1BMQA

Crystal structure of the complex of interleukin-1beta converting enzyme (ice) with a peptide based inhibitor, (3s )-n-methanesulfonyl-3-({1-[n-(2-naphtoyl)-l-valyl]-l-prolyl }amino)-4-oxobutanamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
167
structure length
167
Chain Sequence
b'GNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTERLEUKIN-1 BETA CONVERTASE)
publication title Peptide based interleukin-1 beta converting enzyme (ICE) inhibitors: synthesis, structure activity relationships and crystallographic study of the ICE-inhibitor complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 43
structure length 167
sequence length 167
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 1998-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bmqA00
4D3YA 2CNNA 4NOLA 4IEFB 4PRZA 2QL9A 3UOAB 3PCXA 5IBCA 3BIJA 2NN3C 3H1PA 4QUDA 4DCJA 1RWOA 3EDRA 4QU8A 2H5JA 3KJQA 2CNOA 3R7NA 4IYRA 4I1RA 3DEJA 3DEHA 4EHFA 1SC4A 4ZVSA 2QL7A 1PYOA 3EDQA 3R5KA 4N6OA 1RHMA 3UO8B 3NR2A 2P2CA 3ITNA 4FDLA 4AWBA 2H51A 4DCPA 4N7JA 1CP3A 1K88A 1RHRA 4HQRA 2Y0BA 2K7ZA 2C2KA 1IBCA 3V6LA 4QU0A 4JB8A 1BMQA 4NOKA 1K86A 2QLFA 1GQFA 5H0IA 2XZDA 4N5DA 1I4OA 3H11A 3RJMA 3H0EA 3OD5A 3KJFA 4QULA 4JR1A 1RWXA 1RHJA 4HVAA 4QUAA 4EHAA 2J32A 1F9EA 5IABA 5LU8A 2H5IA 2C2ZA 1SHLA 3PD1A 2HBQA 1JXQA 3R6LA 4JQYA 4LSZA 3R7SA 4AW9A 4QUHA 5K20A 4PS1A 2H4WA 5IARA 2WDPA 4D3ZA 2H54A 1I51A 3NKFA 3R6GA 4N6NA 1ICEA 4JQZA 3R7BA 4EHKA 4QUEA 5IASA 1RWNA 2AR9A 2H4YA 3GJQA 1SC3A 2Y1LA 4ZVQA 3D6HA 3DEIA 4ZVTA 4EHLA 4JJ7A 5LU9A 1RHQA 3D6FA 5IAJA 1GFWA 1RWMA 2QLBA 1QTNA 4I1PA 4NBNA 5LUAA 4EHDA 5IAGA 4QUGA 2XYPA 3V4OA 4DCOA 1RHUA 2FP3A 1QX3A 2FUNB 4EHHA 4QTXA 3DEKA 4ZVRA 4PRYA 2J30A 2CDRA 2HBRA 3D6MA 4FEAA 3PD0A 2J31A 5IBPA 2QL5A 4EJFA 1NMSA 4JJ8A 4QU9A 5IC4A 4AWAA 5IANA 4QTYA 4D3XA 1NW9B 3QNWA 1RWVA 3H13A 3K7EA 4HQ0A 2XZTA 3S8EA 1SC1A 2CNLA 3R5JA 2H65A 3S70A 3V6MA 2QLJA 1SHJA 1M72A 1PAUA 2C2MA 2H48A 4NBKA 5IAEA 2CJXA 5IAKA 2C2OA 3P45A 4JR2A 4FGUA 5I9TA 1I3OA 3GJTA 1RHKA 3E4CA 5I9BA 3V55A 4QU5A 3H11B 4QUBA 4ZVOA 4ZVUA 5IC6A 3KJNA 3V3KA 2CNKA 2C1EA 1RWWA 3P4UA 4NOMA 1RWPA 5JFTA 4JR0A 4QUJA 3V4LA 2XYHA 1KMCA 1NMQA 4QUIA 3IBCA 1QDUA 4PS0A 3GJSA 2XYGA 4EHNA 1NMEA 2HBYA 2DKOA 3NS7A 4N6GA 5IBRA 5LUBA 4ZVPA 2FQQA 4FXOA 2HBZA 4NOJA 1F1JA 4N7MA 2CJYA 2J33A 4M9RA 1RE1A 4NBLA 3GJRA 4JJEA 3SIPA 1CVRA 3IBFA 3SIRA 1I4EB 1RWKA
chains in the Genus database with same CATH superfamily
1CIJA 5J3JA 4EO9A 3HBNA 1NXQA 2BH9A 2AZTA 2CLHB 2WWGA 4FD2A 4KRXA 5DPMA 1U5AA 5FHRA 4LJLA 3QUTA 2YHAA 2QP4A 3LUPA 4QUDA 3OZDA 5IWCA 4UU1A 1JPVA 1WMSA 1B8UA 4U8GA 4CIBA 1ZCJA 4DWOA 3NONA 3TW4A 4EHFA 2JAOA 2VK8A 2VZ8A 4IDDA 4PONA 4Z49A 1PJ3A 4C5BA 2RGDA 1Z4MA 2NV6A 2OXFA 4PN3A 4HZUB 1F2TA 4HB2A 4M6WB 1SVLA 3EFHA 4WLFA 4BZXA 5CVTA 5KTNA 3TSZA 4IQ4A 2PL3A 1ID8A 4N48A 4H7FA 1EGHA 1WD7A 1G60A 1A27A 4IZ6A 3G59A 4OHMA 4DZZA 3A6JA 3ESBA 4LOJA 5BUCA 2VR1A 3FCOA 1GUZA 4TT8A 2J7KA 1V5IA 2O1WA 2ZRAA 4K6CA 6REQA 5AKXA 3JR7A 2H59A 4BO5A 4ZAFA 2HPAA 2WAAA 3AUKA 4LOHA 1Y5IA 4QIHA 2IDZA 3IRVA 3D0RA 4F0JA 3HB5X 5E8RA 2PZLA 4IG9A 3THOA 1AA9A 4AYWA 2N46A 1IXKA 4E5SA 2JZCA 1MQSA 2BGNA 4CKWA 2EWVA 1B15A 3FHOA 4GICA 3LY5A 3WMXA 5C5CA 3WNBA 3U5ZB 2JD1A 1WXDA 4BQEA 3PQFA 4KO8A 5TB5A 3MCTA 1ECGA 5FLKA 1EFHA 4LHWA 3MUOA 3WFJA 4RYDA 1JFFB 3AG6A 3CM0A 3GEIA 2XZLA 1SD2A 4DR1B 4CKYA 1I7QB 5LA6B 5BWOA 2JJYA 2E37A 5FQOA 2IZZA 3C3YA 1XCGB 1IOVA 4MIEA 1C8LA 1UQUA 1V6CA 2YJTD 4ALKA 4D8YA 2QR5A 4IWXA 5K9ZA 3EDMA 4KQCA 4LGMA 2BMJA 1G42A 1J42A 4Q3NA 3H2BA 2AF3C 4II7A 3D5TA 3CN7A 1N5DA 1X1AA 2X0JA 2Q2VA 1JEYA 3N0TA 1MVLA 4YRTA 1MUUA 5KC8A 1FSPA 1KEKA 3HWRA 2FE4A 1NBWB 1F8XA 3C0KA 4BPBA 4TRRA 4K81B 4ZGBA 1XT6A 2WU8A 4PC3A 2O7VA 3A1VA 3UJHA 5ITVA 3NANA 4EVSA 5A3JA 3Q3IA 3PD7A 5CUQA 4ZZ3A 3VTZA 3PJEA 4WPGA 4B81A 2EW1A 1G7CA 4M1WA 5AH0A 1LY1A 2BR4A 1K7SN 4QUBA 3IEKA 3PA6A 4OSEA 2AA3A 1R74A 2C0CA 4F60A 2Q4TA 1IYZA 5B4TA 4P0PB 4FFBB 1CEEA 4FGJA 3INYA 1E3LA 1U1GA 4ZT6A 1SCJA 3D6TB 3DHWC 3P0EA 1UBHS 4I46A 5JNLA 1M6YA 1HNXB 1DRJA 3VU9A 4PC1A 1YVRA 3DKVA 3HJRA 1VHDA 5TY0A 1LQ2A 1EWKA 2CXNA 3HXTA 5AUNB 2P4HX 1P1RA 3WK9A 4NV3A 4HAUA 3MJDA 4TUYA 2BFEA 1JBQA 3RYFA 3QKRB 1WHSB 4C7OA 4AMVA 3R20A 3RVOA 4B7UA 4C22A 2YY5A 4I9GA 3GLFA 2XNJA 3IT2A 5E6RB 5K1ZA 3T3EA 3OU2A 1K6IA 3NAMA 3JZFA 1P0QA 2V6GA 1M2WA 4O2BB 4IDOA 2WTNA 1HEUA 4BKOA 3W8EA 3RRFA 5KCZA 4D6XA 1F1BA 5HK9A 3MBIA 4AO8A 3E7WA 4B1FA 2D54A 2NV2B 2Q5HA 2RB5A 4OKIA 4QQFA 8ATCA 3HUDA 1Y8QB 3RSGA 3TW6A 5E3HA 4DPMA 3AUAA 4W9NC 4F5YA 4ZO7A 2JLSA 1U8YA 2W90A 2RI1A 5LP6A 2PU7A 2CXOA 2EL7A 4MRAA 5DRTA 1KY5A 3U4HA 4ARZA 2AC7A 1B8VA 2MR6A 4EFLA 4NBRA 5K03A 4RPLA 1D07A 2EDCA 3AR6A 4F12A 1U0LA 3NHLA 2GJSA 4LA4A 1FNSA 3Q7PA 4JSTA 4JP1A 3OEHA 2O6LA 1UBGA 2H06A 5I9IA 2EJVA 2ZUEA 1S9DA 2A0WA 2IWRA 4LJKA 1PDWA 1QLWA 4L6IA 1RLJA 4AJLA 2R44A 3QX3A 2WQZA 5D84A 1LRLA 1R8JA 2EBWA 2VJOA 5D7NA 4GP6A 1QKJA 4NCIA 1ACMA 3VDMA 1EFVB 2W6IA 4V0RA 2ZYHA 4JYAB 1PYDA 2H2IA 2YMLA 3KXKA 2YWGA 4NJMA 1OCEA 5FBLB 3T9FA 3PTAA 4ID3A 2WBLC 1CJKC 3W5IA 4IL5A 5EESA 5LU9A 1N3YA 2OLJA 2CFOA 