1BMQA

Crystal structure of the complex of interleukin-1beta converting enzyme (ice) with a peptide based inhibitor, (3s )-n-methanesulfonyl-3-({1-[n-(2-naphtoyl)-l-valyl]-l-prolyl }amino)-4-oxobutanamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
167
structure length
167
Chain Sequence
GNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTERLEUKIN-1 BETA CONVERTASE)
publication title Peptide based interleukin-1 beta converting enzyme (ICE) inhibitors: synthesis, structure activity relationships and crystallographic study of the ICE-inhibitor complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 43
structure length 167
sequence length 167
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1998-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bmqA00
2C2ZA 4QUHA 4EHNA 5LU8A 1SHJA 3H0EA 4AWAA 3SIRA 1GFWA 2CNKA 1F9EA 3H13A 3NS7A 3UOAB 1RHRA 2XZDA 4AW9A 2C2OA 3ITNA 1I4OA 2H5JA 2QL7A 2WDPA 3GJSA 3EDQA 2FUNB 3NKFA 4N7JA 3DEKA 2C2KA 2CNLA 3NR2A 4EHKA 1BMQA 4ZVOA 1M72A 4FDLA 4NOMA 3KJFA 3S70A 3R7NA 2H51A 3PD0A 1QTNA 4NOKA 4QUEA 3S8EA 3D6MA 2CNNA 4N6OA 4PS0A 4JR1A 4QU9A 1RWPA 4HQ0A 5LU9A 1CVRA 5IAEA 4N7MA 1SC1A 3IBCA 2QLJA 3KJNA 2FP3A 4ZVUA 1K86A 5IAJA 3RJMA 4QUIA 1RE1A 2HBQA 4PRZA 1I4EB 3V55A 4D3ZA 3D6HA 4JJEA 4QUDA 5IASA 5IAGA 2AR9A 3OD5A 4QU0A 2QLFA 2CNOA 3PCXA 2HBYA 2J33A 4NBLA 5H0IA 5IC6A 4QULA 1RHKA 2H48A 2K7ZA 1ICEA 3PD1A 2H4WA 2XYGA 2CDRA 4NBKA 3V6MA 3R5KA 4N5DA 4QUAA 1NW9B 4QU5A 2QLBA 3R5JA 5I9BA 3P4UA 1RHUA 1RWOA 4ZVQA 1F1JA 5IBCA 3GJQA 1K88A 3UO8B 1KMCA 3V4OA 1RHJA 5IARA 1RWMA 2CJXA 3GJRA 3V6LA 1GQFA 5I9TA 5IBPA 4ZVPA 3R7BA 1QX3A 1RWVA 4NOLA 4NOJA 4PS1A 1I51A 2H65A 4QTXA 4ZVSA 4QTYA 4FXOA 2FQQA 2J31A 2DKOA 3BIJA 3IBFA 3R7SA 3K7EA 1RWNA 3GJTA 4DCOA 5IANA 4IEFB 1RWWA 1PAUA 1PYOA 4FEAA 2QL5A 3H11A 1SHLA 5K20A 1RWKA 4LSZA 2XYHA 4EJFA 1RHMA 3P45A 4EHLA 2H54A 1RWXA 4EHAA 1SC4A 3DEHA 2XYPA 4JJ7A 5IBRA 4HQRA 5IAKA 4NBNA 3H1PA 3H11B 4DCPA 4IYRA 3SIPA 2Y0BA 3DEJA 1NMSA 4JB8A 4JJ8A 4QUJA 1I3OA 1CP3A 1JXQA 2XZTA 2Y1LA 5IC4A 3E4CA 2C1EA 4JR0A 4QUBA 4I1RA 2J32A 4JR2A 3R6GA 4JQYA 4N6GA 4PRYA 2CJYA 2NN3C 4QUGA 1NMEA 2H4YA 2HBZA 4ZVTA 4M9RA 4HVAA 2P2CA 4ZVRA 2H5IA 2C2MA 4EHHA 3R6LA 4I1PA 4DCJA 3D6FA 1QDUA 1IBCA 3EDRA 4N6NA 5LUBA 3QNWA 4FGUA 1SC3A 4EHFA 5LUAA 2J30A 4D3YA 4D3XA 4AWBA 4QU8A 3KJQA 3V3KA 1NMQA 4EHDA 1RHQA 3V4LA 3DEIA 2QL9A 4JQZA 5IABA 5JFTA 2HBRA
chains in the Genus database with same CATH superfamily
4YAFA 5EHQA 1HTTA 2D5LA 1Q0UA 1YUMA 1KSJA 1G1AA 4E31A 4LYFA 2H6EA 1FVXA 2RHJA 3ZE9A 1QGZA 1EFKA 4B3BA 2R751 2WWYA 1EBFA 2J5QA 1TNDA 2CVOA 1L7PA 2Y2UA 3W8EA 2HCRA 4D7AA 2JKVA 3RG2A 1G21E 1QTRA 2J9RA 4BNIA 1ISRA 3C7KA 1BXZA 4LGVA 5EEHA 3R75A 4IDFA 4OQEA 2DHCA 4FT2A 4BQSA 4YR7A 2ZT8A 3DUFB 1XMIA 4U02A 4Q6BA 3W8FA 1SC1A 2J3EA 5ERGB 2VDMB 2RGNC 3EBPA 3JR7A 1AIPA 3R0ZA 3WDMA 2FV8A 2WA1A 4N82A 1XQXA 1T2NA 2TMKA 4J49A 2ORED 3ZS8A 5ALMA 4C06A 1BCSA 4UZFA 1L5QA 1OWOA 1W6RA 5J4YA 1OXUA 3FPFA 3QF4B 2AH5A 3RKRA 1TLFA 2ZBRA 3JZFA 3T3EA 4D4MA 4D9FA 2CKMA 2WVGA 4QOFA 1NBIA 3VH4A 3TR0A 5CB8A 3L8EA 3UAVA 4MMYB 3VJKA 3IS3A 2LCIA 2JASA 3VKGA 3OCVA 1JG4A 4RPIA 3GLGB 1MUUA 1T2EA 3T5MA 1LX7A 4ZI2A 1CDZA 5EJ6A 4HP8A 4YJHB 3RIYA 2IHZA 4CRWB 4H77A 3L0BA 3K0HA 1HQCA 2JARA 1R1DA 5LFAA 2DE0X 4ZOQI 4L8GA 5FL7D 4HH0A 1P3JA 1UMCA 3A7EA 1NI3A 1AG9A 1QOQB 1N9KA 1HA3A 1Z5ZA 2PGLA 2Q1YA 2ZWMA 3EIHA 3KJHA 5JPIA 3DXFA 3H8VA 3CVJA 1R0ZA 1T5DX 2BYTA 3A1FA 1L2TA 2HF2A 3ETDA 3KS9A 3TCNA 4BO7A 4JSTA 1XIVA 2M98A 3GVIA 1ZUNB 3DAGA 2R60A 1QKJA 3KK0A 2GZ1A 2AN3A 3G6WA 3KZVA 4IFBA 5FCDA 4ENWA 2RH4A 1JDSA 2MIIA 3GZNA 3N59A 5DNEA 1NULA 1C1YA 3EEQA 5CJPA 2QJOA 2RG7A 2O3TA 4M83A 5H8WA 4JLAA 2D3TA 4O3FA 5BV7A 5ELLA 2PUJA 3T54A 4WCFC 5D85A 2QL5A 3FCXA 2OILA 3DZCA 5DULA 4L76A 4U3JB 1C3JA 4I4TF 1AKWA 1I4TD 3W5CA 4KU4A 3B9PA 4LY0A 2JJ2D 4HDKB 2HEIA 2ECQA 3I37X 3ETJA 4KDEA 4G67A 3ZDXB 4YRZA 1KDTA 3DSRA 1HYQA 3M9LA 1JIKA 2NZ8A 2XUFA 1S1CA 2X1HA 1FU7A 3ILHA 3OX3A 2J32A 4KQWA 4XGNA 3ZGZA 1ZSYA 2BY4A 4FMCF 1JILA 3GFGA 5IFLA 1AS0A 1A8PA 1XRJA 2NN3C 3E3OA 1NMEA 2FF5A 3OUUA 4YAWA 3TW6A 4CCAA 1JYSA 4TS9A 3AIIA 3JTEA 4MEBA 2R0QC 2QX9A 3U6KA 3RU3A 2XNDD 2VL7A 4NFYA 3RC2A 3CLSD 4IH9A 1Z12A 5A6VA 1EFRD 1XP5A 3GMSA 1RQNA 5H3HA 2HLDA 3D8HA 4HGQA 1U7XA 3AK4A 1MO5A 4YK7A 1C50A 3BXFA 5TQ2B 5FOXA 2GCNA 4UBJA 4DIMA 4Q1FA 3V7UA 3H0EA 5JATA 4RO0A 3HB0A 4L7VA 1E7WA 4V2UA 5C51B 4LE0A 1GIAA 5C9ZA 2X13A 3DBOB 4NICA 2RGBA 4K40A 4HWPA 1QWSA 1BMDA 3A1TA 2M6RA 1UJ2A 3O91A 4KO4S 4PZ0A 2GEFA 3O4HA 5COBA 3S2IA 1QQ7A 4DQKA 1MC5A 3UATA 4IUBS 5FTNA 2WMNB 3G2OA 4ZGGA 2J6HA 5L7TA 2HC9A 1EX9A 1CULC 2WK1A 1P9LA 1VECA 5BV1A 4DUYB 1IBSA 5B7PA 4GXQA 2GA8A 1SB8A 2C82A 1BS2A 4AQDA 1E2FA 2IPAB 4Q9JA 5I7WA 1DAFA 4IGKA 1USWA 2ZWOA 4BJ5A 3ONVA 4N40A 3OFKA 1RIFA 3MCUA 2WLSA 4LSMA 3URMA 3LMKA 1KZ1A 5A3QA 2PMKA 2ZVQX 2VNHA 1H4QA 4ZO6A 1R6DA 3STVA 3UAOA 2BGKA 3O82A 4MPTA 2KS6A 2RH5A 1DC5A 2GOYA 4V0RA 1SWVA 3N2KB 1WNFA 2HBYA 4YWJA 5EVJA 3EUAA 1GRCA 3ZLJA 3ROQA 3MLAA 4OJTA 1YTUA 1ZR4A 4X8MA 3CR3C 4OP1A 4HQKA 4K9NA 1G8YA 2HMAA 2XKAA 3DLCA 4QJBA 4UULA 1W4RA 