3AHHA

H142a mutant of phosphoketolase from bifidobacterium breve complexed with acetyl thiamine diphosphate
Total Genus 324
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
324
sequence length
802
structure length
802
Chain Sequence
VIGTPWQKLDRPVSEEAIEGMDKYWRVTNYMSIGQIYLRSNPLMKEPFTRDDVKHRLVGHWGTTPGLNFLLAHINRLIADHQQNTVFIMGPGHGGPAGTSQSYVDGTYTEYYPNITKDEAGLQKFFRQFSYPGGIPSAFAPETPGSIHEGGELGYALSHAYGAVMNNPSLFVPCIIGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLNGYKIANPTILARISDEELHDFFRGMGYHPYEFVAGFDNEDHMSIHRRFAELFETIFDEICDIKAAAQTDDMTRPFYPMLIFRTPKGWTCPKFIDGKKTEGSWRAHQVPLASARDTEEHFEVLKGWMESYKPEELFNADGSIKDDVTAFMPKGELRIGANPNANGGVIREDLKLPELDQYEVTGVKEYGHGWGQVEAPRALGAYCRDIIKNNPDSFRIFGPDETASNRLNATYEVTDKQWDNGYLSGLVDEHMAVTGQVTEQLSEHQCEGFLEAYLLTGRHGIWSSYESFVHVIDSMLNQHAKWLEATVREIPWRKPISSVNLLVSSHVWRQDHNGFSHQDPGVTSLLINKTFNNDHVTNIYFATDANMLLAISEKCFKSTNKINAIFAGKQPAPTWVTLDEARAELEAGAAEWKWASNAENNDEVQVVLASAGDVPTQELMAASDALNKMGIKFKVVNVVDLLKLQSRENNDEALTDEEFTELFTADKPVLFAYHSYAQDVRGLIYDRPNHDNFHVVGYKEQGSTTTPFDMVRVNDMDRYALQAAALKLIDADKYADKIDELNAFRKKAFQFAVDNGYDIPEFTDWVYPDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xylulose 5-phosphate/fructose 6-phosphate phosphoketolase
publication title Crystal Structures of phosphoketolase: thiamine diphosphate-dependent dehydration mechanism
pubmed doi rcsb
source organism Bifidobacterium breve
molecule tags Lyase
total genus 324
structure length 802
sequence length 802
ec nomenclature ec 4.1.2.22: Fructose-6-phosphate phosphoketolase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03894 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
A PF09363 XFP_C XFP C-terminal domain
A PF09364 XFP_N XFP N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahhA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahhA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahhA01
5I4IA 3AHGA 4D5EA 3DUFA 4K9MA 4KXYA 3DVAA 2C3OA 3DV0A 3OOYA 1NI4A 2PGOA 5DEIA 2OZLB 1BFDA 5DGTA 3AI7A 1UPAA 3UPTA 3M49A 1X7XA 5EJMA 1L8AA 5K3SA 1AY0A 1X7WB 2BFCB 3HYLA 2VK4A 2EZ4A 5K2OA 1T9CA 2EZ9A 3EXEA 1TRKA 4JUAA 2J9FA 4K9OA 3HWWA 4RJIA 1GPUA 3AHIA 3AHJA 1DTWA 1V1RA 2VBGA 1W88B 4WBXC 4QPZA 3F6EX 2BEUA 2BFEB 4C7VA 2AG1A 2BEWB 4K9KA 1PI3A 3LQ1A 1JSCA 2JIBA 1PVDA 1U5BA 4COKA 1X7ZA 5I5EA 3DUFB 1OLSA 1T9BA 4K9NA 1QPBA 1YD7A 2PANA 5I5GA 1OLXB 3DVAB 3DV0B 1NI4B 1QS0A 1T9DA 5K6RA 2UZ1A 4KXVA 2Q5LA 1TKBA 2BEVA 4FEGA 1V5EA 1X7YA 5EJ5A 5I51A 1X7XB 5IMSA 1YBHA 4GM4A 3ZHVA 5HYVA 3EXEB 2DJIA 4K9QA 2J9FB 2X7JA 4JUBA 1DTWB 3AHHA 1YI1A 3L84A 1V1RB 2BEUB 1Z8NA 2IHUA 2JGDA 1YNOA 2Q5OA 3E9YA 1UMDA 4KXXA 1U5BB 1YHYA 2IHTA 3IAEA 1X7ZB 3F6BX 2C31A 1OLSB 4GPEA 1QS0B 4Q9DA 2Q5QA 1OLXA 3ZHQA 2FN3A 2UZ1B 2BFDA 2BEVB 3EA4A 3OE1A 1N0HA 1UPCA 1X7YB 1YHZA 2BFBA 2YICA 1X80A 3HWX1 1PYDA 4D5GA 5EXEA 2EZ8A 2VBFA 2VBIA 3ZHTA 4GM0A 3M6LA 1OLUA 5HGXA 5ESDA 4JUDX 2VK1A 2XTAA 2O1SA 2Y0PA 3ZHUA 2JGDB 3LQ2A 1W85A 3EXFA 1UMDB 2R5NA 1UPBA 1ITZA 2EZUA 1V5FA 2IHVA 4FEEA 2AG0A 3UK1A 2E6KA 1WCIA 3EXG1 2Q27A 4JD5A 2BFDB 2Q5JA 2XT9A 3FZNA 3RIMA 5HJEA 2BFBB 3D7KA 1X80B 2UZAA 2EZTA 4JU8A 3EXHC 2W93A 1R9JA 4GG1A 1V5GA 1UM9A 3ZHRA 2O1XA 2WVAA 2JI8A 5FEMA 1TKAA 5EJAA 2JLCA 1OLUB 4QELA 5HHTA 3EXHA 2JI6A 1OZHA 1W85B 2G28A 3EXFB 4QQ8A 1POXA 3EY9A 2C3YA 1UMBA 2V3WA 1POWA 1MCZA 1UMCA 1WCIB 1OZGA 3ZHSA 5EJ9A 4JUFA 4RJJA 2WVGA 2Q28A 3EXG2 3KOMA 2IEAA 4GP9A 4XEUA 5EXDA 1UM9B 3AHEA 1T9AA 4C7XA 1RP7A 2VJYA 5EJ8A 3M7IA 4K9PA 2XT6A 5DGDA 4JU9A 5AHKA 3EXHB 1V11A 4KGDA 2R8PA 1OZFA 2BP7A 2BFFA 2C3UA 4MPJA 4ZP1A 1UMBB 4RJKA 5K6TA 1UMCB 1KEKA 2G67A 1OVMA 2NXWA 1IK6A 3EXIA 1V16A 1TKCA 4MQ5A 2QTAA 5EJ7A 3M34A 5EJ6A 2QTCA 1NGSA 1V1MA 4KXWA 3LQ4A 2WVHA 4MPPA 2Q29A 2PGNA 1YI0A 3JU3A 4JUCA 4KXUA 2R8OA 1QGDA 1Y9DA 5EJ4A 2C3MA 1Q6ZA 2JI7A 2OZLA 1V11B 4MZXA 2FWNA 3MOSA 3EYAA 2BP7B 2BFFB 1PO7A 1X7WA 4MPRA 2C42A 2BFCA 1ZPDA 3AHDA 3IAFA 2C3PA 2VK8A 3AHCA 3FLMA 5C4IA 3EXIB 2YIDA 1V16B 5ERYA 2JLAA 1W88A 4GM1A 2BFEA 3AHFA 1V1MB 2BEWA 2G25A 3LPLA 5ERXA 2JI9A 1B0PA 3FSJX 4K9LA 2PDAA
chains in the Genus database with same CATH superfamily
3ZG6A 1CEEA 1I3MA 4QPCA 1B2RA 1BE0A 4NNJA 5AKGA 2Q2QA 4S24A 3C6XA 3UFBA 3OJLA 4BTLA 2AC7A 2AR9A 2QA5A 2ZR7A 4ZT4A 1UAYA 2WF5A 5E6UA 1RQ7A 1W2GA 2J8ZA 3A8TA 4KXYA 2YV1A 4MRMB 4XWGA 5D6NA 3RUIA 3Q0EA 3ZD8A 4BQEA 2DBRA 1KP3A 4EGFA 1B6RA 1WPRA 4Y6PA 4F5WA 4Q3DA 2P9GA 2CF6A 2HCBA 2FQ1A 4BQFA 4TLLB 1GL9B 4ZYYA 1PJCA 1FNCA 3EGWA 1B4DA 2CLCX 2AD5A 3I1YA 1BWRA 3E61A 4A10A 1Y8CA 4HVCA 2EDCA 5JXGA 4YP5A 1Q84A 3M4YA 1E98A 3QLVC 4UHDA 4H1UA 4FDAA 1PX2A 3VR4H 4AUEA 3Q7TA 4S05A 2V6GA 2EWVA 2WWFA 3CNEA 1RQLA 4G4SO 3V4OA 2PIAA 2WIFA 3GVHA 2CLEB 1YZNA 3EUFA 1O94C 4QOFA 2GA9A 1KQFA 2IDZA 5I7AA 1EQAA 4K9OA 4KODA 4ONEA 3EJ6A 2ENUA 3KJXA 4ENSA 1J2RA 1GUFA 4D0GA 3CG4A 4POAA 3W5VA 1JHXA 4Y18A 3G1WA 2W6CX 1FDTA 1ECJA 1JU9A 1T8WA 1W88B 2ESRA 4ZI7B 1UT6A 1UKEA 4Y3UA 1JDBC 5T3YA 3RC2A 4TWAA 3SIPA 3ZJ5A 6YASA 3AY0A 2Z4RA 2PT9A 3GO4A 2BELA 4KP7A 1CQJA 5I4IA 4WA7A 3DDUA 3GRVA 4HDSA 2G07A 5KJFA 1H5UA 5LU8A 3T1YB 4IF6A 2J1LA 4WRRA 3TAXA 5JLAA 5K3DA 1NG9A 4R8SA 2PUTA 4YR7A 2GAOA 1JMYA 3H5VA 4E4TA 5CFMA 1IZ8A 3NM5A 4PSCA 5EQDA 4U1RA 2H2GA 3TNLA 5DX0A 4IXWA 3IKTA 1SXGA 4WK0B 2O0HA 