2D5CA 2H1IA 3B1ZA 3N5KA 3E5RA 3WIUA 2WVJA 4RD3A 4AFNA 5FHQA 4DSUA 5LIPA 2VTKA 4ZXFA 4C3ZA 2PMCA 1IY0A 2Q1YA 1JFTA 3AHGA 5L3QA 1N6HA 2H29A 2ZEJA 4RHUA 1AGYA 3CNBA 2J8ZA 1M2JA 2Z1MA 4RLSA 2FZ5A 4Y2XA 2F67A 3DT6A 4BATA 3FOZA 2XWQA 5CT6A 2CB9A 4JI4B 3BE4A 4F2PA 4HT3B 3UGQA 5HCUA 3ASYA 1KETA 2ACKA 1GXSA 4I55A 1MU0A 5H81A 1DADA 1H42A 2O8EA 5L6LB 3RFXA 1F2TB 4GEKA 1IJBA 1BQ3A 4IH4A 3WGKA 4DGSA 4ZFNA 2KHZA 1X0XA 2V8OA 2WIBA 3MD0A 1GZ4A 4MI9A 3OZCA 1Z6QA 3BK1A 3NGMA 4CM9A 1Z22A 2YJGA 3KQQA 4MHOA 5DMXA 5AXCA 4RKFA 3V6MA 4EJSC 1QIMA 1GKKA 2JBHA 6REQB 4K3VA 1VCOA 3L93A 1FFDA 4DNQA 4HGPA 1XRRA 5F3WB 4BNIA 3W2EA 2XMBA 1J8MF 3E05A 3NHMA 2OL4A 4IIYA 4IWNA 5JASA 5I7WA 2HTFA 1IZ8A 2OO5A 1R8XA 1S1MA 3IT3A 3NQ41 1KH2A 1HMYA 5KBYA 3P4UA 1S2DA 2P69A 2V4ZA 3K15A 4FJ2A 5KNCH 1MZPA 1JZTA 3DE2X 4BFWA 4FC6A 4IILA 4UUAA 4CKWB 4RQAA 1GGNA 1VXRA 2MSNA 3I28A 1WF6A 1OWLA 3AZQA 4JP2A 3S40A 3KKEA 2RHBA 3EIFA 2HH9A 1FFGA 1UFVA 3DE0X 4RPIA 4UQPA 2R85A 4XWTA 4MJ3A 1OOEA 2YTZA 4O5OA 1X8LA 1XXHA 4JVMA 1WBDA 4MQLA 1QG6A 4OB7A 3RKSA 5CBKA 2ORVA 1K5PA 3CIFA 4Y2VA 3GK3A 4CPDA 3MLBA 1AA6A 2CLKB 3N74A 1VPTA 4P3OA 1KC3A 4FUTA 1T5TA 1NR5A 4JLDA 4UHCA 1VJCA 2FUCA 4MTLA 9LDTA 3EYAA 2IHJA 3TZHA 1ZIOA 4GI1A 5CLJA 4GE0A 3I5XA 3W7VA 1AGNA 4YR9A 4DV7B 2A4KA 1GGJA 2APJA 4QDJA 2JGRA 1R88A 2WZCA 2W6QA 4DLUA 1JSRA 1T4GA 4JJZA 2ZVJA 4AYTA 4DHWA 5JD5A 4FFSA 5KSYA 2PD4A 4G63A 5H59A 5HCIA 2I8AA 4K8OA 3RAJA 1JTEA 2RC6A 3PNOA 5D3MA 4EFKA 1JEYB 3IJ5A 1UODA 2W6JD 3E27A 1JWLA 3OSUA 4FB4A 1WMBA 1XRNA 2P11A 1WNFA 3CONA 4KFSA 4IIGA 4M7WA 1Z29A 2IHTA 4KXFB 2C2KA 2EFDB 4NE2A 2VDKB 3LRXA 3RS5A 4TYYA 4D1YA 1IG3A 1JSCA 1ULAA 3NNDA 3BH6A 3CUWA 4PAMA 4YBRA 4JS0A 2QMQA 3ESQA 2JHAA 2PEZA 1IVNA 2XI4A 5EVCA 3HCCA 4MQUA 1WW3A 1Z45A 1USIA 3E9NA 5EC8A 1GNTA 4PLTA 1VRCA 5AM3A 5FI5A 5IDXA 2RG7A 4IPTA 1C7FA 2PG3A 1U9YA 2XITA 3IBYA 4X71A 5DT2A 3WJ2A 2Z9BA 2EJWA 4MW4A 2C82A 2Z0MA 3MYYA 4XFKA 1XA0A 1CNFA 4I4IA 3ZDZB 2E4YA 3VU9B 4AQYB 4AKGA 3KQNA 4RELA 2Q3JA 3O2SB 2B7BA 1O5OA 4YMVA 2P9QA 2DHCA 4NMLA 4EZBA 4UM7A 4KXUA 5HQJA 5CAEA 4AY2A 1KMQA 3ZGVA 1I0LA 3GFRA 4Z9XA 4ZCQA 1N2IA 1XO1A 4P7KA 3WHLA 4BNGA 1E6EA 3HFJA 1W87A 1VMDA 2QU8A 3ORSA 5IYZF 4TUYB 3RYFB 2HZBA 1XMPA 4DXDA 4U7WA 5LQSA 4C7OB 3R6DA 4WIAA 3OPMA 4OM8A 1Z2OX 3KWLA 4BUZA 3GLFB 2XRYA 3D7NA 3BL8A 2C20A 2ILTA 1R6VA 3AHFA 3ZYCA 5AOCA 5FPKA 4YQZA 1E6KA 5CU7A 2G1PA 4YAJA 3IUPA 2P1ZA 2HYIC 5KYUA 1JEOA 4LVOA 4MIOA 1Z73A 1YT5A 4BFSA 2L0XA 1VKOA 5HF9A 4QXAA 1RLMA 2CNWD 1ZJZA 5EHQA 3UXHA 1G66A 9ABPA 1W29A 4WHMA 2JLZA 1JDTA 2OBYA 4X5OA 1BJRE 1HT1E 5LP6B 10MHA 2H4XA 3EN0A 3R9XA 1YZUA 4GYKA 2O2EA 5FV4A 3JAMA 1QB8A 2JCYA 1BU8A 2A9PA 1UPUA 3ZDBA 1GTVA 4UW9A 3CY6A 3GHHA 1RWWA 1LCIA 2ZBRA 3PR2B 2L18A 3VDNB 5DX1A 1DKQA 2LWIA 1G6Q1 1XNGA 2Y1FA 3BHIA 4PYOA 3RUCA 1ZNZA 1AUXA 3MWLA 4L5CA 1Z5GA 3F4KA 3FXAA 1G2PA 1WCXA 2DLDA 4JC8A 3PEVA 5FWDA 4I1PA 5AW0A 2GEVA 1KTIA 4PC7A 1GGFA 2GM5A 4YRKA 2W4IA 4YXWA 3UFXA 3VPCA 4AWBA 1KJJA 4WFIA 4QPDA 2WUFA 1XZFA 3VM6A 1ZD8A 3VKVA 4M9UA 2OPHA 3QFSA 1DWQA 1LTHR 4MUJA 3U09A 3HXMA 3IS3A 2KBFA 4JJ6A 4WNAA 5EP3A 3IEUA 3GGDA 2V5AA 4S2EA 5SY4A 3L18A 2GEBA 2JAWA 2VJQA 3L43A 4U2BA 2ZIGA 2PEYA 1AQ6A 3F46A 5L3QB 2GXAA 2BFBA 5JPCA 4Z0TA 1I94B 1EVLA 1VIYA 2ZJ3A 1GGKA 3PXXA 3IAAA 3VO8A 4PN7A 5JO0A 1SC4A 4YRCA 4FB5A 1ZKDA 3ACDA 3V2GA 3OMXA 5I47A 1PNVA 2XBUA 4I55B 5COQA 1GXSB 4GOKA 9ATCA 2IQIA 2O8EB 1LPMA 2JCSA 2FOLA 1K88A 3K4QA 3MTQA 2ONKA 3OP1A 3PQCA 4NH4A 4B3CA 3QFRA 4XDGA 3ZKWA 1NP6A 3GA7A 4IHJF 2C5FA 2EFYA 2FRDC 2IIPA 1ISMA 1ZN2A 3VV2A 3ZE9A 2QRMA 3FRHA 3FY4A 1K86A 4HP8A 4U7TB 5DCLA 5H68A 5TARA 1ZGGA 3T06B 4UZFA 5DN6D 3PB3A 4M9SA 4KR6A 3WZMA 1NW4A 4WZBA 2VPXA 3HDGA 2I2BA 2NO6A 2BOVA 1Z2CA 3OUUA 1MXFA 3BH0A 1IEWA 4ED9A 5C35A 4UTNA 2UXCB 2B5WA 2OHOA 4YCNA 2QT1A 4ARIA 1P4AA 2PKQO 1KAQA 1LPNA 3CUTA 3ESYA 3WX0A 5T4HA 4H1TA 1DUSA 5HRUA 4D8WA 3P97A 3TK1A 3HV2A 3GELA 1LZKA 4DFDA 4UVHA 3SBOA 4XRGA 4WY5A 3BK2A 1GRCA 1I51A 3J80A 1HKUA 1NU6A 2ECOA 2VRNA 4WBNF 3DR3A 5IASA 2HK6A 3LX4A 1WDKA 2QZJA 3IDOA 1T15A 3IUQA 4J0EA 4ADSG 3CH6A 3VMMA 3SC3A 4E5DA 4N0QA 4CLEA 1IXYA 5DBOA 3C3MA 1Q7GA 3RUPA 4K46A 1LDMA 4BMPB 3QPDA 2IYEA 1K9SA 1HL3A 3G8AA 3R3XA 4HNSA 4FP9A 5JQWA 2OSBA 3F74A 1PEKE 4Q9HA 4C4XA 4GBJA 3BQMB 4XEUA 3UJBA 2XDQA 2ETXA 2DT5A 1TM4E 1WQ4A 2VAWA 3IPYA 4UD2A 4PBTA 2FJUA 2FUG1 3KZ1E 2VYQA 3EZXA 5CYPA 1E0SA 2PLNA 4LF4B 2ZS8A 4YJ3A 2XE6A 3S2EA 3E3AA 5FLYA 3ZDEA 1ESCA 5D3MB 3DM5A 3W4IA 5BPHA 1NQWA 4C07A 2CY0A 3PPYA 3OTOB 1O96A 1XFAA 1KFEB 4IDGA 4WVFA 3REQA 4P31A 2IOFA 2NVBA 4PYNA 4D0LB 3LOUA 2ID7A 2JIBA 2A92A 4XXHA 1MZVA 4U02A 2YIDA 5IK2D 4KAJA 3K4HA 1EDZA 4LZPA 5A7FA 1PT6A 3KQTA 3C43A 4O4LA 4Q7LA 4YJHA 2VVTA 4ZDJA 1WOMA 5BUZA 3L8CA 2FOXA 4HDCA 4EFNA 1KZ4A 2XYGA 2ZS7A 1G2IA 3U13A 5GGYA 5EI5A 2R79A 3CTMA 4PWZA 5ALMA 3OX2A 1CULC 4LY9A 5K8LA 4HWRA 5CDGA 2NWQA 2QMYA 2PWBA 4C4OA 3SG0A 3UAVA 1QHEA 3QWHA 3NYQA 4FS3A 3D6AA 1QANA 4TV9F 1KMIY 5FLXA 4F04A 1G4HA 5ES3A 4GX1A 5CAEB 2FYTA 2YMPA 2V1UA 3T1VA 4PC2A 1CUVA 3UVEA 3LCUA 4MOWA 3DAFA 4YAWA 2YVKA 4FX2A 3IUYA 4RY2A 1EK6A 1KI3A 1P5JA 1RC8A 2G5CA 4K88A 4BNYA 2R86A 3IURA 