3KTAA 4X24A 4PF1A 4ASUD 2PUFA 3R5HA 3MA0A 1K6JA 1EUZA 1E2PA 3MD9A 3NTVA 3Q10A 1JKFA 5AKLA 3U6BA 4BEJA 4B6QA 2FDRA 3KPWA 1PEDA 4M36A 4RENA 2P2SA 3V2HA 3R1IA 4PM4A 3VU8A 1Z34A 3AUXA 1KEVA 2C07A 4GWLA 1XCBA 2CSUA 4C0KA 4JQCA 8ADHA 2BFFA 3G8CA 2QN3A 3BE8A 1O3YA 3CW2A 3DD5A 2VDLB 5U4QA 4UREA 4IHAA 1PFKA 4EMTA 3MJDA 4LKRA 3IEUA 4QTZA 1Y4ZA 1JHRA 3GVCA 3LBFA 1UMBB 3JYQA 3ZV3A 4EKIA 2V3WA 5DGHA 5L3SB 4CEHA 2MSKA 1PR6A 1UC9A 2RHMA 2W4MA 4BKOA 4D5EA 4K9SA 4DB4A 4YJ2B 1PBNA 1XMPA 1MB9A 2VHQA 5HM6A 3TOVA 1XI2A 2AL7A 2OZEA 3M3HA 2ODBA 2WIKA 2XXBA 4MRSA 1KHTA 4E0BA 3JALA 4EA7A 3AW8A 4FJ2A 1JDUA 3WKEA 2PQ2A 1SG0A 3TPFA 3OIVA 4RKFA 4DCVA 1AGRA 3I6IA 4F97A 3VMFA 2I2WA 3DE7X 4NCIA 3EZGA 4JB8A 3SDZA 3VTKA 4AJOA 3RVQA 4L72A 3H5IA 2Y1LA 1U2QA 1P7CA 4LHSA 5AKXA 3ZDCA 5K0TA 2Q0QA 1KZGB 1IY2A 2GEKA 4ESOA 1ZITA 5C1IA 2JHPA 3V7YA 2D1RA 5G02A 1R9GA 2ZTLA 2DU8A 4KZKA 3KBBA 4JHLA 4YACA 1IBCA 1Z26A 2H2DA 3DDZX 4FHZA 3COSA 3LCMA 3K8QA 4K3UA 3W78A 5KB3A 4HN9A 4BB0A 1HF3A 4KIFA 4S1NA 1M8PA 3OU7A 2LIPA 4YCLA 1W49A 4QYWA 1ULZA 4MQ5A 3USCS 3KKPA 2DH6A 2HLHA 3F9RA 3GHYA 3VNRA 3FDZB 4BLQA 1ZZGA 4Z1OA 1ZU4A 2EX1A 4OL9A 1QM5A 2G06A 1W4LA 3ISJA 1SBHA 4BVKA 4Z3DA 1EJ6A 3IPAA 1MB4A 3IUNA 4WK2B 3GJSA 5LWHA 1ZVQA 3SCZA 4GPAA 2WAAA 4A3SA 4L15A 2BI7A 1JDVA 2FZLA 2Y9MB 3FVRA 4BMXA 1F1BA 3VR3A 4BNWA 2LDBA 5EZ5A 2GHQA 3NOQA 2X0NA 3T9FA 4Q4CA 2OV4A 3O2JA 4RJ2A 2V96A 1QFMA 3TSWA 4FHDA 5HXAA 4L4ZA 1SXJB 3F9IA 2B4KA 2IXEA 1ISPA 3BXXA 4R1OA 1ODLA 1XDUA 1M2VB 3NBXX 4U2KA 4W9NA 4I08A 1JSRA 1T1EA 1HUQA 1L4GA 4LYHA 4MX8A 3RODA 4YRFA 2H1RA 2B8WA 2GM4A 5KWEA 5ALJA 3STTA 5BOSA 1KK3A 2BFNA 3R41A 3HCOA 5K8TA 4KRGA 1EUQA 3LT0A 5CBKA 1P72A 1TCAA 1Z35A 5C7IO 1OX5A 4E09A 1RU3A 2Q5CA 1LBQA 4YAKA 2EW1A 2PDAA 1OYOA 1RAIA 1EEXB 1QYRA 2ACWA 2ZK7A 4O4LA 2OFFA 3WV4A 4Y6QA 1SKBA 4C43A 4D81A 1PUIA 3I28A 5EJ8A 4PVCA 2I55A 3EWIA 3L4SO 4Y2UA 4PLWA 2VA9A 3N0TA 4ADSG 5LNK1 1ZA1A 4ID9A 4YHBA 3AHIA 1G8PA 4I4NA 4RKEA 3BD7A 3WICA 1C7RA 1XTTA 1THGA 3RS3A 1XTJA 3L40A 3G0DA 4OKIA 3ZHTA 1JB1A 4G89A 2A7XA 3ESYA 4JP8A 5LYYA 1N0HA 4DRXB 3E03A 1T4MA 2WOJA 4I6JA 5LP6B 4NYIQ 2P41A 3DTNA 3LIIA 4HHEA 3K0CA 2HRCA 5AMXA 5K5EA 4BMCA 1QGYA 1BEEA 1U1IA 3T1VA 2JG3A 3KUCA 3ZY5A 1H1DA 1XN1A 5LXTA 4BO4A 2D13A 2R44A 5DM60 2BBSA 2C04A 3FPLA 4KQHA 2VJBA 4H3SA 1CIPA 2AN9A 2A0UA 4C2TA 1WCWA 3WP0A 2ZRKA 5F7ZA 4COOA 4DMFA 3FDJA 3TNFA 2R1ZA 2ISQA 2V7VA 3C6MA 1JG2A 5CT6A 2VJOA 1CNMA 3HWSA 4FFMA 2B8TA 2JGDB 1JEYA 4MS1A 1TM1E 2NV0A 3OCUA 5G2OA 5FAKA 1QP4A 2NVUA 1GCIA 2OESA 1DEXA 1MZPA 4BNFA 4AQ7A 4ER5A 4PG4A 2RGEA 1QDLB 2H1FA 2CE2X 4BECA 2AFRA 1BXRA 2CVZA 3HCCA 5BMOA 1JAXA 1X9HA 1RIIA 2WTEA 1H5QA 1T9ZA 4LX0A 2UYYA 2SCUA 4OJMX 4ZYWA 5CXSA 3RYCA 2AFIE 3DV0B 1IZ9A 1PP4A 2JAOA 5EEGA 3REFA 3SICE 1DUVG 3ZZ0A 4L16A 3ED5A 1Z2DA 1L4KA 2QI9C 1U0NA 3NYQA 4KI0A 1C7QA 3DBLA 2QK4A 2W6OA 3OF3A 1K9VF 4NCKA 3TTXA 3ZKAA 1KWKA 3FJOA 2BGJA 1YZFA 3BD9A 3BMCB 3MMZA 4K1LA 4CLEA 1NR5A 2IDJA 4NV3A 1ZJ5A 3RUAA 1SUFA 1YR1A 2OMEA 2QE7D 3AR6A 2RK3A 1HV8A 3PVCA 4OG2A 2JK0A 4IDEA 1TZKA 3BL5A 3DONA 2J4DA 4Y9TA 4Q4JA 5HFNA 4L85A 4QL3A 3PS9A 3PQDA 5JDIA 1UKEA 4PLFA 3RC3A 1C30B 3IBYA 3P9PA 3ADOA 4GOJA 2UUOA 4DTIA 3MTEA 1M1NA 1M6WA 3QHPA 2FTKE 2HSZA 5IW8A 3OKCA 2BEVB 2VRWA 5HIJA 1ZFNA 4X9XA 1AXGA 1GEGA 1GCOA 1CY7A 3R76A 2AT1A 1PWZA 3J81A 2A5JA 1YGPA 1ZSNA 1BYIA 1ODCA 2Q6VA 4HDOB 1ZCFA 3VDQA 2H57A 4FYVA 4JBGA 4YJ3F 3OEWA 1RABA 2GK4A 2Q5JA 1G6HA 3LBAA 3LXXA 3BDIA 4OGKA 4TTVA 3FIUA 3TNLA 3TOCA 2CV2A 2WTNA 1JGTA 3TIXB 3TWOA 1HL3A 3FXAA 1WABA 2GWRA 4P7KA 3A27A 2JCVA 3BL6A 3BMNA 4KAXA 5DLQC 3U4QB 3WA6A 4NMWA 2IUYA 2IYWA 1A95A 5GM2A 1N6PA 1EVQA 1ZGJA 4FOTA 3DCYA 2WU4A 3HI4A 1ZN8A 3WWPA 3QYAA 2PGAA 1TCVA 1NG1A 2Y4OA 3EVFA 3BHIA 3RYIB 1AD2A 1O9GA 3B89A 4CQMB 2EW8A 2Q5OA 2ODPA 3CR8A 5IDXA 3BQMB 3IR7A 4DSNA 1KARA 4QSMA 4LNUA 3HY3A 1EP9A 2D5BA 3OD1A 2XRZA 5BSKA 5UKDA 1C7ZA 1P2FA 2VSXA 1I4DD 2OCPA 2XH8A 4JVOA 4R41A 3UM9A 1I7QB 1H1TA 4TVOA 2XDYA 1FTSA 4GICA 1GPLA 1FFCA 4MVJF 4LISA 4M99A 4PRKA 3JSXA 1OGYA 3AF3A 1CSEE 2VP4A 1GZHB 4X0EA 4GKJB 2OV3A 5B55A 2HW8A 4NCHA 4OCZA 4QHSA 5EJ5A 3L8MA 2I3ZA 4MYUA 4AJPA 4Z7QB 3C39A 3FVQA 3WI7A 1S9DA 1SZJG 4PN3A 3JQPA 2VKQA 1ZI9A 1NDQA 4DGQA 3WK4A 1XAHA 1JQAA 2E82A 2RJNA 5DWDA 3WWZA 4QIHA 3E9EA 4YRNA 5JS6A 2GBGA 3UPDA 2A9FA 2NV6A 4LVUA 1HFJA 5C31A 1MXHA 2VZLA 2ZDQA 3P9IA 3GRVA 5ERXA 3VVLA 2WZDA 3JQCA 3BSYA 4FFRA 1R8XA 5JUWA 1QB8A 3F78A 1A71A 3TBHA 3ZCVA 1XEWX 4UD2A 4ZQEA 1O6FA 1RLJA 1W9HA 1X2BA 1F60A 4DSAA 1GTVA 4EI2A 4NHEA 4RTLA 3ACCA 1EP1B 1TTTA 5PNTA 3ZHZA 2ECOA 3A4YA 4H4EA 1RP7A 3NOOA 4CKZA 3MWFA 2QRVA 2QUIA 3Q7SA 4XPIB 3VKWA 4RM2A 5D7BA 4R7ZA 1IPEA 3BX1A 3KQVA 3LUPA 3ZNNA 1QIMA 1PFWA 4EKEA 1ZJ6A 3MD0A 4RUKA 3AY0A 3U3ZA 3AOEC 3OZIA 1KP3A 1V5FA 2Q2NA 3UJHA 2LBPA 1T8WA 2G9UA 2F3TA 3WLJA 3NIFB 2GBIA 3I3OA 3INGA 1I2DA 1W96A 3A06A 3B53X 3N8HA 2HA6A 3ZY3A 3BWMA 2BF7A 4LRTB 5IABA 1VFNA 2YZGA 3DO8A 2ZIVB 1WB6A 2DJ5A 4JOCA 1FSPA 2BH9A 5K3CA 4F9EA 1RZRA 1YQGA 5SYNA 1AS3A 3DLBA 4P1ZA 2Z2YA 3TCKA 2A94A 1J22A 1Q7GA 2IU6A 2FN3A 2WM8A 3HVUA 5SV2A 5F2EA 1RQ7A 5FPSA 4POOA 3HBFA 4MKXA 2TMDA 3RE1A 1RRFA 1YB4A 