3JPYA 3MOIA 3OD1A 4KNVA 1FP7A 1NVKA 5LYJA 2CXPA 4I19A 4PPFA 3DVAB 3DV0B 4LDQA 5FXMA 1T8RA 4QDUA 1NI4B 5EP2A 3TNFA 1EUZA 4ATNA 4JN6B 4C7BA 5KYNA 1HDEA 3RV3A 5GGXA 4I3FA 2G9VA 1C8BA 3C8ZA 5BOSB 5IUJC 4Q7QA 2VRWA 1DT5A 3H9EO 3KQQA 4WBNA 3E70C 1AUPA 1C9DB 4EPVA 2WUDA 4X94A 1T3SA 1NW8A 1JKJA 1L7QA 3N2KB 2H7XA 3THXB 4CQJA 2H5IA 3EZ9A 4DYDA 4EY4A 4ND7A 4O0MA 1TVMA 4UCQA 5LP6B 1YBHA 4FBMA 4HWRA 1V1JA 4EF5A 3SYKA 3C3AA 3OCJA 2IYVA 3D31A 3KKMA 3S2ZA 4D4LA 5DGHA 2VT7A 3CSUA 1EAYA 2OB1A 1A4RA 1I30A 1G291 4XQEA 4ZU3A 5B1YA 4AX4A 3UMYA 3PUIA 1VSQA 3S0JA 1YRYE 4BNMA 1B8NA 1G3IA 3ZV5A 1F48A 1XE3A 2FFQA 2JFXA 1XJWA 2XIJA 3AUFA 5THXA 3FJOA 5G3YA 4DM3A 8ADHA 4D98A 2JFGA 2PKEA 4E5NA 1EJ2A 4F6CA 5F76A 2YFQA 1JEQB 3INYA 1AKTA 3M2PA 4LK3A 3UWMA 3O93A 3RLIA 1V2HE 2HOQA 4DLUA 3RVRA 5JHGB 4KO4S 3U48A 4CNQA 3H2JA 3RK4A 2W42A 1WJGA 1XLWA 5LQSA 5A4MS 5BYAA 4HSGA 2O7SA 1J7KA 1U2ZA 1TCCA 2ZVQX 1DFHA 1F8FA 1UXJA 3EGVA 5F5XA 1DNPA 1UQUA 5GONB 3L6OO 3LC1O 5G1PA 4KQXA 2B35A 1XYYA 1GO2A 4MI1A 5L4SA 4O4LB 1E20A 4FHZA 1X1SA 1II8B 4C7OA 1RXCA 1T6BY 3F6BX 2RK3A 1CY8A 5IDQA 1B1AA 1KOJA 3B5IA 3T1TA 2GERA 1L6RA 1YCFA 1CDDA 1FP6A 2FEMA 1U3TA 1WUIS 4WMLA 3KQHA 2X0KA 1SULA 3C5VA 5C1OA 5E9QA 1Q7BA 5K0EA 1VTKA 4DLZA 3FFWA 4YLYA 2FN3A 3PIDA 3SVTA 1HFKA 5DYIA 3IBYA 4RPJA 2B99A 4MGKR 1JB9A 5F64A 4FYKA 2JRCA 4BASA 5TPWB 1EFLA 6LDHA 4J8PA 2UXBB 3T5BA 2IYXA 2JCGA 1IZ7A 5ALGA 4QRHA 4L73A 4PTZA 3WDLA 2AOUA 1CERA 5TRTA 1ZNZA 4L02A 1XK6A 3EE6A 2I8CA 4TMXA 9GPBA 4B75A 1RYFA 4J0IA 2ZRHA 5HF9A 2QTHA 2CMDA 2ZBUA 5AFSA 5AVZA 3LQFA 1QFZA 3RABA 4GF5A 3IOMA 1XFDA 3D4PA 4CKEA 1A8SA 3NHFA 3RAEC 2P40A 4FGKA 3WV5A 3GROA 3AGQA 4L0QA 1E1LA 4L4YA 1O8CA 1W36B 4L9RA 3MMSA 4AYWA 4DW8A 2Y0EA 4NENB 3E82A 1C1DB 1TQ4A 4IIHA 5J4VA 3GG2A 4DMLA 2VHCA 2WUFA 5H3LA 2IZOA 5DULA 4ME6A 3R0XA 1E0JA 5CHEA 3PNKA 2PS0A 5AT1A 2PXCA 1UEIA 3HE3A 4CWAA 1V8ZA 1UOPA 1Z2OX 5JVDB 3DXFA 4MQBA 2R5NA 3O7MA 1A76A 1U8ZA 1BXKA 1CUEA 1GG9A 1XMPA 2WD7A 3E7PA 3NVMB 2ZRDA 1A5BB 5K0LA 1WSAA 1I5EA 3F7OA 1J2EA 1RWQA 1T6ZA 4M83A 1V5FA 3GLVA 3LM8A 3OIWA 2PX5A 2J3QA 2CHFA 1GIAA 2YWEA 5HEKA 1Z4LA 4ETNA 13PKA 1OE0A 3ID6C 1G98A 1ORIA 2EF1A 1C50A 1NA5A 1VYUA 2JS7A 3KHUA 3MWJA 2J3IA 4G65A 5DLQC 2JHGA 3IE0A 2R6JA 1ZVJA 4YDQA 4G5OA 4JJAA 1FFBA 3H1GA 1EK1A 1QPGA 4X1KA 1YCDA 4MNTA 5ADUS 3UAGA 2BONA 4BEWA 1ODLA 2BFDB 3WZMA 2DWPA 3A6HA 1K7XB 2ZXUA 3DJYA 4EY7A 4S12A 1NUTA 2CB9A 4L57A 2Q99A 4FIZA 1SCQA 4BVHA 1FDOA 4MB0A 2GKSA 1AHNA 4JVMA 2HAEA 1CJUC 2WPDD 4RZ2A 4AP5A 3SX2A 4CUZA 4XDZA 3MJ4A 2QPAA 1XMOB 2BF4A 1Z0UA 4AMZA 4LFCB 2CUTA 4H7DA 3HL0A 3DE0X 3SWWA 2BKUA 4D92A 1ADYA 2CXXA 5FUBA 3NH9A 1PUXA 1EUDA 1TD9A 1X70A 2AX3A 2FAXA 2ZS8A 1BDIA 2PJUA 1FFEA 1C4XA 3DF9A 3T15A 2PLFA 4ARAA 2VXYA 4JGIA 1I6LA 4HDCA 4HXYA 3TUJC 3EVFA 3W6OA 2OWDA 3ABIA 1VI6A 4C08A 5FEMA 3ZHYA 3ITNA 4Z4GA 1ORDA 1JR4A 1O5IA 1PNRA 4GKKB 5K3OA 1UWKA 1P5ZB 3MINA 4K2AA 3BHMA 3K2BA 4KUGA 1NP6A 3UXMA 5LJLA 1XTTA 3V7UA 1H8HD 3L6EA 4E5MA 4YO8A 2FSPA 1DWUA 4CQLA 2BTOA 2HA3A 1E6LA 2LW7A 2NUPA 3Q3CA 2AT1A 1WM1A 2BSAA 3QBVA 4H3VA 4OA8A 4C6RA 4EENA 2R48A 3C8MA 5IFKA 2B2CA 4MUHA 3WRVA 2JAOA 5JDIC 1KEEA 2VTEA 2A67A 4NZNA 1KJIA 3WWOA 4KOEC 2P1DA 1WDWB 4HNUA 1FQJA 1CR6A 4GOXA 3GGDA 4U7HA 3W6ZA 1R5NA 1QB7A 1H22A 5HUHA 2OAQ1 2D7DA 4K03A 1E7QA 5JCPA 3O8CA 2UAGA 4JVLA 5AVOA 3ZJTA 5ALEA 3ZU2A 2H17A 5EPEA 1C8LA 5CFRA 2GUWA 5AKKA 3DKKA 4YPOA 1K9SA 1S9HA 2YJ4A 3MYRA 1GAEO 3N2LA 3MWLA 3RFUA 5BVHB 3T7EA 3T3GA 2JFVA 1AMOA 1OZGA 5A9SA 3T3PB 2XJ9A 1D07A 3A6DA 3KX2A 3TD9A 2XE4A 2DF8A 2PUWA 4KC0A 1MDBA 2VYFA 3P5SA 3B9RA 3JQDA 2DHQA 2RK6A 3K1JA 4P2GA 5I7HA 5L3SB 3ILXA 4KRFA 4YRAA 2WT4A 4W9NA 4ETIA 2DRIA 3ZH9B 1XRSB 2BZSA 2RHGB 2I3BA 1WZNA 3KQMA 2IVZA 4L85A 3EXG2 2I4RA 4D96A 4ER7A 3HBNA 3TUZC 1MGPA 3IX7A 2WM3A 3H11A 5KI6A 2XUPA 1ZK0A 2ZKLA 5DRYA 2R66A 4H4EA 3KTOA 2DH5A 5K03A 4GT1A 4AZ3B 4TSRA 4ZDKA 2WZCA 5LP6C 4YQEA 2QRUA 5ALUA 4EA8A 5BNFA 1WD5A 2BPOA 2HJ9A 2J41A 2Z95A 2GCOB 2FJUA 3HDQA 1X1TA 3K1TA 2KPOA 4KI0A 5DOVA 4LAFA 1DQSA 2WM2A 1PNTA 3PB3A 4D3SA 3GLFE 4MEAA 2P5YA 1FTGA 4L6CA 3L8CA 4HVAA 2H1OA 4NPAA 3ECSA 1UKCA 2NUAA 2CVQA 4MKFA 3UG7A 1TQ6A 3ZHXA 4DQUA 4DR1B 1Z4NA 3RUFA 2DXIA 4FX2A 3AVWA 1O96A 4GX2A 4Q3OA 2ZWAA 4KXLA 1K8YB 1NDUA 3KLPX 5AHKA 1NW5A 3EXHB 3BF7A 5AVRA 4BPBA 1IUOA 4CCYA 1EVIA 3P27A 4FUTA 3KUXA 3X2SA 1WKVA 3JQGB 2C2HA 2WQ7A 2O8FB 5K8TA 3M82A 1IWBB 2C1EA 4B4DA 3D5QA 4HDRB 4I1OA 2P4UA 1OYVA 4MEBA 3KLBA 4ZXFA 1QQAA 1EBBA 1F06A 1R8YA 2FN9A 2YOGA 2WFZA 3HY6A 1EUQA 2YQZA 1TTTA 3GRKA 3R5XA 1UDCA 2I4IA 2Z9BA 4OI4A 3CWQA 2ZSJA 3O21A 1YDMA 4JC8A 1WMFA 2H7VA 1A5SB 1U28A 3PLRA 4O4JB 1P8JA 1E9EA 3U0BA 3ZWPA 5DHRA 4ZHQF 4KN5A 3UJ6A 3OY2A 5CA1A 2PY6A 5EJ7A 2QTAA 1P45A 1Y5RA 3VISA 1T4BA 4IQ4A 4Q34A 5SZIA 2QYHA 2PZFA 2OV8A 5AJUA 2XE8A 3HN6A 1AVTA 2AHOA 4HQNA 4TXHA 3CNNA 4RHYA 2R47A 3ILSA 4XOIA 2DY1A 4JGGA 5CDUA 1W7AA 1M8GA 2ALJA 3AETA 1DRKA 5FULA 4BXOA 2UZIR 3RIEA 2ZG6A 5AQEA 5SY9A 1QTIA 2PSEA 2VF4X 1M5UA 3BCRA 1YI0A 1M76A 2NT3A 4QBFA 4AZSA 2W2VA 3OWHA 4J29A 5HILA 2PYZA 4NZOA 4OUKX 3HGQA 2ZT5A 1CJVC 2UVQA 1SWVA 1EWVA 3MXOA 3R7LA 4F4CA 1I9CA 4CV2A 1T26A 4AO7A 1P2SA 3IOCA 4B8YA 4B7UA 3I73A 1G1MA 3HMKA 5TJ9A 4ZT5A 1ZIYA 2CCJA 2QF7A 4LF9B 1XDUA 1YRHA 3PUVA 4QFCA 3WY9A 2PJZA 1W5AA 1XVIA 