1GZ5A 2H00A 2H0AA 3F1KA 5GONA 2DYKA 1P2DA 1T4BA 3ETEA 2Q1UA 3JWIA 4FR2A 5CR9A 3T6KA 3ZE7A 1Z74A 3EJWA 3UT0A 2DY0A 1E3WA 1H4VB 2VYVD 1KA9H 3QXSA 5TNXA 2HR1A 4NQZA 5KYUB 1DT5A 4WCDA 4PF1A 2WJAA 4I6EA 2OB1A 3CBQA 3QVUA 5LL6P 5IVHA 4ETWA 3E1KA 1GPMA 5BUQA 1TYDE 4DQXA 3HG7A 3D43A 1G3UA 1LB1B 3K0BA 2O7RA 3B6JA 3NBXX 3JZDA 2ZDGA 1A7UA 4YT2A 2IXDA 3REFA 1ORRA 1E7RA 3H0EA 2V7BA 4NBUA 3CH7A 3RIEA 4AIRA 1RBZA 1O77A 2G9QA 4ZVKA 4B71A 3PEYA 4M1EA 1PT8A 1MV5A 3X2FA 1SOAA 4RORA 4EKYA 1K8ZB 1P9OA 4LXIA 1YZNA 5FCDA 3UANA 4YJ2A 4KEAA 1DKPA 4EI2A 1QO7A 1RJEA 4KX5A 4AMZA 4WINA 1IHDA 1G3MA 2J5RA 2XVAA 3DBHB 4CN8A 3NKFA 4MDYA 2GCNA 4HB4A 3LBIA 3T9DA 1KEUA 1P7VA 3Q40A 2RKWA 2YR0A 1XQYA 1Z4JA 2GILA 3CRVA 3UFXB 1DC4A 1TT5B 4E6PA 3IKVA 4CMJA 2YKGA 5C4GB 1XYVA 3DDNA 4UUOA 1RWMA 4OQXA 3OLWA 3WTBA 5H5JA 1ANKA 2A0YA 3FG9A 1EWYA 3P71T 2REBA 3T7TA 4WNAB 2G07A 1J1UA 1DKUA 2Y4NA 2PUAA 3B9QA 2JKYA 1NJ8A 3L7IA 3I2IA 1TYZA 3F5DA 3KE8A 1OU0A 4DV6B 3LD9A 1FVHA 3C6KA 2BFBB 2NU8A 3FBWA 4DZTA 1Q3KA 2F8LA 2X8LA 1FQOA 2I6FA 1A9XB 1A9QA 5LIRA 4FYXA 1ETHA 5F4BA 1SQ0A 2OC4A 4W9RA 3H2GA 4XFDA 1RYBA 1WEHA 2GFQA 1Z17A 2H3EA 3GFSA 1G59A 3ZKWB 2UAGA 2AHRA 3DOUA 4DARA 4PZLA 3VXKA 3GRYA 2X1HA 5IH3A 3RC1A 4KFCA 1KDYA 4YCJA 3QTTA 1N7IA 2PZKA 4YCBA 2VSOA 5EIXA 2KI5A 1OHHA 4BCDA 3ISTA 4WZBB 1MTOA 3ES9A 2QZ9A 3BAZA 4V0MA 5DBFA 4UPEA 1KP3A 4XD2A 3TPZA 3I30X 3KPUA 3NUGA 1ZO8A 3TS1A 1J97A 3TH5A 2CHUA 4BX2A 5JARA 3HBJA 4P86A 2IITA 4N8SA 2X8AA 5IJ9A 4LFBB 1K1EA 2I3BA 3UK7A 3WJ1A 1ZG3A 3MMSA 3T3HA 3ND9A 1U0OC 1E92A 4CL0A 1CQXA 3VAAA 1QVRA 1FRVA 3NDBB 1V8OA 1JJIA 4LYFA 3I01A 2JD2A 2WKSA 3EZFA 1USVA 2C94A 1O0CA 4KR3A 5E8JA 2NZ8A 2P65A 1K9VF 4P33A 2W4QA 3A1EA 3HE3A 4NQRA 2QD4A 4KAAA 3P4XA 2QDXA 2ZRDA 3TEFA 1EYZA 1P45A 4UVGA 1XOIA 2LVBA 2C84A 4R1SA 3TRFA 3KKLA 1CS4C 3BFXA 3TCNA 4CV1A 4PNEA 2C4MA 3FRIA 2ODQA 1DJQA 1C1YA 1I3NA 1KDVA 5HPYB 2IZ1A 2XDQB 2YWEA 3BA6A 1XCJA 2JRCA 1MNQA 3H5VA 1GPYA 2G40A 3L07A 2BUCA 2IDMA 4UMEA 1CUEA 2QM8A 1P0MA 5DSTA 1F38A 4YJ3B 3R7FA 2Q5QA 4GRAA 4I50B 1G6OA 1Z88A 3GNSA 2PZGA 3TAXA 1MF7A 2YFHA 1V8BA 3NWPA 5L9AA 3FCAA 1OYYA 1DLIA 5BN3A 4KQKA 4MRRA 5IP5A 1MIHA 5LDDC 4XWWA 3MWGA 4YI3A 3G7NA 1O96B 4CF7A 3ZZUA 3REQB 4BRUA 4YA6A 2QKYA 3DV0A 3O93A 3H19A 1OT5A 4JLOA 5ENVA 5JFOA 4ZV9A 1FK8A 2AR0A 2WU3A 2PH1A 4L4YA 4WJKB 1JQKA 1JHUA 1I7SB 1HQCA 4L6CA 4YJHB 3PKIA 4O4LB 3MT0A 1U1DA 4JJ4A 1T5BA 1C9JA 4E08A 2GX6A 3VHXA 1AVTA 2VOEA 3I5UA 4EB6A 2IUUA 5EIWA 4TMXA 1ZK0A 5TGZA 1ADJA 4QGBA 2HU2A 4LXUA 1DWPA 3OUZA 4GQIA 1ULBA 5JE8A 3I61A 1KZ7B 3DEIA 5F1KA 2O1SA 3ANTA 4JI5B 3HXKA 3NXKA 1XDDA 2BKXA 4ZQHA 5K05A 4LVUA 5HS6A 2H1VA 3MMNA 3AJEA 2R6R1 2VCHA 5MFPA 3EBLA 2FEWB 1I9GA 1GDTA 2AQ8A 1N6RA 2OBFA 5GONB 4DF3A 2DWPA 1XYYA 4RO0A 1J22A 3EA4A 4O6VA 4PG6A 5JYEA 3QHQA 1JG7A 1RKVA 1QBGA 4EO4A 1Z4QA 3IUNA 4MITA 2FSFA 4RJLA 2B9EA 3V1UA 1XTVA 3D6JA 3LFUA 1NXWA 3UA3A 5BNTA 1P2GA 1DC3A 1NQ5A 2MSWA 2XZTA 3TTVA 2ZUFA 3W9YA 4K9SA 3EAQA 2IVFA 2ONYA 5B7QA 2XR1A 1FCJA 2FVXA 5AVJA 2JG3A 1PUXA 1QKKA 1U80A 4YONB 1XK7A 2F48A 3LYHA 1W44A 4RCYA 4Y6OA 3ZCXA 3V3KA 2XA2A 4HAIA 5J9FA 2Q45A 4OH1A 1MDBA 5H3HA 4YMTA 4RM3A 3E6AA 3VOTA 1NV8A 3DE6X 4IXWA 4E94A 1AMNA 5LP6C 2IOQA 4BEVA 1UBRS 2A5LA 1EE2A 1N3LA 2VH2A 3BD6A 1Y1PA 3D1LA 4JZKA 5FBQB 1RQLA 3TQHA 4EHNA 4YJ2B 2BI7A 3AHJA 5A03A 3OE7D 3F9IA 1CRQA 5EXEA 3EGDB 4RZIA 2VK1A 5JMPA 1NVUQ 3DYIA 1RE1A 1I3LA 2JLAA 3LC7O 1DDIA 3GLRA 1U11A 4H6XA 2A0UA 4IV8A 3VHQA 3EGXB 4OQQA 1O0SA 2A33A 4IIEA 2IGTA 2BFOA 4RKEA 3AJRA 3OJCA 2NX2A 2PMFA 2FZ4A 4DSZA 3OJXA 2F3PA 1ZCBA 2I2DA 1TW3A 1EJ6A 2VNHA 2VTDA 3BG5A 3JQQA 3TJRA 4A03A 3HSKA 3VKHA 3AM5A 3IO5A 4ZYTA 3F8TA 3ADPA 2AC2A 4AP5A 3VR4D 3KIPA 3HADA 2NU8B 4KXLA 1ZI9A 2HRCA 4UULA 4ZZIA 3JQ6A 4JOCA 5LNK6 3AF5A 2I3AA 3MC1A 3NOXA 3VZDA 5LLDA 3QE2A 3EVEA 3AT1A 4KI7A 3B9BA 4YQEA 1Q0SA 2C97A 1T9GR 1MA0A 2QJTA 4WWHA 1FJXA 2QPTA 2JFZA 4H7IA 2CHVA 5FL3A 1ADFA 1A3CA 2ZANA 2PRKA 5F1YA 4ZEVA 5CB0A 5C8VA 2H18A 2JGFA 3C3AA 4RD0A 1IY1A 3BWMA 2IE0A 2LGJA 4P92A 3UK2A 2COKA 2JLRA 2Z3WA 1Z5OA 3L7CA 2GPWA 3LH5A 1OX4B 1RHJA 4QUKA 5EPUA 5IXSA 1O94A 5IYZA 3PUYA 3JZIA 4MVXA 3B3QA 3IMEA 1M6EX 4IDEA 4YJDA 3ZYZA 2DCMA 5KNDH 1RAGA 4N9WA 1H2BA 1W47A 4UNPA 5KWSA 1UJMA 1B6RA 1LDBA 2EP5A 3GL9A 2IU4A 3KU4A 4OD0A 4YMUA 2PSJA 2OO5C 1L1QA 3R7BA 3T3DA 3IUBA 1YVPA 1KXJA 4W8OA 3X2SA 3OQVA 4GVLA 3QRWA 4IQFA 4QFMA 4P6VF 2P1RA 3FB4A 1ZAYA 4RNDB 3E15A 4QNMA 2Q3CA 5IM4F 1FE8A 2JAHA 2JGJA 3N07A 3RNLA 5JSQA 1ZYUA 4WOKA 4P7BA 4BE7B 6ABPA 1QYWA 4BNUA 3L7BA 4PX2A 4CEJB 3EE6A 4IXTA 1POWA 5TGDA 3I39X 1AZWA 2QQ5A 4PCVA 5GJVC 4R0VA 3FYUB 1NBMA 3QU7A 3U7FB 1BFDA 4HYTA 3D6MA 3MGBA 1LC0A 2I7VA 4U7PB 5DNUA 2OHJA 3VX4A 2IXTA 1SUBA 4BNKA 3KETA 3B5IA 4QD3A 5JXJA 3A2MA 4DEVA 3Q7EA 3WBKA 2HX1A 3QVOA 4XQ9A 1ZGHA 2WSBA 2B8JA 1OD6A 1SIWA 4I36A 2XQFA 1XQ9A 2G1JA 4UEWA 5KEIA 4DPLA 3VTAA 4BFXA 2VBFA 5CFZA 2JK1A 4Q4LA 1JIUA 3UV6A 1VP3A 3O5AA 3R74A 1H94A 1V71A 4CM1A 2KPOA 2CHEA 3PU6A 4I4TA 4Q66C 4YNBA 5BN3B 3VRHA 5HKKA 5ALSA 3DWIA 5DGIA 2IY9A 4XVRA 1VLHA 4EW2A 1X87A 3OFJA 1V4BA 3FGNA 3IFSA 2HMYB 4XH9B 1XDSA 4OM7A 3G5TA 4IH1A 5JEDA 1N5OX 5EHZA 