4RVCA 2R8EA 5DM2A 3TLMA 2DHRA 5B3JA 1EB9A 3IMFA 3RHFA 1FBNA 2VDRB 3DEAA 3MAAC 3N07A 3VVMA 3EOAI 2LD4A 4MPPA 4RZUA 3RF7A 3W1VA 4B6PA 4NABA 2EG5A 3EISA 2HJSA 4YUWA 3FOFC 1VA4A 3JQFC 5FNZA 3CB4A 3AF1A 4FOOA 5HCUA 1UMDA 1L8QA 3CLTC 2VDOB 4OQPA 5BWOA 3G9UA 5INTA 4GRIA 1YS2X 3H65A 5CYFA 4EYGA 1XRRA 1X0XA 1YZQA 1W34A 1T91A 3ZKWA 3KEMA 4EW2A 4FN4A 1XTSA 1Y5MA 1M34E 1QONA 4LK2A 4RD4A 5JQWA 5AD1A 2CXOA 2W00A 1ZH8A 3ZWXA 1VL1A 2BF4A 1IATA 2FMUA 2BPOA 4TYQA 4ZO7A 2SBTA 2HMTA 3JV7A 3PD7A 5IH7A 1P77A 1QKKA 5C8DA 5LMUB 2HQOA 4KQ6A 1ADCA 1NXSA 2NV2B 3HB5X 2V7QA 5F52A 4JI5B 3F0TA 4WKCA 2CXQA 2WB4A 3BXZA 1NW8A 5AJWA 5BSUA 2BJWA 2A57A 4WRRA 2QQ0A 3U81A 3V5NA 2E18A 3NVKI 4HVTA 4C1BA 2GPWA 3VSBA 3MHTA 4EX6A 3QG5A 1KZ6A 1T36B 4L8VA 1J8FA 1NSTA 4MR8B 4UFNA 4E33A 4EWLA 2ICAA 2IYXA 3LHIA 3OLQA 3T3MB 1VKZA 4YPVA 1E0JA 4R8VA 5LZ4A 3N0RA 3F3YA 4MUHA 1E1QA 2W8BB 4C3OB 3TSAA 1RKUA 1CY8A 1T4CB 1S6YA 1LDYA 3JYHA 4O1MA 3TZKA 2UUPA 4GNKA 4RESA 4UOEA 3I9JA 2AB0A 5K8UA 4IFEA 1JHZA 3PC3A 5JJLA 2W98A 2PT9A 4XYEA 4DS3A 1A76A 3TL6A 3ETLA 1GNVA 2CLSA 3E0XA 3JVVA 1QPGA 3OWHA 5IMBA 1Z8HA 3RVPA 3L8DA 1X15A 5IK2A 4EPXA 2WJVA 3QPVA 1TT7A 1E3IA 3P45A 4Y2RA 2DQZA 4PZYA 4F7WA 3WGLA 4E1VA 1EJ2A 4LTMA 3Q3HA 4V0LA 3VDNB 3I8OA 1V7CA 1YL6A 4INOA 4MB6A 4UM9D 1DAIA 2H2HA 4U00A 4GQBA 2IF0A 3BGDA 1CP2A 4PYKA 2WWHA 4RCVA 4RQBA 1Q77A 3E05A 3PEWA 4RTQA 1WPQA 5DYIA 4IF4A 3EZLA 4Y1EA 3NW9A 4M8KA 5T8KC 4B4OA 2KYRA 1REQB 1XV5A 3GAZA 3HN7A 5HA5A 1II8B 3ZLTA 2R86A 3OQMA 4KXQA 4UEWA 5F5NA 1N6RA 1G6OA 3U56A 4F8EA 1SUAA 1NXOA 3QPAA 4Q1BA 2BTEA 3NWPA 3QVUA 1BDJA 1F8FA 1ZDMA 2CZQA 1MP0A 4I14A 4R16A 4XTCS 2BUBA 5C2JB 2W2TA 1O95A 2QVBA 4NZMA 1GYQA 3LP6A 3ZTTA 1JQLB 2GCGA 3RUEA 2ZSUA 2P9YA 1E6UA 1N1DA 2J3HA 4J0DA 4MRPA 2V54A 4GGOA 1BWPA 1PJTA 5CRIA 1O0SA 1ISIA 4MDHA 1F7UA 3JYNA 1E9RA 1KK0A 2GYYA 4JJZA 5IKEA 2UUBB 1QU3A 1M0SA 1VKJA 3Q0IA 4KLCA 3PEFA 5HZKA 4YDQA 3DM5A 2EZTA 1WNTA 2J4FA 2OGTA 1QE0A 4XB6B 1HO3A 2DERA 4BGUA 4CI0B 4HH3C 3RVDA 3KIPA 3OEEA 4DIDA 1BNCA 2QZ4A 4OBBA 3FG9A 2Y0PA 3NFYA 5BR8B 3UWMA 1TAQA 1MOSA 2YJ4A 1JR3A 4IJ6A 2O5RA 1KVRA 2P77A 1IN6A 3BGVA 4JYBA 3E82A 1RTKA 5BVHA 2HLPA 1JKXA 4PCUA 4QELA 1UQRA 3BGIA 1JDNA 1VCIA 3RJTA 1XZHA 1MJGA 3S0JA 3ZGLA 1MX1A 3G89A 3M2PA 2W37A 5AM5A 2KB0A 1HT3A 3C87A 1AKTA 3DE0X 4ND3A 4NMHA 2H4WA 4CR6A 5B7NA 1EXVA 2VRCD 4F5DA 4EOGA 2O0MA 2R1TB 4W99A 2Q50A 3EEYA 3U9LA 2QLBA 2HR1A 1VSTA 4YJGB 2CW5A 3RS5A 3Q7RA 5AH0A 1LRKA 2OCLA 4AZ0B 3TF5A 1EQUA 4C3UA 1LPBB 2F1JA 3HNOA 1D9XA 3CWCA 1EP2B 3KU1A 4HNGA 4PGGA 1L7OA 5AXBA 2RGRA 2C29D 2JDIA 1PJZA 3DO5A 3NJ4A 2EKQA 3LX8A 4KDRA 3GMIA 4DMHA 4E1AA 1RI1A 4RL4A 3P9NA 3AJ9A 2ST1A 4QTXA 1VJTA 5TPZD 3RV4A 1Z63A 5ARCA 1YA6A 4MUAA 5KPJA 4IIHA 4B34A 1OXBB 1ZOOA 2NTYC 5REQA 5C46F 2OC4A 2LW7A 5KWIA 1M73E 4U7TB 1QCZA 2NGRA 5AXDA 2GZDA 2HK6A 3WB1A 1SD5A 4CTKA 1XROA 1SH7A 3C6QA 1PZEA 3VR5D 5HBGA 1W4AA 3Q7IA 1EWKA 1JTVA 1GXSA 4TRRA 1G21A 3M9WA 3IKMB 3F6RA 2POQX 3CVOA 4TQGA 3EYWA 3RYTC 3TL3A 4PO3X 1XTVA 1DZIA 4PXAA 2MDTA 4O33A 4BGIA 2O8DA 1X38A 4K46A 4OMCA 4CEIA 3QEMA 3EBOA 4JJGA 5KYVA 5KAPA 4WK4B 4GO1A 3JQ6A 1L7AA 1WUJS 1GU1A 1I3OA 4PW0A 2A67A 4U7PB 1KDZA 2ONJA 4BBJA 4C21A 4AXBA 1G8SA 4DJTA 3MT8A 4RU1A 4BFUA 1WMDA 3R6GA 5ITSA 3V4RA 1KR5A 5TF4A 2YJTD 4HWTA 4EI7A 1M6VA 5JXWA 1J0CA 2CE7A 2VYVA 2O8NA 1IWBB 1DC7A 4NE2A 3K5IA 4EPRA 2ZZMA 1HEYA 2E0IA 1LB1B 4WK0B 1NR1A 2GFHA 1JDTA 4FDVA 2HHAA 1DI0A 4EMUA 2O8BA 1BHJA 5K8LA 1HXHA 1MU0A 4IIBA 1UEXC 3R6TA 4LECA 3NBYC 2BKUA 3OTQA 3H5WA 4RL6A 2PL5A 5EE1A 4A10A 2VTDA 4IDBA 4HEQA 3V8QA 3LX6A 1PVDA 4W7IA 1OV4A 1I9GA 3QUCA 3OTGA 4MAFA 2VAPA 2NYRA 3AGPA 5FO0A 1GZ3A 4U6QA 2RGCA 1AUQA 1SU4A 2WIJA 1IG3A 3I83A 4Y6RA 4HNHA 3KFLA 4R68A 5C8YB 2M6KA 3FDFA 3HB7A 1NNI1 5KHLB 1V1RA 4YNBA 1X19A 1YI0A 2QP3A 2QYSA 4MVJD 3DMFA 3PEEA 1BCRB 1NZDA 3FSEA 3R5SA 4MP3A 4HAXA 4DR3B 4C2AA 1GTRA 4FCVA 2YIDA 3LO8A 4TZKA 5FJIA 4WL0A 3KCNA 2PSSA 1DOAA 4B7UA 2B82A 2ZIXB 4I9GA 5EKTA 4CGYA 1OFVA 2X9LA 3HYSA 4FMDF 3RIEA 1GPNA 2AE2A 2IYNA 2PQMA 2DPLA 3KCQA 1WCXA 3AKDA 4YC7A 1XG5A 2Z1DA 1XT6A 3QX7A 5JWHA 1BW9A 2ATVA 5AQ1A 4HS9A 4I1UA 4MRMA 3MPOA 1QRDA 3R5FA 1E2KA 1T1RA 2AD1A 2MINB 4I6GA 2TS1A 3E8SA 3KJZA 1XTRA 1I2MA 2J9GA 1RHKA 3L4EA 4NBLA 4URWR 5FOWA 3L9XA 3OZ7A 3VR0A 1Z5NA 3VYSB 3PZBA 3RUHA 3RW9A 4V1CA 5J40A 2OP1A 2OHXA 2VN8A 1OI4A 4Q18A 3JZMA 3NAZA 1C8LA 3VR6A 4PZUA 4F9TA 3CH6A 3OCZA 2OO5C 5BYJA 3LYLA 5EIEA 5CYPA 1J25A 2BEWA 4KBFA 2WNHA 5HKAA 4BFZA 1CUXA 5HOQA 3PDUA 3AJEA 5DIFA 5AM1A 1J06A 4GR5A 5CG1A 3ESQA 4JLSA 2GBLC 2ZDHA 3CX3A 2BGTA 3MERA 4F7DA 1LKZA 1MPTA 1SOUA 5K3FA 1O5IA 3JATA 2W2QA 4GVXA 1OY1A 1E3WB 2FXIA 4JOQA 4PS1A 4S0XA 5G4KB 1G8AA 2V9ZA 5I3CA 5AXAA 1XTIA 4Q02A 1HZZC 2Q3MA 1XPJA 1WCIA 1NX6A 4HB0A 3USZA 2WT4A 4FNOA 1IM5A 3O26A 4JROA 4P93A 3VZSA 3WIEA 2VTVA 1X87A 1BXGA 2BCGY 1B1AA 1C4WA 1Z5UA 5KWVA 2XOKA 3PL5A 4G0YA 2NAFA 1AC5A 1OPRA 1ZM3A 3E18A 4G8DA 4PAQA 5A2GA 1EFPB 5I7EA 2KI5A 2XTZA 4ER3A 3LVRE 4H7KA 2F1RA 2VLIA 1R4ZA 3KKKA 3NEPX 3OJ0A 4LJYA 4DN6A 1JLHA 5JIBA 4M8NE 1G5IA 3I92A 3R3UA 3RAPR 1B93A 1I0LA 3AR8A 1GPUA 3OM9A 1Z0AA 4RIIA 4P34A 4JLVA 3ESCA 1UXGA 1I3MA 