4PS1A 3QVVA 5DI3A 3QFRA 3FTQA 1I0LA 3BG5A 2J48A 1ZSVA 4HVTA 1LW6E 5C7LO 1KY3A 1NL3A 5LOVB 3ONNA 1D6SA 3IVCA 4UATA 4J0QA 5MFZA 2JJ1D 4DIDA 3GIWA 3DKIA 3F0TA 1KYVA 5FBHA 2BV3A 3MUFA 4H0FA 4XZ3A 1U3CA 5DTEA 1ZNXA 5BY2A 3DZIA 1AA6A 4M1TA 5BUQA 3WC4A 2PEYA 3CKMA 1GCAA 1SUWA 2BI8A 3I6BA 3RARA 2H8GA 5IXYA 1XVVA 4ZGGA 1ENPA 4YV7A 3UMVA 4JL8A 1U8CB 3W7BA 4QM7A 4A7PA 1AV7A 1H2BA 4CKWB 2AG8A 2L2QA 3LBHA 4GM1A 3O4GA 1IZYA 5EWMA 3T7JA 1RCUA 4WNYA 4AKGA 3AYZB 1YB2A 2ZIUB 2J6IA 1T2AA 1Q5PA 4BFTA 5BR4A 2OCPA 3DLPX 4NYIQ 3V32A 3DKPA 3IB6A 5L7YA 3ZWKA 4I7EA 1JLRA 3DGEC 3KZOA 2I6QA 3MA0A 1E9VA 5HVNA 1UC5B 3QE9Y 5T8KA 1GA1A 2QN6A 2Z0MA 3GX1A 1Z0AA 4AUKA 4XYMA 4K9LA 2LCIA 4A8HA 2O14A 1ZVQA 4P4LA 5IYZF 3C8UA 4KVZA 3C85A 4YWJA 5JS7A 5K09A 3OPXA 2O0MA 4B31A 5KYTA 4DLNA 3U7IA 3WLQA 5GM2A 4H7EA 4HBZA 2ZVDA 4RACA 4CLRB 3W7AA 9LDTA 5CB8A 1J5EB 1U90A 5DNAA 1IY0A 1GGVA 3BE5A 5EHGA 1BFDA 4UBNA 1MO6A 2MSCB 3JAKB 1UKAA 4H3HB 3R7WB 1XXHE 4K81B 1DO2A 1BXRA 3QQ5A 4XASA 1W0KA 3LHSA 5I9MA 5CCEA 2PD3A 1VA5A 4CHTA 1ISRA 3VR4A 3GEEA 4BGUA 2SNIE 1Y5MA 2BSXA 1AQLA 3RAJA 1QGUA 1ZUNB 2A9KA 3OU6A 4GI2A 4M9XA 1X7WB 1NF9A 3VSEA 1Q7TA 1ZLYA 3D8UA 3VOSA 2R96A 4YCBA 3AEQA 5EIOA 3WLLA 2WKRA 1K92A 4G5HA 1HE8B 2QZSA 2B0JA 4HQLA 4RJIA 5DXAA 1IUKA 2QRVB 3DBVO 5EWJB 5KJ6A 5DSZA 1RPJA 4QEDA 4B71A 2GAIA 1UP4A 1Y1SA 4M98A 1UZUA 1ZINA 1EGQA 1CUSA 3CLSC 2CBZA 1P9WA 4M6WA 2NU8A 1SXJB 1RXWA 1Z8HA 3F6EX 4X71A 3RVMA 4ABYA 4JOBA 1FFXB 5IF9A 5AOVA 2A3RA 1CC1S 3ND6A 2H08A 3LYUA 4WKBA 4QDZA 3KSBC 1Z2DA 4OHKA 4EKYA 3W8FA 3G0DA 1D8TA 1J8VA 1SHLA 1KZ4A 5D3MA 4TVBA 5FBVB 1CS0B 1VL1A 4FDUA 4RF3A 5T6BA 1QRDA 1L9XA 2PGAA 2ZW9A 5GY7A 3BJIC 4COKA 3EVAA 1CJTC 5C52B 2VK2A 3ZK8A 4JI0B 3WYAA 4B45A 4W5NA 2H51A 3D0OA 1QH8A 2V5VA 2X1HA 4TZTA 4CM9A 3GLSA 1ODFA 3BFKA 5IT4A 4UC0A 2DB3A 4KR0A 4CCWA 3V8EA 5KSWB 4B4VA 1WZ2A 2ZI6A 3G1TA 5K6RA 3ITDA 2FWMX 1FNMA 1T1RA 3C41J 4UOQA 3RFCA 1MKYA 3LUAA 3DW1X 2WHXA 2WYVA 2ZJ2A 5FHRA 4FQ5A 3FLAA 5LQNA 4JGBA 4YT2A 1CFZA 1CY1A 1MLDA 4PZDA 4NV0A 4CYMA 1GYQA 1DKPA 4J6EA 1FTQA 2OCGA 3JTEA 2E4WA 3VAAA 3ZNOA 1GPNA 4HQFA 4IJMA 3T34A 4EA9A 3WVNA 1KJ8A 3U5ZB 2IVFA 1Y7HA 1SUDA 1JGTA 1ELOA 5AICA 5C8XA 4RTSA 2R6CA 3OZSA 5H1YA 1U5AA 1RW4A 4ZVKA 1RYMA 5DLEA 3EXEB 1ISHA 2CJWA 5CLHA 2AMYA 4K9QA 1SQFA 3TOVA 4AT1A 4LRQA 3NWBA 4DNFA 2YRWA 5JHHB 3PQ3A 1QG6A 2XYRA 4Y6QA 1YI1A 4NEGA 5GV7A 5D00A 3K70B 4Z2YA 5COQA 3UJ8A 3V3TA 2FVYA 5KZMB 1VYHA 4FYHA 1E4YA 1P7CA 1VKRA 3L07A 3TXYA 3GGOA 3BXFA 4A92A 4AF6A 4UM9B 2GDZA 4OL9A 3WAJA 2DCUA 4N82A 1K3FA 4BGIA 3WIBA 4PAOA 1QSGA 2GBCA 3PFNA 1SOVA 3OH8A 3UUWA 2XMZA 3ONDA 4UNIA 2ZOSA 5IEBA 5T4BA 2X42A 2DC1A 1TZMA 1ZU4A 5HX7A 2O06A 1VCIA 2FPKA 3V00A 3DNFA 1QTRA 1EFAA 4A6PA 4ZI7F 4FFSA 1O9BA 4UUAA 3LVBA 4IIVA 3KYDA 2JH3A 3SBEA 4C2BA 4IL5A 4H17A 3QXHA 1P0CA 2XD4A 1NAHA 3BWXA 3LVQE 4TM8A 4JT8A 2I2BA 4NVRA 4LDPA 5C1PA 4DWJA 2RAVA 5I9NA 1P2UA 5GPBA 1P75A 1HOTA 4Q9DA 5T3UA 3ZLJA 3PVCA 1NNUA 3JPWA 1D1SA 2H3EA 2AOTA 3EASA 4BNDB 3AOEA 4V1CA 4KLRA 1GTVA 2SICE 3GN1A 4H7PA 3BXGA 1KIAA 2WJ3A 5T5QA 2QZ9A 4KLCA 3TE6A 3GT3A 3O82A 4M99A 3U1BA 1Z6AA 4RGYA 2RH5A 3DHWC 3OM8A 5DO9A 1ZDMA 3ZHZA 2X0NA 2AQ8A 4Z1OA 3TSZA 2ECPA 5EXXA 1O4VA 4BPRA 1GTMA 3IA7A 5TLSA 2QVZX 2GK6A 2B4YA 3KTAA 2FZKA 4YUXA 2H00A 1J09A 2B30A 4FKBA 1YWGO 5P21A 5LP1A 4M7RA 2P0AA 3AO0B 4Q1EA 3NBXX 3MHTA 1IC6A 5CFPA 3AP1A 3TIXB 1SVOA 3LQQA 1MENA 3IQDB 3AV3A 2P9BA 1W36D 1XC7A 1Z56C 2XA9A 2EIXA 1UBGA 4AJIA 1KA9H 2I2DA 3LZCA 1QHIA 3NT5A 2HBZA 3D0RA 4L5CA 1GGMA 3UBTA 2NU6A 2W0SA 2X1VA 4GOOD 1V41E 3WB2A 4DLBA 2DYKA 2TS1A 1EK6A 3MBOA 1QG4A 3G7SA 4RQAA 2R1VB 3O3OB 5CJJA 2IEYA 4C3UA 5JCOC 1D7AA 1AZWA 1Y8AA 3HB7A 3JQBA 4JJ4A 4QQNA 1KETA 1CQPA 1L4MA 2JJYA 5CTJA 1I4TD 5FUQA 5KREA 1YZVA 4TYMA 3OTIA 4Q0MA 2R84A 2Y77A 4OMFG 3S5UA 1PR9A 4IFIA 3VBCA 2V03A 3TLZA 3ZY3A 1UBNA 4Z0TA 3TX2A 4YR9A 4DR3B 3H2YA 1QV7A 4XLLA 5CR9A 5FOUA 3DKRA 3OZVA 4J1SA 2FN4A 4WN9B 3SEAA 1WXHA 5IJ0B 2RIPA 3QSGA 1A9QA 3SR4A 1ZLXA 1OFGA 2JCYA 5EKUA 1QOZA 2B25A 4F5EA 3QUAA 2VPYA 3ZEAA 4AAYA 3BGDA 3E6AA 4LZNA 4QVIA 2DHEA 4BNIA 821PA 3DZBA 2XH8A 3WMGA 1PFYA 2ZT6A 4TTSA 2PZJA 4CR8A 2OXFA 4JFRA 2GJSA 2XB8A 1EVEA 2OTCA 4P22A 2GBLA 5GONF 3EG9B 4RFSB 4TS3A 5DHSA 4CKBB 4OQXA 3TSYA 4OHXA 2PUDA 3X2EA 4TL7A 3K5HA 1E4EB 1YASA 4O4LF 4OHPA 1QZUA 2NVOA 4I5EA 4HEA6 2QQFA 1D9XA 2XGMA 1XD9A 2ATVA 2DT5A 3Q8WA 1L5ZA 4XCXA 3T7DA 2WKWA 4W5WA 2V4UA 4ACBA 4ZAFA 5GADl 1FTWA 3OE7D 5HJEA 1N8KA 1OX5A 4GD3Q 2QL5A 3L8EA 5L3RA 5K51A 5I7OA 3FI0A 4OBEA 5BWOA 1GDHA 1IHUA 2C04A 1XR3A 2OCIA 3KWMA 3LYAA 2XCOA 2QRHA 2E89A 4KWHA 2WFLB 3CNOA 2Q8PA 3A0UA 3THWB 2JC3A 1BW9B 1TF7A 4LJ4A 5FR1A 4PZYA 2GDJA 1WF6A 4G0XA 3SMQA 3EVGA 1ZD3A 3VR6A 3WLNA 4O4IB 2A4MA 3BHNA 4TV9B 5K8CA 2FI1A 5I7EA 3CB4A 3GC6A 2G0AA 2OK8A 4KSBA 4CRWB 1B3BA 1HQKA 2JGEA 2LIPA 1SG0A 4RELA 1XZJA 3H9CA 3NUQA 3TJMA 1RXYA 6PFKA 5IRCD 3AYXB 3CPJB 1OIWA 2PEZA 1QQBA 1G8KA 3DVLA 2H7YA 3B48A 2XLBA 3I9V6 2GXUA 1SXJC 1DJMA 3OQPA 1E2LA 2W9XA 1IUPA 2JLQA 1YU9A 4HYEA 3PCRB 4MGHA 2YJ3A 4BL5A 4ZTBA 2QUIA 1DLIA 1RHMA 1WA5A 2NNLD 3BGOS 4HMPA 5HQJA 5J4KA 3C3MA 1LVHA 2A6PA 3FGPA 2FUG1 5ALLA 4ZC1A 4BWFB 3OEHA 4ZA2A 4C9BA 4Z7OB 3ML1A 4FBLA 5IBPA 1BHQ1 3PDIA 2BDTA 2VA9A 4ZVPA 3FF1A 3OOHA 3VR3A 2GXSA 3WQQA 1VCOA 3KP1A 1GEGA 