2JH8A 1I4DD 2CLCX 1KMHA 2C4WA 3TX2A 4E5PA 2PTGA 1XDGA 2D74A 4CLRA 1IU9A 1V2GA 1E0KA 2J07A 3L2OB 1SQ6A 1W4BA 4OXNA 4EB6B 3IBFA 2ONJA 1VSTA 2P8JA 1RYDA 1D3AA 1NN5A 2JAUA 3I1FA 2WMDA 1N0HA 3FHCB 1SULA 2V7PA 2FSVA 3B5EA 4L9WA 4GH5A 1RRGA 2QMOA 5CITA 3CRRA 1T9AA 1IHOA 1QBKC 1OU4A 1EK0A 1U7ZA 2CBZA 2FDXA 2R2GA 1GQSA 3LKBA 4NENA 3U4CA 4HAZA 4WKBA 2I4LA 2VN8A 2A0XA 1BHSA 2JGEA 2XQKA 1Y37A 3GGCA 3PC8C 4IDBA 1P5RA 1W93A 4MGHA 4CM5A 1KYQA 2M1XA 4BVBA 2HEIA 5BSUA 5AOBA 5EJ6A 1DKMA 4MKHA 4QBHA 4EUHA 1Y3AA 1C3LA 2NSHA 3GFPA 2WQ6A 4LW8A 2IGBA 3B51X 4WTOA 5B7PA 1HDZA 1CJCA 3QOXA 2WF7A 3SHWA 3EIEA 2CVPA 2WZBA 4Y0NA 3UICA 3DBOB 1T24A 2ZSUA 1GVNB 4W6QA 5BW6B 2PL9A 2YWBA 3CX3A 5SY6A 3RABA 3GEHA 4L8GA 4AAYA 4EB0A 2VJNA 4KV9A 1X8KA 3PXUA 1U99A 2C58A 3C14C 3H42B 1BVRA 1JMKC 1P39A 4YO8A 3TKLA 4JI8B 1XTTA 2Y8EA 4ZYZA 1D6NA 1YRQA 2EKBA 4KN5A 3LBFA 4BYMA 4HNUA 2WM3A 2JFFA 3H4TA 3U26A 1EDDA 3H3JA 4XGNA 3G82C 2W43A 3MTBA 1N2OA 1N3BA 1UK6A 4FHEA 1GQQA 2V7VA 5EG5A 1ZGJA 2VDOB 1ZZGA 4Q7EA 1J20A 4IZIA 1DOAA 4HH1A 2G28A 1ZUWA 3S68A 2GN9A 4WKPA 1D2MA 1YQWA 1VCNA 2QI9F 4PLVA 4D56A 5IG2A 3DHEA 3FJ1A 3ZIDA 1ZICA 2MYNA 1EEXB 3WC4A 5AVRA 4L5AA 3KS9A 2F9FA 3O73A 1KS2A 2PKRA 1SU7A 4GYWA 3UJ6A 1OXMA 2BFFA 1L0BA 3QG5A 5BV8A 5IF9A 1SUAA 4BEWA 4NEQA 3WGUA 5B6JA 3G1UA 1R10A 3QYAA 5K2OA 1TU3A 4DMUB 1RJ9A 3HLTA 3CUKA 4PAGA 4XI9A 5DHQA 4AG5A 5A1JA 2R7NA 1VRWA 3KKQA 2XT9A 4Q15A 5GJBA 4E07A 3GLIA 1J8FA 1Z56C 2VDQB 3GYGA 2UYGA 4KPYA 3AC0A 2HQRA 4KNWA 4DLNA 1U7XA 2JI7A 2VPTA 1W6UA 4QOEA 2Z95A 1XMVA 4XWAA 3S6JA 3ROGA 3WMRA 1M6HA 2XODA 2WIAA 5EOVA 5FNVF 5D6OA 2OGUA 3S1AA 5C3MA 1VIMA 4XYMA 4RCVA 1RM4A 2A59A 1LPPA 1EX1A 5AI8A 3U16A 1M2EA 4KB5A 3AR3A 3HZZA 1VYUA 3SFVA 2P8SA 3CVUA 3C8MA 4JR2A 2QN1A 4NEGA 4YXFA 2IBSA 4DIUA 3H9EO 1E8MA 4MJLA 1DO8A 3UN1A 1OFGA 1E1RD 3F1LA 5FFMA 1YZKA 5JSYA 2PGXA 2CVOA 2LPMA 5IYZB 3PHGA 4G5YA 4K2AA 1QKIA 3LJKA 3QWAA 4QUIA 4RXMA 4ZOLA 5DX8A 3EFEA 4A1OA 4AN0A 5JS7A 1XDBA 2NG1A 3WAGA 1JJBA 4BO8A 4NCAA 1O0BA 4AUEA 2GBIA 3QXCA 4V38A 1M5RA 4EF6A 1T10A 3DCIA 3MINA 5J23A 1TNDA 1E1MA 2Q9UA 5T6MA 3GLHA 1MB0A 1PFKA 4YWHA 2TRSB 3GD7A 4IDNA 4UZEA 1QIHA 4IGEA 3D3JA 3UK6A 3VUEA 4E2XA 4Z7JA 3DP7A 4EJ0A 3ER9A 4IOKA 4MYTA 4KMMA 4RENA 5K0CA 1F0NA 3D81A 3PRKE 5ELMA 2CT8A 1YBAA 2G88A 3Q0TA 5A71A 2OGWA 1JA9A 4NYJR 4Z0PA 2FZCA 1AB5A 1VLJA 2BHSA 1V7CA 1EBUA 2LV8A 1G7SA 2N1MA 4RK0A 4GFDA 3LU1A 3GA0A 1N1GA 4JEMA 5HQTA 3O7WA 4GPBA 3FOAA 5EA2A 3V3TA 3OZEA 4Y2UA 1ZA1A 2WM9B 5J5CA 4ZCPA 1D4FA 4E51A 2CWWA 4JH0A 1NVVR 5B6PA 1NKSA 1T5HX 1CTQA 1S8OA 3V2IA 3L8HA 1VBFA 4FOOA 3WGYA 4LZLA 1D1PA 1HL7A 3EQZA 1BMQA 4RVUA 5EHIA 4CLHA 2HNKA 3F5FA 1PT7A 5DLYA 4ZCMA 4RTKA 3PDIA 1HR0B 2PSHA 2MSDB 3PUVA 3C6BA 1JR2A 2CLLB 2CDNA 1Z6ZA 4I4TB 4I99A 2QVCA 3P94A 1FS5A 4O4JA 1DELA 3OOEA 2G67A 4RL4A 4A3SA 4LK2A 1ZJWA 1EVJA 4P3XA 1BGXT 3ELUA 2I76A 1FYDA 3SDBA 2GETA 4LV5B 3SE0A 1JWAB 3H7AA 2ID4A 3TDKA 3TQQA 1YJCA 4MKGA 4WAUA 3NM5A 1XZKA 5M5BA 1JHZA 3UT5A 1I1NA 1FDSA 4H3HB 1KMHB 3LC2O 1XZPA 1DCKA 1UOOA 1XCPA 3C5EA 3GF4A 2YFYA 2O2HA 4CLRB 5BQFA 4KLCA 1J8DA 3ROPA 3K9LA 4ZVQA 3OCUA 4Q4AA 3U3JA 4D82A 4CEIB 3W2GA 2UV8A 4B7XA 1ZC3A 4HMQA 1G1AA 1OV6A 1JS1X 3MOGA 5EKXA 3RANA 2UVPA 3N76A 4WZAA 1QUEA 4ML3A 4EPRA 2F1IA 4NENB 1DGQA 2OV2A 4MWZA 1D1TA 1E96A 2F17A 4KTVE 4ZVRA 4ZMBA 4UCQA 4M1YA 4QE3A 3WMFA 1QF6A 3PHLA 4MKRA 3IOMA 1S2MA 2C0PA 2CJWA 2D4AA 3DFMA 3ZDFA 1E59A 5DM2A 1TYCA 2NXCA 1M2HA 5JRJA 1QFZA 1F7UA 1B4DA 2WK1A 3IAS1 4BVHA 2Q1SA 2ZUUA 1DE0A 3N2NA 1KY3A 4K9NA 4BB6A 4F6LA 3H13A 2P27A 3AFNA 1QZXA 3OPYI 1I7LA 3DXYA 2RGXA 3N8NA 2RGNC 3ZHBA 4PO8A 4BJ5A 5BYKA 1KFKB 4G0VA 1XK6A 2I6XA 2XWBF 4G65A 4CGYA 5IAEA 1DKOA 4RADA 4GW3A 4C76A 2XCSB 5DKFA 4FEYA 3SFTA 1O4VA 3IQFA 4OHOA 2KM1A 2GJAA 3REOA 5HE9A 2YW9A 3ZTYA 4AL4A 3I6ZA 5AK5A 1NBIA 4QQKA 2PS0A 1OXBB 3H1BA 2JS7A 2Z98A 3HB4X 1NMQA 3OI7A 4JUDX 4MUFA 1G5IA 4MI3A 2JI8A 3DMYA 1S4QA 4HUQB 3ZV4A 4YRNA 1OYVA 2MYUA 3LCVB 3A4VA 4BVFA 5EJ8A 5AW2A 1RYHA 1XGKA 1XZDA 2J3EA 1YNSA 3EDYA 1GG5A 3HKBA 3QEJA 2WNHA 2I34A 5TSDA 5HW0A 2B8TA 1VE6A 5DYYA 5HILA 1QPZA 2KW5A 2R8ZA 1QDEA 2BFPA 1LNQA 3CZQA 2QTBA 4JLWA 5J5AA 2WVHA 1U0EA 5KSOA 1TVKA 2H31A 2NUAA 4IEFB 3HMKA 5NULA 4NU8X 2BFFB 1N7GA 2G36A 3TNFA 3MD9A 1GYRA 4HSEA 5A1TA 1JUDA 1BCSA 3KJEA 5IS2A 2UYYA 3SX4A 2PFKA 4C4TA 5A9RA 4CLOA 1RJ9B 4QPCA 4DIFA 1RWQA 2IIQA 1RMQA 2WIFA 3C45A 1HDXA 3GRZA 1VDMA 2G0TA 2Y0DA 1UF9A 3GLIB 1VRVA 1A9ZA 1UBEA 3C98A 1IRXA 3IOEA 5BQ3A 4Z3OA 3WZ2A 1H2HA 1P9WA 1J9EA 2P4QA 3M1IA 4MV5A 3S1AB 5B3LA 1J90A 1W59A 2VNIA 3QE4A 1ZQ1A 4OVKA 1EQ2A 4D0GA 3FDFA 2B3DA 1B6TA 3A05A 3EXAA 3LIPA 3GU3A 3WGGA 5TR9A 1R5BA 3RVKA 4DMFA 2R8YA 1Q12A 3OE4A 4OQZA 3HY3A 1OMOA 2WC1A 2JW5A 4FOPA 3HVUA 5AKIA 4FIZA 1R9GA 1DV1A 1QIGA 4IJVA 3A0UA 4MGYR 4UDNA 2HK8A 5E6SB 1VG8A 5KWIA 4JQYA 3I2FA 2Z58A 1C3EA 1D0SA 1QFMA 4R9RA 4TVBA 4WXHA 1Y3BE 4JXZA 3SSOA 4MVYA 2UYQA 3M6VA 5J4LA 3WJ7A 3BGWA 4G5HA 2WMOB 5DWDA 3H3XA 1QNFA 3J81k 3SAJA 1OT3A 3JQBA 4UQLA 1V16B 2EQBA 3CUVA 3IEXA 2OD9A 4OEHA 3H0CA 4GKBA 4FFNA 5JAUA 2C07A 1ZWLA 3GLHB 1BXZA 3AONB 3EASA 2WJJA 1D6SA 1X1DA 3OFNA 3M7IA 5I7OA 3C1OA 2LNDA 4D5EA 