4RKWA 2JJ8A 4CQJA 3M4JA 2PH1A 3MRXA 2YY7A 3ZQUA 2QRMA 3EVAA 4BQFA 3W3AA 2DBRA 2P69A 1EI9A 4ZO9A 2YIJA 3SNHA 2Q2VA 4N8SA 2UZ0A 3TSOA 5E1OA 3VHLB 1XQ1A 2GAJA 1GLVA 4IO0A 2C7OA 2HT1A 3OPNA 3SC3A 3BSSA 1OHHD 3JAKA 5U9CA 1DX6A 1Q1NA 2W8ZA 3ACBA 5LZ2A 4YP6A 3ABZA 3V4LA 1GPBA 1U0LA 3AVYA 2RAPA 1HRKA 3OT1B 4MW5A 4KXXA 5BUCA 2AJLI 4FSXA 2CD7A 1J8DA 1MIOB 1X13A 5EIHA 1XAJA 1FBTA 1IZZA 1K6EA 4GR9A 3CGGA 4E30A 5IARA 5JNVA 3VSAA 3F7MA 3DEKA 3V1YA 2VWPA 4TV9A 1V0JA 1QC5A 4P3XA 4BQRA 4RTKA 2IZOA 1TVCA 4JUBA 2WJHA 4FFOA 1H9AA 5LJLA 4HUTA 5IN5A 5TJ9A 1E1RA 5IKXA 1GZDA 3HV0A 1II0A 1EXDA 1F2DA 2B4TO 5F1PA 1G7CA 2QN1A 5KREA 3JASB 4HLDA 3G0IA 2MSEB 5GINE 1H05A 3PDIB 4ESVA 5AKJA 1YDWA 1KY4A 2H5EA 2C9OA 3MMXA 1LDGA 4OUDB 3D6HA 3FPEA 3G2KA 4CKWB 4DVGA 2OCKA 5C8VA 1CEEA 3VMMA 4XQ0A 1DS6A 2CEAA 2DPXA 5A5DA 2J33A 4BJ3A 1IBKB 3O2QB 4M49A 3N9IA 1G8GA 3UWOA 3P32A 1B14A 2JI6A 2GCIA 3CN7A 2BFBB 1CUCA 2YFHA 1YJ8A 1YZUA 1Q84A 2XMGA 5AI8A 2I7VA 4C4PA 2PXAA 1TVKA 2RHRA 1CVLA 2C96A 3NP9A 2IELA 4W8GA 1ZM7A 2ID9A 3AGQA 3NVAA 4O4JB 3PQ4A 1F3LA 4BE7B 2ZOSA 4XWAA 4CLRA 3U3MA 5AKZA 5JH7F 5J1SB 5B2FA 2YRXA 4EW3A 1J33A 1IWOA 1FRVA 3AVPA 4LHXA 2YQZA 1TYDE 1DIBA 4TMTA 1R5BA 3B3AA 4O25A 3NTQA 4IHJF 2SKEA 3BEOA 3NIGB 1I10A 5EP4A 2CCJA 2CHEA 1HLPA 4PC6A 1RVV1 3DCIA 3DUWA 3QNUA 3WRVA 1RYYA 1K8XB 2GEUA 5KTTA 1W29A 4M8LA 3ITEA 3WO1A 2FW7A 2WABA 3HGMA 2DLCX 3N7AA 1DKNA 2V9PA 5FTLA 4ARAA 3CO0S 2QU8A 3ICPA 3WLPA 4HX9A 1E77A 2O2GA 1W8IA 4IL5A 2QHXA 3WOVA 3WK8A 3X1XA 4BMVA 1M33A 3A4LA 5P8WA 5E9QA 3L82B 1FZTA 1ZK0A 1WPGA 3THRA 3H2JA 1MJFA 2JAUA 3LPNA 1MAWA 5IF3A 1NPDA 1T0BA 4AY2A 4DLYA 1I94B 2RONA 4HQRA 3UMJA 5KDOA 3NFRA 3GMDA 3JRXA 4EF5A 1YDHA 1KC1A 2H1SA 4JK3A 4K9LA 4XYMA 4CKCA 3AETB 1IE3A 4FFWA 4S24A 5IZCC 1HETA 1XZPA 3VJLA 2LPMA 4BZWA 1LDBA 4WBNF 5CCEA 4ZDWA 2LV8A 1UXJA 5JVDA 5JNRA 4KO3S 1RYZA 2HQ1A 5DGIA 1PHRA 5ALUA 2PPVA 4UMEA 1E2LA 3IH5A 3QKSA 4HDNB 4UNNA 3EPLA 4OKSA 5J9FA 4ZV7A 1KJZA 2PFSA 2LP4Y 3D5TA 4UNIA 3TEFA 4Z0NA 2HGZA 1IXRC 1PD1A 1CZRA 4G85A 4ZV4A 2CEKA 4FDAA 1X1AA 2C31A 3SWWA 3DOJA 5IN4A 4KYIB 2V7GA 2WMOB 1YQUA 3GJYA 5JAOA 1FK8A 2HRQA 4Q4HA 4OSPA 2ZRIA 3WGYA 1NDUA 2QTLA 3WIUA 2OCYC 1BGVA 4TXJA 1X3SA 2X0KA 4TMWA 1NNUA 2D3WA 1YL5A 4GPD1 2MR6A 4RV4A 1IOWA 1HTWA 2V0GA 2O1WA 5C3UA 3D43A 3QELB 4FC6A 4F2GA 3LCCA 3NRBA 1NAIA 3MBOA 2GVZC 3C8DA 4HPJB 3UV7A 3EDMA 4I50B 4RF3A 4RIEA 5GIOE 2PUEA 5CYGA 3MBIA 2VF7A 5LR6A 1STOA 4ITRC 2FN9A 3ZXYA 1O4WA 3AWIA 3SR4A 3T4XA 5JAPA 2QIPA 4JR1A 4FEEA 1DO8A 4K5QA 1DT5A 5FWXA 2BV3A 2WW8A 1U4NA 2WYVA 5HCNA 5KVQA 4AO8A 5H68A 2OV1A 1YSCA 2VPPA 3C3WA 1OH5A 3QLEA 4PYMA 1YTLA 2G88A 4RWEA 5J2UA 2BFCA 1YHZA 1Q1EA 3P5BA 4BKUA 1UBCA 3IV9A 3UANA 3E3NA 3GLHB 4DLWA 2BBWA 1E4YA 4BQPA 3LC2O 2ZRFA 2YL2A 2R00A 2PH3A 4OOFA 1PZNA 1H2WA 3E7FA 1DV2A 5FBWB 2BH2A 2OYRA 1DWUA 2NZWA 3R5JA 5F2OA 1MFZA 4WZ6A 1KMMA 2ENWA 2BFMA 2AZMA 3LTEA 3CKKA 1EFTA 4GLJA 4G86A 3BN3A 1CR1A 2AFIA 2HMVA 2HF9A 2WAYA 3RTEA 2EFEB 3QH4A 1XVVA 4H1UA 2WSSD 4Q5IA 5CBPB 1KZ7B 3RJ5A 3IHLA 2IITA 3R0QA 4F2PA 3B1XA 4GM0A 3SF0A 4ND4A 1TX4B 3MT7A 3FPAA 1YRAA 3FOBA 4IIEA 2BTQB 4MI6A 2VNIA 2OK7A 1N2XA 6LDHA 1XA3A 3CJQA 4OMUA 4DIOA 2C1ZA 2EP5A 2XUGA 4JXXA 5EXTA 2GBFA 4EB6B 1YC2A 1ZK4A 3HO6A 4YJ2A 2XSZD 4WIAA 3ZHXA 3PWKA 1ZESA 5FO1A 4HXGA 4ZHQA 4F91B 3RVJA 1YBFA 3OZUA 1ZJZA 3ICVA 1CJCA 4EB3A 2GPTA 3DPSA 4C7KA 1J2YA 4OFBA 2FOIA 2VG8A 2V7WA 3MCWA 5CGQB 1JQ5A 4QPZA 2FSPA 5DHPA 2XB9A 3OHPA 4B74A 3H7IA 4HYEA 1AN9A 2GN0A 4E3ZA 1NUQA 1KJWA 1SBNE 5I7OA 1JSXA 1M54A 2PYDA 3O84A 3SXJA 3W5VA 3EQ6A 4FR2A 3DEYX 2C3OA 1LBTA 3CW8X 1F3OA 3EY9A 3BJIC 4GLLA 4M4SA 4OI2A 1IH8A 5LMCA 1KK2A 4KXUA 1KHHA 1GR0A 1XDGA 4OMFG 4TUYF 1JUDA 4TL7A 2O07A 2DWCA 4PWYA 1MFPA 1U0EA 4RHFA 4DA4A 4XQ9A 4PZ9A 1JFSA 5HK8A 1PD0A 1DX9A 4OHWA 4GOXA 2PZMA 3NWJA 4A8TA 3WYEA 3IERA 1H3FA 4UTRA 4N3AA 1PEYA 3BRWA 3VO8A 4LG1A 2FR8A 3LGXA 2OBNA 3QLJA 1QO0A 3LWNA 1HT1E 1UZAA 1T8TA 1TUEA 1W0KA 3TLGA 5FPKA 1ETUA 1JE0A 1OA1A 1YR9A 2JCYA 3MJVA 1CZUA 1Q92A 1MC8A 3DBHA 3ISVA 1R3UA 1SIBE 3PLRA 3HCBA 5CX4A 1LS6A 5EZQA 3IELA 4Y6LA 5EZYB 1Q1ZA 2R6DA 5A03A 4KSCA 4FBGA 4B3JA 4RACA 2Q0XA 2PZFA 4GG1A 2NO9A 3CONA 3HR4A 2O06A 1N57A 2J9ZB 4B87A 3O2SB 2KMLA 2VCYA 2YBDA 1T9BA 4PYIA 4PS0A 1NN5A 3G5AA 1B8OA 3EZ2A 3WBJA 5E3HA 4MDEA 3EPJA 1BVRA 1UT8A 1DEAA 2FMIA 3OH8A 4HPWA 4M46A 1N33B 3LIPA 1GUYA 2C9ZA 3JARA 4IDNA 1U7OA 2RBKA 5DNCA 4QEDA 1XL0A 4F2HA 3GZJA 3ANTA 3D4OA 3DOHA 1FFWA 2IK8A 4P7JA 2L18A 1K3UB 4JJ6A 3O0TA 1AMOA 3NCHA 5HKKA 5JCOC 1KYIA 4X41A 4ZOEA 3RGWS 1ZUIA 2RI6A 3I2JA 5EY5B 3L8YA 3C6KA 4D3SA 3RSCA 3V4ZA 1PDWA 3AT1A 3ROXA 2W6JD 1JA9A 1Z68A 3HFGA 4BATA 3UA4A 2CDRA 3GRCA 1XKXA 2ZXEA 4MWTA 4Z8YA 1L5YA 1NN1A 2ZE6A 5DYNA 4XCXA 2Q4BA 4IEIA 1X3LA 3DBRA 2JHCA 3NDJA 4QA9A 3KXDA 3SKVA 1OROA 4DEVA 3DZIA 3KKMA 1AA9A 2XWJI 3RI3A 5IJ9A 3LNTA 2PSFA 2JPDA 4QJ5A 1IDN1 2RBEA 5EE5B 5LWQA 2W48A 2QTVB 1KO4A 5K0CA 1I14A 1NQUA 1UUFA 2ZITA 3GQVA 2XBUA 1DKQA 3JWHA 1KI7A 2PL9A 3RQIA 5FEUA 5I9NA 3PL1A 4AKSA 1JLLA 1R8YA 3PYMA 4H4CA 1P6UA 3LQ1A 4B84A 4E2ZA 2BKVA 4RFLA 5B1YA 4OHFA 2X8LA 3QJGA 4BRSA 4P5PA 3SXPA 1GKUB 4NTZA 2NO1A 1AS2A 