4UCFA 1LK0A 3ZDEA 5DN9A 1SQ0A 3P0HA 5AJTA 3AUXA 4KQ9A 3B3QA 4Y7CA 5JVDF 2I8AA 1FXUA 3H6GA 4LHWA 4HGQA 5DT9A 5BSGA 4ZAVA 1OXUA 1EIZA 1Z7YA 2V5UA 5JV5A 1KAGA 2JIPA 4BO6A 4BV9A 2VYCA 1OBCA 4MWGA 3SEZA 4GOND 5CDSA 2V6FA 5IAEA 3GLGE 4Q3EA 4C4XA 5D2CA 4DY6A 3ESBA 2ATIA 2C2MA 2HWUA 1J0XO 2WNHA 3UANA 1SCUA 1LJUA 3IEKA 5CEEA 1DEAA 1A69A 1DIHA 2YN0A 1G16A 2RHOA 4NBSA 5B57C 4R51A 2VQEB 4BKPA 4MDEA 1HV8A 4FQ7A 4DSUA 4JQSA 2GPAA 2RI1A 1NVEA 3FOWA 1CDZA 3N53A 1RRFA 3LQYA 2FP4B 3GJQA 3GK3A 5PGMA 4DUGA 4F9EA 1F7UA 1QORA 4GPBA 5EQFA 1Z12A 1ZN7A 4NDZA 1MEJA 5IABA 1VKZA 4PLHA 3OE4A 4EMSA 3R9XB 1AQUA 2GARA 2NTVA 4I5IA 4JSTA 5A3VA 5KVSA 4PFKA 3B3AA 4WE3A 3M7IA 5DNWA 1EXDA 2AF4C 3L1JA 1JLHA 3AIMA 4H7HA 4FZ3A 1HLPA 4MV8A 1S6YA 1Y8RA 1Z6QA 4KRYA 4N7MA 1VGQA 4H0NA 4JR2A 5J5CA 3TBFA 4CXMA 4FFBA 4DLYA 4PNZA 1V11A 4UTNA 2ZRPA 3H8JA 3R3YA 5AW1A 3L8ZA 1Y6ZA 2PSJA 1MB2A 5SYNA 3E4CA 2J3JA 1BH2A 1JVNA 1TLLA 4JXJA 3D4LA 4LTDA 1F0KA 4PV7A 4R1LA 1U9JA 2O52A 2HYDA 4DLPA 1QQ6A 1UXHA 2C3UA 4J3NA 3VHLB 4NCXA 5AESA 1FYEA 4HZUA 4R2KA 4L0DA 4P4TA 4G24A 1VFNA 4NG5A 3RSLA 1SEPA 2PL1A 4JP8A 5HK9A 4TZKA 3UQYS 5HW0A 1E4VA 1P72A 1Z07A 2J6CA 3HS3A 4YAJA 4A6DA 1RXIA 1YJ8A 1NLMA 3GPCA 3QE0A 4Y9RA 4EPXA 5IAOA 1UKVY 1WHTB 2JIZA 3LP8A 2D5LA 3BWMA 3IKMB 3LCRA 4LPSA 1FDUA 5MFPA 1TADA 2AK2A 1G4UR 1OPRA 3MAAC 4KDFA 4G4JA 4YMVA 2C2OA 5LBTA 2V7BA 3JARA 4EJ0A 1JAHA 2O3RA 2XV1A 4LPKA 3NYWA 5AUQA 1Y3FE 1FU4A 5CFOA 1LPOA 1CYEA 1GL3A 3DL4A 4QEZA 3BB4A 1J5XA 4EO4A 1R6AA 4X64B 1SCBA 1RWNA 2RJOA 1PFVA 1TCUA 3E7FA 2YC2C 3RVBA 1WOMA 5CJ2A 4EAQA 4IAOA 2ZIAA 1ESNA 5ALWA 2AG5A 1E2PA 3FLEA 1RKQA 4LVOA 4TRNA 2JZOA 2P65A 4BY9E 1IIRA 2OORC 1DOZA 1U5CA 3BCSA 3DBHA 1XRNA 1TT5A 1TU3A 2ONCA 2O59A 5FR2A 1K7EB 1XVLA 3LZDA 2PKRA 3D6FA 5EIEA 4C4AA 1I1NA 1XRJA 4KXUA 1AZLA 1DQZA 2WHPB 2IJGX 1YS2X 3N0VA 1JQ5A 3UJAA 3QITA 2C3MA 4LISA 1ACJA 3NHSA 1JEYB 3ETJA 3I1JA 1CR1A 5TVGA 1TXGA 1S2IA 4O4IA 1DELA 1JH8A 4XVUA 3WNQA 2QT0A 1YE8A 1A72A 5JD4A 2CJFA 4QAQA 1D2AA 2QSYA 1J49A 4YMIA 2FPIA 3T3DA 1XRPA 3Q3VA 5ALYA 3HLYA 3PD0A 4GR4A 1YDHA 4R6XA 2PCLA 5HF6A 1E5QA 1X9HA 1QVRA 4LSZA 4TLMB 2ZZMA 1AA9A 2EBWA 2Q4TA 2P3SA 2VG8A 3RKUA 4AICA 2Z6VA 4FP9A 5GP1A 4WSOA 4OL0A 1Y4ZA 3UAOA 3N39C 2ZWMA 3OEEA 4KNYA 1EHCA 3K9BA 1VMKA 3OUTA 4FOPA 3UOAB 5JXJA 4TS1A 4M0CA 1P5FA 3QWFA 1PK9A 5AKLA 4FR0A 2PSFA 4GP7A 1VLHA 1A8HA 4BN0A 2OQIA 2VHQA 3M5DA 2N46A 4LBYA 2ZCUA 3RHTA 3PTLA 4ASUD 5LB4A 1QCCA 2PT7A 2XZPA 3G3EA 2WJHA 4BB9A 1T34A 5HKOA 3Q11A 3E3OA 4QOEA 4FGUA 4IICA 2VJOA 2OR3A 1LNZA 2HTEA 4RPHA 1Q3HA 5BN4B 3TZEA 5LXTA 1XZ8A 3VKHA 2IV3A 4G1VA 4UPVA 2GM3A 3KB6A 3QMMA 3ZUGA 3NHBA 5HR5A 4CVNA 1E3LA 3H4TA 2GCEA 3L06A 4FGSA 3NHAA 1GNQA 5EIBD 3BL5A 1MEEA 2L0XA 3ME5A 3V9PA 1TPYA 4AN0A 4GYYA 4D5EA 4MS4A 4MYUA 1XV5A 2BW0A 2W6PA 3UFXB 1OSNA 4B8ZA 3ZQKA 2QHXA 3PC2A 1EUCA 1NAIA 4WKOA 2CT8A 1YDEA 1C3OB 3E81A 1UT8A 1XKXA 3C3JA 1IN8A 4HX9A 3UHOA 3O4VA 3MCAA 1QGED 5DX1A 4BKQA 3UG6A 3TLBA 3BN3A 4MYHA 2H52A 2P75A 2CNWA 1J97A 3GJ0A 3DCYA 1UIRA 3G9TA 1I13A 5DHQA 4LVCA 5FAXA 3TBKA 3V1MA 1M0EA 2R9VA 1I4OA 1R4MB 1YULA 2R8XA 4IS2A 4RYLA 3K16A 2JJ8A 4AY4A 4MCIA 1KP2A 1MA0A 2O8CA 1T5DX 3CZ9A 4C2UA 3FYUB 4WLOA 2RJNA 4NKRA 1UBKS 1G8YA 2QW8A 4L8GA 2G88A 4KYVA 3ROFA 3TPZA 1W87A 3ZI7A 4YACA 2XBLA 3IVRA 1OV4A 2TMDA 3NEPX 3PQ2A 2GXQA 5IBQA 4JUAA 3MS4A 5COBA 1SBCA 2J9FA 5CYFA 1IB6A 2MYUA 4KXQA 2QN3A 3TVYA 2JGRA 5D6OA 1NJ2A 4EQ6B 2HM7A 1RRKA 1Z36A 5IEJA 3Q7SA 3PX7A 2XBUA 2W6ZA 2YCLA 1ZD5A 2QKYA 3D4NA 2XQIA 3IP7A 1QNLA 3HCPA 4JYPA 3EZLA 2H1RA 5A3SA 4LOJA 5ALSA 5DSTA 1XYGA 3RS9A 4PIPA 4QYTA 1EE1A 1NXPA 1YA8A 4XM2A 4ZRNA 5LOVF 2C94A 3NHWA 3QLVA 2VDUE 1P4RA 1JHAA 3GIDA 5B2ZA 3GDWA 1QO9A 1GGHA 1F4VA 2LVBA 1NRJB 5A4AA 3KC2A 3Q0TA 1BDBA 2QX8A 4M0EA 2NYAA 2P2ZA 1GUBA 2DQSA 2NXNA 4IZOA 3PNYA 4P58A 1YJCA 2DPGA 3LT1A 1TK2A 2A0UA 2V4MA 3L7CA 1XMQB 4ZCQA 3ON5A 4JB8A 3JWIA 3HB0A 4PHFA 2E49A 4UHCA 1DWPA 1NZJA 3NNNA 3F3KA 3GL9A 2C8LA 1LEHA 2FW9A 3ZGVA 3MFQA 1JI0A 2OHOA 4YQFA 1T6XA 2XA1A 4RCZA 3NX4A 2LIVA 4V03A 5C1BA 8ATCA 2ZM5A 3ADCA 5FTMA 1OLSA 3UEOA 4KTVE 3B2QA 2H2WA 4HWKA 3MMZA 3W9UA 5JANA 2ADMA 2OC4A 3CF4A 2ILTA 5DVZA 3IB3A 2JG3A 2AG6A 3G0HA 2ZUCA 3ZKWA 3ILHA 2QEQA 3UENA 1OR8A 3N86A 2AN4A 4LY3A 1MVLA 3DDHA 5AOBA 4EG8A 4A36A 3MUEA 2COEA 4DKJA 1MZVA 5EVJA 3B8HA 1CR4A 3QWAA 3G6WA 2BKXA 3BB1A 4CKXA 3E22B 3WK5A 1KI7A 4MK4A 4F85A 2KX7A 2PUFA 2X8JA 3DLTA 2G4LA 2IPMA 4OU4A 1WCXA 2WINI 4P0TA 3ZV3A 1JG7A 1WUHS 3T9EA 1XF9A 2RHTA 3UGKA 3ZOKA 2QX4A 3C14C 1LSUA 3D6HA 2QVXX 1RCTE 3ENVA 1XMVA 3H8SA 3TMAA 3QF7A 5JI3E 3K70D 2HJGA 4NOKA 2GYUA 1UJBA 2OCAA 4ZODA 4KHPB 1CE8A 1YJXA 4KACA 2JL1A 8OHMA 1DBWA 1XJQA 2PPVA 3QVXA 2VPTA 2Z57A 2FZ4A 1IBLB 2OUKA 4UM9D 1HT1E 2CN1A 1IZZA 2FEXA 2REQA 3C3YA 5CB4B 10MHA 4ZQBA 2QBYB 3KQTA 1PUJA 2J3KA 3F90A 1RWMA 1YDGA 3EH1A 1XVTA 1S4QA 3OWXA 1K06A 4MW5A 4WKPA 4F1KA 2HSGA 5IVKA 1AUQA 2DUJA 1FUUA 5CB4F 2G5GX 4FOOA 3W5BA 2XQVA 4AQDA 2ZRJA 1DAPA 1KYYA 2OHXA 3N7TA 4QFMA 1MB9A 1HOXA 1NQUA 2X4GA 1FFWA 4MVCA 4LYAA 4PHCA 2CUZA 4UUBA 5DHPA 1C7EA 4BGEA 2J07A 4FFRA 1YHYA 3ZDBA 3GFVA 1FXWF 5J2TF 4DYHA 1R0CA 1GU7A 5B4UA 4Q9LA 3REFA 2GZ2A 2QM8A 3CLVA 5FTWA 4ZO6A 4J1NA 1TAQA 3FOEC 1KRHA 2QJRA 3SHFA 3UB4A 5D3KA 1QP7A 1WSBA 1BZYA 2HB6A 1EIWA 2FZGA 2GD6A 2WU3A 