3HXOA 1GD1O 2PZBA 1YZLA 4PR3A 4PYKA 1R15A 3LBHA 2N3ZA 4E0BA 4IJ5A 3PZBA 1Q7EA 4MUIA 4TMFA 4NONA 1X74A 3WLHA 4BMOB 3CLVA 1UBKS 1VKRA 4DILA 2E4WA 2FFJA 2GZDA 1X80A 5KHLB 4GR5A 1YIDA 2QX8A 1C9DB 1QZUA 2HUNA 4X20B 1XU4A 1DAHA 2ETVA 4X7PA 4ZRDA 3NYWA 2ZRJA 2JGNA 3O91A 3EWAA 4CL3A 1DC8A 1WTCA 3KSBC 2IBTA 2Z43A 1M72A 4GAEA 2JAPA 5AW9A 1XAJA 3CR3C 3NHWA 4B75A 3C3BA 1AQJA 3CX7A 2CYCA 3M2TA 2AG8A 3FGOA 3LDHA 4Q7MB 5HIKA 3PDIB 4YXWD 3X3HA 4BP8A 1Y3DE 2YJZA 4TX1A 4A2CA 4D42A 4AQDA 2LBPA 4JYCA 4Y1RA 3HWX1 5A06A 3MHTA 4W5NA 3PR3A 1QE0A 4S04A 1I9CA 1Z0FA 3WA7A 4MSUA 4D4IA 4Z2AA 2XB6A 4TZ0A 2VK4A 1PR1A 3NS7A 4N6GA 2R6DA 2ZJ7A 1R0YA 1YE8A 3UT5B 1QFYA 3HBFA 4RC9A 1TIPA 2D3WA 2EF0A 2H85A 2Q6OA 1QHYA 2HDHA 2VJYA 2R5WA 1XU9A 3L77A 1S02A 2QT0A 1I6MA 5ERYA 3AERA 2HF2A 1ZIYA 5HIIA 4B79A 1SKAA 1P1IA 3BH7A 3HRIA 4OL9A 1SAYA 3RS9A 3NHZA 4EWLA 5JATA 4DWJA 4Q4AB 3RG2A 1QYIA 3D9QX 3F47A 2HHCA 2KLBA 4L02A 2RHLA 3MGKA 2Z6UA 1NZJA 1HRDA 2AN9A 3R7WA 4NLLA 3IDZA 3B13B 2UVPB 4D98A 1E1QD 4FZRA 1YDMA 4QXQA 1H23A 4JT2A 5JC1A 1UJBA 3PNVA 4OCZA 1YB7A 3BN3A 3TBKA 3PFNA 4RIEA 1LF5A 1E2MA 5HQ3A 4JP3A 3K0AA 1S89A 2XTJA 2CJWB 2EWMA 2YHIA 4IJWA 4YPVA 3Q7QA 1HM5A 2X5KO 5EIEA 3T5TA 3PQEA 1G19A 2HCJB 4N7JA 4TKLA 1ADGA 3CRMA 5ECWA 1WLYA 4J7XA 4X65B 1CE8B 1P9NA 1ZRMA 1GTG1 3NB0A 3RV3A 3VZQA 1TMOA 4PCLA 1YUMA 2BGJA 2IYNA 4L8VA 3KZNA 4Q37A 1IWPB 1HSOA 2I4IA 2VDWA 1A4IA 3ZLUA 2NO1A 5EXXA 3CLTC 5E4YA 2CF5A 4MV4A 3VR2A 4C7KA 4WY2A 3CINA 1RWBA 4L75A 2X77A 4HD8A 5AJZA 2ZPTX 2MSKA 1VLQA 2XKKA 2E9SA 4G26A 5CNKA 4PW0A 1K7EB 1RPJA 1W2WB 4P83A 3ZJUA 3E23A 3ECAA 3KX2A 4XX0A 1KGDA 1RJDA 4D3DA 1ZD4A 3ZHRA 2ZROA 3ZX5A 1YS9A 2BKVA 2VXYA 3HKBB 4RMHA 5F33A 5JBIA 1K5DA 2H2HA 3PUXA 2Q2QA 3PNMA 1ENZA 3IX7A 4EG3A 5DISB 1YJXA 3ZEIA 4HK4A 3FIUA 3W05A 1IWOA 2QRGA 2GI4A 4CM8A 5A4KA 4JAVC 1TVKB 4MAAA 2ZYIA 4P32A 4X9XA 1XVIA 2GHTA 2NUAB 3S28A 2UUCB 1JAIA 3LCRA 2O0MA 3PFGA 3IJEB 4PX9A 4Y9TA 4ZO9A 2J09A 1DMRA 3I9MA 2X4DA 4D25A 5JT1A 1IY2A 4KXQA 4F8YA 1BCSB 4CLOB 3GRRA 3CCCA 2PUTA 3AHIA 1U8XX 4JLKA 1H0HA 5IUJC 2YNMA 3QTBA 1I5EA 4M55A 5K0FA 2DECA 4XDYA 3L04A 3FOWA 5BYBA 2AKEA 4KACA 2R4UA 2ZYDA 1C14A 4DRZA 1X1EA 3W0LB 2H9IA 1K92A 2D1TA 1MH9A 3EGVA 3S70A 1T1GA 3HC7A 5BRJA 1PR4A 3V7UA 3B52X 1T43A 4Y9RA 4FBMA 2BZSA 1HE4A 1E4EA 3ZQJA 3SS8A 2GEJA 4ER3A 4W5WA 3AF0A 4BO1A 2ODPA 4D4HA 2F3SA 4EGQA 4Q1BA 5AP9A 1OX5A 4QAQA 3EF3A 1CY7A 3LWZA 3L7NA 3AHHA 3TX6A 4RH0A 1SVUA 2WWHA 5F3DA 4ZOBA 5B3KA 1WSBA 2J4DA 4RD6A 4BO2A 3E9QA 4LJ6A 3U0BA 2V97A 1YDGA 4TYWA 4KQ1A 3WLTA 1KXZA 5AW7A 3ODGA 4X1IB 4C14A 1I3CA 5CA0A 2PWYA 3K5IA 3RRBA 1QM5A 2AF4C 1LPSA 1NC3A 2ZYAA 1O94C 1B43A 2PQ0A 3GJRA 3HKCA 4HYEA 1G4UR 5IZCA 4PG4A 2QG9A 2VT7A 1C8VB 4JENA 4U6NA 1L5SA 4LJRA 3R41A 1SRRA 1K5GA 1U31A 3Q1LA 4ALLA 2V7UA 1PYGA 2ANCA 4MVJA 2AR7A 3STTA 5SZJA 1KDTA 1OFTA 2D4HA 2EHDA 3V1TC 1UT8A 4HDQB 4PXSA 4CI0B 5H82A 2JRLA 4EYGA 2OHGA 1V5EA 3QEKA 5AI5A 3T4XA 3V8PA 4AZ0A 4MVJG 4P2BA 4ZAZA 1OASA 5AXBA 4XA8A 4AKHA 3EDQA 2R6HA 4N6OA 3EXHA 1HT0A 3QG1A 3VC3A 2AEJA 3T61A 2IUSA 5FOUA 5GGXA 1X80B 1TGYA 1V2HE 3DLAA 1W36B 4CEHA 5ARDA 1RHRA 1TF7A 2E4ZA 4EA6A 3DWFA 4PGFA 1ZD9A 4J94A 3N0RA 5ILGA 5TS3A 3ESDA 3DMDA 4L95C 5FLEX 3R5SA 4U5QA 4EATA 1ZMOA 1AKQA 2ZI6A 3B1JA 3LQYA 3CB4A 3LW7A 4OQEA 1XALA 5DIFA 2MSEB 3LT0A 3PXBA 3ZGOA 1IWBB 3OC6A 2WIKA 3QX7A 1QVZA 1EGVB 1E60A 1BHJA 2C4VA 1RM0A 3PHHA 4HVAA 4ZANA 4F72A 4INAA 2DTDA 3DCYA 3H5AA 1M66A 4Y1RB 3QXGA 3T9EA 4QG3A 4DWWA 2A1IA 2HL6A 4V39A 4C7XA 3OQMA 3I6IA 3M34A 4KG7A 1YTUA 4WE3A 1AUOA 2X5NA 4LJYA 4QLOA 5DYNA 4L0CA 2FY8A 2QW0X 2EATA 2V9PA 4FDUA 3DB2A 5E9QA 4QUEA 5E1MA 1L1FA 1QQTA 4HWPA 2ZTVA 4LWOA 3N70A 3Q9LA 4UBNA 3HGQA 1ESEA 5ALFA 3Q8MA 3O7MA 3AERB 4KLAA 4MULA 3TM4A 3HR7A 3VZSA 1AKRA 3CXRA 3R7DA 5C51B 3TE6A 4HNHA 3MJCA 3CNHA 1DBIA 1NNUA 3ANLA 4B4KA 4D81A 1WB4A 1V3VA 1ND6A 4Q6BA 2GK3A 3B78A 4OYLA 3G79A 1KHHA 1GUYA 1RFLA 1Z0DA 1WQ1R 4W7HA 2JAQA 2BMWA 2WJ3A 3R7WB 1S8FA 4US1R 5KTOA 4M0CA 3PX3A 4DCNA 5AVKA 3G0GA 2FSVC 3L6DA 1NTOA 2PXHA 1D5WA 2WUEA 2Z3ZA 1R12A 2P2LA 5HQ3B 3K0AB 4CNQA 4ETMA 1WVMA 3FFAA 3NH6A 4JKIA 3IR5A 1SCQA 3M5DA 5AVOA 1YK0A 1YJ5A 2X7XA 4N9QA 2F9MA 1M33A 3ZU2A 1U0BB 4N3CA 1N33B 1PFQA 1MIOA 1GNVA 1N5LA 3IERA 5JH7A 2I3GA 2H2FA 2VJBA 3NFRA 3TLEA 2WFAA 4EUSA 1IQRA 4ZU6X 3UJNA 2G9VA 1P7WA 5D51S 3RVMA 2G1AA 3GMDA 2VDWB 4RHFA 1SD1A 3CZAA 2JFQA 2ZDQA 3QSGA 3BDAA 3QKUA 4OJMX 3FKJA 5DCWA 1EK5A 2JVIA 2IEYA 4QYMA 1AO0A 3WIEA 4A6EA 3J81A 2YIVX 3Q0EA 4U0KA 4XX0B 1VPVA 4F3TA 1TCVA 5CH3A 3N9IA 4NPAA 2WM8A 4PO9A 4YAEA 3HHPA 1CY4A 2MSCB 2VPZA 3AY0A 1BO6A 3WLOA 1LH0A 4KWIA 2RAUA 4PX5A 4RIHA 2CZQA 2E4UA 3WGHA 4EPYA 4GKKB 4RU1A 4YLYA 2C3MA 3PGVA 3V7YA 2JIRA 4ENTA 1QHFA 4ITRC 4XYEA 4JQCA 5DTRA 4OA5A 3DA8A 4W99A 2Y27A 4QXOA 5F12A 3U37A 3SHFA 5JAPA 1PV4A 4Y3UA 3CSSA 1F4LA 4U00A 4CM8B 5G53C 1IY9A 1ZW1A 4UBLA 3UGKA 5CEJA 1NG9A 2DUMA 3VAYA 2INGX 4LS3A 3WLNA 4UMVA 3DMFA 2PU5A 2OV8A 1Q0QA 3IHTA 1AV7A 3LUKA 3LTEA 4ZYUA 1XWWA 1UXKA 5GM2A 3NV7A 3KOUA 2XIQA 3V8VA 3DTVD 4Q82A 3T7EA 4JJIA 2OCPA 5AKEA 4ZPXA 5IWAB 2LCIA 4H4CA 2DFPA 3L3BA 3VHRA 4CF5A 2OUKA 2PX2A 4Q4HA 4EI8A 4RPGA 1FUIA 