3F71A 1A7KA 3LBNA 2XCIA 4HZUB 1L5KA 1V26A 4NAUA 3X1KA 5I4BA 1B3RA 1KI8A 3TX2A 4BB5A 2NU7A 2RAFA 2FQWA 1KAEA 4S0ZA 2C4WA 2G07A 4RA9A 2ZG6A 1FQOA 1KI3A 1T6BY 4RYLA 4UM5A 1CB7A 1PWHA 4BNDB 5CJ2A 3DVRX 3DZFA 2EHDA 2VHWA 2VZ8A 2XQVA 4BEVA 4MV6A 4O2AB 5JZMA 3OETA 5A3SA 3H11B 2BKXA 4L95C 4GM4A 3UWSA 2B1JA 3AERB 4NFSA 4M1OA 2YVQA 2ZB4A 3KPJA 5ANRB 3HVJA 4BASA 3SOZA 4XVCA 4JVLA 1OZAA 1E8MA 4KXLA 1LLDA 5AOAA 3R7WA 4H7PA 3WLRA 5CVUA 4CM6A 4EUNA 1PNRA 2QLLA 2ETXA 3M6XA 1Y9ZA 2CLKB 1WB4A 1P0PA 1V7PC 1ULHA 3R44A 2VZEA 4J0JA 3VOBA 1M34A 3VHQA 3KYCB 1W44A 4E88A 3LBHA 4CQLA 4QATA 5BWCA 5DP2A 4R9NA 1WDLA 3GCDA 4BFYA 3FTFA 3D6NB 5DW0A 4EVQA 1Y6RA 2B3DA 1LA2A 2RGWA 2QVZX 1XTPA 4LGCA 3T5TA 4ECAA 1H3EA 3ZWAA 3QUQA 4M9SA 5B1HA 2NUAA 4MLDA 4KX5A 3O1IC 2IX9A 4MQUA 4QQRA 1AMUA 4R9UC 3S2YA 2D4AA 4A0QA 2X42A 1KTVA 1N7JA 3K1ZA 4TSRA 3NBFA 5MGBA 1KKUA 4FX5A 1SKYE 3CJTA 3OX2A 5JDCC 2ZYTX 1GNQA 3CZPA 3VC1A 4EAAA 5LM3A 2CDCA 2G0NA 3ANLA 4RVOA 1T3GA 5LLDA 1S01A 3H2KA 1XVUA 4PQFA 4EDHA 2V65A 3G17A 1ZW1A 3QMMA 2UVDA 2Q5FA 4JNCA 1FXUA 2CNWD 1XNGA 4OOEA 3SQLA 2Q9AA 1ZHOA 3GWGA 2JNWA 3HVRA 3H05A 4TSFD 4EBBA 1LI7A 1TQ6A 4QXMA 4UOQA 1MA3A 1TAHA 4IZIA 4XWTA 4ZCPA 1OH8A 3PHCA 5ALYA 5CA1B 1EUCA 3NHBA 5CAEA 1TC1A 1D6MA 3F47A 3L4JA 3DF7A 1WBDA 3A05A 4UU0A 4AJJA 1H2AS 2QN6A 1HYHA 1L7RA 4D98A 4QOGA 4QQKA 5JJCA 1ZC4A 5JHGB 1H8HD 2Y8EA 4JJKA 3QITA 4MUFA 3UK6A 2O59A 2CMDA 4A6EA 3COJA 1P29A 2XEDA 1B15A 4V3BA 3CG4A 5KHAA 4B81A 2ONKA 4MYCA 4UAGA 5ED0A 5ALGA 1ZIYA 2E4VA 2VAWA 1V96A 1Y6JA 3FZEA 4OGLA 4YMWA 5FR2A 2A59A 2YIVX 5DK6A 2OZKA 1N3YA 3OT5A 5AK0A 3USES 3D3KA 3H5AA 2V0CA 2QA5A 1SCDA 4NONA 4BFCA 1QJ4A 4CW7A 2YQ5A 2BCJQ 2Q7OE 1CRZA 1U2TA 1MENA 2IIPA 2AXEA 4EKGA 1EHYA 1GGFA 3I0ZA 4MVJG 5DASA 5KYUA 4BLTA 2AF4C 1G5RA 4OHMA 4Y2VA 5TR9A 1GL3A 1M0WA 2VDVE 4Y18A 2QTTA 5IEJA 1G3MA 4HRYA 4LTNA 4U6NA 4EYQA 1UBSB 2KM1A 3H5VA 3F7TA 1DJQA 2J3JA 1LWOA 3A3NA 1PZMA 1SQSA 3B3FA 1JJBA 4XUGB 4AROA 1FNDA 2HRZA 1BWSA 1O9HA 3AUJB 2A30A 2PRJA 3AMVA 2BJVA 4HZIA 3G0OA 4N47A 5KTMA 4AXXA 2ZI3A 3G2PA 4QAJA 3NI2A 2C54A 5FBKA 2Q6OA 4OAOA 1GPDG 3DEZA 1SG9A 3VKVA 3ZDRA 2G1JA 1Q57A 3L41A 5BV0A 2JIPA 3VU0A 3QP9A 3SQOA 5M34A 2EBFX 4RQUA 4E5KA 4UUBA 3D3JA 1DCFA 1E69A 3MNFA 4WXYB 1D0VA 4ABTA 4B4KA 4E5YA 1JKMA 3KYIB 4QPDA 3H9QA 5IC4A 3Q7EA 1NXQA 1WMEA 4Q9AA 4PC3A 3QXGA 3RJZA 1QGDA 4O02B 4XTRA 3SZ3A 3UUGA 3O7WA 3QIVA 5J2TA 4N5IX 1DARA 4FVTA 4ZTUB 2HDWA 3EX7C 5TMBA 3ON5A 3QUAA 4ZVTA 5KYNA 1N8TA 2SNIE 1GOTA 1C8KA 4KODA 5AI5A 5H80A 1RC0A 1FUIA 1YKSA 1HH4A 4YJDA 5JQGF 4XUEA 4CCWA 4HLNA 1A1VA 3OZEA 4N0PA 3DQZA 5KYTA 4XH9B 2CYCA 3IPLA 3NT2A 4IXNA 4UVHA 4FKBA 2XAUA 1QR2A 1TZ2A 4UARA 4YV2A 2QRQA 3D6TB 5F3RA 3M4ZA 3RS7A 3E27A 5FDFA 3N2ZB 1RZ3A 3OEHD 4LMBA 1VI5A 3QW2A 3AV0B 1D2GA 2GA9A 3NKFA 5JMOA 3H4IA 1NLMA 3MWLA 4RM3A 4FGKA 4KN9S 1M72A 1J97A 4LXUA 2AJBA 4QLOA 2X76A 3PPXA 2H51A 3AQIA 3FVVA 5C7OO 3PHGA 4LJ5A 2HU7A 1ABEA 3TW8B 5GOZA 3WB0A 2OEPA 2AR0A 4XASA 2QNBA 4Z0TA 2F3QA 2Q41A 5L53A 3TG2A 5CVJA 1TI7A 4UNQA 4GOOD 4AULA 1MNAA 3QLUC 3QVLA 1D2AA 4I4TB 4QWWA 3BWEA 5TLSA 4ZI7F 3BJRA 4C0HA 1PWXA 3D6JA 4FR0A 1S8NA 1SIUA 2CL7X 3FHCB 4MKHA 4RDIA 3ICWA 4X6XA 4UFPA 2IA5A 4X3CA 1C1XA 4ZFNA 1MEOA 1Y80A 1HX7A 1Z5WA 4PR3A 1D6JA 2P65A 3EF3A 1JEQA 3X2SA 1E3MA 4OK3A 4Q7EA 1BGXT 1K7XB 3TOXA 5JSUA 2B37A 2XUIA 1ZD3A 3BWDD 1PTJC 1GZUA 1U7UA 2W0MA 5BR1A 1LNSA 2Z2ZA 3GFFA 3KOXA 3OZBA 4UTXA 3HSYA 1JR6A 1PG5A 3GFBA 4M1MA 4F1WA 1ZUHA 4IMIB 2OK8A 1AURA 2WWRA 4MKRA 5JMWA 2FPLA 1RHUA 1VTKA 1P3DA 3I2YX 3JXEA 2VZ9A 5KNBH 2FU5C 1Y5RA 4N65A 4WCFA 1PV2A 4UUPA 5E1DA 5IYZF 1AHPA 1CQWA 3N2LA 1G63A 2GRUA 1L5MA 5G1OA 4CL2A 2YWCA 2C9MA 3ZY4A 1TEVA 1PGPA 1QSGA 1A0OA 4AG5A 3LNCA 2BM8A 2QAGC 4CKEB 1QHYA 1TMKA 1PU2A 1N6HA 2BFDA 4A0FA 3FOZA 3JD1A 4AN4A 2E9SA 2A86A 4MUIA 3Q12A 1EE9A 1QH9A 2VQFB 3N8KA 4BP3A 5ISMA 1AGNA 1C9MA 4DUGA 1M5RA 4OSOA 1UP7A 1H9CA 1I4LD 1GRVA 1MO3A 1JHAA 4RPGA 2CUNA 1M7GA 1ORTA 1CNEA 3UQZA 4WK6A 4JI2B 4GEKA 2Q27A 3BD8A 1WHSA 3NMUF 1WBJB 5FLEX 4X91A 2P2GA 1O0CA 1EBBA 1QNLA 3ZZUA 1U0TA 4DJFC 3ODPA 3LK6A 4K9DA 1AHIA 3HCAA 4S1VA 3FNHA 5TIIA 1J2TA 4XEHA 5E0KB 4J0GA 2QVCA 1SHUX 2WBLC 4IJQA 2VQ6A 4URUR 3PC8C 3EDOA 3PC7A 2VOEA 3DDHA 3INTA 1JLMA 4C0SA 3WC4A 1KSFX 2RJOA 4DKXA 4F86A 3EGVA 3QNWA 1ACMA 4Z7JA 4KQ9A 3WJAA 2OXIA 2AXNA 4ZEOA 3X1JA 2ZAYA 3Q1KA 4OQNA 2ZP1A 3ZCUA 2Z6QA 1KNQA 5KSPA 3SS7X 1M8GA 3QVTA 5TEVA 3TZQA 1DG1G 1WKBA 3P0RA 2YQ4A 1GFWA 1RCTE 3PJFA 1XPUA 1SVNA 3OJXA 4YP9A 2OXEA 3KVRA 2A9PA 4R05A 3NETA 2CNLA 3GH1A 3I9LA 1F6BA 1OFGA 3DGEC 4GSYA 4EHKA 2W71A 2D5IA 4TRMA 5KTPA 4NZYA 4KLRA 2DFVA 4AS2A 1XEXB 4PZAA 2R66A 1ZXLA 1NXPA 1RR6A 4IF6A 4EJSC 3U26A 3E7WA 4WKOA 4FHFA 1LQUA 4BWYA 1I7SB 1YFLA 3I5XA 1I7DA 4UU7A 3KZCA 3U4IA 4DV4B 2BEUA 2XYVA 2W58A 4BDSA 5F1YA 2OAQ1 2ZQZA 3DHVA 2GJSA 4YJFA 3O4FA 1WW2A 3UMMA 3FY4A 1ZJWA 4QWMA 5HKOA 5C34B 4RHYA 4C4TA 3ECCA 5BSFA 4F3TA 4KQ2A 1J5EB 3ZV5A 4FBMA 3C7DB 1S2MA 3KC2A 3PNPA 1VG8A 1YUNA 3C97A 4I5IA 3KHSA 2B4RO 4RLQA 4DB2A 1P91A 2AVNA 2HN9A 1R00A 2BAGA 2EGUA 3L46A 4YUXA 3TNDA 4MUEA 5FOVA 5E4YA 4B2LA 4ZZ3A 3FUTA 1VXOA 4J91A 3WMWA 1GTG1 1UBEA 5TGTA 1TGYA 