4LYGA 3S6JA 3FNRA 3RROA 1L5HA 3RQSA 3WX0A 4IV8A 1IXKA 3TGWA 1SU8A 3M4JA 4LJKA 4W5JA 3UJBA 2YVKA 4QEKA 3PFWO 2UUAB 2HW8A 4PO1A 3LKVA 3GT0A 1N0HA 1A5ZA 1GQSA 2Y76A 4EUNA 4WK6A 5DBFA 1DCKA 4NR0A 4PR0A 5J9FA 3V4LA 3VO9A 1MIOB 4DYVA 2G06A 2WJPA 2GN4A 3M4NA 1ZKMA 5AJVB 4LXXA 4BO9A 4D3FA 5A0VA 3ZYCA 3BGVA 3P20A 1JR3A 4L22A 2QG9A 4HNHA 4RMIA 3HJTA 1DKRA 2EFGA 2ZRQA 1UBTS 4P7BA 3GUZA 2O05A 5BPFA 4AY6A 1IOWA 1NBAA 3DOFA 5HKLA 5F12A 1RKUA 4HAXA 2NUTA 1U4OA 1LRKA 1DKLA 1W34A 2XYGA 3A3NA 3A4TA 3E9CA 4FD3A 3WGOA 5CBPB 1CNEA 3FPEA 2RGNC 1EFPA 1QFXA 2RARA 2D8MA 3GD7A 3L02A 3PE3A 5HGXA 1RXVA 4Q1BA 1OY1A 3BA6A 5BT9A 3GEBA 1X0VA 3ZDFA 1EM8B 1LPAB 4WIAA 3RR2A 4V1CI 2QTTA 1UDXA 1ZONA 3N74A 1FJ2A 4YFVA 4XRRA 1NE7A 3N3AC 3WWDA 2ID7A 3QVOA 3U4QB 4YDRA 4B6JA 1REQB 4M0DA 1DWQA 4LDAA 5H80A 3KKEA 4JYCA 4IIGA 4MP3A 5EY5B 2WRZA 2QAGB 1RD4A 4BNZA 1R4NB 4PAGA 1C0LA 1YIOA 4JV5B 4UTOA 4KK3A 5EKSA 2FF7A 4D9JA 3WRXC 1Z3CA 5T67A 3EF3A 3K9WA 2C92A 1SVSA 1SQ6A 2IHVA 3PEFA 4LE2A 4ARZA 2GCIA 4Y1EA 4B9EA 1HTBA 3ENNA 5JNVA 2I6FA 1MH9A 2FE1A 3HZRA 2GX6A 2VNHA 1JU3A 5A5DA 1HY3A 1NKVA 3F2IA 1GG5A 4Y1GA 1W5EA 4OK5A 4PQYA 3DQZA 3DDCA 2JGMA 3JVVA 5LA6F 4ANFA 1DX9A 3AX6A 4AJKA 3RCBA 4L75A 4DRXA 2AMJA 3IDQA 4OQ4A 1C7IA 1EH5A 3FDZB 1CP3A 3GD5A 3HWSA 3KT3A 3WDSA 3ZXYA 3NAGA 4CDRA 3B60A 3RF7A 4YAFA 1PJ8A 1EFDN 1T0JB 4QUEA 4EJMA 1O95D 4E5SA 5ED4A 3BWBA 5F77A 3WK4A 3FZNA 2O8NA 2ID4A 5IX8A 3EBLA 1YRWA 4WPGA 4DVJA 5F33A 3UHAA 5AM2A 4BMCA 5ALMA 1N5KA 3ZCUA 3K94A 4X66B 1XIVA 1KTIA 1U31A 2EX4A 5KINB 1N5JA 4KI7A 1B8PA 1UM9A 2J30A 2YHBA 2NWQA 2H0RA 4Y2VA 4ZAGA 1WO8A 1HNXB 5KOJA 4CM4B 1FLNA 2LBPA 5AM3A 4FE4A 3VZBA 3CVXA 2V7QA 3M8KA 2X8BA 2F8TA 3N8KA 4EX7A 2FPXA 4QOIA 1NJ8A 3WWPA 2I4MA 4G36A 5A4KA 2BCJQ 5JNTA 4Q9NA 2OYCA 3SX4A 1TGVA 2HIMA 3NYIA 5EQJB 4C4YA 5CB6A 1NJFA 3GNQA 1B2LA 2L19A 1XEWX 2C83A 1VE6A 3IQXA 1EBFA 1U1EA 2FPGA 1ENZA 2B4AA 1HT3A 2FX5A 2YFYA 4MUAA 4J49A 3GUYA 1EZ4A 2O5VA 2H16A 2Z1DA 4ZOEA 2IZ7A 2J7PA 4BE9A 2QSJA 1X94A 4HQOA 4NCIA 4PHTA 1H2EA 2C4NA 2GYVA 2FB9A 4IOMA 2FA9A 1TVEA 2NSJA 4RQTA 2BGMA 4X85A 5TY0A 3I9V1 1W85B 2YCBA 4ND5A 2RC6A 1N0UA 1U0RA 3EY9A 1ZMOA 3B1FA 2OHFA 3GN2A 2H06A 1JG2A 3V2GA 1QVVA 5TGZA 3IUMA 5TT1A 3WP0A 4FBGA 4PGAA 3ELDA 1SO8A 1DUVG 3AJEA 3MVEA 3EIXA 4NOLA 4OBXA 4RX1A 2IF2A 4GXNA 4IZ6A 4QD3A 3A1FA 3FOZA 3AVTA 2XZTA 1GZUA 3HEBA 4F2PA 2CBXA 3IXLA 2EOAA 1F8GA 1PZXA 1YZYA 2F9FA 2VDLB 2WYWA 4HSEA 4P8RA 5TR9A 1ZGZA 1Q0ZA 3WIOA 1I4EB 2YMMA 5TARA 1HQCA 1YL6A 5JDIA 4FKMA 3G7NA 5AK0A 3GOQA 1LI5A 1SPXA 5DHAA 3DLHA 2YJNA 3WP1B 1DDIA 4HH3C 4N7JA 1C0KA 1T0PA 2Q7DA 2FWRA 2O2CA 5EIHA 2YIJA 3FHJA 1ILWA 3SQLA 3IT3A 2HH9A 3KOMA 1ODJA 2OCDA 2H92A 2JW5A 2AOVA 5HZGA 1NVWQ 2VNIA 3W4IA 3K1ZA 2XWQA 3WHPA 1JAYA 4MQEB 1M66A 1W44A 2ZB2A 3AHEA 3MXTA 4I5GA 5DP1A 3UGTA 3CVVA 1V48A 3MERA 3RWMB 1XZLA 1KFKB 3MJDA 5LQCA 2N1BA 3RPEA 2Q45A 2EW8A 4L8WB 1Z6XA 4JXKA 1W96A 3TN7A 4C4OA 2IH4A 2YV4A 1B93A 2Y2UA 1XP5A 1YFKA 3NEAA 3U09A 1ESZA 2IU6A 1U8EA 5GZ3A 2E5FA 4F4DA 4A2CA 1AKNA 4AXXA 4E14A 2HXYA 1QBGA 3F96A 4B32A 1VSTA 2E7ZA 2G1AA 2TSYB 5G4KA 5B64A 2FW0A 4FB5A 5CHYA 3A4IA 3DOOA 2X4IA 4JJ8A 2X23A 1JFFA 1G8HA 3CV3A 4J2TA 4OYRA 1G9TA 3GMDA 1B73A 4O4IF 4TV9F 3DBLB 4PRYA 4WLUA 2BP7A 3O47A 1FYXA 1LRLA 4D4JA 5I3ZA 4NATA 3WO0A 4DHEA 1FS5A 1YGYA 3LP6A 4FKZA 1ZL0A 4B6EA 4E12A 2FZVA 2PMFA 2WIAA 4H31A 3E9MA 3UAVA 3L7NA 4HLUC 4RJKA 5JTTA 3B6JA 3LUPA 3VHXA 1E3TA 1ZICA 1KC3A 4FW8A 1XD2A 5FP0A 5BYBA 1R8QA 5ANRB 2JAPA 4AWXA 2GHQA 4DG8A 5HIIA 1MJFA 1E9DA 4PZ0A 2P78A 4G1CA 1JKFA 1FUKA 4KE9A 3ONWA 5EMJA 2Z6QA 1SXJE 2H85A 3E3LA 3JQRA 1QRSA 3NMUF 1K2WA 2YJGA 3FFAA 4L0MA 1O97D 1AK1A 2O3SA 1A04A 3C98A 3WGMA 4D9BA 3JQPA 2XQGA 2CL0X 3WSWA 3D2AA 5JZBA 2MSKA 3I62A 3DEJA 1J1IA 5TB5A 4EI9A 4DCJA 4YT5A 1J0EA 5G0WA 1LI4A 5HMMA 1JW9B 4CM8B 5KWSA 2D2FA 3FTCA 2XUDA 4HNRA 1F3OA 2ERXA 1E2NA 3EVCA 3NVAA 4BN5A 4BVJA 1XZGA 2HTFA 4PLTA 5K3FB 2X6QA 1T2DA 3HV2A 4LZJA 2C29D 3EQZA 2XUJA 4MI6A 4CIAA 1C14A 3MWFA 5KNBH 4C22A 1C8KA 3RADC 3WLEA 3PKJA 1JHUA 3MTQA 1MN6A 3VH3A 1V9SA 1KERA 1RWOA 4J0FA 4Q6WA 4G8JA 3U7JA 7YASA 2VLIA 3B7PA 3ABRB 3LUHA 4X9XA 3T9FA 3LY9A 5CVEA 1CUVA 4EQZA 3PT9A 3ZJVA 3B9QA 3EVEA 4O6VA 1CQIA 1SMKA 1TL7C 1ZMXA 3AEUB 2N47A 4IZIA 3LUCA 2F8MA 3B53X 2ZIXA 4EFDA 1EXMA 3DE6X 1U8FO 1CLUA 2GBPA 3LPNA 1TA4A 4DIKA 2P7HA 2ZLBA 4B73A 5K5EA 5E3JA 3VNQA 4I55B 4C21A 2YNMC 2FCAA 3EAGA 3MUNA 5D7BA 1UZMA 3TKLA 4PCVA 3RS8A 1SPBS 3HCRA 4FMDB 1ZCAA 4ARBA 4IJVA 3RAPR 2Z04A 1CVIA 3AILA 4MUEA 1NQXA 2X3FA 3OZEA 4MMZB 5K3EA 2VJMA 4TV8B 5AVXA 4NHEA 3TL6A 5A6VA 4KPUA 4XE5A 1JS1X 5AYVA 2HD4A 2ONJA 2HMYB 1P39A 3N0TA 2XNDD 3Q7IA 2XNHA 2QMQA 1L5FA 3H19A 3CT6A 1WX1A 3EGXB 4M1MA 1Q0UA 4FGJA 4MYRA 4K26A 1SU7A 2EEPA 3OQOA 3CE9A 1ZMBA 4DLLA 3C5EA 2NGRA 5CITA 5DNYB 3U2QA 2CLFB 4IJKA 5JJKA 3K2IA 2G9NA 4U2CA 1VMAA 2DY0A 2AVDA 2B3TA 2Q4OA 3HGTA 1QHFA 1A9RA 3JRNA 5ERYA 4CN9A 4F3NA 4HNQA 2YXEA 2F8SA 4NH4A 3VYSB 2QXYA 1KMHB 4OQLA 2OLEA 2WU8A 4WZBB 4N76A 2OBMA 1Q12A 2QRPA 1Z5ZA 1DO0A 1E7RA 3Q9UA 3R6WA 3V4VB 4YJGB 4BFWA 3PI6A 5A7HA 4XX0B 2YZNA 2ZJ4A 4HEJA 1QU2A 1VMDA 4PX9A 4A26A 4TXJA 1DIBA 3FPJA 5A5FA 5NULA 2GN2A 5JAZA 2UYGA 1JFVA 1AN9A 1G18A 1E8NA 3C16C 1UKZA 1QC5A 2BGGA 3BMCB 1H9CA 1K63A 3FYTA 3H04A 3TQQA 1RM3A 4A1OA 