1HY3A 2DUUA 2V4UA 3WV5A 3UMFA 1Q22A 5F5LA 3PFKA 4BP3A 2UYOA 3II6X 4P98A 4TMWA 3OLYA 5JS6A 1SCUA 4J0HA 1WW8A 3K32A 2I6UA 4N03A 1E4EB 2YMMA 3DH0A 3QU2A 4DSAA 1B8OA 1PQPA 1XDUA 3SI7A 3ZJ5A 1U63A 1CYDA 4GOJA 3ZWDA 4BKUA 1NTRA 3BMQB 3WGTA 1OTYA 1ZD3A 5KCMA 4BLSA 4YAKA 1C7EA 1ILEA 5T7BA 1AQYA 1CY8A 2HF8A 1TF5A 2O2ZA 3QWBA 5ABPA 2AI3A 1NDUA 2O48X 2R62A 4HGRA 3ZHQA 2QRLA 2IPAB 3NEYA 3SZOA 1XRSB 4J2HA 5CA0B 5IPFA 1O95A 2FGJA 4L22A 1EUYA 2NXWA 4W1PA 2XUFA 3P9NA 5AO9A 3HKCB 1Y6ZA 4E4YA 3FETA 2GUWA 4DLAA 3QFHA 2ROQA 3CLTD 3NGLA 4A8HA 3W5JA 4Z4HA 3NLLA 1J33A 1JJVA 1H1LA 2QN8A 3T1TA 1U2SA 3RHFA 1KEZA 4ARVA 1H4SA 4EGAA 3UAWA 4Z6KA 2HSGA 3ND6A 4RZHA 2ADFA 1TZMA 3GGGA 3R5HA 4OJTA 2VZEA 1PP4A 1DTWA 5JS2A 4CMIA 4AZ0B 3R9XB 1JFLA 1P81A 5AJTA 5FYDA 2ZTUA 1CIVA 1CR2A 4NKRA 3EZ2A 1E8NA 2GNPA 1GP2A 3LX8A 3EXHB 2PMDA 4Q0MA 3FVRA 4LJSA 4X94A 1T6ZA 3NTVA 3AFMA 5AM0A 4CEHB 3IE2A 3K20A 1PJZA 5DRYA 5BURA 1XQXA 5HM8A 4WXPA 1XJ5A 4HCJA 3A7EA 2I78A 1CY0A 1EX6A 4RZSA 1LQUA 4CR6A 3PIRA 3NJRA 3ZQ6A 5DXJA 3KCQA 3L0IB 4LQDA 3H5IA 1ILWA 1X1SA 3KV3O 1IN4A 1R2QA 2QN3A 3D59A 1Y5RA 4HUJA 4JL8A 4ZU1X 1FTYA 2OAQ1 5T57A 2BZ0A 2HMSA 3RC8A 1L4YA 4GYJA 3QE0A 1K08A 4EITA 4BWYA 1YDFA 5A5FA 2FEXA 3SC2A 2PKWA 3JD1A 1O08A 2XHZA 1CDDA 4LRUA 3EA5A 4YIHA 3DAPA 2DR3A 3ENQA 1UADA 5G4KA 3T9CA 4QX6A 4LOKA 4UVIA 2H7VA 1E5TA 4IDPA 1TOAA 3EZLA 3O3MB 4WLVA 5BT9A 2XWPA 1CC1S 3F0TA 4PYRA 4AP6A 4MV8A 1L9XA 5HKBA 4RZ3A 2GZ3A 4KCGA 3FNQA 1II8A 3RF6A 1TECE 1PDVA 4EYKA 4KMOA 2F8MA 1NUQA 2J6CA 1TM3E 5GAJA 4CBVA 1VFPA 1DI0A 2O3TA 5JWHA 4RZXA 3VC7A 3F3YA 1A8HA 5G4LA 3ICQB 4TQGA 4FMDF 2H9AA 4FTWA 3PUHA 5K3SA 1BQ4A 4IFTA 4O1MA 4XTRA 3WGMA 3VU1A 1U0FA 3FGZA 4IVNA 4L0DA 4TTVA 4UM8B 5IT9A 1PZFA 3DPUA 3C39A 4G56A 1V3TA 2XYRA 1O94D 5B58C 2GZHA 1PKEA 1NBOA 1RJGA 1UP6A 4V3BA 4EKNB 1LJLA 4MA4A 3F6SA 1VMAA 5BSRA 1EA7A 1PK8A 4JVLA 3TKYA 2PFGA 3TD2A 1KR5A 3TVTA 2D13A 1MIOB 3EVCA 1SNYA 3LI2A 3WNDA 4E13A 3OEED 5JH7B 2ZZNA 1CEXA 5CB4F 1SXJD 4EPXA 2D5BA 3IELA 4RX1A 5DTEA 2X9VA 3DEZA 4C4ZA 2PGOA 4B3IA 5C53B 1IXSB 1EM8A 5A3RA 3ZK8A 1R4NA 4UU7A 1T4CA 4X1KA 2RFLA 2CXXA 3WKDA 2D7CA 2XUZA 1GAXA 2X58A 4TT3A 2AE2A 2ABWA 2X2PA 2Y67A 4FQ8A 2JCVA 3IMGA 4F11A 5CVCA 1M8FA 4A8JA 5FO1A 1BG6A 4UEOA 1EAMA 4CG1A 1AKVA 3AVWA 4X6YA 1B2RA 3TI7A 1AXEA 3TLZA 5JS8A 3URMA 2O5EA 2PQ2A 2YS6A 2OHXA 3AH8A 2NZJA 3I01M 1AOXA 4C7MA 4UFOA 4ES6A 1BW9A 5CIWA 1B16A 1LWOA 4CIVA 1NPYA 5AM4A 1FRFS 1P18A 1U2ZA 5FA5A 4EY5A 5CFRA 1G8SA 5CM9C 1I6LA 1JN0A 1ESMA 3QVXA 4GBGA 4HFRA 3VX3A 4CF6A 4DCUA 1R64A 3ROFA 2F6RA 5HKKD 2YN0A 1R0ZA 4EW6A 2V7WA 4HOYA 3PWZA 5IMSA 4A5SA 3ICWA 1ZA2A 2W00A 3DKKA 3EIXA 4O25A 4E21A 4BBZA 2A1TR 1FLAA 5LWHA 3D7MA 4Q4HB 3MOSA 4B4VA 2PSFA 1UP4A 2XRZA 4TM7A 1QQ7A 2PE5A 1T9ZA 3AV3A 1PJCA 4A16A 4NU6A 1NMZA 3T7AA 2W2TA 4ZDWA 4ZGGA 5I9TA 3ITDA 1I3OA 1U4OA 2NZXA 1SCUB 1DG9A 2QU7A 3B20A 4KL8S 4NMXB 2FW8A 1GA4A 1UXOA 2G0NA 3KZVA 4YK7A 4HLQB 2OD7A 1OGYA 4N0EA 2O0JA 3NWJA 3ZE6A 1LSJA 2VQSA 1YS6A 2JNWA 2ZB7A 1NVWQ 3A3YA 3IYLW 2HA7A 3C85A 4TTIA 4NMHA 1NC1A 3A28A 1V96A 3USZA 4G4IA 2HJHA 1NMEA 2HU8A 2P4SA 3R3UA 4YRMA 2NSJA 3O4HA 1LVGA 2WTXA 3VZCA 4HHEA 2OGTA 2VF4X 2AD5A 3I0MA 2ZJZA 4TTSA 1OJLA 2QUIA 2P40A 1I80A 4G8BA 2HAEA 4M89A 1A1SA 4PM4A 1W4AA 3QA3E 2DLCX 3KOXA 3L7YA 4F2GA 3N8KA 4MQFA 2X3FA 1IQUA 1N9ZA 2DG2A 3O6VA 3PCXA 1SJ9A 4MW9A 1IK4A 3WYFA 1BVUA 3JQBC 5CTJA 4DCJA 1H1LB 4UHFA 1OXSC 3JARA 4V1CI 4BNZA 1KH3A 1N75A 4M0PA 4JODA 1XAGA 1TEXA 4CQMA 4DC1A 2QTLA 2JASA 3R6TA 4MYUA 2WI8A 2JFWA 1UANA 1K8XB 2P91A 4V1CA 3LUGA 3S3TA 1ZIDA 5JZMA 1XQ1A 4YQFA 3HFGA 3SBXA 3TL6A 2P9CA 3T7JA 1FMTA 1TO2E 4R9SA 4Z4CA 3IQXA 4NTZA 5TF4A 2ATIA 1K3TA 3H11A 4K9PA 4MGIR 3ZDXB 1CY1A 2Y1DA 3C87A 1W36C 2A78A 3GEEA 1AD2A 4RHCA 3RCBA 2YZNA 4BV9A 1VCMA 5LU8A 5KTKA 5L4SA 3G8DA 3K6KA 2GF9A 4LPSA 1SK8A 2A5DA 4NSNA 3ESCA 3SC2B 3DMGA 1L7MA 4Y7DA 3F7TA 1B1AA 5ICGA 1T1RA 2P6UA 1QTQA 4UTRA 5DW3A 5C7LO 3ST7A 1SPXA 2E1PA 2XWSA 1DJLA 4HGZA 2JLXA 5JCOC 3LO5A 4JL6A 2B4TO 4CG2A 1YC5A 4CTNA 1AQNA 3TYXA 4U9UA 4WVLA 3RR2A 3UGTA 2C4UA 3VYTB 1OFUX 4EARA 1II8B 3FNEA 1U2GA 2QL6A 3DW3X 3QE3A 5ALXA 2BDUA 3OY2A 3ZV3A 1AGXA 4ANFA 4CFZA 4CMEA 4E4RA 2VYCA 1DO2A 1T0UA 5I7VA 4QTZA 1DAIA 4ACBA 3F97A 2R6JA 4ARUA 5GOTA 2NYAA 1SWVA 4K9RA 4LMAA 3VOBA 4A8PA 3T9BA 1Z7BA 3O90A 4UVDA 2Q27A 1C7JA 4AIIA 4DRYA 1W0CA 2X4GA 3AQIA 3KUXA 4EI7A 1FPMA 4H15A 3KAJA 1QNLA 4I19A 3QEBZ 3JQGA 4EBBA 1U90A 2HWKA 1WTAA 1S3IA 4FN4A 3ZGZA 1J06A 1QWOA 4H4DA 2NXNA 4HQOA 4M2LA 3S8EA 2PRIA 3Q5DA 1ENYA 1XAHA 3CO0S 2OHVA 5K01A 3LXUX 1PHRA 2I8CA 3WLIA 4P7JA 4LDQA 1OZFA 4LYJA 3FDIA 3B7GA 1FMFA 2FJPA 4FGKA 3SJAA 3LPCA 2RH5A 1C9NA 3R5XA 5COBA 4D8TA 4G5SA 3GLFE 2D2EA 4KI0A 4RSGA 1SKYE 2XNSA 4WZ6A 4DA0A 1EM8B 2XB8A 2XPCA 3WLAA 1R4NB 3QMVA 4X1KB 1LLDA 2PAFA 4MR8A 5CMLA 5KNBD 2RHDA 4NH0A 5C3UA 1WMAA 1GQOA 4DMKA 3QSYA 3ZN2A 4NECA 4RKYA 1HTTA 1IBSA 1M7HA 3QU4A 1RLOA 3USCS 2ZUCA 3UXMA 4BWVA 1JLRA 5C7IO 3GMIA 3JXEA 1GEGA 4A8JB 5C8ZA 4BQSA 1UWKA 4DJEC 1XP5A 4BFLA 3WLFA 5AJXA 1NJGA 2A84A 2HO4A 1TU0A 4RKWA 3UCEA 1ZM7A 4MDHA 2WWWA 2XUOA 1NKTA 2H7CA 2WMNB 4N7RA 3FCEA 2O07A 3UOAB 4Y6GB 3JQ8B 