2NAPA 3H5TA 5IBCA 3G5LA 3PXBA 4FZ3A 2UZAA 4LBYA 4GX0A 4N12A 1V8OA 2IOFA 4U39A 3U3XA 5ICMA 3ORQA 3D8UA 4KQEA 4R1TA 4AY4A 2Z5GA 3IFSA 1NT4A 3RC7A 2ISCA 2Q3BA 1LDEA 5EG5A 4YIKA 3T5GA 3R20A 1G18A 4D6PA 4KX3A 3JQAA 1I2BA 1DC3A 3B12A 3FLAA 3LA6A 2REOA 1DXQA 3BTSA 2AEFA 3GCXA 1IY8A 4Q4DA 4U7HA 4JELA 1LSUA 1Y4DE 3LQYA 5E7IA 4HMOA 4OA5A 4UM9B 3K0BA 3LUDA 3T1QA 3PP8A 3EFBA 3LOUA 3UJCA 5IANA 4YHHB 5HWSA 1K6MA 1NF9A 3E1SA 3JX9A 3P9KA 5BXYA 3PKJA 2W0SA 1ZD1A 4JX8A 1JDBC 1PR1A 3SDBA 1RWKA 1Z2OX 1JHVA 2JHGA 2YHBA 4UUAA 4F8YA 1KY2A 4Q9LA 3TJMA 1L1EA 1NBAA 3JWPA 5IXJA 3QG1A 3UHOA 3RF6A 1OAOC 2W2VA 3CIOA 3S2UA 4BNTA 4QVIA 1CE8A 1Z73A 5LMZA 1OKKA 3O38A 4Z2AA 2HIHA 1ZNXA 4UNSA 1ESZA 1J2RA 1R9NA 1EDDA 5I7RA 1EFLA 1MKYA 4FGWA 1JJIA 4RLSA 3EARA 4FQ7A 5IBQA 1OWMA 1XUOA 2C4TA 1XVLA 4EPTA 3QKWA 16PKA 3I6QA 5FIUA 3V4FA 5J4LA 2ZJ2A 2VNJA 3H18A 3QU2A 2VQDA 4R31A 1GRRA 1YR8A 3KPYA 1RRMA 4JENA 3Q8KA 1YOVB 1W59A 3C70A 3KJQA 2IPOA 1UC5B 1U90A 4JJ4A 4NH4A 4CI9A 4XARA 4BQOA 1MR3F 1PI3A 5JCXA 5J4KA 4NEGA 2IYUA 4CV3A 5KINB 3EIXA 1O5TA 4PZCA 1X1TA 5FL3A 1AA6A 2PUWA 5JISA 1Y6QA 4C9BA 1W2WB 5AW0A 5D8DA 3IL2A 2CUZA 4RQTA 4DWVA 5D3QA 2OC9A 1E6WA 1I13A 3WXMA 3ZIAD 4R5HA 1N8KA 4BYMA 1S2LA 1M1YB 4NNPA 2QRPA 1W93A 3ND6A 2G40A 2RSLA 2YMPA 5KJ6A 3VNUA 3PDJA 1QIEA 3G5TA 4IXMA 3LLVA 4GI3A 4ND8B 1TKAA 1DOZA 1E9DA 1ESDA 4G3XA 5JSHA 2VHXA 4IEEA 2WTBA 4R2IA 1WP4A 2ZAMA 4E5DA 3AUYA 5EGNA 1G19A 4MTLA 1M83A 4GWKA 4H7JA 4OBWA 3TUIC 4AYWA 3PHBE 1XCJA 2ZYAA 2ZSAA 5CMLA 4RPKA 2O3SA 5AM2A 3KB2A 4I9NA 4RJKA 1IYZA 1DQZA 5JNSA 2QR3A 2YDXA 4BMSA 1SA0A 3SHQA 3PENA 1N2BA 4TTAA 1NG9A 1E63A 1YONA 2DMRA 5T67A 3KFVA 5DXFA 1M0TA 1XF1A 2Y3IA 4TKVB 3U7JA 2Q0HA 1PS0A 4H3KB 4RA6A 4J7AA 1CTQA 2OHJA 1KORA 3GDOA 5EP2A 1OQAA 1XZIA 2C1XA 3PTLA 2IPXA 3DLPX 4GP7A 3T4PA 1M1ZA 3ADBA 1SQFA 2HD4A 1HE2A 4US1R 3TYXA 3DB1A 3U4HA 3F67A 2O2SA 3R0XA 3SYTA 2NNLD 4TL6A 1N7GA 1S8FA 2HRRA 4EG1A 5JI3E 1F8UA 3D5QA 2ZJ5A 4J2OA 2ZAOA 4FYWA 2OG2A 3OE5A 3C3MA 3TNJA 1U7TA 3L6UA 4G56A 4IQFA 1NQVA 4KH0A 4ZEWA 1K06A 3NOXA 1U9IC 2WF8A 1ULTA 3T15A 3RLFA 2P6PA 3D8RA 4XR9A 3DE5X 2LTAA 4RKQA 3R9IA 3R5XA 3R0IA 2EL9A 2CBGA 2H63A 1LDNA 2Q8PA 1Z0IA 2AFVA 2PAFA 4GYKA 4FXOA 4IQGA 2A5LA 4M8SA 4Q24A 4WXEA 1Z7YA 2R48A 2DUNA 2OA0A 1JA1A 1M9NA 1FXWF 1L6RA 5JS7A 4UQOA 5C4MA 1X39A 1U0JA 3MMSA 3WNVA 3UK1A 2KE5A 4DSTA 1OU0A 1WW8A 1PG0A 2PT5A 4V02A 3V33A 1CK4A 2Q0SA 2YH2A 1A7AA 1XDSA 1TFUA 1F17A 2A33A 2RHBA 1GRQA 4P9NA 2C7BA 3HM2A 4IJKA 2HYIC 3R77A 4YJ3B 2D4HA 3TB4A 2HFJA 1C9DB 3TVDA 1ZXXA 6ADHA 3FFBA 3LDUA 4EAQA 3SIWA 3VJRA 3D1JA 1NWHA 1NGSA 1W25A 2I3BA 3D7LA 3LS2A 3PNBA 1QIKA 3U1TA 1PKEA 3WLAA 4YLEA 5C3MA 3KSAC 3M6AA 4O4HA 4C7JA 2PD6A 2E4XA 2WYOA 1ISMA 2RH8A 3HBAA 4NE9A 5ALQA 3M1AA 4NULA 5EPUA 2HL6A 1QCCA 3AEYA 3EHEA 4GKAA 4DCCA 5A5EA 2IGBA 3CX6A 4O59O 4HGPA 4KRFA 2Y1GA 4D8XA 5FPYA 5CX1B 1DLJA 1ECLA 2WJPA 3T1YB 4BO5A 4DTCA 4KO8A 5FWYA 3QBVA 1XB2A 2C4HA 1AUVA 3T4EA 2WT8A 5ED4A 4Q4LA 3E3AA 5TMEA 3E2IA 1NE2A 1SPXA 2VP9A 4OHZA 5J3JA 4DR2B 3K0FA 5BSRA 2AW3A 4ZT7A 1B8VA 1WSWA 2VDNB 2XB6A 3EQZA 2Q2OA 3PQCA 2OYSA 4RE6A 1N32B 7MHTA 4CV1A 1HG0A 3K1AA 1FTYA 3LU1A 3NAMA 1WXDA 4MIEA 2VK8A 3F5DA 1DBVO 1KAHA 1C14A 1UQUA 1X80A 2HFKA 3IUQA 3PI7A 3PRJA 3KEGA 4I1IA 4XYGA 4P53A 4KWHA 5EWMB 3TW0A 3UAXA 4AMZA 2D8AA 1ST2A 1N5OX 3C1TA 1OZFA 4C4SA 1PFQA 4DLNA 1A4UA 1CLUA 1PNOA 2FEXA 3GL9A 5FA5A 1EPUA 2O6LA 1HSOA 3FCUB 5FWAA 3KQPA 3NG1A 3OQIB 2NXEA 3HDTA 4OP3A 2B5OA 2BDTA 4YAGA 2FPOA 4QU9A 4HQ0A 1I33A 1K66A 1NUUA 3LFUA 4OLFA 1ZU5A 3KZMA 3IBCA 4LUCA 2K7FA 2DLNA 2P1DA 5LOVA 3R3WA 2BI8A 4XWOA 4RK5A 1T1SA 4RY0A 1OBOA 4R8MA 5HNKA 4YXWA 4M37A 3ICOA 1E8DA 2QUKA 3OTOB 1NOJA 1W0JD 3DFFA 4ZOLF 5JLAA 3RHSA 4HNUA 3UPUA 4JAVC 1DSSG 2WP8J 2ZTMA 4LHZA 3HWWA 2C2GA 3QJ5A 3I6YA 2ZUTA 2PUTA 2NT4A 6AT1A 5LQNA 2GUWA 4TS3A 5E6UB 2FLWA 1N1GA 3C5CA 1SBQA 3PVZA 3QVOA 3QU4A 3QX3A 2ZBFA 1CXZA 2PS3A 1E5QA 4DCTA 1JKJA 5BQ5A 3O3CA 4GLFA 5BYKA 5JXHA 3N0VA 4PNPA 5BSGA 2XUZA 1JSCA 2X8JB 3E22B 4R1PA 1ILWA 3CUTA 4MIOA 2IH5A 3B78A 4BE9A 4DABA 4EVRA 1RCUA 3VPSA 2DCUA 3F73A 2I9KA 3K6SB 5DTIA 3PC6A 1D7OA 1TUIA 4KRYA 3TBKA 1X7WA 4OK6A 1Y3IA 4EKYA 1WOYA 3GDFA 4ZZIA 5C1PA 4UCFA 2X5KO 1YB6A 3OFJA 1G8KA 3UWKA 5JO0A 2O8FA 3ROPA 1S3GA 2AJCA 1ZK1A 3IUMA 3ENWA 1EE2A 1U99A 3HU1A 3NU1A 3IR6A 4FFSA 2W6NA 1VL8A 2PM8A 1DJOA 3OZXA 2GRAA 2P35A 4M76B 4WEQA 3P0EA 4KR0A 3T34A 4DJAA 1USIA 4F3NA 1NLUA 1QS0B 3IQGX 5K3AA 1JNYA 1AF7A 1RHMA 1AQIA 3TO5A 3AOEA 5JD5A 5I5GA 4XFKA 4KR3A 3MZ0A 3H0CA 2GZAA 2QSZA 4R7TA 3FYHA 3GRKA 5I9IA 3QPUA 1DELA 1NMSA 1PS8A 2HWYA 3FOWA 2WV9A 3A1SA 3W77A 2NW6A 3D5EA 3HJCA 2WWVD 1BO6A 1LZKA 3UXHA 4FZ5A 4EB8A 4LZAA 2XMSA 2Z4TA 1W47A 1PT9A 1Z4NA 1L7NA 2E4WA 3O8QA 4QDOA 4Y2XA 4UTPA 1TZMA 3KDAA 4RNCA 5K9ZA 2J59A 1CZLA 1JVSA 2XE6A 2AD5A 1KEEB 2WQ6A 1OZGA 4C4ZA 1Q1QA 3O2NA 1CQIB 4UHKA 1R9JA 4JEMA 2ES4A 4NI5A 4CBVA 1PK9A 1TU4A 1TJ5A 2QX8A 4G1CA 4B17A 5BW8A 1UJBA 4KLNA 3S28A 5JFGA 3PRKE 3W0LB 4JT2A 4AO6A 1HFKA 1A4XA 2NZJA 2F3RA 4P4TA 4B3CA 1IVNA 4B3XA 3PEYA 2VQ3A 4BO2A 4CKBB 5EJ7A 3CLHA 2ZJ0A 1QH8A 4AWAA 3AY3A 3N8DA 1NNSA 1TM3E 1VPLA 2OCBA 4M88A 5L3VA 1RQRA 