1NY5A 3DT9A 3ELBA 5IUNC 4PC3A 3MGAA 3ZJ4A 4X8LA 4Z51A 3IBCA 3AHGA 4K9MA 5FL3A 1PR4A 3CZ4A 4YJFA 5KS2A 1CVLA 4ZV4A 1SUIA 2IK8A 5ITZA 4QBIA 1KAHA 4B84A 1I7SB 3GMIA 2E6UX 3VC2A 1RVV1 2HQSA 4KO3S 1ZZGA 3ZE9A 3VUEA 2A5GA 1M83A 2B21A 1MV8A 2G63A 5CRIA 1W8DA 1DFGA 2MU1A 2XOKA 1S0UA 3NZEA 4FC7A 5JQWA 3TD6A 5M2QA 1EG2A 1FS4A 3I8XA 2A9PA 4MTCA 2RHWA 1U9CA 4PZZA 2Q3CA 4LWPA 4GGOA 1ZCBA 5FEUA 1FSPA 3U3ZA 1DKOA 1SBZA 2OO5A 5ARDA 3ZGOA 3R0JA 2GTIA 3GFOA 1NVVQ 1RFGE 2VPPA 4YUYA 1KMCA 1XELA 3GWZA 3NKLA 3D3WB 2AFHA 4LXTA 3AZOA 3CURA 1SUFA 4QXQA 1PL7A 2PFGA 1F1BA 1TX4B 4NJOA 1XN1A 1Q17A 3TQCA 2K7FA 1MXHA 1CXZA 1W4BA 3OZRA 3QPUA 4MGEA 4QHSA 4RQUA 3LUDA 2HSWA 4Z9AA 1S1CA 4TTVA 3C39A 2IDJA 5DE3A 1ZRSA 2QM7A 3U31A 1RXUA 1VHDA 4J7AA 4V38A 4EFNA 5FAKA 5ALFA 4YRQA 4F2DA 4H4CA 5JR3A 4FNMA 2VSFA 4ZEMA 1Z26A 5JYCA 2A0YA 3I04A 3ZS8A 3SBDA 1XCOA 2JGIA 2YWBA 3W5HA 3CFYA 4U63A 1ORRA 1YBFA 3EBPA 1JLKA 3NETA 1AS2A 1TCVA 4W82A 1ZVVA 2BEWB 4YQYA 1DEHA 4DV6B 3V42A 1JV2B 3KFLA 3S2SA 2QUZA 1KSFX 1PGQA 1DPGA 3F8TA 2ATCA 4WOPA 1XZAA 3AR9A 4IOKA 4KQIA 4OMCA 3RV4A 1AXEA 1VL8A 2JIBA 4R16A 4D45A 2A0XA 2PWYA 3AUAA 1R7RA 2WJVA 4JKIA 3LQKA 2VT6A 5JAHA 2MSEB 1XQYA 4OLFA 4JEMA 4YA6A 4YO7A 4EUHA 5CFQA 4KE7A 3QYJA 2P9FA 3CZPA 3TXXA 3PUYA 4YAIA 2P91A 4PFJA 2Q5HA 4ARSA 1LSJA 1XBTA 3KOOA 5JQGF 3R7AA 4DMUB 4OLHA 4RDHA 5HZHA 5JBNA 3N9IA 4KN8A 2GBGA 5GGYA 4CMGA 1QK3A 2DFLA 1T9DA 1U2SA 4HAWA 1FEZA 3RTAA 3UN1A 4D57A 5BNZA 2GD2A 4CI0B 2Y71A 1HE5A 1U2PA 3DMGA 1UBJS 3S55A 3P7MA 4ENRA 4CLOA 3WOVA 4UZFA 3BH0A 2EVWX 5AXCA 4F46A 2P9CA 4ZVQA 4GE3A 3T52A 4Y30A 3WIDA 4F4IA 2VPIA 2VQ6A 1ZHFA 5LN1A 3O6VA 1I4WA 3SZOA 5JSUA 5LDDC 4IHJF 4EW1A 5K4GA 1IZ0A 1PF7E 3KQOA 1CUXA 1N6LA 5IW8A 1E1QA 2G4VA 5KEIA 1F8XA 3EZGA 5LMUB 3TW8B 3PQ7A 1SC9A 2ZTLA 1M0WA 4JLUA 3TQOA 1L5QA 1BHSA 1N3YA 1G8GA 1PGOA 4WXEA 2VPWA 3EX7C 2FLKA 5EZ6B 3OZFA 4M4SA 4E5KA 3TFQA 4B2YA 3QVSA 2GBIA 3ER6A 4MO9A 1QYXA 4E5DA 5C4MA 1RAFA 3OIVA 1HKUA 2R6AA 3AQIA 1GR0A 3N2GA 4FS3A 1H85A 3SYRA 3WLTA 1O6CA 1V1RB 2VTBB 2XVZA 3F2VA 1TU4A 1XZQA 2W6JA 4DREA 3LKBA 5DV9A 3ZIAD 4II3A 4LYEA 1EFTA 3ESDA 3BVPA 3OCWA 3PQ5A 1OHHD 3WQRA 5CLFA 1TJ4A 4HJXA 1EGHA 2PKQP 4HOYA 2R6R1 1W4AA 4DR7B 4UUMA 1JHQA 1IBRA 1ZM9A 4HGZA 2GPYA 1RRCA 4Q4HB 1PYGA 3N3BC 1KH1A 3HKBB 4CTKA 2JGDA 4KAXA 3QOFA 5DIFA 4DLTA 1DAFA 1UT5A 1YXMA 4BVEA 1KR2A 1DRWA 2XVMA 5AW2A 4WD3A 2OZKA 1FLDA 3G5AA 4HMOA 1NVMB 2H4ZA 4HWTA 5LR6A 4XJTA 2EP8A 3PPXA 4NK5A 3SF8A 1H4TA 5FF9A 4JEHA 1LZKA 1NBME 1Z88A 4ZZ2A 1R15A 2I3AA 3ROZA 3F7NA 2C96A 1VFPA 3ZXIA 3PG5A 4YV1A 4CV0A 1WW2A 2Y6VA 2XR1A 1OU4A 1R8JA 1UFRA 1G8MA 1UIMA 2XMRA 4EKIA 4YAUA 1XA4A 3V8MA 5IHPA 3WBJA 2HRDA 1T36B 1L4YA 3P1JA 1X7YB 3V7YA 2VAMA 3I2GA 4M0KA 1S2MA 4IUDS 2WTMA 4JUIA 2P41A 1VKJA 2CLSA 1R9GA 4QICA 5H70A 1JJFA 3UH0A 1F9AA 4IF4A 4G1EB 1AMNA 1O54A 2NXJA 2F2TA 3LJKA 4JIMA 4Y9SA 5DM1A 1X80A 1T1EA 4YV2A 3PHJA 4TL8A 3NOXA 1YRBA 2G36A 3I5YA 4IP0A 5DWVA 1CQXA 1WZIA 2O48X 4MS1A 3G0GA 2QOEA 2WNSA 4KSYA 1XUOA 1YB6A 3DLCA 4O5AA 1K8RA 3AL2A 1VSUA 1PG2A 2PL5A 3AWIA 1UDWA 4QATA 5JY1A 3KDPA 3EC7A 1ZQ9A 3HLKA 2YWGA 4AJOA 4EO9A 4G5RA 4KPEC 4GM0A 1NQTA 5F3DA 2BT4A 4XI9A 1E2GA 3B6MA 4EELA 4ND8A 1YL7A 4JJKA 2VK1A 5BQ5A 3THSA 1PVVA 5CYPA 5BQOA 3WYFA 1X14A 4PZPA 1T8TA 4AJ2A 2A58A 3FMVA 1KKLA 2NYUA 2QR3A 4NIMA 5EWLA 5BWNA 1H65A 3AB7A 4DGQA 3R5JA 3NGXA 5ALOA 3WK6A 2F55A 1EM6A 1MBZA 2WYIA 1YQXA 3N0XA 4F06A 4JC0A 4WFIA 3Q3HA 1GLVA 4B3TB 4FC6A 1TD1A 1S2LA 1HDGO 3LBFA 3MF4A 3PKIA 4XVCA 5FWYA 1YOVA 1CB7A 1WUJS 2SKDA 3EFOA 1SR8A 4M7PA 3TLCA 3X1DA 4RTKA 1TC2A 4LV8B 2W2PA 2VXOA 4ACAA 1PJAA 3S2IA 4QDOA 5KU1A 2HV8A 2IKSA 2WQZA 4MOWA 4FEEA 3SHTA 5IC5A 4E22A 1K6XA 1M73E 2VYQA 3L1UA 3MQ4A 3O2NA 4GBJA 4C7KA 5LMNB 2C98A 2CYBA 2ZIFA 2PXHA 5B12A 5BN5A 6REQA 3VZSA 5TVKA 4KIJA 3EXG1 5EIXA 1PBNA 1GUYA 2EJVA 3UMGA 1HA3A 4FMBB 3KLOA 3WWCA 1EP3B 2OLKA 2RGYA 2QGZA 2AZXA 3KPUA 3L7LA 3PJEA 5CEJA 3WR5A 1VKNA 2ZROA 3PQFA 5ABPA 3MTIA 1QH9A 1JEOA 5FB3A 1E79A 2JVIA 2X41A 4FDLA 1ZJ5A 3U7QB 2ZJ3A 4LRUA 2GJAA 3BMOA 2HJVA 1OA1A 4PN7A 4XFJA 2HF9A 2AZMA 2HJSA 3Q8KA 4LGMA 5FBKA 3TM4A 1W5SA 2H1FA 5AM4A 1IEQA 4UD6A 1YFJA 2OCBA 4MPTA 1EFRA 4MW0A 1C30B 5BSUA 1R9JA 2AE2A 2IXTA 4GG1A 5GIPE 2HLNA 1Q1EA 1V5GA 2GPSA 1FLAA 1KQNA 1A9XB 2IPNA 1E77A 2HIHA 4C2AA 3OJXA 2V54A 4XD2A 3RVJA 1DXOA 3R5SA 3QTTA 4MUFA 4P35A 3TTWA 3Q6MA 1T4CA 2PCJA 1NR5A 4ZEVA 4DSZA 2IS4A 2NTYC 4B76A 4ZK2A 2HDOA 4QELA 4ENWA 4ALJA 1TEVA 5C8ZA 1NC1A 2A92A 3KE8A 5JD6A 3UIEA 5BR7A 1PVOA 2O8BA 2EGGA 1XZEA 2HI0A 2V65A 1YQ9A 2IDKA 3GUCA 4WFQA 3CCFA 5ES4B 2DPLA 3DYIA 3OOSA 1JDZA 1JSZA 3CVOA 4YRJA 4L5BA 4Y6OA 5HFNA 3GXOA 4BKOA 2ZUEA 1EFUA 1V4BA 4EHHA 3BD8A 4JSYA 4NDNE 4A0SA 3K6RA 3QU2A 4AP6A 3N75A 2WM9B 2FFHA 3IOYA 3V2UA 4L5AA 1FU8A 1USIA 3CWCA 3TZCA 4M8KA 3KHSA 3EW9A 4L4ZA 4W1QA 4XD7D 4Q1DA 3FRHA 1KAMA 4JYZA 4AIRA 3H5OA 4I1IA 3V1UA 3V8VA 1POWA 2QI9C 3GLIB 4V24A 2XVAA 2A7XA 1UMCA 3OSUA 1AGYA 2XAAA 1JHYA 3G79A 3K0AA 3IO5A 4B4OA 2F1IA 4F4FA 1H0HA 2BBOA 1FQWA 3P9IA 9ABPA 1VRWA 1GXSA 4OHOA 4EJ2A 1VC2A 1J8DA 1NSYA 2RGBA 5FFFA 2QMYA 3PICA 3R0VA 1GNTA 3BOSA 4P4SB 5SZKB 1TQ2A 1BIFA 3R0ZA 5TPZD 4IJUA 2PTGA 4OYYA 2VJPA 1VJCA 3HDTA 1DQNA 5H4HA 2AD1A 1NDQA 4TYPA 4BNLA 3DGFC 1AN0A 3A1DA 1H0RA 1TZCA 4RA9B 3AT1A 5ILQA 4KVAA 