5F7XA 3NHPA 5CLQA 1FIUA 1ACJA 1ORWA 3FJOA 1THZA 4NATA 3WIBA 5F5XA 1JJAA 2QUJA 4C0HA 3G0HA 2NU9A 1HFJA 2GARA 2P75A 1E62A 5KDLA 3ZDAA 4AJKA 4DDKA 4DR6B 2AQKA 2GBLA 5HG0A 5LMZA 1J0CA 2ODAA 3L9WA 3HB0A 1JMVA 1Z5NA 4YFVA 1JQBA 5ICCA 4AUMA 2J0VA 4NNPA 3EQ6A 3DDOA 2A4MA 3OESA 1PU2A 3VH3A 4BFUA 5HIAA 2IU3A 2P5TB 3UIEA 3S8YA 1AXGA 1PWHA 1E79A 3D6UA 1TLLA 5SY9A 3WVNA 1PJLA 4WXMA 4EQZA 5IN4A 4EIWA 1V0JA 3L46A 4CMAA 4PFJA 2R0QC 1GPDG 4BJ1A 1YCHA 6NULA 1RVDA 4QNRA 1NKVA 4ZT4A 4XWKA 1BOFA 3RWMB 4TLLB 4YUYA 2Y05A 2PT7A 2YNMC 5CCDA 1NN1A 3AESA 3FSJX 3HI6A 4KXVA 1YBHA 1LUAA 3F9CA 4IJUA 2VOJA 1AU9A 2JIZA 2ZATA 4QUAA 1UOQA 3CH4B 2PKQP 1KVQA 5C8YA 3EZNA 3IVXA 1KPGA 5CIQA 4DR7B 4P08A 4NZMA 4QJ3A 4L7VA 4C08A 3TECE 3K9QO 3A70A 4LUCA 1L4GA 4D9EA 5H70A 1O5IA 4J76A 2VSYA 3WGNA 2FPRA 1F6DA 4DJDC 1MA3A 5AIBA 2QUHA 1MAUA 1ZJYA 4L4ZA 7REQA 8GPBA 1LPBB 3DAOA 3LX5A 821PA 4XIFA 5JWOA 1A98A 2O8CA 2Q6VA 3E3LA 1EP3B 1QTNA 5E6UA 3IAHA 3I3SR 2A0FA 4KFUA 1HLGA 4MQFB 1SVWA 3OM0A 1JQ5A 1YS2X 2HKIA 5HKOA 1PVVA 4GI3A 5LOVA 2GM9A 4KPUB 1HK7A 5DGXA 3JARB 2QW1A 5IZCC 3LK7A 1R27A 3IDFA 1CJBA 4PLGA 2WJZB 4AS3A 1M1XB 2RAVA 3KT8A 4FFPA 1SXGA 3NV9A 3WWOA 5A7HA 3AYZB 4KV7A 5ITSA 1NP3A 2HRRA 1GL3A 2B35A 4R7ZA 3VYRB 2D06A 1EFCA 3EVTA 3OZSA 4ESEA 4IOJA 1TFUA 4MUAA 3NH9A 3RRNA 3A6FA 1XXHE 3UHAA 4ACAA 1ABFA 2FZLA 4BVEA 3LNCA 4EW3A 1GSIA 1ULTA 2GYYA 3WV4A 4DREA 1PQWA 2HTEA 3EXHC 4HXYA 4DV1B 3R8CA 3H11B 2WWTA 4IZHA 5JU6A 3L05A 1C7IA 1ODFA 2XUGA 3DLPX 3NYRA 4GXRA 4KDCA 4ZCSA 4L27A 3AEYA 3C5WP 2FRXA 2WT9A 3QP9A 4MUGA 4U2EA 3DLHA 1ZAKA 2D1RA 3EMKA 4OY3A 2O8DA 1H65A 2G5GX 4PZYA 3UWKA 3K9NA 3COJA 4J7CA 2WHPA 4TN5A 5D87A 3RHZA 4YJGA 3P5SA 2RCYA 4Z9BA 2A7XA 1E2UA 4J0KA 1XQWA 2IF0A 3SJBA 4EDHA 2X9QA 3DLIA 1NJSA 3ASVA 3M2PA 1K8YB 2VUIB 1GR1A 3PPVA 4R3UC 3ME5A 3QYJA 5GP1A 4KQWA 1KZ1A 3OX1A 5COAA 4W5HA 1I2BA 4TL7A 3H1GA 3NHAA 1ECPA 1Y7IA 2ZWPA 1O6FA 3VYWA 4OQNA 5IBCA 3DXFA 3SM9A 1A8SA 3HJAA 4EG7A 3H84A 1KQGA 2EWWA 4KVFA 3VJLA 4QKQA 3WK8A 3OHSX 4J3FA 5KAPA 5A3QA 3DEHA 3M4JA 3NTQA 1H2EA 2RAPA 4JUIA 3ADBA 2CSUA 2CMDA 2YY6A 2KJQA 2WB2A 1XVVA 2G72A 1WJGA 1VE7A 2D2FA 5ALNA 3NHRA 5KKCA 3K71B 3GZNA 4HGOA 5I3CA 4L8WB 1VSBA 4A2QA 3QPCA 5DWQA 4PZAA 1UIRA 3JQGB 2OFPA 2OV4A 3DT8A 4Y2PA 5D5HA 4LXYA 2QE7A 1JG3A 1Y6RA 2JGDA 3K4PA 1K0UA 3C4VA 3D0OA 3D8HA 3NUZA 1DHTA 4WMLA 5CX4A 5JSUA 1D9ZA 2HCTA 3VZPA 3DKPA 3UQZA 2P9TA 2ZIEA 4O8ZA 4DLKA 5J58A 5H9VA 3TR5A 1C0LA 1CT9A 1AQLA 4E2ZA 1U7OA 4C0SA 4I5IA 1MJFA 4IKOA 1T8PA 1U7TA 4LRWA 2C8LA 2F62A 3QU5A 4GIBA 4Q9LA 3DXXA 4D9BA 4YMIA 3R6LA 5JRDS 3PL5A 3OFND 4D26A 2CHGA 3MT7A 4GLJA 1UPAA 1KO4A 1SCAA 2M1ZA 4MR8B 2I4NA 4PVDA 4QEDA 4REMA 4D9MA 1QQ6A 1RPZA 1ZQ9A 2F3TA 3ZU5A 3A26A 3G7SA 4EPTA 3NM4A 4L1KA 1T25A 2HPHA 4Z9AA 5CEEA 3ANNA 3IHLA 3ZCSA 4UM9B 4R2WA 2MWMA 4Z2YA 3REGA 4LF8B 1JYFA 5LC1A 3KDSE 4XM0A 3ONVA 5HHTA 1W36D 1GFWA 1SBNE 2PLWA 3KT3A 2YH2A 5K0NA 1A82A 1RXEA 4XFJA 3KB6A 3HKEA 2EKQA 2VTEA 4UARA 3BXHA 2BL4A 2DBRA 1E18A 1M8PA 4UAJA 1FFYA 2NU9B 2BEKA 4D80A 2EW2A 4ZO4A 3N2LA 4PSCA 5H4HA 3AR9A 1UMKA 2B6NA 3DR5A 4D4JA 4CM3A 1R3DA 2BV3A 3WLMA 1E5XA 2BELA 1NULA 2CWDA 3K1JA 4KRGA 2A1UB 4OQMA 1X14A 3RUDA 3CNQS 5KYTA 1DPFA 1PE0A 4Y2RA 3HN7A 4E5NA 3KKZA 5K4AA 3GH3A 4HMPA 1BXGA 4B3DA 2QX6A 1ODTC 2IK8A 4I0WB 3RVRA 3C6XA 4HFNA 3FI9A 1U5BA 3NJ4A 5IHPA 3WWEA 1DBSA 3TWOA 4B47A 2BZ1A 5DT9A 1ZNYA 2VHEA 4TTRA 3AESB 2J0EA 4KK4A 1VL6A 2O1EA 3B6KA 1MOQA 5TQJA 4N76A 1UZUA 2CBXA 1Y7HA 2FFQA 1P33A 5AHOA 1CW2B 3C5VA 3JWGA 5D1NA 3RC3A 3E5NA 3TPCA 3V8QA 4M98A 2X2FA 4ENPA 5C8YB 4WADA 3ZHCA 5DEOA 1MBZA 4KOAA 3R75A 2XB9A 3A9RA 2G5TA 4KHPB 1JHMA 4IDCA 2KLHA 4HJRA 4KIWA 4AK9A 5E1OA 1T9DA 4H60A 3FR8A 4HWTA 1M83A 4PU0A 5D2CA 3GDHA 4MI1A 4C89A 4XD7A 4K9LA 5B1HA 3WTCA 4C7JA 1WUHS 4HVLA 4H31A 7REQB 2HEGA 2GH1A 1H3FA 1CUSA 3PGKA 1I30A 1ORTA 2NADA 5E6UB 2B5VA 2O8CB 3EGWA 2FUKA 4WZBE 4OX9B 4FZ3A 3T94A 5LOVB 1Y8RA 2P67A 5IVKA 3FTEA 1EQUA 1EM6A 4ZREA 4D74A 5BXQC 3WL8A 4ZAVA 1T5DX 3VR2D 4DZRA 2OYCA 4TQUS 5BO5A 1I7NA 3IAEA 1ZOLA 4CM4A 1T0JB 2O59A 1L4LA 4RUKA 1J2RA 2G25A 2O2IA 4ERXA 2Z2KA 1UFRA 4QXMA 5H83A 3SGLA 4C3OB 2BHLA 2AX3A 4RNCA 1V6AA 1DC5A 4V24A 4HGYA 4QU0A 2WEKA 3RRXA 3FZQA 4IIBA 3PNLA 2WPDA 3KBBA 3D7SA 2XMPA 1A8PA 4R81A 2UUPA 4JVOA 3U1TA 2VSQA 4DJJA 1CR4A 1WB5A 1P8JA 1Q3TA 2EJBA 2FN8A 5LQKA 2DETA 4UTZA 1FNCA 4HDKA 4D8XA 2P5YA 5KQGA 1EB8A 5FI3A 2AT1A 1P91A 5I8PA 2N75A 3ET5A 1VHWA 4TWAA 1GJRA 1G16A 3HY4A 4MV1A 1NJ1A 2O8DB 2IPNA 3U9TA 4J49A 2WHPB 2VJAA 2PRSA 3PQ6A 3GPDG 4YJGB 1JAHA 2BGTA 1GGVA 2H1CA 3HGMA 3Q88A 4DV4B 2EX0A 1A2KC 4A0FA 4C78A 2ZDHA 3ILHA 2R96A 3QVJA 5E7IA 3ONFA 3NTUA 2JFXA 3EDCA 1WPGA 3HDJA 3C7AA 1SKMA 2YNMD 3A37A 3GMTA 4EABA 1W48A 3L7DA 2WKQA 4KH1A 2FMFA 1Z3CA 2GAIA 2OM6A 3HCEA 1U1IA 1H8EA 2PUWA 2QTVA 2XXJA 2XYPA 5DP1A 1DXHA 3H5TA 3KZXA 1KEVA 5F23A 5JNRA 2NT3A 3DDSA 3HACA 1NXXA 2ZWMA 1XTSA 3ABZA 2XE8A 1IMJA 1T9GS 4JUBA 1ND5A 3BK7A 3BM5A 5LDGA 1NXOA 2GPAA 4LMRA 4RY9A 3U60B 1TB4A 3FWNA 3ZQ4A 3B1VA 4I9HA 1MC1A 1ZH4A 3TZCA 1SXIA 4C6TA 2C7RA 1KAEA 3GZNB 2JVKA 3SYTA 2VA9A 4KQFA 1L5KA 1T2EA 5FAKA 3EUAA 2JGDB 3CNOA 1SURA 3RE1A 3QFTA 4R2HA 