2QNRA 5FHRA 4OFXA 2OLEA 4FYJA 1DTEA 4QYIA 4NYMQ 3ABIA 3LWDA 5DBEX 4RAOA 3R3YA 4WN9B 4DJJA 1OE0A 1N75A 5AW6A 2XNJA 2EZ9A 1T6YA 4A5OA 3ZVNA 3BM5A 1BFDA 2FPXA 3ZHVA 2EQBA 3H4VA 4EZBA 2X7HA 1ZBDA 3DNPA 4KFCA 5K6AC 3I9V1 4EUKA 2PS0A 3I9FA 4YCBA 4LFCB 1WUYA 3H19A 4HDRA 2N9UA 5BRNA 4ZU1X 2YW2A 2Q5QA 1KYTA 1QV7A 4IOMA 3DCJA 3WMFA 4IVQA 2AMJA 1FNCA 3G2HA 3LCRA 4ML3A 1X8LA 2PYZA 4B45A 2W4QA 3JPYA 5KYKA 1J9GA 1A04A 2C3UA 2XKBA 3NM4A 1NRJB 2CY0A 2I2DA 4ZICA 2G1KA 1EMDA 4YI3A 1IJBA 4OU5A 3A3PA 5KYXA 3NKVA 4JB2A 3GOQA 3IAFA 1M67A 2VJMB 1O8BA 5DBOA 1IJFA 2FMHA 3TXXA 1V35A 4TZ6A 4ND6A 3LZDA 2CDAA 5D5HA 3AUSA 2ACKA 4G5XA 3VOSA 1AKVA 1OXKB 1R4MB 3PGXA 1YDEA 4FI3F 1G3UA 3K0AB 5KTKA 5A0VA 1Y9AA 1WKVA 3CT6A 1DTWB 7AT1A 1U3VA 3C3YA 3IQIX 1UK9A 4EPVA 2Z5VA 1AB6A 3Q87B 3VR4H 5LKRA 2VXYA 4FHCA 2QP4A 4NYMR 1PSWA 3PPVA 4XA8A 3SBDA 3MCVA 4Q7QA 3VH2A 4KUGA 1D2NA 4JJIA 5T5QA 1TB4A 2J7PA 4E2XA 2QVLA 2FR1A 3CZ5A 3WWCA 2WM2A 3I61A 3B60A 2A9OA 5JC1A 3WDSA 2JFUA 1LK0A 3BH7A 4R8SA 4LBVA 3N05A 4FP9A 3H9UA 4XDHA 1H69A 3O4RA 3EEIA 1KJYA 2F2TA 1UP4A 3KDSE 4JYAB 1U02A 4HEJA 2WIBA 1AZSC 1SPBS 1TKRA 2MR5A 2YV1A 3GAMA 4LY3A 1BFKA 3T9EA 2BP7B 3T3IA 4G97A 4YUYA 4X7PA 1Y8QB 5J1TB 3U44A 3M34A 5FPHA 5HQJA 2NTVA 1W6UA 3PUHA 3PWTA 5ALLA 5EWJB 1V37A 2PRYA 4HRXA 5B1IA 3ZWWA 4BTEA 3ZU3A 3PX2A 2QTWB 1W9MA 2K87A 2ZJOA 3BREA 3KAKA 4MULA 3RVBA 2JS7A 1Y33E 2QUZA 5FNVA 1LQTA 4P4SB 3SAJA 3I3SR 3IOCA 4ALJA 2NSJA 5DHRA 2QPAA 1L5SA 1HQDA 2WV7A 4B3TB 2GJ9A 4A8JA 1FP4B 4BFXA 1HWYA 1P9RA 3UYLA 1R8QA 1U1DA 2DLDA 3IV6A 1M2OB 3B6IA 3EXAA 3D6VA 3QKRB 1Q2XA 2CFIA 2SICE 3KYJB 3FAZA 2NPIA 2AOTB 2BGNA 3G0CA 2W6QA 5FPTA 5IDVA 3QM1A 4A0SA 3W04A 3ZXIA 4BRWA 3K1JA 4RTRA 3R9XA 1B42A 4KVGA 5K0GA 2ZBQA 5K4HA 1E96A 2IW1A 2L17A 3HB1A 3KSRA 1DJMA 1VRWA 3CEJA 4B47A 3NB0A 1C1HA 2AC7A 4MS3A 3OLWA 4DBVO 2MCFA 3NS7A 5KKCA 1F9EA 2E1RA 3DJFA 3JSAA 3LHDA 2HZBA 4FW9A 4OQZA 4XVUA 2WJJA 1JAZA 4ETMA 4H3HB 1TAGA 3RG8A 3RHZA 4XIGS 2PWAA 4RK1A 1GKLA 1TFRA 2D74A 5BYBA 4DDTA 2JIMA 1C9YA 1VKHA 1QANA 1BXKA 2G4VA 3G2JA 1D6NA 4CVNA 2G63A 1ONSA 4HTAA 2R8XA 4KKXB 4BJ1A 3DF9A 1MAHA 3GVPA 3NHSA 2WWIA 3GGJA 2RCNA 2AZDA 2QR5A 3ZU2A 2P9FA 3BFKA 1H2XA 4EGQA 3K70D 1ID1A 4L2IA 3UB3A 1HL7A 1BROA 4MUXA 4B6EA 4C04A 1D7AA 3F4BA 3PNMA 1VG9B 1H0KA 2CLCX 4P3PA 1SU6A 2G80A 2R68A 3ZHSA 1MPXA 3KPVA 3C1OA 5FD8A 2PRZA 3JYLA 4DAOA 3TFOA 1WCV1 3OFSA 1R10A 1VP3A 4X92A 4FOLA 1ZJJA 2WIDA 3AR9A 5BSTA 3VHRA 3UH0A 4NDAA 4X71A 2X22A 2WWTA 1VJDA 3IT1A 4NJMA 4FDTA 4KZPA 3ZH2A 3WXBA 3R4VA 4W5QA 2UXCB 3P26A 2AG8A 5EMMA 4BX0A 2GPYA 2VA8A 3LF1A 4ER6A 5ALEA 1DPGA 2GNAA 2FGJA 2HPHA 3DMRA 1N2IA 3Q4GA 3G59A 1FJ2A 4YMLA 2H59A 4ZI3A 5JSYA 3A37A 5TX7A 4CM8A 1D3AA 1M2WA 1KP9A 5JOQA 2BGUA 4L08A 4YYZA 2GAIA 1JI0A 2I6UA 2FW0A 4E2FA 2OQRA 2WFLA 5JRJA 4HDSB 1Y3BE 4RULA 3PNQA 1MX5A 1A96A 3ADKA 4OHXA 1WU8A 4CM4A 4YQFA 1T9AA 1W36D 3GAFA 1FW6A 1KIAA 4Q03A 1MAUA 3DZJA 1I7NA 3GY0A 1YR6A 3O4GA 4US2R 3CPEA 5M04A 2ZR9A 3JQEA 4B83A 1QLHA 1UWKA 4MHOA 2AOUB 4Q47A 2F17A 2A0KA 2FWNA 4LSZA 3IAUA 1F0PA 4FMDB 4MUJA 1URPA 2HDNB 1CJKC 3F6BX 5JBNA 4RGYA 2CSXA 2BMWA 2E87A 1FEZA 1BYUA 2XYPA 1QAOA 2AWNA 1J4AA 3LRPA 2Y1FA 3DEJA 4REMA 3H5RA 2G8LA 4P6VF 1Z4QA 1XXLA 1PR5A 2ZZKA 4PHCA 1QCYA 3M89A 2P3SA 3JQ8B 3NP7A 2OHGA 4B4WA 3M5DA 4IIFA 2DFNA 4W6QA 4DXDA 3K94A 4TLLB 1EVZA 1W73A 4KIWA 4GMHA 7MDHA 4Z8XA 1FFGA 2PZ8A 3O6VA 4EW1A 4RTJA 3FMOB 1H8ED 1Z0ZA 2BM0A 4I1PA 3CINA 5CTJA 1BRMA 2BR3A 2C5SA 2AZ4A 2VYND 4KWEA 3MGAA 4PGMA 2H00A 6REQB 5L3QB 2MU1A 3C8HA 4OH7A 4CMGA 4AL4A 5KU7A 2JFHA 2EDCA 4KFSA 4MITA 2BFEA 4AKGA 1R6VA 3VR2D 3FSGA 1X1CA 1OLSB 3COZA 5AVKA 1OFHA 5A6SA 1ACLA 1V4VA 4G8BA 2PUGA 3AJ8A 1ZR2A 1AZTA 2G5CA 1P4JA 1T10A 2HMSA 1I4OA 1RI4A 1FOEB 3TXAA 4H7EA 3TTSA 1TK2A 3NHLA 4M0DA 5BURA 4O0MA 3PF8A 2VJPA 2PX3A 4MWZA 2IHYA 2VPQA 4YASA 2PR2A 1T8YA 2FZEA 1V1MB 4BO1A 2L42A 1KDYA 1KGSA 4EEZA 4RJIA 1QGAA 2XE4A 3GFVA 3NUQA 2VJDA 1DAPA 1O96A 3UYKA 1Q0LA 1X7YA 4GLOA 2R1VA 4OB8A 5AHRA 3RVKA 4R7GA 2C5BA 2BHRA 2NU8B 2CN1A 4EENA 5AW4A 3VKFA 2OO5A 2MT9A 1ZOPA 5BMVF 1QK3A 4X90A 3QMWA 3JVUA 3RUCA 4WESA 4RXTA 4MNTA 1MT0A 1WV1A 4DSZA 5KVAA 3EJWA 2QD2A 4HZGA 1K98A 1UXKA 2GBLA 2Z2JA 3DNMA 3FBWA 4HEA1 4QDTA 3ZDEA 3D02A 4RPLA 3K4HA 3AI7A 4EO9A 2VH2A 3HXKA 1DIHA 2B83A 2R6FA 2ARKA 3KSZO 1S0UA 1T43A 1U2ZA 1DKUA 4LA4A 4CCSA 1DMSA 1FA9A 1YAJA 4JU9A 1Z8NA 4Q1DA 3HPQA 3SZOA 1HZZA 4EW6A 3IDQA 4YMUA 2KLHA 4ZOCA 1DRVA 4TN5A 3NDIA 3LP5A 3ZEIA 1QP8A 3OC6A 3URKA 4MWSA 3UJ6A 3EXEA 3I73A 3ELDA 4JYPA 5D5PA 1US8B 1CZKA 5AP9A 2IH4A 5ER9A 3JQQA 1GAQA 1SCBA 4DV3B 2NTJA 2WU3A 3QV1A 4CFZA 2BWJA 4KJZA 5CU7A 1TQ4A 3C3BA 1RYDA 1Q20A 1KVQA 3C5WP 2CBZA 4WNIA 4A6DA 3HJFA 4A0RA 2HF8A 1FQWA 1UF9A 4YALA 5JTUA 1L8LA 3UW1A 2PEZA 5K2OA 3A4TA 1HNNA 3GLKA 2J87A 3E81A 2YMLA 2VHTA 2W6MA 4MUNA 4UJ5A 1IOLA 4ZAVA 3ZU6A 1R0XA 4JC4A 2AR7A 2O19A 1FLVA 1CW2B 4AUNA 4GYJA 1D1QA 2C9DA 2ERXA 1W88A 4NRDA 4RWZA 5IM4F 3EC1A 1HTBA 2JLQA 2VTBB 3DQPA 2AQIA 5KOHA 2REQA 1GWNA 2H2WA 3T7SA 3FHJA 1MX3A 2F4NA 3E8MA 2XCLA 4IQ0A 6PFKA 5CNMA 1T3TA 3KKEA 4EH1A 5CP8A 5ITZA 5DYWA 1WEHA 4YX9A 1B74A 2IOQA 3K72B 1R6TA 1WPRA 2X1MA 