1ZJ6A 4M9SA 1PWHA 2BJVA 3KLNA 4WUVA 5D85A 1Z47A 4ZQEA 2ZBFA 1Q15A 2ZRIA 1CY7A 3H4IA 3WK7A 4AYTA 2C5AA 2VTKA 1RAIA 4TMFA 1KI1A 4MVJA 4JNCA 3VNSA 3QKUA 1N9ZA 1R0KA 2CFSA 4KREA 5EG5A 1SUAA 5JO0A 1M3SA 2HZ7A 5C3MA 3PUZA 1J00A 4EMTA 1EESA 4HR7A 1JXAA 3IBTA 4U7PB 2JFNA 2VYVA 2H9AA 3KXLA 3AERB 4MHOA 1M34A 4WOBA 3RHFA 2JHCA 2ZYRA 1GPBA 3CGGA 4HZIA 3D81A 5EKTA 4WAUA 1GPWB 5EUCA 4EUEA 4ZDIA 2UU9B 3GVXA 4I9NA 3OLWA 3SJ7A 1KORA 1TW2A 3LUBA 4DPLA 1YFLA 1I32A 2JFUA 4HWSA 2Y1WA 1Z4JA 4Y2UA 3BZWA 2G82A 1HWYA 2M32A 3C7TA 5FOVA 4ZJPA 2EG5A 2BR5A 1QWSA 1P61B 1XAHA 1ZYUA 2OD9A 2P6UA 3B1XA 2O2EA 3Q40A 3AUSA 1GQYA 2EFJA 3DC7A 1EJ6A 3MWEB 1EI9A 4MJXA 2BFFA 1HURA 3HU5A 3C4QA 3KNZA 4MR9A 1TM1E 5EPUA 4YPVA 4JI2B 1HGXA 4XDHA 5CVUA 3T5GA 3IODA 1G20A 3CJRA 2FKAA 3QEAZ 4FHFA 1DADA 1WCYA 1KEUA 4KCGA 1GRRA 3JQAA 4Y0AA 3ORSA 1G3MA 1FDRA 3LV8A 1WMEA 2QVYX 1QRAA 4XQ0A 1KEZA 4RSRA 2BMEA 2EL9A 2YXNA 3EVZA 4MI9A 2ENWA 4HAUA 1RRPA 1WBJB 3BRCA 4JLAA 4LHSA 1M2NA 2XB6A 3QHAA 4MQ5A 3RRNA 3TINA 4OB7A 1PU2A 3I6YA 4XGKA 3WRWA 2RHBA 5C2JB 5LWQA 5DMHA 1E2BA 4FK8A 3PITA 1JHVA 2HA6A 2AH5A 3WB9A 2IP4A 1MGOA 5GM1A 5ED0A 3BK2A 1CUFA 5TF4A 2OMEA 3CSSA 2OV6A 3CQ9A 5EJ6A 2DQZA 1HTTA 4B82A 5KX5B 3UJNA 2O23A 1OXTA 4HK4A 2DLCX 3ZWBA 4J3FA 4II2A 4O2RA 3ANYB 1PG0A 2I7DA 3QMPA 1OGYA 3Q5EA 1WZCA 3PGKA 1BRMA 2PR2A 1P1CA 1X7DA 1KAOA 1X1AA 3MIIA 1PZFA 2D5AA 3JVUA 3EC2A 1NVGA 1UK6A 2QLJA 2YUTA 3A6KA 3NGMA 2CBGA 4CEHA 4GC9A 2ECFA 1I5OA 2IYPA 2XWPA 1GCUA 1IEVA 2VHVA 1RVDA 4LXQA 1CG6A 2OGUA 2JH9A 3AESA 3CE6A 1UR5A 4D25A 2FMIA 3L93A 2EQAA 5HDQA 5WRFA 1T5HX 2H5EA 4MLPA 4WJLA 3CLTD 1G6KA 2EHDA 1GADO 3CN7A 3E48A 4CG0A 4FN4A 4BJ6A 2XTJA 4C88A 1OU0A 2F17A 4YMLA 4E2WA 3FDFA 1Z45A 3TDKA 4P2BA 1Q1NA 1H1DA 2OFXA 3FAKA 2NM0A 4JHXA 3CBGA 3S2EA 3C3KA 4C0LA 1LF5A 1N6PA 2OORA 1LLUA 2WMYA 1ZIOA 4MWTA 3MOSA 3BIXA 4WCFB 1HBJA 2XPCA 4GDFA 4NMWA 3RJ5A 2KLBA 2C8KA 3D02A 2VAXA 1IM2A 3LBAA 5FHQA 1SD2A 2SCUB 3PGXA 3RSOA 3RVOA 2VEOA 2C2GA 1Z7GA 3DW3X 2V8BA 3FROA 4F8JA 1SOWA 2ZJBA 1S2OA 4QXAA 1A0OA 1ZY2A 2WG1A 4QJBA 2Q5FA 4FCVA 5LQRA 1YVDA 2G08A 4GUDA 4DIMA 4XWOA 4ZIRB 3I4LA 3SJBA 1UODA 3TMKA 2MMGA 4YTEA 3C5WP 4AB1A 2Q6TA 4UDXX 3KT8A 5H02A 4BP9A 2QYOA 2CLLB 2XYQA 1KWGA 4DT1B 1IQUA 2IYTA 5BWLA 3DONA 2XXAB 4QU9A 1NBIA 1MRSA 1RRVA 2DKOA 2CNNA 2O3TA 3SNHA 1DBSA 4IJ6A 1NVTA 1P3JA 3GJTA 3AHFA 1QFJA 3JASB 3UWSA 3P8ZA 1IBMB 1LPSA 4RV5A 4YRRA 1RLIA 4CEIB 2Z2KA 3DLAA 3PUWA 4WGGA 3NBAA 1M2GA 1PSZA 2IYNA 3LMKA 1JA9A 3SHWA 4GZ5A 2WSYB 1TUEA 3D0QA 3VC7A 2G1KA 5AM0A 5EOVA 4LI0A 2IS2A 3NBUA 1KMIY 2W6ID 1DHRA 3LWZA 1PFGA 3FDXA 3I9KA 5IJZA 2VWQA 3LDAA 2IIVA 3KEGA 3O9MA 4WY8A 4BNWA 4IY1A 4B3JA 1CEXA 1ZMRA 3KAJA 1VJRA 4AU1A 1Z7WA 2X9LA 2IEZA 3O4HA 3OAAA 1VP9A 4OHUA 2NPFA 3OKAA 3BS4A 1QQ5A 2GASA 3VAZA 4BAZA 2WZQA 2ZWVA 2HX1A 4X1IB 3LHIA 621PA 2YVAA 3WICA 5HQ3B 2C3OA 1LA2A 1UPTA 4JLWA 4KTTE 2X5NA 5JEDA 1KQ3A 3AFOA 3FVQA 2MSNA 5JDCC 1KGSA 3FMFA 4JLPA 5A3RA 1Y8ZA 4Y6GB 2KE5A 1PJ2A 1JE1A 1DFIA 5I01A 1HNNA 4CL2A 3ORHA 2FMUA 2XD9A 4AJ1A 4R1QA 2R4TA 5G41A 2V1XA 3DCJA 1R0ZA 1QV6A 3T7IA 1NN3A 1OXBB 1PNOA 1X7XA 4E32A 1Z34A 1WHSA 4YCMA 4DSOA 5HIAA 1B8OA 4Q39A 4HWPA 1FSGA 4MUIA 2PPLA 3HI4A 3ECAA 2FWPA 2EZ4A 3RSHA 1ONNA 4GP6A 3AF1A 3EFEA 4I55F 1WXEA 4G9GA 5EJEA 1AO0A 4HPXB 2R8YA 1A27A 3QKTA 4LHEA 5MN4A 1FLVA 3AHJA 3TNJA 4OGKA 4P33A 1SCKA 2WW8A 3GAZA 2FCRA 4QU8A 2B7CA 2GHTA 1UDAA 1BEEA 1PJRA 4US1R 4A0QA 5JJIA 3DV2A 4L5JA 2ZITA 2B82A 2E1RA 1IONA 4MP8A 1NNSA 2X58A 2YTZA 4MCHA 4RKFA 5FO1A 2PJDA 4D9CA 5A3JA 3IMEA 4BUZA 4NYJR 4AKIA 4DPKA 4MICA 1ZH0A 3RLFA 2GI4A 2AXQA 3CLRD 3WZLA 4NCBA 3HSYA 1GCIA 1K88A 1DPFA 3VYWA 4AJ9A 4D8UA 1O89A 4IWYA 4BNKA 4KLAA 3URKA 1DAEA 4B33A 3JZIA 4G1BA 1S8OA 5JSZB 3UPDA 4D43A 4W5OA 2OLJA 1BOOA 2HK9A 4Z3OA 3QU7A 3V55A 3UXYA 4ON9A 4CG2A 4B6GA 1W59A 2HDNB 2REXB 2PKYX 2LKCA 2VP5A 4KVFA 3TZBA 4CMEC 4XIGS 2JLSA 4W6QA 1K08A 1T9BA 2DUUA 4TTPA 2HFJA 1R9NA 2BLNA 5E6UB 3W2GA 2VHZA 3I5MA 1RQPA 1LBQA 1XAGA 1RFLA 2ZPTX 3BEOA 3WLKX 4RVCA 4BYGA 4HDOB 2QTZA 4R9VA 5DLPA 5LYYA 2MINA 2NW6A 1LQUA 1NXQA 4QGBA 4RWZA 4DQDA 2OHGA 2NIPA 1NFRA 2B9EA 1MW9X 2E82A 3M5WA 3FMIA 1YB7A 2AF3C 1UJ4A 1U0SY 2IF0A 2X86A 3ETHA 3R2JA 2YUIA 1HSOA 1QYIA 4R84A 1RU3A 1XNQB 1GT6A 1MH1A 1IG3A 2ZU0C 4PWZA 3ZE6A 4Q1CA 3RYTC 2CVZA 3JYOA 3MILA 3OEWA 1R6BX 2NVUA 5JWHA 1M2WA 1XKTA 3V5NA 2JJMA 1JDPA 1MX5A 4EJSA 2D0OB 3HVRA 3FHLA 4L15A 1DG1G 3PJFA 4W4TA 4C5AA 2C2BA 1UC9A 4OP2A 4EG6A 2BM1A 2X1LA 1BC5A 1LTQA 2J4DA 3BC1A 3RSFA 3MTDA 1P17A 4QJ3A 3U3KA 1GVHA 3FUXA 4Z9FA 1HC7A 4EYKA 4ECEA 2ZYVX 5B1HA 1QVAA 1P60A 4Y0VA 5EN4A 2O7RA 3NI2A 3VTZA 1KTVA 5EMHA 3NU1A 3PGJA 4MUKA 4X61A 4XXHA 5CU7A 4AG6A 2OQ2A 4LXHA 4RLFA 4URZR 1ND5A 2FE4A 4GIBA 3UCXA 3PNMA 4HWGA 1CQJB 1MG5A 4HDSB 4AZWA 3AK4A 3FCOA 2BTEA 3JATA 1YNOA 2C2YA 1VG1A 3K2QA 3C7KA 1I14A 4N01A 5FV7A 5A1JA 4A4DA 1Q22A 1V9LA 2DPXA 3R5TA 4Z5XA 5GZ6A 2PZGA 1MO2A 1K89A 3F67A 4R8MA 2B8NA 3K8OE 3E0QA 1P9RA 1JRLA 1KPHA 2FEPA 8MHTA 4BFXA 2Q5IA 3K0EA 4CE6A 4EEKA 2QLBA 3MT9A 5LYJB 3EXAA 3KOYA 2XODA 2VF8A 3A6GA 3BH7A 3H5WA 2OBXA 1J33A 3L8YA 2P6RA 3A9TA 1DX4A 3QY9A 4GPEA 4D02A 4WFKA 5TMBA 5J3JA 1KP9A 1X39A 1I3OA 2BDEA 5FI5A 4RZIA 4WBNB 4ETWA 4C7JA 2EKDA 4D42A 3CUYA 1UPCA 1JKJB 1G9SA 2KLHA 3LYLA 5K7SA 3WQBA 3HY4A 1HF3A 