ETMA 4DYHA 5B3KA 1GT6A 3FWYA 3RSQA 3UEOA 3M0EA 3PXXA 1FF9A 1FNCA 3IMKA 4WZZA 1CQJA 3G1WA 2VZEA 1E9VA 1YAJA 3KV1A 4AJNA 3V7FA 3QLVC 1I5RA 2FW6A 1A2BA 3DFKA 4IAOA 1Q77A 1MGOA 1KF0A 4MUGA 4O08A 4RF5A 4Z9YA 3FAKA 4GX2A 4LYHA 2R97A 1ZKMA 1T8TA 4L74A 5LCXA 1UJCA 2BGUA 1L7DA 3E18A 3IXQA 1FW8A 3HA2A 4KFUA 4YAGA 1YVDA 3QSGA 3BB3A 1XJ5A 4CCYA 4AIIA 1HEYA 2PH1A 4R8MA 4B4KA 4OF4A 3F9RA 3LP5A 1V95A 4H3SA 3ZK8A 2Z1MA 1S2MA 3V1YA 1QZZA 1Z7GA 5BYKA 3OTHA 4N39A 2H1IA 2W0MA 4N18A 3N6XA 5EMMA 3LXMA 2NT4A 4GLBA 3U3RA 4BZZA 2QDXA 4KODA 1O1YA 3HB4X 1NMXA 4GFDA 2X0FA 3O1JC 3A10A 3G0BA 3NTOA 1HOTA 3NIDB 1E1LA 2FQYA 2G4LA 1CRLA 4OL9A 5KQRA 1ZIPA 1U94A 3GFOA 4I55F 2BEUB 2WC1A 3MAGA 1JF8A 5K3EA 2P6RA 1JDSA 2QPTA 3VJRA 4QM6A 3Q2OA 4QEZA 1XFDA 4E5KA 1F4LA 2GN4A 3C7DB 4H2DA 5AHWA 4RKWA 4ID9A 4ZVTA 2QLBA 4OI1A 1E79D 4TN1A 5A2QA 2JJ8A 5EHZA 2C9ZA 1R3DA 1WSAA 2WAAA 4YWHA 4XX1A 2PQ6A 1SVSA 1JYFA 3EYAA 10MHA 1RE1A 2IQ5A 4FN4A 4C03A 4R16A 1QVAA 2VQ6A 3GOHA 4HPXB 4OK6A 1U0EA 2NXNA 4Z7NB 3ETCA 1RE0A 4FINA 1SG6A 1Y9ZA 3GJQA 1ONBA 1UKZA 3A37A 3KHSA 4IJ6A 5LXTB 5ISMA 3K6KA 2R4UA 2JZOA 1MCZA 1E1YA 4OG2A 1X1DA 3BHNA 2OILA 4ZV7A 3EG9A 1DCKA 2DG2A 2ZVPX 2H0RA 1DO8A 4GBJA 3HU1A 1ODCA 1DAOA 4PNEA 1B00A 4QRHA 3EIWA 4QHTA 3TOVA 2VOJA 1PJ4A 3DFFA 3L0BA 1QZTA 4W7IA 3JCZA 3LK