2CFRA 2Z2XA 1GUDA 1M75A 4NEHB 1Z83A 1G7TA 4M1ZA 2CXPA 2GPSA 2HPVA 2ADOA 1XLUA 3SE0A 4LXHA 2ZRQA 3LRTA 2O8CA 2Z2IA 4G5HA 3C5VA 3OMWA 4L9SA 1DFGA 3HM9A 2B92A 3KRTA 1I6MA 1E2GA 2AC4A 1T9HA 2HJ9A 2IHKA 3QPWA 3KLBA 2QROA 4JLJA 4R51A 2QM0A 4UVEA 1LTQA 4BBZA 4QGGA 4K05A 3MAGA 1FX0A 1GPMA 1T15A 3EGXB 2I4IA 2QTGA 3G1UA 1N2ZA 3GQBB 4YO7A 2RE8A 3TECE 3GT7A 3HYCA 3BXOA 3FSGD 5EKUA 1C8VB 5JXGA 1R5OA 5TQ0B 4DZZA 2V3VA 4TM7A 4UHEA 5JH7B 4G0UA 4JOSA 4UDNA 1QZUA 4ZU3A 1PYGA 4C20A 4V3CA 4EG5A 2IP4A 2JBWA 5CVTA 3IXLA 1B26A 4A73A 4EGCB 4PIPA 4IHJB 5EMLA 4F2WA 3ESBA 1YASA 1A98A 2E5WA 3CQ9A 3NOVA 1CIJA 3CZAA 1PGQA 2EDAA 2P2LA 2GKSA 1BQ4A 3L7LA 4M1WA 3G49A 3GA5A 4OGGA 4CN9A 2AW5A 3ZX4A 2DPYA 1ZN7A 3DUFA 4LF5B 1HYEA 3OBIA 3ORHA 1Y7HA 5B12A 1Z75A 4QD3A 3RRZA 3STYA 3EXIB 2XIQA 3GYBA 1D2MA 1TCCA 1OLUB 5F23A 4NXNB 4LWZA 1J5XA 1NM5A 4OHPA 4PAOA 4P92A 1B0UA 4MQEB 4BAGA 3AKCA 3IDOA 2IODA 2OZLB 3KB6A 3ZI4A 3S6JA 1OUMA 4D8WA 2XA9A 3QF4A 1HMYA 4B0OA 3P0HA 2IPNA 1JECA 4HADA 4D3ZA 4Y6GB 2EG9A 3EXHB 1E1DA 1FP1D 2VDKB 1E1MA 2YZNA 2AYZA 1ZINA 4TLCA 3RT9A 4WBNB 2HMYB 3KZ1E 5KQSA 4XD7A 1LRLA 3SYLA 3VUFA 2NYAA 4D9BA 3GLGA 4HYQA 3WLTA 4MQFB 2Y1DA 4M6WB 4L9AA 1KRHA 1WA5A 2HNKA 4YJHA 2Y1OA 4TXHA 2Q3JA 1GUAA 1QIIA 4I1YA 1Q1GA 1LQ2A 3OE7D 3L1IA 4GT1A 4O2BF 5EJIA 1Z2CA 4DREA 4Z4HA 5FUQA 3P2OA 2JZOA 3CCCA 1E32A 2IFTA 2YINC 4GFDA 2JLWA 3IE1A 3QKUA 3PXDA 4N5DA 4QUAA 2IVZA 2VHJA 1IUKA 3OWXA 1MN6A 3KHKA 4Z86A 4M89A 4WH0A 5D6NA 5ALPA 3OJEA 1Z6TA 2N0SA 4DUPA 3GWZA 4MKZA 3WGVA 3SFTA 1YO6A 1ZUNA 5AR1A 3A2KA 4OSEA 1VE7A 1FP6A 4FLFA 4ZVPA 4XEUA 5FHQA 3SBOA 1NU8A 3N8NA 4RZ2A 3BTVA 3FNQA 5BSWA 2XA1A 4QTYA 1XZJA 3MF4A 5TGZA 3ESRA 1MQ8B 4RZXA 4AF7A 4F45A 1IUPA 4U3JA 3D8TA 3O8BA 3UUWA 1R0BA 3A6HA 3FAKA 1ZZEA 1JU4A 4JEHA 3D4LA 2Y76A 4HDKA 4FB5A 4AICA 1JFVA 1YRLA 4AJIA 1E2BA 4X3PA 3LF2A 3UV6A 3WGMA 4I2VA 4KYUA 3EMKA 4AZ3B 3HO1A 1JXMA 1C2YA 2D1QA 3FCAA 1OA0A 3FKSD 1KOGA 2B25A 1DJLA 1TVEA 3GXOA 3HKCB 1G60A 1YS9A 1Y8AA 3AZPA 2ZYDA 3HE3A 3OPVA 4AU1A 3UGTA 3LUBA 4RMHA 3R3SA 2YKGA 3NM6B 2BBOA 3P2MA 3ZYCA 2JFOA 2QX7A 4UHBA 4BWGA 2Z0MA 3FMFA 3QEOA 3NGXA 5EIBD 2A78A 1M7HA 1CLEA 3GZ4A 4RXUA 5TQ2A 1LBSA 2JVIA 2ZSDA 4XB1A 1EXMA 2DYKA 4WW0A 4X64B 4H1WA 3QRWA 3CRRA 2PR7A 2PXXA 4FWBA 3OSZA 4U2FA 4G01B 2B8EA 3F1LA 1O94A 1Z0DA 2HBRA 5JDIC 5IX8A 2C5FA 1GL6A 3PQ7A 5CLLA 3ZLBA 4L5YA 4GI1A 4JJAA 3N6RA 1XDWA 3EZ6A 1SCKA 2DT5A 1CHNA 1W85B 4IX9A 1UEJA 2AE1A 5EAIA 2QT1A 1V1JA 1F2VA 2CFTA 3TL2A 1RFLA 2EU8A 2H08A 2IYTA 4OKNA 3EFEA 3SVZA 2QRHA 2EZ8A 3B13B 4BAZA 4BNMA 2P9CA 4OQXA 4G0VA 3DP7A 1LK7A 1CUSA 1ONOA 3G7SA 4M0FA 3C43A 4LDRA 4HR7A 4P0TA 4RVSA 2IEYA 4YB8A 3GEPA 4URHA 5HPYB 4FFNA 2PQ0A 2XT9A 4DE5A 2CHGA 2W6IA 1QOPB 1QFXA 2JGJA 2OO7A 2O5VA 1FU8A 2CVHA 3AFGA 3CEHA 3F6SA 4DARA 4W5TA 3H1EA 3N2KA 2CYAA 4YS6A 1E7RA 1WXFA 3I52A 2A1TR 3T06B 1L4UA 1J0BA 5B6PA 3DULA 5E38A 1E3QA 1Z82A 2Z8ZA 1A77A 3EQ8A 4FMPA 2WYUA 5EWLB 1GPKA 1PIWA 2IQ5A 4BFVA 2ZT7A 4TUYB 1QIGA 4OQMA 3VA7A 2E6KA 2XVAA 4Q1VA 4GMXA 5HKLA 1WB5A 4JWTA 1JPUA 3SLRA 3ELBA 1KI4A 1JP7A 3AY6A 3VSDA 4CL8A 2OORC 1V5EA 3CUEF 4YN3A 1AQYA 1KMNA 2HTFA 3A25A 1HE3A 2J5XA 3GBVA 3GLQA 4JSRA 3HZOA 4LOKA 4NL4H 5K01A 1OIXA 1Y8CA 4HDQB 2NADA 2WM9B 1FFEA 3ZBTA 2ZR7A 4IVPA 3I9KA 5K2MA 1U98A 4Y6OA 1KU0A 4XWWA 4LXIA 1ZVJA 1WXGA 2GN4A 3ZUPA 5L3SA 1UMBA 2GK3A 3QUTA 4YCJA 2D00A 2ZREA 1PL6A 2A5FA 1VP9A 3PJEA 3RVLA 1SVLA 1A8UA 3KKNA 4NENB 1N6IA 3FGOA 2BEKA 2QB5A 2HDOA 4Q3EA 5IDYA 1DWQA 4CF6A 5FQNA 4BU0A 2C0QA 3TKLA 1JVBA 2A92A 3U3DA 4Z4EA 1Z37A 2ZU0C 3HUFA 4KQGA 2OM2A 1L3IA 2V58A 4WFJA 3TG8A 1VYVA 3LW7A 2RKWA 1UBLS 3E6AA 3IQWA 1B4DA 3R7AA 4B0PA 4CT0A 4R69A 3KELA 3IP9A 4HX5A 4WNCA 5KNBD 1OJLA 4KK4A 3U7GA 3B2EA 5JROA 1MIHA 3FF1A 3PFKA 5KMGB 5K3OA 3EC7A 4MMZB 4PC2A 3B1VA 1Q12A 5ALHA 5AIBA 3L5OA 2FW6A 1VFPA 3DPIA 2N47A 4JR2A 4BRUA 5IXYA 2GD1O 4I55F 4ZCRA 2H2IA 2DPGA 3E5MA 4MROA 4S12A 4RS3A 3T9AA 3KOUA 3WYNA 2ODNA 5LMNB 1TF5A 3RABA 2HUPA 4IQ8A 4PGFA 1YACA 3PGKA 5A5FA 3GNSA 3BIXA 1U8ZA 2PPLA 1P6QA 2PZLA 3FDZA 1T5IA 5C1OA 3QFRA 4XWYA 1Z6GA 3KUDA 2IE8A 4DILA 2Z5FA 1UOQA 4A0HA 4NPAA 1KJNA 2BCEA 1F51E 2ZDGA 3OA2A 5H5JA 1E59A 3RDPA 3CEPB 4IV0A 4CMBA 2G25A 2QRGA 4HWGA 5JPCA 2MHCA 4HQ6A 5GONF 4JFRA 2OB1A 2B30A 2JGKA 4G26A 4JYCA 4PLZA 3L7JA 4J16A 4F84A 1NVTA 4BN0A 1T13A 1BMQA 3UAWA 1ONBA 1SXJA 4HFNA 5KPDA 5EI5A 5B3JC 4U7WA 1I4WA 2C0PA 4HNAB 4WECA 1Y1RA 2OQIA 1M2VA 4GPBA 3H83A 3HKDB 3GRFA 4Q7MB 3V9PA 4AJEA 3D6MA 5BSHA 1TLLA 3I5UA 1EUYA 3AR7A 1P2UA 4IP0A 5JU6A 1TMYA 3IP5A 3SZMA 3V8NA 1IZ8A 2GEDA 2Z3VA 1VPDA 2KLBA 3BMQB 5LLTA 2JGFA 2PUHA 1V8PA 3ETGA 3CRNA 2PH5A 1MX9A 3KNZA 1IN5A 1BE6A 1IRXA 2I22A 2G7MC 3AG5A 1OLXB 3AYZB 3B2QA 3U19A 3BGSA 1ODJA 1TW2A 4I81A 2D2FA 4TQAA 2X14A 3RSSA 3TKAA 1ADGA 4CDNA 4F1JA 5AVQA 1ZKMA 3GPCA 4TVBA 2VFAA 1ZHHA 3R4CA 2QF7A 3OA0A 5LIRA 1W19A 3C3XA 2HXYA 4LDAA 1NX9A 1K8RA 2Y1XA 4J6FA 4W9RA 4DVJA 2EIXA 2D54A 5HE9A 5GPBA 1E3LA 2E37A 2I4TA 1NUPA 1U2EA 1CJUC 4B2PA 4M9QA 2G5TA 4R84A 3H2GA 1QQTA 2R79A 3P4UA 4GHWA 3F97A 5T6MA 3FYDA 4R0NA 3VQTA 1YCGA 2YVAA 4DRXA 3GJQA 4CF5A 4J6EA 5LP6A 5IP5A 3RS0A 1XMXA 2JLCA 3C14C 3IIJA 5SZJA