5K0BA 2DR2A 1P60A 3QJYA 4GL2A 2IEZA 3IQEA 5DTQA 3ZE0B 3WIVA 3WLSA 2DWUA 5DSXA 1QUFA 1F17A 2H4HA 4RY0A 1WVIA 1YQEA 2AZ4A 3GDOA 1I2AA 3QYPA 2HADA 5AUQA 5TJHA 1T3SA 2ZSFA 5F2EA 1MHPA 1C80A 2CMGA 4B2LA 3PTZA 3BL5A 1SG6A 1J5XA 2D2IA 3PNKA 5TEWA 3VSDA 2RIPA 2V0CA 4CV3A 1W46A 1OXUA 5TPZD 3WYCA 3Q2KA 2C4NA 4EHJA 4EG5A 1UJNA 4JJAA 3FWYA 3WWCA 4C6SA 1MG5A 3MBKA 5IJ0A 4NV1A 5FD8A 1NUSA 3PX2A 4R2KA 3AOGA 2O8FA 3SIRA 2I5PO 1J8QA 4JX9A 1BGWA 1GKUB 3X1DA 1OTXA 4XCQA 1P7CA 3A1SA 3KVOA 4DE5A 2B83A 4PEVA 4A8JC 3FTNA 4ZPJA 1MX9A 4RHEA 3JX9A 3HKEB 4O2AA 4EFMA 2YV5A 3WXMA 3VR5H 5DDIP 4P34A 2VHYA 4Z3KA 1WZEA 2GPBA 1BOOA 1C9EA 3K35A 4LPKA 5DYIA 4AMUA 3WIDA 3UO8B 2B7LA 1B7GO 1FC0A 4S2UA 2E21A 2HHJA 1KQNA 4J90A 3L0DA 3TD9A 3JQEA 1EJ2A 2KE5A 1N4DA 1H0SA 4G97A 4GZ5A 4PICA 3SOZA 1BXGB 4KSBA 1VKHA 4QT0A 1Z0AA 4LTNA 3W2FA 1TI7A 4P3KA 4ZQBA 2DBVO 1DC6A 1DQRA 3FFXA 3AVPA 5DV9A 1TO6A 2PJRA 1FXWA 1RWXA 3ZTWA 1NY5A 3QGMA 3WLJA 1Y9AA 3TVDA 2CMFA 5J47A 5KTPA 2CVZA 4H77A 4G0OA 1U6KA 3JQAD 1JIQA 1Y7PA 2GLUA 1H1TA 1U7DA 2ZAOA 3NC1C 3NRCA 3PHCA 4RMGA 3VNQA 4F3RA 3IL2A 2YX1A 1SBQA 2BZGA 2C5AA 3UPUA 3OZAA 1YS1X 4LDJA 1UZMA 1CZOA 4LE2A 5E9WA 4ZKEA 4IUCS 1PL7A 5SYMA 2HMUA 3NAGA 4AJ2A 3OOSA 1XQ6A 1F12A 2R25B 3TZKA 5B5SA 3A4MA 3FWHA 2VA8A 4FMCB 1ZGCA 4S1NA 3UEOA 4S05A 1HDEA 2IELA 3GUYA 4RMNA 1RU3A 2W2VA 3BUSA 4FSXA 4RLFA 2WD7A 2VRWA 3W34A 1JRLA 1OBCA 1XELA 4UREA 2J30A 3ZWBA 1Y8RB 4YT5A 4YP9A 4AI6A 1LC3A 2FPUA 3RUEA 2FSPA 3I5MA 4RH1A 1ZVQA 5B37A 2JFNA 2R1UA 3SQLA 3EC2A 4H2DA 2X0EA 3Q8XB 4TTAA 3QOFA 5P21A 3RTAA 1BXRA 1IFXA 5TPWA 1Z4LA 4YAOA 4CM4B 4JWTA 1TA0A 2GD6A 2ZUSA 3VJKA 2HFKA 3K0SA 3A6KA 5HFAA 2XMQA 3LW8A 2LE0A 4ENUA 2WUWE 3M6FA 3DE7X 1EDEA 1TKBA 2CL7X 3BILA 5IC5A 2FZGA 4RFVA 4D4LA 4QVIA 1RXSA 2EVWX 2V0NA 3PXCX 3QBEA 1F8UA 1W8DA 3UT6A 1YQUA 16PKA 2QRQA 1Y0BA 1WXWA 2F64A 4HDKB 2FLWA 3ROXA 4GMFA 4L16A 3T8YA 2EARA 3U44A 1EG7A 1RBYA 4XVQA 2ERCA 3ZGXA 3QKTA 1K6MA 3A31A 1C7ZA 2OFOA 3H9JA 2HMVA 2AB0A 1QJCA 3E03A 3FE2A 1DX4A 1XDZA 2BISA 2P0AA 4XUEA 3E84A 4NBTA 3ILSA 1P4RA 1YS7A 1SBYA 2G77B 4JHLA 2X0DA 4C0XA 1GV0A 1TAQA 1E9EA 5J2TA 1ZCZA 3AVQA 5CM2Z 3EHDA 1A9OA 2Y1OA 3FZEA 3EQ8A 3I83A 2IV7A 1JZSA 3M81A 5IDVA 5DN9A 3ZWXA 1EP1B 3C41J 2ZM6B 4IICA 3CX6A 4HQNA 2BAGA 5BWBA 2AYYA 4JV5B 4Q5IA 1RAAA 2QTVB 4U4AA 2AEMA 4ALJA 5IAAA 5HBGA 3SIWA 3HCWA 2FPSA 5SYAA 5B1SA 2VBIA 3OKAA 4QOHA 1LW6E 3T0GA 4ESHA 4YRBA 3N28A 4OB6A 4CYMA 3LX6A 2ZIUB 5I5GA 1B0ZA 1NUUA 3UKJA 3OIVA 1JLKA 2R7LA 3R3ZA 3Q2IA 2E49A 3ICVA 1U1FA 4C6TB 3F98A 4H7PA 2OCLA 2QLTA 1XVAA 2HY7A 3O26A 3RS3A 1AC5A 2PIDA 2OG1A 4OFXA 2DR0A 3FPSA 3KSUA 3R77A 5ESWA 4DA7A 3N7AA 4MA0A 5H4GA 4RTRA 1U3CA 4GPEA 4HC4A 2YXLA 1KVRA 3H6KA 3RHTA 2D5IA 2B1JA 1KMMA 2RK6A 3KPVA 3O8OA 2HZ7A 2OHHA 3QUCA 3RSCA 4ER0A 1O95D 3ETCA 2P1DA 2B8WA 2QJRA 2AN5A 2J32A 2OQ2A 3JR3A 3GHYA 1DPGA 2C2ZA 3PQ8A 4JLSA 3PD1A 4FHGA 2GAOA 2P6NA 4LTDA 4O1HA 4NAUA 4PGGA 5F78A 4Q3CA 1TA9A 5CA1A 5K45A 1U04A 1KAHA 5IAOA 4YDRA 4ZP1A 4FYPA 2HU7A 2POCA 1JT2A 4D3ZA 1Q91A 4D0NA 2ISSD 4QBGB 4WT7A 1BE0A 1ZL0A 3VAZA 1ZVKA 3DDHA 3V5NA 5AQEA 4EH1A 4MW6A 4YCCA 2X86A 3UH1A 4AM8A 3H6HA 4Q4DA 2I7DA 2Q7OE 4KREA 3IVMA 4Q7KA 1IMOA 4YPOA 1MGPA 2P3OA 2O8FB 3PXDA 2WV9A 4S3MA 1UKAA 2ZUDA 5DYWA 1HT3A 2GK6A 2HK9A 2PMWB 2A5YB 4V0KA 3V4OA 2I6GA 3M82A 2HJ9A 4J9VA 1N6IA 4MCJA 2W2KA 1EFAA 2CXUA 2VQFB 3Q8LA 1O6BA 2XD4A 4GNRA 1W0KA 3FR7A 5BUSA 3G2QA 4LBWA 4O2AB 5AHRA 4K9KA 1M6WA 4YRPA 3OICA 2F8TA 2W11A 3NM6B 1FUUA 4KYIB 2XOEA 2GPNA 4L9AA 4MQ5A 4MVJM 1I7DA 3GP5A 3CLSD 3DQZA 2HPZA 3PFHA 4FD3A 4G5FA 1ORVA 1AGRA 1SG0A 2DPYA 4FCTA 3W2TA 4Y9UA 1GLGA 1N1MA 2FN9A 2Q21A 3EIHA 2BDTA 1RAHA 2I1QA 3PE4A 5DO9A 3RC7A 4KWCA 4AX8A 4XYBA 2CDBA 3KWFA 1E2DA 1XEXB 4DG5A 5JY6A 1GARA 4BNLA 1XEAA 2GBLC 4FR0A 4X0EA 3RPEA 3PKJA 4OGKA 4HEHA 1CUUA 1A4XA 1EVEA 1BN6A 2DFDA 4LWPA 3AY6A 1Y7TA 4UDOA 3SX2A 3U7EB 2H92A 4B2IA 1JU9A 1EK1A 3ZWQA 4ECEA 5K6RA 3ER8A 1X94A 1YRLA 1XKXA 4A1FA 2I62A 3FHJA 3ZV7A 1V41E 2HIMA 2JZNA 2J5BA 5CDHA 2WHRA 1RQXA 1LSSA 3AKZA 3E9MA 1KYIA 4MHSA 1VI2A 2HGSA 2NQTA 2FCRA 5I6DA 4LC9A 3O8LA 2RGRA 4MIYA 4UNQA 3E9YA 3LQQA 3RK4A 3P0RA 3WP1B 4FFRA 1SOWA 3N0VA 1VB5A 5EHXA 4JJEA 1VHJA 1T9BA 2WVGA 3PF9A 4TMVA 4I5FA 3MJEA 3N2EA 4KN9S 1N5KA 1GIAA 2HSWA 4JIMA 1DAGA 1VM6A 1MJNA 3JQ9A 4BC0A 1JPNA 3KKKA 2VUUA 3GLSA 4FKZA 4I2VA 5HMLA 3IAM1 2O4UX 4Q1EA 3ZQKA 1XIVA 1O8CA 4JFRA 1SVSA 3GZ4A 3WNQA 4IV5A 5DLDA 2WD7B 4MVJP 1VJTA 1ML3A 5JDIC 3EG9A 5KJCA 2XBMA 4QYXA 5F5NA 2XNDA 4YWJA 4J29A 5FFNA 2HMAA 1VJ5A 1KSJA 1YMVA 1EE1A 2IW3A 3K2QA 3B8EA 2RAFA 1YQ9A 2IC5A 2J0SA 2O0HA 1BXRB 1UKEA 5TPWB 1VG9B 4TT3D 3F5MA 3WOHA 4BJ3A 3TLGA 3HUTA 4G4JA 4TGLA 4M21A 3DTTA 4EZIA 4U6QA 5CIYA 4HS9A 4TRNA 4DUPA 1FF9A 1PFUA 1B26A 1WF3A 2DSNA 3C7KA 1T8WA 3OAAA 4H18A 3O8CA 1EINA 2PX8A 2OECA 3RSQA 1COWA 5F2OA 3N75A 1NP7A 3M8KA 2ECFA 4FLFA 4II3A 4EGCB 5DGCA 1Z82A 3HJBA 3JD2A 1NBME 3K2BA 4J4TA 1AZLA 4ZK6A 4KOEC 1W4ZA 3U44B 1NQUA 1G8KA 1VKJA 4JI6B 4EGJA 2ZRQA 1NVBA 1NY6A 3V46A 4EVRA 3CUUA 4JQZA 1Z34A 4B3JA 4AY5A 1GNRA 2H5EA 3C3CA 5CCBA 1X42A 3OQHA 3DKRA 5D7BA 3ND8A 5AW4A 1RHQA 4D0RA 1C3JA 2EDAA 4JB0A 2GAJA 2Q5OA