1L4NA 4JL5A 2QWXA 4YUAA 4DB4A 5D5QA 4HDKA 3K3PA 3J7TA 5CMLA 1KO5A 3R6GA 2A5FA 2OFFA 1OGIA 1IEXA 1FYVA 3PFGA 4PC6A 5HZMA 2QZ4A 4GECA 4KE8A 2CV2A 2D74A 4KIWA 5BUCA 2PWPA 5EXSA 3SC4A 3D54D 3QM1A 5DLYA 4S2EA 1S3GA 2E4VA 2C2ZA 1IVYA 1YVEI 2JIMA 2XITA 3U4IA 4YJKA 2C1ZA 5BSTA 4YUVA 1QUFA 4C30A 2B37A 3NONA 1OILA 2GB4A 1AUXA 1OJ7A 2VHUA 3T0FA 5I7RA 3K2EA 4ZU6X 4RCVA 2WZBA 4JLOA 3FBWA 1R9MA 3H7IA 5CBKA 5A7GA 5TQ0A 1RMYA 2J5KA 3DDSA 1Y7IA 5ARBA 2PT5A 2JLWA 3PUKA 4TWBA 2AXNA 3HDVA 3A6PC 4N5LA 3UCEA 3X1ZA 4PYNA 1GPH1 2P9TA 3RTEA 2D3TA 2X3YA 4MROA 3SLGA 3ESAA 4XR4A 3FTNA 5INTA 2QV0A 5DX8A 4X8HA 5A0FA 2RCYA 5FORA 5JZVA 3I0ZA 3IBFA 3LDUA 3PVZA 4GYWA 3SKXA 5IN4A 4X65B 1T24A 4KV7A 4D3ZA 4C7OB 4M7OA 4KE6A 2RGNA 2IYLD 3DFIA 4UCWA 1EP9A 2Z4SA 2BR3A 4I81A 4J7UA 4WHMA 4NAHA 1P6UA 4GPAA 4BAGA 2B2XA 2WMNB 2SKCA 4W5RA 1Z6TA 4FJ0A 3ZN2A 3MJSA 1G8JA 3PWZA 4FLFA 3R4VA 2ZJYA 4QGAA 2JB9A 2H31A 5EIWA 3TDNA 5E7JA 2WJIA 3ORYA 3KVNA 3RVKA 4TMKA 5B3JA 3K9LA 1NX9A 3NR2A 1RKBA 1KBOA 4GSKA 2FUKA 1LFDB 4HEQA 4XVHA 4F04A 3O74A 1T29A 2Q5JA 5JCJD 5FL7D 4DANA 2A1TR 4DB2A 1THTA 3VSAA 4DMGA 1WP9A 4DILA 5D5PA 2AOUB 3ZJUA 4X24A 1N92A 7ADHA 2Z43A 3SJAA 1HQDA 1TJYA 1H2HA 1AMUA 1V7PC 4XWKA 4WXHA 3U3DA 3N8IA 4QTUB 3H9JA 2OOSA 1DQYA 1U99A 3INRA 1D2MA 3QZUA 4HL6A 4KQ1A 4UE6A 4R2IA 1UANA 2QNRA 3R8CA 5JBIA 4KFTA 5B1SA 5IDXA 4R8RA 4A2PA 4EG1A 2D6FA 4G5QA 4G6ZA 4O2BB 3BSFA 2P2YA 1ECBA 5BWMA 4UUOA 4S1NA 3BFXA 1M8FA 3B12A 4FTWA 1OFIA 4K6KA 4ZARA 4F12A 1RKVA 2A0KA 2O0LA 4UBOA 4HUQA 4L4UA 1DMRA 2R8BA 2Q3HA 1U1DA 1USUA 4L9SA 1D4FA 1E5TA 3DPSA 1QIFA 3GJ7A 4A8TA 3G13A 2J09A 4X7BA 1DC5A 1LV8A 1O4WA 3GGJA 3B7GA 4RMGA 1W4CA 3ZBUA 2Y0DA 1DC4A 3MCVA 3UHFA 1E96A 2YVUA 1Y4DE 3VO1A 4KBYA 1S02A 2G28A 1ZRMA 2XHEA 3ZC3A 4TYWA 2QRGA 2CK3A 2XGOA 3KR2A 4RD4A 3S2FA 2WD7B 4NONA 4HTFA 1NUHA 1N1DA 5C8YA 1OXXK 4CCAA 2HMVA 5CCXA 4DDWA 3VRHA 5IP5A 4RNCA 1TT7A 5U4XA 4RULA 1OTHA 1XAJA 1Z4QA 2V3WA 2O07A 4CT0A 4IIXA 2GTHA 2Q5EA 4H77A 1GGFA 2MOKA 1OWOA 1OFTA 4L1KA 4NSNA 3Q72A 4WH0A 3VH4A 3DAPA 3PQDA 4RVHA 2D54A 1JIUA 1ACMA 1ZWLA 4X1KB 3F5SA 4WZBE 2AOWA 3NWPA 2C1XA 2PN1A 4IGAA 3TD2A 4FFVA 4AKEA 4ZYVA 4KU4A 2JD0A 3DZCA 2P9QA 4XFDA 5KO2A 3ABSB 3AGPA 4QDXA 1SIWA 4UXIA 1MC1A 4HPJB 1QMPA 2CZGA 2LKDA 4YP0A 2HPZA 3H3JA 3KT0A 4Y2QA 1SHTX 5I8WA 1GNSA 4HNGA 3HB4X 4OHZA 1GILA 2JLYA 3CA8A 2BISA 1Z62A 2AJ8A 1MC5A 1TAUA 2FRVA 5JO9A 3RC8A 3K6SA 2IUFA 1EUDB 3D3JA 3HUTA 3L5KA 1IHPA 3OQHA 5FA6A 4DJFC 1FRVA 3CNLA 3IUQA 4D0LB 1IY8A 2LR0A 1TI7A 1XHEA 3KRTA 3ZWOA 4KDRA 1U94A 4GBMA 3R75A 4N41A 2CXNA 5AJZA 4I6GA 1CNMA 1N2SA 2IOYA 4NBRA 2E4ZA 1MEOA 4QTYA 2ONZA 4MWEA 3MINB 1R00A 3WNDA 5MDHA 1MX1A 1N9KA 3EDRA 3GDGA 4EB6A 4GKAA 2YH2A 1HL7A 3FTDA 3GVPA 4BLSA 4CQLB 1GY8A 2JEOA 2NUPB 1AG9A 3M4ZA 4DCTA 1IM5A 4OAPA 4X20A 3NRBA 4FU0A 3AVUA 4PYRA 3SI7A 1QTQA 4Y9UA 4KPYA 3G6KA 1H8HA 5M7EA 4B6FA 1DTSA 3T1QA 3VKVA 4H59A 4E31A 4ZHQA 3QW2A 1SVWA 2IOQA 2FEAA 3HC7A 2Z8YM 4LECA 1GQOA 1Y3CE 4G56A 4IKEA 1O58A 1WEKA 3A2NA 5EIFA 1I01A 1F2TA 1KVUA 4MVJI 2Q0HA 4HDMA 3T7KA 3OO0A 4WOCA 4RHUA 4BC0A 5A9SB 3C3WA 4DS3A 1L5NA 1CZOA 1Z22A 3W1WA 1VLJA 3TB4A 1MRNA 4J7CA 3T5AA 3QMVA 1KI9A 4ZCIA 4GL4A 4LXGA 3SBXA 1E92A 1IBKB 3HA7A 1E59A 1TJ3A 3DKVA 1W2WB 4NK4A 1G7RA 4G37A 1G59A 3SFTA 1DI0A 1OYYA 1PDVA 4I1YA 3FWNA 2YWRA 3BWDD 4MWOA 1N2CA 4NU5A 4ARVA 1EVKA 2Q3LA 3H11B 1UBFA 4HLUA 3QUBA 2X2FA 3A7DA 1H4QA 3ZX4A 2JGLA 1KSHA 3K8QA 1I51A 1VE7A 4B3HA 4TS4A 1UK7A 3RIYA 2B3DA 2QQ0A 4UFOA 3O8DA 2NV6A 5AK5A 4Q16A 3SJZA 3NFYA 4IXTA 3VR5D 4EATA 1RWKA 4K6MA 3VC3A 4HLDA 2AZ4A 4B0PA 5CAEA 2BFOA 4EHLA 3QLUC 1GRCA 4W63A 1B1CA 2G4CA 2QD5A 1P1KA 1B15A 2O1EA 2W6QA 3KWFA 3ZLVA 1JAIA 1VIDA 1QFSA 1U8XX 4F21A 1J90A 4AF7A 1FPQA 3DS8A 2NUAB 2WU0A 4X62B 3GPLA 2I03A 1NBOA 4LYYA 5AUOB 4G5YA 2Z5FA 5KVQA 1O96B 3TUIC 1WDLA 2H1IA 3H8VA 4RA6A 4XUCA 4EMUA 4DDUA 1SKYB 1X8KA 5K8UA 2E85A 4M0MA 3MTJA 1L7DA 4CCYB 4P92A 3RU7A 2ZI3A 4RVDA 4XOUA 4CM6A 4HX5A 3UF0A 3HDGA 1D6MA 2Q4BA 3VMFA 2R7NA 4MUNA 1ZIPA 2GZSA 2RIRA 5EYPA 1PO7A 3COWA 3PDWA 3BWCA 2ZIWB 3LT0A 3F9RA 1TEXA 4URFA 3ZH2A 3CRMA 1JHDA 1B42A 3NAZA 4X00A 3O26A 4NAUA 3R74A 4B48A 4DRYA 5CXUA 5HP4A 1K0FA 1Q57A 3KSDO 2TMYA 4L7QA 4IKOA 4J7XA 3HABA 1L7XA 5HCNA 5DBGA 3B6ZA 4TUYF 1QP8A 2C3PA 1NOJA 2IY8A 1JALA 3B1VA 3HR4A 3R8XA 4YRSA 3FIJA 4LXUA 2EV9A 4MVJP 4JP1A 4ZVRA 5A5VA 2AMLA 5I9LA 1AURA 3QBEA 2YNMA 4KDEA 5B1IA 1RWWA 4C0HA 3OCYA 1RI4A 2FXVA 2GAJA 2QIOA 4YH1A 5CA1B 4DNOA 5CJPA 4PLWA 1JFSA 3HSKA 1Y8QA 1G66A 3HWRA 2Q3BA 3KHTA 4MX8A 2C00A 5IYZA 4TROA 1U9IC 3C3DA 1Y6GA 3BSSA 3TTYA 2ZB3A 3TLJA 2IYAA 1N36B 7GPBA 2JFOA 2IY9A 5E8RA 5DN6D 2EJTA 3FOBA 3AETB 5DMXA 3E15A 2FGJA 1R5BA 2LD4A 4BXOB 3DOHA 1P9LA 1DIGA 1GRNA 2ZI5A 3C4JA 3E8MA 4J4HA 4FFNA 2OESA 3CM0A 4JOQA 4LRWA 1VB5A 4YHBA 1SC6A 2EIHA 3FVVA 3W3AD 1MAWA 1XB2A 1ORHA 1CUCA 3TM5A 2H6EA 4GEKA 2ZSHA 4LCBA 1EDZA 3C1OA 4RGQA 1YK1A 1Z5NA 2VRCD 5HCUA 4B3DA 5KX5F 1TMGE 3AH8A 4RWEA 4AMUA 3L40A 4YCSA 3U17A 2C4WA 2H2AA 1SZDA 2H2FA 2ZEJA 3OFJA 4ZMSA 1ST2A 3I01M 3T5TA 2QMHA 1K6JA 3ONVA 3W8DA 2EJCA 2QGFA 4YCDA 1YA4A 5KWVA 2B94A 3L0DA 4K87A 4DA9A 4WT7A 1J8MF 3C7AA 3NTXA 5HK8A 1Z7BA 2WJ6A 2WWIA 3E0XA 3HY3A 4H6PA 4QSMA 2RD2A 3RRZA 5DI3B 4K8RB 5AWFC 2BI7A 4F0JA 5L8VA 4M1WA 1G8FA 3M5CA 4O5OA 1R0YA 2HFK